4YWZA

Crystal structure of the extracellular receptor domain of the essential sensor kinase walk from staphylococcus aureus
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
147
structure length
147
Chain Sequence
NLEKELLDNFKKNITQYAKQLEISIEKVYDEKGSVNAQKDIQNLLSEYANMQEIGEIRFIDKDQIIIATTKQSNRSLINQKANDSSVQKALSLGQSNDHLILKDYGGGKDRVWVYNIPVKVDKKVIGNIYIESKINDVYNQLNNINQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Sensor protein kinase WalK
publication title Structure and mechanism of the essential two-component signal-transduction system WalKR in Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 51
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4ywzA00
3C2WA 4HIAA 2OWJA 2JN7A 4PKYG 2A24A 5HDCA 3LYXA 3H9WA 2WKQA 2CMNA 3MFXA 5HWVA 3UB6A 2V9AA 2PD7A 4NXGA 3OLOA 4BBTA 3CAXA 3PYPA 1LSVA 3F1OA 3NHQA 4K08A 3SW1A 3LI9A 2VV8A 1T1BA 3LI8A 4DJ2A 3VE4A 1T18A 1T19A 4KUOA 4HQAA 1LSXA 1G28A 1UGUA 2VV6A 5J4EA 5G4YA 1S4SA 2PR6A 2PHYA 5HZHA 5IS1A 4RQ9A 1N9LA 4I3IA 2ZOHA 4I38A 2D01A 5DKKA 3UMEA 2QKPA 2ZOIA 3ICYA 2A24B 4EW7A 4JGQA 2QJ7A 2WKRA 5HSQA 1P0ZA 2L0WA 5DJTA 3VOLA 1OTBA 3B33A 2VV7A 3A0RA 5DJUA 4EXOA 4I5SA 3F1OB 3F1NA 5HD3A 1GSXA 4WF0A 3GECA 3BY9A 3GDIA 4LLOB 2PD8A 4KUKA 2KX6A 1XFQA 2V0UA 4GS9B 3LUQA 3D72A 4I3AA 5TBMA 2WKPA 2P7JA 1DP9A 3ULFA 5F6AA 4L9GA 5IU1A 4L9FA 2OWHA 4LRYC 4HNBA 5F69A 4HP9A 5AVEA 4HOIA 4R3AA 2GJ3A 1OT9A 3CLOA 1D7EA 4E04A 2ZBBA 5HD5A 3MQQA 3IBRA 3G6OA 4NXFA 4R70A 2QWSA 1N9NA 2L1MA 3ZQ5A 5F68A 3LIAA 1UWNX 1GSWA 4LPZA 4GS9A 4EESA 3A0SA 3BWLA 1TS6A 3F1NB 5A8BA 4HH3A 5I5LA 3H82A 1F9IA 5EFWA 1BYWA 3K3CA 3F1PB 5TBMB 1JNUA 1S1ZA 3LIFA 1XJ6A 4B9OA 4GHIB 2I9VA 2K7SA 4EETB 1KOUA 1WA9A 4WN5A 4HI4A 2M1CA 4M4XA 1EW0A 1S4RA 2H28A 4JGPA 1OTDA 1OJ5A 3FG8A 2BASA 4HP4A 5J7EA 4XT2B 1S67L 1XJ2A 4LRXC 2PYRA 4DJ3A 4HHDA 3NJAA 1LL8A 2B02A 3EWKA 5DKLA 1NWZA 3F1PA 4GW9A 3RTYA 1MZUA 1N9OA 3UMDA 4EEPA 4GHIA 1GSVA 4R6LA 1D06A 4HJ6A 1S1YA 2J80A 4PKYA 3T50A 3H82B 2JHEA 1XJ3A 3IS2B 3LIEA 4JGRA 1XFNA 3KX0X 2W0NA 2YKFA 1V9ZA 4L9EA 5HWTA 4GCZA 1T1AA 4YWZA 1TS7A 3EEHA 2OOLA 4XT2A 2Z6CA 1VB6A 2KDKA 2R78A 4HY8A 1T1CA 1OTEA 3K3DA 4EEUA 4HJ4A 1P97A 3MQOA 1DP8A 3NOPC 3H7WA 2VEAA 1V9YA 4BBUA 2V1BA 4KQDA 3E4OA 1Y28A 3RH8B 1DP6A 3E4PA 5G4ZA 3P7NA 4I3JA 3MR0A 3LIDA 3IS2A 4F3LB 3MJQA 4EERA 5HWWA 1TS0A 3HJIA 4H6JA 1OTIA 2PDRA 3UE6A 2HV1A 3LIBA 4BBVA 3FC7A 2W27A 5HDDA 5KIZA 4I39A 2PYPA 3VE3A 3PHYA 3CWFA 1LSWA 1OT6A 5J3WA 4WL9A 3UB7A 1S66L 2VLGA 2Z6DA 1ODVA 3E4QA 3C8CA 2INWA 3HJKA 4MN6A 2PR5A 5F5YA 3UB8A 4EQ1A 2V1AA 4NXEA 1X0OA 2V0WA 1DRMA 4HH2A 3UB9A 3BY8A 4MN5A 4WLAA 4JGOA 3H7WB 1OTAA 4F3LA 3NOTC 1XJ4A 4HJ3A 3MXQA 2D02A 5HDSA 4LRZE 2QHKA 2QJ5A 1LT0A 3NOUC 2L4RA 3A0VA 4NXBA 1UWPX 3LICA 4WUJA 2YKHA 1TS8A 2EA9A 4H6JB 5AVFA 1OJGA 1F98A 4R38A
chains in the Genus database with same CATH superfamily
1XXMA 4UQIM 2GDNA 4WMCD 3C7VA 1L0EA 3ZG8B 5TFQA 5HDCA 3LYXA 3R7WB 2HZ5A 4NETA 4WZ5A 3HCYA 4OVDA 2CMNA 3TRCA 3UB6A 2V9AA 5E43A 5FAOA 5E2GA 1G6OA 4G3KA 3W8KA 2IWDA 2JCHA 5EOOA 2WGIA 3F1OA 3WRZA 3NHQA 3SW1A 1HZOA 3FZCA 2JKFA 4A5RA 4DKIA 1WYCA 5GHXA 3V67A 1I2WA 4WEJA 1W5DA 2FFFB 4U0XA 1LI0A 2VV6A 5J4EA 4UAAA 1PZOA 4O7DA 3V50A 4R1GA 5IS1A 2BTFP 1N9LA 4DE1A 3MF0A 1Q2PA 4WZ5C 4I38A 4OOYA 3EGDC 4PMAA 4PPRA 3S4XA 3UMEA 4K0WA 3S1YA 3DW0A 1MY8A 2HJEA 2W3HA 2J3WA 4JGQA 2DMWA 4JBFA 1FQGA 5DJTA 1OTBA 3F1NA 2IWCA 4E3LA 2DRWA 3GECA 2K31A 1PWCA 1K56A 3CJMA 1MPLA 1S6RA 3GSGA 3UPOA 2PT7A 2KX6A 3IH9A 2ZM2A 2GX5A 1TF1A 4Y2FA 2PAVP 3Q82A 3GQZA 3RJUA 1KVMA 4O0PA 3ULFA 5F6AA 1PZPA 4MBHA 4X68A 3PBOA 1LI9A 3C30A 5IU1A 4S2IA 2WKHA 4B4XA 1FSYA 4L9FA 5M19A 2DCFA 3GMWA 4LRYC 4HNBA 1XP4A 5F69A 2PBDP 2JKGA 4HOIA 4R3AA 4KZ8A 1CI8A 4WMCA 4EUVA 2ZJ9A 3DTIA 2WZXA 4DE3A 3TE8A 3ZGAB 4U0TA 3G6OA 1H5XA 3CPTB 2QWSA 3IXBA 4PM6A 1YT4A 1N9NA 4EU0A 3VP2A 3W4PA 4GDBA 5F1GA 5IT5A 1VETA 1GSWA 4LPZA 4GS9A 3BFDA 1CJFA 4ZJ1A 1MWSA 4R4SA 3SS4A 3I7JA 4DN0A 4BD1A 2JBFA 1HTZA 1PI5A 1YLJA 1D1JA 3T1RA 5HPIA 1K55A 3N7WA 1RCJA 5I5LA 4OONA 2HDSA 3AGEA 4KG5A 4C75A 2Q9NA 4PAUA 3K2NA 1BYWA 5KMWA 2O9CA 4QU3A 3PR6A 2C5WB 2VX8A 4NKPA 3Q7VB 3VV4A 1H3QA 2ZC6B 3VP3A 1KOUA 4WN5A 3TW8A 4HI4A 2ZLYA 4S2LA 1YSPA 3N8RA 1P9WA 5CHMA 1JTDA 3A3DA 4G3WA 1OTDA 2ACGA 4X6TA 3WS1A 5GLDA 5EM1A 2BASA 2XD1A 4OKPA 4XT2B 4N1XA 1S67L 4S2NC 1XJ2A 4DJ3A 2J9OA 4ETXA 3VP0A 4LV2A 4JXSA 3G4PA 3LGOA 2B02A 1ERQA 2Y59A 3WS5A 2ZQ8A 1IOUA 3Q7ZA 3LEZA 3Q07A 3F1PA 4GW9A 4PM7A 2ZL1A 5DTKA 4OH0A 3UN7A 2V2FF 5GLAA 2VJWA 4R6LA 3ZDJA 2QPNA 3O87A 3UDIA 1XJ3A 1AWIA 3LIEA 3NY4A 1YLPA 3KX0X 3MFDA 3MS6A 3O5YA 2Z2LB 2ZQ7A 4KZ4A 1DJCA 2JKRI 2B18A 4GKUA 2Z6CA 1YMXA 4HY8A 2E8IA 2R78A 4EEUA 1OTEA 3SH9A 1M40A 3MQOA 4QJGA 3C4PA 3H7WA 4MBFA 1PIOA 4R4RA 2VEAA 2WGWB 5A91A 2V1BA 3E4OA 4ARZB 1IKIA 1SDNA 5TR7A 4GB7A 3IHAA 4I3JA 3MR0A 3LIDA 2XD5A 5EUAA 5G18A 1W8QA 4DRTA 3BQ8A 5M18A 3MJQA 4EERA 4MN7A 1TS0A 1H8YA 5FQKA 4H6JA 1GHIA 3S7NA 3FC7A 2W27A 1K57A 2O99A 2O9BA 2PYPA 4IVIA 3R7WA 4OQ0A 4GZBA 5FI7A 3HUMA 4N92A 3JVUA 3MXSA 3W4OA 4AFIA 3OPPA 1FIKA 1ONGA 4MCWA 3HJKA 2ZQDA 5F5YA 3WS0A 5EOEA 3DTEA 3EOIA 5TJJA 1IELA 1GA9A 2V0WA 2Y2KA 3BY8A 4MN5A 2VKSA 4WLAA 2WKEA 3GR2A 1N4OA 3JPUA 3FPWA 4S2MA 3HREA 1NRJA 3MXQA 2D02A 2JKRM 1NYYA 5HDSA 3MBZA 4HEFA 3HLEA 1FR1A 3A3EA 5FEFA 2L4RA 4NXBA 1UWPX 3LR4A 3P01A 5HL1A 5F83A 2KLIA 1K57C 4LV1A 4DXBA 1IYQA 1ERMA 4KZBA 1K6RA 3QP6A 4Z1WA 1GHMA 4QHCA 4Q0JA 1BLPA 5CX7A 2XRNA 3IX4A 2WKQA 1G6AA 3MFXA 3FV7A 1TDGA 2P04A 2PD7A 2XFTA 3CAXA 2R9XA 2A49A 2ZC7A 4E3OA 4JF4A 1PI4A 4NEED 4OQIA 2XA7S 3DWKA 4RYEA 2Y2LA 3E98A 2J7VA 2VGLS 2ZM8A 4KUOA 3KSFA 5FAPA 3NIAA 1IKGA 2GZAA 1UGUA 3SS5A 3ZVWA 5CRFA 3KSHA 4DF6A 3ZG9B 2PHYA 5HZHA 3A3JA 1SZVA 2Y2MA 4LENA 5CXWA 4RQ9A 3V3RA 3W4QA 2WUQA 3N8LA 2OV5A 4OLGA 4OOLA 2D01A 1JWZA 2QKPA 4WELA 3IXDA 2ZOIA 4HESA 3ICYA 2CC1A 2WGVA 3GVBA 4MLLA 3CPTA 3KYZA 4Y13A 3SZTA 2WKRA 5DTTA 3EEAA 4PM5A 4CQHA 3S22A 4P87A 3WWXA 5C5KA 4GN2A 4PM9A 3A0RA 5DJUA 3ZCZA 4ZBEA 1CK3A 2ZMVA 5FQQA 1MKIA 1YLZA 4WBGA 1C3BA 4ZDXA 1MXOA 5CEDA 2Y2QA 1PWDA 2PD8A 2BLSA 4EUZA 2J8YA 2PRFA 1MWUA 3G31A 4RA7A 4QY6A 3V5MA 3LUQA 4N1HA 4I3AA 3U2AA 1Y54A 4RVAA 2P7JA 4KQQA 5KSCA 1DP9A 1EROA 3IQAA 5FDSA 3ZG0A 1P9RA 1KVLA 4IHQA 2RL3A 3NBLA 1VQQA 3Q7VA 1L2SA 2MJ6A 5EVLA 3GRJA 2G2UA 2B5RA 2KOIA 4GDNA 4DMZA 4FH4A 4E04A 1W63Q 1YLYA 5FAQA 3ZG7B 1SCWA 2A3UA 1KDWA 4EBLA 3RXWA 5EVIC 4EQIA 3KYEA 2L1MA 3LIAA 1UWNX 1DJAA 2FZ0A 4Y17A 3KO6A 4LCLA 4KG6A 3DAVA 2M7UA 2VK3A 2V8CA 2ZD8A 1HD8A 4HH3A 5E2HA 3S7QA 2EX2A 4P85A 1XA7A 3V39A 4FCFA 4MMNA 3LY3A 3RXXA 2K2NA 3IWOA 1DJBA 1JNUA 3UDFA 3LR0A 3UB5P 3TJZC 3PAGA 1FCNA 2QMIA 4EETB 2XFSA 3T4JA 3MZDA 3MZFA 4FH2A 5FQMA 1AXBA 5AJGA 5JYOA 4M4XA 1KGFA 1EW0A 1S4RA 2H28A 2XROA 5CECA 2WGWA 4PHTA 5J7EA 3UE3A 2PYRA 2W3EA 2HGVA 4ARZA 2NUPC 1LL8A 4S2KA 3EWKA 1OMEA 1FILA 5DKLA 1IYOA 1NWZA 1VHMA 1YM1A 3PXPA 3ZVTA 1IYSA 1KE0A 3UPNA 3BJNA 3UE1A 2IWBA 1N9OA 3UO9A 3VP4A 3UMDA 5DF9A 2W3FA 1SHVA 2WK0A 2Y4AA 3IHBA 4GHIA 4GLQA 4ZJ3A 1GSVA 2XDMA 3MXRA 3D3OA 3B3XA 3IX8A 5CTMA 1HVBA 2WADA 5D3OA 3T50A 3IS2B 1J9MA 5FDHA 1XFNA 2YKFA 4YOFA 5MC7A 4MBKA 1T1AA 1U60A 2XR0A 4YWZA 5CEBA 1GCEA 2OOLA 1NYMA 4EBPA 2NUTC 3B42A 2XH9A 4ESPA 1V9YA 4BBUA 1SKFA 2G2WA 1ALQA 5HAPA 3LY4A 1Y28A 5HPFA 2VGKA 1XGIA 3RH8B 3E4PA 4E6WA 4YNRA 3ITBA 3WS2A 5CHJA 3ISGA 3VFHA 2HP6A 3WS4A 2XLNA 4P6BA 1OPXA 1L0FA 1I5QA 3HJIA 1NXYA 4K0XA 1STZA 3LIBA 1W63M 3PBRA 1ES3A 3VE3A 4CLCB 3HLCA 2Y91A 4WM9A 2ZQ9A 3D4FA 4II7A 5J3WA 3UB7A 4JXVA 4BJPA 1G5UA 3C8CA 2INWA 2XGNA 1BZAA 3IF6B 2VZWA 4MN6A 1L0GA 4JXWA 3VSLA 1BUEA 2PR5A 3LR5A 3PBNA 1E4DA 2V1AA 1ES5A 2XA7M 4NXEA 2OLUA 4O01A 1DRMA 4X1MA 2VGLM 3UB9A 4FTXA 4F3LA 3NOTC 3OCLA 1K55C 4N9KA 4HJ3A 3UNWA 3HLBA 3IWIA 3L7HA 2ZC4B 5AQ9A 2QJ5A 2X71A 1LT0A 1MWTA 2PBYA 3NOUC 1K4FA 3IF5A 1VM1A 2YKHA 5DTSA 1TS8A 4HBUA 3BYDA 4BLMA 3P09A 5AVFA 3T12B 1OJGA 3C2WA 3NI9A 1ESIA 2OWJA 4QB8A 2Y2GA 2JN7A 5FI6A 3O86A 4ETZA 1IYPA 2W1RA 3H9WA 1CQAA 1Z09A 5E2EA 1JTGA 4NXGA 3OLOA 4CPKA 4P0MA 4MNRA 4IVKA 1LSVA 3FWLA 1F2KA 4K08A 4UA9A 3O88A 1S0WA 2XSSA 1SDEA 1ACFA 2VV8A 1ES4A 1T1BA 2C6WB 4WYYA 2A2LA 1HLUP 4UHUA 4DJ2A 3VE4A 4IBRA 4QY5A 3BFEA 5AQBA 2RCXA 1T18A 4HQAA 1LSXA 4M3KA 1G28A 1G68A 4DE0A 2PR6A 1K0KA 2UWXA 2ZM0A 2FFYA 2QYBA 3UPPA 5CGXA 2EFUA 3T4QA 2Z2MB 5DKKA 4Y0UA 1TEMA 3UY6A 2A24B 3BLSA 4H8RA 4EW7A 4B4ZA 3QP8A 3MSHA 1PW8A 5HSQA 3HL9A 4EV4A 3T4OA 1P0ZA 2PU2A 1MC0A 2L0WA 1MWRA 2J3TD 3B33A 1Q2QA 1ZG6A 3RFBA 5HD3A 2Y79A 4WF0A 5CGWA 4IBXA 4KQOA 3BRMA 1XKZA 2WYXA 2ZMAA 1L3LA 1MBLA 4CLCD 2Y2IA 2HP9A 3N8SA 1XGJA 1XFQA 1VETB 2V0UA 5KSHA 1YKDA 4GS9B 4KZ6A 4Q8IA 1ZTUA 2V1ZA 4B88A 5EV0A 1YQSA 2VA0A 2WKPA 4ME4A 2WAEA 4OP5A 5L8MA 3UDXA 2P08A 5A90A 5K5BA 2OWHA 2H0TA 3LFVA 5HX9A 4C6YA 4JKTA 3SH8A 3ZFZA 1RGZA 4HP9A 4OPYA 3C38A 5AVEA 3C4OA 2GJ3A 2Y8HA 3V3SA 1BULA 2ZBBA 5HD5A 1LL9A 4D60A 1VEUB 4S2OA 2ZQCA 5HAIA 4GD6A 3FKWA 1PFLA 1PWGA 4R70A 3EQVA 1NZUA 5F68A 2HJ9C 5EE8A 3MKEA 4EESA 5EVEA 3A0SA 1H8MA 5KZHA 5A8BA 2EWVA 3UE0A 1K38A 2ZC5B 1CI9A 4DDSA 3G2ZA 4JF6A 5EFWA 1YAXA 4Q0HA 4Y0OA 3BFFA 3F1PB 5TBMB 1S1ZA 1PW1A 1NLZA 1KDSA 2I9VA 5FQJA 4LV0A 4BMWA 2K7SA 4O8GA 5FATA 3BLMA 3BECA 3OPLA 2M1CA 3G2YA 5A92A 1ZKJA 4KG2A 4OQGA 2ZQAA 4JGPA 3S7PA 1BSGA 4HP4A 1WYBA 3VMAA 2E8JA 1K6SA 5FASA 3ZHHA 1YSQA 4HHDA 1ZC2A 4D2OA 3T4LA 3CMZA 4R0QA 5FQ9A 3HUNA 3SS3A 3T1XA 2Y2NA 4QPRA 1E3UD 2HDUA 5GLCA 4WZ4A 1A0KA 2UV0E 2X01A 1GA0A 1MZUA 3VOYA 3E2KA 4EEPA 2ZMFA 3LEQA 2EFXA 2V20A 2R9WA 5F82A 4HJ6A 1S1YA 2J80A 3IT9A 4PKYA 4CLCA 3H82B 1W79A 3HVFA 5J8XA 5F1FA 4L9EA 1TD5A 4LV3A 5BOHA 3IF6A 4HBTA 1K4EA 1TS7A 3JVVA 4E3KA 4XT2A 4Y0TA 2LB9A 1VB6A 1M6KA 1T1CA 3K3DA 2EWWA 3OC2A 1P97A 1DP8A 3NOPC 1WE4A 1ZG4A 2JC7A 5HFOA 3T1SA 4Y15A 3VSKA 3ZNTA 4N9LA 1LHYA 3DBAA 2XF3A 3MMHA 1DP6A 5GLBA 2J3TC 5HAQA 5G4ZA 4GD8A 2WAFA 2PU4A 3P7NA 3FYZA 3OPHA 1BLHA 2P9VB 2X02A 3D9YA 3G30A 3QNBA 4KZ7A 1XPBA 5HWWA 4CLCC 1PNEA 1FR6A 1IFQA 2Y2PA 5HW3A 1OTIA 1YPRA 4BQMA 4IUKA 4BBVA 4KENB 4UA7A 4KZ3A 4I39A 3LCEA 3IF6C 3CWFA 1LSWA 3NECA 3NC8A 1GHPA 2M7VA 1CF0A 2VLGA 3SOIA 2Z6DA 3W2ZA 1ODVA 2Y2JA 3E4QA 1JVJA 4KQRA 3BFGA 2EXBA 1O7EA 4MDZA 4RX3A 3MZEA 3UB8A 3IWQA 1JWVA 1X0OA 3M6HA 3LO7A 3Q81A 3HLWA 3OOVA 4HH2A 3JYIA 4JGOA 1OTAA 1XX2A 3EQUA 5TGFA 5L10A 4MEZA 4X56A 1RGYA 4S2JA 1NY0A 1KGEA 2AVXA 4ID4A 2W3GA 3ZG5A 1KE4A 5DFXA 4WEKA 3AGDA 4OPZA 1YMSA 4OLDA 1NJ4A 1E3UA 3ZYTA 1RP5A 1TDLA 4OP8A 5U47A 1F98A 4R38A 1EWZA 4HIAA 4NK3A 3VP1A 2WKIA 3N4IA 4PKYG 2O0YA 1FSWA 2A24A 3BEBA 3VFFA 1XA1A 4JF5A 5CERA 1K25A 3IBJA 5FQIA 2W1TB 3A3IA 5HWVA 5E2FA 5HL6A 3E2LA 2XEPA 4X69A 4BBTA 1YLWA 3PYPA 1W7FA 1BLCA 4X1LA 3ITAA 4R23A 1K54A 3R4KA 3LI9A 1ES2A 1KGGA 3SH7A 4R3JA 2H10A 3LI8A 4E3JA 4S2NA 4Q0IA 3PBTA 5AQ7A 5EVIB 1T19A 5IHVA 3EGXC 3NCKA 3PAEA 4BENA 2Q9MA 5FI2A 2H0YA 5G4YA 1S4SA 1NZOA 2O9AA 3LR3A 3OBFA 5DF7A 5EPHA 2HP5A 1W8YA 1SKOB 4E3NA 2OSUA 1CEGA 4DE2A 3B47A 4I3IA 4BWIA 2ZOHA 1NLYA 1QMFA 4P6ZS 2I72A 5JYPA 1QMEA 3O3VA 5L07A 1VEUA 4C3QA 3T1QB 4UQIS 3C7UA 2QJ7A 2BG1A 1BLSA 2G7UA 1NRFA 2EX6A 1F5MA 4DXCA 1K54C 2OAP1 3VOLA 1FCOA 3TG9A 3S7OA 4ZJ2A 2VV7A 4EXOA 4I5SA 3F1OB 2XQZA 1GSXA 2Q0OA 3CUEA 3BY9A 3Q1FA 3GDIA 3L9KA 4LLOB 1LL5A 2J9PA 1LLBA 3NDEA 4KUKA 3T4KA 1DY6A 4GOGA 4EWFA 4IJGA 3T4SA 2WZZA 3D72A 5DVAA 5FSRA 3QP1A 5TBMA 4X25A 4FSFA 3CITA 4GNUA 4L9GA 5L2FA 3IX3A 2HDRA 3U4LP 2IA2A 2V8FA 1H0MA 1MKMA 4JXGA 4BD0A 1PYYA 5CGSA 4XXRA 3WRTA 1OT9A 3CLOA 3T4TA 1D7EA 4Z9QA 4EBNA 3MQQA 1KE3A 3CHWP 3KSIA 4R3BA 3IBRA 4NXFA 5DF8A 4G3VA 3G35A 3DWZA 3ZQ5A 3N6IA 4FD8A 3CUEC 3KSGA 3VOZA 1J3WA 3DTKA 3BWLA 1TS6A 2P74A 1CEFA 3F1NB 3QHYA 4BL2A 4BL3A 3IH8A 3TOIA 5GHYA 5I94A 3BM6A 4PM8A 3H82A 3MKFA 1F9IA 5EECA 3K3CA 3HLGA 4KZ9A 5LBRA 4Y3IA 5M1AA 4E3IA 3PTEA 3LIFA 1XJ6A 3HUOA 4B9OA 4GHIB 2H5SA 4LGWA 3M2JA 3M2KA 2DNSA 2HPBA 1WA9A 4KZAA 5FA7A 2EXAA 4IUHA 2FH5A 3C5AA 3E0YA 4UEYA 1IEMA 1OJ5A 4Y7PA 3FG8A 3FKVA 3HLDA 3G34A 5EVID 2JE5A 4L0LA 4LRXC 3CI6A 3QP4A 5GL9A 3NJAA 4CJNA 2P9VA 2B95A 3QNCA 2QZ6A 4ZAMA 2Y55A 3RTYA 2EX9A 3OCNA 4K91A 4ZTKA 4DDYA 1PRQA 4X55A 3BFCA 1D06A 1JWPA 4E3MA 4Y5FA 5L09A 2JHEA 3FPVA 4JGRA 5FEGA 5CTNA 2W0NA 1V9ZA 5HWTA 3IXHA 3OZHA 4GCZA 4YFMA 2JKTI 3BQAA 1FOFA 1ZHHB 5AQAA 3EEHA 4XUZA 4QD4A 1FCMA 2KDKA 4KZ5A 4HJ4A 2OAQ1 1TVFA 3PBQA 4JPMA 3DTMA 3HBRA 3NDGA 5GHZA 2OLVA 4JLFA 4KQDA 3G32A 4CLCE 2Y2OA 4NG2A 3KYQA 3M6BA 5CHUA 1H8ZA 3HLFA 3IS2A 2LB5A 4F3LB 3P98A 4XUXA 2ZL1B 4YINA 3IXGA 4UA6A 2HDQA 4U3TA 2PDRA 3UE6A 2HV1A 4FUWA 3QP5A 5HDDA 3OPRA 5KIZA 1BTLA 3PHYA 1OT6A 4E6XA 2ZC3B 4QWOA 5HARA 4WL9A 1S66L 4ZRRA 2W1TA 3MQ0A 4S2PA 1N9BA 4IEDA 1I2SA 2Y2HA 4GJ4A 5FL3A 1YLTA 4EQ1A 4OPRA 1BT5A 1EI5A 1K56D 4FOFA 4RX2A 1E25A 4X53A 3H7WB 4OQHA 3AGFA 1O07A 4B93A 3CZDA 3ZNYA 2JKTM 2VGJA 4F94A 5EVIA 1XJ4A 3BW6A 4LFUA 5EM0A 4LRZE 2QHKA 1ONHA 3GV9A 1Z6FA 3A0VA 4OPQA 3QP2A 2GNXA 3LICA 2W3DA 3A3FA 2XK1A 4WUJA 4P6ZM 4OOMA 3TSGA 3GTCA 1SKOA 3CG5A 5A93A 1ESUA 3NULA 2EX8A 3PBSA 4LCMA 2EA9A 5DFYA 4H6JB 1L0DA 1Y4OA 2HF6A
chains in the Genus database with same CATH topology
3C2WA 4HIAA 4UQIM 2OWJA 4Z1WA 2JN7A 4PKYG 2O0YA 2A24A 5HDCA 3LYXA 3R7WB 4Q0JA 4ETZA 5CX7A 2W1RA 3H9WA 3HCYA 3IBJA 2XRNA 2W1TB 2WKQA 2CMNA 3MFXA 3TRCA 5HWVA 3UB6A 5HL6A 2V9AA 2P04A 2PD7A 4NXGA 3OLOA 4BBTA 1G6OA 4G3KA 3CAXA 3PYPA 1LSVA 3F1OA 3NHQA 4K08A 3SW1A 2XSSA 3R4KA 3LI9A 2VV8A 4NEED 1T1BA 3V67A 2A2LA 2XA7S 3LI8A 3E98A 4DJ2A 4WEJA 2VGLS 3VE4A 4Q0IA 3PBTA 1T18A 1T19A 4KUOA 3EGXC 4HQAA 3KSFA 1LSXA 2GZAA 1G28A 1UGUA 2VV6A 5J4EA 5G4YA 1S4SA 2PR6A 2O9AA 3LR3A 3OBFA 3KSHA 2PHYA 2QYBA 5HZHA 5IS1A 4RQ9A 1N9LA 3B47A 4I3IA 3MF0A 4BWIA 2ZOHA 1NLYA 4P6ZS 4OOLA 4I38A 3T4QA 3EGDC 2D01A 5DKKA 3UMEA 2QKPA 4WELA 2HJEA 2ZOIA 3ICYA 2A24B 2W3HA 4EW7A 4UQIS 2J3WA 4JGQA 2QJ7A 3KYZA 2DMWA 2WKRA 5HSQA 2G7UA 3EEAA 3T4OA 4CQHA 1P0ZA 1F5MA 1MC0A 2L0WA 5C5KA 2OAP1 5DJTA 3VOLA 1OTBA 2J3TD 3S7OA 3B33A 2VV7A 3A0RA 5DJUA 3RFBA 4EXOA 4I5SA 2ZMVA 3F1OB 3F1NA 5HD3A 1GSXA 2Y79A 4WF0A 4KQOA 3GECA 3CUEA 2K31A 3BY9A 3GDIA 4LLOB 2PD8A 4CLCD 2PT7A 4KUKA 2KX6A 3T4KA 2GX5A 1TF1A 1XFQA 4IJGA 4Y2FA 2V0UA 3T4SA 5KSHA 1YKDA 4GS9B 3LUQA 1ZTUA 3D72A 4I3AA 3U2AA 5TBMA 2VA0A 2P7JA 2WKPA 1DP9A 4ME4A 4O0PA 3ULFA 4FSFA 5F6AA 3CITA 5L8MA 4L9GA 3PBOA 1P9RA 2P08A 3C30A 4IHQA 5IU1A 2IA2A 5K5BA 4L9FA 2OWHA 1MKMA 2MJ6A 4LRYC 3LFVA 4HNBA 5F69A 4HP9A 2KOIA 3C38A 5AVEA 4HOIA 4R3AA 4DMZA 2GJ3A 1OT9A 2Y8HA 3CLOA 3T4TA 1D7EA 4E04A 1W63Q 2ZBBA 5HD5A 4EUVA 3MQQA 3KSIA 3TE8A 3IBRA 3G6OA 4NXFA 4R70A 2QWSA 3EQVA 4G3VA 1N9NA 2L1MA 3ZQ5A 5F68A 3LIAA 1UWNX 2HJ9C 4EU0A 3CUEC 3KSGA 5IT5A 1GSWA 4LPZA 4GS9A 2FZ0A 4EESA 3KO6A 3A0SA 3BWLA 1TS6A 2M7UA 1H8MA 3F1NB 5A8BA 2EWVA 4DN0A 4HH3A 3S7QA 5HPIA 5I5LA 3H82A 1F9IA 5EFWA 1YAXA 4MMNA 4PAUA 3K2NA 1BYWA 3K3CA 2K2NA 4Q0HA 5LBRA 3F1PB 5TBMB 2O9CA 1JNUA 4Y3IA 1S1ZA 3LR0A 3LIFA 3PR6A 1XJ6A 4B9OA 4GHIB 1NLZA 2VX8A 2I9VA 4NKPA 3TJZC 3VV4A 4BMWA 2K7SA 4O8GA 1H3QA 4EETB 1KOUA 1WA9A 3T4JA 4WN5A 3TW8A 4HI4A 2M1CA 4IUHA 1YSPA 5AJGA 4M4XA 2FH5A 3E0YA 1P9WA 4UEYA 1EW0A 1S4RA 2H28A 2XROA 4JGPA 3S7PA 4G3WA 4PHTA 1OTDA 1OJ5A 3FG8A 2BASA 4HP4A 5J7EA 4XT2B 1S67L 1XJ2A 4L0LA 4LRXC 3UE3A 2PYRA 2W3EA 3CI6A 4DJ3A 4ETXA 2HGVA 4ARZA 1YSQA 4HHDA 3NJAA 2NUPC 1LL8A 2B02A 3EWKA 3T4LA 5DKLA 1NWZA 1VHMA 4QPRA 1IOUA 3PXPA 3F1PA 4GW9A 3RTYA 3BJNA 1MZUA 1N9OA 3OCNA 3UMDA 5DF9A 4EEPA 2W3FA 2ZMFA 4GHIA 4GLQA 1GSVA 2VJWA 4R6LA 3D3OA 1D06A 4HJ6A 4Y5FA 1S1YA 2J80A 4PKYA 3T50A 4CLCA 3H82B 2JHEA 3FPVA 1XJ3A 3IS2B 3LIEA 4JGRA 1XFNA 3KX0X 2W0NA 2YKFA 1V9ZA 4L9EA 4YOFA 5HWTA 5MC7A 4GCZA 3O5YA 1TD5A 2JKTI 1T1AA 4YWZA 2JKRI 3BQAA 1ZHHB 1TS7A 3EEHA 3JVVA 2B18A 2OOLA 4XT2A 2LB9A 2Z6CA 1VB6A 2KDKA 2R78A 4HY8A 1T1CA 1OTEA 3K3DA 2EWWA 3OC2A 4EEUA 4HJ4A 1P97A 3MQOA 2OAQ1 1DP8A 3PBQA 2NUTC 3B42A 3NOPC 3H7WA 2VEAA 1V9YA 4BBUA 2V1BA 4KQDA 3DBAA 3E4OA 1Y28A 4CLCE 5HPFA 3RH8B 3MMHA 1DP6A 3E4PA 4ARZB 3KYQA 2J3TC 5G4ZA 4YNRA 3P7NA 4I3JA 3MR0A 3LIDA 3IS2A 2LB5A 3BQ8A 4F3LB 3MJQA 4EERA 5HWWA 1OPXA 1TS0A 3HJIA 4MN7A 4CLCC 1IFQA 1STZA 4H6JA 1OTIA 2PDRA 3UE6A 2HV1A 3LIBA 4IUKA 4BBVA 1W63M 3S7NA 3FC7A 2W27A 3PBRA 5HDDA 5KIZA 4I39A 2O99A 2O9BA 2PYPA 3VE3A 4CLCB 3PHYA 3CWFA 1LSWA 1OT6A 3R7WA 4II7A 5J3WA 4WL9A 3UB7A 2M7VA 1S66L 2VLGA 4BJPA 3JVUA 2Z6DA 2W1TA 3MQ0A 1ODVA 3E4QA 4ZRRA 3C8CA 2INWA 3W2ZA 4AFIA 2VZWA 3HJKA 4MCWA 4MN6A 4MDZA 4GJ4A 2PR5A 5F5YA 3LR5A 3PBNA 5FL3A 3UB8A 4EQ1A 3EOIA 2V1AA 5TJJA 2XA7M 4NXEA 1X0OA 2V0WA 4O01A 3OOVA 1DRMA 4FOFA 2VGLM 4HH2A 3UB9A 3BY8A 4MN5A 2VKSA 4WLAA 4JGOA 3H7WB 1OTAA 3EQUA 4B93A 3FPWA 4F3LA 3NOTC 3OCLA 2JKTM 1NRJA 1XJ4A 4HJ3A 3BW6A 2D02A 3MXQA 2JKRM 5HDSA 4LRZE 2QHKA 2QJ5A 2W3GA 1LT0A 3NOUC 5DFXA 2L4RA 3A0VA 4WEKA 4NXBA 1UWPX 3LR4A 3P01A 2GNXA 3LICA 2W3DA 2KLIA 4WUJA 4P6ZM 2YKHA 4OOMA 1TS8A 3ZYTA 3PBSA 2EA9A 5DFYA 4H6JB 5AVFA 1OJGA 1F98A 4R38A 2HF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C2W A;  4HIA A;  2OWJ A;  2JN7 A;  4PKY G;  2A24 A;  5HDC A;  3LYX A;  3H9W A;  2WKQ A;  2CMN A;  3MFX A;  5HWV A;  3UB6 A;  2V9A A;  2PD7 A;  4NXG A;  3OLO A;  4BBT A;  3CAX A;  3PYP A;  1LSV A;  3F1O A;  3NHQ A;  4K08 A;  3SW1 A;  3LI9 A;  2VV8 A;  1T1B A;  3LI8 A;  4DJ2 A;  3VE4 A;  1T18 A;  1T19 A;  4KUO A;  4HQA A;  1LSX A;  1G28 A;  1UGU A;  2VV6 A;  5J4E A;  5G4Y A;  1S4S A;  2PR6 A;  2PHY A;  5HZH A;  5IS1 A;  4RQ9 A;  1N9L A;  4I3I A;  2ZOH A;  4I38 A;  2D01 A;  5DKK A;  3UME A;  2QKP A;  2ZOI A;  3ICY A;  2A24 B;  4EW7 A;  4JGQ A;  2QJ7 A;  2WKR A;  5HSQ A;  1P0Z A;  2L0W A;  5DJT A;  3VOL A;  1OTB A;  3B33 A;  2VV7 A;  3A0R A;  5DJU A;  4EXO A;  4I5S A;  3F1O B;  3F1N A;  5HD3 A;  1GSX A;  4WF0 A;  3GEC A;  3BY9 A;  3GDI A;  4LLO B;  2PD8 A;  4KUK A;  2KX6 A;  1XFQ A;  2V0U A;  4GS9 B;  3LUQ A;  3D72 A;  4I3A A;  5TBM A;  2WKP A;  2P7J A;  1DP9 A;  3ULF A;  5F6A A;  4L9G A;  5IU1 A;  4L9F A;  2OWH A;  4LRY C;  4HNB A;  5F69 A;  4HP9 A;  5AVE A;  4HOI A;  4R3A A;  2GJ3 A;  1OT9 A;  3CLO A;  1D7E A;  4E04 A;  2ZBB A;  5HD5 A;  3MQQ A;  3IBR A;  3G6O A;  4NXF A;  4R70 A;  2QWS A;  1N9N A;  2L1M A;  3ZQ5 A;  5F68 A;  3LIA A;  1UWN X;  1GSW A;  4LPZ A;  4GS9 A;  4EES A;  3A0S A;  3BWL A;  1TS6 A;  3F1N B;  5A8B A;  4HH3 A;  5I5L A;  3H82 A;  1F9I A;  5EFW A;  1BYW A;  3K3C A;  3F1P B;  5TBM B;  1JNU A;  1S1Z A;  3LIF A;  1XJ6 A;  4B9O A;  4GHI B;  2I9V A;  2K7S A;  4EET B;  1KOU A;  1WA9 A;  4WN5 A;  4HI4 A;  2M1C A;  4M4X A;  1EW0 A;  1S4R A;  2H28 A;  4JGP A;  1OTD A;  1OJ5 A;  3FG8 A;  2BAS A;  4HP4 A;  5J7E A;  4XT2 B;  1S67 L;  1XJ2 A;  4LRX C;  2PYR A;  4DJ3 A;  4HHD A;  3NJA A;  1LL8 A;  2B02 A;  3EWK A;  5DKL A;  1NWZ A;  3F1P A;  4GW9 A;  3RTY A;  1MZU A;  1N9O A;  3UMD A;  4EEP A;  4GHI A;  1GSV A;  4R6L A;  1D06 A;  4HJ6 A;  1S1Y A;  2J80 A;  4PKY A;  3T50 A;  3H82 B;  2JHE A;  1XJ3 A;  3IS2 B;  3LIE A;  4JGR A;  1XFN A;  3KX0 X;  2W0N A;  2YKF A;  1V9Z A;  4L9E A;  5HWT A;  4GCZ A;  1T1A A;  4YWZ A;  1TS7 A;  3EEH A;  2OOL A;  4XT2 A;  2Z6C A;  1VB6 A;  2KDK A;  2R78 A;  4HY8 A;  1T1C A;  1OTE A;  3K3D A;  4EEU A;  4HJ4 A;  1P97 A;  3MQO A;  1DP8 A;  3NOP C;  3H7W A;  2VEA A;  1V9Y A;  4BBU A;  2V1B A;  4KQD A;  3E4O A;  1Y28 A;  3RH8 B;  1DP6 A;  3E4P A;  5G4Z A;  3P7N A;  4I3J A;  3MR0 A;  3LID A;  3IS2 A;  4F3L B;  3MJQ A;  4EER A;  5HWW A;  1TS0 A;  3HJI A;  4H6J A;  1OTI A;  2PDR A;  3UE6 A;  2HV1 A;  3LIB A;  4BBV A;  3FC7 A;  2W27 A;  5HDD A;  5KIZ A;  4I39 A;  2PYP A;  3VE3 A;  3PHY A;  3CWF A;  1LSW A;  1OT6 A;  5J3W A;  4WL9 A;  3UB7 A;  1S66 L;  2VLG A;  2Z6D A;  1ODV A;  3E4Q A;  3C8C A;  2INW A;  3HJK A;  4MN6 A;  2PR5 A;  5F5Y A;  3UB8 A;  4EQ1 A;  2V1A A;  4NXE A;  1X0O A;  2V0W A;  1DRM A;  4HH2 A;  3UB9 A;  3BY8 A;  4MN5 A;  4WLA A;  4JGO A;  3H7W B;  1OTA A;  4F3L A;  3NOT C;  1XJ4 A;  4HJ3 A;  3MXQ A;  2D02 A;  5HDS A;  4LRZ E;  2QHK A;  2QJ5 A;  1LT0 A;  3NOU C;  2L4R A;  3A0V A;  4NXB A;  1UWP X;  3LIC A;  4WUJ A;  2YKH A;  1TS8 A;  2EA9 A;  4H6J B;  5AVF A;  1OJG A;  1F98 A;  4R38 A; 
#chains in the Genus database with same CATH topology
 1XXM A;  4UQI M;  2GDN A;  4WMC D;  3C7V A;  1L0E A;  3ZG8 B;  5TFQ A;  5HDC A;  3LYX A;  3R7W B;  2HZ5 A;  4NET A;  4WZ5 A;  3HCY A;  4OVD A;  2CMN A;  3TRC A;  3UB6 A;  2V9A A;  5E43 A;  5FAO A;  5E2G A;  1G6O A;  4G3K A;  3W8K A;  2IWD A;  2JCH A;  5EOO A;  2WGI A;  3F1O A;  3WRZ A;  3NHQ A;  3SW1 A;  1HZO A;  3FZC A;  2JKF A;  4A5R A;  4DKI A;  1WYC A;  5GHX A;  3V67 A;  1I2W A;  4WEJ A;  1W5D A;  2FFF B;  4U0X A;  1LI0 A;  2VV6 A;  5J4E A;  4UAA A;  1PZO A;  4O7D A;  3V50 A;  4R1G A;  5IS1 A;  2BTF P;  1N9L A;  4DE1 A;  3MF0 A;  1Q2P A;  4WZ5 C;  4I38 A;  4OOY A;  3EGD C;  4PMA A;  4PPR A;  3S4X A;  3UME A;  4K0W A;  3S1Y A;  3DW0 A;  1MY8 A;  2HJE A;  2W3H A;  2J3W A;  4JGQ A;  2DMW A;  4JBF A;  1FQG A;  5DJT A;  1OTB A;  3F1N A;  2IWC A;  4E3L A;  2DRW A;  3GEC A;  2K31 A;  1PWC A;  1K56 A;  3CJM A;  1MPL A;  1S6R A;  3GSG A;  3UPO A;  2PT7 A;  2KX6 A;  3IH9 A;  2ZM2 A;  2GX5 A;  1TF1 A;  4Y2F A;  2PAV P;  3Q82 A;  3GQZ A;  3RJU A;  1KVM A;  4O0P A;  3ULF A;  5F6A A;  1PZP A;  4MBH A;  4X68 A;  3PBO A;  1LI9 A;  3C30 A;  5IU1 A;  4S2I A;  2WKH A;  4B4X A;  1FSY A;  4L9F A;  5M19 A;  2DCF A;  3GMW A;  4LRY C;  4HNB A;  1XP4 A;  5F69 A;  2PBD P;  2JKG A;  4HOI A;  4R3A A;  4KZ8 A;  1CI8 A;  4WMC A;  4EUV A;  2ZJ9 A;  3DTI A;  2WZX A;  4DE3 A;  3TE8 A;  3ZGA B;  4U0T A;  3G6O A;  1H5X A;  3CPT B;  2QWS A;  3IXB A;  4PM6 A;  1YT4 A;  1N9N A;  4EU0 A;  3VP2 A;  3W4P A;  4GDB A;  5F1G A;  5IT5 A;  1VET A;  1GSW A;  4LPZ A;  4GS9 A;  3BFD A;  1CJF A;  4ZJ1 A;  1MWS A;  4R4S A;  3SS4 A;  3I7J A;  4DN0 A;  4BD1 A;  2JBF A;  1HTZ A;  1PI5 A;  1YLJ A;  1D1J A;  3T1R A;  5HPI A;  1K55 A;  3N7W A;  1RCJ A;  5I5L A;  4OON A;  2HDS A;  3AGE A;  4KG5 A;  4C75 A;  2Q9N A;  4PAU A;  3K2N A;  1BYW A;  5KMW A;  2O9C A;  4QU3 A;  3PR6 A;  2C5W B;  2VX8 A;  4NKP A;  3Q7V B;  3VV4 A;  1H3Q A;  2ZC6 B;  3VP3 A;  1KOU A;  4WN5 A;  3TW8 A;  4HI4 A;  2ZLY A;  4S2L A;  1YSP A;  3N8R A;  1P9W A;  5CHM A;  1JTD A;  3A3D A;  4G3W A;  1OTD A;  2ACG A;  4X6T A;  3WS1 A;  5GLD A;  5EM1 A;  2BAS A;  2XD1 A;  4OKP A;  4XT2 B;  4N1X A;  1S67 L;  4S2N C;  1XJ2 A;  4DJ3 A;  2J9O A;  4ETX A;  3VP0 A;  4LV2 A;  4JXS A;  3G4P A;  3LGO A;  2B02 A;  1ERQ A;  2Y59 A;  3WS5 A;  2ZQ8 A;  1IOU A;  3Q7Z A;  3LEZ A;  3Q07 A;  3F1P A;  4GW9 A;  4PM7 A;  2ZL1 A;  5DTK A;  4OH0 A;  3UN7 A;  2V2F F;  5GLA A;  2VJW A;  4R6L A;  3ZDJ A;  2QPN A;  3O87 A;  3UDI A;  1XJ3 A;  1AWI A;  3LIE A;  3NY4 A;  1YLP A;  3KX0 X;  3MFD A;  3MS6 A;  3O5Y A;  2Z2L B;  2ZQ7 A;  4KZ4 A;  1DJC A;  2JKR I;  2B18 A;  4GKU A;  2Z6C A;  1YMX A;  4HY8 A;  2E8I A;  2R78 A;  4EEU A;  1OTE A;  3SH9 A;  1M40 A;  3MQO A;  4QJG A;  3C4P A;  3H7W A;  4MBF A;  1PIO A;  4R4R A;  2VEA A;  2WGW B;  5A91 A;  2V1B A;  3E4O A;  4ARZ B;  1IKI A;  1SDN A;  5TR7 A;  4GB7 A;  3IHA A;  4I3J A;  3MR0 A;  3LID A;  2XD5 A;  5EUA A;  5G18 A;  1W8Q A;  4DRT A;  3BQ8 A;  5M18 A;  3MJQ A;  4EER A;  4MN7 A;  1TS0 A;  1H8Y A;  5FQK A;  4H6J A;  1GHI A;  3S7N A;  3FC7 A;  2W27 A;  1K57 A;  2O99 A;  2O9B A;  2PYP A;  4IVI A;  3R7W A;  4OQ0 A;  4GZB A;  5FI7 A;  3HUM A;  4N92 A;  3JVU A;  3MXS A;  3W4O A;  4AFI A;  3OPP A;  1FIK A;  1ONG A;  4MCW A;  3HJK A;  2ZQD A;  5F5Y A;  3WS0 A;  5EOE A;  3DTE A;  3EOI A;  5TJJ A;  1IEL A;  1GA9 A;  2V0W A;  2Y2K A;  3BY8 A;  4MN5 A;  2VKS A;  4WLA A;  2WKE A;  3GR2 A;  1N4O A;  3JPU A;  3FPW A;  4S2M A;  3HRE A;  1NRJ A;  3MXQ A;  2D02 A;  2JKR M;  1NYY A;  5HDS A;  3MBZ A;  4HEF A;  3HLE A;  1FR1 A;  3A3E A;  5FEF A;  2L4R A;  4NXB A;  1UWP X;  3LR4 A;  3P01 A;  5HL1 A;  5F83 A;  2KLI A;  1K57 C;  4LV1 A;  4DXB A;  1IYQ A;  1ERM A;  4KZB A;  1K6R A;  3QP6 A;  4Z1W A;  1GHM A;  4QHC A;  4Q0J A;  1BLP A;  5CX7 A;  2XRN A;  3IX4 A;  2WKQ A;  1G6A A;  3MFX A;  3FV7 A;  1TDG A;  2P04 A;  2PD7 A;  2XFT A;  3CAX A;  2R9X A;  2A49 A;  2ZC7 A;  4E3O A;  4JF4 A;  1PI4 A;  4NEE D;  4OQI A;  2XA7 S;  3DWK A;  4RYE A;  2Y2L A;  3E98 A;  2J7V A;  2VGL S;  2ZM8 A;  4KUO A;  3KSF A;  5FAP A;  3NIA A;  1IKG A;  2GZA A;  1UGU A;  3SS5 A;  3ZVW A;  5CRF A;  3KSH A;  4DF6 A;  3ZG9 B;  2PHY A;  5HZH A;  3A3J A;  1SZV A;  2Y2M A;  4LEN A;  5CXW A;  4RQ9 A;  3V3R A;  3W4Q A;  2WUQ A;  3N8L A;  2OV5 A;  4OLG A;  4OOL A;  2D01 A;  1JWZ A;  2QKP A;  4WEL A;  3IXD A;  2ZOI A;  4HES A;  3ICY A;  2CC1 A;  2WGV A;  3GVB A;  4MLL A;  3CPT A;  3KYZ A;  4Y13 A;  3SZT A;  2WKR A;  5DTT A;  3EEA A;  4PM5 A;  4CQH A;  3S22 A;  4P87 A;  3WWX A;  5C5K A;  4GN2 A;  4PM9 A;  3A0R A;  5DJU A;  3ZCZ A;  4ZBE A;  1CK3 A;  2ZMV A;  5FQQ A;  1MKI A;  1YLZ A;  4WBG A;  1C3B A;  4ZDX A;  1MXO A;  5CED A;  2Y2Q A;  1PWD A;  2PD8 A;  2BLS A;  4EUZ A;  2J8Y A;  2PRF A;  1MWU A;  3G31 A;  4RA7 A;  4QY6 A;  3V5M A;  3LUQ A;  4N1H A;  4I3A A;  3U2A A;  1Y54 A;  4RVA A;  2P7J A;  4KQQ A;  5KSC A;  1DP9 A;  1ERO A;  3IQA A;  5FDS A;  3ZG0 A;  1P9R A;  1KVL A;  4IHQ A;  2RL3 A;  3NBL A;  1VQQ A;  3Q7V A;  1L2S A;  2MJ6 A;  5EVL A;  3GRJ A;  2G2U A;  2B5R A;  2KOI A;  4GDN A;  4DMZ A;  4FH4 A;  4E04 A;  1W63 Q;  1YLY A;  5FAQ A;  3ZG7 B;  1SCW A;  2A3U A;  1KDW A;  4EBL A;  3RXW A;  5EVI C;  4EQI A;  3KYE A;  2L1M A;  3LIA A;  1UWN X;  1DJA A;  2FZ0 A;  4Y17 A;  3KO6 A;  4LCL A;  4KG6 A;  3DAV A;  2M7U A;  2VK3 A;  2V8C A;  2ZD8 A;  1HD8 A;  4HH3 A;  5E2H A;  3S7Q A;  2EX2 A;  4P85 A;  1XA7 A;  3V39 A;  4FCF A;  4MMN A;  3LY3 A;  3RXX A;  2K2N A;  3IWO A;  1DJB A;  1JNU A;  3UDF A;  3LR0 A;  3UB5 P;  3TJZ C;  3PAG A;  1FCN A;  2QMI A;  4EET B;  2XFS A;  3T4J A;  3MZD A;  3MZF A;  4FH2 A;  5FQM A;  1AXB A;  5AJG A;  5JYO A;  4M4X A;  1KGF A;  1EW0 A;  1S4R A;  2H28 A;  2XRO A;  5CEC A;  2WGW A;  4PHT A;  5J7E A;  3UE3 A;  2PYR A;  2W3E A;  2HGV A;  4ARZ A;  2NUP C;  1LL8 A;  4S2K A;  3EWK A;  1OME A;  1FIL A;  5DKL A;  1IYO A;  1NWZ A;  1VHM A;  1YM1 A;  3PXP A;  3ZVT A;  1IYS A;  1KE0 A;  3UPN A;  3BJN A;  3UE1 A;  2IWB A;  1N9O A;  3UO9 A;  3VP4 A;  3UMD A;  5DF9 A;  2W3F A;  1SHV A;  2WK0 A;  2Y4A A;  3IHB A;  4GHI A;  4GLQ A;  4ZJ3 A;  1GSV A;  2XDM A;  3MXR A;  3D3O A;  3B3X A;  3IX8 A;  5CTM A;  1HVB A;  2WAD A;  5D3O A;  3T50 A;  3IS2 B;  1J9M A;  5FDH A;  1XFN A;  2YKF A;  4YOF A;  5MC7 A;  4MBK A;  1T1A A;  1U60 A;  2XR0 A;  4YWZ A;  5CEB A;  1GCE A;  2OOL A;  1NYM A;  4EBP A;  2NUT C;  3B42 A;  2XH9 A;  4ESP A;  1V9Y A;  4BBU A;  1SKF A;  2G2W A;  1ALQ A;  5HAP A;  3LY4 A;  1Y28 A;  5HPF A;  2VGK A;  1XGI A;  3RH8 B;  3E4P A;  4E6W A;  4YNR A;  3ITB A;  3WS2 A;  5CHJ A;  3ISG A;  3VFH A;  2HP6 A;  3WS4 A;  2XLN A;  4P6B A;  1OPX A;  1L0F A;  1I5Q A;  3HJI A;  1NXY A;  4K0X A;  1STZ A;  3LIB A;  1W63 M;  3PBR A;  1ES3 A;  3VE3 A;  4CLC B;  3HLC A;  2Y91 A;  4WM9 A;  2ZQ9 A;  3D4F A;  4II7 A;  5J3W A;  3UB7 A;  4JXV A;  4BJP A;  1G5U A;  3C8C A;  2INW A;  2XGN A;  1BZA A;  3IF6 B;  2VZW A;  4MN6 A;  1L0G A;  4JXW A;  3VSL A;  1BUE A;  2PR5 A;  3LR5 A;  3PBN A;  1E4D A;  2V1A A;  1ES5 A;  2XA7 M;  4NXE A;  2OLU A;  4O01 A;  1DRM A;  4X1M A;  2VGL M;  3UB9 A;  4FTX A;  4F3L A;  3NOT C;  3OCL A;  1K55 C;  4N9K A;  4HJ3 A;  3UNW A;  3HLB A;  3IWI A;  3L7H A;  2ZC4 B;  5AQ9 A;  2QJ5 A;  2X71 A;  1LT0 A;  1MWT A;  2PBY A;  3NOU C;  1K4F A;  3IF5 A;  1VM1 A;  2YKH A;  5DTS A;  1TS8 A;  4HBU A;  3BYD A;  4BLM A;  3P09 A;  5AVF A;  3T12 B;  1OJG A;  3C2W A;  3NI9 A;  1ESI A;  2OWJ A;  4QB8 A;  2Y2G A;  2JN7 A;  5FI6 A;  3O86 A;  4ETZ A;  1IYP A;  2W1R A;  3H9W A;  1CQA A;  1Z09 A;  5E2E A;  1JTG A;  4NXG A;  3OLO A;  4CPK A;  4P0M A;  4MNR A;  4IVK A;  1LSV A;  3FWL A;  1F2K A;  4K08 A;  4UA9 A;  3O88 A;  1S0W A;  2XSS A;  1SDE A;  1ACF A;  2VV8 A;  1ES4 A;  1T1B A;  2C6W B;  4WYY A;  2A2L A;  1HLU P;  4UHU A;  4DJ2 A;  3VE4 A;  4IBR A;  4QY5 A;  3BFE A;  5AQB A;  2RCX A;  1T18 A;  4HQA A;  1LSX A;  4M3K A;  1G28 A;  1G68 A;  4DE0 A;  2PR6 A;  1K0K A;  2UWX A;  2ZM0 A;  2FFY A;  2QYB A;  3UPP A;  5CGX A;  2EFU A;  3T4Q A;  2Z2M B;  5DKK A;  4Y0U A;  1TEM A;  3UY6 A;  2A24 B;  3BLS A;  4H8R A;  4EW7 A;  4B4Z A;  3QP8 A;  3MSH A;  1PW8 A;  5HSQ A;  3HL9 A;  4EV4 A;  3T4O A;  1P0Z A;  2PU2 A;  1MC0 A;  2L0W A;  1MWR A;  2J3T D;  3B33 A;  1Q2Q A;  1ZG6 A;  3RFB A;  5HD3 A;  2Y79 A;  4WF0 A;  5CGW A;  4IBX A;  4KQO A;  3BRM A;  1XKZ A;  2WYX A;  2ZMA A;  1L3L A;  1MBL A;  4CLC D;  2Y2I A;  2HP9 A;  3N8S A;  1XGJ A;  1XFQ A;  1VET B;  2V0U A;  5KSH A;  1YKD A;  4GS9 B;  4KZ6 A;  4Q8I A;  1ZTU A;  2V1Z A;  4B88 A;  5EV0 A;  1YQS A;  2VA0 A;  2WKP A;  4ME4 A;  2WAE A;  4OP5 A;  5L8M A;  3UDX A;  2P08 A;  5A90 A;  5K5B A;  2OWH A;  2H0T A;  3LFV A;  5HX9 A;  4C6Y A;  4JKT A;  3SH8 A;  3ZFZ A;  1RGZ A;  4HP9 A;  4OPY A;  3C38 A;  5AVE A;  3C4O A;  2GJ3 A;  2Y8H A;  3V3S A;  1BUL A;  2ZBB A;  5HD5 A;  1LL9 A;  4D60 A;  1VEU B;  4S2O A;  2ZQC A;  5HAI A;  4GD6 A;  3FKW A;  1PFL A;  1PWG A;  4R70 A;  3EQV A;  1NZU A;  5F68 A;  2HJ9 C;  5EE8 A;  3MKE A;  4EES A;  5EVE A;  3A0S A;  1H8M A;  5KZH A;  5A8B A;  2EWV A;  3UE0 A;  1K38 A;  2ZC5 B;  1CI9 A;  4DDS A;  3G2Z A;  4JF6 A;  5EFW A;  1YAX A;  4Q0H A;  4Y0O A;  3BFF A;  3F1P B;  5TBM B;  1S1Z A;  1PW1 A;  1NLZ A;  1KDS A;  2I9V A;  5FQJ A;  4LV0 A;  4BMW A;  2K7S A;  4O8G A;  5FAT A;  3BLM A;  3BEC A;  3OPL A;  2M1C A;  3G2Y A;  5A92 A;  1ZKJ A;  4KG2 A;  4OQG A;  2ZQA A;  4JGP A;  3S7P A;  1BSG A;  4HP4 A;  1WYB A;  3VMA A;  2E8J A;  1K6S A;  5FAS A;  3ZHH A;  1YSQ A;  4HHD A;  1ZC2 A;  4D2O A;  3T4L A;  3CMZ A;  4R0Q A;  5FQ9 A;  3HUN A;  3SS3 A;  3T1X A;  2Y2N A;  4QPR A;  1E3U D;  2HDU A;  5GLC A;  4WZ4 A;  1A0K A;  2UV0 E;  2X01 A;  1GA0 A;  1MZU A;  3VOY A;  3E2K A;  4EEP A;  2ZMF A;  3LEQ A;  2EFX A;  2V20 A;  2R9W A;  5F82 A;  4HJ6 A;  1S1Y A;  2J80 A;  3IT9 A;  4PKY A;  4CLC A;  3H82 B;  1W79 A;  3HVF A;  5J8X A;  5F1F A;  4L9E A;  1TD5 A;  4LV3 A;  5BOH A;  3IF6 A;  4HBT A;  1K4E A;  1TS7 A;  3JVV A;  4E3K A;  4XT2 A;  4Y0T A;  2LB9 A;  1VB6 A;  1M6K A;  1T1C A;  3K3D A;  2EWW A;  3OC2 A;  1P97 A;  1DP8 A;  3NOP C;  1WE4 A;  1ZG4 A;  2JC7 A;  5HFO A;  3T1S A;  4Y15 A;  3VSK A;  3ZNT A;  4N9L A;  1LHY A;  3DBA A;  2XF3 A;  3MMH A;  1DP6 A;  5GLB A;  2J3T C;  5HAQ A;  5G4Z A;  4GD8 A;  2WAF A;  2PU4 A;  3P7N A;  3FYZ A;  3OPH A;  1BLH A;  2P9V B;  2X02 A;  3D9Y A;  3G30 A;  3QNB A;  4KZ7 A;  1XPB A;  5HWW A;  4CLC C;  1PNE A;  1FR6 A;  1IFQ A;  2Y2P A;  5HW3 A;  1OTI A;  1YPR A;  4BQM A;  4IUK A;  4BBV A;  4KEN B;  4UA7 A;  4KZ3 A;  4I39 A;  3LCE A;  3IF6 C;  3CWF A;  1LSW A;  3NEC A;  3NC8 A;  1GHP A;  2M7V A;  1CF0 A;  2VLG A;  3SOI A;  2Z6D A;  3W2Z A;  1ODV A;  2Y2J A;  3E4Q A;  1JVJ A;  4KQR A;  3BFG A;  2EXB A;  1O7E A;  4MDZ A;  4RX3 A;  3MZE A;  3UB8 A;  3IWQ A;  1JWV A;  1X0O A;  3M6H A;  3LO7 A;  3Q81 A;  3HLW A;  3OOV A;  4HH2 A;  3JYI A;  4JGO A;  1OTA A;  1XX2 A;  3EQU A;  5TGF A;  5L10 A;  4MEZ A;  4X56 A;  1RGY A;  4S2J A;  1NY0 A;  1KGE A;  2AVX A;  4ID4 A;  2W3G A;  3ZG5 A;  1KE4 A;  5DFX A;  4WEK A;  3AGD A;  4OPZ A;  1YMS A;  4OLD A;  1NJ4 A;  1E3U A;  3ZYT A;  1RP5 A;  1TDL A;  4OP8 A;  5U47 A;  1F98 A;  4R38 A;  1EWZ A;  4HIA A;  4NK3 A;  3VP1 A;  2WKI A;  3N4I A;  4PKY G;  2O0Y A;  1FSW A;  2A24 A;  3BEB A;  3VFF A;  1XA1 A;  4JF5 A;  5CER A;  1K25 A;  3IBJ A;  5FQI A;  2W1T B;  3A3I A;  5HWV A;  5E2F A;  5HL6 A;  3E2L A;  2XEP A;  4X69 A;  4BBT A;  1YLW A;  3PYP A;  1W7F A;  1BLC A;  4X1L A;  3ITA A;  4R23 A;  1K54 A;  3R4K A;  3LI9 A;  1ES2 A;  1KGG A;  3SH7 A;  4R3J A;  2H10 A;  3LI8 A;  4E3J A;  4S2N A;  4Q0I A;  3PBT A;  5AQ7 A;  5EVI B;  1T19 A;  5IHV A;  3EGX C;  3NCK A;  3PAE A;  4BEN A;  2Q9M A;  5FI2 A;  2H0Y A;  5G4Y A;  1S4S A;  1NZO A;  2O9A A;  3LR3 A;  3OBF A;  5DF7 A;  5EPH A;  2HP5 A;  1W8Y A;  1SKO B;  4E3N A;  2OSU A;  1CEG A;  4DE2 A;  3B47 A;  4I3I A;  4BWI A;  2ZOH A;  1NLY A;  1QMF A;  4P6Z S;  2I72 A;  5JYP A;  1QME A;  3O3V A;  5L07 A;  1VEU A;  4C3Q A;  3T1Q B;  4UQI S;  3C7U A;  2QJ7 A;  2BG1 A;  1BLS A;  2G7U A;  1NRF A;  2EX6 A;  1F5M A;  4DXC A;  1K54 C;  2OAP 1;  3VOL A;  1FCO A;  3TG9 A;  3S7O A;  4ZJ2 A;  2VV7 A;  4EXO A;  4I5S A;  3F1O B;  2XQZ A;  1GSX A;  2Q0O A;  3CUE A;  3BY9 A;  3Q1F A;  3GDI A;  3L9K A;  4LLO B;  1LL5 A;  2J9P A;  1LLB A;  3NDE A;  4KUK A;  3T4K A;  1DY6 A;  4GOG A;  4EWF A;  4IJG A;  3T4S A;  2WZZ A;  3D72 A;  5DVA A;  5FSR A;  3QP1 A;  5TBM A;  4X25 A;  4FSF A;  3CIT A;  4GNU A;  4L9G A;  5L2F A;  3IX3 A;  2HDR A;  3U4L P;  2IA2 A;  2V8F A;  1H0M A;  1MKM A;  4JXG A;  4BD0 A;  1PYY A;  5CGS A;  4XXR A;  3WRT A;  1OT9 A;  3CLO A;  3T4T A;  1D7E A;  4Z9Q A;  4EBN A;  3MQQ A;  1KE3 A;  3CHW P;  3KSI A;  4R3B A;  3IBR A;  4NXF A;  5DF8 A;  4G3V A;  3G35 A;  3DWZ A;  3ZQ5 A;  3N6I A;  4FD8 A;  3CUE C;  3KSG A;  3VOZ A;  1J3W A;  3DTK A;  3BWL A;  1TS6 A;  2P74 A;  1CEF A;  3F1N B;  3QHY A;  4BL2 A;  4BL3 A;  3IH8 A;  3TOI A;  5GHY A;  5I94 A;  3BM6 A;  4PM8 A;  3H82 A;  3MKF A;  1F9I A;  5EEC A;  3K3C A;  3HLG A;  4KZ9 A;  5LBR A;  4Y3I A;  5M1A A;  4E3I A;  3PTE A;  3LIF A;  1XJ6 A;  3HUO A;  4B9O A;  4GHI B;  2H5S A;  4LGW A;  3M2J A;  3M2K A;  2DNS A;  2HPB A;  1WA9 A;  4KZA A;  5FA7 A;  2EXA A;  4IUH A;  2FH5 A;  3C5A A;  3E0Y A;  4UEY A;  1IEM A;  1OJ5 A;  4Y7P A;  3FG8 A;  3FKV A;  3HLD A;  3G34 A;  5EVI D;  2JE5 A;  4L0L A;  4LRX C;  3CI6 A;  3QP4 A;  5GL9 A;  3NJA A;  4CJN A;  2P9V A;  2B95 A;  3QNC A;  2QZ6 A;  4ZAM A;  2Y55 A;  3RTY A;  2EX9 A;  3OCN A;  4K91 A;  4ZTK A;  4DDY A;  1PRQ A;  4X55 A;  3BFC A;  1D06 A;  1JWP A;  4E3M A;  4Y5F A;  5L09 A;  2JHE A;  3FPV A;  4JGR A;  5FEG A;  5CTN A;  2W0N A;  1V9Z A;  5HWT A;  3IXH A;  3OZH A;  4GCZ A;  4YFM A;  2JKT I;  3BQA A;  1FOF A;  1ZHH B;  5AQA A;  3EEH A;  4XUZ A;  4QD4 A;  1FCM A;  2KDK A;  4KZ5 A;  4HJ4 A;  2OAQ 1;  1TVF A;  3PBQ A;  4JPM A;  3DTM A;  3HBR A;  3NDG A;  5GHZ A;  2OLV A;  4JLF A;  4KQD A;  3G32 A;  4CLC E;  2Y2O A;  4NG2 A;  3KYQ A;  3M6B A;  5CHU A;  1H8Z A;  3HLF A;  3IS2 A;  2LB5 A;  4F3L B;  3P98 A;  4XUX A;  2ZL1 B;  4YIN A;  3IXG A;  4UA6 A;  2HDQ A;  4U3T A;  2PDR A;  3UE6 A;  2HV1 A;  4FUW A;  3QP5 A;  5HDD A;  3OPR A;  5KIZ A;  1BTL A;  3PHY A;  1OT6 A;  4E6X A;  2ZC3 B;  4QWO A;  5HAR A;  4WL9 A;  1S66 L;  4ZRR A;  2W1T A;  3MQ0 A;  4S2P A;  1N9B A;  4IED A;  1I2S A;  2Y2H A;  4GJ4 A;  5FL3 A;  1YLT A;  4EQ1 A;  4OPR A;  1BT5 A;  1EI5 A;  1K56 D;  4FOF A;  4RX2 A;  1E25 A;  4X53 A;  3H7W B;  4OQH A;  3AGF A;  1O07 A;  4B93 A;  3CZD A;  3ZNY A;  2JKT M;  2VGJ A;  4F94 A;  5EVI A;  1XJ4 A;  3BW6 A;  4LFU A;  5EM0 A;  4LRZ E;  2QHK A;  1ONH A;  3GV9 A;  1Z6F A;  3A0V A;  4OPQ A;  3QP2 A;  2GNX A;  3LIC A;  2W3D A;  3A3F A;  2XK1 A;  4WUJ A;  4P6Z M;  4OOM A;  3TSG A;  3GTC A;  1SKO A;  3CG5 A;  5A93 A;  1ESU A;  3NUL A;  2EX8 A;  3PBS A;  4LCM A;  2EA9 A;  5DFY A;  4H6J B;  1L0D A;  1Y4O A;  2HF6 A; 
#chains in the Genus database with same CATH homology
 3C2W A;  4HIA A;  4UQI M;  2OWJ A;  4Z1W A;  2JN7 A;  4PKY G;  2O0Y A;  2A24 A;  5HDC A;  3LYX A;  3R7W B;  4Q0J A;  4ETZ A;  5CX7 A;  2W1R A;  3H9W A;  3HCY A;  3IBJ A;  2XRN A;  2W1T B;  2WKQ A;  2CMN A;  3MFX A;  3TRC A;  5HWV A;  3UB6 A;  5HL6 A;  2V9A A;  2P04 A;  2PD7 A;  4NXG A;  3OLO A;  4BBT A;  1G6O A;  4G3K A;  3CAX A;  3PYP A;  1LSV A;  3F1O A;  3NHQ A;  4K08 A;  3SW1 A;  2XSS A;  3R4K A;  3LI9 A;  2VV8 A;  4NEE D;  1T1B A;  3V67 A;  2A2L A;  2XA7 S;  3LI8 A;  3E98 A;  4DJ2 A;  4WEJ A;  2VGL S;  3VE4 A;  4Q0I A;  3PBT A;  1T18 A;  1T19 A;  4KUO A;  3EGX C;  4HQA A;  3KSF A;  1LSX A;  2GZA A;  1G28 A;  1UGU A;  2VV6 A;  5J4E A;  5G4Y A;  1S4S A;  2PR6 A;  2O9A A;  3LR3 A;  3OBF A;  3KSH A;  2PHY A;  2QYB A;  5HZH A;  5IS1 A;  4RQ9 A;  1N9L A;  3B47 A;  4I3I A;  3MF0 A;  4BWI A;  2ZOH A;  1NLY A;  4P6Z S;  4OOL A;  4I38 A;  3T4Q A;  3EGD C;  2D01 A;  5DKK A;  3UME A;  2QKP A;  4WEL A;  2HJE A;  2ZOI A;  3ICY A;  2A24 B;  2W3H A;  4EW7 A;  4UQI S;  2J3W A;  4JGQ A;  2QJ7 A;  3KYZ A;  2DMW A;  2WKR A;  5HSQ A;  2G7U A;  3EEA A;  3T4O A;  4CQH A;  1P0Z A;  1F5M A;  1MC0 A;  2L0W A;  5C5K A;  2OAP 1;  5DJT A;  3VOL A;  1OTB A;  2J3T D;  3S7O A;  3B33 A;  2VV7 A;  3A0R A;  5DJU A;  3RFB A;  4EXO A;  4I5S A;  2ZMV A;  3F1O B;  3F1N A;  5HD3 A;  1GSX A;  2Y79 A;  4WF0 A;  4KQO A;  3GEC A;  3CUE A;  2K31 A;  3BY9 A;  3GDI A;  4LLO B;  2PD8 A;  4CLC D;  2PT7 A;  4KUK A;  2KX6 A;  3T4K A;  2GX5 A;  1TF1 A;  1XFQ A;  4IJG A;  4Y2F A;  2V0U A;  3T4S A;  5KSH A;  1YKD A;  4GS9 B;  3LUQ A;  1ZTU A;  3D72 A;  4I3A A;  3U2A A;  5TBM A;  2VA0 A;  2P7J A;  2WKP A;  1DP9 A;  4ME4 A;  4O0P A;  3ULF A;  4FSF A;  5F6A A;  3CIT A;  5L8M A;  4L9G A;  3PBO A;  1P9R A;  2P08 A;  3C30 A;  4IHQ A;  5IU1 A;  2IA2 A;  5K5B A;  4L9F A;  2OWH A;  1MKM A;  2MJ6 A;  4LRY C;  3LFV A;  4HNB A;  5F69 A;  4HP9 A;  2KOI A;  3C38 A;  5AVE A;  4HOI A;  4R3A A;  4DMZ A;  2GJ3 A;  1OT9 A;  2Y8H A;  3CLO A;  3T4T A;  1D7E A;  4E04 A;  1W63 Q;  2ZBB A;  5HD5 A;  4EUV A;  3MQQ A;  3KSI A;  3TE8 A;  3IBR A;  3G6O A;  4NXF A;  4R70 A;  2QWS A;  3EQV A;  4G3V A;  1N9N A;  2L1M A;  3ZQ5 A;  5F68 A;  3LIA A;  1UWN X;  2HJ9 C;  4EU0 A;  3CUE C;  3KSG A;  5IT5 A;  1GSW A;  4LPZ A;  4GS9 A;  2FZ0 A;  4EES A;  3KO6 A;  3A0S A;  3BWL A;  1TS6 A;  2M7U A;  1H8M A;  3F1N B;  5A8B A;  2EWV A;  4DN0 A;  4HH3 A;  3S7Q A;  5HPI A;  5I5L A;  3H82 A;  1F9I A;  5EFW A;  1YAX A;  4MMN A;  4PAU A;  3K2N A;  1BYW A;  3K3C A;  2K2N A;  4Q0H A;  5LBR A;  3F1P B;  5TBM B;  2O9C A;  1JNU A;  4Y3I A;  1S1Z A;  3LR0 A;  3LIF A;  3PR6 A;  1XJ6 A;  4B9O A;  4GHI B;  1NLZ A;  2VX8 A;  2I9V A;  4NKP A;  3TJZ C;  3VV4 A;  4BMW A;  2K7S A;  4O8G A;  1H3Q A;  4EET B;  1KOU A;  1WA9 A;  3T4J A;  4WN5 A;  3TW8 A;  4HI4 A;  2M1C A;  4IUH A;  1YSP A;  5AJG A;  4M4X A;  2FH5 A;  3E0Y A;  1P9W A;  4UEY A;  1EW0 A;  1S4R A;  2H28 A;  2XRO A;  4JGP A;  3S7P A;  4G3W A;  4PHT A;  1OTD A;  1OJ5 A;  3FG8 A;  2BAS A;  4HP4 A;  5J7E A;  4XT2 B;  1S67 L;  1XJ2 A;  4L0L A;  4LRX C;  3UE3 A;  2PYR A;  2W3E A;  3CI6 A;  4DJ3 A;  4ETX A;  2HGV A;  4ARZ A;  1YSQ A;  4HHD A;  3NJA A;  2NUP C;  1LL8 A;  2B02 A;  3EWK A;  3T4L A;  5DKL A;  1NWZ A;  1VHM A;  4QPR A;  1IOU A;  3PXP A;  3F1P A;  4GW9 A;  3RTY A;  3BJN A;  1MZU A;  1N9O A;  3OCN A;  3UMD A;  5DF9 A;  4EEP A;  2W3F A;  2ZMF A;  4GHI A;  4GLQ A;  1GSV A;  2VJW A;  4R6L A;  3D3O A;  1D06 A;  4HJ6 A;  4Y5F A;  1S1Y A;  2J80 A;  4PKY A;  3T50 A;  4CLC A;  3H82 B;  2JHE A;  3FPV A;  1XJ3 A;  3IS2 B;  3LIE A;  4JGR A;  1XFN A;  3KX0 X;  2W0N A;  2YKF A;  1V9Z A;  4L9E A;  4YOF A;  5HWT A;  5MC7 A;  4GCZ A;  3O5Y A;  1TD5 A;  2JKT I;  1T1A A;  4YWZ A;  2JKR I;  3BQA A;  1ZHH B;  1TS7 A;  3EEH A;  3JVV A;  2B18 A;  2OOL A;  4XT2 A;  2LB9 A;  2Z6C A;  1VB6 A;  2KDK A;  2R78 A;  4HY8 A;  1T1C A;  1OTE A;  3K3D A;  2EWW A;  3OC2 A;  4EEU A;  4HJ4 A;  1P97 A;  3MQO A;  2OAQ 1;  1DP8 A;  3PBQ A;  2NUT C;  3B42 A;  3NOP C;  3H7W A;  2VEA A;  1V9Y A;  4BBU A;  2V1B A;  4KQD A;  3DBA A;  3E4O A;  1Y28 A;  4CLC E;  5HPF A;  3RH8 B;  3MMH A;  1DP6 A;  3E4P A;  4ARZ B;  3KYQ A;  2J3T C;  5G4Z A;  4YNR A;  3P7N A;  4I3J A;  3MR0 A;  3LID A;  3IS2 A;  2LB5 A;  3BQ8 A;  4F3L B;  3MJQ A;  4EER A;  5HWW A;  1OPX A;  1TS0 A;  3HJI A;  4MN7 A;  4CLC C;  1IFQ A;  1STZ A;  4H6J A;  1OTI A;  2PDR A;  3UE6 A;  2HV1 A;  3LIB A;  4IUK A;  4BBV A;  1W63 M;  3S7N A;  3FC7 A;  2W27 A;  3PBR A;  5HDD A;  5KIZ A;  4I39 A;  2O99 A;  2O9B A;  2PYP A;  3VE3 A;  4CLC B;  3PHY A;  3CWF A;  1LSW A;  1OT6 A;  3R7W A;  4II7 A;  5J3W A;  4WL9 A;  3UB7 A;  2M7V A;  1S66 L;  2VLG A;  4BJP A;  3JVU A;  2Z6D A;  2W1T A;  3MQ0 A;  1ODV A;  3E4Q A;  4ZRR A;  3C8C A;  2INW A;  3W2Z A;  4AFI A;  2VZW A;  3HJK A;  4MCW A;  4MN6 A;  4MDZ A;  4GJ4 A;  2PR5 A;  5F5Y A;  3LR5 A;  3PBN A;  5FL3 A;  3UB8 A;  4EQ1 A;  3EOI A;  2V1A A;  5TJJ A;  2XA7 M;  4NXE A;  1X0O A;  2V0W A;  4O01 A;  3OOV A;  1DRM A;  4FOF A;  2VGL M;  4HH2 A;  3UB9 A;  3BY8 A;  4MN5 A;  2VKS A;  4WLA A;  4JGO A;  3H7W B;  1OTA A;  3EQU A;  4B93 A;  3FPW A;  4F3L A;  3NOT C;  3OCL A;  2JKT M;  1NRJ A;  1XJ4 A;  4HJ3 A;  3BW6 A;  2D02 A;  3MXQ A;  2JKR M;  5HDS A;  4LRZ E;  2QHK A;  2QJ5 A;  2W3G A;  1LT0 A;  3NOU C;  5DFX A;  2L4R A;  3A0V A;  4WEK A;  4NXB A;  1UWP X;  3LR4 A;  3P01 A;  2GNX A;  3LIC A;  2W3D A;  2KLI A;  4WUJ A;  4P6Z M;  2YKH A;  4OOM A;  1TS8 A;  3ZYT A;  3PBS A;  2EA9 A;  5DFY A;  4H6J B;  5AVF A;  1OJG A;  1F98 A;  4R38 A;  2HF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...