4YWZA

Crystal structure of the extracellular receptor domain of the essential sensor kinase walk from staphylococcus aureus
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
147
structure length
147
Chain Sequence
NLEKELLDNFKKNITQYAKQLEISIEKVYDEKGSVNAQKDIQNLLSEYANMQEIGEIRFIDKDQIIIATTKQSNRSLINQKANDSSVQKALSLGQSNDHLILKDYGGGKDRVWVYNIPVKVDKKVIGNIYIESKINDVYNQLNNINQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein kinase WalK
publication title Structure and mechanism of the essential two-component signal-transduction system WalKR in Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 51
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4ywzA00
2A24A 1XJ4A 5J4EA 1GSWA 1GSXA 1KOUA 5IU1A 4HOIA 2HV1A 2PD7A 2PYRA 1OTBA 4WUJA 2B02A 4GW9A 2WKPA 4XT2B 2PR5A 2L4RA 2D01A 1OT6A 3VOLA 4L9EA 3MFXA 3B33A 3UB9A 4GHIA 3IBRA 1LT0A 2W0NA 2PHYA 3NOTC 3E4PA 3EEHA 2D02A 4HQAA 3BWLA 3ICYA 1LL8A 3PHYA 1S67L 1OTEA 5J7EA 3LI8A 3SW1A 2JN7A 4GS9B 1V9ZA 4JGPA 3MJQA 2I9VA 3H82B 1OJGA 2CMNA 5HDCA 4LLOB 3VE4A 2ZOIA 4JGQA 1S4RA 4HH2A 4I3IA 1UGUA 5HD3A 3F1NA 5AVEA 4HI4A 4PKYG 3LYXA 3FC7A 3LUQA 1N9NA 2QJ7A 4RQ9A 3IS2A 3LIAA 3LIDA 4HJ3A 2V1AA 2P7JA 4LRZE 5TBMB 4H6JA 4GCZA 2M1CA 3RTYA 2WKQA 4EEPA 2VV8A 1UWNX 4R38A 4L9FA 4WL9A 5G4ZA 4MN6A 3CLOA 4NXGA 1OJ5A 1UWPX 5HZHA 1XJ6A 3NJAA 3CAXA 1F98A 4HY8A 2QKPA 4MN5A 2L1MA 2V1BA 2K7SA 5HWVA 3H7WB 4LPZA 4R6LA 4WN5A 3LIFA 3UB6A 4DJ3A 1LSVA 1V9YA 2R78A 3C2WA 3GECA 2Z6CA 1LSWA 4XT2A 1T18A 5J3WA 4DJ2A 3LIBA 3LIEA 5EFWA 3E4QA 3F1PB 3UMEA 3VE3A 4BBTA 4WLAA 1XFNA 1DP8A 5HDDA 2PYPA 3UMDA 2YKHA 4R3AA 3GDIA 4NXFA 2BASA 4HP9A 4EXOA 1DRMA 4NXBA 1S4SA 1VB6A 3G6OA 4HJ4A 5HWTA 2PDRA 3C8CA 4HHDA 2VV7A 4HIAA 3P7NA 5DJUA 2GJ3A 4B9OA 3PYPA 5F6AA 1S1ZA 2WKRA 1ODVA 4I3JA 3H9WA 4LRXC 1T19A 4GS9A 1S1YA 5HD5A 2W27A 1T1BA 3UB8A 1XJ2A 3LICA 2JHEA 4HP4A 2YKFA 3H82A 1S66L 3UB7A 4L9GA 3ZQ5A 2OOLA 3RH8B 2OWJA 1OT9A 3D72A 2KX6A 1DP9A 2VEAA 5DKLA 5A8BA 5TBMA 4F3LB 4HJ6A 2J80A 3F1OB 4EETB 4HNBA 3EWKA 1T1AA 3BY8A 4PKYA 4R70A 2ZOHA 1N9OA 1MZUA 3A0RA 3T50A 4I39A 1DP6A 2VV6A 2QJ5A 2A24B 5AVFA 4BBUA 3A0VA 3H7WA 3NHQA 1OTIA 4LRYC 4I5SA 4YWZA 2PR6A 5F68A 3K3DA 1JNUA 5KIZA 1XFQA 2KDKA 5HWWA 2V0WA 4WF0A 2INWA 4EERA 1TS7A 4M4XA 5F69A 1BYWA 3F1PA 2V0UA 2ZBBA 2QHKA 2L0WA 4GHIB 3K3CA 4JGRA 5F5YA 2VLGA 4K08A 3OLOA 2QWSA 1G28A 1X0OA 1EW0A 4BBVA 5HSQA 3NOUC 3MR0A 3CWFA 3LI9A 3FG8A 4KUKA 1N9LA 3BY9A 1GSVA 1TS0A 3HJKA 1OTDA 3MQOA 3MQQA 4EESA 4EW7A 5DKKA 4KUOA 3UE6A 5I5LA 1Y28A 4HH3A 1D06A 1TS6A 2Z6DA 3MXQA 4EQ1A 4E04A 1F9IA 1T1CA 4I38A 3F1NB 4I3AA 5G4YA 1TS8A 1WA9A 4JGOA 3KX0X 4NXEA 1D7EA 5HDSA 3IS2B 3A0SA 2EA9A 2V9AA 1P97A 3ULFA 4H6JB 4F3LA 1XJ3A 1P0ZA 1LSXA 1OTAA 2OWHA 3NOPC 3F1OA 3E4OA 5DJTA 1NWZA 2H28A 5IS1A 3HJIA 4EEUA 2PD8A 4KQDA
chains in the Genus database with same CATH superfamily
2A24A 3Q82A 1ZKJA 2Q0OA 1ES2A 4CLCA 1KOUA 4OP8A 1PZPA 5I94A 5CTNA 1XP4A 1MWUA 5L8MA 5AQ9A 3EQUA 2QMIA 1IYOA 2X01A 4GLQA 4KZ6A 3Q81A 2XGNA 3B47A 2P04A 3A3FA 3FPVA 3UE1A 3CG5A 4MEZA 3QHYA 1HLUP 3VOLA 4L9EA 3B33A 1J9MA 1WE4A 3IQAA 4GHIA 1P9RA 4ESPA 4OQIA 3IBRA 4QWOA 3BM6A 4EU0A 3U4LP 4Y0OA 5M18A 3EEHA 1M6KA 1YLZA 3BWLA 2GNXA 5FQ9A 4S2LA 3AGDA 1SZVA 1MPLA 1J3WA 2WKHA 5IT5A 5CTMA 4ZRRA 5E43A 3SW1A 4Q8IA 3NC8A 3CI6A 4DXBA 2OLUA 4GJ4A 4DXCA 3CPTA 1PW8A 3GTCA 2I9VA 5HDCA 5HL1A 4JGQA 1WYCA 2P9VB 4FH2A 3O88A 1Z6FA 1GCEA 1XGIA 1ES4A 1MWRA 3M2JA 4HJ3A 3PBNA 5TBMB 3ZHHA 3BRMA 3RXXA 4FH4A 4EEPA 2W3EA 4LCLA 5A91A 1K6SA 5F82A 1NJ4A 3VP1A 3K2NA 4S2NC 5G4ZA 5LBRA 3KSGA 4ID4A 5CERA 4S2OA 4NXGA 3WS4A 1OJ5A 1TD5A 4ME4A 1PRQA 2Y2JA 3BYDA 5FDHA 4HESA 5L10A 3M6BA 2JBFA 1SHVA 4B88A 3V5MA 4IBRA 3DBAA 3R7WA 3SZTA 4ZJ1A 3H7WB 4OQGA 4R6LA 2RCXA 1FILA 3UB6A 1VQQA 2VGKA 3S7NA 2WGVA 3MF0A 1JWPA 4P0MA 3GECA 1KE4A 4DE2A 1G5UA 4XT2A 5EVIB 1T18A 2J3TC 1LL5A 2ZL1B 3LIBA 3LIEA 4HBUA 3S7OA 2XSSA 4PMAA 4JF5A 3F1PB 3QP4A 3HUOA 1DP8A 4P6BA 2WAEA 1FR6A 1DJAA 2PYPA 5CX7A 4EUVA 2XR0A 3O3VA 4BMWA 2BASA 2EFXA 4HP9A 4EXOA 1GA0A 5DF8A 5EE8A 4EBNA 3OC2A 4HJ4A 4WEKA 4O8GA 2PDRA 2Y59A 5FATA 3C8CA 3ISGA 4N9KA 1E3UD 2EWVA 4GOGA 4KZ4A 3P7NA 1CJFA 4K0WA 4B9OA 4EV4A 1P9WA 4GN2A 2ZLYA 5TJJA 2W3DA 3P01A 1Z09A 4JLFA 1T19A 4GS9A 3QP6A 4R23A 3UB8A 3D3OA 3IF6B 4EBPA 2YKFA 2XK1A 4PM6A 2A49A 3H82A 1S66L 4WZ4A 2ZMFA 3ZQ5A 2Y8HA 1ONHA 3HUMA 1EWZA 1Y4OA 1OT9A 1K55A 5HX9A 3PBSA 3KSIA 1RGZA 3UY6A 2EX6A 3RJUA 5EECA 2RL3A 3CITA 5A92A 4Q0IA 5FQKA 3SOIA 2J3TD 1YM1A 3BFEA 4HJ6A 1IEMA 1NRFA 5L09A 2W1TB 4HNBA 3LR3A 3BY8A 1KE3A 5A90A 2ZOHA 4DE3A 3BLSA 4DN0A 2XD5A 3PAGA 4C3QA 2QJ5A 2A24B 4CLCB 4GDBA 4ZAMA 5FEFA 1ERQA 5HARA 3BECA 3NHQA 4Q0HA 3CUEA 4X1MA 4E3JA 1K56A 2Y2GA 5DF7A 1BZAA 4JKTA 4EUZA 1JWZA 3K3DA 1XKZA 2EX9A 3ZVWA 4MBKA 2INWA 5KZHA 3NDGA 4N9LA 5JYOA 4ARZA 3ZG5A 4JXGA 2V2FF 4DE0A 2QHKA 2L0WA 4GHIB 3GV9A 4EWFA 1YLJA 5F5YA 4JXWA 2VLGA 4E3KA 2UWXA 5G18A 3UPPA 4YINA 3DWZA 4BBVA 3PBQA 4JBFA 3NOUC 4FSFA 3LI9A 4PM5A 2WKEA 3BFFA 3OPPA 2Y2HA 1OMEA 1GSVA 4KZAA 4ZTKA 1TS0A 4X25A 3BQAA 3OCLA 4Y3IA 4S2MA 3MQQA 5E2FA 4EESA 2VJWA 3CPTB 1NZOA 2Y2QA 2HPBA 3HBRA 4HH3A 1TS6A 4NK3A 3WS5A 3NCKA 4OPZA 4E04A 4MMNA 1GA9A 4I3AA 3UDIA 3KX0X 4GD8A 1C3BA 5JYPA 5E2EA 5HDSA 3W4QA 4OONA 3ZDJA 1SDNA 3IX8A 3NDEA 4OPRA 2EA9A 3ULFA 1ZG4A 1PW1A 1PWCA 1P0ZA 1CQAA 1K57A 4XUXA 1ALQA 1F2KA 3E4OA 2Q9NA 2LB5A 1CF0A 2WYXA 1XPBA 3RFBA 2VKSA 1CEGA 1LHYA 2ZQ9A 3R7WB 3BQ8A 5GHYA 4FUWA 3ZNTA 3LR4A 3RXWA 3T4LA 3GVBA 4HOIA 3QP5A 4Y15A 4Y0UA 1H0MA 2PD7A 5TFQA 5AQAA 3D9YA 3VP2A 2R9XA 4E3IA 4E6XA 2GX5A 4S2JA 3V39A 4GW9A 1E4DA 3IHBA 4XT2B 4DDYA 3O86A 4IHQA 3N4IA 2HP5A 4IUKA 3MZEA 3IXHA 4BLMA 2JCHA 4R1GA 5FI7A 4D2OA 1YLYA 5GHZA 1U60A 3NOTC 3VMAA 1FSWA 2IWCA 3HUNA 3VV4A 3FKWA 1H5XA 2D02A 4KZ8A 5K5BA 5KSHA 4HQAA 1STZA 3ZYTA 2OLVA 5FAQA 1ESUA 1OTEA 2DNSA 2C6WB 5CXWA 4IJGA 4WZ5C 2PBDP 2EX8A 4GS9B 2HP9A 3G32A 1TVFA 4G3KA 3MJQA 1FOFA 4BD1A 2J7VA 3MMHA 1VETA 3H82B 1K54C 2HDQA 1S4RA 1IELA 2JKFA 5HL6A 2FZ0A 5HD3A 5AVEA 3MXSA 3IWIA 3LUQA 1N9NA 2QJ7A 4OQHA 1S6RA 2XH9A 3HLBA 2B95A 4CPKA 2H5SA 2V1AA 2ZC3B 2LB9A 5CHMA 3N7WA 1BULA 5AQBA 2WKQA 3IF5A 5DVAA 2VV8A 1EI5A 3WS2A 3D4FA 4R38A 4YOFA 3WRZA 3OPHA 3N8LA 2W1RA 2B18A 2ZQDA 3CLOA 3A3DA 1XJ6A 3NJAA 5J8XA 5CRFA 2Y79A 3DTMA 3O87A 2FH5A 4G3WA 4B4ZA 4OPQA 2L1MA 2K7SA 4LPZA 4OOYA 4N1HA 2W3HA 4KZ5A 4LGWA 4OLDA 4R0QA 1KVLA 4KG5A 1YLWA 2HDRA 5EVLA 1W8QA 2R78A 1QMFA 3S4XA 1K4FA 1IOUA 5GHXA 4X55A 3VFHA 5KMWA 2V8CA 3PBRA 3UPNA 1YLPA 4QD4A 3UNWA 4ARZB 5HPFA 5EFWA 1MBLA 2E8IA 1HZOA 3E4QA 3VE3A 4BBTA 1KDSA 5AJGA 3N6IA 1MKMA 3UMDA 2YKHA 4R3AA 4U0XA 4ETZA 2JE5A 3KYZA 1DRMA 4NXBA 1S4SA 4R4RA 4RX2A 1VB6A 1YT4A 2M7VA 3PR6A 4HHDA 1KDWA 4UA9A 3GR2A 3LEQA 4M3KA 3T1RA 2GJ3A 5FL3A 1YLTA 5F6AA 1XXMA 4WYYA 1H3QA 1ODVA 3H9WA 1XGJA 4LRXC 1A0KA 3NY4A 1LI0A 3G34A 2W27A 1T1BA 4KQRA 2ZD8A 4P85A 4MN7A 3VFFA 3UB7A 2O9AA 2OOLA 2PT7A 3RH8B 3AGFA 2XROA 1XA1A 3G31A 3MFDA 2XD1A 1BLPA 5A8BA 3WS0A 3VP0A 2UV0E 1L3LA 2ZC5B 4O0PA 5FASA 1ES5A 4GNUA 3UB5P 2WGIA 3UO9A 4GKUA 1G6AA 2BG1A 2H10A 4I39A 1DP6A 1AXBA 1G68A 1ACFA 3V50A 3IXGA 3ITAA 3ZVTA 3T12B 2HDSA 4LV1A 3LY4A 3HL9A 1MWSA 5HPIA 3BLMA 4YWZA 1KE0A 3FV7A 2EX2A 4FCFA 4XXRA 1EROA 1YAXA 5KIZA 1GHIA 5HWWA 1FQGA 2V20A 4UHUA 1IKGA 1W5DA 4GZBA 4K0XA 4X53A 2GDNA 1TS7A 5EM1A 3UE0A 5FI2A 2V0UA 2ZBBA 3IXDA 3FWLA 5HAQA 2EFUA 3N8SA 4K08A 3GQZA 3IX3A 2AVXA 4JPMA 5CECA 2QWSA 4GB7A 5MC7A 2O9BA 2XQZA 1CK3A 1EW0A 3NECA 3MKFA 3C4OA 2OAP1 1KGGA 3MR0A 5EOEA 3CWFA 1RP5A 1PFLA 4OOLA 1N9LA 4KQQA 3KYEA 4E6WA 1IYSA 4WMCD 5TGFA 3T4QA 3EOIA 4GD6A 1E3UA 3PXPA 5CEDA 1ONGA 2G7UA 1BLHA 3LO7A 5HW3A 1YMXA 4JF6A 3UE6A 4S2NA 1VETB 2Y2PA 3EEAA 5I5LA 2CC1A 3MXQA 4LV0A 4EQ1A 4DKIA 1F9IA 2QPNA 5G4YA 3LY3A 3G30A 5IHVA 1D7EA 2PRFA 2JKTI 4PM7A 4BQMA 5EM0A 2EXAA 1P97A 1I2SA 3UPOA 4F3LA 1OTAA 2OWHA 1KGFA 5CGWA 3E2LA 3PTEA 3OCNA 5IS1A 4L0LA 4Y5FA 5FQIA 3VOYA 1ERMA 1ZG6A 5CHUA 2PD8A 1RCJA 3PBTA 1PZOA 3LEZA 2VZWA 5J4EA 4AFIA 1GSWA 3M2KA 1GSXA 2JKRM 3SH7A 1CEFA 4OQ0A 1ESIA 3L9KA 5IU1A 1W79A 3G4PA 4X1LA 2HV1A 2J9OA 3DTIA 3ZFZA 3LGOA 3UDXA 2P74A 3LFVA 1OTBA 1BSGA 4II7A 5C5KA 5CGSA 4C75A 2H0TA 3BFCA 1DY6A 2PR5A 4DDSA 2L4RA 1VEUA 2D01A 3IXBA 5FQMA 3WRTA 3EGXC 3MFXA 1PI5A 4N1XA 3UB9A 4RA7A 1LT0A 2O9CA 4H8RA 3OZHA 4UA6A 4MCWA 3IT9A 1BLCA 2Y2KA 3E4PA 3SH8A 4RX3A 5EVIC 1LL8A 3NULA 1S67L 2PU2A 3E0YA 3A3IA 2ZM0A 3LI8A 4OVDA 2JN7A 4A5RA 4JXSA 2H0YA 4JGPA 2JKRI 1FSYA 4PHTA 4PM9A 1JWVA 4MBHA 3TSGA 3BFGA 1OJGA 2O99A 3VE4A 3ZGAB 3DWKA 5DF9A 4I3IA 4KG2A 4KZ9A 3F1NA 4HI4A 4PKYG 3P09A 3T1SA 2Z2MB 1ZHHB 4PM8A 2J8YA 5CEBA 1D1JA 1BTLA 1Q2QA 3LIAA 2GZAA 3T4KA 2XLNA 2ZC7A 4GCZA 2M1CA 1ES3A 1UWNX 2MJ6A 4Z1WA 3JYIA 3TJZC 3IF6C 2EWWA 4OOMA 2W3GA 3UE3A 4MN6A 3B42A 1UWPX 1PIOA 1M40A 3LCEA 3VOZA 3HLFA 2M7UA 1H8MA 3I7JA 1CI8A 1OPXA 1Y54A 5L2FA 3CAXA 3VSLA 4HY8A 5F83A 4ZDXA 1TF1A 2PBYA 5HWVA 1PI4A 2ZMVA 2NUTC 5EVID 4BJPA 3KSFA 4PAUA 1LSVA 4CLCE 1WYBA 3Q7VA 2Q9MA 4O7DA 4LENA 2Z6CA 2XFTA 5CGXA 3BFDA 5DFYA 4DJ2A 4IBXA 4Y2FA 2XA7M 2XEPA 4CLCC 1N9BA 1YMSA 2WUQA 1YSPA 3KYQA 3UMEA 1KVMA 5HDDA 4KQOA 1S0WA 1HVBA 4NXFA 3JPUA 2HDUA 4ZJ2A 2WZZA 4BL3A 4C6YA 4Z9QA 3G6OA 3A3EA 3AGEA 2VV7A 3T1XA 2VX8A 5DJUA 1TEMA 4QPRA 4NKPA 3L7HA 3KSHA 1S1ZA 3LR5A 3P98A 4ZBEA 4I3JA 4S2IA 4P6ZS 4HEFA 1XJ2A 3LICA 2JHEA 2ZJ9A 4HP4A 2DMWA 2BTFP 3CHWP 4L9GA 2OWJA 1L0FA 1YQSA 4KZ7A 2Y2MA 1DP9A 2IA2A 3WS1A 1XA7A 4Y7PA 5DKLA 4F3LB 2ZC4B 1F5MA 1W63M 4MNRA 5AQ7A 1G6OA 3EWKA 3G35A 1O7EA 1T1AA 4CLCD 2VA0A 4PKYA 1VHMA 4R70A 2HZ5A 1SKFA 2HGVA 3A0RA 3V3SA 4GDNA 2VV6A 2JKGA 3JVUA 5FAOA 4QHCA 3IWQA 3GMWA 5KSCA 2B5RA 3QP1A 1L0DA 3A0VA 4BBUA 4WELA 1HD8A 4KENB 3UDFA 1BUEA 2O0YA 4LRYC 5FSRA 4UQIM 2PR6A 5F68A 4IVKA 1SKOA 1XFQA 3TRCA 1VEUB 1FCOA 3MXRA 4KZBA 3IH8A 4LV3A 5FDSA 1BYWA 4WZ5A 3ZCZA 3W2ZA 3K3CA 4JGRA 1NXYA 1ZTUA 3BJNA 3OLOA 1K54A 1G28A 1X0OA 4CQHA 5HSQA 1K6RA 5FAPA 3T4OA 4KUKA 4IUHA 2HJEA 2E8JA 3HJKA 5HAIA 3UN7A 4CJNA 1OTDA 2C5WB 4ZJ3A 4O01A 3G2YA 2XDMA 3FZCA 4P87A 1XX2A 4PPRA 3NBLA 1Y28A 1D06A 2Z6DA 4S2PA 4Y0TA 3NIAA 3N8RA 1T1CA 2XF3A 1AWIA 1YKDA 2OAQ1 2P08A 3F1NB 4I38A 2Y2IA 3KO6A 4F94A 1I2WA 4JGOA 1YSQA 1IYQA 3S1YA 3HREA 2ZQAA 3Q1FA 4IVIA 2QZ6A 2XA7S 1GHPA 5F1GA 1LSXA 5EV0A 3F1OA 5DJTA 3QNCA 1NWZA 1KGEA 1TDGA 4EEUA 1NLZA 2IWDA 3S7PA 3T4JA 2W3FA 5E2GA 4KG6A 3DTEA 4KQDA 1K55C 4X56A 1HTZA 4OPYA 1XJ4A 2NUPC 5GLCA 4D60A 2HP6A 2G2UA 3DW0A 2ZC6B 2V1ZA 1Q2PA 5FEGA 2PYRA 1W7FA 4UAAA 3Q7VB 4JF4A 2I72A 4WUJA 3MKEA 2B02A 2JKTM 5DTKA 4OP5A 2WKPA 3M6HA 3MQ0A 1K0KA 1BT5A 1PWGA 2Y4AA 2FFFB 1L0EA 1OT6A 2VGLS 4FD8A 3HVFA 3CUEC 3TG9A 5DFXA 2XRNA 4XUZA 2W0NA 2WAFA 2JC7A 2PHYA 4LV2A 5GLBA 4KZ3A 2KOIA 1H8YA 3LR0A 3TW8A 2PAVP 4FOFA 1W63Q 1I5QA 1IFQA 1N4OA 1IKIA 3ICYA 5FI6A 4DE1A 3PHYA 4QY5A 3MZFA 5J7EA 3FKVA 1ZC2A 3C7VA 1DJCA 2DCFA 3VP4A 5A93A 2Z2LB 5TR7A 3T1QB 2WKIA 4U0TA 1V9ZA 4UA7A 3VP3A 1O07A 2FFYA 3U2AA 1MC0A 1MWTA 1IYPA 2VGJA 3V67A 4WMCA 2CMNA 4LLOB 2ZOIA 3OOVA 3CMZA 4HH2A 3OBFA 1UGUA 4WBGA 3BEBA 2EXBA 2QYBA 3EGDC 1DJBA 3LYXA 3FC7A 5M19A 4UQIS 5BOHA 2J3WA 4RQ9A 3IS2A 2WZXA 3ZNYA 3LIDA 2ZMAA 2ZQCA 4LRZE 2P7JA 5EUAA 5GLDA 3BW6A 2OV5A 4H6JA 3RTYA 2WGWA 3IWOA 4DMZA 4L9FA 4N92A 4WL9A 2K31A 3IX4A 3CJMA 3OPLA 2V8FA 4DRTA 2WK0A 3C5AA 5HZHA 4P6ZM 3W4PA 1F98A 3C30A 3VSKA 3HLDA 4WM9A 1K56D 2QKPA 3QP2A 4MN5A 2V1BA 2HJ9C 4EQIA 2OSUA 5GL9A 3IH9A 4WN5A 2BLSA 1K25A 3LIFA 4BD0A 2Y2OA 1K57C 1W8YA 4DJ3A 4X6TA 1K4EA 1V9YA 4E3LA 2X71A 4YNRA 3QP8A 3C2WA 2Y2LA 1SKOB 3TOIA 1LSWA 5J3WA 5L07A 4FTXA 3CZDA 3E2KA 4X69A 1PNEA 4MLLA 5FQQA 5F1FA 4WLAA 1XFNA 4R4SA 1SDEA 3PBOA 2K2NA 3PAEA 3GDIA 4Y13A 1L2SA 1MXOA 3MZDA 3O5YA 4MBFA 1JTGA 1FR1A 3FPWA 2ZM8A 5HWTA 3W8KA 3SS3A 5E2HA 4UEYA 3HLEA 5U47A 4BWIA 4X68A 4HIAA 3HCYA 3PYPA 3SS4A 2WKRA 3MSHA 1YPRA 3EQVA 4DF6A 3G2ZA 3SH9A 1S1YA 4IEDA 5HD5A 2Y55A 2Y91A 3IHAA 4Y17A 3ZG0A 1JTDA 1QMEA 4EBLA 1FCNA 3SS5A 4JXVA 1FCMA 2P9VA 3WWXA 3E98A 3OPRA 5M1AA 3C4PA 4BL2A 3D72A 2KX6A 5D3OA 2IWBA 2VEAA 1L0GA 4NETA 4Q0JA 1LL9A 3QNBA 5TBMA 1VM1A 2J80A 3FYZA 3F1OB 3ZG7B 4QJGA 1CI9A 4EETB 5DTSA 1NY0A 1N9OA 4B93A 3C7UA 5HAPA 2Y2NA 1MZUA 4HBTA 2DRWA 4S2KA 3T50A 3T4SA 2PU4A 2R9WA 5HFOA 1SCWA 2HF6A 5AVFA 1LI9A 2A2LA 1PWDA 2KLIA 1K38A 4OLGA 4ETXA 1FIKA 2G2WA 3H7WA 1BLSA 3R4KA 2ZQ8A 3HLGA 4B4XA 1PYYA 4K91A 2A3UA 3HLWA 1OTIA 1NLYA 4I5SA 1NYYA 4RYEA 3W4OA 1JNUA 5GLAA 5EVIA 3GRJA 4QB8A 2KDKA 2V0WA 3MS6A 4WF0A 1H8ZA 2ZL1A 3JVVA 4EERA 1NRJA 4QY6A 4NEED 4M4XA 5F69A 1E25A 3Q7ZA 3F1PA 4OH0A 2X02A 3C38A 5EVEA 3GSGA 3DTKA 1LLBA 2WADA 2ZM2A 4NG2A 4OKPA 1MKIA 1MY8A 1NZUA 4E3NA 4RVAA 3FG8A 3A3JA 2J9PA 3BY9A 3NI9A 4LFUA 3DAVA 3ZG8B 4R3JA 3MQOA 3MBZA 2ZQ7A 3V3RA 4EW7A 3B3XA 5DKKA 3IF6A 1TDLA 1RGYA 2ACGA 5CHJA 3S22A 2VGLM 3HLCA 4KUOA 3S7QA 4R3BA 3IBJA 3T4TA 4G3VA 4BENA 1GHMA 5FA7A 2VK3A 1TS8A 1WA9A 4WEJA 5EPHA 4NXEA 5EOOA 3IS2B 3TE8A 3A0SA 2V9AA 4LCMA 4E3MA 4YFMA 4H6JB 3ZG9B 1XJ3A 2WGWB 4MDZA 3NOPC 2W1TA 3Q07A 2H28A 3HJIA 5DTTA 2XFSA 1NYMA 4U3TA 5FQJA 4E3OA 3ITBA 1JVJA 4QU3A
chains in the Genus database with same CATH topology
2A24A 3PBTA 1XJ4A 2VZWA 5J4EA 3R7WB 4AFIA 1GSWA 2NUPC 3BQ8A 1GSXA 4CLCA 1KOUA 2JKRM 3LR4A 3T4LA 5IU1A 4HOIA 5L8MA 3EQUA 2HV1A 2PD7A 2PYRA 3LFVA 1OTBA 4II7A 2GX5A 4GLQA 4WUJA 2B02A 5C5KA 2JKTM 4GW9A 2WKPA 3MQ0A 4XT2B 3B47A 2P04A 2PR5A 3FPVA 2L4RA 4IHQA 2D01A 1OT6A 3VOLA 3EGXC 2VGLS 4IUKA 4L9EA 3MFXA 3B33A 3UB9A 4GHIA 1P9RA 3CUEC 3IBRA 1LT0A 2O9CA 5DFXA 2XRNA 2W0NA 2PHYA 4EU0A 4MCWA 3NOTC 2KOIA 3VV4A 3LR0A 3E4PA 3TW8A 4FOFA 1W63Q 3EEHA 2D02A 1IFQA 5K5BA 5KSHA 4HQAA 3BWLA 1STZA 2GNXA 3ICYA 3ZYTA 1LL8A 3PHYA 1S67L 1OTEA 3E0YA 5J7EA 5IT5A 4ZRRA 3LI8A 4IJGA 3SW1A 2JN7A 4GS9B 1V9ZA 4JGPA 2JKRI 3CI6A 4PHTA 4G3KA 3MJQA 4GJ4A 3U2AA 1MC0A 3MMHA 3V67A 2I9VA 3H82B 1OJGA 2CMNA 5HDCA 2O99A 4LLOB 2ZOIA 3VE4A 4JGQA 1S4RA 3OOVA 5HL6A 2FZ0A 4HH2A 5DF9A 3OBFA 4I3IA 1UGUA 5HD3A 3F1NA 2QYBA 3EGDC 4HI4A 4PKYG 5AVEA 3LYXA 3FC7A 3LUQA 1N9NA 1ZHHB 2QJ7A 4UQIS 2J3WA 4RQ9A 3IS2A 3LIAA 2GZAA 3LIDA 3T4KA 4HJ3A 2V1AA 2P7JA 3PBNA 4LRZE 3BW6A 5TBMB 2LB9A 4H6JA 4GCZA 2M1CA 3RTYA 2WKQA 4EEPA 2W3EA 2VV8A 1UWNX 2MJ6A 4Z1WA 4DMZA 4R38A 4YOFA 3TJZC 4L9FA 3K2NA 2EWWA 2W1RA 4OOMA 2B18A 4WL9A 2K31A 3KSGA 5G4ZA 5LBRA 2W3GA 3UE3A 4MN6A 3CLOA 4NXGA 3B42A 1TD5A 1OJ5A 4ME4A 1UWPX 2M7UA 1H8MA 1XJ6A 5HZHA 1OPXA 3NJAA 4P6ZM 3CAXA 1F98A 2Y79A 4HY8A 2FH5A 3C30A 4G3WA 1TF1A 2QKPA 3DBAA 3R7WA 4MN5A 2L1MA 2V1BA 2HJ9C 2K7SA 5HWVA 3H7WB 4LPZA 4R6LA 4WN5A 2ZMVA 2NUTC 2W3HA 3LIFA 3UB6A 4BJPA 3KSFA 4PAUA 4DJ3A 3S7NA 1LSVA 4CLCE 1V9YA 3MF0A 4YNRA 2R78A 3C2WA 3GECA 2Z6CA 1LSWA 4XT2A 1IOUA 1T18A 5J3WA 2J3TC 5DFYA 4DJ2A 3LIBA 4Y2FA 3LIEA 3PBRA 3S7OA 2XA7M 4ARZB 2XSSA 5HPFA 5EFWA 4CLCC 3E4QA 1YSPA 3F1PB 3KYQA 3UMEA 4WLAA 1XFNA 3VE3A 4BBTA 1DP8A 5AJGA 1MKMA 3PBOA 2K2NA 5HDDA 5CX7A 2PYPA 3UMDA 2YKHA 4EUVA 4R3AA 3GDIA 4KQOA 4NXFA 2BASA 4BMWA 4ETZA 3O5YA 3KYZA 4HP9A 4EXOA 1DRMA 4NXBA 1S4SA 1VB6A 2M7VA 3OC2A 3G6OA 3FPWA 4HJ4A 4WEKA 3PR6A 2PDRA 4O8GA 5HWTA 3C8CA 4HHDA 4UEYA 2VV7A 4BWIA 2VX8A 2EWVA 4HIAA 3P7NA 3HCYA 5DJUA 2GJ3A 4QPRA 4NKPA 4B9OA 1P9WA 5FL3A 3PYPA 5F6AA 3KSHA 1S1ZA 3LR5A 2WKRA 2W3DA 5TJJA 1H3QA 1ODVA 3P01A 4I3JA 3H9WA 4LRXC 3EQVA 4P6ZS 1T19A 4GS9A 1S1YA 5HD5A 2W27A 1T1BA 3UB8A 3D3OA 1XJ2A 3LICA 2JHEA 4HP4A 2YKFA 4MN7A 2DMWA 3H82A 1S66L 3UB7A 2ZMFA 4L9GA 3ZQ5A 2O9AA 2OOLA 2Y8HA 2PT7A 3RH8B 3E98A 2OWJA 1OT9A 3PBSA 2XROA 3KSIA 3D72A 2KX6A 1DP9A 2IA2A 2VEAA 3CITA 4Q0JA 5DKLA 5A8BA 4Q0IA 5TBMA 4F3LB 1F5MA 2J3TD 1W63M 4HJ6A 4O0PA 2J80A 3F1OB 2W1TB 1G6OA 4EETB 4HNBA 3EWKA 3LR3A 1T1AA 4CLCD 3BY8A 2VA0A 4PKYA 1VHMA 4R70A 2ZOHA 1N9OA 4B93A 1MZUA 2HGVA 3A0RA 4DN0A 3T50A 4I39A 1DP6A 3T4SA 2VV6A 3JVUA 2QJ5A 2A24B 2HF6A 5AVFA 2A2LA 2KLIA 4CLCB 4ETXA 3A0VA 4BBUA 3H7WA 3R4KA 4WELA 3NHQA 4Q0HA 3CUEA 1OTIA 5HPIA 1NLYA 2O0YA 4I5SA 4LRYC 4YWZA 4UQIM 2PR6A 5F68A 3K3DA 1JNUA 1YAXA 5KIZA 1XFQA 2KDKA 3TRCA 5HWWA 2V0WA 4WF0A 2INWA 3JVVA 4EERA 4ARZA 1NRJA 1TS7A 4NEED 4M4XA 5F69A 1BYWA 3F1PA 2V0UA 2ZBBA 2QHKA 2L0WA 4GHIB 3C38A 3W2ZA 3K3CA 4JGRA 1ZTUA 5F5YA 3BJNA 2VLGA 4K08A 3OLOA 2QWSA 5MC7A 2O9BA 1G28A 1X0OA 1EW0A 4BBVA 4CQHA 5HSQA 2OAP1 3PBQA 3NOUC 3MR0A 4FSFA 3CWFA 3T4OA 3LI9A 3FG8A 4KUKA 4IUHA 4OOLA 2HJEA 1N9LA 3BY9A 1GSVA 3T4QA 1TS0A 3HJKA 3BQAA 3OCLA 3EOIA 4Y3IA 1OTDA 3MQOA 3PXPA 2G7UA 3MQQA 4O01A 4EESA 4EW7A 2VJWA 5DKKA 2VGLM 4KUOA 3UE6A 3EEAA 5I5LA 1Y28A 3S7QA 4HH3A 1D06A 1TS6A 3IBJA 2Z6DA 3MXQA 3T4TA 4EQ1A 4E04A 4MMNA 1F9IA 1T1CA 4G3VA 1YKDA 2OAQ1 2P08A 3F1NB 4I38A 4I3AA 5G4YA 1TS8A 1WA9A 4WEJA 3KO6A 4JGOA 3KX0X 4NXEA 1YSQA 1D7EA 5HDSA 3IS2B 3TE8A 3A0SA 2EA9A 2JKTI 2V9AA 1P97A 3ULFA 4H6JB 2XA7S 4F3LA 1XJ3A 1P0ZA 1LSXA 1OTAA 2OWHA 4MDZA 3NOPC 3F1OA 3E4OA 2W1TA 5DJTA 1NWZA 2H28A 3OCNA 2LB5A 5IS1A 3HJIA 4L0LA 4Y5FA 4EEUA 1NLZA 3S7PA 3T4JA 3RFBA 2PD8A 2W3FA 2VKSA 4KQDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A24 A;  1XJ4 A;  5J4E A;  1GSW A;  1GSX A;  1KOU A;  5IU1 A;  4HOI A;  2HV1 A;  2PD7 A;  2PYR A;  1OTB A;  4WUJ A;  2B02 A;  4GW9 A;  2WKP A;  4XT2 B;  2PR5 A;  2L4R A;  2D01 A;  1OT6 A;  3VOL A;  4L9E A;  3MFX A;  3B33 A;  3UB9 A;  4GHI A;  3IBR A;  1LT0 A;  2W0N A;  2PHY A;  3NOT C;  3E4P A;  3EEH A;  2D02 A;  4HQA A;  3BWL A;  3ICY A;  1LL8 A;  3PHY A;  1S67 L;  1OTE A;  5J7E A;  3LI8 A;  3SW1 A;  2JN7 A;  4GS9 B;  1V9Z A;  4JGP A;  3MJQ A;  2I9V A;  3H82 B;  1OJG A;  2CMN A;  5HDC A;  4LLO B;  3VE4 A;  2ZOI A;  4JGQ A;  1S4R A;  4HH2 A;  4I3I A;  1UGU A;  5HD3 A;  3F1N A;  5AVE A;  4HI4 A;  4PKY G;  3LYX A;  3FC7 A;  3LUQ A;  1N9N A;  2QJ7 A;  4RQ9 A;  3IS2 A;  3LIA A;  3LID A;  4HJ3 A;  2V1A A;  2P7J A;  4LRZ E;  5TBM B;  4H6J A;  4GCZ A;  2M1C A;  3RTY A;  2WKQ A;  4EEP A;  2VV8 A;  1UWN X;  4R38 A;  4L9F A;  4WL9 A;  5G4Z A;  4MN6 A;  3CLO A;  4NXG A;  1OJ5 A;  1UWP X;  5HZH A;  1XJ6 A;  3NJA A;  3CAX A;  1F98 A;  4HY8 A;  2QKP A;  4MN5 A;  2L1M A;  2V1B A;  2K7S A;  5HWV A;  3H7W B;  4LPZ A;  4R6L A;  4WN5 A;  3LIF A;  3UB6 A;  4DJ3 A;  1LSV A;  1V9Y A;  2R78 A;  3C2W A;  3GEC A;  2Z6C A;  1LSW A;  4XT2 A;  1T18 A;  5J3W A;  4DJ2 A;  3LIB A;  3LIE A;  5EFW A;  3E4Q A;  3F1P B;  3UME A;  3VE3 A;  4BBT A;  4WLA A;  1XFN A;  1DP8 A;  5HDD A;  2PYP A;  3UMD A;  2YKH A;  4R3A A;  3GDI A;  4NXF A;  2BAS A;  4HP9 A;  4EXO A;  1DRM A;  4NXB A;  1S4S A;  1VB6 A;  3G6O A;  4HJ4 A;  5HWT A;  2PDR A;  3C8C A;  4HHD A;  2VV7 A;  4HIA A;  3P7N A;  5DJU A;  2GJ3 A;  4B9O A;  3PYP A;  5F6A A;  1S1Z A;  2WKR A;  1ODV A;  4I3J A;  3H9W A;  4LRX C;  1T19 A;  4GS9 A;  1S1Y A;  5HD5 A;  2W27 A;  1T1B A;  3UB8 A;  1XJ2 A;  3LIC A;  2JHE A;  4HP4 A;  2YKF A;  3H82 A;  1S66 L;  3UB7 A;  4L9G A;  3ZQ5 A;  2OOL A;  3RH8 B;  2OWJ A;  1OT9 A;  3D72 A;  2KX6 A;  1DP9 A;  2VEA A;  5DKL A;  5A8B A;  5TBM A;  4F3L B;  4HJ6 A;  2J80 A;  3F1O B;  4EET B;  4HNB A;  3EWK A;  1T1A A;  3BY8 A;  4PKY A;  4R70 A;  2ZOH A;  1N9O A;  1MZU A;  3A0R A;  3T50 A;  4I39 A;  1DP6 A;  2VV6 A;  2QJ5 A;  2A24 B;  5AVF A;  4BBU A;  3A0V A;  3H7W A;  3NHQ A;  1OTI A;  4LRY C;  4I5S A;  4YWZ A;  2PR6 A;  5F68 A;  3K3D A;  1JNU A;  5KIZ A;  1XFQ A;  2KDK A;  5HWW A;  2V0W A;  4WF0 A;  2INW A;  4EER A;  1TS7 A;  4M4X A;  5F69 A;  1BYW A;  3F1P A;  2V0U A;  2ZBB A;  2QHK A;  2L0W A;  4GHI B;  3K3C A;  4JGR A;  5F5Y A;  2VLG A;  4K08 A;  3OLO A;  2QWS A;  1G28 A;  1X0O A;  1EW0 A;  4BBV A;  5HSQ A;  3NOU C;  3MR0 A;  3CWF A;  3LI9 A;  3FG8 A;  4KUK A;  1N9L A;  3BY9 A;  1GSV A;  1TS0 A;  3HJK A;  1OTD A;  3MQO A;  3MQQ A;  4EES A;  4EW7 A;  5DKK A;  4KUO A;  3UE6 A;  5I5L A;  1Y28 A;  4HH3 A;  1D06 A;  1TS6 A;  2Z6D A;  3MXQ A;  4EQ1 A;  4E04 A;  1F9I A;  1T1C A;  4I38 A;  3F1N B;  4I3A A;  5G4Y A;  1TS8 A;  1WA9 A;  4JGO A;  3KX0 X;  4NXE A;  1D7E A;  5HDS A;  3IS2 B;  3A0S A;  2EA9 A;  2V9A A;  1P97 A;  3ULF A;  4H6J B;  4F3L A;  1XJ3 A;  1P0Z A;  1LSX A;  1OTA A;  2OWH A;  3NOP C;  3F1O A;  3E4O A;  5DJT A;  1NWZ A;  2H28 A;  5IS1 A;  3HJI A;  4EEU A;  2PD8 A;  4KQD A; 
#chains in the Genus database with same CATH topology
 2A24 A;  3Q82 A;  1ZKJ A;  2Q0O A;  1ES2 A;  4CLC A;  1KOU A;  4OP8 A;  1PZP A;  5I94 A;  5CTN A;  1XP4 A;  1MWU A;  5L8M A;  5AQ9 A;  3EQU A;  2QMI A;  1IYO A;  2X01 A;  4GLQ A;  4KZ6 A;  3Q81 A;  2XGN A;  3B47 A;  2P04 A;  3A3F A;  3FPV A;  3UE1 A;  3CG5 A;  4MEZ A;  3QHY A;  1HLU P;  3VOL A;  4L9E A;  3B33 A;  1J9M A;  1WE4 A;  3IQA A;  4GHI A;  1P9R A;  4ESP A;  4OQI A;  3IBR A;  4QWO A;  3BM6 A;  4EU0 A;  3U4L P;  4Y0O A;  5M18 A;  3EEH A;  1M6K A;  1YLZ A;  3BWL A;  2GNX A;  5FQ9 A;  4S2L A;  3AGD A;  1SZV A;  1MPL A;  1J3W A;  2WKH A;  5IT5 A;  5CTM A;  4ZRR A;  5E43 A;  3SW1 A;  4Q8I A;  3NC8 A;  3CI6 A;  4DXB A;  2OLU A;  4GJ4 A;  4DXC A;  3CPT A;  1PW8 A;  3GTC A;  2I9V A;  5HDC A;  5HL1 A;  4JGQ A;  1WYC A;  2P9V B;  4FH2 A;  3O88 A;  1Z6F A;  1GCE A;  1XGI A;  1ES4 A;  1MWR A;  3M2J A;  4HJ3 A;  3PBN A;  5TBM B;  3ZHH A;  3BRM A;  3RXX A;  4FH4 A;  4EEP A;  2W3E A;  4LCL A;  5A91 A;  1K6S A;  5F82 A;  1NJ4 A;  3VP1 A;  3K2N A;  4S2N C;  5G4Z A;  5LBR A;  3KSG A;  4ID4 A;  5CER A;  4S2O A;  4NXG A;  3WS4 A;  1OJ5 A;  1TD5 A;  4ME4 A;  1PRQ A;  2Y2J A;  3BYD A;  5FDH A;  4HES A;  5L10 A;  3M6B A;  2JBF A;  1SHV A;  4B88 A;  3V5M A;  4IBR A;  3DBA A;  3R7W A;  3SZT A;  4ZJ1 A;  3H7W B;  4OQG A;  4R6L A;  2RCX A;  1FIL A;  3UB6 A;  1VQQ A;  2VGK A;  3S7N A;  2WGV A;  3MF0 A;  1JWP A;  4P0M A;  3GEC A;  1KE4 A;  4DE2 A;  1G5U A;  4XT2 A;  5EVI B;  1T18 A;  2J3T C;  1LL5 A;  2ZL1 B;  3LIB A;  3LIE A;  4HBU A;  3S7O A;  2XSS A;  4PMA A;  4JF5 A;  3F1P B;  3QP4 A;  3HUO A;  1DP8 A;  4P6B A;  2WAE A;  1FR6 A;  1DJA A;  2PYP A;  5CX7 A;  4EUV A;  2XR0 A;  3O3V A;  4BMW A;  2BAS A;  2EFX A;  4HP9 A;  4EXO A;  1GA0 A;  5DF8 A;  5EE8 A;  4EBN A;  3OC2 A;  4HJ4 A;  4WEK A;  4O8G A;  2PDR A;  2Y59 A;  5FAT A;  3C8C A;  3ISG A;  4N9K A;  1E3U D;  2EWV A;  4GOG A;  4KZ4 A;  3P7N A;  1CJF A;  4K0W A;  4B9O A;  4EV4 A;  1P9W A;  4GN2 A;  2ZLY A;  5TJJ A;  2W3D A;  3P01 A;  1Z09 A;  4JLF A;  1T19 A;  4GS9 A;  3QP6 A;  4R23 A;  3UB8 A;  3D3O A;  3IF6 B;  4EBP A;  2YKF A;  2XK1 A;  4PM6 A;  2A49 A;  3H82 A;  1S66 L;  4WZ4 A;  2ZMF A;  3ZQ5 A;  2Y8H A;  1ONH A;  3HUM A;  1EWZ A;  1Y4O A;  1OT9 A;  1K55 A;  5HX9 A;  3PBS A;  3KSI A;  1RGZ A;  3UY6 A;  2EX6 A;  3RJU A;  5EEC A;  2RL3 A;  3CIT A;  5A92 A;  4Q0I A;  5FQK A;  3SOI A;  2J3T D;  1YM1 A;  3BFE A;  4HJ6 A;  1IEM A;  1NRF A;  5L09 A;  2W1T B;  4HNB A;  3LR3 A;  3BY8 A;  1KE3 A;  5A90 A;  2ZOH A;  4DE3 A;  3BLS A;  4DN0 A;  2XD5 A;  3PAG A;  4C3Q A;  2QJ5 A;  2A24 B;  4CLC B;  4GDB A;  4ZAM A;  5FEF A;  1ERQ A;  5HAR A;  3BEC A;  3NHQ A;  4Q0H A;  3CUE A;  4X1M A;  4E3J A;  1K56 A;  2Y2G A;  5DF7 A;  1BZA A;  4JKT A;  4EUZ A;  1JWZ A;  3K3D A;  1XKZ A;  2EX9 A;  3ZVW A;  4MBK A;  2INW A;  5KZH A;  3NDG A;  4N9L A;  5JYO A;  4ARZ A;  3ZG5 A;  4JXG A;  2V2F F;  4DE0 A;  2QHK A;  2L0W A;  4GHI B;  3GV9 A;  4EWF A;  1YLJ A;  5F5Y A;  4JXW A;  2VLG A;  4E3K A;  2UWX A;  5G18 A;  3UPP A;  4YIN A;  3DWZ A;  4BBV A;  3PBQ A;  4JBF A;  3NOU C;  4FSF A;  3LI9 A;  4PM5 A;  2WKE A;  3BFF A;  3OPP A;  2Y2H A;  1OME A;  1GSV A;  4KZA A;  4ZTK A;  1TS0 A;  4X25 A;  3BQA A;  3OCL A;  4Y3I A;  4S2M A;  3MQQ A;  5E2F A;  4EES A;  2VJW A;  3CPT B;  1NZO A;  2Y2Q A;  2HPB A;  3HBR A;  4HH3 A;  1TS6 A;  4NK3 A;  3WS5 A;  3NCK A;  4OPZ A;  4E04 A;  4MMN A;  1GA9 A;  4I3A A;  3UDI A;  3KX0 X;  4GD8 A;  1C3B A;  5JYP A;  5E2E A;  5HDS A;  3W4Q A;  4OON A;  3ZDJ A;  1SDN A;  3IX8 A;  3NDE A;  4OPR A;  2EA9 A;  3ULF A;  1ZG4 A;  1PW1 A;  1PWC A;  1P0Z A;  1CQA A;  1K57 A;  4XUX A;  1ALQ A;  1F2K A;  3E4O A;  2Q9N A;  2LB5 A;  1CF0 A;  2WYX A;  1XPB A;  3RFB A;  2VKS A;  1CEG A;  1LHY A;  2ZQ9 A;  3R7W B;  3BQ8 A;  5GHY A;  4FUW A;  3ZNT A;  3LR4 A;  3RXW A;  3T4L A;  3GVB A;  4HOI A;  3QP5 A;  4Y15 A;  4Y0U A;  1H0M A;  2PD7 A;  5TFQ A;  5AQA A;  3D9Y A;  3VP2 A;  2R9X A;  4E3I A;  4E6X A;  2GX5 A;  4S2J A;  3V39 A;  4GW9 A;  1E4D A;  3IHB A;  4XT2 B;  4DDY A;  3O86 A;  4IHQ A;  3N4I A;  2HP5 A;  4IUK A;  3MZE A;  3IXH A;  4BLM A;  2JCH A;  4R1G A;  5FI7 A;  4D2O A;  1YLY A;  5GHZ A;  1U60 A;  3NOT C;  3VMA A;  1FSW A;  2IWC A;  3HUN A;  3VV4 A;  3FKW A;  1H5X A;  2D02 A;  4KZ8 A;  5K5B A;  5KSH A;  4HQA A;  1STZ A;  3ZYT A;  2OLV A;  5FAQ A;  1ESU A;  1OTE A;  2DNS A;  2C6W B;  5CXW A;  4IJG A;  4WZ5 C;  2PBD P;  2EX8 A;  4GS9 B;  2HP9 A;  3G32 A;  1TVF A;  4G3K A;  3MJQ A;  1FOF A;  4BD1 A;  2J7V A;  3MMH A;  1VET A;  3H82 B;  1K54 C;  2HDQ A;  1S4R A;  1IEL A;  2JKF A;  5HL6 A;  2FZ0 A;  5HD3 A;  5AVE A;  3MXS A;  3IWI A;  3LUQ A;  1N9N A;  2QJ7 A;  4OQH A;  1S6R A;  2XH9 A;  3HLB A;  2B95 A;  4CPK A;  2H5S A;  2V1A A;  2ZC3 B;  2LB9 A;  5CHM A;  3N7W A;  1BUL A;  5AQB A;  2WKQ A;  3IF5 A;  5DVA A;  2VV8 A;  1EI5 A;  3WS2 A;  3D4F A;  4R38 A;  4YOF A;  3WRZ A;  3OPH A;  3N8L A;  2W1R A;  2B18 A;  2ZQD A;  3CLO A;  3A3D A;  1XJ6 A;  3NJA A;  5J8X A;  5CRF A;  2Y79 A;  3DTM A;  3O87 A;  2FH5 A;  4G3W A;  4B4Z A;  4OPQ A;  2L1M A;  2K7S A;  4LPZ A;  4OOY A;  4N1H A;  2W3H A;  4KZ5 A;  4LGW A;  4OLD A;  4R0Q A;  1KVL A;  4KG5 A;  1YLW A;  2HDR A;  5EVL A;  1W8Q A;  2R78 A;  1QMF A;  3S4X A;  1K4F A;  1IOU A;  5GHX A;  4X55 A;  3VFH A;  5KMW A;  2V8C A;  3PBR A;  3UPN A;  1YLP A;  4QD4 A;  3UNW A;  4ARZ B;  5HPF A;  5EFW A;  1MBL A;  2E8I A;  1HZO A;  3E4Q A;  3VE3 A;  4BBT A;  1KDS A;  5AJG A;  3N6I A;  1MKM A;  3UMD A;  2YKH A;  4R3A A;  4U0X A;  4ETZ A;  2JE5 A;  3KYZ A;  1DRM A;  4NXB A;  1S4S A;  4R4R A;  4RX2 A;  1VB6 A;  1YT4 A;  2M7V A;  3PR6 A;  4HHD A;  1KDW A;  4UA9 A;  3GR2 A;  3LEQ A;  4M3K A;  3T1R A;  2GJ3 A;  5FL3 A;  1YLT A;  5F6A A;  1XXM A;  4WYY A;  1H3Q A;  1ODV A;  3H9W A;  1XGJ A;  4LRX C;  1A0K A;  3NY4 A;  1LI0 A;  3G34 A;  2W27 A;  1T1B A;  4KQR A;  2ZD8 A;  4P85 A;  4MN7 A;  3VFF A;  3UB7 A;  2O9A A;  2OOL A;  2PT7 A;  3RH8 B;  3AGF A;  2XRO A;  1XA1 A;  3G31 A;  3MFD A;  2XD1 A;  1BLP A;  5A8B A;  3WS0 A;  3VP0 A;  2UV0 E;  1L3L A;  2ZC5 B;  4O0P A;  5FAS A;  1ES5 A;  4GNU A;  3UB5 P;  2WGI A;  3UO9 A;  4GKU A;  1G6A A;  2BG1 A;  2H10 A;  4I39 A;  1DP6 A;  1AXB A;  1G68 A;  1ACF A;  3V50 A;  3IXG A;  3ITA A;  3ZVT A;  3T12 B;  2HDS A;  4LV1 A;  3LY4 A;  3HL9 A;  1MWS A;  5HPI A;  3BLM A;  4YWZ A;  1KE0 A;  3FV7 A;  2EX2 A;  4FCF A;  4XXR A;  1ERO A;  1YAX A;  5KIZ A;  1GHI A;  5HWW A;  1FQG A;  2V20 A;  4UHU A;  1IKG A;  1W5D A;  4GZB A;  4K0X A;  4X53 A;  2GDN A;  1TS7 A;  5EM1 A;  3UE0 A;  5FI2 A;  2V0U A;  2ZBB A;  3IXD A;  3FWL A;  5HAQ A;  2EFU A;  3N8S A;  4K08 A;  3GQZ A;  3IX3 A;  2AVX A;  4JPM A;  5CEC A;  2QWS A;  4GB7 A;  5MC7 A;  2O9B A;  2XQZ A;  1CK3 A;  1EW0 A;  3NEC A;  3MKF A;  3C4O A;  2OAP 1;  1KGG A;  3MR0 A;  5EOE A;  3CWF A;  1RP5 A;  1PFL A;  4OOL A;  1N9L A;  4KQQ A;  3KYE A;  4E6W A;  1IYS A;  4WMC D;  5TGF A;  3T4Q A;  3EOI A;  4GD6 A;  1E3U A;  3PXP A;  5CED A;  1ONG A;  2G7U A;  1BLH A;  3LO7 A;  5HW3 A;  1YMX A;  4JF6 A;  3UE6 A;  4S2N A;  1VET B;  2Y2P A;  3EEA A;  5I5L A;  2CC1 A;  3MXQ A;  4LV0 A;  4EQ1 A;  4DKI A;  1F9I A;  2QPN A;  5G4Y A;  3LY3 A;  3G30 A;  5IHV A;  1D7E A;  2PRF A;  2JKT I;  4PM7 A;  4BQM A;  5EM0 A;  2EXA A;  1P97 A;  1I2S A;  3UPO A;  4F3L A;  1OTA A;  2OWH A;  1KGF A;  5CGW A;  3E2L A;  3PTE A;  3OCN A;  5IS1 A;  4L0L A;  4Y5F A;  5FQI A;  3VOY A;  1ERM A;  1ZG6 A;  5CHU A;  2PD8 A;  1RCJ A;  3PBT A;  1PZO A;  3LEZ A;  2VZW A;  5J4E A;  4AFI A;  1GSW A;  3M2K A;  1GSX A;  2JKR M;  3SH7 A;  1CEF A;  4OQ0 A;  1ESI A;  3L9K A;  5IU1 A;  1W79 A;  3G4P A;  4X1L A;  2HV1 A;  2J9O A;  3DTI A;  3ZFZ A;  3LGO A;  3UDX A;  2P74 A;  3LFV A;  1OTB A;  1BSG A;  4II7 A;  5C5K A;  5CGS A;  4C75 A;  2H0T A;  3BFC A;  1DY6 A;  2PR5 A;  4DDS A;  2L4R A;  1VEU A;  2D01 A;  3IXB A;  5FQM A;  3WRT A;  3EGX C;  3MFX A;  1PI5 A;  4N1X A;  3UB9 A;  4RA7 A;  1LT0 A;  2O9C A;  4H8R A;  3OZH A;  4UA6 A;  4MCW A;  3IT9 A;  1BLC A;  2Y2K A;  3E4P A;  3SH8 A;  4RX3 A;  5EVI C;  1LL8 A;  3NUL A;  1S67 L;  2PU2 A;  3E0Y A;  3A3I A;  2ZM0 A;  3LI8 A;  4OVD A;  2JN7 A;  4A5R A;  4JXS A;  2H0Y A;  4JGP A;  2JKR I;  1FSY A;  4PHT A;  4PM9 A;  1JWV A;  4MBH A;  3TSG A;  3BFG A;  1OJG A;  2O99 A;  3VE4 A;  3ZGA B;  3DWK A;  5DF9 A;  4I3I A;  4KG2 A;  4KZ9 A;  3F1N A;  4HI4 A;  4PKY G;  3P09 A;  3T1S A;  2Z2M B;  1ZHH B;  4PM8 A;  2J8Y A;  5CEB A;  1D1J A;  1BTL A;  1Q2Q A;  3LIA A;  2GZA A;  3T4K A;  2XLN A;  2ZC7 A;  4GCZ A;  2M1C A;  1ES3 A;  1UWN X;  2MJ6 A;  4Z1W A;  3JYI A;  3TJZ C;  3IF6 C;  2EWW A;  4OOM A;  2W3G A;  3UE3 A;  4MN6 A;  3B42 A;  1UWP X;  1PIO A;  1M40 A;  3LCE A;  3VOZ A;  3HLF A;  2M7U A;  1H8M A;  3I7J A;  1CI8 A;  1OPX A;  1Y54 A;  5L2F A;  3CAX A;  3VSL A;  4HY8 A;  5F83 A;  4ZDX A;  1TF1 A;  2PBY A;  5HWV A;  1PI4 A;  2ZMV A;  2NUT C;  5EVI D;  4BJP A;  3KSF A;  4PAU A;  1LSV A;  4CLC E;  1WYB A;  3Q7V A;  2Q9M A;  4O7D A;  4LEN A;  2Z6C A;  2XFT A;  5CGX A;  3BFD A;  5DFY A;  4DJ2 A;  4IBX A;  4Y2F A;  2XA7 M;  2XEP A;  4CLC C;  1N9B A;  1YMS A;  2WUQ A;  1YSP A;  3KYQ A;  3UME A;  1KVM A;  5HDD A;  4KQO A;  1S0W A;  1HVB A;  4NXF A;  3JPU A;  2HDU A;  4ZJ2 A;  2WZZ A;  4BL3 A;  4C6Y A;  4Z9Q A;  3G6O A;  3A3E A;  3AGE A;  2VV7 A;  3T1X A;  2VX8 A;  5DJU A;  1TEM A;  4QPR A;  4NKP A;  3L7H A;  3KSH A;  1S1Z A;  3LR5 A;  3P98 A;  4ZBE A;  4I3J A;  4S2I A;  4P6Z S;  4HEF A;  1XJ2 A;  3LIC A;  2JHE A;  2ZJ9 A;  4HP4 A;  2DMW A;  2BTF P;  3CHW P;  4L9G A;  2OWJ A;  1L0F A;  1YQS A;  4KZ7 A;  2Y2M A;  1DP9 A;  2IA2 A;  3WS1 A;  1XA7 A;  4Y7P A;  5DKL A;  4F3L B;  2ZC4 B;  1F5M A;  1W63 M;  4MNR A;  5AQ7 A;  1G6O A;  3EWK A;  3G35 A;  1O7E A;  1T1A A;  4CLC D;  2VA0 A;  4PKY A;  1VHM A;  4R70 A;  2HZ5 A;  1SKF A;  2HGV A;  3A0R A;  3V3S A;  4GDN A;  2VV6 A;  2JKG A;  3JVU A;  5FAO A;  4QHC A;  3IWQ A;  3GMW A;  5KSC A;  2B5R A;  3QP1 A;  1L0D A;  3A0V A;  4BBU A;  4WEL A;  1HD8 A;  4KEN B;  3UDF A;  1BUE A;  2O0Y A;  4LRY C;  5FSR A;  4UQI M;  2PR6 A;  5F68 A;  4IVK A;  1SKO A;  1XFQ A;  3TRC A;  1VEU B;  1FCO A;  3MXR A;  4KZB A;  3IH8 A;  4LV3 A;  5FDS A;  1BYW A;  4WZ5 A;  3ZCZ A;  3W2Z A;  3K3C A;  4JGR A;  1NXY A;  1ZTU A;  3BJN A;  3OLO A;  1K54 A;  1G28 A;  1X0O A;  4CQH A;  5HSQ A;  1K6R A;  5FAP A;  3T4O A;  4KUK A;  4IUH A;  2HJE A;  2E8J A;  3HJK A;  5HAI A;  3UN7 A;  4CJN A;  1OTD A;  2C5W B;  4ZJ3 A;  4O01 A;  3G2Y A;  2XDM A;  3FZC A;  4P87 A;  1XX2 A;  4PPR A;  3NBL A;  1Y28 A;  1D06 A;  2Z6D A;  4S2P A;  4Y0T A;  3NIA A;  3N8R A;  1T1C A;  2XF3 A;  1AWI A;  1YKD A;  2OAQ 1;  2P08 A;  3F1N B;  4I38 A;  2Y2I A;  3KO6 A;  4F94 A;  1I2W A;  4JGO A;  1YSQ A;  1IYQ A;  3S1Y A;  3HRE A;  2ZQA A;  3Q1F A;  4IVI A;  2QZ6 A;  2XA7 S;  1GHP A;  5F1G A;  1LSX A;  5EV0 A;  3F1O A;  5DJT A;  3QNC A;  1NWZ A;  1KGE A;  1TDG A;  4EEU A;  1NLZ A;  2IWD A;  3S7P A;  3T4J A;  2W3F A;  5E2G A;  4KG6 A;  3DTE A;  4KQD A;  1K55 C;  4X56 A;  1HTZ A;  4OPY A;  1XJ4 A;  2NUP C;  5GLC A;  4D60 A;  2HP6 A;  2G2U A;  3DW0 A;  2ZC6 B;  2V1Z A;  1Q2P A;  5FEG A;  2PYR A;  1W7F A;  4UAA A;  3Q7V B;  4JF4 A;  2I72 A;  4WUJ A;  3MKE A;  2B02 A;  2JKT M;  5DTK A;  4OP5 A;  2WKP A;  3M6H A;  3MQ0 A;  1K0K A;  1BT5 A;  1PWG A;  2Y4A A;  2FFF B;  1L0E A;  1OT6 A;  2VGL S;  4FD8 A;  3HVF A;  3CUE C;  3TG9 A;  5DFX A;  2XRN A;  4XUZ A;  2W0N A;  2WAF A;  2JC7 A;  2PHY A;  4LV2 A;  5GLB A;  4KZ3 A;  2KOI A;  1H8Y A;  3LR0 A;  3TW8 A;  2PAV P;  4FOF A;  1W63 Q;  1I5Q A;  1IFQ A;  1N4O A;  1IKI A;  3ICY A;  5FI6 A;  4DE1 A;  3PHY A;  4QY5 A;  3MZF A;  5J7E A;  3FKV A;  1ZC2 A;  3C7V A;  1DJC A;  2DCF A;  3VP4 A;  5A93 A;  2Z2L B;  5TR7 A;  3T1Q B;  2WKI A;  4U0T A;  1V9Z A;  4UA7 A;  3VP3 A;  1O07 A;  2FFY A;  3U2A A;  1MC0 A;  1MWT A;  1IYP A;  2VGJ A;  3V67 A;  4WMC A;  2CMN A;  4LLO B;  2ZOI A;  3OOV A;  3CMZ A;  4HH2 A;  3OBF A;  1UGU A;  4WBG A;  3BEB A;  2EXB A;  2QYB A;  3EGD C;  1DJB A;  3LYX A;  3FC7 A;  5M19 A;  4UQI S;  5BOH A;  2J3W A;  4RQ9 A;  3IS2 A;  2WZX A;  3ZNY A;  3LID A;  2ZMA A;  2ZQC A;  4LRZ E;  2P7J A;  5EUA A;  5GLD A;  3BW6 A;  2OV5 A;  4H6J A;  3RTY A;  2WGW A;  3IWO A;  4DMZ A;  4L9F A;  4N92 A;  4WL9 A;  2K31 A;  3IX4 A;  3CJM A;  3OPL A;  2V8F A;  4DRT A;  2WK0 A;  3C5A A;  5HZH A;  4P6Z M;  3W4P A;  1F98 A;  3C30 A;  3VSK A;  3HLD A;  4WM9 A;  1K56 D;  2QKP A;  3QP2 A;  4MN5 A;  2V1B A;  2HJ9 C;  4EQI A;  2OSU A;  5GL9 A;  3IH9 A;  4WN5 A;  2BLS A;  1K25 A;  3LIF A;  4BD0 A;  2Y2O A;  1K57 C;  1W8Y A;  4DJ3 A;  4X6T A;  1K4E A;  1V9Y A;  4E3L A;  2X71 A;  4YNR A;  3QP8 A;  3C2W A;  2Y2L A;  1SKO B;  3TOI A;  1LSW A;  5J3W A;  5L07 A;  4FTX A;  3CZD A;  3E2K A;  4X69 A;  1PNE A;  4MLL A;  5FQQ A;  5F1F A;  4WLA A;  1XFN A;  4R4S A;  1SDE A;  3PBO A;  2K2N A;  3PAE A;  3GDI A;  4Y13 A;  1L2S A;  1MXO A;  3MZD A;  3O5Y A;  4MBF A;  1JTG A;  1FR1 A;  3FPW A;  2ZM8 A;  5HWT A;  3W8K A;  3SS3 A;  5E2H A;  4UEY A;  3HLE A;  5U47 A;  4BWI A;  4X68 A;  4HIA A;  3HCY A;  3PYP A;  3SS4 A;  2WKR A;  3MSH A;  1YPR A;  3EQV A;  4DF6 A;  3G2Z A;  3SH9 A;  1S1Y A;  4IED A;  5HD5 A;  2Y55 A;  2Y91 A;  3IHA A;  4Y17 A;  3ZG0 A;  1JTD A;  1QME A;  4EBL A;  1FCN A;  3SS5 A;  4JXV A;  1FCM A;  2P9V A;  3WWX A;  3E98 A;  3OPR A;  5M1A A;  3C4P A;  4BL2 A;  3D72 A;  2KX6 A;  5D3O A;  2IWB A;  2VEA A;  1L0G A;  4NET A;  4Q0J A;  1LL9 A;  3QNB A;  5TBM A;  1VM1 A;  2J80 A;  3FYZ A;  3F1O B;  3ZG7 B;  4QJG A;  1CI9 A;  4EET B;  5DTS A;  1NY0 A;  1N9O A;  4B93 A;  3C7U A;  5HAP A;  2Y2N A;  1MZU A;  4HBT A;  2DRW A;  4S2K A;  3T50 A;  3T4S A;  2PU4 A;  2R9W A;  5HFO A;  1SCW A;  2HF6 A;  5AVF A;  1LI9 A;  2A2L A;  1PWD A;  2KLI A;  1K38 A;  4OLG A;  4ETX A;  1FIK A;  2G2W A;  3H7W A;  1BLS A;  3R4K A;  2ZQ8 A;  3HLG A;  4B4X A;  1PYY A;  4K91 A;  2A3U A;  3HLW A;  1OTI A;  1NLY A;  4I5S A;  1NYY A;  4RYE A;  3W4O A;  1JNU A;  5GLA A;  5EVI A;  3GRJ A;  4QB8 A;  2KDK A;  2V0W A;  3MS6 A;  4WF0 A;  1H8Z A;  2ZL1 A;  3JVV A;  4EER A;  1NRJ A;  4QY6 A;  4NEE D;  4M4X A;  5F69 A;  1E25 A;  3Q7Z A;  3F1P A;  4OH0 A;  2X02 A;  3C38 A;  5EVE A;  3GSG A;  3DTK A;  1LLB A;  2WAD A;  2ZM2 A;  4NG2 A;  4OKP A;  1MKI A;  1MY8 A;  1NZU A;  4E3N A;  4RVA A;  3FG8 A;  3A3J A;  2J9P A;  3BY9 A;  3NI9 A;  4LFU A;  3DAV A;  3ZG8 B;  4R3J A;  3MQO A;  3MBZ A;  2ZQ7 A;  3V3R A;  4EW7 A;  3B3X A;  5DKK A;  3IF6 A;  1TDL A;  1RGY A;  2ACG A;  5CHJ A;  3S22 A;  2VGL M;  3HLC A;  4KUO A;  3S7Q A;  4R3B A;  3IBJ A;  3T4T A;  4G3V A;  4BEN A;  1GHM A;  5FA7 A;  2VK3 A;  1TS8 A;  1WA9 A;  4WEJ A;  5EPH A;  4NXE A;  5EOO A;  3IS2 B;  3TE8 A;  3A0S A;  2V9A A;  4LCM A;  4E3M A;  4YFM A;  4H6J B;  3ZG9 B;  1XJ3 A;  2WGW B;  4MDZ A;  3NOP C;  2W1T A;  3Q07 A;  2H28 A;  3HJI A;  5DTT A;  2XFS A;  1NYM A;  4U3T A;  5FQJ A;  4E3O A;  3ITB A;  1JVJ A;  4QU3 A; 
#chains in the Genus database with same CATH homology
 2A24 A;  3PBT A;  1XJ4 A;  2VZW A;  5J4E A;  3R7W B;  4AFI A;  1GSW A;  2NUP C;  3BQ8 A;  1GSX A;  4CLC A;  1KOU A;  2JKR M;  3LR4 A;  3T4L A;  5IU1 A;  4HOI A;  5L8M A;  3EQU A;  2HV1 A;  2PD7 A;  2PYR A;  3LFV A;  1OTB A;  4II7 A;  2GX5 A;  4GLQ A;  4WUJ A;  2B02 A;  5C5K A;  2JKT M;  4GW9 A;  2WKP A;  3MQ0 A;  4XT2 B;  3B47 A;  2P04 A;  2PR5 A;  3FPV A;  2L4R A;  4IHQ A;  2D01 A;  1OT6 A;  3VOL A;  3EGX C;  2VGL S;  4IUK A;  4L9E A;  3MFX A;  3B33 A;  3UB9 A;  4GHI A;  1P9R A;  3CUE C;  3IBR A;  1LT0 A;  2O9C A;  5DFX A;  2XRN A;  2W0N A;  2PHY A;  4EU0 A;  4MCW A;  3NOT C;  2KOI A;  3VV4 A;  3LR0 A;  3E4P A;  3TW8 A;  4FOF A;  1W63 Q;  3EEH A;  2D02 A;  1IFQ A;  5K5B A;  5KSH A;  4HQA A;  3BWL A;  1STZ A;  2GNX A;  3ICY A;  3ZYT A;  1LL8 A;  3PHY A;  1S67 L;  1OTE A;  3E0Y A;  5J7E A;  5IT5 A;  4ZRR A;  3LI8 A;  4IJG A;  3SW1 A;  2JN7 A;  4GS9 B;  1V9Z A;  4JGP A;  2JKR I;  3CI6 A;  4PHT A;  4G3K A;  3MJQ A;  4GJ4 A;  3U2A A;  1MC0 A;  3MMH A;  3V67 A;  2I9V A;  3H82 B;  1OJG A;  2CMN A;  5HDC A;  2O99 A;  4LLO B;  2ZOI A;  3VE4 A;  4JGQ A;  1S4R A;  3OOV A;  5HL6 A;  2FZ0 A;  4HH2 A;  5DF9 A;  3OBF A;  4I3I A;  1UGU A;  5HD3 A;  3F1N A;  2QYB A;  3EGD C;  4HI4 A;  4PKY G;  5AVE A;  3LYX A;  3FC7 A;  3LUQ A;  1N9N A;  1ZHH B;  2QJ7 A;  4UQI S;  2J3W A;  4RQ9 A;  3IS2 A;  3LIA A;  2GZA A;  3LID A;  3T4K A;  4HJ3 A;  2V1A A;  2P7J A;  3PBN A;  4LRZ E;  3BW6 A;  5TBM B;  2LB9 A;  4H6J A;  4GCZ A;  2M1C A;  3RTY A;  2WKQ A;  4EEP A;  2W3E A;  2VV8 A;  1UWN X;  2MJ6 A;  4Z1W A;  4DMZ A;  4R38 A;  4YOF A;  3TJZ C;  4L9F A;  3K2N A;  2EWW A;  2W1R A;  4OOM A;  2B18 A;  4WL9 A;  2K31 A;  3KSG A;  5G4Z A;  5LBR A;  2W3G A;  3UE3 A;  4MN6 A;  3CLO A;  4NXG A;  3B42 A;  1TD5 A;  1OJ5 A;  4ME4 A;  1UWP X;  2M7U A;  1H8M A;  1XJ6 A;  5HZH A;  1OPX A;  3NJA A;  4P6Z M;  3CAX A;  1F98 A;  2Y79 A;  4HY8 A;  2FH5 A;  3C30 A;  4G3W A;  1TF1 A;  2QKP A;  3DBA A;  3R7W A;  4MN5 A;  2L1M A;  2V1B A;  2HJ9 C;  2K7S A;  5HWV A;  3H7W B;  4LPZ A;  4R6L A;  4WN5 A;  2ZMV A;  2NUT C;  2W3H A;  3LIF A;  3UB6 A;  4BJP A;  3KSF A;  4PAU A;  4DJ3 A;  3S7N A;  1LSV A;  4CLC E;  1V9Y A;  3MF0 A;  4YNR A;  2R78 A;  3C2W A;  3GEC A;  2Z6C A;  1LSW A;  4XT2 A;  1IOU A;  1T18 A;  5J3W A;  2J3T C;  5DFY A;  4DJ2 A;  3LIB A;  4Y2F A;  3LIE A;  3PBR A;  3S7O A;  2XA7 M;  4ARZ B;  2XSS A;  5HPF A;  5EFW A;  4CLC C;  3E4Q A;  1YSP A;  3F1P B;  3KYQ A;  3UME A;  4WLA A;  1XFN A;  3VE3 A;  4BBT A;  1DP8 A;  5AJG A;  1MKM A;  3PBO A;  2K2N A;  5HDD A;  5CX7 A;  2PYP A;  3UMD A;  2YKH A;  4EUV A;  4R3A A;  3GDI A;  4KQO A;  4NXF A;  2BAS A;  4BMW A;  4ETZ A;  3O5Y A;  3KYZ A;  4HP9 A;  4EXO A;  1DRM A;  4NXB A;  1S4S A;  1VB6 A;  2M7V A;  3OC2 A;  3G6O A;  3FPW A;  4HJ4 A;  4WEK A;  3PR6 A;  2PDR A;  4O8G A;  5HWT A;  3C8C A;  4HHD A;  4UEY A;  2VV7 A;  4BWI A;  2VX8 A;  2EWV A;  4HIA A;  3P7N A;  3HCY A;  5DJU A;  2GJ3 A;  4QPR A;  4NKP A;  4B9O A;  1P9W A;  5FL3 A;  3PYP A;  5F6A A;  3KSH A;  1S1Z A;  3LR5 A;  2WKR A;  2W3D A;  5TJJ A;  1H3Q A;  1ODV A;  3P01 A;  4I3J A;  3H9W A;  4LRX C;  3EQV A;  4P6Z S;  1T19 A;  4GS9 A;  1S1Y A;  5HD5 A;  2W27 A;  1T1B A;  3UB8 A;  3D3O A;  1XJ2 A;  3LIC A;  2JHE A;  4HP4 A;  2YKF A;  4MN7 A;  2DMW A;  3H82 A;  1S66 L;  3UB7 A;  2ZMF A;  4L9G A;  3ZQ5 A;  2O9A A;  2OOL A;  2Y8H A;  2PT7 A;  3RH8 B;  3E98 A;  2OWJ A;  1OT9 A;  3PBS A;  2XRO A;  3KSI A;  3D72 A;  2KX6 A;  1DP9 A;  2IA2 A;  2VEA A;  3CIT A;  4Q0J A;  5DKL A;  5A8B A;  4Q0I A;  5TBM A;  4F3L B;  1F5M A;  2J3T D;  1W63 M;  4HJ6 A;  4O0P A;  2J80 A;  3F1O B;  2W1T B;  1G6O A;  4EET B;  4HNB A;  3EWK A;  3LR3 A;  1T1A A;  4CLC D;  3BY8 A;  2VA0 A;  4PKY A;  1VHM A;  4R70 A;  2ZOH A;  1N9O A;  4B93 A;  1MZU A;  2HGV A;  3A0R A;  4DN0 A;  3T50 A;  4I39 A;  1DP6 A;  3T4S A;  2VV6 A;  3JVU A;  2QJ5 A;  2A24 B;  2HF6 A;  5AVF A;  2A2L A;  2KLI A;  4CLC B;  4ETX A;  3A0V A;  4BBU A;  3H7W A;  3R4K A;  4WEL A;  3NHQ A;  4Q0H A;  3CUE A;  1OTI A;  5HPI A;  1NLY A;  2O0Y A;  4I5S A;  4LRY C;  4YWZ A;  4UQI M;  2PR6 A;  5F68 A;  3K3D A;  1JNU A;  1YAX A;  5KIZ A;  1XFQ A;  2KDK A;  3TRC A;  5HWW A;  2V0W A;  4WF0 A;  2INW A;  3JVV A;  4EER A;  4ARZ A;  1NRJ A;  1TS7 A;  4NEE D;  4M4X A;  5F69 A;  1BYW A;  3F1P A;  2V0U A;  2ZBB A;  2QHK A;  2L0W A;  4GHI B;  3C38 A;  3W2Z A;  3K3C A;  4JGR A;  1ZTU A;  5F5Y A;  3BJN A;  2VLG A;  4K08 A;  3OLO A;  2QWS A;  5MC7 A;  2O9B A;  1G28 A;  1X0O A;  1EW0 A;  4BBV A;  4CQH A;  5HSQ A;  2OAP 1;  3PBQ A;  3NOU C;  3MR0 A;  4FSF A;  3CWF A;  3T4O A;  3LI9 A;  3FG8 A;  4KUK A;  4IUH A;  4OOL A;  2HJE A;  1N9L A;  3BY9 A;  1GSV A;  3T4Q A;  1TS0 A;  3HJK A;  3BQA A;  3OCL A;  3EOI A;  4Y3I A;  1OTD A;  3MQO A;  3PXP A;  2G7U A;  3MQQ A;  4O01 A;  4EES A;  4EW7 A;  2VJW A;  5DKK A;  2VGL M;  4KUO A;  3UE6 A;  3EEA A;  5I5L A;  1Y28 A;  3S7Q A;  4HH3 A;  1D06 A;  1TS6 A;  3IBJ A;  2Z6D A;  3MXQ A;  3T4T A;  4EQ1 A;  4E04 A;  4MMN A;  1F9I A;  1T1C A;  4G3V A;  1YKD A;  2OAQ 1;  2P08 A;  3F1N B;  4I38 A;  4I3A A;  5G4Y A;  1TS8 A;  1WA9 A;  4WEJ A;  3KO6 A;  4JGO A;  3KX0 X;  4NXE A;  1YSQ A;  1D7E A;  5HDS A;  3IS2 B;  3TE8 A;  3A0S A;  2EA9 A;  2JKT I;  2V9A A;  1P97 A;  3ULF A;  4H6J B;  2XA7 S;  4F3L A;  1XJ3 A;  1P0Z A;  1LSX A;  1OTA A;  2OWH A;  4MDZ A;  3NOP C;  3F1O A;  3E4O A;  2W1T A;  5DJT A;  1NWZ A;  2H28 A;  3OCN A;  2LB5 A;  5IS1 A;  3HJI A;  4L0L A;  4Y5F A;  4EEU A;  1NLZ A;  3S7P A;  3T4J A;  3RFB A;  2PD8 A;  2W3F A;  2VKS A;  4KQD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...