3W2ZA

Crystal structure of the cyanobacterial protein
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
178
structure length
178
Chain Sequence
SGLVPRGSHMAVSKVMEKILRVSNIDKIFQTTTQEIRQLLKCDRVAVYRFNPDWSGEFVAESVGSGWVKLVGPDIKTVWEDTHLQETQGGRYRHQESFVVNDIYEAGHFSCHLEILEQFEIKAYIIVPVFAAEKLWGLLAAYQNSGTREWVEWESSFLTQVGLQFGIAISHAEYLEQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyl-accepting chemotaxis protein
publication title Structures of cyanobacteriochromes from phototaxis regulators AnPixJ and TePixJ reveal general and specific photoconversion mechanism
pubmed doi rcsb
source organism Nostoc
molecule tags Signaling protein
total genus 60
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3w2zA00
2O99A 2VZWA 3IBJA 3W2ZA 4E04A 2VJWA 4MDZA 2Y8HA 3LFVA 3KSHA 3D3OA 5LBRA 4ETXA 3NOPC 3S7PA 1MKMA 3S7OA 2VEAA 4LRZE 2W3HA 4CQHA 2K31A 2QYBA 1YSQA 2W1RA 2O9BA 2XSSA 4ETZA 3OBFA 3NOTC 3S7NA 3CI6A 3R4KA 4IJGA 4DMZA 5C5KA 4IUKA 3G6OA 2KOIA 5HL6A 4MN7A 3S7QA 2ZMFA 1TD5A 4MCWA 3KSFA 3NOUC 4IUHA 4RQ9A 4BWIA 2O9CA 3E0YA 3E98A 1F5MA 3MMHA 4ME4A 4EUVA 3RFBA 2GX5A 2W1TA 4GW9A 4Y3IA 4G3WA 5L8MA 4MMNA 2HGVA 2XROA 1ZTUA 5AJGA 3OOVA 2KLIA 5HSQA 4QPRA 4Z1WA 2M7UA 3TRCA 2OOLA 4O01A 3KSGA 2W3EA 4G3KA 4Y2FA 5HPIA 3MF0A 3CITA 5DFYA 3EEAA 4FOFA 2B18A 1VHMA 4YOFA 5DFXA 3O5YA 4LRYC 3BJNA 4R70A 4DN0A 1YSPA 4R6LA 4G3VA 2W3GA 4Y5FA 3NHQA 1YKDA 2VKSA 2LB5A 3KSIA 3DBAA 3HCYA 4Q0JA 2W1TB 4ZRRA 5K5BA 4YNRA 2XRNA 3K2NA 1TF1A 2G7UA 3VV4A 3IBRA 3ZQ5A 2K2NA 4O8GA 5TJJA 1MC0A 3KO6A 4O0PA 4Q0IA 4PAUA 5I5LA 2M7VA 2W3FA 2W3DA 4LRXC 2O0YA 5HPFA 4GLQA 4EU0A 2Y79A 3C2WA 2IA2A 3MQ0A 1STZA 2LB9A 2O9AA 4Q0HA
chains in the Genus database with same CATH superfamily
1H8YA 3F1OA 1LSXA 3EQUA 1SHVA 5LBRA 4YWZA 3A3IA 3OC2A 3G31A 2QWSA 4C3QA 1O7EA 1LI9A 3S7OA 3T4LA 2K7SA 5GLDA 2K31A 2Z6DA 2QYBA 2BLSA 2OV5A 3IF5A 3WS1A 3GQZA 3WS0A 2VGJA 1CF0A 5HL1A 4ZAMA 4L9GA 5KIZA 2R9XA 2UWXA 3ISGA 4E3IA 4DJ2A 4Q8IA 2X71A 1PRQA 3H82B 3ZVTA 1VB6A 4G3WA 1OTDA 1K56A 3JVUA 4HH3A 1ERQA 3OOVA 3WRZA 2ZL1A 5HSQA 4OQGA 3BFEA 4KQOA 2PYRA 1MZUA 3HLBA 4JGQA 3TOIA 2ZQAA 5E2GA 2PT7A 3QP5A 4ZDXA 3OCLA 4LPZA 4H6JB 3MFDA 1YSPA 1F2KA 3WRTA 4GB7A 1YKDA 1G68A 4A5RA 1MWUA 2VA0A 4HIAA 2D02A 3UE0A 3ZG0A 2Y59A 5FQ9A 3UE1A 5AQBA 3T4JA 1OJ5A 2WKRA 4NETA 4NK3A 3R7WB 3V3RA 3CWFA 1K25A 1XX2A 3F1NA 4KUKA 2HF6A 3CJMA 1EROA 5HARA 1YLPA 2XFSA 4KZ9A 1NXYA 2XLNA 2Y8HA 3Q07A 3KSHA 1FSYA 3ZVWA 2XA7M 4RYEA 1BT5A 2CMNA 4JXWA 1TS6A 4JF4A 2O9BA 2OLVA 1MWTA 2PD8A 4DMZA 2HDSA 2H0YA 3OPPA 1XA1A 3HLEA 5GLBA 2XGNA 3CG5A 2WGVA 2HZ5A 5HFOA 1ES4A 2EX9A 4O7DA 5HD3A 3A3FA 4BWIA 4DE2A 1IYQA 1FCMA 4HI4A 4DRTA 3OPHA 3H7WA 3ZYTA 4ZJ2A 2W0NA 5HAIA 4NKPA 1FQGA 3IX4A 4KG6A 3FV7A 1NY0A 1KDSA 4GN2A 3SS4A 2MJ6A 2PDRA 2W3EA 3UMEA 3PBSA 5EVEA 2I72A 1I5QA 3MSHA 3TW8A 4N1HA 1KVMA 3PBNA 4GS9A 5HWTA 4N1XA 1BTLA 3KSIA 4Y17A 1P0ZA 3PAEA 3VV4A 2RL3A 3KO6A 2PU2A 3GVBA 4D2OA 3ITBA 5FL3A 2HPBA 4CPKA 2O0YA 1FOFA 3OCNA 3VP3A 3O88A 3VFHA 1SKOB 4Q0HA 2VZWA 3A0SA 4KZ8A 2Z2LB 3NIAA 3DTEA 4S2LA 3VE3A 1E3UD 5KSHA 1ZC2A 3V3SA 3P01A 4HNBA 3LI9A 4KENB 3QP2A 5J3WA 5C5KA 4HHDA 4R4RA 1LHYA 2KOIA 2E8JA 3WS5A 4KQRA 1SCWA 1L0DA 4GCZA 4GKUA 2ZOIA 3MBZA 1E4DA 2HJEA 1YLZA 1L0GA 2HDUA 3C7VA 4GW9A 4UQIM 4Y3IA 2NUPC 2V8FA 2C5WB 4HOIA 2KLIA 2XA7S 3F1PA 5EUAA 2XH9A 3B47A 4IBRA 5CTMA 5HPIA 2ZOHA 2JKFA 4U0XA 4PKYG 1F98A 1KGFA 4R3BA 4ESPA 4OOYA 4BBTA 1NJ4A 5G18A 1S67L 1KGGA 2WKPA 5MC7A 3RXXA 3ZHHA 1H5XA 3IHAA 2J80A 2VKSA 1TDLA 1ERMA 2JKTI 3JYIA 4BMWA 3NDEA 1L0EA 4O8GA 3UB5P 1GSXA 2GNXA 5G4ZA 1UWNX 3NECA 3MFXA 4LCMA 1L2SA 4RA7A 4EBPA 2Y2HA 1S4SA 3IHBA 2O9AA 4I39A 1G6AA 1T18A 3P7NA 4ETXA 3U2AA 4X56A 4BD0A 4WYYA 4WEJA 4HY8A 1CEFA 3UE3A 4P6ZM 1G5UA 3LR0A 1KDWA 3N8LA 1DRMA 3MQQA 4IEDA 3R4KA 2ZMAA 3PR6A 5EOOA 3CLOA 4EEPA 1YAXA 4X55A 1KE0A 3GTCA 3HLDA 4OOMA 3LR3A 3PBOA 1W5DA 4P0MA 2P04A 5EPHA 4PPRA 2VK3A 3CHWP 4S2KA 4EETB 1N9OA 4LV3A 3DTKA 1K0KA 3S4XA 4JKTA 4PM7A 1UWPX 3NI9A 2ZQ8A 2ACGA 3ZG7B 1J3WA 4K0WA 5IU1A 1OMEA 5FA7A 1MWSA 3RTYA 3B42A 1K54A 4Y2FA 2EWVA 2B95A 3HUMA 5TBMB 4GNUA 3C4OA 1BUEA 4DE3A 4DE0A 5I94A 2V1ZA 1IFQA 5DJUA 2R9WA 1JTDA 1ZG4A 2YKHA 5K5BA 3BRMA 3K2NA 5TFQA 3LIEA 2Y2KA 3NBLA 1D7EA 4CLCA 3D4FA 2M7VA 3ZNYA 2W3DA 3KYQA 4U3TA 5CX7A 4EU0A 3T12B 5CRFA 3MQ0A 1ACFA 1PI4A 5AQ7A 4E04A 3W2ZA 3VOYA 4MBKA 4BLMA 4EWFA 1PFLA 4I38A 2BG1A 5EM0A 4IHQA 3IS2B 1TDGA 3Q7VB 1MKMA 3BLSA 3HBRA 1GSWA 4L9FA 4KZ4A 3QHYA 5F6AA 4X25A 4OKPA 4X69A 2P74A 4EV4A 3Q1FA 4OVDA 3H9WA 2OSUA 3T4OA 4LFUA 1ES5A 4RQ9A 5U47A 4QHCA 4JGRA 1W8YA 1PI5A 1HZOA 2O9CA 3E0YA 5DVAA 2EX6A 5CERA 2P7JA 1NRFA 2OWHA 2V1BA 3E4OA 3LR5A 3ZDJA 4NXEA 5DF7A 1CI8A 5CEBA 2BASA 1JWPA 3FKWA 4P6ZS 2GZAA 1H3QA 2WAFA 4IBXA 1MKIA 4XUZA 4I3JA 3AGDA 4UEYA 1XPBA 3GRJA 4GHIB 3IBRA 1P9WA 3W4PA 1IKGA 5I5LA 1VQQA 4LRXC 5EECA 4WZ5A 3GV9A 4ZBEA 4E6WA 4B4ZA 3RXWA 5CHUA 4XUXA 1XJ4A 2J9OA 2O99A 2VJWA 4MDZA 3UDXA 5FI2A 3NULA 2JE5A 4WZ4A 1FIKA 2OAQ1 2WKIA 2XK1A 3KYEA 3G30A 4CQHA 4UA9A 4E3OA 3MJQA 4ETZA 1M6KA 2WAEA 2X02A 3BECA 4ARZB 5JYPA 3V5MA 4FH2A 4UA6A 4GJ4A 1P9RA 4N9KA 4GOGA 3ICYA 3EWKA 4KZ6A 4FSFA 4MN7A 4S2NC 2P9VB 4X1LA 3WS4A 1TD5A 1JWVA 1Y4OA 4YFMA 3A3DA 3RJUA 5KMWA 5L07A 2PD7A 4XT2A 2R78A 1K6RA 1ZHHB 3LIAA 1Z09A 1EW0A 1N9LA 3EGDC 4OPQA 4PKYA 1N9BA 3SH7A 5G4YA 1K55A 2Z6CA 4LENA 3B3XA 4EXOA 1CI9A 3TRCA 1CQAA 3CMZA 2Y2IA 3JVVA 1UGUA 3O86A 1WE4A 1SDEA 3G35A 3PBQA 2Y2PA 5F1GA 4XXRA 1MY8A 3N7WA 4E3MA 1OTIA 1ES3A 5EFWA 2W3GA 1BLSA 2PRFA 3CPTB 4MBFA 3LI8A 2XRNA 1GHMA 4QY6A 1OJGA 2KX6A 4NG2A 2DMWA 1I2WA 2IWDA 2XFTA 1YT4A 1Q2PA 2V9AA 1KGEA 3UPPA 4OH0A 3OLOA 3BY8A 2WKHA 1T1CA 3NCKA 2OWJA 1IELA 4L9EA 2QJ5A 5J7EA 4K0XA 1V9YA 1FILA 3FWLA 5HWWA 2H28A 4JF6A 4Z9QA 2X01A 4HJ4A 4HEFA 3HJIA 2J3TC 3OZHA 5E43A 4AFIA 1K4EA 4IJGA 1BYWA 4IUKA 3T1XA 3S7QA 2QJ7A 1RGZA 2ZMFA 3R7WA 3MR0A 3MXQA 5GHXA 5FQJA 3BW6A 2VV8A 1K6SA 1F5MA 1WYCA 1S1ZA 5TGFA 4N92A 1J9MA 2GX5A 1LL5A 3IXHA 3FG8A 2M1CA 1PIOA 1ZTUA 4QD4A 1K38A 2EX2A 4YINA 5FDSA 1PWDA 1G28A 3C30A 5EV0A 2L4RA 3C8CA 3LY3A 4WUJA 4NEED 2A24B 1VHMA 3UDIA 4DN0A 3LUQA 1RCJA 1OT6A 4G3VA 3OPLA 4JGPA 4B88A 3H7WB 4ZRRA 5EE8A 4BL2A 2XD1A 2Y55A 2ZC6B 3ZCZA 2G2UA 2K2NA 2WKQA 4LV0A 5TJJA 3UN7A 5M19A 1HTZA 1LL8A 2PBDP 4GD8A 2VGLM 1DP9A 3UO9A 4N9LA 2IA2A 3KYZA 1KE4A 3BFCA 2ZJ9A 1G6OA 3IWOA 1LI0A 4HJ6A 4ZJ3A 4UAAA 5A91A 3MQOA 2PYPA 4FCFA 3S7PA 4LRZE 2W3HA 5AVEA 1W8QA 3FYZA 3CUEA 3CI6A 3D72A 4MEZA 3T4TA 3T50A 4OP8A 3VP0A 4R3AA 1GHIA 2VX8A 3VOZA 5HL6A 3MS6A 3KX0X 3HLWA 1OTBA 2Y2LA 4Y0OA 2W27A 4KZBA 1E3UA 4ME4A 4PM8A 5KSCA 2W1TA 4OQ0A 3SS3A 2JBFA 1V9ZA 5FQIA 2KDKA 3VFFA 3E4QA 1AWIA 4U0TA 3O3VA 4IVIA 4EERA 1IKIA 1NLZA 3IX8A 3W4OA 2PAVP 4Y5FA 3W4QA 1JWZA 4Q0JA 3UB6A 4WL9A 5CTNA 3ZG9B 1TF1A 2G7UA 1XFNA 3HVFA 1OPXA 3IF6C 2ZD8A 1LSVA 1ZKJA 5EVIA 1VETB 4R1GA 3IT9A 5CXWA 1QMFA 2HDQA 2IWBA 2ZC4B 5CGXA 1W63Q 4JBFA 2WK0A 3L9KA 2ZMVA 4GD6A 3LIBA 2JKRM 1XFQA 4KQDA 4D60A 2IWCA 4EQIA 5EVLA 3T1RA 5DF8A 3G32A 2Y4AA 4JXSA 3A3EA 4WF0A 4K91A 1X0OA 3JPUA 3M6BA 3NOUC 5FAPA 1DJCA 4UHUA 2ZBBA 3UPNA 3VP4A 4WELA 3UMDA 3FC7A 4HJ3A 1JTGA 2J3TD 5J4EA 4WEKA 2WGWA 4Y0TA 5F83A 2HGVA 4HQAA 4F3LA 2ZM8A 3AGEA 3ITAA 1D06A 1BLHA 2VV7A 3NY4A 5CGWA 1N4OA 1O07A 3M6HA 2PU4A 3PBTA 2QZ6A 3MKFA 2H0TA 4DKIA 4HBUA 2XEPA 4OQHA 2ZC5B 3I7JA 4K08A 2HV1A 2XD5A 4Y0UA 1AXBA 1T1BA 2HP5A 3GR2A 3P09A 1TS0A 4F94A 4PAUA 4RVAA 4DXBA 2YKFA 5GL9A 4S2PA 1FR1A 1MBLA 4DJ3A 2H10A 4JGOA 1OT9A 3LY4A 1VEUB 2Y2MA 3T1QB 2Q0OA 4S2IA 4NXFA 1S1YA 4II7A 3N8RA 5TBMA 3BWLA 1TVFA 2W1RA 3BFGA 4JF5A 4UQIS 4WMCD 4QWOA 1T1AA 1XP4A 1DP8A 4KZ7A 3OPRA 3BEBA 3NJAA 2L0WA 4FTXA 4S2JA 5DKLA 1WA9A 4B4XA 1PWGA 3S1YA 1FCOA 3T4SA 4PHTA 3E98A 1CEGA 3HLCA 3FPVA 1IYOA 1W63M 3MKEA 1S6RA 4WBGA 2GJ3A 4OPZA 3Q7VA 4QPRA 1YLJA 3GMWA 5JYOA 3IWQA 3GSGA 5F69A 3SW1A 5CHMA 2FZ0A 2ZQ7A 2ZQDA 4FOFA 3O5YA 3O87A 4R70A 2QKPA 2Y2QA 3UDFA 1W7FA 2VV6A 2A3UA 2PHYA 3EQVA 3B33A 4WLAA 2HDRA 1RGYA 3UPOA 1DP6A 3NDGA 4KG5A 3UB9A 3LIDA 3LEZA 5F5YA 4PM5A 4NXGA 2ZLYA 1MC0A 4I3IA 4S2MA 5HDSA 1LL9A 2PR6A 4E3KA 4X6TA 2WGIA 5DKKA 1STZA 3PHYA 2LB9A 1YQSA 4FH4A 3IF6B 4HP9A 2JHEA 4EW7A 3E2LA 4UA7A 3K3DA 4OP5A 2VEAA 1GHPA 4ZTKA 5GHZA 1T19A 3DW0A 1KE3A 2EA9A 1SDNA 3LGOA 4GDNA 3RH8B 3VP2A 5FQKA 4BENA 4EBLA 3ZG8B 3HL9A 1ALQA 3G4PA 1PYYA 3SS5A 3CUEC 4IUHA 4ID4A 4KQQA 3MMHA 4HP4A 1JVJA 1TS8A 3QP6A 4CJNA 1QMEA 2XF3A 3T1SA 2FH5A 4Y13A 1LLBA 3BY9A 4EQ1A 4LV1A 4E3NA 4BL3A 2OOLA 1K57A 4JXVA 1ESIA 3F1OB 3HUNA 3ZNTA 2PBYA 2J9PA 1KOUA 2Y2JA 4BBUA 4ARZA 3MZFA 4EEUA 4YOFA 1DJAA 5DFXA 1XA7A 2WADA 3BJNA 5AQAA 3BFFA 3DTIA 1K4FA 2P9VA 4R6LA 5GHYA 2EFUA 2J3WA 2V20A 4OONA 5HAQA 2JN7A 3EEHA 3MZEA 4RX2A 4HESA 4Q0IA 3PYPA 4P85A 3LO7A 3C4PA 3C2WA 1BZAA 5CECA 3ZGAB 2QHKA 3DWKA 3TE8A 5EVIC 1Y28A 2HJ9C 5A93A 2A49A 3Q81A 4PM6A 2WZZA 3NOPC 2ZL1B 1S0WA 3H82A 5DTKA 2VLGA 3HLFA 3OBFA 3CPTA 4B9OA 3BQ8A 1K56D 2JKGA 3T4QA 2INWA 3IXGA 4M3KA 1H8ZA 3FPWA 1PW8A 5A90A 4WM9A 1Z6FA 4HH2A 1NZOA 4JPMA 4RX3A 2JC7A 4X68A 3GECA 2BTFP 4E3JA 4OLDA 2XR0A 4H6JA 2FFYA 2ZC3B 3Q82A 3LCEA 1D1JA 4NXBA 5AJGA 3F1NB 3W8KA 1DY6A 4R0QA 1FSWA 4DF6A 5HWVA 1P97A 1XJ6A 1HLUP 4IVKA 5FEGA 1PZPA 1WYBA 2EX8A 3VSLA 2CC1A 3WWXA 3DWZA 5DTSA 5D3OA 5E2EA 3A3JA 1S66L 5DFYA 1IYPA 2ZQCA 3BFDA 2QPNA 3HCYA 1BLPA 1M40A 1BSGA 1U60A 1EI5A 2DRWA 3T4KA 4QB8A 1OTEA 1YMXA 3L7HA 5J8XA 3CZDA 5FI7A 1XGIA 5FATA 1K54C 2EWWA 1IEMA 4MLLA 4S2OA 4FD8A 2V2FF 3FKVA 4EBNA 2A24A 2XQZA 2EXBA 2WUQA 3QNCA 4Y15A 3G34A 4WN5A 1SKFA 4OLGA 1DJBA 3G2YA 1OTAA 3MZDA 4C6YA 4HBTA 1YLTA 1S4RA 5FEFA 3V67A 4GS9B 2WYXA 2DCFA 1TS7A 2HP6A 4I5SA 1YMSA 4BJPA 4CLCC 5FAOA 2ZC7A 4MCWA 3KSFA 2ZQ9A 3V50A 5TR7A 3BM6A 3VE4A 3LEQA 4M4XA 4DXCA 5DJTA 3C7UA 4MBHA 5CEDA 4KG2A 1IYSA 3DTMA 2JKRI 3QNBA 3QP8A 1ONGA 4Z1WA 1ZG6A 3M2JA 3N8SA 3EEAA 2ZM0A 5CGSA 5BOHA 1SKOA 3UY6A 1NWZA 5A92A 1GCEA 3IXDA 3PBRA 3IXBA 2LB5A 3DBAA 3A0VA 1CK3A 2W1TB 4BBVA 1BLCA 5FSRA 4E6XA 5HZHA 3MXSA 4S2NA 5FAQA 4GLQA 2WKEA 5IHVA 3MXRA 3BLMA 1I2SA 3C5AA 1Q2QA 2V8CA 2V0WA 3ULFA 5FDHA 1PW1A 3A0RA 2D01A 3IWIA 3F1PB 1H0MA 1PWCA 5EM1A 5F1FA 1YSQA 5EVIB 4KUOA 1PZOA 4X1MA 1VETA 3HLGA 3VSKA 3ZG5A 4WZ5C 5EVID 3HUOA 2AVXA 1MWRA 5FI6A 1TEMA 4MN5A 2Y2NA 4EUVA 2Q9MA 5FASA 3RFBA 3AGFA 3UNWA 2XROA 1NLYA 3VMAA 2Y2OA 1KVLA 5F68A 1A0KA 4MNRA 4QY5A 2M7UA 4E3LA 4EUZA 4Y7PA 1HVBA 1H8MA 1YM1A 4G3KA 4MN6A 4BD1A 3CITA 3NC8A 2VGLS 4OOLA 3G2ZA 4H8RA 4QU3A 2B02A 4FUWA 1K57C 3NHQA 5L2FA 1BULA 4QJGA 2P08A 4YNRA 2WGWB 3TSGA 4KZ5A 1ODVA 4F3LB 4KZAA 1CJFA 5IS1A 2C6WB 4DDSA 5A8BA 2W3FA 1K55C 5HPFA 4X53A 4R23A 3EGXC 4JLFA 2Y79A 3SZTA 2OAP1 3PTEA 2DNSA 2L1MA 2G2WA 2J8YA 1RP5A 3QP4A 3UE6A 2Z2MB 3D9YA 1NYMA 2UV0E 2XSSA 5HAPA 3NOTC 3S7NA 1E25A 2VGKA 3BYDA 3G6OA 3DAVA 1XJ3A 3SOIA 3QP1A 3LIFA 1GA9A 2V1AA 1MXOA 4CLCE 4ZJ1A 1NYYA 2JKTM 3BQAA 2WZXA 2PR5A 2H5SA 5HD5A 4OPYA 1JNUA 4DDYA 2GDNA 1VEUA 1VM1A 5L8MA 4CLCB 5L10A 1L0FA 3V39A 5CHJA 2OLUA 4WMCA 2XDMA 3E4PA 1GSVA 3M2KA 5AQ9A 3VOLA 5F82A 4CLCD 1W79A 1Y54A 2E8IA 3UB8A 3P98A 3WS2A 2J7VA 3VP1A 2B18A 4LRYC 3LYXA 3FZCA 5FQMA 3N6IA 5L09A 5HDDA 5DF9A 2QMIA 1ES2A 3LICA 4LCLA 5HDCA 4OQIA 5M18A 1MPLA 3IS2A 1YPRA 3SH8A 2Y91A 5GLAA 3CAXA 2B5RA 3LR4A 1NRJA 4JXGA 4O0PA 3Q7ZA 2EXAA 3TJZC 5E2HA 3E2KA 4LGWA 3HJKA 3IH9A 3PAGA 4PMAA 4LV2A 3HREA 1L3LA 1C3BA 3IH8A 3IBJA 1LSWA 1ONHA 3LFVA 3D3OA 3K3CA 4GZBA 3GDIA 1SZVA 1YLWA 5AVFA 2ZM2A 2HP9A 5FQQA 4DE1A 1FCNA 3SH9A 4LLOB 4C75A 3C38A 4P87A 4KZ3A 1F9IA 2FFFB 5EOEA 5IT5A 2V0UA 4R4SA 5HX9A 4PM9A 3U4LP 3IF6A 1XJ2A 1IOUA 4MMNA 1GA0A 4GHIA 3UB7A 5HW3A 2NUTC 1HD8A 1PNEA 4R3JA 4O01A 3KSGA 1XXMA 1N9NA 3MF0A 4EESA 1LT0A 2RCXA 3S22A 4B93A 2EFXA 1ESUA 1NZUA 4R38A 2Y2GA 2Q9NA 3EOIA 2A2LA 3N4IA 3PXPA 4I3AA 2I9VA 5M1AA 3IQAA 1XGJA 3IX3A 4GDBA 5KZHA 5GLCA 1YLYA 3ZQ5A 1EWZA 3ZFZA 1FR6A 1XKZA 4L0LA 4P6BA 4OPRA 4BQMA 3TG9A 2JCHA 4XT2B 5DTTA 5E2FA
chains in the Genus database with same CATH topology
2EWWA 4E04A 3W2ZA 3F1OA 4I38A 1LSXA 3EQUA 5LBRA 4YWZA 2ZMVA 3LIBA 2JKRM 2A24A 4IHQA 3OC2A 3IS2B 2QWSA 1MKMA 3S7OA 3T4LA 2K7SA 4WN5A 2K31A 1XFQA 2QYBA 2Z6DA 1GSWA 4L9FA 4KQDA 5F6AA 1OTAA 1S4RA 3V67A 4L9GA 4GS9B 1TS7A 4I5SA 5KIZA 4BJPA 4CLCC 3H9WA 4WF0A 3T4OA 1X0OA 4MCWA 3KSFA 3NOUC 4RQ9A 2ZBBA 4DJ2A 4WELA 4JGRA 2O9CA 3E0YA 3UMDA 3FC7A 3VE4A 4HJ3A 4M4XA 2P7JA 3H82B 1VB6A 5DJTA 4G3WA 2J3TD 5J4EA 1OTDA 2OWHA 4WEKA 2V1BA 3JVUA 3E4OA 3LR5A 2HGVA 4HH3A 4HQAA 2JKRI 4F3LA 3OOVA 4NXEA 1D06A 5HSQA 4KQOA 4Z1WA 2BASA 2PYRA 1MZUA 4JGQA 2VV7A 4P6ZS 2PT7A 2GZAA 3PBTA 3EEAA 1H3QA 3OCLA 4LPZA 1NWZA 4H6JB 1YSPA 3PBRA 1YKDA 4K08A 2LB5A 2HV1A 3DBAA 3A0VA 2W1TB 4BBVA 2VA0A 4HIAA 4I3JA 4UEYA 1T1BA 5HZHA 2D02A 4GHIB 3IBRA 3T4JA 1OJ5A 1TS0A 4PAUA 1P9WA 2WKRA 5I5LA 2YKFA 3R7WB 4LRXC 3CWFA 4DJ3A 3F1NA 4GLQA 4KUKA 2HF6A 4JGOA 1OT9A 1XJ4A 2O99A 2VJWA 4MDZA 2Y8HA 2V0WA 3KSHA 4NXFA 1S1YA 3ULFA 4II7A 2XA7M 2OAQ1 5TBMA 2CMNA 3A0RA 2D01A 3F1PB 1TS6A 3BWLA 4CQHA 2W1RA 1YSQA 2O9BA 3MJQA 4ETZA 4UQIS 4KUOA 2PD8A 1T1AA 4DMZA 4ARZB 1DP8A 4GJ4A 1P9RA 3ICYA 3EWKA 4FSFA 4MN7A 3NJAA 2L0WA 5DKLA 1WA9A 1TD5A 5HD3A 2PD7A 3T4SA 4PHTA 4MN5A 4BWIA 3E98A 4XT2A 2R78A 4EUVA 4HI4A 1ZHHB 3FPVA 3LIAA 3RFBA 3ZYTA 3H7WA 1W63M 1EW0A 1N9LA 3EGDC 2W0NA 4PKYA 5G4YA 4NKPA 2GJ3A 1NLYA 2XROA 2Z6CA 5F68A 4QPRA 4EXOA 3SW1A 5F69A 2M7UA 3TRCA 3JVVA 1UGUA 2MJ6A 2PDRA 1H8MA 2W3EA 4G3KA 4MN6A 3CITA 3UMEA 3PBQA 2VGLS 2FZ0A 3PBSA 4OOLA 4FOFA 3TW8A 2B02A 3O5YA 3PBNA 1OTIA 4GS9A 2QKPA 4R70A 5HWTA 5EFWA 2VV6A 2PHYA 2W3GA 3EQVA 3NHQA 3B33A 4WLAA 3KSIA 3LI8A 2P08A 4YNRA 2XRNA 1DP6A 1P0ZA 3LIDA 3UB9A 1ODVA 1OJGA 2KX6A 5F5YA 3VV4A 4F3LB 5IS1A 4NXGA 2DMWA 1MC0A 3KO6A 4I3IA 5FL3A 5HDSA 2W3FA 5A8BA 2PR6A 2O0YA 2V9AA 3OCNA 5HPFA 3EGXC 2Y79A 5DKKA 3OLOA 1STZA 3PHYA 3BY8A 1T1CA 2OWJA 2OAP1 2LB9A 4Q0HA 2VZWA 3A0SA 4L9EA 4HP9A 2JHEA 4EW7A 2QJ5A 5J7EA 3K3DA 1V9YA 2L1MA 5HWWA 3VE3A 2H28A 2VEAA 5KSHA 3UE6A 4HJ4A 3P01A 4HNBA 1T19A 2XSSA 2J3TC 3HJIA 3LI9A 3NOTC 2EA9A 3S7NA 5J3WA 4AFIA 4IJGA 5C5KA 1BYWA 4HHDA 4IUKA 3RH8B 3G6OA 2KOIA 1XJ3A 3LIFA 3S7QA 2QJ7A 2V1AA 2ZMFA 3R7WA 3MR0A 4CLCE 3CUEC 4IUHA 2JKTM 4GCZA 3BQAA 2PR5A 5HD5A 3MXQA 2ZOIA 1JNUA 2HJEA 3BW6A 2VV8A 1F5MA 3MMHA 4HP4A 1TS8A 1S1ZA 2GX5A 5L8MA 4GW9A 4UQIM 4Y3IA 4CLCB 2FH5A 3FG8A 2NUPC 3BY9A 2M1CA 1ZTUA 4EQ1A 4HOIA 2KLIA 2XA7S 3F1PA 3E4PA 1GSVA 3B47A 1G28A 2OOLA 3VOLA 3C30A 4CLCD 3F1OB 2L4RA 3C8CA 5HPIA 3UB8A 2ZOHA 1KOUA 4BBUA 4PKYG 1F98A 4NEED 2A24B 4WUJA 4ARZA 2B18A 4EEUA 1VHMA 4YOFA 4BBTA 5DFXA 4LRYC 3BJNA 3LUQA 1S67L 3LYXA 4DN0A 1OT6A 2WKPA 5MC7A 5HDDA 4R6LA 4G3VA 5DF9A 4JGPA 3LICA 2J80A 2J3WA 5HDCA 2VKSA 3H7WB 4ZRRA 3IS2A 2JKTI 4BMWA 3CAXA 2JN7A 3EEHA 2K2NA 2WKQA 4O8GA 5TJJA 3LR4A 4Q0IA 1NRJA 4O0PA 1GSXA 2GNXA 5G4ZA 1UWNX 1LL8A 3PYPA 3MFXA 2VGLM 3TJZC 1DP9A 3C2WA 2IA2A 3HJKA 3KYZA 1S4SA 1G6OA 2O9AA 3IBJA 1LSWA 2QHKA 4I39A 3TE8A 3LFVA 1T18A 3P7NA 4HJ6A 1Y28A 3D3OA 2HJ9C 3K3CA 4ETXA 3U2AA 3GDIA 3MQOA 2PYPA 3NOPC 4WEJA 3S7PA 4HY8A 3UE3A 3H82A 4LRZE 2W3HA 4P6ZM 5AVEA 5AVFA 2VLGA 3LR0A 1DRMA 3OBFA 3CUEA 4B9OA 3BQ8A 3MQQA 3CI6A 3T4QA 3R4KA 3D72A 2INWA 3PR6A 3T4TA 3T50A 4LLOB 3FPWA 4R3AA 3CLOA 4EEPA 1YAXA 4HH2A 2VX8A 5HL6A 3C38A 3LR3A 3PBOA 4OOMA 3GECA 1F9IA 5IT5A 2P04A 3KX0X 4EETB 1N9OA 2V0UA 1OTBA 4H6JA 2W27A 1UWPX 4ME4A 1XJ2A 1IOUA 2W1TA 4MMNA 5IU1A 4NXBA 4GHIA 3F1NB 5AJGA 3UB7A 1V9ZA 5HWVA 2NUTC 3RTYA 1P97A 1XJ6A 3B42A 4O01A 2KDKA 3KSGA 4Y2FA 3E4QA 1N9NA 3MF0A 2EWVA 4EESA 1S66L 5DFYA 1LT0A 5TBMB 4EERA 4B93A 1NLZA 4R38A 3EOIA 1IFQA 4Y5FA 2A2LA 5DJUA 3PXPA 4I3AA 4Q0JA 3HCYA 2I9VA 2YKHA 5K5BA 3UB6A 3K2NA 4WL9A 1TF1A 2G7UA 3LIEA 1XFNA 3ZQ5A 1OPXA 3T4KA 1OTEA 1LSVA 1D7EA 4CLCA 2M7VA 2W3DA 3KYQA 5CX7A 4EU0A 3MQ0A 4L0LA 4XT2B 1W63Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O99 A;  2VZW A;  3IBJ A;  3W2Z A;  4E04 A;  2VJW A;  4MDZ A;  2Y8H A;  3LFV A;  3KSH A;  3D3O A;  5LBR A;  4ETX A;  3NOP C;  3S7P A;  1MKM A;  3S7O A;  2VEA A;  4LRZ E;  2W3H A;  4CQH A;  2K31 A;  2QYB A;  1YSQ A;  2W1R A;  2O9B A;  2XSS A;  4ETZ A;  3OBF A;  3NOT C;  3S7N A;  3CI6 A;  3R4K A;  4IJG A;  4DMZ A;  5C5K A;  4IUK A;  3G6O A;  2KOI A;  5HL6 A;  4MN7 A;  3S7Q A;  2ZMF A;  1TD5 A;  4MCW A;  3KSF A;  3NOU C;  4IUH A;  4RQ9 A;  4BWI A;  2O9C A;  3E0Y A;  3E98 A;  1F5M A;  3MMH A;  4ME4 A;  4EUV A;  3RFB A;  2GX5 A;  2W1T A;  4GW9 A;  4Y3I A;  4G3W A;  5L8M A;  4MMN A;  2HGV A;  2XRO A;  1ZTU A;  5AJG A;  3OOV A;  2KLI A;  5HSQ A;  4QPR A;  4Z1W A;  2M7U A;  3TRC A;  2OOL A;  4O01 A;  3KSG A;  2W3E A;  4G3K A;  4Y2F A;  5HPI A;  3MF0 A;  3CIT A;  5DFY A;  3EEA A;  4FOF A;  2B18 A;  1VHM A;  4YOF A;  5DFX A;  3O5Y A;  4LRY C;  3BJN A;  4R70 A;  4DN0 A;  1YSP A;  4R6L A;  4G3V A;  2W3G A;  4Y5F A;  3NHQ A;  1YKD A;  2VKS A;  2LB5 A;  3KSI A;  3DBA A;  3HCY A;  4Q0J A;  2W1T B;  4ZRR A;  5K5B A;  4YNR A;  2XRN A;  3K2N A;  1TF1 A;  2G7U A;  3VV4 A;  3IBR A;  3ZQ5 A;  2K2N A;  4O8G A;  5TJJ A;  1MC0 A;  3KO6 A;  4O0P A;  4Q0I A;  4PAU A;  5I5L A;  2M7V A;  2W3F A;  2W3D A;  4LRX C;  2O0Y A;  5HPF A;  4GLQ A;  4EU0 A;  2Y79 A;  3C2W A;  2IA2 A;  3MQ0 A;  1STZ A;  2LB9 A;  2O9A A;  4Q0H A; 
#chains in the Genus database with same CATH topology
 1H8Y A;  3F1O A;  1LSX A;  3EQU A;  1SHV A;  5LBR A;  4YWZ A;  3A3I A;  3OC2 A;  3G31 A;  2QWS A;  4C3Q A;  1O7E A;  1LI9 A;  3S7O A;  3T4L A;  2K7S A;  5GLD A;  2K31 A;  2Z6D A;  2QYB A;  2BLS A;  2OV5 A;  3IF5 A;  3WS1 A;  3GQZ A;  3WS0 A;  2VGJ A;  1CF0 A;  5HL1 A;  4ZAM A;  4L9G A;  5KIZ A;  2R9X A;  2UWX A;  3ISG A;  4E3I A;  4DJ2 A;  4Q8I A;  2X71 A;  1PRQ A;  3H82 B;  3ZVT A;  1VB6 A;  4G3W A;  1OTD A;  1K56 A;  3JVU A;  4HH3 A;  1ERQ A;  3OOV A;  3WRZ A;  2ZL1 A;  5HSQ A;  4OQG A;  3BFE A;  4KQO A;  2PYR A;  1MZU A;  3HLB A;  4JGQ A;  3TOI A;  2ZQA A;  5E2G A;  2PT7 A;  3QP5 A;  4ZDX A;  3OCL A;  4LPZ A;  4H6J B;  3MFD A;  1YSP A;  1F2K A;  3WRT A;  4GB7 A;  1YKD A;  1G68 A;  4A5R A;  1MWU A;  2VA0 A;  4HIA A;  2D02 A;  3UE0 A;  3ZG0 A;  2Y59 A;  5FQ9 A;  3UE1 A;  5AQB A;  3T4J A;  1OJ5 A;  2WKR A;  4NET A;  4NK3 A;  3R7W B;  3V3R A;  3CWF A;  1K25 A;  1XX2 A;  3F1N A;  4KUK A;  2HF6 A;  3CJM A;  1ERO A;  5HAR A;  1YLP A;  2XFS A;  4KZ9 A;  1NXY A;  2XLN A;  2Y8H A;  3Q07 A;  3KSH A;  1FSY A;  3ZVW A;  2XA7 M;  4RYE A;  1BT5 A;  2CMN A;  4JXW A;  1TS6 A;  4JF4 A;  2O9B A;  2OLV A;  1MWT A;  2PD8 A;  4DMZ A;  2HDS A;  2H0Y A;  3OPP A;  1XA1 A;  3HLE A;  5GLB A;  2XGN A;  3CG5 A;  2WGV A;  2HZ5 A;  5HFO A;  1ES4 A;  2EX9 A;  4O7D A;  5HD3 A;  3A3F A;  4BWI A;  4DE2 A;  1IYQ A;  1FCM A;  4HI4 A;  4DRT A;  3OPH A;  3H7W A;  3ZYT A;  4ZJ2 A;  2W0N A;  5HAI A;  4NKP A;  1FQG A;  3IX4 A;  4KG6 A;  3FV7 A;  1NY0 A;  1KDS A;  4GN2 A;  3SS4 A;  2MJ6 A;  2PDR A;  2W3E A;  3UME A;  3PBS A;  5EVE A;  2I72 A;  1I5Q A;  3MSH A;  3TW8 A;  4N1H A;  1KVM A;  3PBN A;  4GS9 A;  5HWT A;  4N1X A;  1BTL A;  3KSI A;  4Y17 A;  1P0Z A;  3PAE A;  3VV4 A;  2RL3 A;  3KO6 A;  2PU2 A;  3GVB A;  4D2O A;  3ITB A;  5FL3 A;  2HPB A;  4CPK A;  2O0Y A;  1FOF A;  3OCN A;  3VP3 A;  3O88 A;  3VFH A;  1SKO B;  4Q0H A;  2VZW A;  3A0S A;  4KZ8 A;  2Z2L B;  3NIA A;  3DTE A;  4S2L A;  3VE3 A;  1E3U D;  5KSH A;  1ZC2 A;  3V3S A;  3P01 A;  4HNB A;  3LI9 A;  4KEN B;  3QP2 A;  5J3W A;  5C5K A;  4HHD A;  4R4R A;  1LHY A;  2KOI A;  2E8J A;  3WS5 A;  4KQR A;  1SCW A;  1L0D A;  4GCZ A;  4GKU A;  2ZOI A;  3MBZ A;  1E4D A;  2HJE A;  1YLZ A;  1L0G A;  2HDU A;  3C7V A;  4GW9 A;  4UQI M;  4Y3I A;  2NUP C;  2V8F A;  2C5W B;  4HOI A;  2KLI A;  2XA7 S;  3F1P A;  5EUA A;  2XH9 A;  3B47 A;  4IBR A;  5CTM A;  5HPI A;  2ZOH A;  2JKF A;  4U0X A;  4PKY G;  1F98 A;  1KGF A;  4R3B A;  4ESP A;  4OOY A;  4BBT A;  1NJ4 A;  5G18 A;  1S67 L;  1KGG A;  2WKP A;  5MC7 A;  3RXX A;  3ZHH A;  1H5X A;  3IHA A;  2J80 A;  2VKS A;  1TDL A;  1ERM A;  2JKT I;  3JYI A;  4BMW A;  3NDE A;  1L0E A;  4O8G A;  3UB5 P;  1GSX A;  2GNX A;  5G4Z A;  1UWN X;  3NEC A;  3MFX A;  4LCM A;  1L2S A;  4RA7 A;  4EBP A;  2Y2H A;  1S4S A;  3IHB A;  2O9A A;  4I39 A;  1G6A A;  1T18 A;  3P7N A;  4ETX A;  3U2A A;  4X56 A;  4BD0 A;  4WYY A;  4WEJ A;  4HY8 A;  1CEF A;  3UE3 A;  4P6Z M;  1G5U A;  3LR0 A;  1KDW A;  3N8L A;  1DRM A;  3MQQ A;  4IED A;  3R4K A;  2ZMA A;  3PR6 A;  5EOO A;  3CLO A;  4EEP A;  1YAX A;  4X55 A;  1KE0 A;  3GTC A;  3HLD A;  4OOM A;  3LR3 A;  3PBO A;  1W5D A;  4P0M A;  2P04 A;  5EPH A;  4PPR A;  2VK3 A;  3CHW P;  4S2K A;  4EET B;  1N9O A;  4LV3 A;  3DTK A;  1K0K A;  3S4X A;  4JKT A;  4PM7 A;  1UWP X;  3NI9 A;  2ZQ8 A;  2ACG A;  3ZG7 B;  1J3W A;  4K0W A;  5IU1 A;  1OME A;  5FA7 A;  1MWS A;  3RTY A;  3B42 A;  1K54 A;  4Y2F A;  2EWV A;  2B95 A;  3HUM A;  5TBM B;  4GNU A;  3C4O A;  1BUE A;  4DE3 A;  4DE0 A;  5I94 A;  2V1Z A;  1IFQ A;  5DJU A;  2R9W A;  1JTD A;  1ZG4 A;  2YKH A;  5K5B A;  3BRM A;  3K2N A;  5TFQ A;  3LIE A;  2Y2K A;  3NBL A;  1D7E A;  4CLC A;  3D4F A;  2M7V A;  3ZNY A;  2W3D A;  3KYQ A;  4U3T A;  5CX7 A;  4EU0 A;  3T12 B;  5CRF A;  3MQ0 A;  1ACF A;  1PI4 A;  5AQ7 A;  4E04 A;  3W2Z A;  3VOY A;  4MBK A;  4BLM A;  4EWF A;  1PFL A;  4I38 A;  2BG1 A;  5EM0 A;  4IHQ A;  3IS2 B;  1TDG A;  3Q7V B;  1MKM A;  3BLS A;  3HBR A;  1GSW A;  4L9F A;  4KZ4 A;  3QHY A;  5F6A A;  4X25 A;  4OKP A;  4X69 A;  2P74 A;  4EV4 A;  3Q1F A;  4OVD A;  3H9W A;  2OSU A;  3T4O A;  4LFU A;  1ES5 A;  4RQ9 A;  5U47 A;  4QHC A;  4JGR A;  1W8Y A;  1PI5 A;  1HZO A;  2O9C A;  3E0Y A;  5DVA A;  2EX6 A;  5CER A;  2P7J A;  1NRF A;  2OWH A;  2V1B A;  3E4O A;  3LR5 A;  3ZDJ A;  4NXE A;  5DF7 A;  1CI8 A;  5CEB A;  2BAS A;  1JWP A;  3FKW A;  4P6Z S;  2GZA A;  1H3Q A;  2WAF A;  4IBX A;  1MKI A;  4XUZ A;  4I3J A;  3AGD A;  4UEY A;  1XPB A;  3GRJ A;  4GHI B;  3IBR A;  1P9W A;  3W4P A;  1IKG A;  5I5L A;  1VQQ A;  4LRX C;  5EEC A;  4WZ5 A;  3GV9 A;  4ZBE A;  4E6W A;  4B4Z A;  3RXW A;  5CHU A;  4XUX A;  1XJ4 A;  2J9O A;  2O99 A;  2VJW A;  4MDZ A;  3UDX A;  5FI2 A;  3NUL A;  2JE5 A;  4WZ4 A;  1FIK A;  2OAQ 1;  2WKI A;  2XK1 A;  3KYE A;  3G30 A;  4CQH A;  4UA9 A;  4E3O A;  3MJQ A;  4ETZ A;  1M6K A;  2WAE A;  2X02 A;  3BEC A;  4ARZ B;  5JYP A;  3V5M A;  4FH2 A;  4UA6 A;  4GJ4 A;  1P9R A;  4N9K A;  4GOG A;  3ICY A;  3EWK A;  4KZ6 A;  4FSF A;  4MN7 A;  4S2N C;  2P9V B;  4X1L A;  3WS4 A;  1TD5 A;  1JWV A;  1Y4O A;  4YFM A;  3A3D A;  3RJU A;  5KMW A;  5L07 A;  2PD7 A;  4XT2 A;  2R78 A;  1K6R A;  1ZHH B;  3LIA A;  1Z09 A;  1EW0 A;  1N9L A;  3EGD C;  4OPQ A;  4PKY A;  1N9B A;  3SH7 A;  5G4Y A;  1K55 A;  2Z6C A;  4LEN A;  3B3X A;  4EXO A;  1CI9 A;  3TRC A;  1CQA A;  3CMZ A;  2Y2I A;  3JVV A;  1UGU A;  3O86 A;  1WE4 A;  1SDE A;  3G35 A;  3PBQ A;  2Y2P A;  5F1G A;  4XXR A;  1MY8 A;  3N7W A;  4E3M A;  1OTI A;  1ES3 A;  5EFW A;  2W3G A;  1BLS A;  2PRF A;  3CPT B;  4MBF A;  3LI8 A;  2XRN A;  1GHM A;  4QY6 A;  1OJG A;  2KX6 A;  4NG2 A;  2DMW A;  1I2W A;  2IWD A;  2XFT A;  1YT4 A;  1Q2P A;  2V9A A;  1KGE A;  3UPP A;  4OH0 A;  3OLO A;  3BY8 A;  2WKH A;  1T1C A;  3NCK A;  2OWJ A;  1IEL A;  4L9E A;  2QJ5 A;  5J7E A;  4K0X A;  1V9Y A;  1FIL A;  3FWL A;  5HWW A;  2H28 A;  4JF6 A;  4Z9Q A;  2X01 A;  4HJ4 A;  4HEF A;  3HJI A;  2J3T C;  3OZH A;  5E43 A;  4AFI A;  1K4E A;  4IJG A;  1BYW A;  4IUK A;  3T1X A;  3S7Q A;  2QJ7 A;  1RGZ A;  2ZMF A;  3R7W A;  3MR0 A;  3MXQ A;  5GHX A;  5FQJ A;  3BW6 A;  2VV8 A;  1K6S A;  1F5M A;  1WYC A;  1S1Z A;  5TGF A;  4N92 A;  1J9M A;  2GX5 A;  1LL5 A;  3IXH A;  3FG8 A;  2M1C A;  1PIO A;  1ZTU A;  4QD4 A;  1K38 A;  2EX2 A;  4YIN A;  5FDS A;  1PWD A;  1G28 A;  3C30 A;  5EV0 A;  2L4R A;  3C8C A;  3LY3 A;  4WUJ A;  4NEE D;  2A24 B;  1VHM A;  3UDI A;  4DN0 A;  3LUQ A;  1RCJ A;  1OT6 A;  4G3V A;  3OPL A;  4JGP A;  4B88 A;  3H7W B;  4ZRR A;  5EE8 A;  4BL2 A;  2XD1 A;  2Y55 A;  2ZC6 B;  3ZCZ A;  2G2U A;  2K2N A;  2WKQ A;  4LV0 A;  5TJJ A;  3UN7 A;  5M19 A;  1HTZ A;  1LL8 A;  2PBD P;  4GD8 A;  2VGL M;  1DP9 A;  3UO9 A;  4N9L A;  2IA2 A;  3KYZ A;  1KE4 A;  3BFC A;  2ZJ9 A;  1G6O A;  3IWO A;  1LI0 A;  4HJ6 A;  4ZJ3 A;  4UAA A;  5A91 A;  3MQO A;  2PYP A;  4FCF A;  3S7P A;  4LRZ E;  2W3H A;  5AVE A;  1W8Q A;  3FYZ A;  3CUE A;  3CI6 A;  3D72 A;  4MEZ A;  3T4T A;  3T50 A;  4OP8 A;  3VP0 A;  4R3A A;  1GHI A;  2VX8 A;  3VOZ A;  5HL6 A;  3MS6 A;  3KX0 X;  3HLW A;  1OTB A;  2Y2L A;  4Y0O A;  2W27 A;  4KZB A;  1E3U A;  4ME4 A;  4PM8 A;  5KSC A;  2W1T A;  4OQ0 A;  3SS3 A;  2JBF A;  1V9Z A;  5FQI A;  2KDK A;  3VFF A;  3E4Q A;  1AWI A;  4U0T A;  3O3V A;  4IVI A;  4EER A;  1IKI A;  1NLZ A;  3IX8 A;  3W4O A;  2PAV P;  4Y5F A;  3W4Q A;  1JWZ A;  4Q0J A;  3UB6 A;  4WL9 A;  5CTN A;  3ZG9 B;  1TF1 A;  2G7U A;  1XFN A;  3HVF A;  1OPX A;  3IF6 C;  2ZD8 A;  1LSV A;  1ZKJ A;  5EVI A;  1VET B;  4R1G A;  3IT9 A;  5CXW A;  1QMF A;  2HDQ A;  2IWB A;  2ZC4 B;  5CGX A;  1W63 Q;  4JBF A;  2WK0 A;  3L9K A;  2ZMV A;  4GD6 A;  3LIB A;  2JKR M;  1XFQ A;  4KQD A;  4D60 A;  2IWC A;  4EQI A;  5EVL A;  3T1R A;  5DF8 A;  3G32 A;  2Y4A A;  4JXS A;  3A3E A;  4WF0 A;  4K91 A;  1X0O A;  3JPU A;  3M6B A;  3NOU C;  5FAP A;  1DJC A;  4UHU A;  2ZBB A;  3UPN A;  3VP4 A;  4WEL A;  3UMD A;  3FC7 A;  4HJ3 A;  1JTG A;  2J3T D;  5J4E A;  4WEK A;  2WGW A;  4Y0T A;  5F83 A;  2HGV A;  4HQA A;  4F3L A;  2ZM8 A;  3AGE A;  3ITA A;  1D06 A;  1BLH A;  2VV7 A;  3NY4 A;  5CGW A;  1N4O A;  1O07 A;  3M6H A;  2PU4 A;  3PBT A;  2QZ6 A;  3MKF A;  2H0T A;  4DKI A;  4HBU A;  2XEP A;  4OQH A;  2ZC5 B;  3I7J A;  4K08 A;  2HV1 A;  2XD5 A;  4Y0U A;  1AXB A;  1T1B A;  2HP5 A;  3GR2 A;  3P09 A;  1TS0 A;  4F94 A;  4PAU A;  4RVA A;  4DXB A;  2YKF A;  5GL9 A;  4S2P A;  1FR1 A;  1MBL A;  4DJ3 A;  2H10 A;  4JGO A;  1OT9 A;  3LY4 A;  1VEU B;  2Y2M A;  3T1Q B;  2Q0O A;  4S2I A;  4NXF A;  1S1Y A;  4II7 A;  3N8R A;  5TBM A;  3BWL A;  1TVF A;  2W1R A;  3BFG A;  4JF5 A;  4UQI S;  4WMC D;  4QWO A;  1T1A A;  1XP4 A;  1DP8 A;  4KZ7 A;  3OPR A;  3BEB A;  3NJA A;  2L0W A;  4FTX A;  4S2J A;  5DKL A;  1WA9 A;  4B4X A;  1PWG A;  3S1Y A;  1FCO A;  3T4S A;  4PHT A;  3E98 A;  1CEG A;  3HLC A;  3FPV A;  1IYO A;  1W63 M;  3MKE A;  1S6R A;  4WBG A;  2GJ3 A;  4OPZ A;  3Q7V A;  4QPR A;  1YLJ A;  3GMW A;  5JYO A;  3IWQ A;  3GSG A;  5F69 A;  3SW1 A;  5CHM A;  2FZ0 A;  2ZQ7 A;  2ZQD A;  4FOF A;  3O5Y A;  3O87 A;  4R70 A;  2QKP A;  2Y2Q A;  3UDF A;  1W7F A;  2VV6 A;  2A3U A;  2PHY A;  3EQV A;  3B33 A;  4WLA A;  2HDR A;  1RGY A;  3UPO A;  1DP6 A;  3NDG A;  4KG5 A;  3UB9 A;  3LID A;  3LEZ A;  5F5Y A;  4PM5 A;  4NXG A;  2ZLY A;  1MC0 A;  4I3I A;  4S2M A;  5HDS A;  1LL9 A;  2PR6 A;  4E3K A;  4X6T A;  2WGI A;  5DKK A;  1STZ A;  3PHY A;  2LB9 A;  1YQS A;  4FH4 A;  3IF6 B;  4HP9 A;  2JHE A;  4EW7 A;  3E2L A;  4UA7 A;  3K3D A;  4OP5 A;  2VEA A;  1GHP A;  4ZTK A;  5GHZ A;  1T19 A;  3DW0 A;  1KE3 A;  2EA9 A;  1SDN A;  3LGO A;  4GDN A;  3RH8 B;  3VP2 A;  5FQK A;  4BEN A;  4EBL A;  3ZG8 B;  3HL9 A;  1ALQ A;  3G4P A;  1PYY A;  3SS5 A;  3CUE C;  4IUH A;  4ID4 A;  4KQQ A;  3MMH A;  4HP4 A;  1JVJ A;  1TS8 A;  3QP6 A;  4CJN A;  1QME A;  2XF3 A;  3T1S A;  2FH5 A;  4Y13 A;  1LLB A;  3BY9 A;  4EQ1 A;  4LV1 A;  4E3N A;  4BL3 A;  2OOL A;  1K57 A;  4JXV A;  1ESI A;  3F1O B;  3HUN A;  3ZNT A;  2PBY A;  2J9P A;  1KOU A;  2Y2J A;  4BBU A;  4ARZ A;  3MZF A;  4EEU A;  4YOF A;  1DJA A;  5DFX A;  1XA7 A;  2WAD A;  3BJN A;  5AQA A;  3BFF A;  3DTI A;  1K4F A;  2P9V A;  4R6L A;  5GHY A;  2EFU A;  2J3W A;  2V20 A;  4OON A;  5HAQ A;  2JN7 A;  3EEH A;  3MZE A;  4RX2 A;  4HES A;  4Q0I A;  3PYP A;  4P85 A;  3LO7 A;  3C4P A;  3C2W A;  1BZA A;  5CEC A;  3ZGA B;  2QHK A;  3DWK A;  3TE8 A;  5EVI C;  1Y28 A;  2HJ9 C;  5A93 A;  2A49 A;  3Q81 A;  4PM6 A;  2WZZ A;  3NOP C;  2ZL1 B;  1S0W A;  3H82 A;  5DTK A;  2VLG A;  3HLF A;  3OBF A;  3CPT A;  4B9O A;  3BQ8 A;  1K56 D;  2JKG A;  3T4Q A;  2INW A;  3IXG A;  4M3K A;  1H8Z A;  3FPW A;  1PW8 A;  5A90 A;  4WM9 A;  1Z6F A;  4HH2 A;  1NZO A;  4JPM A;  4RX3 A;  2JC7 A;  4X68 A;  3GEC A;  2BTF P;  4E3J A;  4OLD A;  2XR0 A;  4H6J A;  2FFY A;  2ZC3 B;  3Q82 A;  3LCE A;  1D1J A;  4NXB A;  5AJG A;  3F1N B;  3W8K A;  1DY6 A;  4R0Q A;  1FSW A;  4DF6 A;  5HWV A;  1P97 A;  1XJ6 A;  1HLU P;  4IVK A;  5FEG A;  1PZP A;  1WYB A;  2EX8 A;  3VSL A;  2CC1 A;  3WWX A;  3DWZ A;  5DTS A;  5D3O A;  5E2E A;  3A3J A;  1S66 L;  5DFY A;  1IYP A;  2ZQC A;  3BFD A;  2QPN A;  3HCY A;  1BLP A;  1M40 A;  1BSG A;  1U60 A;  1EI5 A;  2DRW A;  3T4K A;  4QB8 A;  1OTE A;  1YMX A;  3L7H A;  5J8X A;  3CZD A;  5FI7 A;  1XGI A;  5FAT A;  1K54 C;  2EWW A;  1IEM A;  4MLL A;  4S2O A;  4FD8 A;  2V2F F;  3FKV A;  4EBN A;  2A24 A;  2XQZ A;  2EXB A;  2WUQ A;  3QNC A;  4Y15 A;  3G34 A;  4WN5 A;  1SKF A;  4OLG A;  1DJB A;  3G2Y A;  1OTA A;  3MZD A;  4C6Y A;  4HBT A;  1YLT A;  1S4R A;  5FEF A;  3V67 A;  4GS9 B;  2WYX A;  2DCF A;  1TS7 A;  2HP6 A;  4I5S A;  1YMS A;  4BJP A;  4CLC C;  5FAO A;  2ZC7 A;  4MCW A;  3KSF A;  2ZQ9 A;  3V50 A;  5TR7 A;  3BM6 A;  3VE4 A;  3LEQ A;  4M4X A;  4DXC A;  5DJT A;  3C7U A;  4MBH A;  5CED A;  4KG2 A;  1IYS A;  3DTM A;  2JKR I;  3QNB A;  3QP8 A;  1ONG A;  4Z1W A;  1ZG6 A;  3M2J A;  3N8S A;  3EEA A;  2ZM0 A;  5CGS A;  5BOH A;  1SKO A;  3UY6 A;  1NWZ A;  5A92 A;  1GCE A;  3IXD A;  3PBR A;  3IXB A;  2LB5 A;  3DBA A;  3A0V A;  1CK3 A;  2W1T B;  4BBV A;  1BLC A;  5FSR A;  4E6X A;  5HZH A;  3MXS A;  4S2N A;  5FAQ A;  4GLQ A;  2WKE A;  5IHV A;  3MXR A;  3BLM A;  1I2S A;  3C5A A;  1Q2Q A;  2V8C A;  2V0W A;  3ULF A;  5FDH A;  1PW1 A;  3A0R A;  2D01 A;  3IWI A;  3F1P B;  1H0M A;  1PWC A;  5EM1 A;  5F1F A;  1YSQ A;  5EVI B;  4KUO A;  1PZO A;  4X1M A;  1VET A;  3HLG A;  3VSK A;  3ZG5 A;  4WZ5 C;  5EVI D;  3HUO A;  2AVX A;  1MWR A;  5FI6 A;  1TEM A;  4MN5 A;  2Y2N A;  4EUV A;  2Q9M A;  5FAS A;  3RFB A;  3AGF A;  3UNW A;  2XRO A;  1NLY A;  3VMA A;  2Y2O A;  1KVL A;  5F68 A;  1A0K A;  4MNR A;  4QY5 A;  2M7U A;  4E3L A;  4EUZ A;  4Y7P A;  1HVB A;  1H8M A;  1YM1 A;  4G3K A;  4MN6 A;  4BD1 A;  3CIT A;  3NC8 A;  2VGL S;  4OOL A;  3G2Z A;  4H8R A;  4QU3 A;  2B02 A;  4FUW A;  1K57 C;  3NHQ A;  5L2F A;  1BUL A;  4QJG A;  2P08 A;  4YNR A;  2WGW B;  3TSG A;  4KZ5 A;  1ODV A;  4F3L B;  4KZA A;  1CJF A;  5IS1 A;  2C6W B;  4DDS A;  5A8B A;  2W3F A;  1K55 C;  5HPF A;  4X53 A;  4R23 A;  3EGX C;  4JLF A;  2Y79 A;  3SZT A;  2OAP 1;  3PTE A;  2DNS A;  2L1M A;  2G2W A;  2J8Y A;  1RP5 A;  3QP4 A;  3UE6 A;  2Z2M B;  3D9Y A;  1NYM A;  2UV0 E;  2XSS A;  5HAP A;  3NOT C;  3S7N A;  1E25 A;  2VGK A;  3BYD A;  3G6O A;  3DAV A;  1XJ3 A;  3SOI A;  3QP1 A;  3LIF A;  1GA9 A;  2V1A A;  1MXO A;  4CLC E;  4ZJ1 A;  1NYY A;  2JKT M;  3BQA A;  2WZX A;  2PR5 A;  2H5S A;  5HD5 A;  4OPY A;  1JNU A;  4DDY A;  2GDN A;  1VEU A;  1VM1 A;  5L8M A;  4CLC B;  5L10 A;  1L0F A;  3V39 A;  5CHJ A;  2OLU A;  4WMC A;  2XDM A;  3E4P A;  1GSV A;  3M2K A;  5AQ9 A;  3VOL A;  5F82 A;  4CLC D;  1W79 A;  1Y54 A;  2E8I A;  3UB8 A;  3P98 A;  3WS2 A;  2J7V A;  3VP1 A;  2B18 A;  4LRY C;  3LYX A;  3FZC A;  5FQM A;  3N6I A;  5L09 A;  5HDD A;  5DF9 A;  2QMI A;  1ES2 A;  3LIC A;  4LCL A;  5HDC A;  4OQI A;  5M18 A;  1MPL A;  3IS2 A;  1YPR A;  3SH8 A;  2Y91 A;  5GLA A;  3CAX A;  2B5R A;  3LR4 A;  1NRJ A;  4JXG A;  4O0P A;  3Q7Z A;  2EXA A;  3TJZ C;  5E2H A;  3E2K A;  4LGW A;  3HJK A;  3IH9 A;  3PAG A;  4PMA A;  4LV2 A;  3HRE A;  1L3L A;  1C3B A;  3IH8 A;  3IBJ A;  1LSW A;  1ONH A;  3LFV A;  3D3O A;  3K3C A;  4GZB A;  3GDI A;  1SZV A;  1YLW A;  5AVF A;  2ZM2 A;  2HP9 A;  5FQQ A;  4DE1 A;  1FCN A;  3SH9 A;  4LLO B;  4C75 A;  3C38 A;  4P87 A;  4KZ3 A;  1F9I A;  2FFF B;  5EOE A;  5IT5 A;  2V0U A;  4R4S A;  5HX9 A;  4PM9 A;  3U4L P;  3IF6 A;  1XJ2 A;  1IOU A;  4MMN A;  1GA0 A;  4GHI A;  3UB7 A;  5HW3 A;  2NUT C;  1HD8 A;  1PNE A;  4R3J A;  4O01 A;  3KSG A;  1XXM A;  1N9N A;  3MF0 A;  4EES A;  1LT0 A;  2RCX A;  3S22 A;  4B93 A;  2EFX A;  1ESU A;  1NZU A;  4R38 A;  2Y2G A;  2Q9N A;  3EOI A;  2A2L A;  3N4I A;  3PXP A;  4I3A A;  2I9V A;  5M1A A;  3IQA A;  1XGJ A;  3IX3 A;  4GDB A;  5KZH A;  5GLC A;  1YLY A;  3ZQ5 A;  1EWZ A;  3ZFZ A;  1FR6 A;  1XKZ A;  4L0L A;  4P6B A;  4OPR A;  4BQM A;  3TG9 A;  2JCH A;  4XT2 B;  5DTT A;  5E2F A; 
#chains in the Genus database with same CATH homology
 2EWW A;  4E04 A;  3W2Z A;  3F1O A;  4I38 A;  1LSX A;  3EQU A;  5LBR A;  4YWZ A;  2ZMV A;  3LIB A;  2JKR M;  2A24 A;  4IHQ A;  3OC2 A;  3IS2 B;  2QWS A;  1MKM A;  3S7O A;  3T4L A;  2K7S A;  4WN5 A;  2K31 A;  1XFQ A;  2QYB A;  2Z6D A;  1GSW A;  4L9F A;  4KQD A;  5F6A A;  1OTA A;  1S4R A;  3V67 A;  4L9G A;  4GS9 B;  1TS7 A;  4I5S A;  5KIZ A;  4BJP A;  4CLC C;  3H9W A;  4WF0 A;  3T4O A;  1X0O A;  4MCW A;  3KSF A;  3NOU C;  4RQ9 A;  2ZBB A;  4DJ2 A;  4WEL A;  4JGR A;  2O9C A;  3E0Y A;  3UMD A;  3FC7 A;  3VE4 A;  4HJ3 A;  4M4X A;  2P7J A;  3H82 B;  1VB6 A;  5DJT A;  4G3W A;  2J3T D;  5J4E A;  1OTD A;  2OWH A;  4WEK A;  2V1B A;  3JVU A;  3E4O A;  3LR5 A;  2HGV A;  4HH3 A;  4HQA A;  2JKR I;  4F3L A;  3OOV A;  4NXE A;  1D06 A;  5HSQ A;  4KQO A;  4Z1W A;  2BAS A;  2PYR A;  1MZU A;  4JGQ A;  2VV7 A;  4P6Z S;  2PT7 A;  2GZA A;  3PBT A;  3EEA A;  1H3Q A;  3OCL A;  4LPZ A;  1NWZ A;  4H6J B;  1YSP A;  3PBR A;  1YKD A;  4K08 A;  2LB5 A;  2HV1 A;  3DBA A;  3A0V A;  2W1T B;  4BBV A;  2VA0 A;  4HIA A;  4I3J A;  4UEY A;  1T1B A;  5HZH A;  2D02 A;  4GHI B;  3IBR A;  3T4J A;  1OJ5 A;  1TS0 A;  4PAU A;  1P9W A;  2WKR A;  5I5L A;  2YKF A;  3R7W B;  4LRX C;  3CWF A;  4DJ3 A;  3F1N A;  4GLQ A;  4KUK A;  2HF6 A;  4JGO A;  1OT9 A;  1XJ4 A;  2O99 A;  2VJW A;  4MDZ A;  2Y8H A;  2V0W A;  3KSH A;  4NXF A;  1S1Y A;  3ULF A;  4II7 A;  2XA7 M;  2OAQ 1;  5TBM A;  2CMN A;  3A0R A;  2D01 A;  3F1P B;  1TS6 A;  3BWL A;  4CQH A;  2W1R A;  1YSQ A;  2O9B A;  3MJQ A;  4ETZ A;  4UQI S;  4KUO A;  2PD8 A;  1T1A A;  4DMZ A;  4ARZ B;  1DP8 A;  4GJ4 A;  1P9R A;  3ICY A;  3EWK A;  4FSF A;  4MN7 A;  3NJA A;  2L0W A;  5DKL A;  1WA9 A;  1TD5 A;  5HD3 A;  2PD7 A;  3T4S A;  4PHT A;  4MN5 A;  4BWI A;  3E98 A;  4XT2 A;  2R78 A;  4EUV A;  4HI4 A;  1ZHH B;  3FPV A;  3LIA A;  3RFB A;  3ZYT A;  3H7W A;  1W63 M;  1EW0 A;  1N9L A;  3EGD C;  2W0N A;  4PKY A;  5G4Y A;  4NKP A;  2GJ3 A;  1NLY A;  2XRO A;  2Z6C A;  5F68 A;  4QPR A;  4EXO A;  3SW1 A;  5F69 A;  2M7U A;  3TRC A;  3JVV A;  1UGU A;  2MJ6 A;  2PDR A;  1H8M A;  2W3E A;  4G3K A;  4MN6 A;  3CIT A;  3UME A;  3PBQ A;  2VGL S;  2FZ0 A;  3PBS A;  4OOL A;  4FOF A;  3TW8 A;  2B02 A;  3O5Y A;  3PBN A;  1OTI A;  4GS9 A;  2QKP A;  4R70 A;  5HWT A;  5EFW A;  2VV6 A;  2PHY A;  2W3G A;  3EQV A;  3NHQ A;  3B33 A;  4WLA A;  3KSI A;  3LI8 A;  2P08 A;  4YNR A;  2XRN A;  1DP6 A;  1P0Z A;  3LID A;  3UB9 A;  1ODV A;  1OJG A;  2KX6 A;  5F5Y A;  3VV4 A;  4F3L B;  5IS1 A;  4NXG A;  2DMW A;  1MC0 A;  3KO6 A;  4I3I A;  5FL3 A;  5HDS A;  2W3F A;  5A8B A;  2PR6 A;  2O0Y A;  2V9A A;  3OCN A;  5HPF A;  3EGX C;  2Y79 A;  5DKK A;  3OLO A;  1STZ A;  3PHY A;  3BY8 A;  1T1C A;  2OWJ A;  2OAP 1;  2LB9 A;  4Q0H A;  2VZW A;  3A0S A;  4L9E A;  4HP9 A;  2JHE A;  4EW7 A;  2QJ5 A;  5J7E A;  3K3D A;  1V9Y A;  2L1M A;  5HWW A;  3VE3 A;  2H28 A;  2VEA A;  5KSH A;  3UE6 A;  4HJ4 A;  3P01 A;  4HNB A;  1T19 A;  2XSS A;  2J3T C;  3HJI A;  3LI9 A;  3NOT C;  2EA9 A;  3S7N A;  5J3W A;  4AFI A;  4IJG A;  5C5K A;  1BYW A;  4HHD A;  4IUK A;  3RH8 B;  3G6O A;  2KOI A;  1XJ3 A;  3LIF A;  3S7Q A;  2QJ7 A;  2V1A A;  2ZMF A;  3R7W A;  3MR0 A;  4CLC E;  3CUE C;  4IUH A;  2JKT M;  4GCZ A;  3BQA A;  2PR5 A;  5HD5 A;  3MXQ A;  2ZOI A;  1JNU A;  2HJE A;  3BW6 A;  2VV8 A;  1F5M A;  3MMH A;  4HP4 A;  1TS8 A;  1S1Z A;  2GX5 A;  5L8M A;  4GW9 A;  4UQI M;  4Y3I A;  4CLC B;  2FH5 A;  3FG8 A;  2NUP C;  3BY9 A;  2M1C A;  1ZTU A;  4EQ1 A;  4HOI A;  2KLI A;  2XA7 S;  3F1P A;  3E4P A;  1GSV A;  3B47 A;  1G28 A;  2OOL A;  3VOL A;  3C30 A;  4CLC D;  3F1O B;  2L4R A;  3C8C A;  5HPI A;  3UB8 A;  2ZOH A;  1KOU A;  4BBU A;  4PKY G;  1F98 A;  4NEE D;  2A24 B;  4WUJ A;  4ARZ A;  2B18 A;  4EEU A;  1VHM A;  4YOF A;  4BBT A;  5DFX A;  4LRY C;  3BJN A;  3LUQ A;  1S67 L;  3LYX A;  4DN0 A;  1OT6 A;  2WKP A;  5MC7 A;  5HDD A;  4R6L A;  4G3V A;  5DF9 A;  4JGP A;  3LIC A;  2J80 A;  2J3W A;  5HDC A;  2VKS A;  3H7W B;  4ZRR A;  3IS2 A;  2JKT I;  4BMW A;  3CAX A;  2JN7 A;  3EEH A;  2K2N A;  2WKQ A;  4O8G A;  5TJJ A;  3LR4 A;  4Q0I A;  1NRJ A;  4O0P A;  1GSX A;  2GNX A;  5G4Z A;  1UWN X;  1LL8 A;  3PYP A;  3MFX A;  2VGL M;  3TJZ C;  1DP9 A;  3C2W A;  2IA2 A;  3HJK A;  3KYZ A;  1S4S A;  1G6O A;  2O9A A;  3IBJ A;  1LSW A;  2QHK A;  4I39 A;  3TE8 A;  3LFV A;  1T18 A;  3P7N A;  4HJ6 A;  1Y28 A;  3D3O A;  2HJ9 C;  3K3C A;  4ETX A;  3U2A A;  3GDI A;  3MQO A;  2PYP A;  3NOP C;  4WEJ A;  3S7P A;  4HY8 A;  3UE3 A;  3H82 A;  4LRZ E;  2W3H A;  4P6Z M;  5AVE A;  5AVF A;  2VLG A;  3LR0 A;  1DRM A;  3OBF A;  3CUE A;  4B9O A;  3BQ8 A;  3MQQ A;  3CI6 A;  3T4Q A;  3R4K A;  3D72 A;  2INW A;  3PR6 A;  3T4T A;  3T50 A;  4LLO B;  3FPW A;  4R3A A;  3CLO A;  4EEP A;  1YAX A;  4HH2 A;  2VX8 A;  5HL6 A;  3C38 A;  3LR3 A;  3PBO A;  4OOM A;  3GEC A;  1F9I A;  5IT5 A;  2P04 A;  3KX0 X;  4EET B;  1N9O A;  2V0U A;  1OTB A;  4H6J A;  2W27 A;  1UWP X;  4ME4 A;  1XJ2 A;  1IOU A;  2W1T A;  4MMN A;  5IU1 A;  4NXB A;  4GHI A;  3F1N B;  5AJG A;  3UB7 A;  1V9Z A;  5HWV A;  2NUT C;  3RTY A;  1P97 A;  1XJ6 A;  3B42 A;  4O01 A;  2KDK A;  3KSG A;  4Y2F A;  3E4Q A;  1N9N A;  3MF0 A;  2EWV A;  4EES A;  1S66 L;  5DFY A;  1LT0 A;  5TBM B;  4EER A;  4B93 A;  1NLZ A;  4R38 A;  3EOI A;  1IFQ A;  4Y5F A;  2A2L A;  5DJU A;  3PXP A;  4I3A A;  4Q0J A;  3HCY A;  2I9V A;  2YKH A;  5K5B A;  3UB6 A;  3K2N A;  4WL9 A;  1TF1 A;  2G7U A;  3LIE A;  1XFN A;  3ZQ5 A;  1OPX A;  3T4K A;  1OTE A;  1LSV A;  1D7E A;  4CLC A;  2M7V A;  2W3D A;  3KYQ A;  5CX7 A;  4EU0 A;  3MQ0 A;  4L0L A;  4XT2 B;  1W63 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...