3W2ZA

Crystal structure of the cyanobacterial protein
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
178
structure length
178
Chain Sequence
SGLVPRGSHMAVSKVMEKILRVSNIDKIFQTTTQEIRQLLKCDRVAVYRFNPDWSGEFVAESVGSGWVKLVGPDIKTVWEDTHLQETQGGRYRHQESFVVNDIYEAGHFSCHLEILEQFEIKAYIIVPVFAAEKLWGLLAAYQNSGTREWVEWESSFLTQVGLQFGIAISHAEYLEQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Methyl-accepting chemotaxis protein
publication title Structures of cyanobacteriochromes from phototaxis regulators AnPixJ and TePixJ reveal general and specific photoconversion mechanism
pubmed doi rcsb
source organism Nostoc
total genus 60
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3w2zA00
2XRNA 3MF0A 1MKMA 4RQ9A 5HL6A 3NOPC 1STZA 3MMHA 4G3KA 2O99A 4O0PA 3G6OA 3KSHA 4ETXA 4O8GA 1VHMA 3RFBA 3KSGA 5TJJA 4Y3IA 1YSQA 2W3GA 4G3VA 4IUKA 4LRXC 4Q0HA 4BWIA 3HCYA 4IJGA 3KO6A 2W3DA 5L8MA 4R70A 3S7OA 2GX5A 2QYBA 2W1RA 2ZMFA 2VZWA 3LFVA 3TRCA 2LB5A 4FOFA 5AJGA 4O01A 3OOVA 2OOLA 4G3WA 2HGVA 3S7PA 3C2WA 3R4KA 4Q0IA 1MC0A 1ZTUA 2VKSA 4CQHA 3DBAA 1YKDA 1TF1A 2XROA 3IBRA 3E98A 3EEAA 4MCWA 2Y8HA 4YNRA 4IUHA 1TD5A 4GW9A 3E0YA 4YOFA 2K31A 5LBRA 4ZRRA 2XSSA 5HSQA 2W3HA 3KSIA 4R6LA 4PAUA 3W2ZA 4QPRA 4MDZA 1F5MA 3CI6A 2G7UA 2O9CA 4MN7A 3CITA 3KSFA 5HPIA 4LRYC 3D3OA 4GLQA 2VEAA 1YSPA 2KOIA 2O9AA 4Y2FA 3NOUC 5HPFA 3NHQA 5C5KA 2W3FA 2B18A 3OBFA 4ME4A 3MQ0A 4MMNA 2W1TB 2VJWA 4EU0A 3NOTC 2W3EA 3IBJA 5DFXA 4ETZA 2IA2A 3ZQ5A 2KLIA 5DFYA 2M7VA 2LB9A 3S7NA 2O9BA 4Y5FA 3VV4A 2O0YA 4DMZA 2M7UA 4Z1WA 3S7QA 4LRZE 4Q0JA 3O5YA 3K2NA 5K5BA 2Y79A 4EUVA 3BJNA 2W1TA 2K2NA 4E04A 5I5LA 4DN0A
chains in the Genus database with same CATH superfamily
3FKWA 3MF0A 4PHTA 1GSVA 3VP4A 4LPZA 4PKYA 1FSWA 3HLFA 4WF0A 3C8CA 2Y2IA 3IWQA 5G18A 3C7UA 1IKGA 1DRMA 3MFXA 4II7A 5TJJA 2HZ5A 5HD3A 3AGEA 4BENA 4QD4A 3EOIA 3WRTA 4F3LB 4G3VA 4IUKA 1MWTA 3DTMA 2OAP1 2JKTM 1GSWA 3U4LP 3KYEA 2BTFP 3IS2A 2XGNA 4OOLA 1MC0A 2HDQA 2Y91A 1OTDA 4GW9A 5IHVA 1TS8A 5GLAA 1KGFA 1KVMA 5HSQA 1N9NA 3W2ZA 4Y0OA 3IXGA 2VEAA 3M2KA 3RTYA 4HY8A 2ZQ9A 3SS3A 3V67A 3TE8A 4Y7PA 4OKPA 1FIKA 5HX9A 4CPKA 2XFSA 3CMZA 3ZCZA 3UB9A 2W27A 5GHYA 5FEGA 3IX3A 2E8IA 3VE3A 1XFNA 2HP5A 4EW7A 3Q1FA 1NLYA 4WYYA 3FZCA 1UGUA 3A3JA 1T1CA 3F1NA 4N9LA 5FI6A 2H28A 3O5YA 2WZXA 1PWDA 4QB8A 4BD1A 3NJAA 2G2WA 1ES2A 3UPNA 4OPRA 1PFLA 2Z6DA 1C3BA 2Y59A 5FEFA 5CERA 1L0EA 2HJEA 4R70A 4BLMA 4P87A 5HFOA 2QJ5A 2ZC7A 2L4RA 3NECA 3W8KA 4Z9QA 3UDXA 5DKKA 1JWPA 1YMXA 5EVIC 3ICYA 1SKOB 3BQ8A 5DF9A 3Q7VA 4UAAA 1ZG4A 4PM7A 4QWOA 5DVAA 5KSCA 3NC8A 4UA7A 4ZJ1A 2R9XA 3VFHA 4RYEA 1ZC2A 3L7HA 5BOHA 1TDGA 2W3HA 3W4QA 1G6OA 1VM1A 1WYCA 1K57A 4OQHA 5F1GA 2KOIA 1VQQA 3IH8A 1HD8A 1FCMA 3BEBA 4R4RA 3V3RA 4HEFA 3UE3A 4CLCC 4P6ZS 4ME4A 3I7JA 2VJWA 3GV9A 2WAEA 3IQAA 3WS2A 1W5DA 3UPPA 2ZC4B 2JHEA 5A92A 1H8ZA 4BMWA 2H0TA 3QP1A 3IF6C 2D02A 3K2NA 1JWVA 3BJNA 1TS7A 2XRNA 4LENA 1TVFA 3CHWP 3NOPC 5F83A 4CLCE 2Y2GA 5EUAA 4JGPA 1ERMA 1LL9A 3H7WA 3LICA 5FI2A 3K3CA 4HJ4A 2PBDP 3N8LA 3E4OA 2DCFA 4R3BA 4BBTA 1G68A 4Y17A 4RA7A 5EM0A 2WKHA 4LV2A 1XP4A 4IJGA 3LIFA 4OONA 2QYBA 4LLOB 4OOYA 1F2KA 4QJGA 2ZMFA 5EOOA 5J7EA 1YLYA 4ARZB 3MKFA 2P08A 2V1AA 4HI4A 1YLPA 3C7VA 2PD7A 1EROA 1LHYA 2B95A 2V1ZA 1ODVA 4F3LA 4ZRRA 2EFXA 3HUMA 4CJNA 4A5RA 1NXYA 4KZ4A 3ZDJA 2PHYA 3GECA 2QMIA 3FWLA 2KDKA 3MSHA 2I9VA 4FH2A 4P0MA 4WM9A 2DRWA 2GZAA 4WZ5A 4KZ9A 2IWBA 1NYMA 3H82B 1XA7A 3PBTA 3G32A 3T50A 2W1TB 4IHQA 1SZVA 3PYPA 3CPTB 1EW0A 3MQQA 2UV0E 3ZYTA 1BYWA 2KLIA 4UHUA 4X1LA 2V2FF 4JGOA 3P09A 3S7NA 2PYPA 1DP6A 1OTIA 4BD0A 3M6HA 3S7QA 2Y79A 3EGXC 1VEUB 2ZD8A 2Y2PA 2Q9NA 3T4LA 1P97A 1ALQA 5GLDA 1L3LA 5E2HA 1YLWA 5GL9A 4HH2A 1XGJA 2WUQA 5FQKA 1VHMA 4PM8A 2XEPA 3A3IA 2HDUA 1KE4A 3WRZA 3O3VA 5L8MA 4X55A 1ZKJA 3HREA 1DP9A 4KG6A 4S2NA 3CUEA 4O01A 3IXDA 4ZAMA 4Y13A 3BM6A 4S2JA 4WZ4A 3C38A 1XX2A 2XROA 1S66L 2OWJA 4MBHA 3FPWA 3C4OA 3MZDA 3OLOA 1LL5A 3MBZA 4KENB 5DTKA 1YLTA 3OZHA 1JNUA 2XD5A 3D3OA 3SOIA 4UA6A 3G2ZA 3NOUC 2XD1A 1XGIA 2ZQ8A 3MQ0A 3MR0A 1SDNA 3OPHA 1IYPA 4F94A 4LV3A 2Y2HA 2LB9A 4KQQA 1IELA 3WS1A 3CG5A 3F1NB 3DTKA 4B9OA 5CXWA 4UA9A 2M1CA 4M4XA 2WAFA 1A0KA 2X02A 3UN7A 2HP9A 4I3AA 1CF0A 1GSXA 1K38A 1YT4A 3T12B 1GHMA 2PRFA 4DE3A 1BSGA 5EFWA 1OPXA 1I2WA 4GS9B 4EEUA 3KX0X 1K55C 1UWNX 1LT0A 3F1OB 3JPUA 3UPOA 1PW8A 1CI9A 3MXQA 1H8MA 4HNBA 1FCOA 1NZUA 2VV8A 3K3DA 4HIAA 2W1RA 4C6YA 4IVIA 2ZC6B 4R3JA 5EV0A 5AQBA 2VGLS 3G31A 2EA9A 4U0XA 2ZJ9A 1YLZA 3OPPA 2P04A 3TG9A 4C3QA 4DE1A 4S2KA 4JKTA 4EQIA 1NWZA 4ZJ2A 4BL3A 3GTCA 4LRYC 3UDIA 4X68A 4PPRA 1K56A 5HPFA 5CGXA 3OBFA 1KGGA 4KQRA 2MJ6A 2IA2A 5CX7A 1D1JA 5HD5A 4NXBA 3IHBA 3LUQA 4OPQA 4EERA 4P85A 2PU2A 1I2SA 2BG1A 4E6XA 4EUVA 2W1TA 2VV7A 3CPTA 4NXGA 2A2LA 1ES3A 1CJFA 4OLGA 3G30A 3W4PA 5F82A 4N1HA 4IEDA 1W7FA 2ZQ7A 2ZM2A 3OPRA 2P7JA 2Y2JA 2WKEA 1LSWA 2ZM0A 1GCEA 3PR6A 3CLOA 4YINA 3LR4A 2YKHA 4GHIA 1S67L 1ES4A 4QY6A 1NJ4A 2EWWA 4HJ6A 3GDIA 4CQHA 2VKSA 4GOGA 5FATA 4HOIA 4IUHA 5LBRA 1X0OA 3HLBA 4BQMA 2XFTA 5FAPA 3NY4A 1TS0A 1S4RA 1PI5A 1LLBA 1W63M 1PZOA 1NZOA 3N7WA 1FCNA 4R6LA 1F5MA 2H10A 4FH4A 2J80A 3MS6A 1EWZA 1JTDA 3VFFA 4WMCA 3CJMA 1D06A 3UDFA 5AQAA 2WADA 4EU0A 1K4EA 3R7WB 1BLHA 1AWIA 3HLGA 3BFCA 3OCNA 4HBTA 2W3EA 3S1YA 2JN7A 4ETZA 3MZEA 3PAEA 4WUJA 4S2LA 2X71A 3B3XA 3V50A 5DKLA 3GR2A 3M2JA 1E4DA 4KZ5A 5HW3A 2QPNA 2CC1A 3LY3A 4EQ1A 4Y0UA 5F69A 3BQAA 3IF5A 2BASA 3PTEA 1GHPA 2V0UA 1KDSA 5J4EA 2PAVP 2IWCA 2ZC3B 5CTMA 5G4ZA 4N9KA 2WKIA 4X69A 4OP8A 4ESPA 4GB7A 4LV1A 4O8GA 2EWVA 4LCMA 5FQJA 1W8YA 4Y3IA 2PR6A 3OPLA 4BWIA 2RCXA 4YWZA 2C5WB 3ULFA 2QWSA 4DJ2A 4GS9A 1K56D 1BT5A 4WEJA 3IT9A 1L0GA 3R4KA 1ACFA 4OOMA 3UMEA 3F1OA 2EFUA 4S2MA 3P01A 4I5SA 3E98A 5AVFA 4X25A 2NUTC 3UY6A 4OQIA 4N92A 3FG8A 2UWXA 3O87A 4MN7A 3NDEA 1L2SA 3BFDA 2HDRA 2KX6A 2WGWB 5FDHA 1WYBA 4HP4A 4WL9A 4RX3A 4JXSA 5EVID 3QP5A 4H6JA 4Y5FA 4EESA 4OQ0A 1U60A 4X53A 3PBSA 4I3IA 1CEFA 2K7SA 4ZJ3A 1F98A 2BLSA 1K54A 4OH0A 4DXBA 4JF5A 3JVUA 5EVEA 3SW1A 3SH9A 3PXPA 5KZHA 4K08A 3QNBA 3B47A 1N9BA 5DTTA 1HTZA 4KZBA 4GDBA 1Z09A 5DJUA 2W0NA 3EQVA 1T19A 4X1MA 3SS5A 2VA0A 3ZNYA 2ZBBA 4Q0HA 4WLAA 4XUZA 4ID4A 2YKFA 3N6IA 3T4OA 3UB7A 4XT2B 2JCHA 4WMCD 3LR3A 4KG5A 3N8RA 5CTNA 5HARA 3BFEA 3E0YA 2GJ3A 4ZBEA 2IWDA 4MEZA 2E8JA 2VGJA 1K6RA 3EQUA 1W8QA 3JYIA 4Y0TA 2DMWA 4R38A 2WGVA 2XK1A 4L9EA 1G28A 3Q7ZA 3DWZA 3IH9A 1OMEA 3NULA 1J9MA 1PRQA 4DJ3A 5CECA 1Q2PA 1S6RA 4HESA 2Y2LA 1JVJA 4PKYG 1L0FA 4HBUA 1ESUA 4H8RA 1Y4OA 4E6WA 1N4OA 3T4TA 4K91A 4Q0JA 1GA9A 4HJ3A 3VP0A 3A3EA 5KMWA 5M1AA 3R7WA 3LI9A 4RQ9A 4JF6A 1DJBA 2A3UA 2RL3A 4G3KA 4L0LA 2OAQ1 3HLDA 4XUXA 4S2PA 3C4PA 5CEDA 1FR1A 3EGDC 3LEZA 3U2AA 4Q8IA 4OPZA 3ISGA 5EPHA 1QMEA 3V5MA 3OCLA 3LCEA 3PBNA 4DF6A 3UB8A 2GX5A 1CQAA 4X6TA 2JKFA 4PM5A 2VZWA 4GHIB 5E2GA 3TRCA 2ZM8A 3NDGA 3OOVA 1RGZA 5E2FA 3C2WA 5CHMA 1NYYA 4BBUA 4FSFA 2EX9A 2EXAA 2ACGA 2Y2OA 4YNRA 4E3NA 5CEBA 3CZDA 2K31A 4EBLA 3T4QA 3V3SA 4YFMA 5IU1A 1IFQA 1K57C 3BY8A 4P6BA 3VP2A 3CITA 3KSFA 3MXRA 3TOIA 1K25A 1H3QA 1NY0A 5F1FA 3P98A 4QY5A 1BTLA 1H0MA 5M18A 4DE0A 2EX6A 4HQAA 1MWRA 3BW6A 1XFQA 4E3LA 2P9VA 3GVBA 1BLPA 2PU4A 3DWKA 4NETA 5AQ7A 2OSUA 2J8YA 1P0ZA 1KE3A 3C30A 3PBQA 3ZVTA 2ZL1A 5HL1A 2Z2LB 2WGWA 4DN0A 3IWOA 3DW0A 5TBMB 2ZLYA 4GKUA 2JKGA 4HHDA 1BZAA 1RGYA 3DTEA 3G4PA 1I5QA 3LI8A 1UWPX 1T1BA 4XXRA 3NIAA 3QHYA 5FQ9A 3ZG7B 2WKPA 5CRFA 2D01A 3PBOA 3T1XA 3GQZA 2OLUA 5HDSA 3E4PA 1SHVA 1OTAA 5KSHA 2V8CA 4OP5A 1XPBA 5FASA 2J3TD 1LSVA 3DBAA 2VLGA 3EEAA 4U0TA 1LI9A 3A0SA 2XSSA 4LGWA 4KUKA 1HVBA 2C6WB 4B88A 1SDEA 3KSIA 3UO9A 4B4ZA 4XT2A 5HPIA 4WZ5C 1MWUA 1PW1A 4Y2FA 5HWTA 4JLFA 3HBRA 2Y2NA 4MN5A 5L07A 1Z6FA 3GRJA 4LFUA 3D9YA 2CMNA 2Y2MA 3ZQ5A 3W4OA 1FQGA 1K0KA 2QHKA 3TW8A 2HDSA 3VV4A 4H6JB 4FTXA 2M7UA 2PR5A 2XA7M 1MPLA 1TS6A 1DY6A 3T1RA 3ZGAB 1P9WA 3HUNA 4QU3A 5J3WA 1WA9A 3DTIA 3VSKA 3Q07A 4I3JA 4IVKA 2O99A 3KYZA 3JVVA 4U3TA 3UE0A 5HWVA 1PZPA 3VSLA 2XH9A 3KSGA 4DDYA 4I39A 2EX8A 2JBFA 3F1PA 3A0VA 2JKRI 1ERQA 3NBLA 5HAPA 1LSXA 2J7VA 4S2NC 3CUEC 3LFVA 4PMAA 2WK0A 2HGVA 4OPYA 4S2OA 2R9WA 1ZTUA 5EVIA 2EXBA 3MJQA 4R3AA 5DTSA 4MCWA 5FQIA 3T1SA 5F5YA 3EWKA 1ONGA 2XA7S 3KYQA 1TDLA 2JKRM 2EX2A 4NKPA 2O9CA 3O88A 1E3UA 1S0WA 4JXWA 4ZDXA 2O9AA 4NXFA 2XR0A 4DXCA 3NHQA 1IYSA 4D60A 2J9PA 2B18A 4CLCA 3VMAA 4R1GA 4R23A 1IYOA 4QHCA 1XA1A 4WBGA 1ESIA 4EETB 1CEGA 2H5SA 3ITAA 4E3IA 3V39A 2O9BA 3FV7A 2Y2KA 2O0YA 1K4FA 1IKIA 3D4FA 3ZNTA 4NK3A 1OJGA 4KQDA 3HVFA 5EM1A 3IF6A 4HH3A 3MXSA 1N9LA 1NLZA 2K2NA 2V8FA 2ZMAA 3HL9A 2JC7A 5E43A 5DF7A 5L2FA 3QP4A 4BJPA 1DJAA 4KZAA 3LIDA 2PBYA 5CHJA 3IWIA 4ETXA 2OV5A 4MN6A 4EBPA 2WZZA 3RXXA 2X01A 5FAOA 3HLCA 3O86A 5FAQA 1GA0A 2XDMA 4K0XA 1XJ2A 5JYPA 1G6AA 5F6AA 1XJ4A 4GZBA 5FDSA 3FKVA 5TBMA 4FOFA 1YLJA 3GSGA 2Y4AA 4JBFA 3LO7A 1JTGA 3ZG8B 2GNXA 3BWLA 4JXVA 3M6BA 2PDRA 1MWSA 2HP6A 2HPBA 4E3KA 1CK3A 3T4SA 4I38A 3IHAA 2G2UA 1MY8A 4GD6A 1ZG6A 4PAUA 1ZHHB 3HLWA 1PWCA 4KG2A 1HLUP 3RH8B 1YAXA 5C5KA 3LIBA 3TSGA 1MXOA 3BLMA 3C5AA 3PHYA 5IS1A 2L1MA 2V9AA 4GJ4A 2HV1A 2P9VB 5EECA 3QP2A 3QP6A 2ZQDA 4P6ZM 3SH8A 1IOUA 2ZMVA 1IYQA 2ZQAA 5A93A 1VB6A 1S1YA 3WS0A 2ZL1B 4E04A 2M7VA 1XXMA 3EEHA 1MKMA 1J3WA 1VETA 1S4SA 1F9IA 1STZA 2XLNA 3VP1A 2PD8A 5A90A 2J3WA 3H9WA 3A3DA 3ZFZA 2A49A 2Y2QA 3ZG0A 4NG2A 3RFBA 1CI8A 1YM1A 3T1QB 2QJ7A 1PWGA 1MZUA 4FD8A 4NEED 2W3GA 1JWZA 1KE0A 1NRFA 4N1XA 3VE4A 3HCYA 1W79A 3S7OA 5GHZA 1DJCA 1O07A 5IT5A 4JGRA 1E3UD 5HAQA 4E3JA 4RVAA 3IXHA 3WWXA 2OOLA 4JGQA 4LV0A 4CLCD 3N8SA 4KZ6A 3A0RA 4OLDA 3ZVWA 4YOFA 2FFYA 4BL2A 3UE6A 3LYXA 2HF6A 4K0WA 5CHUA 2VGKA 2WKRA 5HAIA 3WS4A 3CAXA 5FL3A 4L9FA 3RJUA 3B42A 5HDDA 3T4JA 3GMWA 4DRTA 2W3FA 1SKFA 3ZG5A 3NOTC 3LY4A 2Z6CA 4E3OA 2Z2MB 3BFGA 3UB5P 3AGFA 1YPRA 5TR7A 3NI9A 5FQQA 1FSYA 3E2KA 1LI0A 3P7NA 4C75A 1Y28A 4DMZA 5EVLA 4LRZE 3ITBA 2V1BA 3LIEA 2FFFB 1GHIA 3BECA 4DKIA 4RX2A 1YMSA 3ZHHA 5CGWA 2VX8A 1ONHA 4L9GA 3MMHA 5GHXA 1MKIA 5TFQA 4WN5A 1O7EA 3BY9A 3MFDA 1K55A 4ZTKA 2QZ6A 2XF3A 2A24B 5GLCA 1PYYA 4LRXC 3F1PB 4B4XA 5JYOA 2W3DA 2LB5A 2P74A 4EWFA 2FH5A 5L09A 1XJ6A 4EEPA 3S7PA 1HZOA 1PNEA 3Q81A 4Q0IA 1OT6A 4FUWA 5EVIB 4PM9A 1W63Q 1QMFA 5FA7A 1PI4A 1FILA 4IBXA 3UNWA 1H8YA 3IXBA 2WYXA 3IX8A 4EUZA 3SZTA 2V0WA 5MC7A 4GLQA 1FOFA 1M40A 2NUPC 3G35A 2OLVA 3E2LA 2ZOHA 4MMNA 1WE4A 4JF4A 4CLCB 1SCWA 4GD8A 4MBKA 3HUOA 3DAVA 2PT7A 3OC2A 3QP8A 1N9OA 3MZFA 4WEKA 4WELA 1YQSA 3SH7A 4GDNA 1OTBA 4UEYA 4OVDA 2GDNA 3L9KA 4AFIA 2B5RA 2L0WA 4HP9A 1RP5A 1BUEA 3IF6B 4B93A 4UQIM 2XQZA 4EBNA 1XKZA 3HLEA 1K54C 3BYDA 3E4QA 4DDSA 5HDCA 1T1AA 2WGIA 2OWHA 1S1ZA 3G2YA 3RXWA 3S4XA 3IS2B 1YSQA 5J8XA 4JPMA 1M6KA 1AXBA 5FQMA 2WKQA 5I94A 5F68A 1L0DA 3BFFA 3BLSA 1KGEA 2VK3A 4G3WA 5D3OA 1SKOA 1ES5A 1EI5A 5CGSA 2Y8HA 4MNRA 5DJTA 5GLBA 2PYRA 2VGLM 3UB6A 4UQIS 3AGDA 1KDWA 1OJ5A 4MDZA 3IX4A 3TJZC 2R78A 3A3FA 1H5XA 5HZHA 2J9OA 1BLSA 2J3TC 3FPVA 2VV6A 5AVEA 3N4IA 4E3MA 2ZQCA 4OQGA 2Q0OA 2AVXA 5DFXA 2Q9MA 3LGOA 1OTEA 2Y55A 2HJ9C 1BLCA 3QNCA 5G4YA 1NRJA 3FYZA 4X56A 5KIZA 4LCLA 5K5BA 4EV4A 1K6SA 1P9RA 1Q2QA 1IEMA 5I5LA 4MBFA 3LEQA 1G5UA 4Y15A 1VETB 1V9ZA 3SS4A 5HL6A 3UE1A 4O0PA 3LR0A 1KOUA 3VOLA 4BBVA 3LR5A 3G6OA 5HWWA 1TEMA 3WS5A 4KZ8A 4D2OA 4S2IA 3KSHA 3G34A 4GNUA 4R0QA 3UMDA 2QKPA 3FC7A 3Q7VB 5DF8A 2INWA 4FCFA 4R4SA 5M19A 3MQOA 3KO6A 3CWFA 1D7EA 1T18A 4KUOA 5A91A 4M3KA 5EE8A 4IBRA 5AQ9A 5AJGA 3VOYA 4ARZA 5TGFA 1OT9A 4EXOA 3HJIA 1KVLA 3NCKA 2V20A 3LIAA 4KZ7A 2H0YA 1YKDA 1TF1A 2A24A 1MBLA 3IBRA 1TD5A 4DE2A 4KQOA 5A8BA 4GN2A 5E2EA 4NXEA 3PBRA 3BRMA 1FR6A 5FSRA 4QPRA 3CI6A 3S22A 2G7UA 2JE5A 1DP8A 2DNSA 1YSPA 2ZC5B 1BULA 3B33A 3H82A 3PAGA 4KZ3A 4O7DA 5FI7A 3D72A 1RCJA 3T4KA 2ZOIA 2I72A 1XJ3A 4PM6A 3IBJA 2B02A 5EOEA 3ZG9B 5L10A 5DFYA 3H7WB 3VOZA 3VP3A 1Y54A 4MLLA 1PIOA 4JXGA 4Z1WA 2FZ0A 3MKEA 1E25A 3Q82A 4GCZA 3HJKA 1V9YA 2JKTI 1LL8A 1VEUA 5U47A
chains in the Genus database with same CATH topology
3EEHA 3MF0A 4I3AA 1GSXA 1MKMA 4PHTA 4RQ9A 1GSVA 1S4SA 1F9IA 4LPZA 1STZA 4G3KA 4L0LA 2OAQ1 5EFWA 1OPXA 2PD8A 4PKYA 4WF0A 3C8CA 4GS9B 2J3WA 3H9WA 4EEUA 3KX0X 1UWNX 3EGDC 1LT0A 3F1OB 3U2AA 1DRMA 3RFBA 3MFXA 4II7A 2QJ7A 5TJJA 1MZUA 5HD3A 4NEED 3EOIA 2W3GA 4G3VA 3MXQA 4IUKA 4F3LB 1H8MA 4HNBA 3VE4A 3OCLA 2OAP1 3HCYA 3PBNA 2VV8A 3UB8A 3K3DA 2GX5A 2JKTM 3S7OA 1GSWA 5IT5A 4JGRA 4HIAA 2W1RA 2VZWA 4GHIB 3TRCA 3OOVA 3IS2A 2OOLA 2VGLS 3C2WA 4JGQA 4OOLA 2EA9A 4CLCD 1MC0A 1OTDA 3A0RA 4BBUA 4FSFA 2P04A 4YNRA 4GW9A 4YOFA 1TS8A 2K31A 3T4QA 5HSQA 1N9NA 1NWZA 5IU1A 1IFQA 3UE6A 3W2ZA 3LYXA 2HF6A 3BY8A 3CITA 3KSFA 4LRYC 2VEAA 3RTYA 2WKRA 1H3QA 4HY8A 3CAXA 5FL3A 4L9FA 3T4JA 3B42A 5HDDA 3V67A 5HPFA 3TE8A 2W3FA 3OBFA 3NOTC 3UB9A 2W27A 4HQAA 2Z6CA 3BW6A 3VE3A 1XFQA 2MJ6A 1XFNA 2IA2A 5CX7A 4EW7A 5HD5A 4NXBA 1NLYA 3LUQA 1UGUA 4EERA 1T1CA 3F1NA 3P7NA 1Y28A 4DMZA 1P0ZA 4LRZE 2H28A 2V1BA 3C30A 3O5YA 3LIEA 3PBQA 4EUVA 2W1TA 2VV7A 4DN0A 2VX8A 4NXGA 3NJAA 2A2LA 4L9GA 3MMHA 5TBMB 4WN5A 4HHDA 3BY9A 2Z6DA 3LI8A 1UWPX 2A24B 1T1BA 2P7JA 4LRXC 2WKPA 1LSWA 3F1PB 2D01A 2HJEA 2W3DA 3PBOA 4R70A 3PR6A 3CLOA 3LR4A 2QJ5A 2YKHA 4GHIA 2L4RA 5HDSA 1S67L 3E4PA 2LB5A 2FH5A 1OTAA 5KSHA 5DKKA 1XJ6A 2J3TD 3S7PA 4EEPA 2EWWA 4HJ6A 4Q0IA 1OT6A 3GDIA 3ICYA 2VKSA 1LSVA 4CQHA 3BQ8A 3DBAA 5DF9A 2VLGA 4HOIA 1W63Q 3EEAA 4IUHA 5LBRA 1X0OA 3A0SA 2XSSA 4KUKA 1TS0A 1S4RA 1W63M 2W3HA 3KSIA 4R6LA 1G6OA 1F5MA 2J80A 4XT2A 5HPIA 2V0WA 5MC7A 4GLQA 2KOIA 2NUPC 4Y2FA 5HWTA 1D06A 3UE3A 2ZOHA 4CLCC 4P6ZS 4MN5A 4ME4A 4MMNA 4CLCB 4EU0A 2VJWA 3R7WB 2PT7A 3OCNA 2W3EA 3OC2A 2JN7A 4ETZA 2CMNA 2JHEA 3ZQ5A 1N9OA 4WUJA 4WEKA 4WELA 5DKLA 2QHKA 1OTBA 3TW8A 4BMWA 3VV4A 4H6JB 4UEYA 2M7UA 4AFIA 4EQ1A 4HP9A 2L0WA 2D02A 2PR5A 2XA7M 3K2NA 5F69A 3BQAA 2BASA 1TS6A 4UQIM 4B93A 3BJNA 1P9WA 1TS7A 2V0UA 2XRNA 5J4EA 5J3WA 1WA9A 4I3JA 3E4QA 3NOPC 4CLCE 5HDCA 5G4ZA 2O99A 1T1AA 3KYZA 3JVVA 4JGPA 2OWHA 1S1ZA 3H7WA 3LICA 3K3CA 3IS2B 4HJ4A 5HWVA 4O8GA 3E4OA 2EWVA 3KSGA 4Y3IA 1YSQA 2PR6A 4I39A 4BBTA 3F1PA 3A0VA 2JKRI 4BWIA 4IJGA 3LIFA 4YWZA 1LSXA 2QYBA 4LLOB 3ULFA 2QWSA 2WKQA 3CUEC 2ZMFA 5F68A 3LFVA 4DJ2A 4GS9A 5J7EA 4G3WA 4ARZB 2HGVA 4WEJA 2P08A 2V1AA 4HI4A 3R4KA 2PD7A 1ZTUA 4OOMA 3UMEA 3F1OA 3P01A 3MJQA 4I5SA 4R3AA 1ODVA 3E98A 4MCWA 2Y8HA 5AVFA 5F5YA 4F3LA 4ZRRA 5DJTA 3EWKA 2XA7S 2PYRA 2VGLM 3UB6A 3KYQA 4UQIS 2NUTC 1OJ5A 4MDZA 2PHYA 3GECA 3TJZC 2JKRM 3FG8A 2KDKA 2I9VA 2O9CA 2R78A 4NKPA 4MN7A 5HZHA 2GZAA 2O9AA 2J3TC 4NXFA 3NHQA 3H82B 3FPVA 2VV6A 2B18A 3PBTA 5AVEA 3T50A 4CLCA 2W1TB 4IHQA 2KX6A 4HP4A 3PYPA 4WL9A 1EW0A 3MQQA 5DFXA 4EETB 1OTEA 3ZYTA 1BYWA 2KLIA 2HJ9C 4JGOA 3S7NA 2PYPA 2O9BA 5G4YA 1DP6A 4Y5FA 1OTIA 4H6JA 2O0YA 1NRJA 4EESA 1OJGA 3PBSA 4KQDA 3S7QA 5KIZA 4HH3A 4I3IA 5K5BA 2Y79A 1N9LA 2K7SA 1NLZA 3EGXC 1P9RA 2K2NA 5I5LA 1F98A 3T4LA 1P97A 1V9ZA 5HL6A 3JVUA 3SW1A 4O0PA 3LR0A 1KOUA 3VOLA 4BBVA 3LR5A 4BJPA 3G6OA 3PXPA 5HWWA 3LIDA 4K08A 3B47A 3KSHA 4ETXA 4HH2A 4MN6A 3UMDA 1VHMA 2QKPA 3FC7A 5DJUA 2W0NA 3EQVA 2INWA 1T19A 3MQOA 1XJ2A 2VA0A 2ZBBA 4Q0HA 4WLAA 5F6AA 3KO6A 3CWFA 5L8MA 1D7EA 1XJ4A 1T18A 4KUOA 1DP9A 2YKFA 3T4OA 5TBMA 3CUEA 4FOFA 3UB7A 5AJGA 4XT2B 4O01A 4ARZA 3LR3A 1OT9A 4EXOA 3HJIA 3LIAA 2GNXA 3BWLA 1YKDA 1TF1A 2A24A 3C38A 2XROA 2PDRA 1S66L 3IBRA 2OWJA 1TD5A 3E0YA 5A8BA 2GJ3A 4KQOA 3FPWA 3T4SA 3OLOA 4I38A 4NXEA 3PBRA 4PAUA 4QPRA 1ZHHB 3EQUA 3CI6A 2DMWA 2G7UA 4R38A 1DP8A 1JNUA 3D3OA 1YSPA 4L9EA 1G28A 3RH8B 3NOUC 1YAXA 3B33A 3H82A 5C5KA 3LIBA 3MQ0A 3D72A 4DJ3A 3MR0A 3PHYA 5IS1A 3T4KA 2L1MA 2V9AA 2ZOIA 4GJ4A 2HV1A 4PKYG 1XJ3A 3IBJA 2B02A 5DFYA 3H7WB 4P6ZM 2LB9A 1IOUA 3T4TA 2ZMVA 3F1NB 4B9OA 4Z1WA 2FZ0A 4Q0JA 4GCZA 4HJ3A 3HJKA 2M1CA 4M4XA 1V9YA 2JKTI 1VB6A 1S1YA 1LL8A 3R7WA 4E04A 3LI9A 2M7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XRN A;  3MF0 A;  1MKM A;  4RQ9 A;  5HL6 A;  3NOP C;  1STZ A;  3MMH A;  4G3K A;  2O99 A;  4O0P A;  3G6O A;  3KSH A;  4ETX A;  4O8G A;  1VHM A;  3RFB A;  3KSG A;  5TJJ A;  4Y3I A;  1YSQ A;  2W3G A;  4G3V A;  4IUK A;  4LRX C;  4Q0H A;  4BWI A;  3HCY A;  4IJG A;  3KO6 A;  2W3D A;  5L8M A;  4R70 A;  3S7O A;  2GX5 A;  2QYB A;  2W1R A;  2ZMF A;  2VZW A;  3LFV A;  3TRC A;  2LB5 A;  4FOF A;  5AJG A;  4O01 A;  3OOV A;  2OOL A;  4G3W A;  2HGV A;  3S7P A;  3C2W A;  3R4K A;  4Q0I A;  1MC0 A;  1ZTU A;  2VKS A;  4CQH A;  3DBA A;  1YKD A;  1TF1 A;  2XRO A;  3IBR A;  3E98 A;  3EEA A;  4MCW A;  2Y8H A;  4YNR A;  4IUH A;  1TD5 A;  4GW9 A;  3E0Y A;  4YOF A;  2K31 A;  5LBR A;  4ZRR A;  2XSS A;  5HSQ A;  2W3H A;  3KSI A;  4R6L A;  4PAU A;  3W2Z A;  4QPR A;  4MDZ A;  1F5M A;  3CI6 A;  2G7U A;  2O9C A;  4MN7 A;  3CIT A;  3KSF A;  5HPI A;  4LRY C;  3D3O A;  4GLQ A;  2VEA A;  1YSP A;  2KOI A;  2O9A A;  4Y2F A;  3NOU C;  5HPF A;  3NHQ A;  5C5K A;  2W3F A;  2B18 A;  3OBF A;  4ME4 A;  3MQ0 A;  4MMN A;  2W1T B;  2VJW A;  4EU0 A;  3NOT C;  2W3E A;  3IBJ A;  5DFX A;  4ETZ A;  2IA2 A;  3ZQ5 A;  2KLI A;  5DFY A;  2M7V A;  2LB9 A;  3S7N A;  2O9B A;  4Y5F A;  3VV4 A;  2O0Y A;  4DMZ A;  2M7U A;  4Z1W A;  3S7Q A;  4LRZ E;  4Q0J A;  3O5Y A;  3K2N A;  5K5B A;  2Y79 A;  4EUV A;  3BJN A;  2W1T A;  2K2N A;  4E04 A;  5I5L A;  4DN0 A; 
#chains in the Genus database with same CATH topology
 3FKW A;  3MF0 A;  4PHT A;  1GSV A;  3VP4 A;  4LPZ A;  4PKY A;  1FSW A;  3HLF A;  4WF0 A;  3C8C A;  2Y2I A;  3IWQ A;  5G18 A;  3C7U A;  1IKG A;  1DRM A;  3MFX A;  4II7 A;  5TJJ A;  2HZ5 A;  5HD3 A;  3AGE A;  4BEN A;  4QD4 A;  3EOI A;  3WRT A;  4F3L B;  4G3V A;  4IUK A;  1MWT A;  3DTM A;  2OAP 1;  2JKT M;  1GSW A;  3U4L P;  3KYE A;  2BTF P;  3IS2 A;  2XGN A;  4OOL A;  1MC0 A;  2HDQ A;  2Y91 A;  1OTD A;  4GW9 A;  5IHV A;  1TS8 A;  5GLA A;  1KGF A;  1KVM A;  5HSQ A;  1N9N A;  3W2Z A;  4Y0O A;  3IXG A;  2VEA A;  3M2K A;  3RTY A;  4HY8 A;  2ZQ9 A;  3SS3 A;  3V67 A;  3TE8 A;  4Y7P A;  4OKP A;  1FIK A;  5HX9 A;  4CPK A;  2XFS A;  3CMZ A;  3ZCZ A;  3UB9 A;  2W27 A;  5GHY A;  5FEG A;  3IX3 A;  2E8I A;  3VE3 A;  1XFN A;  2HP5 A;  4EW7 A;  3Q1F A;  1NLY A;  4WYY A;  3FZC A;  1UGU A;  3A3J A;  1T1C A;  3F1N A;  4N9L A;  5FI6 A;  2H28 A;  3O5Y A;  2WZX A;  1PWD A;  4QB8 A;  4BD1 A;  3NJA A;  2G2W A;  1ES2 A;  3UPN A;  4OPR A;  1PFL A;  2Z6D A;  1C3B A;  2Y59 A;  5FEF A;  5CER A;  1L0E A;  2HJE A;  4R70 A;  4BLM A;  4P87 A;  5HFO A;  2QJ5 A;  2ZC7 A;  2L4R A;  3NEC A;  3W8K A;  4Z9Q A;  3UDX A;  5DKK A;  1JWP A;  1YMX A;  5EVI C;  3ICY A;  1SKO B;  3BQ8 A;  5DF9 A;  3Q7V A;  4UAA A;  1ZG4 A;  4PM7 A;  4QWO A;  5DVA A;  5KSC A;  3NC8 A;  4UA7 A;  4ZJ1 A;  2R9X A;  3VFH A;  4RYE A;  1ZC2 A;  3L7H A;  5BOH A;  1TDG A;  2W3H A;  3W4Q A;  1G6O A;  1VM1 A;  1WYC A;  1K57 A;  4OQH A;  5F1G A;  2KOI A;  1VQQ A;  3IH8 A;  1HD8 A;  1FCM A;  3BEB A;  4R4R A;  3V3R A;  4HEF A;  3UE3 A;  4CLC C;  4P6Z S;  4ME4 A;  3I7J A;  2VJW A;  3GV9 A;  2WAE A;  3IQA A;  3WS2 A;  1W5D A;  3UPP A;  2ZC4 B;  2JHE A;  5A92 A;  1H8Z A;  4BMW A;  2H0T A;  3QP1 A;  3IF6 C;  2D02 A;  3K2N A;  1JWV A;  3BJN A;  1TS7 A;  2XRN A;  4LEN A;  1TVF A;  3CHW P;  3NOP C;  5F83 A;  4CLC E;  2Y2G A;  5EUA A;  4JGP A;  1ERM A;  1LL9 A;  3H7W A;  3LIC A;  5FI2 A;  3K3C A;  4HJ4 A;  2PBD P;  3N8L A;  3E4O A;  2DCF A;  4R3B A;  4BBT A;  1G68 A;  4Y17 A;  4RA7 A;  5EM0 A;  2WKH A;  4LV2 A;  1XP4 A;  4IJG A;  3LIF A;  4OON A;  2QYB A;  4LLO B;  4OOY A;  1F2K A;  4QJG A;  2ZMF A;  5EOO A;  5J7E A;  1YLY A;  4ARZ B;  3MKF A;  2P08 A;  2V1A A;  4HI4 A;  1YLP A;  3C7V A;  2PD7 A;  1ERO A;  1LHY A;  2B95 A;  2V1Z A;  1ODV A;  4F3L A;  4ZRR A;  2EFX A;  3HUM A;  4CJN A;  4A5R A;  1NXY A;  4KZ4 A;  3ZDJ A;  2PHY A;  3GEC A;  2QMI A;  3FWL A;  2KDK A;  3MSH A;  2I9V A;  4FH2 A;  4P0M A;  4WM9 A;  2DRW A;  2GZA A;  4WZ5 A;  4KZ9 A;  2IWB A;  1NYM A;  3H82 B;  1XA7 A;  3PBT A;  3G32 A;  3T50 A;  2W1T B;  4IHQ A;  1SZV A;  3PYP A;  3CPT B;  1EW0 A;  3MQQ A;  2UV0 E;  3ZYT A;  1BYW A;  2KLI A;  4UHU A;  4X1L A;  2V2F F;  4JGO A;  3P09 A;  3S7N A;  2PYP A;  1DP6 A;  1OTI A;  4BD0 A;  3M6H A;  3S7Q A;  2Y79 A;  3EGX C;  1VEU B;  2ZD8 A;  2Y2P A;  2Q9N A;  3T4L A;  1P97 A;  1ALQ A;  5GLD A;  1L3L A;  5E2H A;  1YLW A;  5GL9 A;  4HH2 A;  1XGJ A;  2WUQ A;  5FQK A;  1VHM A;  4PM8 A;  2XEP A;  3A3I A;  2HDU A;  1KE4 A;  3WRZ A;  3O3V A;  5L8M A;  4X55 A;  1ZKJ A;  3HRE A;  1DP9 A;  4KG6 A;  4S2N A;  3CUE A;  4O01 A;  3IXD A;  4ZAM A;  4Y13 A;  3BM6 A;  4S2J A;  4WZ4 A;  3C38 A;  1XX2 A;  2XRO A;  1S66 L;  2OWJ A;  4MBH A;  3FPW A;  3C4O A;  3MZD A;  3OLO A;  1LL5 A;  3MBZ A;  4KEN B;  5DTK A;  1YLT A;  3OZH A;  1JNU A;  2XD5 A;  3D3O A;  3SOI A;  4UA6 A;  3G2Z A;  3NOU C;  2XD1 A;  1XGI A;  2ZQ8 A;  3MQ0 A;  3MR0 A;  1SDN A;  3OPH A;  1IYP A;  4F94 A;  4LV3 A;  2Y2H A;  2LB9 A;  4KQQ A;  1IEL A;  3WS1 A;  3CG5 A;  3F1N B;  3DTK A;  4B9O A;  5CXW A;  4UA9 A;  2M1C A;  4M4X A;  2WAF A;  1A0K A;  2X02 A;  3UN7 A;  2HP9 A;  4I3A A;  1CF0 A;  1GSX A;  1K38 A;  1YT4 A;  3T12 B;  1GHM A;  2PRF A;  4DE3 A;  1BSG A;  5EFW A;  1OPX A;  1I2W A;  4GS9 B;  4EEU A;  3KX0 X;  1K55 C;  1UWN X;  1LT0 A;  3F1O B;  3JPU A;  3UPO A;  1PW8 A;  1CI9 A;  3MXQ A;  1H8M A;  4HNB A;  1FCO A;  1NZU A;  2VV8 A;  3K3D A;  4HIA A;  2W1R A;  4C6Y A;  4IVI A;  2ZC6 B;  4R3J A;  5EV0 A;  5AQB A;  2VGL S;  3G31 A;  2EA9 A;  4U0X A;  2ZJ9 A;  1YLZ A;  3OPP A;  2P04 A;  3TG9 A;  4C3Q A;  4DE1 A;  4S2K A;  4JKT A;  4EQI A;  1NWZ A;  4ZJ2 A;  4BL3 A;  3GTC A;  4LRY C;  3UDI A;  4X68 A;  4PPR A;  1K56 A;  5HPF A;  5CGX A;  3OBF A;  1KGG A;  4KQR A;  2MJ6 A;  2IA2 A;  5CX7 A;  1D1J A;  5HD5 A;  4NXB A;  3IHB A;  3LUQ A;  4OPQ A;  4EER A;  4P85 A;  2PU2 A;  1I2S A;  2BG1 A;  4E6X A;  4EUV A;  2W1T A;  2VV7 A;  3CPT A;  4NXG A;  2A2L A;  1ES3 A;  1CJF A;  4OLG A;  3G30 A;  3W4P A;  5F82 A;  4N1H A;  4IED A;  1W7F A;  2ZQ7 A;  2ZM2 A;  3OPR A;  2P7J A;  2Y2J A;  2WKE A;  1LSW A;  2ZM0 A;  1GCE A;  3PR6 A;  3CLO A;  4YIN A;  3LR4 A;  2YKH A;  4GHI A;  1S67 L;  1ES4 A;  4QY6 A;  1NJ4 A;  2EWW A;  4HJ6 A;  3GDI A;  4CQH A;  2VKS A;  4GOG A;  5FAT A;  4HOI A;  4IUH A;  5LBR A;  1X0O A;  3HLB A;  4BQM A;  2XFT A;  5FAP A;  3NY4 A;  1TS0 A;  1S4R A;  1PI5 A;  1LLB A;  1W63 M;  1PZO A;  1NZO A;  3N7W A;  1FCN A;  4R6L A;  1F5M A;  2H10 A;  4FH4 A;  2J80 A;  3MS6 A;  1EWZ A;  1JTD A;  3VFF A;  4WMC A;  3CJM A;  1D06 A;  3UDF A;  5AQA A;  2WAD A;  4EU0 A;  1K4E A;  3R7W B;  1BLH A;  1AWI A;  3HLG A;  3BFC A;  3OCN A;  4HBT A;  2W3E A;  3S1Y A;  2JN7 A;  4ETZ A;  3MZE A;  3PAE A;  4WUJ A;  4S2L A;  2X71 A;  3B3X A;  3V50 A;  5DKL A;  3GR2 A;  3M2J A;  1E4D A;  4KZ5 A;  5HW3 A;  2QPN A;  2CC1 A;  3LY3 A;  4EQ1 A;  4Y0U A;  5F69 A;  3BQA A;  3IF5 A;  2BAS A;  3PTE A;  1GHP A;  2V0U A;  1KDS A;  5J4E A;  2PAV P;  2IWC A;  2ZC3 B;  5CTM A;  5G4Z A;  4N9K A;  2WKI A;  4X69 A;  4OP8 A;  4ESP A;  4GB7 A;  4LV1 A;  4O8G A;  2EWV A;  4LCM A;  5FQJ A;  1W8Y A;  4Y3I A;  2PR6 A;  3OPL A;  4BWI A;  2RCX A;  4YWZ A;  2C5W B;  3ULF A;  2QWS A;  4DJ2 A;  4GS9 A;  1K56 D;  1BT5 A;  4WEJ A;  3IT9 A;  1L0G A;  3R4K A;  1ACF A;  4OOM A;  3UME A;  3F1O A;  2EFU A;  4S2M A;  3P01 A;  4I5S A;  3E98 A;  5AVF A;  4X25 A;  2NUT C;  3UY6 A;  4OQI A;  4N92 A;  3FG8 A;  2UWX A;  3O87 A;  4MN7 A;  3NDE A;  1L2S A;  3BFD A;  2HDR A;  2KX6 A;  2WGW B;  5FDH A;  1WYB A;  4HP4 A;  4WL9 A;  4RX3 A;  4JXS A;  5EVI D;  3QP5 A;  4H6J A;  4Y5F A;  4EES A;  4OQ0 A;  1U60 A;  4X53 A;  3PBS A;  4I3I A;  1CEF A;  2K7S A;  4ZJ3 A;  1F98 A;  2BLS A;  1K54 A;  4OH0 A;  4DXB A;  4JF5 A;  3JVU A;  5EVE A;  3SW1 A;  3SH9 A;  3PXP A;  5KZH A;  4K08 A;  3QNB A;  3B47 A;  1N9B A;  5DTT A;  1HTZ A;  4KZB A;  4GDB A;  1Z09 A;  5DJU A;  2W0N A;  3EQV A;  1T19 A;  4X1M A;  3SS5 A;  2VA0 A;  3ZNY A;  2ZBB A;  4Q0H A;  4WLA A;  4XUZ A;  4ID4 A;  2YKF A;  3N6I A;  3T4O A;  3UB7 A;  4XT2 B;  2JCH A;  4WMC D;  3LR3 A;  4KG5 A;  3N8R A;  5CTN A;  5HAR A;  3BFE A;  3E0Y A;  2GJ3 A;  4ZBE A;  2IWD A;  4MEZ A;  2E8J A;  2VGJ A;  1K6R A;  3EQU A;  1W8Q A;  3JYI A;  4Y0T A;  2DMW A;  4R38 A;  2WGV A;  2XK1 A;  4L9E A;  1G28 A;  3Q7Z A;  3DWZ A;  3IH9 A;  1OME A;  3NUL A;  1J9M A;  1PRQ A;  4DJ3 A;  5CEC A;  1Q2P A;  1S6R A;  4HES A;  2Y2L A;  1JVJ A;  4PKY G;  1L0F A;  4HBU A;  1ESU A;  4H8R A;  1Y4O A;  4E6W A;  1N4O A;  3T4T A;  4K91 A;  4Q0J A;  1GA9 A;  4HJ3 A;  3VP0 A;  3A3E A;  5KMW A;  5M1A A;  3R7W A;  3LI9 A;  4RQ9 A;  4JF6 A;  1DJB A;  2A3U A;  2RL3 A;  4G3K A;  4L0L A;  2OAQ 1;  3HLD A;  4XUX A;  4S2P A;  3C4P A;  5CED A;  1FR1 A;  3EGD C;  3LEZ A;  3U2A A;  4Q8I A;  4OPZ A;  3ISG A;  5EPH A;  1QME A;  3V5M A;  3OCL A;  3LCE A;  3PBN A;  4DF6 A;  3UB8 A;  2GX5 A;  1CQA A;  4X6T A;  2JKF A;  4PM5 A;  2VZW A;  4GHI B;  5E2G A;  3TRC A;  2ZM8 A;  3NDG A;  3OOV A;  1RGZ A;  5E2F A;  3C2W A;  5CHM A;  1NYY A;  4BBU A;  4FSF A;  2EX9 A;  2EXA A;  2ACG A;  2Y2O A;  4YNR A;  4E3N A;  5CEB A;  3CZD A;  2K31 A;  4EBL A;  3T4Q A;  3V3S A;  4YFM A;  5IU1 A;  1IFQ A;  1K57 C;  3BY8 A;  4P6B A;  3VP2 A;  3CIT A;  3KSF A;  3MXR A;  3TOI A;  1K25 A;  1H3Q A;  1NY0 A;  5F1F A;  3P98 A;  4QY5 A;  1BTL A;  1H0M A;  5M18 A;  4DE0 A;  2EX6 A;  4HQA A;  1MWR A;  3BW6 A;  1XFQ A;  4E3L A;  2P9V A;  3GVB A;  1BLP A;  2PU4 A;  3DWK A;  4NET A;  5AQ7 A;  2OSU A;  2J8Y A;  1P0Z A;  1KE3 A;  3C30 A;  3PBQ A;  3ZVT A;  2ZL1 A;  5HL1 A;  2Z2L B;  2WGW A;  4DN0 A;  3IWO A;  3DW0 A;  5TBM B;  2ZLY A;  4GKU A;  2JKG A;  4HHD A;  1BZA A;  1RGY A;  3DTE A;  3G4P A;  1I5Q A;  3LI8 A;  1UWP X;  1T1B A;  4XXR A;  3NIA A;  3QHY A;  5FQ9 A;  3ZG7 B;  2WKP A;  5CRF A;  2D01 A;  3PBO A;  3T1X A;  3GQZ A;  2OLU A;  5HDS A;  3E4P A;  1SHV A;  1OTA A;  5KSH A;  2V8C A;  4OP5 A;  1XPB A;  5FAS A;  2J3T D;  1LSV A;  3DBA A;  2VLG A;  3EEA A;  4U0T A;  1LI9 A;  3A0S A;  2XSS A;  4LGW A;  4KUK A;  1HVB A;  2C6W B;  4B88 A;  1SDE A;  3KSI A;  3UO9 A;  4B4Z A;  4XT2 A;  5HPI A;  4WZ5 C;  1MWU A;  1PW1 A;  4Y2F A;  5HWT A;  4JLF A;  3HBR A;  2Y2N A;  4MN5 A;  5L07 A;  1Z6F A;  3GRJ A;  4LFU A;  3D9Y A;  2CMN A;  2Y2M A;  3ZQ5 A;  3W4O A;  1FQG A;  1K0K A;  2QHK A;  3TW8 A;  2HDS A;  3VV4 A;  4H6J B;  4FTX A;  2M7U A;  2PR5 A;  2XA7 M;  1MPL A;  1TS6 A;  1DY6 A;  3T1R A;  3ZGA B;  1P9W A;  3HUN A;  4QU3 A;  5J3W A;  1WA9 A;  3DTI A;  3VSK A;  3Q07 A;  4I3J A;  4IVK A;  2O99 A;  3KYZ A;  3JVV A;  4U3T A;  3UE0 A;  5HWV A;  1PZP A;  3VSL A;  2XH9 A;  3KSG A;  4DDY A;  4I39 A;  2EX8 A;  2JBF A;  3F1P A;  3A0V A;  2JKR I;  1ERQ A;  3NBL A;  5HAP A;  1LSX A;  2J7V A;  4S2N C;  3CUE C;  3LFV A;  4PMA A;  2WK0 A;  2HGV A;  4OPY A;  4S2O A;  2R9W A;  1ZTU A;  5EVI A;  2EXB A;  3MJQ A;  4R3A A;  5DTS A;  4MCW A;  5FQI A;  3T1S A;  5F5Y A;  3EWK A;  1ONG A;  2XA7 S;  3KYQ A;  1TDL A;  2JKR M;  2EX2 A;  4NKP A;  2O9C A;  3O88 A;  1E3U A;  1S0W A;  4JXW A;  4ZDX A;  2O9A A;  4NXF A;  2XR0 A;  4DXC A;  3NHQ A;  1IYS A;  4D60 A;  2J9P A;  2B18 A;  4CLC A;  3VMA A;  4R1G A;  4R23 A;  1IYO A;  4QHC A;  1XA1 A;  4WBG A;  1ESI A;  4EET B;  1CEG A;  2H5S A;  3ITA A;  4E3I A;  3V39 A;  2O9B A;  3FV7 A;  2Y2K A;  2O0Y A;  1K4F A;  1IKI A;  3D4F A;  3ZNT A;  4NK3 A;  1OJG A;  4KQD A;  3HVF A;  5EM1 A;  3IF6 A;  4HH3 A;  3MXS A;  1N9L A;  1NLZ A;  2K2N A;  2V8F A;  2ZMA A;  3HL9 A;  2JC7 A;  5E43 A;  5DF7 A;  5L2F A;  3QP4 A;  4BJP A;  1DJA A;  4KZA A;  3LID A;  2PBY A;  5CHJ A;  3IWI A;  4ETX A;  2OV5 A;  4MN6 A;  4EBP A;  2WZZ A;  3RXX A;  2X01 A;  5FAO A;  3HLC A;  3O86 A;  5FAQ A;  1GA0 A;  2XDM A;  4K0X A;  1XJ2 A;  5JYP A;  1G6A A;  5F6A A;  1XJ4 A;  4GZB A;  5FDS A;  3FKV A;  5TBM A;  4FOF A;  1YLJ A;  3GSG A;  2Y4A A;  4JBF A;  3LO7 A;  1JTG A;  3ZG8 B;  2GNX A;  3BWL A;  4JXV A;  3M6B A;  2PDR A;  1MWS A;  2HP6 A;  2HPB A;  4E3K A;  1CK3 A;  3T4S A;  4I38 A;  3IHA A;  2G2U A;  1MY8 A;  4GD6 A;  1ZG6 A;  4PAU A;  1ZHH B;  3HLW A;  1PWC A;  4KG2 A;  1HLU P;  3RH8 B;  1YAX A;  5C5K A;  3LIB A;  3TSG A;  1MXO A;  3BLM A;  3C5A A;  3PHY A;  5IS1 A;  2L1M A;  2V9A A;  4GJ4 A;  2HV1 A;  2P9V B;  5EEC A;  3QP2 A;  3QP6 A;  2ZQD A;  4P6Z M;  3SH8 A;  1IOU A;  2ZMV A;  1IYQ A;  2ZQA A;  5A93 A;  1VB6 A;  1S1Y A;  3WS0 A;  2ZL1 B;  4E04 A;  2M7V A;  1XXM A;  3EEH A;  1MKM A;  1J3W A;  1VET A;  1S4S A;  1F9I A;  1STZ A;  2XLN A;  3VP1 A;  2PD8 A;  5A90 A;  2J3W A;  3H9W A;  3A3D A;  3ZFZ A;  2A49 A;  2Y2Q A;  3ZG0 A;  4NG2 A;  3RFB A;  1CI8 A;  1YM1 A;  3T1Q B;  2QJ7 A;  1PWG A;  1MZU A;  4FD8 A;  4NEE D;  2W3G A;  1JWZ A;  1KE0 A;  1NRF A;  4N1X A;  3VE4 A;  3HCY A;  1W79 A;  3S7O A;  5GHZ A;  1DJC A;  1O07 A;  5IT5 A;  4JGR A;  1E3U D;  5HAQ A;  4E3J A;  4RVA A;  3IXH A;  3WWX A;  2OOL A;  4JGQ A;  4LV0 A;  4CLC D;  3N8S A;  4KZ6 A;  3A0R A;  4OLD A;  3ZVW A;  4YOF A;  2FFY A;  4BL2 A;  3UE6 A;  3LYX A;  2HF6 A;  4K0W A;  5CHU A;  2VGK A;  2WKR A;  5HAI A;  3WS4 A;  3CAX A;  5FL3 A;  4L9F A;  3RJU A;  3B42 A;  5HDD A;  3T4J A;  3GMW A;  4DRT A;  2W3F A;  1SKF A;  3ZG5 A;  3NOT C;  3LY4 A;  2Z6C A;  4E3O A;  2Z2M B;  3BFG A;  3UB5 P;  3AGF A;  1YPR A;  5TR7 A;  3NI9 A;  5FQQ A;  1FSY A;  3E2K A;  1LI0 A;  3P7N A;  4C75 A;  1Y28 A;  4DMZ A;  5EVL A;  4LRZ E;  3ITB A;  2V1B A;  3LIE A;  2FFF B;  1GHI A;  3BEC A;  4DKI A;  4RX2 A;  1YMS A;  3ZHH A;  5CGW A;  2VX8 A;  1ONH A;  4L9G A;  3MMH A;  5GHX A;  1MKI A;  5TFQ A;  4WN5 A;  1O7E A;  3BY9 A;  3MFD A;  1K55 A;  4ZTK A;  2QZ6 A;  2XF3 A;  2A24 B;  5GLC A;  1PYY A;  4LRX C;  3F1P B;  4B4X A;  5JYO A;  2W3D A;  2LB5 A;  2P74 A;  4EWF A;  2FH5 A;  5L09 A;  1XJ6 A;  4EEP A;  3S7P A;  1HZO A;  1PNE A;  3Q81 A;  4Q0I A;  1OT6 A;  4FUW A;  5EVI B;  4PM9 A;  1W63 Q;  1QMF A;  5FA7 A;  1PI4 A;  1FIL A;  4IBX A;  3UNW A;  1H8Y A;  3IXB A;  2WYX A;  3IX8 A;  4EUZ A;  3SZT A;  2V0W A;  5MC7 A;  4GLQ A;  1FOF A;  1M40 A;  2NUP C;  3G35 A;  2OLV A;  3E2L A;  2ZOH A;  4MMN A;  1WE4 A;  4JF4 A;  4CLC B;  1SCW A;  4GD8 A;  4MBK A;  3HUO A;  3DAV A;  2PT7 A;  3OC2 A;  3QP8 A;  1N9O A;  3MZF A;  4WEK A;  4WEL A;  1YQS A;  3SH7 A;  4GDN A;  1OTB A;  4UEY A;  4OVD A;  2GDN A;  3L9K A;  4AFI A;  2B5R A;  2L0W A;  4HP9 A;  1RP5 A;  1BUE A;  3IF6 B;  4B93 A;  4UQI M;  2XQZ A;  4EBN A;  1XKZ A;  3HLE A;  1K54 C;  3BYD A;  3E4Q A;  4DDS A;  5HDC A;  1T1A A;  2WGI A;  2OWH A;  1S1Z A;  3G2Y A;  3RXW A;  3S4X A;  3IS2 B;  1YSQ A;  5J8X A;  4JPM A;  1M6K A;  1AXB A;  5FQM A;  2WKQ A;  5I94 A;  5F68 A;  1L0D A;  3BFF A;  3BLS A;  1KGE A;  2VK3 A;  4G3W A;  5D3O A;  1SKO A;  1ES5 A;  1EI5 A;  5CGS A;  2Y8H A;  4MNR A;  5DJT A;  5GLB A;  2PYR A;  2VGL M;  3UB6 A;  4UQI S;  3AGD A;  1KDW A;  1OJ5 A;  4MDZ A;  3IX4 A;  3TJZ C;  2R78 A;  3A3F A;  1H5X A;  5HZH A;  2J9O A;  1BLS A;  2J3T C;  3FPV A;  2VV6 A;  5AVE A;  3N4I A;  4E3M A;  2ZQC A;  4OQG A;  2Q0O A;  2AVX A;  5DFX A;  2Q9M A;  3LGO A;  1OTE A;  2Y55 A;  2HJ9 C;  1BLC A;  3QNC A;  5G4Y A;  1NRJ A;  3FYZ A;  4X56 A;  5KIZ A;  4LCL A;  5K5B A;  4EV4 A;  1K6S A;  1P9R A;  1Q2Q A;  1IEM A;  5I5L A;  4MBF A;  3LEQ A;  1G5U A;  4Y15 A;  1VET B;  1V9Z A;  3SS4 A;  5HL6 A;  3UE1 A;  4O0P A;  3LR0 A;  1KOU A;  3VOL A;  4BBV A;  3LR5 A;  3G6O A;  5HWW A;  1TEM A;  3WS5 A;  4KZ8 A;  4D2O A;  4S2I A;  3KSH A;  3G34 A;  4GNU A;  4R0Q A;  3UMD A;  2QKP A;  3FC7 A;  3Q7V B;  5DF8 A;  2INW A;  4FCF A;  4R4S A;  5M19 A;  3MQO A;  3KO6 A;  3CWF A;  1D7E A;  1T18 A;  4KUO A;  5A91 A;  4M3K A;  5EE8 A;  4IBR A;  5AQ9 A;  5AJG A;  3VOY A;  4ARZ A;  5TGF A;  1OT9 A;  4EXO A;  3HJI A;  1KVL A;  3NCK A;  2V20 A;  3LIA A;  4KZ7 A;  2H0Y A;  1YKD A;  1TF1 A;  2A24 A;  1MBL A;  3IBR A;  1TD5 A;  4DE2 A;  4KQO A;  5A8B A;  4GN2 A;  5E2E A;  4NXE A;  3PBR A;  3BRM A;  1FR6 A;  5FSR A;  4QPR A;  3CI6 A;  3S22 A;  2G7U A;  2JE5 A;  1DP8 A;  2DNS A;  1YSP A;  2ZC5 B;  1BUL A;  3B33 A;  3H82 A;  3PAG A;  4KZ3 A;  4O7D A;  5FI7 A;  3D72 A;  1RCJ A;  3T4K A;  2ZOI A;  2I72 A;  1XJ3 A;  4PM6 A;  3IBJ A;  2B02 A;  5EOE A;  3ZG9 B;  5L10 A;  5DFY A;  3H7W B;  3VOZ A;  3VP3 A;  1Y54 A;  4MLL A;  1PIO A;  4JXG A;  4Z1W A;  2FZ0 A;  3MKE A;  1E25 A;  3Q82 A;  4GCZ A;  3HJK A;  1V9Y A;  2JKT I;  1LL8 A;  1VEU A;  5U47 A; 
#chains in the Genus database with same CATH homology
 3EEH A;  3MF0 A;  4I3A A;  1GSX A;  1MKM A;  4PHT A;  4RQ9 A;  1GSV A;  1S4S A;  1F9I A;  4LPZ A;  1STZ A;  4G3K A;  4L0L A;  2OAQ 1;  5EFW A;  1OPX A;  2PD8 A;  4PKY A;  4WF0 A;  3C8C A;  4GS9 B;  2J3W A;  3H9W A;  4EEU A;  3KX0 X;  1UWN X;  3EGD C;  1LT0 A;  3F1O B;  3U2A A;  1DRM A;  3RFB A;  3MFX A;  4II7 A;  2QJ7 A;  5TJJ A;  1MZU A;  5HD3 A;  4NEE D;  3EOI A;  2W3G A;  4G3V A;  3MXQ A;  4IUK A;  4F3L B;  1H8M A;  4HNB A;  3VE4 A;  3OCL A;  2OAP 1;  3HCY A;  3PBN A;  2VV8 A;  3UB8 A;  3K3D A;  2GX5 A;  2JKT M;  3S7O A;  1GSW A;  5IT5 A;  4JGR A;  4HIA A;  2W1R A;  2VZW A;  4GHI B;  3TRC A;  3OOV A;  3IS2 A;  2OOL A;  2VGL S;  3C2W A;  4JGQ A;  4OOL A;  2EA9 A;  4CLC D;  1MC0 A;  1OTD A;  3A0R A;  4BBU A;  4FSF A;  2P04 A;  4YNR A;  4GW9 A;  4YOF A;  1TS8 A;  2K31 A;  3T4Q A;  5HSQ A;  1N9N A;  1NWZ A;  5IU1 A;  1IFQ A;  3UE6 A;  3W2Z A;  3LYX A;  2HF6 A;  3BY8 A;  3CIT A;  3KSF A;  4LRY C;  2VEA A;  3RTY A;  2WKR A;  1H3Q A;  4HY8 A;  3CAX A;  5FL3 A;  4L9F A;  3T4J A;  3B42 A;  5HDD A;  3V67 A;  5HPF A;  3TE8 A;  2W3F A;  3OBF A;  3NOT C;  3UB9 A;  2W27 A;  4HQA A;  2Z6C A;  3BW6 A;  3VE3 A;  1XFQ A;  2MJ6 A;  1XFN A;  2IA2 A;  5CX7 A;  4EW7 A;  5HD5 A;  4NXB A;  1NLY A;  3LUQ A;  1UGU A;  4EER A;  1T1C A;  3F1N A;  3P7N A;  1Y28 A;  4DMZ A;  1P0Z A;  4LRZ E;  2H28 A;  2V1B A;  3C30 A;  3O5Y A;  3LIE A;  3PBQ A;  4EUV A;  2W1T A;  2VV7 A;  4DN0 A;  2VX8 A;  4NXG A;  3NJA A;  2A2L A;  4L9G A;  3MMH A;  5TBM B;  4WN5 A;  4HHD A;  3BY9 A;  2Z6D A;  3LI8 A;  1UWP X;  2A24 B;  1T1B A;  2P7J A;  4LRX C;  2WKP A;  1LSW A;  3F1P B;  2D01 A;  2HJE A;  2W3D A;  3PBO A;  4R70 A;  3PR6 A;  3CLO A;  3LR4 A;  2QJ5 A;  2YKH A;  4GHI A;  2L4R A;  5HDS A;  1S67 L;  3E4P A;  2LB5 A;  2FH5 A;  1OTA A;  5KSH A;  5DKK A;  1XJ6 A;  2J3T D;  3S7P A;  4EEP A;  2EWW A;  4HJ6 A;  4Q0I A;  1OT6 A;  3GDI A;  3ICY A;  2VKS A;  1LSV A;  4CQH A;  3BQ8 A;  3DBA A;  5DF9 A;  2VLG A;  4HOI A;  1W63 Q;  3EEA A;  4IUH A;  5LBR A;  1X0O A;  3A0S A;  2XSS A;  4KUK A;  1TS0 A;  1S4R A;  1W63 M;  2W3H A;  3KSI A;  4R6L A;  1G6O A;  1F5M A;  2J80 A;  4XT2 A;  5HPI A;  2V0W A;  5MC7 A;  4GLQ A;  2KOI A;  2NUP C;  4Y2F A;  5HWT A;  1D06 A;  3UE3 A;  2ZOH A;  4CLC C;  4P6Z S;  4MN5 A;  4ME4 A;  4MMN A;  4CLC B;  4EU0 A;  2VJW A;  3R7W B;  2PT7 A;  3OCN A;  2W3E A;  3OC2 A;  2JN7 A;  4ETZ A;  2CMN A;  2JHE A;  3ZQ5 A;  1N9O A;  4WUJ A;  4WEK A;  4WEL A;  5DKL A;  2QHK A;  1OTB A;  3TW8 A;  4BMW A;  3VV4 A;  4H6J B;  4UEY A;  2M7U A;  4AFI A;  4EQ1 A;  4HP9 A;  2L0W A;  2D02 A;  2PR5 A;  2XA7 M;  3K2N A;  5F69 A;  3BQA A;  2BAS A;  1TS6 A;  4UQI M;  4B93 A;  3BJN A;  1P9W A;  1TS7 A;  2V0U A;  2XRN A;  5J4E A;  5J3W A;  1WA9 A;  4I3J A;  3E4Q A;  3NOP C;  4CLC E;  5HDC A;  5G4Z A;  2O99 A;  1T1A A;  3KYZ A;  3JVV A;  4JGP A;  2OWH A;  1S1Z A;  3H7W A;  3LIC A;  3K3C A;  3IS2 B;  4HJ4 A;  5HWV A;  4O8G A;  3E4O A;  2EWV A;  3KSG A;  4Y3I A;  1YSQ A;  2PR6 A;  4I39 A;  4BBT A;  3F1P A;  3A0V A;  2JKR I;  4BWI A;  4IJG A;  3LIF A;  4YWZ A;  1LSX A;  2QYB A;  4LLO B;  3ULF A;  2QWS A;  2WKQ A;  3CUE C;  2ZMF A;  5F68 A;  3LFV A;  4DJ2 A;  4GS9 A;  5J7E A;  4G3W A;  4ARZ B;  2HGV A;  4WEJ A;  2P08 A;  2V1A A;  4HI4 A;  3R4K A;  2PD7 A;  1ZTU A;  4OOM A;  3UME A;  3F1O A;  3P01 A;  3MJQ A;  4I5S A;  4R3A A;  1ODV A;  3E98 A;  4MCW A;  2Y8H A;  5AVF A;  5F5Y A;  4F3L A;  4ZRR A;  5DJT A;  3EWK A;  2XA7 S;  2PYR A;  2VGL M;  3UB6 A;  3KYQ A;  4UQI S;  2NUT C;  1OJ5 A;  4MDZ A;  2PHY A;  3GEC A;  3TJZ C;  2JKR M;  3FG8 A;  2KDK A;  2I9V A;  2O9C A;  2R78 A;  4NKP A;  4MN7 A;  5HZH A;  2GZA A;  2O9A A;  2J3T C;  4NXF A;  3NHQ A;  3H82 B;  3FPV A;  2VV6 A;  2B18 A;  3PBT A;  5AVE A;  3T50 A;  4CLC A;  2W1T B;  4IHQ A;  2KX6 A;  4HP4 A;  3PYP A;  4WL9 A;  1EW0 A;  3MQQ A;  5DFX A;  4EET B;  1OTE A;  3ZYT A;  1BYW A;  2KLI A;  2HJ9 C;  4JGO A;  3S7N A;  2PYP A;  2O9B A;  5G4Y A;  1DP6 A;  4Y5F A;  1OTI A;  4H6J A;  2O0Y A;  1NRJ A;  4EES A;  1OJG A;  3PBS A;  4KQD A;  3S7Q A;  5KIZ A;  4HH3 A;  4I3I A;  5K5B A;  2Y79 A;  1N9L A;  2K7S A;  1NLZ A;  3EGX C;  1P9R A;  2K2N A;  5I5L A;  1F98 A;  3T4L A;  1P97 A;  1V9Z A;  5HL6 A;  3JVU A;  3SW1 A;  4O0P A;  3LR0 A;  1KOU A;  3VOL A;  4BBV A;  3LR5 A;  4BJP A;  3G6O A;  3PXP A;  5HWW A;  3LID A;  4K08 A;  3B47 A;  3KSH A;  4ETX A;  4HH2 A;  4MN6 A;  3UMD A;  1VHM A;  2QKP A;  3FC7 A;  5DJU A;  2W0N A;  3EQV A;  2INW A;  1T19 A;  3MQO A;  1XJ2 A;  2VA0 A;  2ZBB A;  4Q0H A;  4WLA A;  5F6A A;  3KO6 A;  3CWF A;  5L8M A;  1D7E A;  1XJ4 A;  1T18 A;  4KUO A;  1DP9 A;  2YKF A;  3T4O A;  5TBM A;  3CUE A;  4FOF A;  3UB7 A;  5AJG A;  4XT2 B;  4O01 A;  4ARZ A;  3LR3 A;  1OT9 A;  4EXO A;  3HJI A;  3LIA A;  2GNX A;  3BWL A;  1YKD A;  1TF1 A;  2A24 A;  3C38 A;  2XRO A;  2PDR A;  1S66 L;  3IBR A;  2OWJ A;  1TD5 A;  3E0Y A;  5A8B A;  2GJ3 A;  4KQO A;  3FPW A;  3T4S A;  3OLO A;  4I38 A;  4NXE A;  3PBR A;  4PAU A;  4QPR A;  1ZHH B;  3EQU A;  3CI6 A;  2DMW A;  2G7U A;  4R38 A;  1DP8 A;  1JNU A;  3D3O A;  1YSP A;  4L9E A;  1G28 A;  3RH8 B;  3NOU C;  1YAX A;  3B33 A;  3H82 A;  5C5K A;  3LIB A;  3MQ0 A;  3D72 A;  4DJ3 A;  3MR0 A;  3PHY A;  5IS1 A;  3T4K A;  2L1M A;  2V9A A;  2ZOI A;  4GJ4 A;  2HV1 A;  4PKY G;  1XJ3 A;  3IBJ A;  2B02 A;  5DFY A;  3H7W B;  4P6Z M;  2LB9 A;  1IOU A;  3T4T A;  2ZMV A;  3F1N B;  4B9O A;  4Z1W A;  2FZ0 A;  4Q0J A;  4GCZ A;  4HJ3 A;  3HJK A;  2M1C A;  4M4X A;  1V9Y A;  2JKT I;  1VB6 A;  1S1Y A;  1LL8 A;  3R7W A;  4E04 A;  3LI9 A;  2M7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...