3W2ZA

Crystal structure of the cyanobacterial protein
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
178
structure length
178
Chain Sequence
SGLVPRGSHMAVSKVMEKILRVSNIDKIFQTTTQEIRQLLKCDRVAVYRFNPDWSGEFVAESVGSGWVKLVGPDIKTVWEDTHLQETQGGRYRHQESFVVNDIYEAGHFSCHLEILEQFEIKAYIIVPVFAAEKLWGLLAAYQNSGTREWVEWESSFLTQVGLQFGIAISHAEYLEQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyl-accepting chemotaxis protein
publication title Structures of cyanobacteriochromes from phototaxis regulators AnPixJ and TePixJ reveal general and specific photoconversion mechanism
pubmed doi rcsb
source organism Nostoc
molecule tags Signaling protein
total genus 60
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3w2zA00
2KOIA 4G3WA 2XSSA 5HPIA 3CITA 3KSFA 4Y5FA 2M7UA 4O0PA 4GW9A 2G7UA 2W1RA 3NHQA 4E04A 3NOUC 1STZA 3MF0A 4O01A 4Q0JA 4YOFA 3KSIA 4R70A 1YKDA 3NOPC 2W3DA 3TRCA 4IJGA 4MMNA 2VEAA 4MN7A 5DFXA 3OBFA 3G6OA 5HL6A 2HGVA 5TJJA 4LRYC 2IA2A 3S7PA 4IUKA 2LB5A 2W3FA 2VZWA 3ZQ5A 2K2NA 4DMZA 3IBRA 4R6LA 4DN0A 3S7QA 3MQ0A 3OOVA 2B18A 5HSQA 4BWIA 2O9CA 4PAUA 2O9AA 3EEAA 1MC0A 5LBRA 4EU0A 3MMHA 3RFBA 3KO6A 4CQHA 3VV4A 3IBJA 2VJWA 3K2NA 4Y2FA 4O8GA 2GX5A 3C2WA 4ETZA 4LRZE 2O9BA 4QPRA 2VKSA 4ME4A 4G3KA 2O0YA 2XROA 4GLQA 1YSQA 5DFYA 3DBAA 4MCWA 5C5KA 3R4KA 4MDZA 3W2ZA 4Q0IA 3KSHA 2W3EA 1TD5A 1MKMA 4ZRRA 3S7NA 2K31A 2KLIA 1YSPA 2O99A 1ZTUA 2Y79A 2OOLA 4YNRA 2W3GA 1TF1A 2M7VA 4EUVA 2W1TA 4Q0HA 3KSGA 5I5LA 4Z1WA 5K5BA 3BJNA 3LFVA 3NOTC 4FOFA 2QYBA 4G3VA 3E98A 4IUHA 4LRXC 5AJGA 2W1TB 2Y8HA 3E0YA 3HCYA 3CI6A 4Y3IA 5L8MA 2W3HA 2XRNA 3O5YA 1F5MA 4ETXA 5HPFA 3D3OA 2LB9A 1VHMA 3S7OA 4RQ9A 2ZMFA
chains in the Genus database with same CATH superfamily
3QP2A 2HDUA 1BUEA 1N9NA 2OWHA 2J7VA 4GW9A 4EQIA 1EW0A 1XJ4A 4YOFA 1Z09A 5I94A 5M19A 1W8YA 3VOZA 1UWPX 3CAXA 4IBRA 1G5UA 5A92A 2VK3A 3ZG9B 1PZOA 4Y0OA 1K6RA 1BLPA 4E3NA 5AQAA 3MJQA 2HDSA 4IUKA 2PT7A 2XR0A 1WYCA 1HD8A 4H6JB 4K91A 4E3LA 1G28A 4EU0A 4OQGA 2VJWA 5FI2A 3A3FA 1HTZA 1SKOA 3EEHA 3IT9A 5EFWA 2Y4AA 4QPRA 4HBUA 5DKKA 4G3KA 4S2PA 5D3OA 1DJBA 3H9WA 3LR0A 3TJZC 3HLBA 5KZHA 1IELA 3CPTA 4BBUA 2HZ5A 4DE0A 2WZXA 3IWQA 3EWKA 5GHYA 3K3DA 3L9KA 2ZQDA 4JF6A 1CI9A 3AGEA 5MC7A 3VE3A 5FQJA 1X0OA 3DTMA 5E2EA 4CLCC 4Q0HA 3PYPA 5GHZA 5FQMA 4BD0A 3HCYA 3CI6A 4U3TA 3JVUA 5CHUA 5DTTA 2JKFA 2HDRA 3S7OA 4I3JA 4EESA 4N9LA 4R3AA 1FQGA 4OH0A 4R3JA 3Q81A 1GSWA 3UE0A 4IBXA 5HFOA 1C3BA 3NHQA 1YLWA 4P6BA 3NOUC 4GS9A 3CLOA 4OKPA 4L9EA 4R70A 1E4DA 4DDYA 1ERMA 2VV7A 3TRCA 3DW0A 3ZFZA 1HZOA 4H8RA 3AGDA 2I9VA 4GZBA 3MZDA 2WK0A 3NIAA 3IXHA 1S1ZA 3O3VA 3AGFA 3DTEA 3NDEA 4CLCB 1G68A 2ZM0A 4UAAA 5HWTA 3QNCA 4QWOA 1N9LA 2P7JA 1S1YA 4Z9QA 1TEMA 1PI4A 4I5SA 3RFBA 1S67L 4II7A 3K2NA 2OSUA 2J80A 5EVID 1XA7A 3IF6A 4BBTA 1RCJA 3K3CA 1H8ZA 2H0YA 5L10A 2V9AA 4HBTA 3DBAA 3M6BA 1CI8A 4MCWA 4L9GA 4CJNA 3GSGA 3JVVA 1SDNA 2PHYA 4PM5A 3A3JA 1ES3A 2KLIA 1LI0A 5F69A 2O99A 3NULA 2Y79A 5J3WA 3BQAA 3TG9A 4E3JA 3FWLA 2P08A 2QKPA 1WA9A 4GN2A 4KZAA 3WS0A 5CECA 1GCEA 4BL3A 2HF6A 1V9YA 3WS1A 2Y91A 2WGIA 2YKFA 1SHVA 4QB8A 1FCMA 3B47A 2XSSA 2J3WA 1M40A 2FFFB 1L3LA 4O0PA 3MSHA 3PBTA 3F1OB 4JXVA 1OMEA 4MN6A 1VEUA 1PI5A 2WKQA 3LY4A 2R9WA 2WAFA 3TE8A 1MPLA 3VP1A 5TJJA 1V9ZA 4WN5A 1CJFA 2GZAA 5FAPA 4Q8IA 3H7WA 3LIAA 1IYSA 3UB9A 1K57C 5E43A 5EOEA 1T1AA 2Y2PA 3U2AA 4X6TA 1PFLA 3P7NA 5GLDA 1BLHA 3IXDA 5LBRA 4PKYA 1GSXA 3ZG0A 4UA9A 2O9BA 3ZDJA 3T4LA 1W7FA 3O86A 1FIKA 5FAOA 3QHYA 1PYYA 5HDSA 5EE8A 4DJ2A 1JVJA 3MZEA 3WRTA 1LSWA 5G18A 5M1AA 4QJGA 4WUJA 4K0WA 1H8MA 3LYXA 2M7VA 2W1TA 3VP4A 1S4RA 3PXPA 3NDGA 1N9OA 5A91A 4G3VA 2Y2GA 5TR7A 4XT2A 4IUHA 3KYQA 1G6AA 5M18A 3ZG7B 3V67A 4OOLA 4QY6A 4WEKA 5EVIC 5HPFA 1BLSA 3GDIA 1NY0A 4RX2A 2X71A 1D7EA 2XQZA 5F83A 3LCEA 2H5SA 3BFCA 2EX8A 1Y54A 3IHAA 5JYOA 3I7JA 1DP9A 1KGFA 1G6OA 1YKDA 3RTYA 3BEBA 3GVBA 3M2KA 3G32A 4MLLA 4IJGA 2FZ0A 3P01A 1NRJA 5CHJA 3HBRA 3G34A 1SDEA 3C30A 3LY3A 4KZ9A 2RCXA 2JKRM 2RL3A 2UWXA 4B88A 3A3IA 5HSQA 4BWIA 1PWCA 3DAVA 2PDRA 3T4SA 2G2WA 4JBFA 3IBJA 2JC7A 3PBQA 1I2SA 1XFNA 1PW8A 2IWBA 3N8SA 3HLGA 2WKHA 1XKZA 3RJUA 5EOOA 4N9KA 3VMAA 3C4PA 1ONHA 1MKMA 3UN7A 3V50A 2BASA 4S2MA 4GD6A 3W4QA 4R4SA 1GA9A 2KX6A 3LIFA 5HX9A 1XX2A 3IX8A 2OOLA 4UHUA 3Q7VA 2WUQA 2Q0OA 2HP5A 3JPUA 3PR6A 1K54C 5FDHA 5I5LA 3E98A 5L09A 3N4IA 3OLOA 2EFUA 4FD8A 1VETB 1MKIA 2XH9A 2XRNA 4FTXA 4F3LB 1MWRA 4OLGA 5FQQA 4L0LA 2ACGA 4MNRA 1T19A 2PYPA 2PD8A 4X25A 1IYQA 4FUWA 3TW8A 3EGDC 3VSLA 1W79A 2OLUA 2XGNA 2V1BA 4S2KA 4S2NA 3LIBA 4KZ4A 2WKIA 1AWIA 2VEAA 3BWLA 5BOHA 3UB5P 3HLEA 4KUOA 4H6JA 3C7UA 3V3RA 4KG5A 3T12B 3P09A 4KUKA 4XUXA 3HUMA 4IVIA 5KIZA 1J9MA 2H28A 2A3UA 2ZMVA 3HREA 3G4PA 3E2LA 3UDXA 1A0KA 5EV0A 1RGYA 5E2GA 1YPRA 1M6KA 3UMEA 3WS5A 1FR6A 4C3QA 2JCHA 2BLSA 1QMFA 2Y2QA 4GCZA 2ZL1B 2HJEA 1H3QA 2VX8A 3W2ZA 4Y0TA 3KSHA 3T4TA 4ZRRA 3SH9A 3S7NA 3Q7ZA 1OJGA 4DF6A 1S66L 4XXRA 4KENB 1LL5A 2QPNA 2VA0A 1ODVA 4ZJ1A 5AVFA 1T1BA 3SH7A 4Z1WA 5K5BA 4PM8A 3WWXA 2A24B 2HDQA 3IH8A 4ETXA 2Y2MA 3T1XA 2PYRA 5HWWA 3HLCA 2ZMFA 4HJ4A 3HL9A 1TDLA 3Q82A 1Y28A 1MWTA 5DF8A 3ULFA 4E04A 4E3KA 1LSXA 3N7WA 3LR5A 2H0TA 2K7SA 4X55A 2EA9A 1D1JA 4OQIA 4KG6A 2AVXA 4X53A 4E6XA 4NG2A 1KE4A 2WKPA 4CLCA 3DTIA 4HEFA 2NUTC 3IWIA 2VZWA 4QHCA 3MKFA 4DN0A 4R6LA 3M6HA 1T18A 4MN5A 2Z2LB 3OOVA 3UPOA 3R7WB 3EQUA 3N8LA 1ZHHB 3VV4A 5CEBA 3DTKA 2HP9A 4OPRA 2H10A 2NUPC 3MFXA 1FSWA 4WM9A 1DP6A 1PNEA 4BQMA 3A3DA 1MWSA 4HNBA 3O87A 4WYYA 2WAEA 1PZPA 3FYZA 3GMWA 4MDZA 4S2OA 3V5MA 1ZG4A 1GHPA 3LI9A 3CZDA 2JN7A 1IKIA 1JNUA 2HJ9C 3ITAA 1TDGA 2VV8A 5FEGA 5HAPA 3UMDA 3VOLA 4C6YA 2PRFA 1N4OA 4R23A 1FOFA 3NOTC 3LIDA 1XJ6A 1IKGA 1IEMA 5FI7A 3B33A 2Y8HA 2EX9A 4LLOB 5EVLA 5HARA 4ID4A 4KZ6A 2J3TD 3FPVA 4JGQA 3CUEA 1MZUA 3CITA 4ZAMA 2Y59A 3F1OA 2Y2HA 1OTDA 5EM1A 4LPZA 2W1RA 4LCMA 4EXOA 3S22A 1RGZA 2FFYA 1FCOA 5F68A 1EWZA 4EBPA 2Q9MA 3ZYTA 3UDFA 2W3FA 3ZQ5A 4OLDA 1OTAA 2V0WA 4JGRA 1K55C 4QY5A 2J9OA 3O88A 4NXGA 2B18A 4I39A 2WGWB 4WLAA 5J4EA 1YQSA 2XFSA 4Y2FA 4O8GA 2VGLS 3V3SA 3DWKA 4PHTA 4ZBEA 4QD4A 1E3UA 5HD5A 5CXWA 4DRTA 2KDKA 4LV3A 5FAQA 4X69A 1W63Q 3PBOA 4ME4A 3T4QA 1Y4OA 4LCLA 4AFIA 2E8IA 3VE4A 1TD5A 3PBRA 3E4PA 2VGLM 2XEPA 2ZC3B 2ZQ7A 1YMXA 1YLYA 5TFQA 4MBHA 1MY8A 1ES4A 3HLDA 4EUVA 5KMWA 5L07A 5CRFA 2PBDP 3BJNA 3CHWP 4EEPA 4GKUA 4X1MA 3TOIA 4N92A 4EBLA 3V39A 2EXAA 3MKEA 2W3HA 3O5YA 2ZJ9A 2QWSA 4LV1A 1OTEA 4JPMA 4Y7PA 4WMCA 1DJAA 3ZG5A 5HPIA 1YLPA 2DCFA 4OVDA 1W5DA 3ZNYA 1H5XA 2XA7S 3F1PB 1PIOA 3LR4A 4Y0UA 4FH2A 2ZQCA 3LGOA 3OCLA 2Y55A 4E3IA 2HGVA 1LI9A 2QZ6A 3BW6A 3BY8A 2EXBA 2XA7M 2ZMAA 2EX2A 2O9CA 3LI8A 4P85A 5FEFA 3E2KA 4EWFA 1WYBA 3NC8A 3LIEA 2CMNA 2X01A 1K38A 3VP2A 1OJ5A 4JGOA 2XFTA 3GECA 3Q1FA 3BYDA 1WE4A 2K31A 3MXSA 3U4LP 2V8CA 3QP8A 5G4YA 4IHQA 1VETA 4KQQA 4NXEA 4JKTA 5DF9A 4DE1A 4F3LA 1XXMA 4R0QA 3BFFA 2L0WA 3RH8B 3VOYA 4FH4A 1XA1A 1IYPA 1CEFA 3B42A 1KDSA 4HIAA 4HJ6A 4R4RA 3A0VA 3BY9A 5DKLA 4EV4A 3FZCA 3BFDA 1LL9A 2BTFP 4WZ5C 1YAXA 2ZC7A 4DE2A 3NOPC 2V8FA 4WBGA 3FKVA 2DMWA 4R1GA 2ZBBA 1FILA 3SS3A 4ZJ3A 4BENA 4DDSA 5DJTA 4YWZA 2V1AA 5J8XA 3IX4A 4GB7A 3UNWA 3A0RA 2DNSA 3FKWA 4OPYA 4CQHA 1XGIA 4DE3A 4R38A 3LICA 4EEUA 5FQKA 2ZL1A 2ZQAA 2PD7A 5DTKA 3WS4A 3FG8A 4JGPA 3BM6A 3HVFA 2QJ5A 4JLFA 4ZDXA 4UQIS 3VSKA 3VP0A 5FQIA 3SS4A 2JKTI 1YSPA 3IQAA 5EVIB 1KGEA 1K25A 2W3GA 2EFXA 3IH9A 4KQDA 1TF1A 5CTMA 2A49A 1KGGA 2A24A 4YINA 3PAGA 3D72A 1W8QA 4ARZB 4GDBA 4UQIM 4BD1A 3LFVA 3BLSA 3KYEA 3C4OA 1SZVA 4UEYA 2OV5A 4JXGA 1AXBA 2QMIA 3PBNA 4IEDA 1I5QA 1YMSA 5TGFA 4EBNA 3EQVA 4EUZA 1S6RA 5L2FA 1L0EA 4OP5A 2Y2IA 5CEDA 3CWFA 1PW1A 5F5YA 3UB6A 2GNXA 2WKEA 4JXWA 5CERA 5HAIA 1KE3A 1OTIA 2FH5A 4X56A 2ZM2A 4N1HA 2Y2OA 2L1MA 1E25A 1NYYA 5FQ9A 3R7WA 1NLZA 1XFQA 4U0TA 1YT4A 4OOMA 4WELA 3ZVTA 2Y2LA 5FASA 4MBFA 2QJ7A 4CLCE 2WADA 3C2WA 4K0XA 1KDWA 4WZ4A 1NJ4A 4L9FA 4RVAA 4UA6A 1KVMA 5CGXA 3GRJA 1XJ3A 4WL9A 2VKSA 4DXBA 5GL9A 2JKGA 3D4FA 3MS6A 3UE3A 4HJ3A 4JF5A 3LUQA 2Z2MB 1YM1A 1CEGA 3F1NB 3S1YA 2BG1A 1F2KA 1ZTUA 1T1CA 1TS8A 3W4OA 3H82B 2J8YA 4EERA 2ZQ9A 4KZ8A 5TBMA 3ICYA 3CJMA 5FI6A 4QU3A 1XJ2A 3E0YA 1HVBA 1TS7A 1F5MA 4MEZA 4HP9A 1DJCA 3OC2A 4Y5FA 1IFQA 1ALQA 5A93A 1Q2QA 3IS2B 4KZ7A 2IWCA 4CLCD 1STZA 4O01A 4Q0JA 2D02A 4I38A 2I72A 4MN7A 1GSVA 3G30A 4OONA 2WKRA 1HLUP 2WGWA 5FSRA 2XD5A 5FATA 3IWOA 1K4FA 2HPBA 2C6WB 2XK1A 1F9IA 3BFGA 5F1FA 2O9AA 5DF7A 3G31A 3NI9A 1MC0A 4HY8A 2VLGA 4RYEA 2EWWA 2ZQ8A 3E4QA 3T4KA 1ZG6A 4UA7A 2P04A 4MBKA 4B9OA 3C7VA 1JWVA 2R9XA 5DFYA 1Q2PA 2HV1A 4DXCA 2XD1A 3A0SA 3N6IA 1VM1A 5HW3A 1K55A 4OPZA 1TS6A 3MBZA 1OTBA 2ZC5B 4HHDA 3P98A 5HAQA 1MBLA 2GDNA 3E4OA 5HZHA 4M3KA 3B3XA 4RQ9A 4EW7A 3ITBA 5F82A 5HL1A 5EUAA 3SW1A 3KYZA 4FCFA 1BSGA 3F1PA 5E2HA 4OQ0A 3NJAA 1IYOA 3LEZA 2Y2JA 4HH2A 1NXYA 4RA7A 1UWNX 3NCKA 4IVKA 3KSIA 1BZAA 1U60A 5EPHA 1BLCA 4MMNA 3HLWA 3UY6A 5TBMB 5FA7A 3G6OA 3ZVWA 1L0DA 4HI4A 5HL6A 1L0GA 3UDIA 2K2NA 4NKPA 4GHIB 1W63M 4PMAA 1NYMA 1E3UD 5CGSA 5U47A 4FSFA 3GTCA 2J9PA 3TSGA 2GX5A 1RP5A 1OPXA 4XUZA 3T1QB 1ZC2A 1CF0A 3QP6A 1FCNA 4P6ZS 4LFUA 1SCWA 1GA0A 2W0NA 4U0XA 4EETB 1OT9A 2W3EA 1MWUA 5GHXA 4HQAA 4I3IA 1ACFA 4KZ3A 4S2LA 3IHBA 4B4XA 2ZC6B 5AVEA 4P6ZM 2C5WB 3KSGA 4WMCD 4M4XA 1NLYA 5A90A 4LRXC 1ERQA 5AJGA 5CTNA 3UO9A 1IOUA 3PTEA 3D3OA 2P9VB 4GDNA 1DP8A 2KOIA 4G3WA 5KSCA 2PR6A 4DKIA 1K57A 5DVAA 3KSFA 1YLZA 2B95A 2M7UA 1LHYA 3QP1A 3IF5A 1H0MA 4RX3A 2W3DA 5CX7A 5GLBA 5GLAA 3ZNTA 3UB8A 2JBFA 1P0ZA 4GJ4A 4LRYC 3S7PA 4P87A 4NXFA 3CUEC 2PAVP 1P9WA 3DWZA 3G2ZA 1FR1A 1FSYA 2OAQ1 4LGWA 5HD3A 4PAUA 1PRQA 3GR2A 4KG2A 1KOUA 1XGJA 4NEED 5J7EA 4HP4A 3VFFA 4CPKA 4LRZE 4WZ5A 3S4XA 4NK3A 4OP8A 1SKOB 2ZC4B 1EROA 1YSQA 1DRMA 3VFHA 3R4KA 4OQHA 5EVIA 3WRZA 2GJ3A 2VGKA 1JWPA 2Z6CA 3T1SA 3T4JA 2J3TC 1P97A 3BQ8A 3CPTB 3RXWA 5HDCA 3LEQA 4ARZA 2VV6A 4YNRA 1TVFA 5AQBA 1YLJA 1BT5A 1JTGA 4E3MA 1LT0A 1XPBA 3C5AA 3UE6A 3C8CA 4EQ1A 4P0MA 4GOGA 4Y17A 2LB9A 1K6SA 5E2FA 4X1LA 3LO7A 2R78A 2JE5A 2W27A 1F98A 3ISGA 2PBYA 2WZZA 2E8JA 3IF6C 2G7UA 3LR3A 3OCNA 3JYIA 5CGWA 1N9BA 3HLFA 4NXBA 3MR0A 4X68A 5FL3A 5CHMA 4ZJ2A 5DJUA 2XDMA 5DFXA 4R3BA 2EWVA 3OPPA 4GS9B 4PM7A 4F94A 3QNBA 4DMZA 3IBRA 3UB7A 2JKTM 3PHYA 5EECA 3CMZA 3PBSA 3UPNA 4PM9A 2ZLYA 3VP3A 2D01A 4ETZA 1K54A 1OT6A 2V1ZA 4KQOA 2CC1A 2XF3A 2XROA 3ZGAB 3N8RA 3NY4A 1Z6FA 3F1NA 3IF6B 5C5KA 1LLBA 1EI5A 3PAEA 3H82A 2V20A 4OOYA 1KVLA 2V2FF 1QMEA 3ZG8B 2B02A 1SKFA 1CK3A 3MXRA 1KE0A 1I2WA 2QHKA 5EM0A 5L8MA 4S2JA 4WF0A 5IT5A 1K0KA 1VHMA 3NBLA 3FV7A 3IS2A 1VB6A 3NECA 3SZTA 3G35A 4HH3A 4BMWA 4JF4A 4NETA 3ZHHA 3SS5A 1ESIA 2Q9NA 4D60A 3MF0A 1BULA 1NZOA 3EGXC 3W8KA 1LL8A 1ESUA 5F1GA 3WS2A 1VEUB 4A5RA 1LSVA 5HWVA 2LB5A 4KZBA 2IWDA 2DRWA 1S0WA 1JWZA 3GQZA 4LENA 3S7QA 4OPQA 5HDDA 2Y2KA 3H7WB 5DTSA 3EEAA 5F6AA 4E6WA 1BTLA 1NZUA 3KO6A 3ZCZA 4JXSA 3Q07A 2L4RA 3IXBA 3M2JA 2JHEA 3MQQA 1ONGA 1BYWA 2MJ6A 3MZFA 2OAP1 1PWGA 4ESPA 2O0YA 4GLQA 4PKYG 1ES5A 1NWZA 5FDSA 5JYPA 1L0FA 2X02A 3IX3A 2G2UA 2JKRI 1YLTA 3MXQA 4E3OA 1XP4A 2INWA 5IHVA 1TS0A 3OPHA 2PU4A 1DY6A 4O7DA 1S4SA 4Y15A 4D2OA 3QP5A 3IXGA 2Z6DA 4DJ3A 2A2LA 4GNUA 3BFEA 3T1RA 1PWDA 1H8YA 2ZD8A 4PM6A 5AQ9A 4PPRA 4FOFA 1O7EA 2QYBA 2XLNA 5A8BA 4LV0A 2PU2A 4KZ5A 2W1TB 4YFMA 4B4ZA 4BJPA 3UE1A 4Y13A 3A3EA 1J3WA 1O07A 4XT2B 2OLVA 4LV2A 2ZM8A 2OWJA 3OPLA 3BRMA 4S2IA 2B5RA 3T4OA 2Y2NA 3MFDA 4HOIA 4ZTKA 3D9YA 4WEJA 1NRFA 3EOIA 4K08A 5KSHA 4N1XA 1VQQA 3OBFA 1D06A 3SOIA 4GHIA 3HJIA 2WGVA 1ES2A 5AQ7A 4BL2A 2PR5A 2EX6A 5EVEA 2IA2A 4HESA 4B93A 3HUOA 3MQOA 4I3AA 3OPRA 2V0UA 3MQ0A 3T50A 1K4EA 2P74A 1MXOA 1ZKJA 1L2SA 3MMHA 2UV0E 3FPWA 1K56D 1UGUA 4GD8A 4BBVA 5IS1A 5GLCA 3C38A 1P9RA 2ZOHA 3FC7A 2M1CA 3BLMA 3QP4A 4Q0IA 4C75A 3SH8A 3GV9A 3BECA 4S2NC 1GHMA 2ZOIA 3L7HA 3HJKA 2WYXA 3KX0X 5IU1A 3W4PA 1JTDA 5G4ZA 4KQRA 3CG5A 3RXXA 3Q7VB 2P9VA 2VGJA 1K56A 4Y3IA 1CQAA 1GHIA 4BLMA 2HP6A 3G2YA 3UPPA 2YKHA 3HUNA 3OZHA
chains in the Genus database with same CATH topology
1DP8A 2KOIA 4G3WA 4L0LA 4HIAA 4HJ6A 2PR6A 3A0VA 3BY9A 5DKLA 1T19A 3KSFA 2PYPA 2PD8A 2M7UA 1N9NA 2OWHA 3TW8A 4GW9A 1YAXA 3EGDC 1EW0A 1XJ4A 4YOFA 2V1BA 3NOPC 3LIBA 1UWPX 3CAXA 2W3DA 5CX7A 2DMWA 2VEAA 3BWLA 2ZBBA 4KUOA 4H6JA 3UB8A 3MJQA 1P0ZA 4GJ4A 4LRYC 4KUKA 3S7PA 4IUKA 2PT7A 5DJTA 4YWZA 4NXFA 3CUEC 1P9WA 2V1AA 4H6JB 2OAQ1 5KIZA 2H28A 3A0RA 2ZMVA 5HD3A 1G28A 4PAUA 4EU0A 4CQHA 2VJWA 4R38A 3LICA 1KOUA 4EEUA 4NEED 5J7EA 4HP4A 3EEHA 4LRZE 3UMEA 5EFWA 4QPRA 5DKKA 2PD7A 4G3KA 3FG8A 4JGPA 3H9WA 3LR0A 4GCZA 1YSQA 2HJEA 3TJZC 2QJ5A 1H3QA 1DRMA 2VX8A 4UQIS 3R4KA 3W2ZA 4BBUA 2GJ3A 3KSHA 3T4TA 4ZRRA 3S7NA 2Z6CA 3EWKA 3T4JA 2J3TC 1OJGA 1P97A 2JKTI 1S66L 3BQ8A 3K3DA 1YSPA 5HDCA 4ARZA 2VA0A 2VV6A 4YNRA 2W3GA 1ODVA 4KQDA 5MC7A 3VE3A 1TF1A 1X0OA 2A24A 5AVFA 3D72A 4CLCC 1T1BA 4Q0HA 4ARZB 4UQIM 4Z1WA 5K5BA 1LT0A 3LFVA 3PYPA 3UE6A 3C8CA 2A24B 4EQ1A 3HCYA 4UEYA 3CI6A 3JVUA 4ETXA 2LB9A 3PBNA 3S7OA 2PYRA 5HWWA 2ZMFA 4I3JA 2R78A 4EESA 4R3AA 2W27A 4HJ4A 3EQVA 1F98A 1GSWA 1Y28A 2G7UA 3LR3A 3NHQA 3OCNA 3ULFA 3CWFA 4E04A 3NOUC 4GS9A 3CLOA 4NXBA 3MR0A 1LSXA 3LR5A 4L9EA 4R70A 2K7SA 5F5YA 2EA9A 5FL3A 3UB6A 2GNXA 5DJUA 2VV7A 3TRCA 5DFXA 1OTIA 2FH5A 2EWVA 4GS9B 2I9VA 2WKPA 4CLCA 1S1ZA 2L1MA 2NUTC 2VZWA 3R7WA 4DMZA 1NLZA 3IBRA 4R6LA 4CLCB 4MN5A 1T18A 3UB7A 4DN0A 1XFQA 5HWTA 2JKTM 3OOVA 3PHYA 4OOMA 4WELA 1N9LA 2P7JA 3R7WB 3EQUA 1S1YA 1ZHHB 2QJ7A 3PBSA 4I5SA 3RFBA 3VV4A 1S67L 4II7A 3K2NA 4CLCE 2J80A 3C2WA 2D01A 4L9FA 4ETZA 2NUPC 1OT6A 1XJ3A 4BBTA 3MFXA 4KQOA 2VKSA 4WL9A 3K3CA 2XROA 3UE3A 1DP6A 2V9AA 4HJ3A 3F1NA 4HNBA 3DBAA 4MCWA 5C5KA 4L9GA 4MDZA 3LUQA 3JVVA 2PHYA 3LI9A 2JN7A 3F1NB 2KLIA 5F69A 1JNUA 2O99A 2HJ9C 3H82A 1ZTUA 2Y79A 5J3WA 3BQAA 1T1CA 2VV8A 1TS8A 2P08A 2QKPA 1WA9A 3H82B 3UMDA 3VOLA 4EERA 2B02A 3NOTC 3LIDA 5TBMA 1XJ6A 3ICYA 3B33A 2QHKA 2HF6A 1V9YA 1XJ2A 2Y8HA 3E0YA 4LLOB 5L8MA 4WF0A 5IT5A 1TS7A 1F5MA 1VHMA 4HP9A 2YKFA 2J3TD 3FPVA 3OC2A 3IS2A 4JGQA 3CUEA 3B47A 2XSSA 1VB6A 1MZUA 3CITA 2J3WA 4Y5FA 3F1OA 4HH3A 1OTDA 4BMWA 1IFQA 4O0PA 3IS2B 4LPZA 2W1RA 4CLCD 4EXOA 1STZA 3MF0A 3PBTA 3F1OB 4MN6A 2D02A 4O01A 4Q0JA 2WKQA 5F68A 3EGXC 4I38A 1LL8A 4MN7A 1GSVA 3TE8A 1LSVA 5TJJA 5HWVA 3ZYTA 1V9ZA 4WN5A 2WKRA 2GZAA 2LB5A 2W3FA 3ZQ5A 1OTAA 2V0WA 3H7WA 3LIAA 4JGRA 3UB9A 1T1AA 3S7QA 3U2AA 4NXGA 5HDDA 2B18A 1F9IA 4I39A 3P7NA 2O9AA 3H7WB 4WLAA 3EEAA 1MC0A 5F6AA 4HY8A 2VLGA 5LBRA 5J4EA 3KO6A 4PKYA 2EWWA 4Y2FA 3E4QA 3T4KA 4O8GA 2VGLS 2L4RA 4PHTA 1GSXA 5HD5A 2P04A 2KDKA 2O9BA 2JHEA 3T4LA 4B9OA 3MQQA 1BYWA 2MJ6A 1W63Q 2OAP1 3PBOA 4ME4A 2O0YA 4GLQA 3T4QA 4PKYG 1NWZA 4AFIA 5DFYA 3VE4A 2JKRI 2HV1A 5HDSA 1TD5A 3PBRA 3MXQA 4DJ2A 3E4PA 2VGLM 1LSWA 3A0SA 2INWA 4WUJA 1TS0A 1H8MA 1S4SA 3LYXA 2M7VA 4EUVA 2W1TA 2Z6DA 4DJ3A 2A2LA 1S4RA 3PXPA 1TS6A 1N9OA 3BJNA 4FOFA 2QYBA 4G3VA 1OTBA 4XT2A 4IUHA 4EEPA 5A8BA 3KYQA 2W1TB 4HHDA 3V67A 4BJPA 4OOLA 2W3HA 4WEKA 3E4OA 3O5YA 5HZHA 2QWSA 5HPFA 1OTEA 4XT2B 3GDIA 4RQ9A 2OWJA 4EW7A 3SW1A 1D7EA 5HPIA 3KYZA 3T4OA 4HOIA 3F1PA 3NJAA 4HH2A 4WEJA 1UWNX 1DP9A 2XA7S 1G6OA 3KSIA 3EOIA 1YKDA 3F1PB 3RTYA 4K08A 5KSHA 3LR4A 4IJGA 4MMNA 2FZ0A 3P01A 3OBFA 1NRJA 5TBMB 1D06A 3G6OA 3OCLA 4GHIA 3HJIA 3C30A 4HI4A 2HGVA 5HL6A 2PR5A 3BW6A 2IA2A 2JKRM 4B93A 2K2NA 4NKPA 4GHIB 3BY8A 3MQOA 1W63M 4I3AA 2XA7M 2V0UA 3MQ0A 3T50A 5HSQA 4BWIA 2O9CA 3LI8A 3MMHA 2PDRA 3T4SA 4FSFA 3FPWA 3IBJA 2GX5A 3PBQA 3LIEA 2CMNA 1OPXA 1UGUA 4BBVA 1XFNA 5IS1A 1OJ5A 3C38A 4JGOA 1P9RA 4P6ZS 2ZOHA 3FC7A 2M1CA 3GECA 2W0NA 4EETB 4Q0IA 1OT9A 2W3EA 1MKMA 2BASA 4HQAA 2K31A 4I3IA 2KX6A 3LIFA 5G4YA 2ZOIA 3HJKA 2OOLA 3KX0X 4IHQA 5AVEA 5IU1A 4P6ZM 3PR6A 5G4ZA 3KSGA 4NXEA 5I5LA 5DF9A 4F3LA 4M4XA 1NLYA 3E98A 4LRXC 5AJGA 3OLOA 2L0WA 4Y3IA 3RH8B 1IOUA 2XRNA 4F3LB 3D3OA 3B42A 2YKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOI A;  4G3W A;  2XSS A;  5HPI A;  3CIT A;  3KSF A;  4Y5F A;  2M7U A;  4O0P A;  4GW9 A;  2G7U A;  2W1R A;  3NHQ A;  4E04 A;  3NOU C;  1STZ A;  3MF0 A;  4O01 A;  4Q0J A;  4YOF A;  3KSI A;  4R70 A;  1YKD A;  3NOP C;  2W3D A;  3TRC A;  4IJG A;  4MMN A;  2VEA A;  4MN7 A;  5DFX A;  3OBF A;  3G6O A;  5HL6 A;  2HGV A;  5TJJ A;  4LRY C;  2IA2 A;  3S7P A;  4IUK A;  2LB5 A;  2W3F A;  2VZW A;  3ZQ5 A;  2K2N A;  4DMZ A;  3IBR A;  4R6L A;  4DN0 A;  3S7Q A;  3MQ0 A;  3OOV A;  2B18 A;  5HSQ A;  4BWI A;  2O9C A;  4PAU A;  2O9A A;  3EEA A;  1MC0 A;  5LBR A;  4EU0 A;  3MMH A;  3RFB A;  3KO6 A;  4CQH A;  3VV4 A;  3IBJ A;  2VJW A;  3K2N A;  4Y2F A;  4O8G A;  2GX5 A;  3C2W A;  4ETZ A;  4LRZ E;  2O9B A;  4QPR A;  2VKS A;  4ME4 A;  4G3K A;  2O0Y A;  2XRO A;  4GLQ A;  1YSQ A;  5DFY A;  3DBA A;  4MCW A;  5C5K A;  3R4K A;  4MDZ A;  3W2Z A;  4Q0I A;  3KSH A;  2W3E A;  1TD5 A;  1MKM A;  4ZRR A;  3S7N A;  2K31 A;  2KLI A;  1YSP A;  2O99 A;  1ZTU A;  2Y79 A;  2OOL A;  4YNR A;  2W3G A;  1TF1 A;  2M7V A;  4EUV A;  2W1T A;  4Q0H A;  3KSG A;  5I5L A;  4Z1W A;  5K5B A;  3BJN A;  3LFV A;  3NOT C;  4FOF A;  2QYB A;  4G3V A;  3E98 A;  4IUH A;  4LRX C;  5AJG A;  2W1T B;  2Y8H A;  3E0Y A;  3HCY A;  3CI6 A;  4Y3I A;  5L8M A;  2W3H A;  2XRN A;  3O5Y A;  1F5M A;  4ETX A;  5HPF A;  3D3O A;  2LB9 A;  1VHM A;  3S7O A;  4RQ9 A;  2ZMF A; 
#chains in the Genus database with same CATH topology
 3QP2 A;  2HDU A;  1BUE A;  1N9N A;  2OWH A;  2J7V A;  4GW9 A;  4EQI A;  1EW0 A;  1XJ4 A;  4YOF A;  1Z09 A;  5I94 A;  5M19 A;  1W8Y A;  3VOZ A;  1UWP X;  3CAX A;  4IBR A;  1G5U A;  5A92 A;  2VK3 A;  3ZG9 B;  1PZO A;  4Y0O A;  1K6R A;  1BLP A;  4E3N A;  5AQA A;  3MJQ A;  2HDS A;  4IUK A;  2PT7 A;  2XR0 A;  1WYC A;  1HD8 A;  4H6J B;  4K91 A;  4E3L A;  1G28 A;  4EU0 A;  4OQG A;  2VJW A;  5FI2 A;  3A3F A;  1HTZ A;  1SKO A;  3EEH A;  3IT9 A;  5EFW A;  2Y4A A;  4QPR A;  4HBU A;  5DKK A;  4G3K A;  4S2P A;  5D3O A;  1DJB A;  3H9W A;  3LR0 A;  3TJZ C;  3HLB A;  5KZH A;  1IEL A;  3CPT A;  4BBU A;  2HZ5 A;  4DE0 A;  2WZX A;  3IWQ A;  3EWK A;  5GHY A;  3K3D A;  3L9K A;  2ZQD A;  4JF6 A;  1CI9 A;  3AGE A;  5MC7 A;  3VE3 A;  5FQJ A;  1X0O A;  3DTM A;  5E2E A;  4CLC C;  4Q0H A;  3PYP A;  5GHZ A;  5FQM A;  4BD0 A;  3HCY A;  3CI6 A;  4U3T A;  3JVU A;  5CHU A;  5DTT A;  2JKF A;  2HDR A;  3S7O A;  4I3J A;  4EES A;  4N9L A;  4R3A A;  1FQG A;  4OH0 A;  4R3J A;  3Q81 A;  1GSW A;  3UE0 A;  4IBX A;  5HFO A;  1C3B A;  3NHQ A;  1YLW A;  4P6B A;  3NOU C;  4GS9 A;  3CLO A;  4OKP A;  4L9E A;  4R70 A;  1E4D A;  4DDY A;  1ERM A;  2VV7 A;  3TRC A;  3DW0 A;  3ZFZ A;  1HZO A;  4H8R A;  3AGD A;  2I9V A;  4GZB A;  3MZD A;  2WK0 A;  3NIA A;  3IXH A;  1S1Z A;  3O3V A;  3AGF A;  3DTE A;  3NDE A;  4CLC B;  1G68 A;  2ZM0 A;  4UAA A;  5HWT A;  3QNC A;  4QWO A;  1N9L A;  2P7J A;  1S1Y A;  4Z9Q A;  1TEM A;  1PI4 A;  4I5S A;  3RFB A;  1S67 L;  4II7 A;  3K2N A;  2OSU A;  2J80 A;  5EVI D;  1XA7 A;  3IF6 A;  4BBT A;  1RCJ A;  3K3C A;  1H8Z A;  2H0Y A;  5L10 A;  2V9A A;  4HBT A;  3DBA A;  3M6B A;  1CI8 A;  4MCW A;  4L9G A;  4CJN A;  3GSG A;  3JVV A;  1SDN A;  2PHY A;  4PM5 A;  3A3J A;  1ES3 A;  2KLI A;  1LI0 A;  5F69 A;  2O99 A;  3NUL A;  2Y79 A;  5J3W A;  3BQA A;  3TG9 A;  4E3J A;  3FWL A;  2P08 A;  2QKP A;  1WA9 A;  4GN2 A;  4KZA A;  3WS0 A;  5CEC A;  1GCE A;  4BL3 A;  2HF6 A;  1V9Y A;  3WS1 A;  2Y91 A;  2WGI A;  2YKF A;  1SHV A;  4QB8 A;  1FCM A;  3B47 A;  2XSS A;  2J3W A;  1M40 A;  2FFF B;  1L3L A;  4O0P A;  3MSH A;  3PBT A;  3F1O B;  4JXV A;  1OME A;  4MN6 A;  1VEU A;  1PI5 A;  2WKQ A;  3LY4 A;  2R9W A;  2WAF A;  3TE8 A;  1MPL A;  3VP1 A;  5TJJ A;  1V9Z A;  4WN5 A;  1CJF A;  2GZA A;  5FAP A;  4Q8I A;  3H7W A;  3LIA A;  1IYS A;  3UB9 A;  1K57 C;  5E43 A;  5EOE A;  1T1A A;  2Y2P A;  3U2A A;  4X6T A;  1PFL A;  3P7N A;  5GLD A;  1BLH A;  3IXD A;  5LBR A;  4PKY A;  1GSX A;  3ZG0 A;  4UA9 A;  2O9B A;  3ZDJ A;  3T4L A;  1W7F A;  3O86 A;  1FIK A;  5FAO A;  3QHY A;  1PYY A;  5HDS A;  5EE8 A;  4DJ2 A;  1JVJ A;  3MZE A;  3WRT A;  1LSW A;  5G18 A;  5M1A A;  4QJG A;  4WUJ A;  4K0W A;  1H8M A;  3LYX A;  2M7V A;  2W1T A;  3VP4 A;  1S4R A;  3PXP A;  3NDG A;  1N9O A;  5A91 A;  4G3V A;  2Y2G A;  5TR7 A;  4XT2 A;  4IUH A;  3KYQ A;  1G6A A;  5M18 A;  3ZG7 B;  3V67 A;  4OOL A;  4QY6 A;  4WEK A;  5EVI C;  5HPF A;  1BLS A;  3GDI A;  1NY0 A;  4RX2 A;  2X71 A;  1D7E A;  2XQZ A;  5F83 A;  3LCE A;  2H5S A;  3BFC A;  2EX8 A;  1Y54 A;  3IHA A;  5JYO A;  3I7J A;  1DP9 A;  1KGF A;  1G6O A;  1YKD A;  3RTY A;  3BEB A;  3GVB A;  3M2K A;  3G32 A;  4MLL A;  4IJG A;  2FZ0 A;  3P01 A;  1NRJ A;  5CHJ A;  3HBR A;  3G34 A;  1SDE A;  3C30 A;  3LY3 A;  4KZ9 A;  2RCX A;  2JKR M;  2RL3 A;  2UWX A;  4B88 A;  3A3I A;  5HSQ A;  4BWI A;  1PWC A;  3DAV A;  2PDR A;  3T4S A;  2G2W A;  4JBF A;  3IBJ A;  2JC7 A;  3PBQ A;  1I2S A;  1XFN A;  1PW8 A;  2IWB A;  3N8S A;  3HLG A;  2WKH A;  1XKZ A;  3RJU A;  5EOO A;  4N9K A;  3VMA A;  3C4P A;  1ONH A;  1MKM A;  3UN7 A;  3V50 A;  2BAS A;  4S2M A;  4GD6 A;  3W4Q A;  4R4S A;  1GA9 A;  2KX6 A;  3LIF A;  5HX9 A;  1XX2 A;  3IX8 A;  2OOL A;  4UHU A;  3Q7V A;  2WUQ A;  2Q0O A;  2HP5 A;  3JPU A;  3PR6 A;  1K54 C;  5FDH A;  5I5L A;  3E98 A;  5L09 A;  3N4I A;  3OLO A;  2EFU A;  4FD8 A;  1VET B;  1MKI A;  2XH9 A;  2XRN A;  4FTX A;  4F3L B;  1MWR A;  4OLG A;  5FQQ A;  4L0L A;  2ACG A;  4MNR A;  1T19 A;  2PYP A;  2PD8 A;  4X25 A;  1IYQ A;  4FUW A;  3TW8 A;  3EGD C;  3VSL A;  1W79 A;  2OLU A;  2XGN A;  2V1B A;  4S2K A;  4S2N A;  3LIB A;  4KZ4 A;  2WKI A;  1AWI A;  2VEA A;  3BWL A;  5BOH A;  3UB5 P;  3HLE A;  4KUO A;  4H6J A;  3C7U A;  3V3R A;  4KG5 A;  3T12 B;  3P09 A;  4KUK A;  4XUX A;  3HUM A;  4IVI A;  5KIZ A;  1J9M A;  2H28 A;  2A3U A;  2ZMV A;  3HRE A;  3G4P A;  3E2L A;  3UDX A;  1A0K A;  5EV0 A;  1RGY A;  5E2G A;  1YPR A;  1M6K A;  3UME A;  3WS5 A;  1FR6 A;  4C3Q A;  2JCH A;  2BLS A;  1QMF A;  2Y2Q A;  4GCZ A;  2ZL1 B;  2HJE A;  1H3Q A;  2VX8 A;  3W2Z A;  4Y0T A;  3KSH A;  3T4T A;  4ZRR A;  3SH9 A;  3S7N A;  3Q7Z A;  1OJG A;  4DF6 A;  1S66 L;  4XXR A;  4KEN B;  1LL5 A;  2QPN A;  2VA0 A;  1ODV A;  4ZJ1 A;  5AVF A;  1T1B A;  3SH7 A;  4Z1W A;  5K5B A;  4PM8 A;  3WWX A;  2A24 B;  2HDQ A;  3IH8 A;  4ETX A;  2Y2M A;  3T1X A;  2PYR A;  5HWW A;  3HLC A;  2ZMF A;  4HJ4 A;  3HL9 A;  1TDL A;  3Q82 A;  1Y28 A;  1MWT A;  5DF8 A;  3ULF A;  4E04 A;  4E3K A;  1LSX A;  3N7W A;  3LR5 A;  2H0T A;  2K7S A;  4X55 A;  2EA9 A;  1D1J A;  4OQI A;  4KG6 A;  2AVX A;  4X53 A;  4E6X A;  4NG2 A;  1KE4 A;  2WKP A;  4CLC A;  3DTI A;  4HEF A;  2NUT C;  3IWI A;  2VZW A;  4QHC A;  3MKF A;  4DN0 A;  4R6L A;  3M6H A;  1T18 A;  4MN5 A;  2Z2L B;  3OOV A;  3UPO A;  3R7W B;  3EQU A;  3N8L A;  1ZHH B;  3VV4 A;  5CEB A;  3DTK A;  2HP9 A;  4OPR A;  2H10 A;  2NUP C;  3MFX A;  1FSW A;  4WM9 A;  1DP6 A;  1PNE A;  4BQM A;  3A3D A;  1MWS A;  4HNB A;  3O87 A;  4WYY A;  2WAE A;  1PZP A;  3FYZ A;  3GMW A;  4MDZ A;  4S2O A;  3V5M A;  1ZG4 A;  1GHP A;  3LI9 A;  3CZD A;  2JN7 A;  1IKI A;  1JNU A;  2HJ9 C;  3ITA A;  1TDG A;  2VV8 A;  5FEG A;  5HAP A;  3UMD A;  3VOL A;  4C6Y A;  2PRF A;  1N4O A;  4R23 A;  1FOF A;  3NOT C;  3LID A;  1XJ6 A;  1IKG A;  1IEM A;  5FI7 A;  3B33 A;  2Y8H A;  2EX9 A;  4LLO B;  5EVL A;  5HAR A;  4ID4 A;  4KZ6 A;  2J3T D;  3FPV A;  4JGQ A;  3CUE A;  1MZU A;  3CIT A;  4ZAM A;  2Y59 A;  3F1O A;  2Y2H A;  1OTD A;  5EM1 A;  4LPZ A;  2W1R A;  4LCM A;  4EXO A;  3S22 A;  1RGZ A;  2FFY A;  1FCO A;  5F68 A;  1EWZ A;  4EBP A;  2Q9M A;  3ZYT A;  3UDF A;  2W3F A;  3ZQ5 A;  4OLD A;  1OTA A;  2V0W A;  4JGR A;  1K55 C;  4QY5 A;  2J9O A;  3O88 A;  4NXG A;  2B18 A;  4I39 A;  2WGW B;  4WLA A;  5J4E A;  1YQS A;  2XFS A;  4Y2F A;  4O8G A;  2VGL S;  3V3S A;  3DWK A;  4PHT A;  4ZBE A;  4QD4 A;  1E3U A;  5HD5 A;  5CXW A;  4DRT A;  2KDK A;  4LV3 A;  5FAQ A;  4X69 A;  1W63 Q;  3PBO A;  4ME4 A;  3T4Q A;  1Y4O A;  4LCL A;  4AFI A;  2E8I A;  3VE4 A;  1TD5 A;  3PBR A;  3E4P A;  2VGL M;  2XEP A;  2ZC3 B;  2ZQ7 A;  1YMX A;  1YLY A;  5TFQ A;  4MBH A;  1MY8 A;  1ES4 A;  3HLD A;  4EUV A;  5KMW A;  5L07 A;  5CRF A;  2PBD P;  3BJN A;  3CHW P;  4EEP A;  4GKU A;  4X1M A;  3TOI A;  4N92 A;  4EBL A;  3V39 A;  2EXA A;  3MKE A;  2W3H A;  3O5Y A;  2ZJ9 A;  2QWS A;  4LV1 A;  1OTE A;  4JPM A;  4Y7P A;  4WMC A;  1DJA A;  3ZG5 A;  5HPI A;  1YLP A;  2DCF A;  4OVD A;  1W5D A;  3ZNY A;  1H5X A;  2XA7 S;  3F1P B;  1PIO A;  3LR4 A;  4Y0U A;  4FH2 A;  2ZQC A;  3LGO A;  3OCL A;  2Y55 A;  4E3I A;  2HGV A;  1LI9 A;  2QZ6 A;  3BW6 A;  3BY8 A;  2EXB A;  2XA7 M;  2ZMA A;  2EX2 A;  2O9C A;  3LI8 A;  4P85 A;  5FEF A;  3E2K A;  4EWF A;  1WYB A;  3NC8 A;  3LIE A;  2CMN A;  2X01 A;  1K38 A;  3VP2 A;  1OJ5 A;  4JGO A;  2XFT A;  3GEC A;  3Q1F A;  3BYD A;  1WE4 A;  2K31 A;  3MXS A;  3U4L P;  2V8C A;  3QP8 A;  5G4Y A;  4IHQ A;  1VET A;  4KQQ A;  4NXE A;  4JKT A;  5DF9 A;  4DE1 A;  4F3L A;  1XXM A;  4R0Q A;  3BFF A;  2L0W A;  3RH8 B;  3VOY A;  4FH4 A;  1XA1 A;  1IYP A;  1CEF A;  3B42 A;  1KDS A;  4HIA A;  4HJ6 A;  4R4R A;  3A0V A;  3BY9 A;  5DKL A;  4EV4 A;  3FZC A;  3BFD A;  1LL9 A;  2BTF P;  4WZ5 C;  1YAX A;  2ZC7 A;  4DE2 A;  3NOP C;  2V8F A;  4WBG A;  3FKV A;  2DMW A;  4R1G A;  2ZBB A;  1FIL A;  3SS3 A;  4ZJ3 A;  4BEN A;  4DDS A;  5DJT A;  4YWZ A;  2V1A A;  5J8X A;  3IX4 A;  4GB7 A;  3UNW A;  3A0R A;  2DNS A;  3FKW A;  4OPY A;  4CQH A;  1XGI A;  4DE3 A;  4R38 A;  3LIC A;  4EEU A;  5FQK A;  2ZL1 A;  2ZQA A;  2PD7 A;  5DTK A;  3WS4 A;  3FG8 A;  4JGP A;  3BM6 A;  3HVF A;  2QJ5 A;  4JLF A;  4ZDX A;  4UQI S;  3VSK A;  3VP0 A;  5FQI A;  3SS4 A;  2JKT I;  1YSP A;  3IQA A;  5EVI B;  1KGE A;  1K25 A;  2W3G A;  2EFX A;  3IH9 A;  4KQD A;  1TF1 A;  5CTM A;  2A49 A;  1KGG A;  2A24 A;  4YIN A;  3PAG A;  3D72 A;  1W8Q A;  4ARZ B;  4GDB A;  4UQI M;  4BD1 A;  3LFV A;  3BLS A;  3KYE A;  3C4O A;  1SZV A;  4UEY A;  2OV5 A;  4JXG A;  1AXB A;  2QMI A;  3PBN A;  4IED A;  1I5Q A;  1YMS A;  5TGF A;  4EBN A;  3EQV A;  4EUZ A;  1S6R A;  5L2F A;  1L0E A;  4OP5 A;  2Y2I A;  5CED A;  3CWF A;  1PW1 A;  5F5Y A;  3UB6 A;  2GNX A;  2WKE A;  4JXW A;  5CER A;  5HAI A;  1KE3 A;  1OTI A;  2FH5 A;  4X56 A;  2ZM2 A;  4N1H A;  2Y2O A;  2L1M A;  1E25 A;  1NYY A;  5FQ9 A;  3R7W A;  1NLZ A;  1XFQ A;  4U0T A;  1YT4 A;  4OOM A;  4WEL A;  3ZVT A;  2Y2L A;  5FAS A;  4MBF A;  2QJ7 A;  4CLC E;  2WAD A;  3C2W A;  4K0X A;  1KDW A;  4WZ4 A;  1NJ4 A;  4L9F A;  4RVA A;  4UA6 A;  1KVM A;  5CGX A;  3GRJ A;  1XJ3 A;  4WL9 A;  2VKS A;  4DXB A;  5GL9 A;  2JKG A;  3D4F A;  3MS6 A;  3UE3 A;  4HJ3 A;  4JF5 A;  3LUQ A;  2Z2M B;  1YM1 A;  1CEG A;  3F1N B;  3S1Y A;  2BG1 A;  1F2K A;  1ZTU A;  1T1C A;  1TS8 A;  3W4O A;  3H82 B;  2J8Y A;  4EER A;  2ZQ9 A;  4KZ8 A;  5TBM A;  3ICY A;  3CJM A;  5FI6 A;  4QU3 A;  1XJ2 A;  3E0Y A;  1HVB A;  1TS7 A;  1F5M A;  4MEZ A;  4HP9 A;  1DJC A;  3OC2 A;  4Y5F A;  1IFQ A;  1ALQ A;  5A93 A;  1Q2Q A;  3IS2 B;  4KZ7 A;  2IWC A;  4CLC D;  1STZ A;  4O01 A;  4Q0J A;  2D02 A;  4I38 A;  2I72 A;  4MN7 A;  1GSV A;  3G30 A;  4OON A;  2WKR A;  1HLU P;  2WGW A;  5FSR A;  2XD5 A;  5FAT A;  3IWO A;  1K4F A;  2HPB A;  2C6W B;  2XK1 A;  1F9I A;  3BFG A;  5F1F A;  2O9A A;  5DF7 A;  3G31 A;  3NI9 A;  1MC0 A;  4HY8 A;  2VLG A;  4RYE A;  2EWW A;  2ZQ8 A;  3E4Q A;  3T4K A;  1ZG6 A;  4UA7 A;  2P04 A;  4MBK A;  4B9O A;  3C7V A;  1JWV A;  2R9X A;  5DFY A;  1Q2P A;  2HV1 A;  4DXC A;  2XD1 A;  3A0S A;  3N6I A;  1VM1 A;  5HW3 A;  1K55 A;  4OPZ A;  1TS6 A;  3MBZ A;  1OTB A;  2ZC5 B;  4HHD A;  3P98 A;  5HAQ A;  1MBL A;  2GDN A;  3E4O A;  5HZH A;  4M3K A;  3B3X A;  4RQ9 A;  4EW7 A;  3ITB A;  5F82 A;  5HL1 A;  5EUA A;  3SW1 A;  3KYZ A;  4FCF A;  1BSG A;  3F1P A;  5E2H A;  4OQ0 A;  3NJA A;  1IYO A;  3LEZ A;  2Y2J A;  4HH2 A;  1NXY A;  4RA7 A;  1UWN X;  3NCK A;  4IVK A;  3KSI A;  1BZA A;  1U60 A;  5EPH A;  1BLC A;  4MMN A;  3HLW A;  3UY6 A;  5TBM B;  5FA7 A;  3G6O A;  3ZVW A;  1L0D A;  4HI4 A;  5HL6 A;  1L0G A;  3UDI A;  2K2N A;  4NKP A;  4GHI B;  1W63 M;  4PMA A;  1NYM A;  1E3U D;  5CGS A;  5U47 A;  4FSF A;  3GTC A;  2J9P A;  3TSG A;  2GX5 A;  1RP5 A;  1OPX A;  4XUZ A;  3T1Q B;  1ZC2 A;  1CF0 A;  3QP6 A;  1FCN A;  4P6Z S;  4LFU A;  1SCW A;  1GA0 A;  2W0N A;  4U0X A;  4EET B;  1OT9 A;  2W3E A;  1MWU A;  5GHX A;  4HQA A;  4I3I A;  1ACF A;  4KZ3 A;  4S2L A;  3IHB A;  4B4X A;  2ZC6 B;  5AVE A;  4P6Z M;  2C5W B;  3KSG A;  4WMC D;  4M4X A;  1NLY A;  5A90 A;  4LRX C;  1ERQ A;  5AJG A;  5CTN A;  3UO9 A;  1IOU A;  3PTE A;  3D3O A;  2P9V B;  4GDN A;  1DP8 A;  2KOI A;  4G3W A;  5KSC A;  2PR6 A;  4DKI A;  1K57 A;  5DVA A;  3KSF A;  1YLZ A;  2B95 A;  2M7U A;  1LHY A;  3QP1 A;  3IF5 A;  1H0M A;  4RX3 A;  2W3D A;  5CX7 A;  5GLB A;  5GLA A;  3ZNT A;  3UB8 A;  2JBF A;  1P0Z A;  4GJ4 A;  4LRY C;  3S7P A;  4P87 A;  4NXF A;  3CUE C;  2PAV P;  1P9W A;  3DWZ A;  3G2Z A;  1FR1 A;  1FSY A;  2OAQ 1;  4LGW A;  5HD3 A;  4PAU A;  1PRQ A;  3GR2 A;  4KG2 A;  1KOU A;  1XGJ A;  4NEE D;  5J7E A;  4HP4 A;  3VFF A;  4CPK A;  4LRZ E;  4WZ5 A;  3S4X A;  4NK3 A;  4OP8 A;  1SKO B;  2ZC4 B;  1ERO A;  1YSQ A;  1DRM A;  3VFH A;  3R4K A;  4OQH A;  5EVI A;  3WRZ A;  2GJ3 A;  2VGK A;  1JWP A;  2Z6C A;  3T1S A;  3T4J A;  2J3T C;  1P97 A;  3BQ8 A;  3CPT B;  3RXW A;  5HDC A;  3LEQ A;  4ARZ A;  2VV6 A;  4YNR A;  1TVF A;  5AQB A;  1YLJ A;  1BT5 A;  1JTG A;  4E3M A;  1LT0 A;  1XPB A;  3C5A A;  3UE6 A;  3C8C A;  4EQ1 A;  4P0M A;  4GOG A;  4Y17 A;  2LB9 A;  1K6S A;  5E2F A;  4X1L A;  3LO7 A;  2R78 A;  2JE5 A;  2W27 A;  1F98 A;  3ISG A;  2PBY A;  2WZZ A;  2E8J A;  3IF6 C;  2G7U A;  3LR3 A;  3OCN A;  3JYI A;  5CGW A;  1N9B A;  3HLF A;  4NXB A;  3MR0 A;  4X68 A;  5FL3 A;  5CHM A;  4ZJ2 A;  5DJU A;  2XDM A;  5DFX A;  4R3B A;  2EWV A;  3OPP A;  4GS9 B;  4PM7 A;  4F94 A;  3QNB A;  4DMZ A;  3IBR A;  3UB7 A;  2JKT M;  3PHY A;  5EEC A;  3CMZ A;  3PBS A;  3UPN A;  4PM9 A;  2ZLY A;  3VP3 A;  2D01 A;  4ETZ A;  1K54 A;  1OT6 A;  2V1Z A;  4KQO A;  2CC1 A;  2XF3 A;  2XRO A;  3ZGA B;  3N8R A;  3NY4 A;  1Z6F A;  3F1N A;  3IF6 B;  5C5K A;  1LLB A;  1EI5 A;  3PAE A;  3H82 A;  2V20 A;  4OOY A;  1KVL A;  2V2F F;  1QME A;  3ZG8 B;  2B02 A;  1SKF A;  1CK3 A;  3MXR A;  1KE0 A;  1I2W A;  2QHK A;  5EM0 A;  5L8M A;  4S2J A;  4WF0 A;  5IT5 A;  1K0K A;  1VHM A;  3NBL A;  3FV7 A;  3IS2 A;  1VB6 A;  3NEC A;  3SZT A;  3G35 A;  4HH3 A;  4BMW A;  4JF4 A;  4NET A;  3ZHH A;  3SS5 A;  1ESI A;  2Q9N A;  4D60 A;  3MF0 A;  1BUL A;  1NZO A;  3EGX C;  3W8K A;  1LL8 A;  1ESU A;  5F1G A;  3WS2 A;  1VEU B;  4A5R A;  1LSV A;  5HWV A;  2LB5 A;  4KZB A;  2IWD A;  2DRW A;  1S0W A;  1JWZ A;  3GQZ A;  4LEN A;  3S7Q A;  4OPQ A;  5HDD A;  2Y2K A;  3H7W B;  5DTS A;  3EEA A;  5F6A A;  4E6W A;  1BTL A;  1NZU A;  3KO6 A;  3ZCZ A;  4JXS A;  3Q07 A;  2L4R A;  3IXB A;  3M2J A;  2JHE A;  3MQQ A;  1ONG A;  1BYW A;  2MJ6 A;  3MZF A;  2OAP 1;  1PWG A;  4ESP A;  2O0Y A;  4GLQ A;  4PKY G;  1ES5 A;  1NWZ A;  5FDS A;  5JYP A;  1L0F A;  2X02 A;  3IX3 A;  2G2U A;  2JKR I;  1YLT A;  3MXQ A;  4E3O A;  1XP4 A;  2INW A;  5IHV A;  1TS0 A;  3OPH A;  2PU4 A;  1DY6 A;  4O7D A;  1S4S A;  4Y15 A;  4D2O A;  3QP5 A;  3IXG A;  2Z6D A;  4DJ3 A;  2A2L A;  4GNU A;  3BFE A;  3T1R A;  1PWD A;  1H8Y A;  2ZD8 A;  4PM6 A;  5AQ9 A;  4PPR A;  4FOF A;  1O7E A;  2QYB A;  2XLN A;  5A8B A;  4LV0 A;  2PU2 A;  4KZ5 A;  2W1T B;  4YFM A;  4B4Z A;  4BJP A;  3UE1 A;  4Y13 A;  3A3E A;  1J3W A;  1O07 A;  4XT2 B;  2OLV A;  4LV2 A;  2ZM8 A;  2OWJ A;  3OPL A;  3BRM A;  4S2I A;  2B5R A;  3T4O A;  2Y2N A;  3MFD A;  4HOI A;  4ZTK A;  3D9Y A;  4WEJ A;  1NRF A;  3EOI A;  4K08 A;  5KSH A;  4N1X A;  1VQQ A;  3OBF A;  1D06 A;  3SOI A;  4GHI A;  3HJI A;  2WGV A;  1ES2 A;  5AQ7 A;  4BL2 A;  2PR5 A;  2EX6 A;  5EVE A;  2IA2 A;  4HES A;  4B93 A;  3HUO A;  3MQO A;  4I3A A;  3OPR A;  2V0U A;  3MQ0 A;  3T50 A;  1K4E A;  2P74 A;  1MXO A;  1ZKJ A;  1L2S A;  3MMH A;  2UV0 E;  3FPW A;  1K56 D;  1UGU A;  4GD8 A;  4BBV A;  5IS1 A;  5GLC A;  3C38 A;  1P9R A;  2ZOH A;  3FC7 A;  2M1C A;  3BLM A;  3QP4 A;  4Q0I A;  4C75 A;  3SH8 A;  3GV9 A;  3BEC A;  4S2N C;  1GHM A;  2ZOI A;  3L7H A;  3HJK A;  2WYX A;  3KX0 X;  5IU1 A;  3W4P A;  1JTD A;  5G4Z A;  4KQR A;  3CG5 A;  3RXX A;  3Q7V B;  2P9V A;  2VGJ A;  1K56 A;  4Y3I A;  1CQA A;  1GHI A;  4BLM A;  2HP6 A;  3G2Y A;  3UPP A;  2YKH A;  3HUN A;  3OZH A; 
#chains in the Genus database with same CATH homology
 1DP8 A;  2KOI A;  4G3W A;  4L0L A;  4HIA A;  4HJ6 A;  2PR6 A;  3A0V A;  3BY9 A;  5DKL A;  1T19 A;  3KSF A;  2PYP A;  2PD8 A;  2M7U A;  1N9N A;  2OWH A;  3TW8 A;  4GW9 A;  1YAX A;  3EGD C;  1EW0 A;  1XJ4 A;  4YOF A;  2V1B A;  3NOP C;  3LIB A;  1UWP X;  3CAX A;  2W3D A;  5CX7 A;  2DMW A;  2VEA A;  3BWL A;  2ZBB A;  4KUO A;  4H6J A;  3UB8 A;  3MJQ A;  1P0Z A;  4GJ4 A;  4LRY C;  4KUK A;  3S7P A;  4IUK A;  2PT7 A;  5DJT A;  4YWZ A;  4NXF A;  3CUE C;  1P9W A;  2V1A A;  4H6J B;  2OAQ 1;  5KIZ A;  2H28 A;  3A0R A;  2ZMV A;  5HD3 A;  1G28 A;  4PAU A;  4EU0 A;  4CQH A;  2VJW A;  4R38 A;  3LIC A;  1KOU A;  4EEU A;  4NEE D;  5J7E A;  4HP4 A;  3EEH A;  4LRZ E;  3UME A;  5EFW A;  4QPR A;  5DKK A;  2PD7 A;  4G3K A;  3FG8 A;  4JGP A;  3H9W A;  3LR0 A;  4GCZ A;  1YSQ A;  2HJE A;  3TJZ C;  2QJ5 A;  1H3Q A;  1DRM A;  2VX8 A;  4UQI S;  3R4K A;  3W2Z A;  4BBU A;  2GJ3 A;  3KSH A;  3T4T A;  4ZRR A;  3S7N A;  2Z6C A;  3EWK A;  3T4J A;  2J3T C;  1OJG A;  1P97 A;  2JKT I;  1S66 L;  3BQ8 A;  3K3D A;  1YSP A;  5HDC A;  4ARZ A;  2VA0 A;  2VV6 A;  4YNR A;  2W3G A;  1ODV A;  4KQD A;  5MC7 A;  3VE3 A;  1TF1 A;  1X0O A;  2A24 A;  5AVF A;  3D72 A;  4CLC C;  1T1B A;  4Q0H A;  4ARZ B;  4UQI M;  4Z1W A;  5K5B A;  1LT0 A;  3LFV A;  3PYP A;  3UE6 A;  3C8C A;  2A24 B;  4EQ1 A;  3HCY A;  4UEY A;  3CI6 A;  3JVU A;  4ETX A;  2LB9 A;  3PBN A;  3S7O A;  2PYR A;  5HWW A;  2ZMF A;  4I3J A;  2R78 A;  4EES A;  4R3A A;  2W27 A;  4HJ4 A;  3EQV A;  1F98 A;  1GSW A;  1Y28 A;  2G7U A;  3LR3 A;  3NHQ A;  3OCN A;  3ULF A;  3CWF A;  4E04 A;  3NOU C;  4GS9 A;  3CLO A;  4NXB A;  3MR0 A;  1LSX A;  3LR5 A;  4L9E A;  4R70 A;  2K7S A;  5F5Y A;  2EA9 A;  5FL3 A;  3UB6 A;  2GNX A;  5DJU A;  2VV7 A;  3TRC A;  5DFX A;  1OTI A;  2FH5 A;  2EWV A;  4GS9 B;  2I9V A;  2WKP A;  4CLC A;  1S1Z A;  2L1M A;  2NUT C;  2VZW A;  3R7W A;  4DMZ A;  1NLZ A;  3IBR A;  4R6L A;  4CLC B;  4MN5 A;  1T18 A;  3UB7 A;  4DN0 A;  1XFQ A;  5HWT A;  2JKT M;  3OOV A;  3PHY A;  4OOM A;  4WEL A;  1N9L A;  2P7J A;  3R7W B;  3EQU A;  1S1Y A;  1ZHH B;  2QJ7 A;  3PBS A;  4I5S A;  3RFB A;  3VV4 A;  1S67 L;  4II7 A;  3K2N A;  4CLC E;  2J80 A;  3C2W A;  2D01 A;  4L9F A;  4ETZ A;  2NUP C;  1OT6 A;  1XJ3 A;  4BBT A;  3MFX A;  4KQO A;  2VKS A;  4WL9 A;  3K3C A;  2XRO A;  3UE3 A;  1DP6 A;  2V9A A;  4HJ3 A;  3F1N A;  4HNB A;  3DBA A;  4MCW A;  5C5K A;  4L9G A;  4MDZ A;  3LUQ A;  3JVV A;  2PHY A;  3LI9 A;  2JN7 A;  3F1N B;  2KLI A;  5F69 A;  1JNU A;  2O99 A;  2HJ9 C;  3H82 A;  1ZTU A;  2Y79 A;  5J3W A;  3BQA A;  1T1C A;  2VV8 A;  1TS8 A;  2P08 A;  2QKP A;  1WA9 A;  3H82 B;  3UMD A;  3VOL A;  4EER A;  2B02 A;  3NOT C;  3LID A;  5TBM A;  1XJ6 A;  3ICY A;  3B33 A;  2QHK A;  2HF6 A;  1V9Y A;  1XJ2 A;  2Y8H A;  3E0Y A;  4LLO B;  5L8M A;  4WF0 A;  5IT5 A;  1TS7 A;  1F5M A;  1VHM A;  4HP9 A;  2YKF A;  2J3T D;  3FPV A;  3OC2 A;  3IS2 A;  4JGQ A;  3CUE A;  3B47 A;  2XSS A;  1VB6 A;  1MZU A;  3CIT A;  2J3W A;  4Y5F A;  3F1O A;  4HH3 A;  1OTD A;  4BMW A;  1IFQ A;  4O0P A;  3IS2 B;  4LPZ A;  2W1R A;  4CLC D;  4EXO A;  1STZ A;  3MF0 A;  3PBT A;  3F1O B;  4MN6 A;  2D02 A;  4O01 A;  4Q0J A;  2WKQ A;  5F68 A;  3EGX C;  4I38 A;  1LL8 A;  4MN7 A;  1GSV A;  3TE8 A;  1LSV A;  5TJJ A;  5HWV A;  3ZYT A;  1V9Z A;  4WN5 A;  2WKR A;  2GZA A;  2LB5 A;  2W3F A;  3ZQ5 A;  1OTA A;  2V0W A;  3H7W A;  3LIA A;  4JGR A;  3UB9 A;  1T1A A;  3S7Q A;  3U2A A;  4NXG A;  5HDD A;  2B18 A;  1F9I A;  4I39 A;  3P7N A;  2O9A A;  3H7W B;  4WLA A;  3EEA A;  1MC0 A;  5F6A A;  4HY8 A;  2VLG A;  5LBR A;  5J4E A;  3KO6 A;  4PKY A;  2EWW A;  4Y2F A;  3E4Q A;  3T4K A;  4O8G A;  2VGL S;  2L4R A;  4PHT A;  1GSX A;  5HD5 A;  2P04 A;  2KDK A;  2O9B A;  2JHE A;  3T4L A;  4B9O A;  3MQQ A;  1BYW A;  2MJ6 A;  1W63 Q;  2OAP 1;  3PBO A;  4ME4 A;  2O0Y A;  4GLQ A;  3T4Q A;  4PKY G;  1NWZ A;  4AFI A;  5DFY A;  3VE4 A;  2JKR I;  2HV1 A;  5HDS A;  1TD5 A;  3PBR A;  3MXQ A;  4DJ2 A;  3E4P A;  2VGL M;  1LSW A;  3A0S A;  2INW A;  4WUJ A;  1TS0 A;  1H8M A;  1S4S A;  3LYX A;  2M7V A;  4EUV A;  2W1T A;  2Z6D A;  4DJ3 A;  2A2L A;  1S4R A;  3PXP A;  1TS6 A;  1N9O A;  3BJN A;  4FOF A;  2QYB A;  4G3V A;  1OTB A;  4XT2 A;  4IUH A;  4EEP A;  5A8B A;  3KYQ A;  2W1T B;  4HHD A;  3V67 A;  4BJP A;  4OOL A;  2W3H A;  4WEK A;  3E4O A;  3O5Y A;  5HZH A;  2QWS A;  5HPF A;  1OTE A;  4XT2 B;  3GDI A;  4RQ9 A;  2OWJ A;  4EW7 A;  3SW1 A;  1D7E A;  5HPI A;  3KYZ A;  3T4O A;  4HOI A;  3F1P A;  3NJA A;  4HH2 A;  4WEJ A;  1UWN X;  1DP9 A;  2XA7 S;  1G6O A;  3KSI A;  3EOI A;  1YKD A;  3F1P B;  3RTY A;  4K08 A;  5KSH A;  3LR4 A;  4IJG A;  4MMN A;  2FZ0 A;  3P01 A;  3OBF A;  1NRJ A;  5TBM B;  1D06 A;  3G6O A;  3OCL A;  4GHI A;  3HJI A;  3C30 A;  4HI4 A;  2HGV A;  5HL6 A;  2PR5 A;  3BW6 A;  2IA2 A;  2JKR M;  4B93 A;  2K2N A;  4NKP A;  4GHI B;  3BY8 A;  3MQO A;  1W63 M;  4I3A A;  2XA7 M;  2V0U A;  3MQ0 A;  3T50 A;  5HSQ A;  4BWI A;  2O9C A;  3LI8 A;  3MMH A;  2PDR A;  3T4S A;  4FSF A;  3FPW A;  3IBJ A;  2GX5 A;  3PBQ A;  3LIE A;  2CMN A;  1OPX A;  1UGU A;  4BBV A;  1XFN A;  5IS1 A;  1OJ5 A;  3C38 A;  4JGO A;  1P9R A;  4P6Z S;  2ZOH A;  3FC7 A;  2M1C A;  3GEC A;  2W0N A;  4EET B;  4Q0I A;  1OT9 A;  2W3E A;  1MKM A;  2BAS A;  4HQA A;  2K31 A;  4I3I A;  2KX6 A;  3LIF A;  5G4Y A;  2ZOI A;  3HJK A;  2OOL A;  3KX0 X;  4IHQ A;  5AVE A;  5IU1 A;  4P6Z M;  3PR6 A;  5G4Z A;  3KSG A;  4NXE A;  5I5L A;  5DF9 A;  4F3L A;  4M4X A;  1NLY A;  3E98 A;  4LRX C;  5AJG A;  3OLO A;  2L0W A;  4Y3I A;  3RH8 B;  1IOU A;  2XRN A;  4F3L B;  3D3O A;  3B42 A;  2YKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...