5FQKA

W229d and f290w mutant of the last common ancestor of gram-negative bacteria (gnca4) beta-lactamase class a bound to 5(6)-nitrobenzotriazole (ts-analog)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
263
structure length
263
Chain Sequence
AALSEQLAELEKRSGGRLGVAVLDTATGRRFGYRGDERFPMCSTFKALLAAAVLARVDQGKENLDRRITYGKEDLVDYSPVTEKHVGDGMTVAELCEAAITYSDNTAANLLLEALGGPAALTAFLRSIGDNVTRLDRWEPELNTAAPGDPRDTTTPAAMAATLRTLLLGDVLSPASRQQLVDWLIANKTGDKRLRAGLPADDRVGDKTGTGEHGTTNDIAVIWPPNRAPILVAVYLTESQVDADARDAVIAEVARLVVAAWHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GNCA4 LACTAMASE W229D AND F290W
publication title De novo active sites for resurrected Precambrian enzymes.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Hydrolase
total genus 99
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5fqkA00
1YLJA 4RA7A 3ZG7B 3VFHA 1MWRA 1HVBA 5FA7A 4S2NC 4DDYA 4DE1A 4LV2A 1NXYA 4A5RA 1MKIA 1PZOA 5J8XA 2A3UA 4LV0A 1IYPA 5AQAA 3PAGA 3DTMA 3ZDJA 4RX2A 1IYOA 3PBNA 1AXBA 2XFTA 5CGSA 1TDGA 2HPBA 1BSGA 1J9MA 3UE1A 3IT9A 5FQ9A 3VP2A 4JF6A 4ZJ3A 2WADA 3W4QA 1PW1A 4Y7PA 4XUZA 2WZZA 2P9VA 1MPLA 3ZG8B 2V20A 3LCEA 4NK3A 1YT4A 2OV5A 1FQGA 1YMXA 5FQMA 3TSGA 1KVMA 5TFQA 4EBLA 4OOMA 5KMWA 2FFYA 2WAEA 2HDSA 4KZ6A 1IYQA 2FFFB 3O88A 3C7VA 1E25A 1E4DA 1WE4A 3TG9A 4X55A 5EVIB 3VFFA 2JE5A 3S22A 1H8ZA 3AGDA 2WGVA 1KE0A 4KZAA 3WS0A 2ZC7A 2ZMAA 2Y2JA 1H5XA 2HDRA 1K6SA 2WZXA 3G2YA 5FQKA 2OLVA 3GTCA 5KSHA 4DXBA 1K4FA 2I72A 5FAQA 1H8YA 1BLSA 2EXAA 4OQGA 3OZHA 1ZKJA 1L0GA 1FCOA 1ESIA 1KGEA 1K55C 3WS1A 4E3JA 2R9WA 2RCXA 1ERQA 1XA1A 3PBRA 2HDQA 3PBTA 3AGEA 1CEFA 4GB7A 4JXSA 4ID4A 4IEDA 2PU2A 3BFFA 4KZ7A 3ITBA 5I94A 4P85A 4E3IA 3NC8A 4OVDA 2H5SA 3V39A 4KZ8A 3HUOA 2EFXA 4P87A 3GR2A 5GL9A 1ES3A 4WZ4A 2ZC5B 2Y2IA 3OPLA 4M3KA 1U60A 4S2LA 4XUXA 5FQJA 1RP5A 2WKEA 4R3BA 3ZGAB 3BEBA 5M19A 3HUNA 4S2NA 4PM8A 4QHCA 3UO9A 4JF4A 4DDSA 1Q2PA 1Z6FA 5E2GA 1CI9A 1I2SA 3UN7A 3W4OA 1IEMA 3VSLA 4X53A 4ZBEA 1CEGA 1M6KA 4WEKA 3VP4A 1EWZA 1W7FA 1PIOA 3C7UA 4CJNA 4MNRA 5M1AA 1BLCA 5JYOA 5IHVA 3PBOA 4MBKA 5DF9A 5BOHA 4KZ4A 3V3RA 3NY4A 1I2WA 2WGWA 2XK1A 4BD1A 3WS4A 4HEFA 2J9PA 2XD5A 5FDHA 3WRTA 3A3FA 4UHUA 3A3IA 4B4XA 5A93A 3ZG9B 4E3KA 1E3UD 3HLBA 3DWZA 4X68A 4ZTKA 2JCHA 4KQOA 3VOYA 1K38A 4PM5A 4PM7A 1FR1A 4S2MA 1ESUA 3SH9A 5A92A 1BZAA 1PW8A 1L0FA 2Y4AA 3IHAA 1MBLA 1GA0A 1ZG4A 4C3QA 3G31A 4IVIA 4OPYA 2HP6A 4EV4A 4OLDA 2EX8A 2J8YA 4GN2A 3NDGA 4JXWA 1O7EA 4NETA 4P0MA 3IWOA 3TOIA 3SS3A 1NYYA 1PYYA 2ZQ8A 1S6RA 1K55A 4EUZA 4OONA 3ZFZA 4MBHA 3LO7A 3UDXA 1BTLA 4KQRA 5FASA 1Q2QA 4KG2A 1FCMA 5AQBA 2WUQA 3SS5A 2B5RA 2IWCA 2WGWB 4N9KA 4DE3A 4N1HA 3IXGA 1S0WA 5EVIA 3EQUA 3V3SA 2ZLYA 4WEJA 3G32A 3HLWA 2WGIA 2OLUA 1SDEA 1MWUA 1PWCA 4GOGA 3UDFA 1DY6A 3BM6A 3IXHA 4IVKA 3S4XA 5FATA 3SH7A 2Y2GA 4BL3A 4BLMA 4OP8A 1K54C 5D3OA 1FSYA 1LI0A 2Y59A 2XF3A 3MXRA 4JBFA 1W79A 3LY4A 4B88A 3GV9A 4S2JA 2IWBA 5G18A 4U0TA 1WYCA 5HX9A 2Z2MB 1BULA 5CHUA 4ZJ2A 1XGIA 4DE0A 1DJBA 2Y2NA 3G30A 5HAPA 1KGGA 3ZG5A 4Q8IA 1FSWA 1K57C 3HLGA 5A91A 3N8SA 4LENA 5DTSA 1WYBA 3ZG0A 2J7VA 3HLEA 1YM1A 4GDBA 2A49A 4BD0A 1JWVA 3GQZA 3PBSA 3BFDA 2EX2A 3FKVA 3CZDA 5E2HA 4LV3A 3HUMA 4ZAMA 3UE0A 1XP4A 3RJUA 3O87A 3LY3A 1L0DA 3ZVWA 5E43A 1OMEA 3AGFA 4U3TA 3OPHA 3VP1A 4UA7A 3GRJA 1G6AA 4U0XA 3IF5A 3M2JA 3WS5A 3UPNA 5HARA 5FI2A 3P98A 1NZOA 4Y0TA 4MLLA 3IH8A 5E2FA 3VP3A 4GKUA 5KZHA 4KZBA 5DF7A 1K25A 4HBUA 2H0YA 2DNSA 3OC2A 2WKHA 2HP5A 3RXWA 5CEDA 1ONHA 1YMSA 2R9XA 3MXSA 1K56D 2X02A 3ZNYA 4F94A 4R3JA 1KE4A 4E3OA 4EWFA 2PU4A 2ZQ9A 4R23A 3V50A 4O7DA 4WM9A 4K0XA 5CERA 2V2FF 2ZD8A 3DWKA 3WWXA 4R4SA 1M40A 5TGFA 4EQIA 2OSUA 1VM1A 1N4OA 1ONGA 2EFUA 3C5AA 3RXXA 1JTDA 4PMAA 2IWDA 1W5DA 4KZ9A 5EOOA 3V5MA 2Q9NA 3LEZA 3G35A 3HL9A 5FI7A 3C4OA 3IHBA 4BENA 1N9BA 1PI5A 5CTNA 1ERMA 1G68A 1HD8A 1EI5A 2Q9MA 3GMWA 5HFOA 5FAOA 4WYYA 2PBYA 5DTKA 2XEPA 4JKTA 5JYPA 5EE8A 1KE3A 3MKEA 4HESA 1KVLA 3HBRA 2JBFA 4N92A 3CMZA 5EOEA 3UPPA 4L0LA 3WS2A 1ZG6A 3QHYA 1E3UA 4S2PA 5CTMA 3CJMA 3SH8A 3UY6A 1SHVA 1I5QA 1K57A 1MWTA 3P09A 4EBPA 1XKZA 2XDMA 4FH2A 3B3XA 4DE2A 5F1FA 1VQQA 4GZBA 5EECA 1PI4A 5HL1A 4ZDXA 1YLZA 2EX9A 4JXGA 1IYSA 3ZNTA 3MFDA 5HW3A 1YLTA 2WK0A 5EUAA 3N8LA 4OPRA 4GD8A 1BLHA 2QZ6A 4UA9A 3N8RA 4WMCA 5GHXA 3FZCA 5DVAA 5F1GA 1FCNA 1C3BA 4OOYA 4JLFA 4WZ5C 1LHYA 3M2KA 4RX3A 3FV7A 1GHIA 5CEBA 5TR7A 3BLSA 3A3DA 2XLNA 3S1YA 4OPZA 3HVFA 5AQ7A 3G2ZA 1PWGA 3I7JA 3M6BA 5CHMA 3O86A 1NRFA 5F82A 4RYEA 2Z2LB 1Y54A 1KDSA 4PM9A 3OPPA 2Y2QA 5M18A 3FKWA 3E2LA 1CI8A 3MZFA 1W8YA 3OCNA 3NCKA 3BFGA 3BYDA 5DF8A 1LL9A 2H0TA 3ITAA 4LV1A 3FWLA 1MY8A 3ISGA 2C5WB 1DJAA 4KENB 3WRZA 1JVJA 1ES5A 4GNUA 4OLGA 1CK3A 4PM6A 3IWQA 5DTTA 4C6YA 3ZCZA 4S2KA 1XGJA 4C75A 5CGXA 1SKFA 1FR6A 1GHMA 4QY6A 4R1GA 4MEZA 1XA7A 1GCEA 1YLWA 3Q7VB 4K0WA 3DW0A 4P6BA 3M6HA 1QMEA 2DRWA 4OP5A 1EROA 4FH4A 2EX6A 2ZQDA 3IF6C 4X6TA 1ES2A 4YINA 4BL2A 3JYIA 1XXMA 1TDLA 3IXDA 2CC1A 4FSFA 5EVID 1LI9A 3BLMA 3W8KA 1RGYA 1ALQA 2VGKA 1JWZA 1ES4A 1JWPA 3OCLA 2Y2OA 5A90A 2G2WA 2ZQCA 5GLDA 1ZC2A 4OPQA 2BG1A 5U47A 4UA6A 1RGZA 4QB8A 1GA9A 1JTGA 3Q7ZA 2ZM0A 4OOLA 2ZQAA 3EQVA 3VSKA 3BFEA 4E6XA 5GHYA 3UDIA 4QY5A 4X56A 2UWXA 2XR0A 4WBGA 1BUEA 4N1XA 4E3NA 3GVBA 2V1ZA 3IXBA 2HP9A 2ZC4B 1K56A 3IQAA 2ZC3B 3W4PA 3HLFA 4FCFA 4OH0A 4WZ5A 3NDEA 1KGFA 2EXBA 4IBXA 4YFMA 1TEMA 5FQQA 3HLCA 4JPMA 4B4ZA 2E8IA 1MXOA 4HBTA 2C6WB 4OQIA 1IKGA 3IWIA 4UAAA 5HAQA 3N6IA 3G34A 1NY0A 3IH9A 1BLPA 4QU3A 3O3VA 3BFCA 5CRFA 1L2SA 4BJPA 4LCMA 1BT5A 3N7WA 3UPOA 2Y91A 4KZ3A 3QNCA 5EPHA 1W8QA 4OKPA 1IELA 1SCWA 3D4FA 3MKFA 3N4IA 4QD4A 4X69A 5GLBA 2XQZA 2XFSA 1K54A 1O07A 1RCJA 4Y0UA 1IKIA 3PTEA 4XXRA 5E2EA 2P9VB 5FAPA 5F83A 3ZHHA 4JXVA 4E6WA 5CHJA 5L2FA 4IBRA 1HZOA 3GSGA 5AQ9A 5EVIC 3MBZA 3A3EA 2H10A 2XD1A 2G2UA 1PZPA 5CGWA 1YQSA 3IF6A 2QPNA 1NYMA 5FSRA 2Y2LA 2DCFA 2ZJ9A 3HREA 4D2OA 3C4PA 4LCLA 5HAIA 4GDNA 3NI9A 3Q82A 4N9LA 2J9OA 1LL5A 5CECA 4BQMA 2XGNA 4DRTA 1K6RA 3E2KA 2WKIA 3FYZA 2X71A 3ZVTA 3Q07A 4R0QA 3Q81A 1FOFA 4OQ0A 5EVLA 2RL3A 2Y2PA 3VOZA 3OPRA 4CPKA 4WELA 4E3MA 3A3JA 2HDUA 4Y0OA 2Y2MA 3PAEA 4FD8A 3CG5A 3PBQA 5KSCA 4GD6A 1TVFA 5FI6A 2WAFA 1GHPA 2Y2HA 3MZDA 3Q7VA 2VGJA 4KQQA 2ZC6B 4S2OA 4Z9QA 4ZJ1A 1MWSA 2X01A 3MZEA 1HTZA 2BLSA 5CXWA 3SS4A 4E3LA 2GDNA 2QMIA 5GLAA 3VP0A 3QNBA 1DJCA 1NJ4A 4DKIA 4R4RA 3IF6B 1YLYA 3NIAA 3G4PA 1K4EA 4JF5A 4OQHA 2P74A 4S2IA 2ZM2A 3BECA 4EBNA 1PWDA 3HLDA 1YLPA 4K91A 1L0EA 3UE3A 4DXCA 2Y2KA 2ZM8A 5GHZA 4H8RA 5FQIA 2JC7A 4DF6A 4KG5A 4PPRA 1SDNA 3BRMA 1QMFA 3UNWA 1LLBA 4WMCD 2WYXA 3Q1FA 1NZUA 4KG6A 4MBFA 3VMAA 5GLCA 4RVAA 2Y55A 2ZQ7A 2XH9A 1XPBA 4KZ5A 1KDWA 3SOIA 3NBLA 4QJGA 1XX2A
chains in the Genus database with same CATH superfamily
4GS9B 2D02A 4RA7A 3ZG7B 5HWTA 5FA7A 3LR0A 4A5RA 2A3UA 4LV0A 3LYXA 5AQAA 3ZDJA 5CGSA 2HPBA 3VP2A 5FQ9A 2WZZA 2W0NA 3ZG8B 2OV5A 4EW7A 2E8JA 1FQGA 1YMXA 3B47A 3RTYA 3TSGA 3T50A 2FFFB 4I5SA 3C7VA 3GDIA 1E25A 1OJ5A 4X55A 2JE5A 1H8ZA 2PDRA 3WS0A 2ZC7A 2ZMAA 2XSSA 1Z09A 4G3WA 2HDRA 2I72A 2O9BA 2ZOIA 1KGEA 1K55C 2L1MA 4E3JA 4GJ4A 3FG8A 2O9AA 2PU2A 1BYWA 5I94A 4OVDA 2W3HA 3GR2A 1JNUA 3OPLA 1U60A 4XUXA 4R3BA 3BEBA 1TS8A 4PM8A 1Z6FA 1CI9A 4IUKA 2W3GA 1IEMA 3JVUA 3VSLA 3VP4A 4ETXA 1PIOA 1FIKA 1BLCA 2VK3A 5BOHA 3EEHA 3KSHA 3NY4A 3EOIA 5MC7A 2WGWA 1IFQA 3A3FA 4B4XA 5A93A 4KQOA 2VEAA 4MN7A 3S7NA 1L3LA 1K38A 4PKYG 1IOUA 1FR1A 1ESUA 1PW8A 3IHAA 1MBLA 1GA0A 3G31A 5F5YA 4OPYA 2W1TA 4NG2A 2J8YA 4OLDA 4JXWA 3S7QA 5TBMA 2GJ3A 1K55A 3UDXA 5FASA 1FCMA 5AQBA 1MKMA 5AVEA 4N9KA 3IXGA 3EQUA 3C8CA 3G32A 2WGIA 3ULFA 1MWUA 1DY6A 3T4TA 4OP8A 2VGLM 4MN5A 3T1SA 5DKLA 1NLZA 4GHIB 3GV9A 4MMNA 2IWBA 4CQHA 2INWA 3P7NA 1YKDA 5HWWA 3MMHA 4Q8IA 1K57C 4G3KA 3N8SA 2AVXA 1FILA 1S1ZA 3CHWP 1CF0A 1JWVA 1Y4OA 3CZDA 2W3FA 3LY3A 3ZVWA 4U3TA 3LFVA 1VB6A 1EW0A 2H28A 3IF5A 4U0XA 3P98A 5DKKA 4Y0TA 5E2FA 3IBJA 1K25A 4O8GA 2HP5A 3C2WA 3MXSA 1K56D 2Y8HA 2X02A 3DTKA 1W63Q 2PU4A 4R23A 2ZBBA 4Y15A 2M7VA 4K0XA 2V9AA 2V2FF 3WWXA 3LIAA 3RXXA 4PMAA 4EU0A 3V5MA 3CPTA 5FI7A 4WN5A 4BENA 5F6AA 5CTNA 1ERMA 1G68A 3GMWA 5HFOA 5FAOA 3T4KA 4WYYA 3TW8A 1D1JA 5EE8A 3MKEA 3IX8A 1S67L 2JBFA 4N92A 5EOEA 3QHYA 4PHTA 3UY6A 1K57A 1MWTA 5F1FA 1PI4A 4ZDXA 1IYSA 5HW3A 1YLTA 1GSWA 2OAQ1 5EUAA 3N8LA 5GHXA 3FZCA 1FCNA 3MJQA 1DRMA 4JLFA 2V0UA 4WZ5C 1LHYA 4RX3A 3FV7A 5CEBA 3S1YA 3G2ZA 3M6BA 5CHMA 5F82A 4PM9A 5I5LA 5M18A 1CI8A 4YNRA 3MZFA 4JGRA 3OCNA 3UMDA 4I38A 5FEFA 4LV1A 3FWLA 1T19A 4HP4A 1DJAA 4GNUA 4OLGA 2PT7A 3L7HA 4C6YA 3IWQA 5L8MA 1D06A 4Q0HA 4S2KA 5CGXA 3MQOA 4R1GA 5L07A 3DW0A 2PRFA 2ZQDA 4X6TA 5FDSA 4YINA 3JYIA 3IXDA 2CC1A 5G4ZA 2JKRM 1ES4A 1ZC2A 2FH5A 1V9ZA 3IS2B 1JTGA 2ZM0A 3KSFA 3EQVA 3UDIA 4QY5A 2UWXA 2XR0A 1BUEA 3GVBA 3RFBA 2HP9A 1K56A 4WZ5A 1KGFA 1NLYA 3MQ0A 3HLCA 5FQQA 2C6WB 1NY0A 3BY9A 3IH9A 1XFNA 5CRFA 1AWIA 4BJPA 4HQAA 1VHMA 3NOPC 2M1CA 4QD4A 3K3DA 4JGQA 1K54A 2LB9A 5FAPA 1ZHHB 5FEGA 2BASA 4IBRA 4HJ6A 3MBZA 2PYRA 3A3EA 1VETA 5EFWA 2Y2LA 2ZJ9A 3TRCA 3C4PA 4LCLA 4Y3IA 2I9VA 4N9LA 1LL5A 5CECA 2WKIA 3FYZA 1FOFA 2RL3A 1N9OA 3OPRA 4II7A 1CQAA 2VV8A 1GHPA 2Y2HA 4KQQA 4S2OA 1MWSA 3LR4A 3KYQA 5CXWA 3SS4A 2YKFA 2GDNA 2QMIA 3UB9A 2JKTM 3VP0A 4NXEA 4HHDA 1NJ4A 4LGWA 1DP6A 1OT9A 3QP8A 4EBNA 3IX4A 1G5UA 5A8BA 1D7EA 2ZM8A 4H8RA 5FQIA 3UNWA 3Q1FA 1NZUA 4KG6A 4RVAA 4H6JB 2WKPA 4QJGA 2R78A 4S2NC 4DDYA 4DE1A 1ODVA 1PZOA 5J8XA 1IYPA 3TJZC 4RX2A 1BSGA 1J9MA 4JF6A 2WADA 1T1BA 4HI4A 4Y7PA 4X25A 2P9VA 1MPLA 2QYBA 2V20A 4MN6A 3TE8A 3QP6A 4OOMA 3R4KA 5KMWA 2FFYA 2P04A 2HDSA 2WAEA 2WKQA 3TG9A 5EVIB 3AGDA 1KE0A 4KZAA 4BBVA 4LPZA 1H5XA 3G2YA 5FQKA 4NXFA 1K4FA 3T1XA 3OZHA 3BY8A 5J7EA 1FCOA 2KLIA 4Q0JA 3WS1A 2R9WA 3OLOA 3PBRA 1CJFA 1CEFA 3AGEA 4EESA 4ID4A 3KX0X 1OTEA 4KZ8A 1F5MA 2EFXA 2PHYA 2ZC5B 4M3KA 3VE3A 5FQJA 2WKEA 3KYZA 3ZGAB 2J3TD 4S2NA 4DDSA 2L4RA 2HGVA 3UN7A 3CWFA 3C7UA 4CJNA 2W27A 3T4OA 3T4SA 5IHVA 3U4LP 3BQ8A 3HCYA 3WS4A 2PR6A 3VE4A 5FDHA 3WRTA 4UHUA 3A3IA 3QP4A 2JHEA 4KUOA 4E3KA 1E3UD 4ZTKA 3VOYA 3U2AA 3BJNA 1T1AA 1X0OA 3SH9A 2ZMVA 3KO6A 3DAVA 3FC7A 4P0MA 3B42A 3TOIA 4GN2A 4Y2FA 3IWOA 3DTIA 1HLUP 1PYYA 1S6RA 3LO7A 4KQRA 1Q2QA 2B5RA 2IWCA 3F1NA 4HY8A 4N1HA 3V3SA 4WEJA 4ZRRA 3MF0A 1SDEA 3C38A 2VV6A 4IVKA 3S4XA 2Y2GA 4BL3A 2O0YA 5EV0A 2Y59A 1LI0A 4NXGA 1W79A 3UB6A 4S2JA 1YAXA 4U0TA 1NRJA 1F9IA 5CHUA 1BULA 2A24B 2YKHA 4ZJ2A 4WLAA 3P01A 1WYBA 2J7VA 3HLEA 1YM1A 4GDBA 2A49A 4F3LA 1OPXA 3LI8A 4HJ4A 5E2HA 4ZAMA 1OMEA 4UA7A 2D01A 4XT2B 3QP1A 3UPNA 5HARA 3LIDA 1NZOA 2JKFA 4MLLA 3VP3A 4GKUA 4HBUA 3QP2A 5CEDA 1MC0A 1YMSA 2B95A 1V9YA 1YSPA 3ZNYA 4R3JA 4E3OA 2ZQ9A 4QWOA 3S7OA 3G6OA 4HIAA 1P0ZA 3DWKA 1M40A 4EQIA 1VEUA 2EWWA 3C5AA 1VM1A 2EFUA 3BW6A 5EOOA 2HZ5A 3G35A 3OOVA 3C4OA 1N9BA 5L09A 2Q9MA 3UE6A 4NXBA 1STZA 2BTFP 5JYPA 4HESA 1KVLA 3UPPA 4L0LA 1E3UA 4S2PA 1SHVA 3MS6A 1W63M 3P09A 4EBPA 1XKZA 4DE2A 1VQQA 5EECA 5HL1A 2L0WA 3ZQ5A 1S4RA 1F2KA 4JXGA 3MFDA 3T4JA 4Y13A 1XFQA 4OPRA 1BLHA 2VV7A 3D72A 5HSQA 5F1GA 4ARZB 4OOYA 3M2KA 5TR7A 3E4OA 5AQ7A 4Y17A 3I7JA 4RYEA 2Z2LB 2EA9A 3OPPA 1S1YA 2HJEA 3FKWA 3E2LA 3IS2A 1W8YA 3BFGA 5DF8A 1LL9A 4NEED 3ISGA 2PBDP 4KENB 3WRZA 1ES5A 3KSIA 3DTEA 1K0KA 2KX6A 3ZCZA 4C75A 1XGJA 1FR6A 1GCEA 3Q7VB 1QMEA 2DRWA 4FH4A 2EX6A 4FSFA 5EVID 2VGKA 5K5BA 4OPQA 4UA6A 4QB8A 1GA9A 4DJ2A 4DMZA 3EGDC 4OOLA 4E6XA 3UB7A 4N1XA 2V1ZA 1P9WA 3A0RA 1XJ4A 2V8FA 2OOLA 1TEMA 4JPMA 4HBTA 3LIFA 3O3VA 3PXPA 3CUEC 3N7WA 4NKPA 4KZ3A 3BWLA 5EPHA 1W8QA 3N4IA 4Y0UA 3PTEA 3SW1A 4JXVA 3R7WA 2GZAA 5CHJA 5L2FA 5LBRA 5EVIC 1YPRA 2DMWA 2H10A 2XD1A 2G2UA 1YQSA 1OJGA 2QPNA 1NYMA 3T1RA 4GDNA 3NI9A 1OTIA 3QP5A 2XGNA 3E2KA 2X71A 3ZVTA 2ZL1A 3Q07A 4OQ0A 4CPKA 4WELA 2Y2MA 3PAEA 4FD8A 4EEPA 3CG5A 1OTBA 4H6JA 4Z9QA 2VLGA 2X01A 4E3LA 1TF1A 5EM1A 5GLAA 3QNBA 1DJCA 3HJKA 4R6LA 4R4RA 4ME4A 3G4PA 1K4EA 4OQHA 4Y5FA 1PWDA 2VA0A 4K91A 2J3WA 4DXCA 4LRYC 4EXOA 4DF6A 4WMCD 2WYXA 2K7SA 2Y55A 2XH9A 1XPBA 3LIEA 3NBLA 1YLJA 1HVBA 2VGLS 1MKIA 1PNEA 1TS7A 3PAGA 2V8CA 1SKOA 1IYOA 3PBNA 2EWVA 1AXBA 1S66L 1TDGA 3LICA 3NECA 4ZJ3A 3EWKA 1PW1A 3O5YA 5IS1A 4XUZA 4GW9A 5TBMB 1YT4A 1KVMA 1T18A 4HJ3A 4KZ6A 1IYQA 2V1BA 1E4DA 3S22A 1K6SA 1PRQA 2WZXA 5HL6A 5KSHA 3KYEA 3NOTC 2M7UA 1TD5A 1GSXA 2EXAA 3UB5P 3MXQA 1ESIA 4B9OA 2HV1A 1ERQA 2W1RA 2VKSA 4LRZE 4GB7A 4JXSA 1YSQA 4JGPA 4E3IA 3V39A 3HUOA 4P87A 4EETB 4L9GA 5GL9A 4DN0A 1ES3A 4WZ4A 4S2LA 5M19A 3JVVA 3F1PB 1Q2PA 5E2GA 4P6ZM 5IU1A 3BQAA 4X53A 4ZBEA 4WEKA 1EWZA 5HDDA 3F1OA 5M1AA 3H9WA 5JYOA 4MCWA 1UGUA 3NULA 4MBKA 5DF9A 3E0YA 2XK1A 4BD1A 3W2ZA 4HEFA 2J9PA 2XD5A 3T4LA 2NUPC 4GS9A 4GLQA 3ZG9B 2JCHA 3H82B 4YOFA 4QPRA 1BZAA 1L0FA 3L9KA 1ZG4A 3CPTB 2HP6A 4EV4A 2EX8A 3NDGA 1O7EA 1XJ2A 3SS3A 2ZQ8A 4EUZA 3ZFZA 4MBHA 2WUQA 3SS5A 1WA9A 3MFXA 2VX8A 1S0WA 4LRXC 4I3IA 2OLUA 3UDFA 3BM6A 4BMWA 3IXHA 5HD5A 3SH7A 4BBTA 4Q0IA 4XT2A 3E98A 1FSYA 2XF3A 3MXRA 4JBFA 4B93A 3LY4A 3FPWA 1S4SA 4B88A 2QJ5A 5G18A 1WYCA 2G7UA 3B33A 1DJBA 2Y2NA 3G30A 5HAPA 1KGGA 3E4QA 3HLGA 5DTSA 2B18A 3PBSA 3BFDA 2EX2A 3FKVA 3EEAA 4LV3A 3HUMA 3UE0A 1XP4A 4PKYA 1ACFA 3O87A 3OPHA 3CI6A 3GRJA 4LFUA 1N9LA 1OTAA 5KZHA 4KZBA 5DF7A 2H0YA 2WKHA 3RXWA 1ONHA 1UWPX 2QJ7A 3D3OA 4O7DA 5DJTA 5CERA 1SZVA 2ZD8A 4R4SA 2OSUA 1ONGA 1JTDA 2IWDA 3RH8B 1W5DA 3IHBA 1PI5A 2UV0E 2Q0OA 3HJIA 3LR3A 5DFXA 5C5KA 4ARZA 5HWVA 5HZHA 5DTKA 2XEPA 4JKTA 4HH2A 3HBRA 2PD7A 3WS2A 4I39A 4P6ZS 2KDKA 3K2NA 3NHQA 4FH2A 3B3XA 4GZBA 1KOUA 2QWSA 1YLZA 1G28A 4R3AA 4GHIA 4GD8A 2QZ6A 3NOUC 4UA9A 5TJJA 4WUJA 5DVAA 1TS0A 3H7WB 4IJGA 1LT0A 2XROA 1PFLA 1GHIA 3A3DA 4FOFA 2W3EA 2GX5A 3C30A 1PWGA 1NRFA 1P9RA 2J3TC 2Y2QA 4BBUA 5HDCA 3NCKA 1J3WA 2P08A 3ITAA 2IA2A 2C5WB 5CX7A 1JVJA 4DJ3A 4PM6A 1F98A 1GHMA 4QY6A 4MEZA 5AJGA 1MZUA 4OP5A 4CLCB 5KSCA 1XXMA 1TDLA 1LI9A 1ALQA 3LGOA 1JWZA 1JWPA 3OCLA 5A90A 5U47A 3NJAA 3Q7ZA 3VSKA 3BFEA 4LLOB 5GHYA 1H3QA 4X56A 3LUQA 4WBGA 4E3NA 2O9CA 2ZC4B 3IQAA 2ZC3B 2J80A 3HLFA 4OH0A 2EXBA 5DFYA 1IKGA 4D60A 3N6IA 4O0PA 3G34A 4IUHA 4EUVA 3JPUA 4QU3A 2V1AA 5DJUA 4BWIA 2OWHA 1L2SA 2P7JA 2JKGA 4LCMA 4Z1WA 3UB8A 3QNCA 4OKPA 1SCWA 3D4FA 3MKFA 4X69A 5GLBA 4K08A 2XQZA 2XFSA 1O07A 2WKRA 1IKIA 5J3WA 2P9VB 5F83A 4E6WA 2A2LA 2QKPA 3GSGA 2LB5A 4R38A 4O01A 2DCFA 3HREA 5EM0A 5HAIA 2Z6DA 3CITA 3Q82A 2J9OA 3LR5A 4MDZA 4FUWA 3Q81A 5EVLA 2Y2PA 2QHKA 3A3JA 2OWJA 3ICYA 2GNXA 1XJ3A 4GD6A 1TVFA 2ZOHA 4ZJ1A 1HTZA 3A0VA 4UEYA 2PR5A 3IF6B 1YLYA 4I3AA 1A0KA 1Y28A 2P74A 1YLPA 3T1QB 2Y2KA 2JC7A 4KG5A 4PPRA 1XJ6A 1LLBA 2V0WA 5GLCA 1LSXA 4KZ5A 2XA7M 1KDWA 3LEQA 3VFHA 1MWRA 3D9YA 4LV2A 1NXYA 1N9NA 5FL3A 5AVFA 3DTMA 2XFTA 3UE1A 3IT9A 5HPFA 3W4QA 3S7PA 4AFIA 3LCEA 4NK3A 4ETZA 3A0SA 2JKRI 2O99A 5FQMA 5TFQA 4EBLA 3O88A 2K31A 3F1NB 1WE4A 3VFFA 3F1PA 2WGVA 2PAVP 2Y2JA 2OLVA 3GTCA 4DXBA 5HD3A 1H8MA 5FAQA 1H8YA 1BLSA 4OQGA 1ZKJA 1L0GA 2RCXA 1XA1A 2HDQA 2MJ6A 3PBTA 4IEDA 3BFFA 4KZ7A 3ITBA 4P85A 3NC8A 2H5SA 4E04A 4R70A 3H82A 2Y2IA 4KUKA 1RP5A 2Z6CA 4F3LB 5J4EA 3HUNA 4QHCA 3UO9A 4JF4A 1I2SA 3W4OA 1CEGA 1M6KA 1UWNX 1W7FA 2HJ9C 4MNRA 2NUTC 3PBOA 4KZ4A 3V3RA 1I2WA 5HDSA 4IHQA 3HLBA 3DWZA 4X68A 4PM5A 4PM7A 4S2MA 4UQIM 1VEUB 5A92A 2FZ0A 4X1LA 2Y4AA 3VOLA 4C3QA 4IVIA 3LI9A 3GECA 1LSVA 3CUEA 4NETA 3T12B 2JKTI 1NYYA 1P97A 4OONA 4CLCE 1BTLA 4KG2A 5F69A 2WGWB 4CLCD 4DE3A 5EVIA 2ZLYA 5G4YA 3HLWA 4EERA 1PWCA 4GOGA 3ZYTA 5FATA 4BLMA 1K54C 5D3OA 3OBFA 2XA7S 4YWZA 2W1TB 5HX9A 2Z2MB 3MR0A 1XGIA 2K2NA 4DE0A 3ZG5A 1FSWA 5A91A 4LENA 3ZG0A 3V67A 3CLOA 2ZMFA 4BD0A 3GQZA 1LSWA 4L9EA 2XRNA 4WF0A 3RJUA 4M4XA 1L0DA 5E43A 3AGFA 3VP1A 1G6AA 3M2JA 3WS5A 5FI2A 3IH8A 4CLCC 4X1MA 2DNSA 3OC2A 2R9XA 4F94A 1KE4A 4EWFA 1H0MA 3EGXC 5L10A 3V50A 4WM9A 4HH3A 5TGFA 1N4OA 2ACGA 2CMNA 3KSGA 3PHYA 2Q9NA 3LEZA 3HL9A 5KIZA 1HD8A 1EI5A 3H7WA 2PBYA 3IX3A 1KE3A 3CMZA 1ZG6A 5CTMA 3SH8A 3CJMA 4G3VA 1I5QA 2XDMA 1ZTUA 4HNBA 2PYPA 4EEUA 4EQ1A 2EX9A 3ZNTA 2WK0A 3IBRA 3K3CA 3SZTA 3N8RA 4WMCA 4PAUA 1C3BA 2A24A 3R7WB 4JGOA 4CLCA 3BLSA 4UQIS 2XLNA 4HP9A 4OPZA 3HVFA 3DBAA 3O86A 3E4PA 1Y54A 1KDSA 3BYDA 2H0TA 1MY8A 2ZL1B 1CK3A 5DTTA 2JN7A 2W3DA 1SKFA 1LL8A 1XA7A 1YLWA 3PR6A 4K0WA 4P6BA 3M6HA 1EROA 3IF6C 1ES2A 4BL2A 3BLMA 1G6OA 3W8KA 1RGYA 5IT5A 2Y2OA 2G2WA 2ZQCA 5GLDA 2BG1A 1RGZA 4RQ9A 3MQQA 3CAXA 2ZQAA 3FPVA 3IXBA 2HF6A 3W4PA 4FCFA 1OT6A 3NDEA 4IBXA 4YFMA 4B4ZA 2E8IA 1MXOA 4UAAA 4ESPA 4OQIA 5HAQA 3IWIA 1BLPA 3MSHA 4WL9A 1NWZA 4GCZA 3BFCA 1T1CA 1BT5A 1SKOB 3UPOA 2Y91A 1IELA 5E2EA 3LIBA 1RCJA 4XXRA 2KOIA 3ZHHA 1TS6A 1HZOA 5AQ9A 1PZPA 5CGWA 3IF6A 5FSRA 3T4QA 4D2OA 1XX2A 4BQMA 4L9FA 4DRTA 2B02A 1K6RA 1DP8A 4R0QA 4I3JA 2VZWA 3VOZA 4E3MA 2HDUA 4Y0OA 2VJWA 2OAP1 5F68A 3VV4A 3PBQA 5FI6A 2WAFA 3MZDA 3Q7VA 2VGJA 2ZC6B 3PYPA 1GSVA 3MZEA 2BLSA 1VETB 4DKIA 4FTXA 3NIAA 2Y79A 4JF5A 4S2IA 4KQDA 2ZM2A 3BECA 4HOIA 5HPIA 3HLDA 1L0EA 3UE3A 1OTDA 3F1OB 5GHZA 1SDNA 3BRMA 1DP9A 1QMFA 5EVEA 4MBFA 3VMAA 3UMEA 2ZQ7A 3SOIA 4KZ9A 2PD8A
chains in the Genus database with same CATH topology
1YLJA 4RA7A 3ZG7B 3VFHA 1MWRA 1HVBA 5FA7A 4S2NC 4DDYA 4DE1A 4LV2A 1NXYA 4A5RA 1MKIA 1PZOA 5J8XA 2A3UA 4LV0A 1IYPA 5AQAA 3PAGA 3DTMA 3ZDJA 4RX2A 1IYOA 3PBNA 1AXBA 2XFTA 5CGSA 1TDGA 2HPBA 1BSGA 1J9MA 3UE1A 3IT9A 5FQ9A 3VP2A 4JF6A 4ZJ3A 2WADA 3W4QA 1PW1A 4Y7PA 4XUZA 2WZZA 2P9VA 1MPLA 3ZG8B 2V20A 3LCEA 4NK3A 1YT4A 2OV5A 1FQGA 1YMXA 5FQMA 3TSGA 1KVMA 5TFQA 4EBLA 4OOMA 5KMWA 2FFYA 2WAEA 2HDSA 4KZ6A 1IYQA 2FFFB 3O88A 3C7VA 1E25A 1E4DA 1WE4A 3TG9A 4X55A 5EVIB 3VFFA 2JE5A 3S22A 1H8ZA 3AGDA 2WGVA 1KE0A 4KZAA 3WS0A 2ZC7A 2ZMAA 2Y2JA 1H5XA 2HDRA 1K6SA 2WZXA 3G2YA 5FQKA 2OLVA 3GTCA 5KSHA 4DXBA 1K4FA 2I72A 5FAQA 1H8YA 1BLSA 2EXAA 4OQGA 3OZHA 1ZKJA 1L0GA 1FCOA 1ESIA 1KGEA 1K55C 3WS1A 4E3JA 2R9WA 2RCXA 1ERQA 1XA1A 3PBRA 2HDQA 3PBTA 3AGEA 1CEFA 4GB7A 4JXSA 4ID4A 4IEDA 2PU2A 3BFFA 4KZ7A 3ITBA 5I94A 4P85A 4E3IA 3NC8A 4OVDA 2H5SA 3V39A 4KZ8A 3HUOA 2EFXA 4P87A 3GR2A 5GL9A 1ES3A 4WZ4A 2ZC5B 2Y2IA 3OPLA 4M3KA 1U60A 4S2LA 4XUXA 5FQJA 1RP5A 2WKEA 4R3BA 3ZGAB 3BEBA 5M19A 3HUNA 4S2NA 4PM8A 4QHCA 3UO9A 4JF4A 4DDSA 1Q2PA 1Z6FA 5E2GA 1CI9A 1I2SA 3UN7A 3W4OA 1IEMA 3VSLA 4X53A 4ZBEA 1CEGA 1M6KA 4WEKA 3VP4A 1EWZA 1W7FA 1PIOA 3C7UA 4CJNA 4MNRA 5M1AA 1BLCA 5JYOA 5IHVA 3PBOA 4MBKA 5DF9A 5BOHA 4KZ4A 3V3RA 3NY4A 1I2WA 2WGWA 2XK1A 4BD1A 3WS4A 4HEFA 2J9PA 2XD5A 5FDHA 3WRTA 3A3FA 4UHUA 3A3IA 4B4XA 5A93A 3ZG9B 4E3KA 1E3UD 3HLBA 3DWZA 4X68A 4ZTKA 2JCHA 4KQOA 3VOYA 1K38A 4PM5A 4PM7A 1FR1A 4S2MA 1ESUA 3SH9A 5A92A 1BZAA 1PW8A 1L0FA 2Y4AA 3IHAA 1MBLA 1GA0A 1ZG4A 4C3QA 3G31A 4IVIA 4OPYA 2HP6A 4EV4A 4OLDA 2EX8A 2J8YA 4GN2A 3NDGA 4JXWA 1O7EA 4NETA 4P0MA 3IWOA 3TOIA 3SS3A 1NYYA 1PYYA 2ZQ8A 1S6RA 1K55A 4EUZA 4OONA 3ZFZA 4MBHA 3LO7A 3UDXA 1BTLA 4KQRA 5FASA 1Q2QA 4KG2A 1FCMA 5AQBA 2WUQA 3SS5A 2B5RA 2IWCA 2WGWB 4N9KA 4DE3A 4N1HA 3IXGA 1S0WA 5EVIA 3EQUA 3V3SA 2ZLYA 4WEJA 3G32A 3HLWA 2WGIA 2OLUA 1SDEA 1MWUA 1PWCA 4GOGA 3UDFA 1DY6A 3BM6A 3IXHA 4IVKA 3S4XA 5FATA 3SH7A 2Y2GA 4BL3A 4BLMA 4OP8A 1K54C 5D3OA 1FSYA 1LI0A 2Y59A 2XF3A 3MXRA 4JBFA 1W79A 3LY4A 4B88A 3GV9A 4S2JA 2IWBA 5G18A 4U0TA 1WYCA 5HX9A 2Z2MB 1BULA 5CHUA 4ZJ2A 1XGIA 4DE0A 1DJBA 2Y2NA 3G30A 5HAPA 1KGGA 3ZG5A 4Q8IA 1FSWA 1K57C 3HLGA 5A91A 3N8SA 4LENA 5DTSA 1WYBA 3ZG0A 2J7VA 3HLEA 1YM1A 4GDBA 2A49A 4BD0A 1JWVA 3GQZA 3PBSA 3BFDA 2EX2A 3FKVA 3CZDA 5E2HA 4LV3A 3HUMA 4ZAMA 3UE0A 1XP4A 3RJUA 3O87A 3LY3A 1L0DA 3ZVWA 5E43A 1OMEA 3AGFA 4U3TA 3OPHA 3VP1A 4UA7A 3GRJA 1G6AA 4U0XA 3IF5A 3M2JA 3WS5A 3UPNA 5HARA 5FI2A 3P98A 1NZOA 4Y0TA 4MLLA 3IH8A 5E2FA 3VP3A 4GKUA 5KZHA 4KZBA 5DF7A 1K25A 4HBUA 2H0YA 2DNSA 3OC2A 2WKHA 2HP5A 3RXWA 5CEDA 1ONHA 1YMSA 2R9XA 3MXSA 1K56D 2X02A 3ZNYA 4F94A 4R3JA 1KE4A 4E3OA 4EWFA 2PU4A 2ZQ9A 4R23A 3V50A 4O7DA 4WM9A 4K0XA 5CERA 2V2FF 2ZD8A 3DWKA 3WWXA 4R4SA 1M40A 5TGFA 4EQIA 2OSUA 1VM1A 1N4OA 1ONGA 2EFUA 3C5AA 3RXXA 1JTDA 4PMAA 2IWDA 1W5DA 4KZ9A 5EOOA 3V5MA 2Q9NA 3LEZA 3G35A 3HL9A 5FI7A 3C4OA 3IHBA 4BENA 1N9BA 1PI5A 5CTNA 1ERMA 1G68A 1HD8A 1EI5A 2Q9MA 3GMWA 5HFOA 5FAOA 4WYYA 2PBYA 5DTKA 2XEPA 4JKTA 5JYPA 5EE8A 1KE3A 3MKEA 4HESA 1KVLA 3HBRA 2JBFA 4N92A 3CMZA 5EOEA 3UPPA 4L0LA 3WS2A 1ZG6A 3QHYA 1E3UA 4S2PA 5CTMA 3CJMA 3SH8A 3UY6A 1SHVA 1I5QA 1K57A 1MWTA 3P09A 4EBPA 1XKZA 2XDMA 4FH2A 3B3XA 4DE2A 5F1FA 1VQQA 4GZBA 5EECA 1PI4A 5HL1A 4ZDXA 1YLZA 2EX9A 4JXGA 1IYSA 3ZNTA 3MFDA 5HW3A 1YLTA 2WK0A 5EUAA 3N8LA 4OPRA 4GD8A 1BLHA 2QZ6A 4UA9A 3N8RA 4WMCA 5GHXA 3FZCA 5DVAA 5F1GA 1FCNA 1C3BA 4OOYA 4JLFA 4WZ5C 1LHYA 3M2KA 4RX3A 3FV7A 1GHIA 5CEBA 5TR7A 3BLSA 3A3DA 2XLNA 3S1YA 4OPZA 3HVFA 5AQ7A 3G2ZA 1PWGA 3I7JA 3M6BA 5CHMA 3O86A 1NRFA 5F82A 4RYEA 2Z2LB 1Y54A 1KDSA 4PM9A 3OPPA 2Y2QA 5M18A 3FKWA 3E2LA 1CI8A 3MZFA 1W8YA 3OCNA 3NCKA 3BFGA 3BYDA 5DF8A 1LL9A 2H0TA 3ITAA 4LV1A 3FWLA 1MY8A 3ISGA 2C5WB 1DJAA 4KENB 3WRZA 1JVJA 1ES5A 4GNUA 4OLGA 1CK3A 4PM6A 3IWQA 5DTTA 4C6YA 3ZCZA 4S2KA 1XGJA 4C75A 5CGXA 1SKFA 1FR6A 1GHMA 4QY6A 4R1GA 4MEZA 1XA7A 1GCEA 1YLWA 3Q7VB 4K0WA 3DW0A 4P6BA 3M6HA 1QMEA 2DRWA 4OP5A 1EROA 4FH4A 2EX6A 2ZQDA 3IF6C 4X6TA 1ES2A 4YINA 4BL2A 3JYIA 1XXMA 1TDLA 3IXDA 2CC1A 4FSFA 5EVID 1LI9A 3BLMA 3W8KA 1RGYA 1ALQA 2VGKA 1JWZA 1ES4A 1JWPA 3OCLA 2Y2OA 5A90A 2G2WA 2ZQCA 5GLDA 1ZC2A 4OPQA 2BG1A 5U47A 4UA6A 1RGZA 4QB8A 1GA9A 1JTGA 3Q7ZA 2ZM0A 4OOLA 2ZQAA 3EQVA 3VSKA 3BFEA 4E6XA 5GHYA 3UDIA 4QY5A 4X56A 2UWXA 2XR0A 4WBGA 1BUEA 4N1XA 4E3NA 3GVBA 2V1ZA 3IXBA 2HP9A 2ZC4B 1K56A 3IQAA 2ZC3B 3W4PA 3HLFA 4FCFA 4OH0A 4WZ5A 3NDEA 1KGFA 2EXBA 4IBXA 4YFMA 1TEMA 5FQQA 3HLCA 4JPMA 4B4ZA 2E8IA 1MXOA 4HBTA 2C6WB 4OQIA 1IKGA 3IWIA 4UAAA 5HAQA 3N6IA 3G34A 1NY0A 3IH9A 1BLPA 4QU3A 3O3VA 3BFCA 5CRFA 1L2SA 4BJPA 4LCMA 1BT5A 3N7WA 3UPOA 2Y91A 4KZ3A 3QNCA 5EPHA 1W8QA 4OKPA 1IELA 1SCWA 3D4FA 3MKFA 3N4IA 4QD4A 4X69A 5GLBA 2XQZA 2XFSA 1K54A 1O07A 1RCJA 4Y0UA 1IKIA 3PTEA 4XXRA 5E2EA 2P9VB 5FAPA 5F83A 3ZHHA 4JXVA 4E6WA 5CHJA 5L2FA 4IBRA 1HZOA 3GSGA 5AQ9A 5EVIC 3MBZA 3A3EA 2H10A 2XD1A 2G2UA 1PZPA 5CGWA 1YQSA 3IF6A 2QPNA 1NYMA 5FSRA 2Y2LA 2DCFA 2ZJ9A 3HREA 4D2OA 3C4PA 4LCLA 5HAIA 4GDNA 3NI9A 3Q82A 4N9LA 2J9OA 1LL5A 5CECA 4BQMA 2XGNA 4DRTA 1K6RA 3E2KA 2WKIA 3FYZA 2X71A 3ZVTA 3Q07A 4R0QA 3Q81A 1FOFA 4OQ0A 5EVLA 2RL3A 2Y2PA 3VOZA 3OPRA 4CPKA 4WELA 4E3MA 3A3JA 2HDUA 4Y0OA 2Y2MA 3PAEA 4FD8A 3CG5A 3PBQA 5KSCA 4GD6A 1TVFA 5FI6A 2WAFA 1GHPA 2Y2HA 3MZDA 3Q7VA 2VGJA 4KQQA 2ZC6B 4S2OA 4Z9QA 4ZJ1A 1MWSA 2X01A 3MZEA 1HTZA 2BLSA 5CXWA 3SS4A 4E3LA 2GDNA 2QMIA 5GLAA 3VP0A 3QNBA 1DJCA 1NJ4A 4DKIA 4R4RA 3IF6B 1YLYA 3NIAA 3G4PA 1K4EA 4JF5A 4OQHA 2P74A 4S2IA 2ZM2A 3BECA 4EBNA 1PWDA 3HLDA 1YLPA 4K91A 1L0EA 3UE3A 4DXCA 2Y2KA 2ZM8A 5GHZA 4H8RA 5FQIA 2JC7A 4DF6A 4KG5A 4PPRA 1SDNA 3BRMA 1QMFA 3UNWA 1LLBA 4WMCD 2WYXA 3Q1FA 1NZUA 4KG6A 4MBFA 3VMAA 5GLCA 4RVAA 2Y55A 2ZQ7A 2XH9A 1XPBA 4KZ5A 1KDWA 3SOIA 3NBLA 4QJGA 1XX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YLJ A;  4RA7 A;  3ZG7 B;  3VFH A;  1MWR A;  1HVB A;  5FA7 A;  4S2N C;  4DDY A;  4DE1 A;  4LV2 A;  1NXY A;  4A5R A;  1MKI A;  1PZO A;  5J8X A;  2A3U A;  4LV0 A;  1IYP A;  5AQA A;  3PAG A;  3DTM A;  3ZDJ A;  4RX2 A;  1IYO A;  3PBN A;  1AXB A;  2XFT A;  5CGS A;  1TDG A;  2HPB A;  1BSG A;  1J9M A;  3UE1 A;  3IT9 A;  5FQ9 A;  3VP2 A;  4JF6 A;  4ZJ3 A;  2WAD A;  3W4Q A;  1PW1 A;  4Y7P A;  4XUZ A;  2WZZ A;  2P9V A;  1MPL A;  3ZG8 B;  2V20 A;  3LCE A;  4NK3 A;  1YT4 A;  2OV5 A;  1FQG A;  1YMX A;  5FQM A;  3TSG A;  1KVM A;  5TFQ A;  4EBL A;  4OOM A;  5KMW A;  2FFY A;  2WAE A;  2HDS A;  4KZ6 A;  1IYQ A;  2FFF B;  3O88 A;  3C7V A;  1E25 A;  1E4D A;  1WE4 A;  3TG9 A;  4X55 A;  5EVI B;  3VFF A;  2JE5 A;  3S22 A;  1H8Z A;  3AGD A;  2WGV A;  1KE0 A;  4KZA A;  3WS0 A;  2ZC7 A;  2ZMA A;  2Y2J A;  1H5X A;  2HDR A;  1K6S A;  2WZX A;  3G2Y A;  5FQK A;  2OLV A;  3GTC A;  5KSH A;  4DXB A;  1K4F A;  2I72 A;  5FAQ A;  1H8Y A;  1BLS A;  2EXA A;  4OQG A;  3OZH A;  1ZKJ A;  1L0G A;  1FCO A;  1ESI A;  1KGE A;  1K55 C;  3WS1 A;  4E3J A;  2R9W A;  2RCX A;  1ERQ A;  1XA1 A;  3PBR A;  2HDQ A;  3PBT A;  3AGE A;  1CEF A;  4GB7 A;  4JXS A;  4ID4 A;  4IED A;  2PU2 A;  3BFF A;  4KZ7 A;  3ITB A;  5I94 A;  4P85 A;  4E3I A;  3NC8 A;  4OVD A;  2H5S A;  3V39 A;  4KZ8 A;  3HUO A;  2EFX A;  4P87 A;  3GR2 A;  5GL9 A;  1ES3 A;  4WZ4 A;  2ZC5 B;  2Y2I A;  3OPL A;  4M3K A;  1U60 A;  4S2L A;  4XUX A;  5FQJ A;  1RP5 A;  2WKE A;  4R3B A;  3ZGA B;  3BEB A;  5M19 A;  3HUN A;  4S2N A;  4PM8 A;  4QHC A;  3UO9 A;  4JF4 A;  4DDS A;  1Q2P A;  1Z6F A;  5E2G A;  1CI9 A;  1I2S A;  3UN7 A;  3W4O A;  1IEM A;  3VSL A;  4X53 A;  4ZBE A;  1CEG A;  1M6K A;  4WEK A;  3VP4 A;  1EWZ A;  1W7F A;  1PIO A;  3C7U A;  4CJN A;  4MNR A;  5M1A A;  1BLC A;  5JYO A;  5IHV A;  3PBO A;  4MBK A;  5DF9 A;  5BOH A;  4KZ4 A;  3V3R A;  3NY4 A;  1I2W A;  2WGW A;  2XK1 A;  4BD1 A;  3WS4 A;  4HEF A;  2J9P A;  2XD5 A;  5FDH A;  3WRT A;  3A3F A;  4UHU A;  3A3I A;  4B4X A;  5A93 A;  3ZG9 B;  4E3K A;  1E3U D;  3HLB A;  3DWZ A;  4X68 A;  4ZTK A;  2JCH A;  4KQO A;  3VOY A;  1K38 A;  4PM5 A;  4PM7 A;  1FR1 A;  4S2M A;  1ESU A;  3SH9 A;  5A92 A;  1BZA A;  1PW8 A;  1L0F A;  2Y4A A;  3IHA A;  1MBL A;  1GA0 A;  1ZG4 A;  4C3Q A;  3G31 A;  4IVI A;  4OPY A;  2HP6 A;  4EV4 A;  4OLD A;  2EX8 A;  2J8Y A;  4GN2 A;  3NDG A;  4JXW A;  1O7E A;  4NET A;  4P0M A;  3IWO A;  3TOI A;  3SS3 A;  1NYY A;  1PYY A;  2ZQ8 A;  1S6R A;  1K55 A;  4EUZ A;  4OON A;  3ZFZ A;  4MBH A;  3LO7 A;  3UDX A;  1BTL A;  4KQR A;  5FAS A;  1Q2Q A;  4KG2 A;  1FCM A;  5AQB A;  2WUQ A;  3SS5 A;  2B5R A;  2IWC A;  2WGW B;  4N9K A;  4DE3 A;  4N1H A;  3IXG A;  1S0W A;  5EVI A;  3EQU A;  3V3S A;  2ZLY A;  4WEJ A;  3G32 A;  3HLW A;  2WGI A;  2OLU A;  1SDE A;  1MWU A;  1PWC A;  4GOG A;  3UDF A;  1DY6 A;  3BM6 A;  3IXH A;  4IVK A;  3S4X A;  5FAT A;  3SH7 A;  2Y2G A;  4BL3 A;  4BLM A;  4OP8 A;  1K54 C;  5D3O A;  1FSY A;  1LI0 A;  2Y59 A;  2XF3 A;  3MXR A;  4JBF A;  1W79 A;  3LY4 A;  4B88 A;  3GV9 A;  4S2J A;  2IWB A;  5G18 A;  4U0T A;  1WYC A;  5HX9 A;  2Z2M B;  1BUL A;  5CHU A;  4ZJ2 A;  1XGI A;  4DE0 A;  1DJB A;  2Y2N A;  3G30 A;  5HAP A;  1KGG A;  3ZG5 A;  4Q8I A;  1FSW A;  1K57 C;  3HLG A;  5A91 A;  3N8S A;  4LEN A;  5DTS A;  1WYB A;  3ZG0 A;  2J7V A;  3HLE A;  1YM1 A;  4GDB A;  2A49 A;  4BD0 A;  1JWV A;  3GQZ A;  3PBS A;  3BFD A;  2EX2 A;  3FKV A;  3CZD A;  5E2H A;  4LV3 A;  3HUM A;  4ZAM A;  3UE0 A;  1XP4 A;  3RJU A;  3O87 A;  3LY3 A;  1L0D A;  3ZVW A;  5E43 A;  1OME A;  3AGF A;  4U3T A;  3OPH A;  3VP1 A;  4UA7 A;  3GRJ A;  1G6A A;  4U0X A;  3IF5 A;  3M2J A;  3WS5 A;  3UPN A;  5HAR A;  5FI2 A;  3P98 A;  1NZO A;  4Y0T A;  4MLL A;  3IH8 A;  5E2F A;  3VP3 A;  4GKU A;  5KZH A;  4KZB A;  5DF7 A;  1K25 A;  4HBU A;  2H0Y A;  2DNS A;  3OC2 A;  2WKH A;  2HP5 A;  3RXW A;  5CED A;  1ONH A;  1YMS A;  2R9X A;  3MXS A;  1K56 D;  2X02 A;  3ZNY A;  4F94 A;  4R3J A;  1KE4 A;  4E3O A;  4EWF A;  2PU4 A;  2ZQ9 A;  4R23 A;  3V50 A;  4O7D A;  4WM9 A;  4K0X A;  5CER A;  2V2F F;  2ZD8 A;  3DWK A;  3WWX A;  4R4S A;  1M40 A;  5TGF A;  4EQI A;  2OSU A;  1VM1 A;  1N4O A;  1ONG A;  2EFU A;  3C5A A;  3RXX A;  1JTD A;  4PMA A;  2IWD A;  1W5D A;  4KZ9 A;  5EOO A;  3V5M A;  2Q9N A;  3LEZ A;  3G35 A;  3HL9 A;  5FI7 A;  3C4O A;  3IHB A;  4BEN A;  1N9B A;  1PI5 A;  5CTN A;  1ERM A;  1G68 A;  1HD8 A;  1EI5 A;  2Q9M A;  3GMW A;  5HFO A;  5FAO A;  4WYY A;  2PBY A;  5DTK A;  2XEP A;  4JKT A;  5JYP A;  5EE8 A;  1KE3 A;  3MKE A;  4HES A;  1KVL A;  3HBR A;  2JBF A;  4N92 A;  3CMZ A;  5EOE A;  3UPP A;  4L0L A;  3WS2 A;  1ZG6 A;  3QHY A;  1E3U A;  4S2P A;  5CTM A;  3CJM A;  3SH8 A;  3UY6 A;  1SHV A;  1I5Q A;  1K57 A;  1MWT A;  3P09 A;  4EBP A;  1XKZ A;  2XDM A;  4FH2 A;  3B3X A;  4DE2 A;  5F1F A;  1VQQ A;  4GZB A;  5EEC A;  1PI4 A;  5HL1 A;  4ZDX A;  1YLZ A;  2EX9 A;  4JXG A;  1IYS A;  3ZNT A;  3MFD A;  5HW3 A;  1YLT A;  2WK0 A;  5EUA A;  3N8L A;  4OPR A;  4GD8 A;  1BLH A;  2QZ6 A;  4UA9 A;  3N8R A;  4WMC A;  5GHX A;  3FZC A;  5DVA A;  5F1G A;  1FCN A;  1C3B A;  4OOY A;  4JLF A;  4WZ5 C;  1LHY A;  3M2K A;  4RX3 A;  3FV7 A;  1GHI A;  5CEB A;  5TR7 A;  3BLS A;  3A3D A;  2XLN A;  3S1Y A;  4OPZ A;  3HVF A;  5AQ7 A;  3G2Z A;  1PWG A;  3I7J A;  3M6B A;  5CHM A;  3O86 A;  1NRF A;  5F82 A;  4RYE A;  2Z2L B;  1Y54 A;  1KDS A;  4PM9 A;  3OPP A;  2Y2Q A;  5M18 A;  3FKW A;  3E2L A;  1CI8 A;  3MZF A;  1W8Y A;  3OCN A;  3NCK A;  3BFG A;  3BYD A;  5DF8 A;  1LL9 A;  2H0T A;  3ITA A;  4LV1 A;  3FWL A;  1MY8 A;  3ISG A;  2C5W B;  1DJA A;  4KEN B;  3WRZ A;  1JVJ A;  1ES5 A;  4GNU A;  4OLG A;  1CK3 A;  4PM6 A;  3IWQ A;  5DTT A;  4C6Y A;  3ZCZ A;  4S2K A;  1XGJ A;  4C75 A;  5CGX A;  1SKF A;  1FR6 A;  1GHM A;  4QY6 A;  4R1G A;  4MEZ A;  1XA7 A;  1GCE A;  1YLW A;  3Q7V B;  4K0W A;  3DW0 A;  4P6B A;  3M6H A;  1QME A;  2DRW A;  4OP5 A;  1ERO A;  4FH4 A;  2EX6 A;  2ZQD A;  3IF6 C;  4X6T A;  1ES2 A;  4YIN A;  4BL2 A;  3JYI A;  1XXM A;  1TDL A;  3IXD A;  2CC1 A;  4FSF A;  5EVI D;  1LI9 A;  3BLM A;  3W8K A;  1RGY A;  1ALQ A;  2VGK A;  1JWZ A;  1ES4 A;  1JWP A;  3OCL A;  2Y2O A;  5A90 A;  2G2W A;  2ZQC A;  5GLD A;  1ZC2 A;  4OPQ A;  2BG1 A;  5U47 A;  4UA6 A;  1RGZ A;  4QB8 A;  1GA9 A;  1JTG A;  3Q7Z A;  2ZM0 A;  4OOL A;  2ZQA A;  3EQV A;  3VSK A;  3BFE A;  4E6X A;  5GHY A;  3UDI A;  4QY5 A;  4X56 A;  2UWX A;  2XR0 A;  4WBG A;  1BUE A;  4N1X A;  4E3N A;  3GVB A;  2V1Z A;  3IXB A;  2HP9 A;  2ZC4 B;  1K56 A;  3IQA A;  2ZC3 B;  3W4P A;  3HLF A;  4FCF A;  4OH0 A;  4WZ5 A;  3NDE A;  1KGF A;  2EXB A;  4IBX A;  4YFM A;  1TEM A;  5FQQ A;  3HLC A;  4JPM A;  4B4Z A;  2E8I A;  1MXO A;  4HBT A;  2C6W B;  4OQI A;  1IKG A;  3IWI A;  4UAA A;  5HAQ A;  3N6I A;  3G34 A;  1NY0 A;  3IH9 A;  1BLP A;  4QU3 A;  3O3V A;  3BFC A;  5CRF A;  1L2S A;  4BJP A;  4LCM A;  1BT5 A;  3N7W A;  3UPO A;  2Y91 A;  4KZ3 A;  3QNC A;  5EPH A;  1W8Q A;  4OKP A;  1IEL A;  1SCW A;  3D4F A;  3MKF A;  3N4I A;  4QD4 A;  4X69 A;  5GLB A;  2XQZ A;  2XFS A;  1K54 A;  1O07 A;  1RCJ A;  4Y0U A;  1IKI A;  3PTE A;  4XXR A;  5E2E A;  2P9V B;  5FAP A;  5F83 A;  3ZHH A;  4JXV A;  4E6W A;  5CHJ A;  5L2F A;  4IBR A;  1HZO A;  3GSG A;  5AQ9 A;  5EVI C;  3MBZ A;  3A3E A;  2H10 A;  2XD1 A;  2G2U A;  1PZP A;  5CGW A;  1YQS A;  3IF6 A;  2QPN A;  1NYM A;  5FSR A;  2Y2L A;  2DCF A;  2ZJ9 A;  3HRE A;  4D2O A;  3C4P A;  4LCL A;  5HAI A;  4GDN A;  3NI9 A;  3Q82 A;  4N9L A;  2J9O A;  1LL5 A;  5CEC A;  4BQM A;  2XGN A;  4DRT A;  1K6R A;  3E2K A;  2WKI A;  3FYZ A;  2X71 A;  3ZVT A;  3Q07 A;  4R0Q A;  3Q81 A;  1FOF A;  4OQ0 A;  5EVL A;  2RL3 A;  2Y2P A;  3VOZ A;  3OPR A;  4CPK A;  4WEL A;  4E3M A;  3A3J A;  2HDU A;  4Y0O A;  2Y2M A;  3PAE A;  4FD8 A;  3CG5 A;  3PBQ A;  5KSC A;  4GD6 A;  1TVF A;  5FI6 A;  2WAF A;  1GHP A;  2Y2H A;  3MZD A;  3Q7V A;  2VGJ A;  4KQQ A;  2ZC6 B;  4S2O A;  4Z9Q A;  4ZJ1 A;  1MWS A;  2X01 A;  3MZE A;  1HTZ A;  2BLS A;  5CXW A;  3SS4 A;  4E3L A;  2GDN A;  2QMI A;  5GLA A;  3VP0 A;  3QNB A;  1DJC A;  1NJ4 A;  4DKI A;  4R4R A;  3IF6 B;  1YLY A;  3NIA A;  3G4P A;  1K4E A;  4JF5 A;  4OQH A;  2P74 A;  4S2I A;  2ZM2 A;  3BEC A;  4EBN A;  1PWD A;  3HLD A;  1YLP A;  4K91 A;  1L0E A;  3UE3 A;  4DXC A;  2Y2K A;  2ZM8 A;  5GHZ A;  4H8R A;  5FQI A;  2JC7 A;  4DF6 A;  4KG5 A;  4PPR A;  1SDN A;  3BRM A;  1QMF A;  3UNW A;  1LLB A;  4WMC D;  2WYX A;  3Q1F A;  1NZU A;  4KG6 A;  4MBF A;  3VMA A;  5GLC A;  4RVA A;  2Y55 A;  2ZQ7 A;  2XH9 A;  1XPB A;  4KZ5 A;  1KDW A;  3SOI A;  3NBL A;  4QJG A;  1XX2 A; 
#chains in the Genus database with same CATH topology
 4GS9 B;  2D02 A;  4RA7 A;  3ZG7 B;  5HWT A;  5FA7 A;  3LR0 A;  4A5R A;  2A3U A;  4LV0 A;  3LYX A;  5AQA A;  3ZDJ A;  5CGS A;  2HPB A;  3VP2 A;  5FQ9 A;  2WZZ A;  2W0N A;  3ZG8 B;  2OV5 A;  4EW7 A;  2E8J A;  1FQG A;  1YMX A;  3B47 A;  3RTY A;  3TSG A;  3T50 A;  2FFF B;  4I5S A;  3C7V A;  3GDI A;  1E25 A;  1OJ5 A;  4X55 A;  2JE5 A;  1H8Z A;  2PDR A;  3WS0 A;  2ZC7 A;  2ZMA A;  2XSS A;  1Z09 A;  4G3W A;  2HDR A;  2I72 A;  2O9B A;  2ZOI A;  1KGE A;  1K55 C;  2L1M A;  4E3J A;  4GJ4 A;  3FG8 A;  2O9A A;  2PU2 A;  1BYW A;  5I94 A;  4OVD A;  2W3H A;  3GR2 A;  1JNU A;  3OPL A;  1U60 A;  4XUX A;  4R3B A;  3BEB A;  1TS8 A;  4PM8 A;  1Z6F A;  1CI9 A;  4IUK A;  2W3G A;  1IEM A;  3JVU A;  3VSL A;  3VP4 A;  4ETX A;  1PIO A;  1FIK A;  1BLC A;  2VK3 A;  5BOH A;  3EEH A;  3KSH A;  3NY4 A;  3EOI A;  5MC7 A;  2WGW A;  1IFQ A;  3A3F A;  4B4X A;  5A93 A;  4KQO A;  2VEA A;  4MN7 A;  3S7N A;  1L3L A;  1K38 A;  4PKY G;  1IOU A;  1FR1 A;  1ESU A;  1PW8 A;  3IHA A;  1MBL A;  1GA0 A;  3G31 A;  5F5Y A;  4OPY A;  2W1T A;  4NG2 A;  2J8Y A;  4OLD A;  4JXW A;  3S7Q A;  5TBM A;  2GJ3 A;  1K55 A;  3UDX A;  5FAS A;  1FCM A;  5AQB A;  1MKM A;  5AVE A;  4N9K A;  3IXG A;  3EQU A;  3C8C A;  3G32 A;  2WGI A;  3ULF A;  1MWU A;  1DY6 A;  3T4T A;  4OP8 A;  2VGL M;  4MN5 A;  3T1S A;  5DKL A;  1NLZ A;  4GHI B;  3GV9 A;  4MMN A;  2IWB A;  4CQH A;  2INW A;  3P7N A;  1YKD A;  5HWW A;  3MMH A;  4Q8I A;  1K57 C;  4G3K A;  3N8S A;  2AVX A;  1FIL A;  1S1Z A;  3CHW P;  1CF0 A;  1JWV A;  1Y4O A;  3CZD A;  2W3F A;  3LY3 A;  3ZVW A;  4U3T A;  3LFV A;  1VB6 A;  1EW0 A;  2H28 A;  3IF5 A;  4U0X A;  3P98 A;  5DKK A;  4Y0T A;  5E2F A;  3IBJ A;  1K25 A;  4O8G A;  2HP5 A;  3C2W A;  3MXS A;  1K56 D;  2Y8H A;  2X02 A;  3DTK A;  1W63 Q;  2PU4 A;  4R23 A;  2ZBB A;  4Y15 A;  2M7V A;  4K0X A;  2V9A A;  2V2F F;  3WWX A;  3LIA A;  3RXX A;  4PMA A;  4EU0 A;  3V5M A;  3CPT A;  5FI7 A;  4WN5 A;  4BEN A;  5F6A A;  5CTN A;  1ERM A;  1G68 A;  3GMW A;  5HFO A;  5FAO A;  3T4K A;  4WYY A;  3TW8 A;  1D1J A;  5EE8 A;  3MKE A;  3IX8 A;  1S67 L;  2JBF A;  4N92 A;  5EOE A;  3QHY A;  4PHT A;  3UY6 A;  1K57 A;  1MWT A;  5F1F A;  1PI4 A;  4ZDX A;  1IYS A;  5HW3 A;  1YLT A;  1GSW A;  2OAQ 1;  5EUA A;  3N8L A;  5GHX A;  3FZC A;  1FCN A;  3MJQ A;  1DRM A;  4JLF A;  2V0U A;  4WZ5 C;  1LHY A;  4RX3 A;  3FV7 A;  5CEB A;  3S1Y A;  3G2Z A;  3M6B A;  5CHM A;  5F82 A;  4PM9 A;  5I5L A;  5M18 A;  1CI8 A;  4YNR A;  3MZF A;  4JGR A;  3OCN A;  3UMD A;  4I38 A;  5FEF A;  4LV1 A;  3FWL A;  1T19 A;  4HP4 A;  1DJA A;  4GNU A;  4OLG A;  2PT7 A;  3L7H A;  4C6Y A;  3IWQ A;  5L8M A;  1D06 A;  4Q0H A;  4S2K A;  5CGX A;  3MQO A;  4R1G A;  5L07 A;  3DW0 A;  2PRF A;  2ZQD A;  4X6T A;  5FDS A;  4YIN A;  3JYI A;  3IXD A;  2CC1 A;  5G4Z A;  2JKR M;  1ES4 A;  1ZC2 A;  2FH5 A;  1V9Z A;  3IS2 B;  1JTG A;  2ZM0 A;  3KSF A;  3EQV A;  3UDI A;  4QY5 A;  2UWX A;  2XR0 A;  1BUE A;  3GVB A;  3RFB A;  2HP9 A;  1K56 A;  4WZ5 A;  1KGF A;  1NLY A;  3MQ0 A;  3HLC A;  5FQQ A;  2C6W B;  1NY0 A;  3BY9 A;  3IH9 A;  1XFN A;  5CRF A;  1AWI A;  4BJP A;  4HQA A;  1VHM A;  3NOP C;  2M1C A;  4QD4 A;  3K3D A;  4JGQ A;  1K54 A;  2LB9 A;  5FAP A;  1ZHH B;  5FEG A;  2BAS A;  4IBR A;  4HJ6 A;  3MBZ A;  2PYR A;  3A3E A;  1VET A;  5EFW A;  2Y2L A;  2ZJ9 A;  3TRC A;  3C4P A;  4LCL A;  4Y3I A;  2I9V A;  4N9L A;  1LL5 A;  5CEC A;  2WKI A;  3FYZ A;  1FOF A;  2RL3 A;  1N9O A;  3OPR A;  4II7 A;  1CQA A;  2VV8 A;  1GHP A;  2Y2H A;  4KQQ A;  4S2O A;  1MWS A;  3LR4 A;  3KYQ A;  5CXW A;  3SS4 A;  2YKF A;  2GDN A;  2QMI A;  3UB9 A;  2JKT M;  3VP0 A;  4NXE A;  4HHD A;  1NJ4 A;  4LGW A;  1DP6 A;  1OT9 A;  3QP8 A;  4EBN A;  3IX4 A;  1G5U A;  5A8B A;  1D7E A;  2ZM8 A;  4H8R A;  5FQI A;  3UNW A;  3Q1F A;  1NZU A;  4KG6 A;  4RVA A;  4H6J B;  2WKP A;  4QJG A;  2R78 A;  4S2N C;  4DDY A;  4DE1 A;  1ODV A;  1PZO A;  5J8X A;  1IYP A;  3TJZ C;  4RX2 A;  1BSG A;  1J9M A;  4JF6 A;  2WAD A;  1T1B A;  4HI4 A;  4Y7P A;  4X25 A;  2P9V A;  1MPL A;  2QYB A;  2V20 A;  4MN6 A;  3TE8 A;  3QP6 A;  4OOM A;  3R4K A;  5KMW A;  2FFY A;  2P04 A;  2HDS A;  2WAE A;  2WKQ A;  3TG9 A;  5EVI B;  3AGD A;  1KE0 A;  4KZA A;  4BBV A;  4LPZ A;  1H5X A;  3G2Y A;  5FQK A;  4NXF A;  1K4F A;  3T1X A;  3OZH A;  3BY8 A;  5J7E A;  1FCO A;  2KLI A;  4Q0J A;  3WS1 A;  2R9W A;  3OLO A;  3PBR A;  1CJF A;  1CEF A;  3AGE A;  4EES A;  4ID4 A;  3KX0 X;  1OTE A;  4KZ8 A;  1F5M A;  2EFX A;  2PHY A;  2ZC5 B;  4M3K A;  3VE3 A;  5FQJ A;  2WKE A;  3KYZ A;  3ZGA B;  2J3T D;  4S2N A;  4DDS A;  2L4R A;  2HGV A;  3UN7 A;  3CWF A;  3C7U A;  4CJN A;  2W27 A;  3T4O A;  3T4S A;  5IHV A;  3U4L P;  3BQ8 A;  3HCY A;  3WS4 A;  2PR6 A;  3VE4 A;  5FDH A;  3WRT A;  4UHU A;  3A3I A;  3QP4 A;  2JHE A;  4KUO A;  4E3K A;  1E3U D;  4ZTK A;  3VOY A;  3U2A A;  3BJN A;  1T1A A;  1X0O A;  3SH9 A;  2ZMV A;  3KO6 A;  3DAV A;  3FC7 A;  4P0M A;  3B42 A;  3TOI A;  4GN2 A;  4Y2F A;  3IWO A;  3DTI A;  1HLU P;  1PYY A;  1S6R A;  3LO7 A;  4KQR A;  1Q2Q A;  2B5R A;  2IWC A;  3F1N A;  4HY8 A;  4N1H A;  3V3S A;  4WEJ A;  4ZRR A;  3MF0 A;  1SDE A;  3C38 A;  2VV6 A;  4IVK A;  3S4X A;  2Y2G A;  4BL3 A;  2O0Y A;  5EV0 A;  2Y59 A;  1LI0 A;  4NXG A;  1W79 A;  3UB6 A;  4S2J A;  1YAX A;  4U0T A;  1NRJ A;  1F9I A;  5CHU A;  1BUL A;  2A24 B;  2YKH A;  4ZJ2 A;  4WLA A;  3P01 A;  1WYB A;  2J7V A;  3HLE A;  1YM1 A;  4GDB A;  2A49 A;  4F3L A;  1OPX A;  3LI8 A;  4HJ4 A;  5E2H A;  4ZAM A;  1OME A;  4UA7 A;  2D01 A;  4XT2 B;  3QP1 A;  3UPN A;  5HAR A;  3LID A;  1NZO A;  2JKF A;  4MLL A;  3VP3 A;  4GKU A;  4HBU A;  3QP2 A;  5CED A;  1MC0 A;  1YMS A;  2B95 A;  1V9Y A;  1YSP A;  3ZNY A;  4R3J A;  4E3O A;  2ZQ9 A;  4QWO A;  3S7O A;  3G6O A;  4HIA A;  1P0Z A;  3DWK A;  1M40 A;  4EQI A;  1VEU A;  2EWW A;  3C5A A;  1VM1 A;  2EFU A;  3BW6 A;  5EOO A;  2HZ5 A;  3G35 A;  3OOV A;  3C4O A;  1N9B A;  5L09 A;  2Q9M A;  3UE6 A;  4NXB A;  1STZ A;  2BTF P;  5JYP A;  4HES A;  1KVL A;  3UPP A;  4L0L A;  1E3U A;  4S2P A;  1SHV A;  3MS6 A;  1W63 M;  3P09 A;  4EBP A;  1XKZ A;  4DE2 A;  1VQQ A;  5EEC A;  5HL1 A;  2L0W A;  3ZQ5 A;  1S4R A;  1F2K A;  4JXG A;  3MFD A;  3T4J A;  4Y13 A;  1XFQ A;  4OPR A;  1BLH A;  2VV7 A;  3D72 A;  5HSQ A;  5F1G A;  4ARZ B;  4OOY A;  3M2K A;  5TR7 A;  3E4O A;  5AQ7 A;  4Y17 A;  3I7J A;  4RYE A;  2Z2L B;  2EA9 A;  3OPP A;  1S1Y A;  2HJE A;  3FKW A;  3E2L A;  3IS2 A;  1W8Y A;  3BFG A;  5DF8 A;  1LL9 A;  4NEE D;  3ISG A;  2PBD P;  4KEN B;  3WRZ A;  1ES5 A;  3KSI A;  3DTE A;  1K0K A;  2KX6 A;  3ZCZ A;  4C75 A;  1XGJ A;  1FR6 A;  1GCE A;  3Q7V B;  1QME A;  2DRW A;  4FH4 A;  2EX6 A;  4FSF A;  5EVI D;  2VGK A;  5K5B A;  4OPQ A;  4UA6 A;  4QB8 A;  1GA9 A;  4DJ2 A;  4DMZ A;  3EGD C;  4OOL A;  4E6X A;  3UB7 A;  4N1X A;  2V1Z A;  1P9W A;  3A0R A;  1XJ4 A;  2V8F A;  2OOL A;  1TEM A;  4JPM A;  4HBT A;  3LIF A;  3O3V A;  3PXP A;  3CUE C;  3N7W A;  4NKP A;  4KZ3 A;  3BWL A;  5EPH A;  1W8Q A;  3N4I A;  4Y0U A;  3PTE A;  3SW1 A;  4JXV A;  3R7W A;  2GZA A;  5CHJ A;  5L2F A;  5LBR A;  5EVI C;  1YPR A;  2DMW A;  2H10 A;  2XD1 A;  2G2U A;  1YQS A;  1OJG A;  2QPN A;  1NYM A;  3T1R A;  4GDN A;  3NI9 A;  1OTI A;  3QP5 A;  2XGN A;  3E2K A;  2X71 A;  3ZVT A;  2ZL1 A;  3Q07 A;  4OQ0 A;  4CPK A;  4WEL A;  2Y2M A;  3PAE A;  4FD8 A;  4EEP A;  3CG5 A;  1OTB A;  4H6J A;  4Z9Q A;  2VLG A;  2X01 A;  4E3L A;  1TF1 A;  5EM1 A;  5GLA A;  3QNB A;  1DJC A;  3HJK A;  4R6L A;  4R4R A;  4ME4 A;  3G4P A;  1K4E A;  4OQH A;  4Y5F A;  1PWD A;  2VA0 A;  4K91 A;  2J3W A;  4DXC A;  4LRY C;  4EXO A;  4DF6 A;  4WMC D;  2WYX A;  2K7S A;  2Y55 A;  2XH9 A;  1XPB A;  3LIE A;  3NBL A;  1YLJ A;  1HVB A;  2VGL S;  1MKI A;  1PNE A;  1TS7 A;  3PAG A;  2V8C A;  1SKO A;  1IYO A;  3PBN A;  2EWV A;  1AXB A;  1S66 L;  1TDG A;  3LIC A;  3NEC A;  4ZJ3 A;  3EWK A;  1PW1 A;  3O5Y A;  5IS1 A;  4XUZ A;  4GW9 A;  5TBM B;  1YT4 A;  1KVM A;  1T18 A;  4HJ3 A;  4KZ6 A;  1IYQ A;  2V1B A;  1E4D A;  3S22 A;  1K6S A;  1PRQ A;  2WZX A;  5HL6 A;  5KSH A;  3KYE A;  3NOT C;  2M7U A;  1TD5 A;  1GSX A;  2EXA A;  3UB5 P;  3MXQ A;  1ESI A;  4B9O A;  2HV1 A;  1ERQ A;  2W1R A;  2VKS A;  4LRZ E;  4GB7 A;  4JXS A;  1YSQ A;  4JGP A;  4E3I A;  3V39 A;  3HUO A;  4P87 A;  4EET B;  4L9G A;  5GL9 A;  4DN0 A;  1ES3 A;  4WZ4 A;  4S2L A;  5M19 A;  3JVV A;  3F1P B;  1Q2P A;  5E2G A;  4P6Z M;  5IU1 A;  3BQA A;  4X53 A;  4ZBE A;  4WEK A;  1EWZ A;  5HDD A;  3F1O A;  5M1A A;  3H9W A;  5JYO A;  4MCW A;  1UGU A;  3NUL A;  4MBK A;  5DF9 A;  3E0Y A;  2XK1 A;  4BD1 A;  3W2Z A;  4HEF A;  2J9P A;  2XD5 A;  3T4L A;  2NUP C;  4GS9 A;  4GLQ A;  3ZG9 B;  2JCH A;  3H82 B;  4YOF A;  4QPR A;  1BZA A;  1L0F A;  3L9K A;  1ZG4 A;  3CPT B;  2HP6 A;  4EV4 A;  2EX8 A;  3NDG A;  1O7E A;  1XJ2 A;  3SS3 A;  2ZQ8 A;  4EUZ A;  3ZFZ A;  4MBH A;  2WUQ A;  3SS5 A;  1WA9 A;  3MFX A;  2VX8 A;  1S0W A;  4LRX C;  4I3I A;  2OLU A;  3UDF A;  3BM6 A;  4BMW A;  3IXH A;  5HD5 A;  3SH7 A;  4BBT A;  4Q0I A;  4XT2 A;  3E98 A;  1FSY A;  2XF3 A;  3MXR A;  4JBF A;  4B93 A;  3LY4 A;  3FPW A;  1S4S A;  4B88 A;  2QJ5 A;  5G18 A;  1WYC A;  2G7U A;  3B33 A;  1DJB A;  2Y2N A;  3G30 A;  5HAP A;  1KGG A;  3E4Q A;  3HLG A;  5DTS A;  2B18 A;  3PBS A;  3BFD A;  2EX2 A;  3FKV A;  3EEA A;  4LV3 A;  3HUM A;  3UE0 A;  1XP4 A;  4PKY A;  1ACF A;  3O87 A;  3OPH A;  3CI6 A;  3GRJ A;  4LFU A;  1N9L A;  1OTA A;  5KZH A;  4KZB A;  5DF7 A;  2H0Y A;  2WKH A;  3RXW A;  1ONH A;  1UWP X;  2QJ7 A;  3D3O A;  4O7D A;  5DJT A;  5CER A;  1SZV A;  2ZD8 A;  4R4S A;  2OSU A;  1ONG A;  1JTD A;  2IWD A;  3RH8 B;  1W5D A;  3IHB A;  1PI5 A;  2UV0 E;  2Q0O A;  3HJI A;  3LR3 A;  5DFX A;  5C5K A;  4ARZ A;  5HWV A;  5HZH A;  5DTK A;  2XEP A;  4JKT A;  4HH2 A;  3HBR A;  2PD7 A;  3WS2 A;  4I39 A;  4P6Z S;  2KDK A;  3K2N A;  3NHQ A;  4FH2 A;  3B3X A;  4GZB A;  1KOU A;  2QWS A;  1YLZ A;  1G28 A;  4R3A A;  4GHI A;  4GD8 A;  2QZ6 A;  3NOU C;  4UA9 A;  5TJJ A;  4WUJ A;  5DVA A;  1TS0 A;  3H7W B;  4IJG A;  1LT0 A;  2XRO A;  1PFL A;  1GHI A;  3A3D A;  4FOF A;  2W3E A;  2GX5 A;  3C30 A;  1PWG A;  1NRF A;  1P9R A;  2J3T C;  2Y2Q A;  4BBU A;  5HDC A;  3NCK A;  1J3W A;  2P08 A;  3ITA A;  2IA2 A;  2C5W B;  5CX7 A;  1JVJ A;  4DJ3 A;  4PM6 A;  1F98 A;  1GHM A;  4QY6 A;  4MEZ A;  5AJG A;  1MZU A;  4OP5 A;  4CLC B;  5KSC A;  1XXM A;  1TDL A;  1LI9 A;  1ALQ A;  3LGO A;  1JWZ A;  1JWP A;  3OCL A;  5A90 A;  5U47 A;  3NJA A;  3Q7Z A;  3VSK A;  3BFE A;  4LLO B;  5GHY A;  1H3Q A;  4X56 A;  3LUQ A;  4WBG A;  4E3N A;  2O9C A;  2ZC4 B;  3IQA A;  2ZC3 B;  2J80 A;  3HLF A;  4OH0 A;  2EXB A;  5DFY A;  1IKG A;  4D60 A;  3N6I A;  4O0P A;  3G34 A;  4IUH A;  4EUV A;  3JPU A;  4QU3 A;  2V1A A;  5DJU A;  4BWI A;  2OWH A;  1L2S A;  2P7J A;  2JKG A;  4LCM A;  4Z1W A;  3UB8 A;  3QNC A;  4OKP A;  1SCW A;  3D4F A;  3MKF A;  4X69 A;  5GLB A;  4K08 A;  2XQZ A;  2XFS A;  1O07 A;  2WKR A;  1IKI A;  5J3W A;  2P9V B;  5F83 A;  4E6W A;  2A2L A;  2QKP A;  3GSG A;  2LB5 A;  4R38 A;  4O01 A;  2DCF A;  3HRE A;  5EM0 A;  5HAI A;  2Z6D A;  3CIT A;  3Q82 A;  2J9O A;  3LR5 A;  4MDZ A;  4FUW A;  3Q81 A;  5EVL A;  2Y2P A;  2QHK A;  3A3J A;  2OWJ A;  3ICY A;  2GNX A;  1XJ3 A;  4GD6 A;  1TVF A;  2ZOH A;  4ZJ1 A;  1HTZ A;  3A0V A;  4UEY A;  2PR5 A;  3IF6 B;  1YLY A;  4I3A A;  1A0K A;  1Y28 A;  2P74 A;  1YLP A;  3T1Q B;  2Y2K A;  2JC7 A;  4KG5 A;  4PPR A;  1XJ6 A;  1LLB A;  2V0W A;  5GLC A;  1LSX A;  4KZ5 A;  2XA7 M;  1KDW A;  3LEQ A;  3VFH A;  1MWR A;  3D9Y A;  4LV2 A;  1NXY A;  1N9N A;  5FL3 A;  5AVF A;  3DTM A;  2XFT A;  3UE1 A;  3IT9 A;  5HPF A;  3W4Q A;  3S7P A;  4AFI A;  3LCE A;  4NK3 A;  4ETZ A;  3A0S A;  2JKR I;  2O99 A;  5FQM A;  5TFQ A;  4EBL A;  3O88 A;  2K31 A;  3F1N B;  1WE4 A;  3VFF A;  3F1P A;  2WGV A;  2PAV P;  2Y2J A;  2OLV A;  3GTC A;  4DXB A;  5HD3 A;  1H8M A;  5FAQ A;  1H8Y A;  1BLS A;  4OQG A;  1ZKJ A;  1L0G A;  2RCX A;  1XA1 A;  2HDQ A;  2MJ6 A;  3PBT A;  4IED A;  3BFF A;  4KZ7 A;  3ITB A;  4P85 A;  3NC8 A;  2H5S A;  4E04 A;  4R70 A;  3H82 A;  2Y2I A;  4KUK A;  1RP5 A;  2Z6C A;  4F3L B;  5J4E A;  3HUN A;  4QHC A;  3UO9 A;  4JF4 A;  1I2S A;  3W4O A;  1CEG A;  1M6K A;  1UWN X;  1W7F A;  2HJ9 C;  4MNR A;  2NUT C;  3PBO A;  4KZ4 A;  3V3R A;  1I2W A;  5HDS A;  4IHQ A;  3HLB A;  3DWZ A;  4X68 A;  4PM5 A;  4PM7 A;  4S2M A;  4UQI M;  1VEU B;  5A92 A;  2FZ0 A;  4X1L A;  2Y4A A;  3VOL A;  4C3Q A;  4IVI A;  3LI9 A;  3GEC A;  1LSV A;  3CUE A;  4NET A;  3T12 B;  2JKT I;  1NYY A;  1P97 A;  4OON A;  4CLC E;  1BTL A;  4KG2 A;  5F69 A;  2WGW B;  4CLC D;  4DE3 A;  5EVI A;  2ZLY A;  5G4Y A;  3HLW A;  4EER A;  1PWC A;  4GOG A;  3ZYT A;  5FAT A;  4BLM A;  1K54 C;  5D3O A;  3OBF A;  2XA7 S;  4YWZ A;  2W1T B;  5HX9 A;  2Z2M B;  3MR0 A;  1XGI A;  2K2N A;  4DE0 A;  3ZG5 A;  1FSW A;  5A91 A;  4LEN A;  3ZG0 A;  3V67 A;  3CLO A;  2ZMF A;  4BD0 A;  3GQZ A;  1LSW A;  4L9E A;  2XRN A;  4WF0 A;  3RJU A;  4M4X A;  1L0D A;  5E43 A;  3AGF A;  3VP1 A;  1G6A A;  3M2J A;  3WS5 A;  5FI2 A;  3IH8 A;  4CLC C;  4X1M A;  2DNS A;  3OC2 A;  2R9X A;  4F94 A;  1KE4 A;  4EWF A;  1H0M A;  3EGX C;  5L10 A;  3V50 A;  4WM9 A;  4HH3 A;  5TGF A;  1N4O A;  2ACG A;  2CMN A;  3KSG A;  3PHY A;  2Q9N A;  3LEZ A;  3HL9 A;  5KIZ A;  1HD8 A;  1EI5 A;  3H7W A;  2PBY A;  3IX3 A;  1KE3 A;  3CMZ A;  1ZG6 A;  5CTM A;  3SH8 A;  3CJM A;  4G3V A;  1I5Q A;  2XDM A;  1ZTU A;  4HNB A;  2PYP A;  4EEU A;  4EQ1 A;  2EX9 A;  3ZNT A;  2WK0 A;  3IBR A;  3K3C A;  3SZT A;  3N8R A;  4WMC A;  4PAU A;  1C3B A;  2A24 A;  3R7W B;  4JGO A;  4CLC A;  3BLS A;  4UQI S;  2XLN A;  4HP9 A;  4OPZ A;  3HVF A;  3DBA A;  3O86 A;  3E4P A;  1Y54 A;  1KDS A;  3BYD A;  2H0T A;  1MY8 A;  2ZL1 B;  1CK3 A;  5DTT A;  2JN7 A;  2W3D A;  1SKF A;  1LL8 A;  1XA7 A;  1YLW A;  3PR6 A;  4K0W A;  4P6B A;  3M6H A;  1ERO A;  3IF6 C;  1ES2 A;  4BL2 A;  3BLM A;  1G6O A;  3W8K A;  1RGY A;  5IT5 A;  2Y2O A;  2G2W A;  2ZQC A;  5GLD A;  2BG1 A;  1RGZ A;  4RQ9 A;  3MQQ A;  3CAX A;  2ZQA A;  3FPV A;  3IXB A;  2HF6 A;  3W4P A;  4FCF A;  1OT6 A;  3NDE A;  4IBX A;  4YFM A;  4B4Z A;  2E8I A;  1MXO A;  4UAA A;  4ESP A;  4OQI A;  5HAQ A;  3IWI A;  1BLP A;  3MSH A;  4WL9 A;  1NWZ A;  4GCZ A;  3BFC A;  1T1C A;  1BT5 A;  1SKO B;  3UPO A;  2Y91 A;  1IEL A;  5E2E A;  3LIB A;  1RCJ A;  4XXR A;  2KOI A;  3ZHH A;  1TS6 A;  1HZO A;  5AQ9 A;  1PZP A;  5CGW A;  3IF6 A;  5FSR A;  3T4Q A;  4D2O A;  1XX2 A;  4BQM A;  4L9F A;  4DRT A;  2B02 A;  1K6R A;  1DP8 A;  4R0Q A;  4I3J A;  2VZW A;  3VOZ A;  4E3M A;  2HDU A;  4Y0O A;  2VJW A;  2OAP 1;  5F68 A;  3VV4 A;  3PBQ A;  5FI6 A;  2WAF A;  3MZD A;  3Q7V A;  2VGJ A;  2ZC6 B;  3PYP A;  1GSV A;  3MZE A;  2BLS A;  1VET B;  4DKI A;  4FTX A;  3NIA A;  2Y79 A;  4JF5 A;  4S2I A;  4KQD A;  2ZM2 A;  3BEC A;  4HOI A;  5HPI A;  3HLD A;  1L0E A;  3UE3 A;  1OTD A;  3F1O B;  5GHZ A;  1SDN A;  3BRM A;  1DP9 A;  1QMF A;  5EVE A;  4MBF A;  3VMA A;  3UME A;  2ZQ7 A;  3SOI A;  4KZ9 A;  2PD8 A; 
#chains in the Genus database with same CATH homology
 1YLJ A;  4RA7 A;  3ZG7 B;  3VFH A;  1MWR A;  1HVB A;  5FA7 A;  4S2N C;  4DDY A;  4DE1 A;  4LV2 A;  1NXY A;  4A5R A;  1MKI A;  1PZO A;  5J8X A;  2A3U A;  4LV0 A;  1IYP A;  5AQA A;  3PAG A;  3DTM A;  3ZDJ A;  4RX2 A;  1IYO A;  3PBN A;  1AXB A;  2XFT A;  5CGS A;  1TDG A;  2HPB A;  1BSG A;  1J9M A;  3UE1 A;  3IT9 A;  5FQ9 A;  3VP2 A;  4JF6 A;  4ZJ3 A;  2WAD A;  3W4Q A;  1PW1 A;  4Y7P A;  4XUZ A;  2WZZ A;  2P9V A;  1MPL A;  3ZG8 B;  2V20 A;  3LCE A;  4NK3 A;  1YT4 A;  2OV5 A;  1FQG A;  1YMX A;  5FQM A;  3TSG A;  1KVM A;  5TFQ A;  4EBL A;  4OOM A;  5KMW A;  2FFY A;  2WAE A;  2HDS A;  4KZ6 A;  1IYQ A;  2FFF B;  3O88 A;  3C7V A;  1E25 A;  1E4D A;  1WE4 A;  3TG9 A;  4X55 A;  5EVI B;  3VFF A;  2JE5 A;  3S22 A;  1H8Z A;  3AGD A;  2WGV A;  1KE0 A;  4KZA A;  3WS0 A;  2ZC7 A;  2ZMA A;  2Y2J A;  1H5X A;  2HDR A;  1K6S A;  2WZX A;  3G2Y A;  5FQK A;  2OLV A;  3GTC A;  5KSH A;  4DXB A;  1K4F A;  2I72 A;  5FAQ A;  1H8Y A;  1BLS A;  2EXA A;  4OQG A;  3OZH A;  1ZKJ A;  1L0G A;  1FCO A;  1ESI A;  1KGE A;  1K55 C;  3WS1 A;  4E3J A;  2R9W A;  2RCX A;  1ERQ A;  1XA1 A;  3PBR A;  2HDQ A;  3PBT A;  3AGE A;  1CEF A;  4GB7 A;  4JXS A;  4ID4 A;  4IED A;  2PU2 A;  3BFF A;  4KZ7 A;  3ITB A;  5I94 A;  4P85 A;  4E3I A;  3NC8 A;  4OVD A;  2H5S A;  3V39 A;  4KZ8 A;  3HUO A;  2EFX A;  4P87 A;  3GR2 A;  5GL9 A;  1ES3 A;  4WZ4 A;  2ZC5 B;  2Y2I A;  3OPL A;  4M3K A;  1U60 A;  4S2L A;  4XUX A;  5FQJ A;  1RP5 A;  2WKE A;  4R3B A;  3ZGA B;  3BEB A;  5M19 A;  3HUN A;  4S2N A;  4PM8 A;  4QHC A;  3UO9 A;  4JF4 A;  4DDS A;  1Q2P A;  1Z6F A;  5E2G A;  1CI9 A;  1I2S A;  3UN7 A;  3W4O A;  1IEM A;  3VSL A;  4X53 A;  4ZBE A;  1CEG A;  1M6K A;  4WEK A;  3VP4 A;  1EWZ A;  1W7F A;  1PIO A;  3C7U A;  4CJN A;  4MNR A;  5M1A A;  1BLC A;  5JYO A;  5IHV A;  3PBO A;  4MBK A;  5DF9 A;  5BOH A;  4KZ4 A;  3V3R A;  3NY4 A;  1I2W A;  2WGW A;  2XK1 A;  4BD1 A;  3WS4 A;  4HEF A;  2J9P A;  2XD5 A;  5FDH A;  3WRT A;  3A3F A;  4UHU A;  3A3I A;  4B4X A;  5A93 A;  3ZG9 B;  4E3K A;  1E3U D;  3HLB A;  3DWZ A;  4X68 A;  4ZTK A;  2JCH A;  4KQO A;  3VOY A;  1K38 A;  4PM5 A;  4PM7 A;  1FR1 A;  4S2M A;  1ESU A;  3SH9 A;  5A92 A;  1BZA A;  1PW8 A;  1L0F A;  2Y4A A;  3IHA A;  1MBL A;  1GA0 A;  1ZG4 A;  4C3Q A;  3G31 A;  4IVI A;  4OPY A;  2HP6 A;  4EV4 A;  4OLD A;  2EX8 A;  2J8Y A;  4GN2 A;  3NDG A;  4JXW A;  1O7E A;  4NET A;  4P0M A;  3IWO A;  3TOI A;  3SS3 A;  1NYY A;  1PYY A;  2ZQ8 A;  1S6R A;  1K55 A;  4EUZ A;  4OON A;  3ZFZ A;  4MBH A;  3LO7 A;  3UDX A;  1BTL A;  4KQR A;  5FAS A;  1Q2Q A;  4KG2 A;  1FCM A;  5AQB A;  2WUQ A;  3SS5 A;  2B5R A;  2IWC A;  2WGW B;  4N9K A;  4DE3 A;  4N1H A;  3IXG A;  1S0W A;  5EVI A;  3EQU A;  3V3S A;  2ZLY A;  4WEJ A;  3G32 A;  3HLW A;  2WGI A;  2OLU A;  1SDE A;  1MWU A;  1PWC A;  4GOG A;  3UDF A;  1DY6 A;  3BM6 A;  3IXH A;  4IVK A;  3S4X A;  5FAT A;  3SH7 A;  2Y2G A;  4BL3 A;  4BLM A;  4OP8 A;  1K54 C;  5D3O A;  1FSY A;  1LI0 A;  2Y59 A;  2XF3 A;  3MXR A;  4JBF A;  1W79 A;  3LY4 A;  4B88 A;  3GV9 A;  4S2J A;  2IWB A;  5G18 A;  4U0T A;  1WYC A;  5HX9 A;  2Z2M B;  1BUL A;  5CHU A;  4ZJ2 A;  1XGI A;  4DE0 A;  1DJB A;  2Y2N A;  3G30 A;  5HAP A;  1KGG A;  3ZG5 A;  4Q8I A;  1FSW A;  1K57 C;  3HLG A;  5A91 A;  3N8S A;  4LEN A;  5DTS A;  1WYB A;  3ZG0 A;  2J7V A;  3HLE A;  1YM1 A;  4GDB A;  2A49 A;  4BD0 A;  1JWV A;  3GQZ A;  3PBS A;  3BFD A;  2EX2 A;  3FKV A;  3CZD A;  5E2H A;  4LV3 A;  3HUM A;  4ZAM A;  3UE0 A;  1XP4 A;  3RJU A;  3O87 A;  3LY3 A;  1L0D A;  3ZVW A;  5E43 A;  1OME A;  3AGF A;  4U3T A;  3OPH A;  3VP1 A;  4UA7 A;  3GRJ A;  1G6A A;  4U0X A;  3IF5 A;  3M2J A;  3WS5 A;  3UPN A;  5HAR A;  5FI2 A;  3P98 A;  1NZO A;  4Y0T A;  4MLL A;  3IH8 A;  5E2F A;  3VP3 A;  4GKU A;  5KZH A;  4KZB A;  5DF7 A;  1K25 A;  4HBU A;  2H0Y A;  2DNS A;  3OC2 A;  2WKH A;  2HP5 A;  3RXW A;  5CED A;  1ONH A;  1YMS A;  2R9X A;  3MXS A;  1K56 D;  2X02 A;  3ZNY A;  4F94 A;  4R3J A;  1KE4 A;  4E3O A;  4EWF A;  2PU4 A;  2ZQ9 A;  4R23 A;  3V50 A;  4O7D A;  4WM9 A;  4K0X A;  5CER A;  2V2F F;  2ZD8 A;  3DWK A;  3WWX A;  4R4S A;  1M40 A;  5TGF A;  4EQI A;  2OSU A;  1VM1 A;  1N4O A;  1ONG A;  2EFU A;  3C5A A;  3RXX A;  1JTD A;  4PMA A;  2IWD A;  1W5D A;  4KZ9 A;  5EOO A;  3V5M A;  2Q9N A;  3LEZ A;  3G35 A;  3HL9 A;  5FI7 A;  3C4O A;  3IHB A;  4BEN A;  1N9B A;  1PI5 A;  5CTN A;  1ERM A;  1G68 A;  1HD8 A;  1EI5 A;  2Q9M A;  3GMW A;  5HFO A;  5FAO A;  4WYY A;  2PBY A;  5DTK A;  2XEP A;  4JKT A;  5JYP A;  5EE8 A;  1KE3 A;  3MKE A;  4HES A;  1KVL A;  3HBR A;  2JBF A;  4N92 A;  3CMZ A;  5EOE A;  3UPP A;  4L0L A;  3WS2 A;  1ZG6 A;  3QHY A;  1E3U A;  4S2P A;  5CTM A;  3CJM A;  3SH8 A;  3UY6 A;  1SHV A;  1I5Q A;  1K57 A;  1MWT A;  3P09 A;  4EBP A;  1XKZ A;  2XDM A;  4FH2 A;  3B3X A;  4DE2 A;  5F1F A;  1VQQ A;  4GZB A;  5EEC A;  1PI4 A;  5HL1 A;  4ZDX A;  1YLZ A;  2EX9 A;  4JXG A;  1IYS A;  3ZNT A;  3MFD A;  5HW3 A;  1YLT A;  2WK0 A;  5EUA A;  3N8L A;  4OPR A;  4GD8 A;  1BLH A;  2QZ6 A;  4UA9 A;  3N8R A;  4WMC A;  5GHX A;  3FZC A;  5DVA A;  5F1G A;  1FCN A;  1C3B A;  4OOY A;  4JLF A;  4WZ5 C;  1LHY A;  3M2K A;  4RX3 A;  3FV7 A;  1GHI A;  5CEB A;  5TR7 A;  3BLS A;  3A3D A;  2XLN A;  3S1Y A;  4OPZ A;  3HVF A;  5AQ7 A;  3G2Z A;  1PWG A;  3I7J A;  3M6B A;  5CHM A;  3O86 A;  1NRF A;  5F82 A;  4RYE A;  2Z2L B;  1Y54 A;  1KDS A;  4PM9 A;  3OPP A;  2Y2Q A;  5M18 A;  3FKW A;  3E2L A;  1CI8 A;  3MZF A;  1W8Y A;  3OCN A;  3NCK A;  3BFG A;  3BYD A;  5DF8 A;  1LL9 A;  2H0T A;  3ITA A;  4LV1 A;  3FWL A;  1MY8 A;  3ISG A;  2C5W B;  1DJA A;  4KEN B;  3WRZ A;  1JVJ A;  1ES5 A;  4GNU A;  4OLG A;  1CK3 A;  4PM6 A;  3IWQ A;  5DTT A;  4C6Y A;  3ZCZ A;  4S2K A;  1XGJ A;  4C75 A;  5CGX A;  1SKF A;  1FR6 A;  1GHM A;  4QY6 A;  4R1G A;  4MEZ A;  1XA7 A;  1GCE A;  1YLW A;  3Q7V B;  4K0W A;  3DW0 A;  4P6B A;  3M6H A;  1QME A;  2DRW A;  4OP5 A;  1ERO A;  4FH4 A;  2EX6 A;  2ZQD A;  3IF6 C;  4X6T A;  1ES2 A;  4YIN A;  4BL2 A;  3JYI A;  1XXM A;  1TDL A;  3IXD A;  2CC1 A;  4FSF A;  5EVI D;  1LI9 A;  3BLM A;  3W8K A;  1RGY A;  1ALQ A;  2VGK A;  1JWZ A;  1ES4 A;  1JWP A;  3OCL A;  2Y2O A;  5A90 A;  2G2W A;  2ZQC A;  5GLD A;  1ZC2 A;  4OPQ A;  2BG1 A;  5U47 A;  4UA6 A;  1RGZ A;  4QB8 A;  1GA9 A;  1JTG A;  3Q7Z A;  2ZM0 A;  4OOL A;  2ZQA A;  3EQV A;  3VSK A;  3BFE A;  4E6X A;  5GHY A;  3UDI A;  4QY5 A;  4X56 A;  2UWX A;  2XR0 A;  4WBG A;  1BUE A;  4N1X A;  4E3N A;  3GVB A;  2V1Z A;  3IXB A;  2HP9 A;  2ZC4 B;  1K56 A;  3IQA A;  2ZC3 B;  3W4P A;  3HLF A;  4FCF A;  4OH0 A;  4WZ5 A;  3NDE A;  1KGF A;  2EXB A;  4IBX A;  4YFM A;  1TEM A;  5FQQ A;  3HLC A;  4JPM A;  4B4Z A;  2E8I A;  1MXO A;  4HBT A;  2C6W B;  4OQI A;  1IKG A;  3IWI A;  4UAA A;  5HAQ A;  3N6I A;  3G34 A;  1NY0 A;  3IH9 A;  1BLP A;  4QU3 A;  3O3V A;  3BFC A;  5CRF A;  1L2S A;  4BJP A;  4LCM A;  1BT5 A;  3N7W A;  3UPO A;  2Y91 A;  4KZ3 A;  3QNC A;  5EPH A;  1W8Q A;  4OKP A;  1IEL A;  1SCW A;  3D4F A;  3MKF A;  3N4I A;  4QD4 A;  4X69 A;  5GLB A;  2XQZ A;  2XFS A;  1K54 A;  1O07 A;  1RCJ A;  4Y0U A;  1IKI A;  3PTE A;  4XXR A;  5E2E A;  2P9V B;  5FAP A;  5F83 A;  3ZHH A;  4JXV A;  4E6W A;  5CHJ A;  5L2F A;  4IBR A;  1HZO A;  3GSG A;  5AQ9 A;  5EVI C;  3MBZ A;  3A3E A;  2H10 A;  2XD1 A;  2G2U A;  1PZP A;  5CGW A;  1YQS A;  3IF6 A;  2QPN A;  1NYM A;  5FSR A;  2Y2L A;  2DCF A;  2ZJ9 A;  3HRE A;  4D2O A;  3C4P A;  4LCL A;  5HAI A;  4GDN A;  3NI9 A;  3Q82 A;  4N9L A;  2J9O A;  1LL5 A;  5CEC A;  4BQM A;  2XGN A;  4DRT A;  1K6R A;  3E2K A;  2WKI A;  3FYZ A;  2X71 A;  3ZVT A;  3Q07 A;  4R0Q A;  3Q81 A;  1FOF A;  4OQ0 A;  5EVL A;  2RL3 A;  2Y2P A;  3VOZ A;  3OPR A;  4CPK A;  4WEL A;  4E3M A;  3A3J A;  2HDU A;  4Y0O A;  2Y2M A;  3PAE A;  4FD8 A;  3CG5 A;  3PBQ A;  5KSC A;  4GD6 A;  1TVF A;  5FI6 A;  2WAF A;  1GHP A;  2Y2H A;  3MZD A;  3Q7V A;  2VGJ A;  4KQQ A;  2ZC6 B;  4S2O A;  4Z9Q A;  4ZJ1 A;  1MWS A;  2X01 A;  3MZE A;  1HTZ A;  2BLS A;  5CXW A;  3SS4 A;  4E3L A;  2GDN A;  2QMI A;  5GLA A;  3VP0 A;  3QNB A;  1DJC A;  1NJ4 A;  4DKI A;  4R4R A;  3IF6 B;  1YLY A;  3NIA A;  3G4P A;  1K4E A;  4JF5 A;  4OQH A;  2P74 A;  4S2I A;  2ZM2 A;  3BEC A;  4EBN A;  1PWD A;  3HLD A;  1YLP A;  4K91 A;  1L0E A;  3UE3 A;  4DXC A;  2Y2K A;  2ZM8 A;  5GHZ A;  4H8R A;  5FQI A;  2JC7 A;  4DF6 A;  4KG5 A;  4PPR A;  1SDN A;  3BRM A;  1QMF A;  3UNW A;  1LLB A;  4WMC D;  2WYX A;  3Q1F A;  1NZU A;  4KG6 A;  4MBF A;  3VMA A;  5GLC A;  4RVA A;  2Y55 A;  2ZQ7 A;  2XH9 A;  1XPB A;  4KZ5 A;  1KDW A;  3SOI A;  3NBL A;  4QJG A;  1XX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...