5FQKA

W229d and f290w mutant of the last common ancestor of gram-negative bacteria (gnca4) beta-lactamase class a bound to 5(6)-nitrobenzotriazole (ts-analog)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
263
structure length
263
Chain Sequence
AALSEQLAELEKRSGGRLGVAVLDTATGRRFGYRGDERFPMCSTFKALLAAAVLARVDQGKENLDRRITYGKEDLVDYSPVTEKHVGDGMTVAELCEAAITYSDNTAANLLLEALGGPAALTAFLRSIGDNVTRLDRWEPELNTAAPGDPRDTTTPAAMAATLRTLLLGDVLSPASRQQLVDWLIANKTGDKRLRAGLPADDRVGDKTGTGEHGTTNDIAVIWPPNRAPILVAVYLTESQVDADARDAVIAEVARLVVAAWHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GNCA4 LACTAMASE W229D AND F290W
publication title De novo active sites for resurrected Precambrian enzymes.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Hydrolase
total genus 99
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5fqkA00
2Q9NA 3ZDJA 2J7VA 1PZOA 2XH9A 5DVAA 2ZC3B 4WEKA 3NI9A 3WS1A 3ZNTA 4CJNA 4JPMA 5HAQA 4JXVA 3LY4A 4IBXA 2ZQ9A 5G18A 5CHUA 2PU2A 4K0XA 1XA7A 1KDSA 2ZM2A 4P0MA 4N9LA 5FA7A 4OQIA 4E3MA 2EXBA 4OP5A 3BECA 4KZ3A 2HDRA 1K57A 2WYXA 5M19A 3UPPA 1IYOA 5IHVA 4OH0A 4KQOA 4OPRA 2JC7A 5EOEA 3ZNYA 3IXHA 2WGWA 2Y2JA 3HLCA 3MXSA 4E3IA 4LV1A 5GHYA 1WYBA 1KE3A 4KG5A 4DRTA 1IYQA 5KMWA 3W4OA 4Y0OA 1M6KA 1FSYA 1VQQA 3IH8A 3UE3A 5FQIA 2E8IA 5CGWA 3A3FA 3LY3A 1RCJA 2XR0A 3MBZA 2P74A 1EWZA 1W8QA 1SDNA 3EQUA 5FAPA 3SH8A 4DDYA 3Q1FA 4CPKA 4C75A 4DF6A 3BRMA 1XGIA 3VSLA 5HL1A 1KDWA 1YLJA 1FR6A 4M3KA 4FSFA 3PBSA 2ZM0A 5AQ7A 2Y59A 1HVBA 1IKGA 3Q7ZA 1PYYA 3DWKA 1ESIA 5CRFA 3OPHA 4NK3A 2HDQA 3GQZA 1N9BA 3NY4A 4IBRA 1RP5A 1JTDA 1DJCA 2EX9A 4WMCD 3OPRA 4R4SA 5CERA 3E2LA 4Y0TA 5CGXA 3G30A 1BLSA 4RX3A 3WWXA 2Y2IA 3HVFA 4MLLA 4P87A 4PM6A 3ZG9B 1PW8A 4OLGA 2PBYA 4EUZA 2Y2OA 4PM5A 1MY8A 3HBRA 4UHUA 4XUXA 1JWPA 2Z2LB 4XXRA 3W4PA 2WZXA 3IHBA 3IWIA 2CC1A 4KZ6A 2DNSA 2XGNA 4PM7A 5DF7A 4ZJ2A 2Y2QA 4ID4A 3FZCA 5HAPA 3M2KA 2C5WB 3FWLA 3HUOA 1C3BA 4QU3A 4P6BA 3PBNA 1BUEA 4L0LA 3BFFA 4S2PA 4QY5A 1FCNA 3OCLA 3UN7A 4B88A 4BENA 3BFDA 2WKHA 5EECA 4DE3A 4KZ8A 5E2EA 4F94A 4JXSA 5GLAA 2UWXA 4DXBA 3VP3A 4N9KA 4JF4A 4OP8A 5DTTA 4RVAA 4Q8IA 1VM1A 2OLVA 2ZM8A 2WGIA 5M18A 4S2KA 5GL9A 1GHMA 3Q82A 2EFXA 2WGVA 5CXWA 4DDSA 2HPBA 1K56A 3NBLA 2G2WA 3IXDA 1CEFA 4UAAA 4BD1A 2ZMAA 5HFOA 3UPOA 3N8LA 1O07A 3AGDA 3FYZA 4X68A 3OZHA 4X6TA 3AGEA 1FCMA 3P09A 3ZVWA 2C6WB 2VGKA 2V2FF 4XUZA 2XFTA 3VOZA 5CTNA 5A93A 2ZC5B 4MBKA 5CEBA 5EVIA 3HL9A 3HLBA 4E3KA 1FOFA 5EVLA 4MNRA 1IKIA 1HD8A 3GVBA 3IQAA 4FD8A 3C4OA 2A49A 2XEPA 1ONHA 3SS5A 4BQMA 2H10A 2J9OA 2ZC7A 3G2YA 1Q2QA 2ZQ7A 4QD4A 2Y2GA 4QY6A 1I2WA 2XLNA 5EOOA 2QMIA 1YLWA 1MPLA 2WAFA 2Y2NA 5A91A 2P9VB 1YT4A 4R4RA 2XFSA 3C5AA 3BFGA 2QPNA 3A3EA 4RX2A 3ZVTA 5AQ9A 1HZOA 5FI7A 1XPBA 1ESUA 3V5MA 4JF5A 3PBOA 1W5DA 1DJBA 1PWCA 4U0XA 1K54A 1NJ4A 1H5XA 3SS4A 4X53A 1SDEA 2WKIA 5AQAA 3OPPA 1SKFA 3JYIA 4K0WA 3VMAA 4WBGA 5DF9A 4QHCA 5FAQA 5HX9A 2ZQ8A 3ISGA 2JE5A 2ZQDA 1RGZA 3PBQA 5CHMA 2Y2KA 5FASA 4KENB 2HDSA 3MXRA 4OOYA 2EXAA 2R9WA 4JKTA 1K4FA 4YFMA 3SH7A 3IXBA 1YLPA 2QZ6A 1ZG6A 1JWVA 3NDGA 4MEZA 4HBUA 3N7WA 1L0DA 1YM1A 2WAEA 3IT9A 5TGFA 3GMWA 4LCMA 4YINA 3TG9A 4ZAMA 3A3JA 1KE4A 1K4EA 1YMXA 4MBHA 2EX2A 3V3SA 5EVIC 4UA6A 1EROA 5CECA 1PZPA 1HTZA 2G2UA 3UDFA 4KQQA 1KGFA 1J9MA 1H8YA 3PTEA 2P9VA 1Q2PA 4KZ5A 4EV4A 4LV2A 3NIAA 1TDGA 4HBTA 4X55A 2BG1A 3A3IA 3ZG7B 4DXCA 3O86A 5JYPA 3GV9A 1JWZA 1ALQA 2ZC4B 3IF5A 4IVKA 1LHYA 4BL3A 3MZEA 3VOYA 2WK0A 2ZQAA 2OSUA 4OKPA 1JTGA 2Y4AA 3W8KA 1MBLA 1NYYA 3IXGA 2WZZA 1G68A 3VP2A 3RXXA 3LEZA 3UY6A 4DKIA 4E3LA 4EQIA 3S22A 1OMEA 1K54C 4E6WA 2GDNA 3G34A 2J9PA 4BD0A 1S0WA 4EBLA 3IHAA 3ITBA 2XQZA 1K25A 3PBTA 2JCHA 5GLCA 4S2NA 1ES4A 1KVMA 3LO7A 3QNBA 1K57C 3P98A 1MXOA 4DE1A 4RA7A 4GKUA 3ZFZA 2WKEA 1K56D 1FQGA 4HESA 2WADA 2HP6A 1RGYA 3M6HA 4R3JA 5EVIB 5FQ9A 4KQRA 4OONA 4OQGA 3CZDA 3M6BA 3DWZA 5FI2A 5GHXA 2XK1A 5FQKA 3G2ZA 3OPLA 3E2KA 1E3UA 2IWCA 3BLMA 5M1AA 2IWDA 3QHYA 5EPHA 5E43A 4OOMA 5A90A 5EVID 3VSKA 4OQ0A 3UE1A 1K55A 3GSGA 4S2LA 3O88A 3BYDA 3UDXA 2DCFA 3S4XA 1YLYA 4S2MA 4GZBA 4DE2A 1ONGA 4P85A 3MZDA 5D3OA 3BFEA 1KE0A 4GD6A 3HLGA 4A5RA 3HREA 1TVFA 2ZLYA 3GRJA 3BFCA 1IEMA 5AQBA 3VP0A 4DE0A 3AGFA 3TOIA 4KZAA 5L2FA 1PIOA 4EBNA 1KGGA 2ZJ9A 1YLZA 4EWFA 1XGJA 3G31A 3G32A 1SCWA 1NY0A 3ZGAB 4ZTKA 5FQQA 4S2NC 3CG5A 3HLEA 1PWGA 1K38A 3DTMA 5J8XA 1XXMA 4PM8A 5TR7A 5BOHA 1E25A 2PU4A 5E2GA 4C6YA 3UPNA 4GB7A 4KZ9A 5KZHA 4UA9A 3TSGA 5CTMA 2H0YA 3MZFA 4LCLA 3N6IA 1LL5A 3OCNA 4R3BA 2IWBA 1CI8A 2WUQA 5HARA 4N1HA 3NDEA 4BJPA 4IEDA 2XF3A 4X56A 2ZD8A 4QJGA 5DTKA 3Q7VA 1MWRA 3BEBA 4E3JA 1GHPA 4KG6A 3UNWA 4OPQA 3EQVA 4JXGA 2ZQCA 4LENA 3V50A 4KZBA 1K55C 2RL3A 1XP4A 1BLPA 2BLSA 3OC2A 3O87A 3ZG0A 1MKIA 3M2JA 1W7FA 1FR1A 5U47A 3G35A 5HW3A 3ITAA 4OVDA 1IYSA 3SOIA 4E3OA 1Y54A 1AXBA 1E4DA 1PW1A 4GOGA 4O7DA 1KGEA 3IF6B 2EFUA 4E3NA 1FSWA 3V39A 4FCFA 1M40A 1YQSA 2V1ZA 2HP5A 5FAOA 5EE8A 3RJUA 1BLHA 1EI5A 5DTSA 3W4QA 4D2OA 3UE0A 1L0FA 2Y2LA 5KSHA 1N4OA 1NZUA 4KZ4A 3LCEA 4EBPA 4WYYA 1PI4A 5F1GA 5F82A 3S1YA 1BSGA 5CGSA 5FDHA 5DF8A 4ZBEA 5TFQA 1QMFA 2I72A 2V20A 4WEJA 1ES3A 3PAGA 2XD5A 2H5SA 4FH4A 2A3UA 1W8YA 1MWUA 3SH9A 4B4XA 4KZ7A 2HP9A 2XD1A 3CMZA 3WS0A 3IWOA 3ZG5A 1IYPA 3WRTA 1E3UD 4S2JA 4GDBA 3C7UA 3UO9A 2Q9MA 4QB8A 3VFHA 3HLWA 3NC8A 2OLUA 1NRFA 1NXYA 3WS2A 3MFDA 3G4PA 4OQHA 4R1GA 4B4ZA 4S2OA 1BTLA 3IF6A 3Q81A 4RYEA 3N4IA 2Y2HA 5FSRA 4WZ5A 2Y55A 5E2HA 2H0TA 1GCEA 5GLDA 1QMEA 1BZAA 1I5QA 4OLDA 4WELA 3N8SA 1GHIA 5A92A 5F1FA 1KVLA 3WS5A 1I2SA 1WE4A 5EUAA 3HUNA 1ERMA 2OV5A 4GDNA 1MWTA 2XDMA 5FI6A 4JLFA 3UDIA 3VFFA 5JYOA 5FQMA 3C7VA 3C4PA 1K6RA 2Y91A 1ERQA 4E6XA 3FKVA 3WRZA 1YLTA 4U0TA 1NYMA 4U3TA 1GA0A 4S2IA 1H8ZA 1ZC2A 1LLBA 4JF6A 4JBFA 3I7JA 3IWQA 3SS3A 3A3DA 3Q7VB 4OPYA 1CI9A 2EX6A 4JXWA 4K91A 4X69A 4ZJ1A 4UA7A 4PPRA 1ZG4A 2B5RA 3V3RA 4ZDXA 4H8RA 5F83A 2X02A 3B3XA 1XA1A 4IVIA 2EX8A 1ES5A 5E2FA 4R23A 4Y7PA 4HEFA 3QNCA 4R0QA 2VGJA 3FV7A 4Z9QA 4GNUA 1LI0A 3HUMA 1WYCA 1G6AA 3PBRA 4ZJ3A 1CEGA 4N1XA 5KSCA 2X01A 3MKFA 3Q07A 4WMCA 1JVJA 2JBFA 3RXWA 2ZC6B 4N92A 4LV3A 4WZ4A 2X71A 1XKZA 3BM6A 1NZOA 1ZKJA 1TDLA 2Y2PA 3IF6C 4MBFA 2Z2MB 4NETA 5FATA 1ES2A 3ZG8B 4WZ5C 2Y2MA 3N8RA 1BULA 1BT5A 4GD8A 2HDUA 4LV0A 3VP4A 3PAEA 1BLCA 5CEDA 3D4FA 1MWSA 1DY6A 1W79A 1GA9A 5FQJA 4KG2A 5CHJA 4BLMA 1U60A 4GN2A 4PMAA 1TEMA 1XX2A 3VP1A 5I94A 2DRWA 3DW0A 2R9XA 3FKWA 1L0GA 3ZHHA 1FCOA 3GTCA 3IH9A 1DJAA 1O7EA 1PI5A 3MKEA 4WM9A 3NCKA 5HAIA 3CJMA 2WGWB 3ZCZA 3BLSA 3O3VA 5GHZA 1LI9A 2FFFB 1SHVA 1L0EA 2FFYA 4FH2A 4Y0UA 4OOLA 3GR2A 2J8YA 2RCXA 3HLDA 1IELA 1K6SA 4C3QA 5GLBA 1Z6FA 1S6RA 1PWDA 1L2SA 1CK3A 4OPZA 4BL2A 1LL9A 3HLFA 3WS4A 1YMSA 4PM9A
chains in the Genus database with same CATH superfamily
2Q9NA 3ZDJA 1PZOA 2V1AA 2ZC3B 4CJNA 3WS1A 3ZNTA 4MCWA 1P9RA 3LEQA 3NECA 1YSQA 4JXVA 2D02A 2PU2A 4K0XA 3CITA 5DFXA 1XA7A 2ZM2A 3A0VA 4E3MA 2EWVA 4OP5A 4MN7A 3BECA 2WYXA 3NJAA 4OPRA 5EOEA 4HJ6A 4DRTA 3UE3A 4LFUA 3A3FA 3LY3A 4B93A 1EWZA 5FAPA 5L10A 4HQAA 1KDWA 1FR6A 4M3KA 4ETZA 4I3IA 5AQ7A 2Y59A 3DWKA 3GQZA 1N9BA 1RP5A 3NOTC 2VGLS 5CERA 2W3GA 5CGXA 1BLSA 3WWXA 4MLLA 3S7QA 4JGPA 4EUZA 2Y2OA 5DJTA 1MY8A 2K31A 4XUXA 3W4PA 2WZXA 2CMNA 3IWIA 4KZ6A 2DNSA 4PM7A 4BWIA 4ID4A 2W27A 3FWLA 1C3BA 3HUOA 2D01A 4QY5A 5EECA 3L7HA 3VP3A 1H3QA 5TJJA 2VEAA 2WGIA 5CXWA 3N8LA 3FYZA 2JKGA 3P01A 3VOZA 1S1YA 4MBKA 5L07A 5CEBA 3EWKA 4E3KA 1HD8A 3C4OA 2A49A 3SS5A 4QY6A 4QD4A 1YLWA 3C5AA 3BFGA 2QPNA 4RX2A 3UMDA 3ZVTA 5FI7A 1ESUA 4LPZA 2IA2A 4JF5A 3K3DA 3T4JA 1K54A 1NJ4A 3PHYA 2VGLM 3BWLA 4WBGA 3ISGA 2VJWA 1RGZA 2Y2KA 5FASA 1EW0A 1N9LA 1K4FA 3LIBA 3ZQ5A 4IJGA 1UGUA 1F98A 3VOLA 3A3JA 1UWNX 1KE4A 1YMXA 4UA6A 3P7NA 1HTZA 4AFIA 1Q2PA 3BJNA 4X55A 5DKLA 5JYPA 3MZEA 2OSUA 2ZOHA 3MQ0A 1G68A 3VP2A 3LFVA 4DJ2A 4EBLA 2JKTI 2HGVA 3ITBA 2JCHA 5GLCA 2FH5A 3LO7A 2W3EA 3P98A 1MXOA 1YSPA 3ZFZA 2HP6A 2WADA 4XT2A 3M6BA 4Y15A 4NG2A 3IS2B 2PRFA 3BLMA 5E43A 5HZHA 1NWZA 1K55A 1Z09A 3O88A 3BYDA 3VV4A 3UDXA 3S4XA 1T1BA 2ACGA 2V9AA 4S2MA 2WKRA 3IX4A 3QP8A 4DE2A 1ONGA 5D3OA 4CLCB 1KE0A 4GD6A 3HLGA 2ZLYA 4PHTA 3QP6A 3AGFA 4KZAA 3K3CA 3NOUC 4PKYG 3T12B 5MC7A 1NY0A 1DP8A 3HLEA 1PWGA 5BOHA 2KLIA 4KZ9A 4UA9A 3TSGA 3FC7A 3MZFA 2A24B 4LCLA 3NHQA 1XJ2A 4NXBA 2ZD8A 4QJGA 3Q7VA 4UQIS 4JGRA 4LRYC 2LB5A 2RL3A 1BLPA 2L1MA 3NULA 1W7FA 3ITAA 4GOGA 3V39A 1M40A 2PBDP 4ARZA 1EI5A 5DTSA 2W3DA 3W4QA 4D2OA 3RFBA 3LCEA 1YKDA 1PI4A 2ZMFA 4YOFA 3CLOA 3S7OA 5DF8A 4ZBEA 4HY8A 3MF0A 2ZL1A 3F1PB 4B4XA 4KZ7A 5HD3A 2KDKA 3WRTA 1E3UD 3C7UA 1F2KA 3HLWA 3NC8A 1BTLA 3Q81A 2W1TB 4GLQA 3OBFA 3F1NA 2Y55A 4Y2FA 3VE4A 5E2HA 5GLDA 1I5QA 4OLDA 5F1FA 1KVLA 4DMZA 3WS5A 1WE4A 1ERMA 3UDIA 1MWTA 2XDMA 3QP2A 5FQMA 4JGOA 4UQIM 1LSVA 1NYMA 4EXOA 2QKPA 1ZC2A 2VKSA 3T4TA 1CI9A 4ZJ1A 5HPFA 3R7WA 1ZG4A 4ZDXA 5E2FA 2EX8A 3CPTA 4HEFA 4R0QA 3FV7A 2VV7A 3HUMA 3PBRA 1MC0A 4N1XA 5KSCA 2X01A 3Q07A 1JVJA 4N92A 4R6LA 1XKZA 1TDLA 3ZG8B 2O9CA 4WL9A 3N8RA 2OAQ1 3VP4A 5CEDA 3LUQA 1GA9A 4BLMA 4KG2A 5CHJA 4GN2A 4PMAA 1TEMA 4Q0IA 1W63M 5I94A 5IU1A 3GTCA 1ACFA 3LI9A 1O7EA 3NCKA 3TW8A 5HAIA 3ZCZA 3LR5A 3O3VA 3KYQA 1SHVA 1L0EA 4FH2A 4OOLA 3GR2A 5AJGA 2J8YA 2RCXA 3UB6A 4CQHA 5HDSA 3WS4A 4X1LA 2J7VA 4JPMA 1OTIA 1PFLA 2ZQ9A 4IBXA 5G18A 5CHUA 2M7VA 4P0MA 5FA7A 1J3WA 2HDRA 1K57A 5M19A 3UPPA 1IYOA 4GS9B 4Q0HA 3ZNYA 3MXSA 4E3IA 4LV1A 5GHYA 1IYQA 3CAXA 5KMWA 1M6KA 4QWOA 1VQQA 3PYPA 5FQIA 5EM0A 3H82A 3LYXA 1RCJA 5G4ZA 3T4KA 1VETA 2V8FA 1W8QA 4DF6A 5TBMB 1XGIA 1YLJA 3G6OA 2ZM0A 1HVBA 1IKGA 1ODVA 5CRFA 4NK3A 4IBRA 1JTDA 3E2LA 5AVFA 4RX3A 3HVFA 4P87A 4PM6A 1PW8A 1SKOB 2PBYA 1NLYA 4OLGA 4PM5A 5HDDA 4UHUA 3E98A 3IHBA 4H6JB 3B33A 2Y2QA 1OJGA 2W1RA 3E4QA 3FZCA 4P6BA 3PBNA 3BFFA 4Z1WA 4BENA 1FIKA 4R3AA 3QP1A 2UWXA 3NOPC 4GCZA 3LR3A 4D60A 3MR0A 2ZM8A 5M18A 5GL9A 2WGVA 4DDSA 3LR0A 3NBLA 3DTIA 3IXDA 1CEFA 4UAAA 1IOUA 1TD5A 3OZHA 4X6TA 3QP5A 1VB6A 2C6WB 2AVXA 4XUZA 3MQQA 2PAVP 5A93A 1LL8A 1FOFA 1IKIA 3GVBA 1L3LA 3G2YA 2ZQ7A 2Y2GA 2XLNA 5EOOA 5EV0A 1MPLA 2Y2NA 5A91A 4R4RA 3A3EA 5AQ9A 1DJBA 1JNUA 4U0XA 3OPPA 4G3VA 4K0WA 3VMAA 4FTXA 2Z6CA 5CHMA 2ZOIA 2HDSA 3MXRA 4YFMA 2R9WA 4JKTA 1YLPA 4E04A 2QZ6A 3NDGA 3S7NA 4MEZA 2PYPA 4HBUA 4HI4A 3IT9A 4LCMA 4YINA 3TG9A 1P0ZA 3V3SA 5CECA 1IFQA 3EOIA 4XT2B 3UDFA 2QHKA 4KQQA 1J9MA 5I5LA 1H8YA 4WN5A 2J3TD 2P9VA 3PTEA 4KZ5A 4EV4A 1TDGA 4HBTA 3FPWA 2BG1A 3A3IA 4DXCA 3GV9A 1ALQA 2ZC4B 3IF5A 1LHYA 3C8CA 1MKMA 2WK0A 2ZQAA 2O99A 3OOVA 2VK3A 1NYYA 2WZZA 3RXXA 4EQIA 4E6WA 3G34A 3TJZC 4BD0A 3IX3A 2XQZA 4F3LA 1K25A 3PR6A 1LSXA 2H28A 4LRXC 1ES4A 4Y5FA 1K57C 4RA7A 2K2NA 1K56D 5DKKA 1FQGA 1RGYA 5EVIB 3TRCA 2M1CA 4OQGA 2WKPA 4UEYA 3DWZA 2XRNA 2V8CA 3G2ZA 3OPLA 5EPHA 5A90A 5EVID 2YKHA 3HJKA 3GSGA 4JGQA 3ZYTA 1YLYA 4GHIA 3LIEA 1TS7A 4P85A 3MZDA 1V9YA 3BFEA 4A5RA 3HREA 3BFCA 5AQBA 1CJFA 4WF0A 5L2FA 3H9WA 3FG8A 2PHYA 2LB9A 2ZJ9A 1XGJA 3G32A 2Z6DA 5FQQA 4S2NC 3CG5A 5J8XA 1P9WA 4PM8A 4KQDA 4ARZB 3LICA 3CI6A 2PU4A 3E0YA 4GB7A 5CTMA 2H0YA 1LL5A 3BQAA 2ZL1B 3UNWA 4JXGA 2K7SA 2ZQCA 3V50A 4MMNA 5U47A 3G35A 3SOIA 1IYSA 1Y54A 1E4DA 3CWFA 4O7DA 1KGEA 4R70A 3V67A 3QP4A 3F1NB 2V1ZA 3IBJA 4MDZA 1L0FA 2Y2LA 3DBAA 4WYYA 5FDHA 5TFQA 2I72A 3H7WA 5G4YA 5HWWA 3HCYA 3SH9A 2O9AA 2XD1A 3HJIA 3ZG5A 4S2JA 4GDBA 3UO9A 2Q9MA 3CPTB 4OQHA 4B4ZA 1TS6A 4G3KA 4RQ9A 5J3WA 2Y2HA 4IUKA 5AVEA 1GCEA 1QMEA 4WELA 3N8SA 4LRZE 1GHIA 4I3AA 4DJ3A 3B42A 5EUAA 2PR6A 3KX0X 2MJ6A 1K6RA 5HWVA 1YLTA 1STZA 4U3TA 1GA0A 4S2IA 4X69A 4K91A 2EX6A 2J80A 3V3RA 3MXQA 5F83A 3B3XA 1XA1A 2VGJA 1LI0A 3UB5P 2OOLA 1WYCA 4ZJ3A 1CEGA 1MZUA 4LLOB 3MKFA 2KX6A 3RXWA 2X71A 1NZOA 3IF6C 4NETA 2Z2MB 4CLCD 4WZ5C 1BT5A 4GD8A 1D7EA 1MWSA 5K5BA 1YPRA 2B18A 2PD8A 1L0GA 1FCOA 3T1QB 4WM9A 4BBUA 5GHZA 4BMWA 1LI9A 3C38A 3F1OA 1IELA 1K6SA 1G5UA 1K0KA 3H82B 3FPVA 1L2SA 4OPZA 4BL2A 5DVAA 1OTDA 2XH9A 4WEKA 2XSSA 1S4RA 2O9BA 3LY4A 5L09A 1KDSA 4HIAA 4N9LA 4OQIA 2EXBA 4KZ3A 1G6OA 1VEUA 4KQOA 4EEPA 2JC7A 3IXHA 2WGWA 3HLCA 1WYBA 4KG5A 3W4OA 4Y0OA 3UB7A 5EFWA 1T19A 2E8IA 2P74A 3EQUA 3Q1FA 4CPKA 2V0UA 4FSFA 3PBSA 2Y8HA 1PYYA 1ESIA 3NY4A 4O8GA 4WMCD 4Y0TA 3L9KA 2Y2IA 3R4KA 4B9OA 5KIZA 3HBRA 4O0PA 1JWPA 4XXRA 2CC1A 4P6ZS 5HAPA 3M2KA 2C5WB 3UB9A 2QWSA 4QU3A 1ZTUA 3KSGA 1BUEA 4NXFA 3UN7A 4B88A 4DE3A 3BFDA 2WKHA 5E2EA 3BW6A 4F94A 4L9FA 4EERA 3ICYA 3W2ZA 4JF4A 4OP8A 5DFYA 4RVAA 5DTTA 5LBRA 1VM1A 4M4XA 1GHMA 3Q82A 2EFXA 1OT6A 2HPBA 4BD1A 3UPOA 2ZMAA 3AGDA 1FCMA 2M7UA 2VGKA 2HF6A 2P7JA 2DMWA 5CTNA 3SW1A 2J3TC 4MNRA 3KSIA 3IQAA 4FD8A 3IS2A 2XEPA 2H10A 2J9OA 2ZC7A 1XJ3A 1Q2QA 4YNRA 1I2WA 2QMIA 2P9VB 1YT4A 4ZRRA 1HZOA 1XPBA 3LGOA 3V5MA 3CUEA 3PBOA 1W5DA 2JHEA 3SS4A 1H5XA 4X53A 1VHMA 5AQAA 3JYIA 1GSWA 4BBVA 5DF9A 4QHCA 2ZQ8A 3PBQA 2JE5A 1XFNA 3MS6A 2EXAA 3D3OA 3SH7A 4NEED 3GDIA 1CQAA 3N7WA 1L0DA 2WAEA 4ZAMA 5FEFA 2EX2A 5EVIC 1EROA 1F9IA 2A24A 2G2UA 4IHQA 5IT5A 1KGFA 1T18A 4HNBA 3ZG7B 1JWZA 2R78A 4IVKA 2W0NA 4BL3A 1S1ZA 4HH2A 2NUTC 1JTGA 2Y4AA 5EM1A 1ZHHB 3LEZA 4E3LA 3S22A 1OMEA 2J9PA 1X0OA 3DTKA 3PBTA 4S2NA 1KVMA 2XA7S 4QPRA 4HHDA 4R3JA 2JKRI 4OONA 5FI2A 2XK1A 5FQKA 1XJ4A 1E3UA 3QHYA 2J3WA 5F6AA 2V0WA 4Y3IA 4GZBA 3T4LA 5F69A 2W1TA 3GRJA 4DE0A 1DRMA 1IEMA 3TOIA 4NXEA 4EBNA 1KGGA 4EWFA 3G31A 1SCWA 3JVUA 3DTMA 1XXMA 3D72A 5HDCA 1DP6A 1E25A 4C6YA 3C2WA 3BY9A 3N6IA 3OCNA 2O0YA 2IWBA 1CI8A 3NDEA 5A8BA 2XF3A 4E3JA 1GHPA 4KG6A 4EW7A 4I5SA 1SZVA 2BASA 3EQVA 1V9ZA 1XP4A 3OC2A 3LI8A 3O87A 3ZG0A 1MKIA 5J4EA 2JN7A 3EGXC 1FR1A 5HW3A 2ZBBA 4E3OA 1AXBA 3T50A 2EFUA 4E3NA 1FSWA 4FCFA 4K08A 4DN0A 3IBRA 5EE8A 1BLHA 5DJUA 3S7PA 3UE0A 4HJ4A 5EVEA 1N4OA 1TS8A 4KZ4A 4EBPA 1A0KA 5F1GA 5F82A 4X25A 2QYBA 1QMFA 2KOIA 1ES3A 1PNEA 3PAGA 2XD5A 2H5SA 4FH4A 2A3UA 1W8YA 1MWUA 2P08A 2HP9A 3CMZA 5FL3A 3IWOA 3CUEC 3BY8A 3A0RA 4QB8A 3VFHA 1NRFA 1NXYA 3MFDA 1LT0A 4CLCC 4S2OA 3IF6A 4FUWA 4WZ5A 5F68A 2L0WA 3TE8A 2H0TA 4L9EA 1BZAA 2HJEA 5A92A 4GDNA 5JYOA 2EWWA 3VFFA 3C7VA 1GSVA 3MMHA 2P04A 4L9GA 3T4QA 3FKVA 4GS9A 1G28A 3WRZA 1AWIA 4JF6A 4JBFA 4X1MA 3I7JA 3O5YA 1YAXA 3SS3A 3A3DA 3Q7VB 4OPYA 4JXWA 4PPRA 2B5RA 4ME4A 3EEHA 4WUJA 4IVIA 1WA9A 1CF0A 3QNCA 3F1OB 2VX8A 4Z9QA 4O01A 5TBMA 4ESPA 2ZC6B 1ZKJA 2Y2PA 1BYWA 2INWA 1ES2A 2Y2MA 1BULA 4LV0A 2GNXA 1BLCA 3D4FA 4WLAA 2JKTM 1U60A 1SKOA 1P97A 3VP1A 2DRWA 3DW0A 3FKWA 3BQ8A 3ZHHA 5FEGA 1VEUB 3T4OA 1DJAA 4H6JA 3MKEA 4NKPA 1D06A 2WGWB 2FFYA 1OTBA 3HLDA 4C3QA 1Z6FA 4EUVA 3T1SA 4BBTA 1CK3A 3HLFA 4HP9A 3NI9A 3DTEA 5HAQA 3EGDC 4HJ3A 1HLUP 3LIDA 5IHVA 4OH0A 2Y2JA 2B02A 1KE3A 4KUOA 3R7WB 3IX8A 1FSYA 3IH8A 5CGWA 1W63Q 3PXPA 2XR0A 3MBZA 1GSXA 1SDNA 3SH8A 4DDYA 4C75A 3BRMA 3VSLA 5HL1A 2PD7A 4CLCE 3KSHA 3Q7ZA 2FZ0A 3OPHA 2HDQA 3D9YA 1DJCA 2EX9A 3OPRA 4R4SA 3G30A 2OAP1 3ZG9B 4IUHA 4YWZA 1N9NA 2Z2LB 3UB8A 4ZJ2A 2XGNA 5DF7A 2GZAA 1OTAA 2PR5A 4L0LA 4S2PA 1FCNA 3OCLA 4KZ8A 4JXSA 5GLAA 3U4LP 4DXBA 4ETXA 4N9KA 4Q8IA 3A0SA 5IS1A 1S67L 2OLVA 4S2KA 2HV1A 1K56A 2G2WA 2UV0E 5HFOA 1O07A 4X68A 3ZVWA 3AGEA 3LIFA 3P09A 2V2FF 2XFTA 2ZC5B 4EESA 2A2LA 5EVIA 3HL9A 3HLBA 5EVLA 2VLGA 3T1RA 4EQ1A 4R38A 1ONHA 4BQMA 4PAUA 2WAFA 5F5YA 2XFSA 4I39A 1VETB 2WKQA 3B47A 2XROA 1OT9A 1PWCA 2Y79A 3GECA 1SDEA 2WKIA 1OJ5A 1SKFA 5HL6A 5HX9A 2VV6A 5FAQA 2ZQDA 1F5MA 4KENB 5HSQA 3LR4A 4OOYA 3IXBA 4EEUA 1ZG6A 1JWVA 1YM1A 5TGFA 3GMWA 3MJQA 1K4EA 4MBHA 3MFXA 1PZPA 3T4SA 4G3WA 3E4PA 4LV2A 3NIAA 3O86A 1KOUA 2VV8A 4KUKA 3VOYA 4OKPA 3W8KA 1MBLA 3IXGA 3LIAA 3UY6A 4FOFA 4DKIA 1K54C 2GDNA 1S0WA 1S4SA 3IHAA 4PKYA 3QNBA 4I3JA 3KYEA 4DE1A 4GKUA 4HOIA 2WKEA 4HESA 3M6HA 5FQ9A 4KQRA 3CZDA 5GHXA 2GJ3A 3E2KA 2IWCA 3OLOA 5M1AA 2IWDA 5C5KA 4OOMA 3VSKA 4OQ0A 2G7UA 3UE1A 3T1XA 4S2LA 3UMEA 1NRJA 2DCFA 3DAVA 1Y28A 3VP0A 1TVFA 2W3FA 1PIOA 5HPIA 2JKFA 1YLZA 1S66L 1LSWA 3VE3A 3ZGAB 4ZTKA 1K38A 1PRQA 5TR7A 5E2GA 2EA9A 3ULFA 3UPNA 5KZHA 2QJ7A 3KO6A 2Q0OA 1FILA 4R3BA 2WUQA 5HARA 4N1HA 4BJPA 4EETB 4IEDA 4X56A 3EEAA 1H0MA 5DTKA 1MWRA 3BEBA 2OWHA 1XFQA 3K2NA 4II7A 4OPQA 4LENA 4KZBA 1K55C 2BLSA 2JKRM 3M2JA 4CLCA 3RTYA 4OVDA 2BTFP 1DP9A 4F3LB 1PW1A 1T1CA 3JPUA 3IF6B 5L8MA 1YQSA 4P6ZM 2HP5A 5FAOA 3RJUA 2YKFA 4HH3A 5KSHA 1NZUA 2ZMVA 3S1YA 1BSGA 5CGSA 2V20A 4WEJA 4Y17A 1UWPX 3C30A 1TS0A 4MN5A 3WS0A 3JVVA 1IYPA 1OTEA 1OPXA 4GHIB 5J7EA 2OLUA 3WS2A 4R1GA 3G4PA 2QJ5A 2PT7A 4RYEA 3N4IA 5FSRA 4NXGA 2W3HA 4I38A 3CHWP 3SZTA 1I2SA 3HUNA 5FDSA 2OV5A 5FI6A 4JLFA 2GX5A 2VZWA 4Q0JA 3C4PA 1NLZA 2Y91A 1ERQA 4E6XA 3U2AA 3F1PA 2L4RA 4U0TA 2OWJA 1H8ZA 2PDRA 1LLBA 4GW9A 3IWQA 4MN6A 2VA0A 4GJ4A 4UA7A 2B95A 4HP4A 4H8RA 2V1BA 2X02A 1ES5A 3KSFA 4R23A 2I9VA 4Y7PA 1T1AA 4GNUA 1G6AA 5CX7A 3MSHA 4EU0A 4WMCA 3KYZA 2JBFA 4WZ4A 1Y4OA 4LV3A 2PYRA 3BM6A 2HZ5A 4MBFA 1N9OA 5FATA 1H8MA 4LGWA 4Y13A 2HDUA 3PAEA 1TF1A 5HWTA 3RH8B 1DY6A 1W79A 5FQJA 2HJ9C 1XX2A 2R9XA 3H7WB 3IH9A 1PI5A 3CJMA 2NUPC 3BLSA 3E4OA 2E8JA 5HD5A 1D1JA 2FFFB 4Y0UA 3MQOA 3UE6A 5GLBA 1S6RA 2XA7M 1PWDA 1XJ6A 1LL9A 1YMSA 4PM9A
chains in the Genus database with same CATH topology
2Q9NA 3ZDJA 2J7VA 1PZOA 2XH9A 5DVAA 2ZC3B 4WEKA 3NI9A 3WS1A 3ZNTA 4CJNA 4JPMA 5HAQA 4JXVA 3LY4A 4IBXA 2ZQ9A 5G18A 5CHUA 2PU2A 4K0XA 1XA7A 1KDSA 2ZM2A 4P0MA 4N9LA 5FA7A 4OQIA 4E3MA 2EXBA 4OP5A 3BECA 4KZ3A 2HDRA 1K57A 2WYXA 5M19A 3UPPA 1IYOA 5IHVA 4OH0A 4KQOA 4OPRA 2JC7A 5EOEA 3ZNYA 3IXHA 2WGWA 2Y2JA 3HLCA 3MXSA 4E3IA 4LV1A 5GHYA 1WYBA 1KE3A 4KG5A 4DRTA 1IYQA 5KMWA 3W4OA 4Y0OA 1M6KA 1FSYA 1VQQA 3IH8A 3UE3A 5FQIA 2E8IA 5CGWA 3A3FA 3LY3A 1RCJA 2XR0A 3MBZA 2P74A 1EWZA 1W8QA 1SDNA 3EQUA 5FAPA 3SH8A 4DDYA 3Q1FA 4CPKA 4C75A 4DF6A 3BRMA 1XGIA 3VSLA 5HL1A 1KDWA 1YLJA 1FR6A 4M3KA 4FSFA 3PBSA 2ZM0A 5AQ7A 2Y59A 1HVBA 1IKGA 3Q7ZA 1PYYA 3DWKA 1ESIA 5CRFA 3OPHA 4NK3A 2HDQA 3GQZA 1N9BA 3NY4A 4IBRA 1RP5A 1JTDA 1DJCA 2EX9A 4WMCD 3OPRA 4R4SA 5CERA 3E2LA 4Y0TA 5CGXA 3G30A 1BLSA 4RX3A 3WWXA 2Y2IA 3HVFA 4MLLA 4P87A 4PM6A 3ZG9B 1PW8A 4OLGA 2PBYA 4EUZA 2Y2OA 4PM5A 1MY8A 3HBRA 4UHUA 4XUXA 1JWPA 2Z2LB 4XXRA 3W4PA 2WZXA 3IHBA 3IWIA 2CC1A 4KZ6A 2DNSA 2XGNA 4PM7A 5DF7A 4ZJ2A 2Y2QA 4ID4A 3FZCA 5HAPA 3M2KA 2C5WB 3FWLA 3HUOA 1C3BA 4QU3A 4P6BA 3PBNA 1BUEA 4L0LA 3BFFA 4S2PA 4QY5A 1FCNA 3OCLA 3UN7A 4B88A 4BENA 3BFDA 2WKHA 5EECA 4DE3A 4KZ8A 5E2EA 4F94A 4JXSA 5GLAA 2UWXA 4DXBA 3VP3A 4N9KA 4JF4A 4OP8A 5DTTA 4RVAA 4Q8IA 1VM1A 2OLVA 2ZM8A 2WGIA 5M18A 4S2KA 5GL9A 1GHMA 3Q82A 2EFXA 2WGVA 5CXWA 4DDSA 2HPBA 1K56A 3NBLA 2G2WA 3IXDA 1CEFA 4UAAA 4BD1A 2ZMAA 5HFOA 3UPOA 3N8LA 1O07A 3AGDA 3FYZA 4X68A 3OZHA 4X6TA 3AGEA 1FCMA 3P09A 3ZVWA 2C6WB 2VGKA 2V2FF 4XUZA 2XFTA 3VOZA 5CTNA 5A93A 2ZC5B 4MBKA 5CEBA 5EVIA 3HL9A 3HLBA 4E3KA 1FOFA 5EVLA 4MNRA 1IKIA 1HD8A 3GVBA 3IQAA 4FD8A 3C4OA 2A49A 2XEPA 1ONHA 3SS5A 4BQMA 2H10A 2J9OA 2ZC7A 3G2YA 1Q2QA 2ZQ7A 4QD4A 2Y2GA 4QY6A 1I2WA 2XLNA 5EOOA 2QMIA 1YLWA 1MPLA 2WAFA 2Y2NA 5A91A 2P9VB 1YT4A 4R4RA 2XFSA 3C5AA 3BFGA 2QPNA 3A3EA 4RX2A 3ZVTA 5AQ9A 1HZOA 5FI7A 1XPBA 1ESUA 3V5MA 4JF5A 3PBOA 1W5DA 1DJBA 1PWCA 4U0XA 1K54A 1NJ4A 1H5XA 3SS4A 4X53A 1SDEA 2WKIA 5AQAA 3OPPA 1SKFA 3JYIA 4K0WA 3VMAA 4WBGA 5DF9A 4QHCA 5FAQA 5HX9A 2ZQ8A 3ISGA 2JE5A 2ZQDA 1RGZA 3PBQA 5CHMA 2Y2KA 5FASA 4KENB 2HDSA 3MXRA 4OOYA 2EXAA 2R9WA 4JKTA 1K4FA 4YFMA 3SH7A 3IXBA 1YLPA 2QZ6A 1ZG6A 1JWVA 3NDGA 4MEZA 4HBUA 3N7WA 1L0DA 1YM1A 2WAEA 3IT9A 5TGFA 3GMWA 4LCMA 4YINA 3TG9A 4ZAMA 3A3JA 1KE4A 1K4EA 1YMXA 4MBHA 2EX2A 3V3SA 5EVIC 4UA6A 1EROA 5CECA 1PZPA 1HTZA 2G2UA 3UDFA 4KQQA 1KGFA 1J9MA 1H8YA 3PTEA 2P9VA 1Q2PA 4KZ5A 4EV4A 4LV2A 3NIAA 1TDGA 4HBTA 4X55A 2BG1A 3A3IA 3ZG7B 4DXCA 3O86A 5JYPA 3GV9A 1JWZA 1ALQA 2ZC4B 3IF5A 4IVKA 1LHYA 4BL3A 3MZEA 3VOYA 2WK0A 2ZQAA 2OSUA 4OKPA 1JTGA 2Y4AA 3W8KA 1MBLA 1NYYA 3IXGA 2WZZA 1G68A 3VP2A 3RXXA 3LEZA 3UY6A 4DKIA 4E3LA 4EQIA 3S22A 1OMEA 1K54C 4E6WA 2GDNA 3G34A 2J9PA 4BD0A 1S0WA 4EBLA 3IHAA 3ITBA 2XQZA 1K25A 3PBTA 2JCHA 5GLCA 4S2NA 1ES4A 1KVMA 3LO7A 3QNBA 1K57C 3P98A 1MXOA 4DE1A 4RA7A 4GKUA 3ZFZA 2WKEA 1K56D 1FQGA 4HESA 2WADA 2HP6A 1RGYA 3M6HA 4R3JA 5EVIB 5FQ9A 4KQRA 4OONA 4OQGA 3CZDA 3M6BA 3DWZA 5FI2A 5GHXA 2XK1A 5FQKA 3G2ZA 3OPLA 3E2KA 1E3UA 2IWCA 3BLMA 5M1AA 2IWDA 3QHYA 5EPHA 5E43A 4OOMA 5A90A 5EVID 3VSKA 4OQ0A 3UE1A 1K55A 3GSGA 4S2LA 3O88A 3BYDA 3UDXA 2DCFA 3S4XA 1YLYA 4S2MA 4GZBA 4DE2A 1ONGA 4P85A 3MZDA 5D3OA 3BFEA 1KE0A 4GD6A 3HLGA 4A5RA 3HREA 1TVFA 2ZLYA 3GRJA 3BFCA 1IEMA 5AQBA 3VP0A 4DE0A 3AGFA 3TOIA 4KZAA 5L2FA 1PIOA 4EBNA 1KGGA 2ZJ9A 1YLZA 4EWFA 1XGJA 3G31A 3G32A 1SCWA 1NY0A 3ZGAB 4ZTKA 5FQQA 4S2NC 3CG5A 3HLEA 1PWGA 1K38A 3DTMA 5J8XA 1XXMA 4PM8A 5TR7A 5BOHA 1E25A 2PU4A 5E2GA 4C6YA 3UPNA 4GB7A 4KZ9A 5KZHA 4UA9A 3TSGA 5CTMA 2H0YA 3MZFA 4LCLA 3N6IA 1LL5A 3OCNA 4R3BA 2IWBA 1CI8A 2WUQA 5HARA 4N1HA 3NDEA 4BJPA 4IEDA 2XF3A 4X56A 2ZD8A 4QJGA 5DTKA 3Q7VA 1MWRA 3BEBA 4E3JA 1GHPA 4KG6A 3UNWA 4OPQA 3EQVA 4JXGA 2ZQCA 4LENA 3V50A 4KZBA 1K55C 2RL3A 1XP4A 1BLPA 2BLSA 3OC2A 3O87A 3ZG0A 1MKIA 3M2JA 1W7FA 1FR1A 5U47A 3G35A 5HW3A 3ITAA 4OVDA 1IYSA 3SOIA 4E3OA 1Y54A 1AXBA 1E4DA 1PW1A 4GOGA 4O7DA 1KGEA 3IF6B 2EFUA 4E3NA 1FSWA 3V39A 4FCFA 1M40A 1YQSA 2V1ZA 2HP5A 5FAOA 5EE8A 3RJUA 1BLHA 1EI5A 5DTSA 3W4QA 4D2OA 3UE0A 1L0FA 2Y2LA 5KSHA 1N4OA 1NZUA 4KZ4A 3LCEA 4EBPA 4WYYA 1PI4A 5F1GA 5F82A 3S1YA 1BSGA 5CGSA 5FDHA 5DF8A 4ZBEA 5TFQA 1QMFA 2I72A 2V20A 4WEJA 1ES3A 3PAGA 2XD5A 2H5SA 4FH4A 2A3UA 1W8YA 1MWUA 3SH9A 4B4XA 4KZ7A 2HP9A 2XD1A 3CMZA 3WS0A 3IWOA 3ZG5A 1IYPA 3WRTA 1E3UD 4S2JA 4GDBA 3C7UA 3UO9A 2Q9MA 4QB8A 3VFHA 3HLWA 3NC8A 2OLUA 1NRFA 1NXYA 3WS2A 3MFDA 3G4PA 4OQHA 4R1GA 4B4ZA 4S2OA 1BTLA 3IF6A 3Q81A 4RYEA 3N4IA 2Y2HA 5FSRA 4WZ5A 2Y55A 5E2HA 2H0TA 1GCEA 5GLDA 1QMEA 1BZAA 1I5QA 4OLDA 4WELA 3N8SA 1GHIA 5A92A 5F1FA 1KVLA 3WS5A 1I2SA 1WE4A 5EUAA 3HUNA 1ERMA 2OV5A 4GDNA 1MWTA 2XDMA 5FI6A 4JLFA 3UDIA 3VFFA 5JYOA 5FQMA 3C7VA 3C4PA 1K6RA 2Y91A 1ERQA 4E6XA 3FKVA 3WRZA 1YLTA 4U0TA 1NYMA 4U3TA 1GA0A 4S2IA 1H8ZA 1ZC2A 1LLBA 4JF6A 4JBFA 3I7JA 3IWQA 3SS3A 3A3DA 3Q7VB 4OPYA 1CI9A 2EX6A 4JXWA 4K91A 4X69A 4ZJ1A 4UA7A 4PPRA 1ZG4A 2B5RA 3V3RA 4ZDXA 4H8RA 5F83A 2X02A 3B3XA 1XA1A 4IVIA 2EX8A 1ES5A 5E2FA 4R23A 4Y7PA 4HEFA 3QNCA 4R0QA 2VGJA 3FV7A 4Z9QA 4GNUA 1LI0A 3HUMA 1WYCA 1G6AA 3PBRA 4ZJ3A 1CEGA 4N1XA 5KSCA 2X01A 3MKFA 3Q07A 4WMCA 1JVJA 2JBFA 3RXWA 2ZC6B 4N92A 4LV3A 4WZ4A 2X71A 1XKZA 3BM6A 1NZOA 1ZKJA 1TDLA 2Y2PA 3IF6C 4MBFA 2Z2MB 4NETA 5FATA 1ES2A 3ZG8B 4WZ5C 2Y2MA 3N8RA 1BULA 1BT5A 4GD8A 2HDUA 4LV0A 3VP4A 3PAEA 1BLCA 5CEDA 3D4FA 1MWSA 1DY6A 1W79A 1GA9A 5FQJA 4KG2A 5CHJA 4BLMA 1U60A 4GN2A 4PMAA 1TEMA 1XX2A 3VP1A 5I94A 2DRWA 3DW0A 2R9XA 3FKWA 1L0GA 3ZHHA 1FCOA 3GTCA 3IH9A 1DJAA 1O7EA 1PI5A 3MKEA 4WM9A 3NCKA 5HAIA 3CJMA 2WGWB 3ZCZA 3BLSA 3O3VA 5GHZA 1LI9A 2FFFB 1SHVA 1L0EA 2FFYA 4FH2A 4Y0UA 4OOLA 3GR2A 2J8YA 2RCXA 3HLDA 1IELA 1K6SA 4C3QA 5GLBA 1Z6FA 1S6RA 1PWDA 1L2SA 1CK3A 4OPZA 4BL2A 1LL9A 3HLFA 3WS4A 1YMSA 4PM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q9N A;  3ZDJ A;  2J7V A;  1PZO A;  2XH9 A;  5DVA A;  2ZC3 B;  4WEK A;  3NI9 A;  3WS1 A;  3ZNT A;  4CJN A;  4JPM A;  5HAQ A;  4JXV A;  3LY4 A;  4IBX A;  2ZQ9 A;  5G18 A;  5CHU A;  2PU2 A;  4K0X A;  1XA7 A;  1KDS A;  2ZM2 A;  4P0M A;  4N9L A;  5FA7 A;  4OQI A;  4E3M A;  2EXB A;  4OP5 A;  3BEC A;  4KZ3 A;  2HDR A;  1K57 A;  2WYX A;  5M19 A;  3UPP A;  1IYO A;  5IHV A;  4OH0 A;  4KQO A;  4OPR A;  2JC7 A;  5EOE A;  3ZNY A;  3IXH A;  2WGW A;  2Y2J A;  3HLC A;  3MXS A;  4E3I A;  4LV1 A;  5GHY A;  1WYB A;  1KE3 A;  4KG5 A;  4DRT A;  1IYQ A;  5KMW A;  3W4O A;  4Y0O A;  1M6K A;  1FSY A;  1VQQ A;  3IH8 A;  3UE3 A;  5FQI A;  2E8I A;  5CGW A;  3A3F A;  3LY3 A;  1RCJ A;  2XR0 A;  3MBZ A;  2P74 A;  1EWZ A;  1W8Q A;  1SDN A;  3EQU A;  5FAP A;  3SH8 A;  4DDY A;  3Q1F A;  4CPK A;  4C75 A;  4DF6 A;  3BRM A;  1XGI A;  3VSL A;  5HL1 A;  1KDW A;  1YLJ A;  1FR6 A;  4M3K A;  4FSF A;  3PBS A;  2ZM0 A;  5AQ7 A;  2Y59 A;  1HVB A;  1IKG A;  3Q7Z A;  1PYY A;  3DWK A;  1ESI A;  5CRF A;  3OPH A;  4NK3 A;  2HDQ A;  3GQZ A;  1N9B A;  3NY4 A;  4IBR A;  1RP5 A;  1JTD A;  1DJC A;  2EX9 A;  4WMC D;  3OPR A;  4R4S A;  5CER A;  3E2L A;  4Y0T A;  5CGX A;  3G30 A;  1BLS A;  4RX3 A;  3WWX A;  2Y2I A;  3HVF A;  4MLL A;  4P87 A;  4PM6 A;  3ZG9 B;  1PW8 A;  4OLG A;  2PBY A;  4EUZ A;  2Y2O A;  4PM5 A;  1MY8 A;  3HBR A;  4UHU A;  4XUX A;  1JWP A;  2Z2L B;  4XXR A;  3W4P A;  2WZX A;  3IHB A;  3IWI A;  2CC1 A;  4KZ6 A;  2DNS A;  2XGN A;  4PM7 A;  5DF7 A;  4ZJ2 A;  2Y2Q A;  4ID4 A;  3FZC A;  5HAP A;  3M2K A;  2C5W B;  3FWL A;  3HUO A;  1C3B A;  4QU3 A;  4P6B A;  3PBN A;  1BUE A;  4L0L A;  3BFF A;  4S2P A;  4QY5 A;  1FCN A;  3OCL A;  3UN7 A;  4B88 A;  4BEN A;  3BFD A;  2WKH A;  5EEC A;  4DE3 A;  4KZ8 A;  5E2E A;  4F94 A;  4JXS A;  5GLA A;  2UWX A;  4DXB A;  3VP3 A;  4N9K A;  4JF4 A;  4OP8 A;  5DTT A;  4RVA A;  4Q8I A;  1VM1 A;  2OLV A;  2ZM8 A;  2WGI A;  5M18 A;  4S2K A;  5GL9 A;  1GHM A;  3Q82 A;  2EFX A;  2WGV A;  5CXW A;  4DDS A;  2HPB A;  1K56 A;  3NBL A;  2G2W A;  3IXD A;  1CEF A;  4UAA A;  4BD1 A;  2ZMA A;  5HFO A;  3UPO A;  3N8L A;  1O07 A;  3AGD A;  3FYZ A;  4X68 A;  3OZH A;  4X6T A;  3AGE A;  1FCM A;  3P09 A;  3ZVW A;  2C6W B;  2VGK A;  2V2F F;  4XUZ A;  2XFT A;  3VOZ A;  5CTN A;  5A93 A;  2ZC5 B;  4MBK A;  5CEB A;  5EVI A;  3HL9 A;  3HLB A;  4E3K A;  1FOF A;  5EVL A;  4MNR A;  1IKI A;  1HD8 A;  3GVB A;  3IQA A;  4FD8 A;  3C4O A;  2A49 A;  2XEP A;  1ONH A;  3SS5 A;  4BQM A;  2H10 A;  2J9O A;  2ZC7 A;  3G2Y A;  1Q2Q A;  2ZQ7 A;  4QD4 A;  2Y2G A;  4QY6 A;  1I2W A;  2XLN A;  5EOO A;  2QMI A;  1YLW A;  1MPL A;  2WAF A;  2Y2N A;  5A91 A;  2P9V B;  1YT4 A;  4R4R A;  2XFS A;  3C5A A;  3BFG A;  2QPN A;  3A3E A;  4RX2 A;  3ZVT A;  5AQ9 A;  1HZO A;  5FI7 A;  1XPB A;  1ESU A;  3V5M A;  4JF5 A;  3PBO A;  1W5D A;  1DJB A;  1PWC A;  4U0X A;  1K54 A;  1NJ4 A;  1H5X A;  3SS4 A;  4X53 A;  1SDE A;  2WKI A;  5AQA A;  3OPP A;  1SKF A;  3JYI A;  4K0W A;  3VMA A;  4WBG A;  5DF9 A;  4QHC A;  5FAQ A;  5HX9 A;  2ZQ8 A;  3ISG A;  2JE5 A;  2ZQD A;  1RGZ A;  3PBQ A;  5CHM A;  2Y2K A;  5FAS A;  4KEN B;  2HDS A;  3MXR A;  4OOY A;  2EXA A;  2R9W A;  4JKT A;  1K4F A;  4YFM A;  3SH7 A;  3IXB A;  1YLP A;  2QZ6 A;  1ZG6 A;  1JWV A;  3NDG A;  4MEZ A;  4HBU A;  3N7W A;  1L0D A;  1YM1 A;  2WAE A;  3IT9 A;  5TGF A;  3GMW A;  4LCM A;  4YIN A;  3TG9 A;  4ZAM A;  3A3J A;  1KE4 A;  1K4E A;  1YMX A;  4MBH A;  2EX2 A;  3V3S A;  5EVI C;  4UA6 A;  1ERO A;  5CEC A;  1PZP A;  1HTZ A;  2G2U A;  3UDF A;  4KQQ A;  1KGF A;  1J9M A;  1H8Y A;  3PTE A;  2P9V A;  1Q2P A;  4KZ5 A;  4EV4 A;  4LV2 A;  3NIA A;  1TDG A;  4HBT A;  4X55 A;  2BG1 A;  3A3I A;  3ZG7 B;  4DXC A;  3O86 A;  5JYP A;  3GV9 A;  1JWZ A;  1ALQ A;  2ZC4 B;  3IF5 A;  4IVK A;  1LHY A;  4BL3 A;  3MZE A;  3VOY A;  2WK0 A;  2ZQA A;  2OSU A;  4OKP A;  1JTG A;  2Y4A A;  3W8K A;  1MBL A;  1NYY A;  3IXG A;  2WZZ A;  1G68 A;  3VP2 A;  3RXX A;  3LEZ A;  3UY6 A;  4DKI A;  4E3L A;  4EQI A;  3S22 A;  1OME A;  1K54 C;  4E6W A;  2GDN A;  3G34 A;  2J9P A;  4BD0 A;  1S0W A;  4EBL A;  3IHA A;  3ITB A;  2XQZ A;  1K25 A;  3PBT A;  2JCH A;  5GLC A;  4S2N A;  1ES4 A;  1KVM A;  3LO7 A;  3QNB A;  1K57 C;  3P98 A;  1MXO A;  4DE1 A;  4RA7 A;  4GKU A;  3ZFZ A;  2WKE A;  1K56 D;  1FQG A;  4HES A;  2WAD A;  2HP6 A;  1RGY A;  3M6H A;  4R3J A;  5EVI B;  5FQ9 A;  4KQR A;  4OON A;  4OQG A;  3CZD A;  3M6B A;  3DWZ A;  5FI2 A;  5GHX A;  2XK1 A;  5FQK A;  3G2Z A;  3OPL A;  3E2K A;  1E3U A;  2IWC A;  3BLM A;  5M1A A;  2IWD A;  3QHY A;  5EPH A;  5E43 A;  4OOM A;  5A90 A;  5EVI D;  3VSK A;  4OQ0 A;  3UE1 A;  1K55 A;  3GSG A;  4S2L A;  3O88 A;  3BYD A;  3UDX A;  2DCF A;  3S4X A;  1YLY A;  4S2M A;  4GZB A;  4DE2 A;  1ONG A;  4P85 A;  3MZD A;  5D3O A;  3BFE A;  1KE0 A;  4GD6 A;  3HLG A;  4A5R A;  3HRE A;  1TVF A;  2ZLY A;  3GRJ A;  3BFC A;  1IEM A;  5AQB A;  3VP0 A;  4DE0 A;  3AGF A;  3TOI A;  4KZA A;  5L2F A;  1PIO A;  4EBN A;  1KGG A;  2ZJ9 A;  1YLZ A;  4EWF A;  1XGJ A;  3G31 A;  3G32 A;  1SCW A;  1NY0 A;  3ZGA B;  4ZTK A;  5FQQ A;  4S2N C;  3CG5 A;  3HLE A;  1PWG A;  1K38 A;  3DTM A;  5J8X A;  1XXM A;  4PM8 A;  5TR7 A;  5BOH A;  1E25 A;  2PU4 A;  5E2G A;  4C6Y A;  3UPN A;  4GB7 A;  4KZ9 A;  5KZH A;  4UA9 A;  3TSG A;  5CTM A;  2H0Y A;  3MZF A;  4LCL A;  3N6I A;  1LL5 A;  3OCN A;  4R3B A;  2IWB A;  1CI8 A;  2WUQ A;  5HAR A;  4N1H A;  3NDE A;  4BJP A;  4IED A;  2XF3 A;  4X56 A;  2ZD8 A;  4QJG A;  5DTK A;  3Q7V A;  1MWR A;  3BEB A;  4E3J A;  1GHP A;  4KG6 A;  3UNW A;  4OPQ A;  3EQV A;  4JXG A;  2ZQC A;  4LEN A;  3V50 A;  4KZB A;  1K55 C;  2RL3 A;  1XP4 A;  1BLP A;  2BLS A;  3OC2 A;  3O87 A;  3ZG0 A;  1MKI A;  3M2J A;  1W7F A;  1FR1 A;  5U47 A;  3G35 A;  5HW3 A;  3ITA A;  4OVD A;  1IYS A;  3SOI A;  4E3O A;  1Y54 A;  1AXB A;  1E4D A;  1PW1 A;  4GOG A;  4O7D A;  1KGE A;  3IF6 B;  2EFU A;  4E3N A;  1FSW A;  3V39 A;  4FCF A;  1M40 A;  1YQS A;  2V1Z A;  2HP5 A;  5FAO A;  5EE8 A;  3RJU A;  1BLH A;  1EI5 A;  5DTS A;  3W4Q A;  4D2O A;  3UE0 A;  1L0F A;  2Y2L A;  5KSH A;  1N4O A;  1NZU A;  4KZ4 A;  3LCE A;  4EBP A;  4WYY A;  1PI4 A;  5F1G A;  5F82 A;  3S1Y A;  1BSG A;  5CGS A;  5FDH A;  5DF8 A;  4ZBE A;  5TFQ A;  1QMF A;  2I72 A;  2V20 A;  4WEJ A;  1ES3 A;  3PAG A;  2XD5 A;  2H5S A;  4FH4 A;  2A3U A;  1W8Y A;  1MWU A;  3SH9 A;  4B4X A;  4KZ7 A;  2HP9 A;  2XD1 A;  3CMZ A;  3WS0 A;  3IWO A;  3ZG5 A;  1IYP A;  3WRT A;  1E3U D;  4S2J A;  4GDB A;  3C7U A;  3UO9 A;  2Q9M A;  4QB8 A;  3VFH A;  3HLW A;  3NC8 A;  2OLU A;  1NRF A;  1NXY A;  3WS2 A;  3MFD A;  3G4P A;  4OQH A;  4R1G A;  4B4Z A;  4S2O A;  1BTL A;  3IF6 A;  3Q81 A;  4RYE A;  3N4I A;  2Y2H A;  5FSR A;  4WZ5 A;  2Y55 A;  5E2H A;  2H0T A;  1GCE A;  5GLD A;  1QME A;  1BZA A;  1I5Q A;  4OLD A;  4WEL A;  3N8S A;  1GHI A;  5A92 A;  5F1F A;  1KVL A;  3WS5 A;  1I2S A;  1WE4 A;  5EUA A;  3HUN A;  1ERM A;  2OV5 A;  4GDN A;  1MWT A;  2XDM A;  5FI6 A;  4JLF A;  3UDI A;  3VFF A;  5JYO A;  5FQM A;  3C7V A;  3C4P A;  1K6R A;  2Y91 A;  1ERQ A;  4E6X A;  3FKV A;  3WRZ A;  1YLT A;  4U0T A;  1NYM A;  4U3T A;  1GA0 A;  4S2I A;  1H8Z A;  1ZC2 A;  1LLB A;  4JF6 A;  4JBF A;  3I7J A;  3IWQ A;  3SS3 A;  3A3D A;  3Q7V B;  4OPY A;  1CI9 A;  2EX6 A;  4JXW A;  4K91 A;  4X69 A;  4ZJ1 A;  4UA7 A;  4PPR A;  1ZG4 A;  2B5R A;  3V3R A;  4ZDX A;  4H8R A;  5F83 A;  2X02 A;  3B3X A;  1XA1 A;  4IVI A;  2EX8 A;  1ES5 A;  5E2F A;  4R23 A;  4Y7P A;  4HEF A;  3QNC A;  4R0Q A;  2VGJ A;  3FV7 A;  4Z9Q A;  4GNU A;  1LI0 A;  3HUM A;  1WYC A;  1G6A A;  3PBR A;  4ZJ3 A;  1CEG A;  4N1X A;  5KSC A;  2X01 A;  3MKF A;  3Q07 A;  4WMC A;  1JVJ A;  2JBF A;  3RXW A;  2ZC6 B;  4N92 A;  4LV3 A;  4WZ4 A;  2X71 A;  1XKZ A;  3BM6 A;  1NZO A;  1ZKJ A;  1TDL A;  2Y2P A;  3IF6 C;  4MBF A;  2Z2M B;  4NET A;  5FAT A;  1ES2 A;  3ZG8 B;  4WZ5 C;  2Y2M A;  3N8R A;  1BUL A;  1BT5 A;  4GD8 A;  2HDU A;  4LV0 A;  3VP4 A;  3PAE A;  1BLC A;  5CED A;  3D4F A;  1MWS A;  1DY6 A;  1W79 A;  1GA9 A;  5FQJ A;  4KG2 A;  5CHJ A;  4BLM A;  1U60 A;  4GN2 A;  4PMA A;  1TEM A;  1XX2 A;  3VP1 A;  5I94 A;  2DRW A;  3DW0 A;  2R9X A;  3FKW A;  1L0G A;  3ZHH A;  1FCO A;  3GTC A;  3IH9 A;  1DJA A;  1O7E A;  1PI5 A;  3MKE A;  4WM9 A;  3NCK A;  5HAI A;  3CJM A;  2WGW B;  3ZCZ A;  3BLS A;  3O3V A;  5GHZ A;  1LI9 A;  2FFF B;  1SHV A;  1L0E A;  2FFY A;  4FH2 A;  4Y0U A;  4OOL A;  3GR2 A;  2J8Y A;  2RCX A;  3HLD A;  1IEL A;  1K6S A;  4C3Q A;  5GLB A;  1Z6F A;  1S6R A;  1PWD A;  1L2S A;  1CK3 A;  4OPZ A;  4BL2 A;  1LL9 A;  3HLF A;  3WS4 A;  1YMS A;  4PM9 A; 
#chains in the Genus database with same CATH topology
 2Q9N A;  3ZDJ A;  1PZO A;  2V1A A;  2ZC3 B;  4CJN A;  3WS1 A;  3ZNT A;  4MCW A;  1P9R A;  3LEQ A;  3NEC A;  1YSQ A;  4JXV A;  2D02 A;  2PU2 A;  4K0X A;  3CIT A;  5DFX A;  1XA7 A;  2ZM2 A;  3A0V A;  4E3M A;  2EWV A;  4OP5 A;  4MN7 A;  3BEC A;  2WYX A;  3NJA A;  4OPR A;  5EOE A;  4HJ6 A;  4DRT A;  3UE3 A;  4LFU A;  3A3F A;  3LY3 A;  4B93 A;  1EWZ A;  5FAP A;  5L10 A;  4HQA A;  1KDW A;  1FR6 A;  4M3K A;  4ETZ A;  4I3I A;  5AQ7 A;  2Y59 A;  3DWK A;  3GQZ A;  1N9B A;  1RP5 A;  3NOT C;  2VGL S;  5CER A;  2W3G A;  5CGX A;  1BLS A;  3WWX A;  4MLL A;  3S7Q A;  4JGP A;  4EUZ A;  2Y2O A;  5DJT A;  1MY8 A;  2K31 A;  4XUX A;  3W4P A;  2WZX A;  2CMN A;  3IWI A;  4KZ6 A;  2DNS A;  4PM7 A;  4BWI A;  4ID4 A;  2W27 A;  3FWL A;  1C3B A;  3HUO A;  2D01 A;  4QY5 A;  5EEC A;  3L7H A;  3VP3 A;  1H3Q A;  5TJJ A;  2VEA A;  2WGI A;  5CXW A;  3N8L A;  3FYZ A;  2JKG A;  3P01 A;  3VOZ A;  1S1Y A;  4MBK A;  5L07 A;  5CEB A;  3EWK A;  4E3K A;  1HD8 A;  3C4O A;  2A49 A;  3SS5 A;  4QY6 A;  4QD4 A;  1YLW A;  3C5A A;  3BFG A;  2QPN A;  4RX2 A;  3UMD A;  3ZVT A;  5FI7 A;  1ESU A;  4LPZ A;  2IA2 A;  4JF5 A;  3K3D A;  3T4J A;  1K54 A;  1NJ4 A;  3PHY A;  2VGL M;  3BWL A;  4WBG A;  3ISG A;  2VJW A;  1RGZ A;  2Y2K A;  5FAS A;  1EW0 A;  1N9L A;  1K4F A;  3LIB A;  3ZQ5 A;  4IJG A;  1UGU A;  1F98 A;  3VOL A;  3A3J A;  1UWN X;  1KE4 A;  1YMX A;  4UA6 A;  3P7N A;  1HTZ A;  4AFI A;  1Q2P A;  3BJN A;  4X55 A;  5DKL A;  5JYP A;  3MZE A;  2OSU A;  2ZOH A;  3MQ0 A;  1G68 A;  3VP2 A;  3LFV A;  4DJ2 A;  4EBL A;  2JKT I;  2HGV A;  3ITB A;  2JCH A;  5GLC A;  2FH5 A;  3LO7 A;  2W3E A;  3P98 A;  1MXO A;  1YSP A;  3ZFZ A;  2HP6 A;  2WAD A;  4XT2 A;  3M6B A;  4Y15 A;  4NG2 A;  3IS2 B;  2PRF A;  3BLM A;  5E43 A;  5HZH A;  1NWZ A;  1K55 A;  1Z09 A;  3O88 A;  3BYD A;  3VV4 A;  3UDX A;  3S4X A;  1T1B A;  2ACG A;  2V9A A;  4S2M A;  2WKR A;  3IX4 A;  3QP8 A;  4DE2 A;  1ONG A;  5D3O A;  4CLC B;  1KE0 A;  4GD6 A;  3HLG A;  2ZLY A;  4PHT A;  3QP6 A;  3AGF A;  4KZA A;  3K3C A;  3NOU C;  4PKY G;  3T12 B;  5MC7 A;  1NY0 A;  1DP8 A;  3HLE A;  1PWG A;  5BOH A;  2KLI A;  4KZ9 A;  4UA9 A;  3TSG A;  3FC7 A;  3MZF A;  2A24 B;  4LCL A;  3NHQ A;  1XJ2 A;  4NXB A;  2ZD8 A;  4QJG A;  3Q7V A;  4UQI S;  4JGR A;  4LRY C;  2LB5 A;  2RL3 A;  1BLP A;  2L1M A;  3NUL A;  1W7F A;  3ITA A;  4GOG A;  3V39 A;  1M40 A;  2PBD P;  4ARZ A;  1EI5 A;  5DTS A;  2W3D A;  3W4Q A;  4D2O A;  3RFB A;  3LCE A;  1YKD A;  1PI4 A;  2ZMF A;  4YOF A;  3CLO A;  3S7O A;  5DF8 A;  4ZBE A;  4HY8 A;  3MF0 A;  2ZL1 A;  3F1P B;  4B4X A;  4KZ7 A;  5HD3 A;  2KDK A;  3WRT A;  1E3U D;  3C7U A;  1F2K A;  3HLW A;  3NC8 A;  1BTL A;  3Q81 A;  2W1T B;  4GLQ A;  3OBF A;  3F1N A;  2Y55 A;  4Y2F A;  3VE4 A;  5E2H A;  5GLD A;  1I5Q A;  4OLD A;  5F1F A;  1KVL A;  4DMZ A;  3WS5 A;  1WE4 A;  1ERM A;  3UDI A;  1MWT A;  2XDM A;  3QP2 A;  5FQM A;  4JGO A;  4UQI M;  1LSV A;  1NYM A;  4EXO A;  2QKP A;  1ZC2 A;  2VKS A;  3T4T A;  1CI9 A;  4ZJ1 A;  5HPF A;  3R7W A;  1ZG4 A;  4ZDX A;  5E2F A;  2EX8 A;  3CPT A;  4HEF A;  4R0Q A;  3FV7 A;  2VV7 A;  3HUM A;  3PBR A;  1MC0 A;  4N1X A;  5KSC A;  2X01 A;  3Q07 A;  1JVJ A;  4N92 A;  4R6L A;  1XKZ A;  1TDL A;  3ZG8 B;  2O9C A;  4WL9 A;  3N8R A;  2OAQ 1;  3VP4 A;  5CED A;  3LUQ A;  1GA9 A;  4BLM A;  4KG2 A;  5CHJ A;  4GN2 A;  4PMA A;  1TEM A;  4Q0I A;  1W63 M;  5I94 A;  5IU1 A;  3GTC A;  1ACF A;  3LI9 A;  1O7E A;  3NCK A;  3TW8 A;  5HAI A;  3ZCZ A;  3LR5 A;  3O3V A;  3KYQ A;  1SHV A;  1L0E A;  4FH2 A;  4OOL A;  3GR2 A;  5AJG A;  2J8Y A;  2RCX A;  3UB6 A;  4CQH A;  5HDS A;  3WS4 A;  4X1L A;  2J7V A;  4JPM A;  1OTI A;  1PFL A;  2ZQ9 A;  4IBX A;  5G18 A;  5CHU A;  2M7V A;  4P0M A;  5FA7 A;  1J3W A;  2HDR A;  1K57 A;  5M19 A;  3UPP A;  1IYO A;  4GS9 B;  4Q0H A;  3ZNY A;  3MXS A;  4E3I A;  4LV1 A;  5GHY A;  1IYQ A;  3CAX A;  5KMW A;  1M6K A;  4QWO A;  1VQQ A;  3PYP A;  5FQI A;  5EM0 A;  3H82 A;  3LYX A;  1RCJ A;  5G4Z A;  3T4K A;  1VET A;  2V8F A;  1W8Q A;  4DF6 A;  5TBM B;  1XGI A;  1YLJ A;  3G6O A;  2ZM0 A;  1HVB A;  1IKG A;  1ODV A;  5CRF A;  4NK3 A;  4IBR A;  1JTD A;  3E2L A;  5AVF A;  4RX3 A;  3HVF A;  4P87 A;  4PM6 A;  1PW8 A;  1SKO B;  2PBY A;  1NLY A;  4OLG A;  4PM5 A;  5HDD A;  4UHU A;  3E98 A;  3IHB A;  4H6J B;  3B33 A;  2Y2Q A;  1OJG A;  2W1R A;  3E4Q A;  3FZC A;  4P6B A;  3PBN A;  3BFF A;  4Z1W A;  4BEN A;  1FIK A;  4R3A A;  3QP1 A;  2UWX A;  3NOP C;  4GCZ A;  3LR3 A;  4D60 A;  3MR0 A;  2ZM8 A;  5M18 A;  5GL9 A;  2WGV A;  4DDS A;  3LR0 A;  3NBL A;  3DTI A;  3IXD A;  1CEF A;  4UAA A;  1IOU A;  1TD5 A;  3OZH A;  4X6T A;  3QP5 A;  1VB6 A;  2C6W B;  2AVX A;  4XUZ A;  3MQQ A;  2PAV P;  5A93 A;  1LL8 A;  1FOF A;  1IKI A;  3GVB A;  1L3L A;  3G2Y A;  2ZQ7 A;  2Y2G A;  2XLN A;  5EOO A;  5EV0 A;  1MPL A;  2Y2N A;  5A91 A;  4R4R A;  3A3E A;  5AQ9 A;  1DJB A;  1JNU A;  4U0X A;  3OPP A;  4G3V A;  4K0W A;  3VMA A;  4FTX A;  2Z6C A;  5CHM A;  2ZOI A;  2HDS A;  3MXR A;  4YFM A;  2R9W A;  4JKT A;  1YLP A;  4E04 A;  2QZ6 A;  3NDG A;  3S7N A;  4MEZ A;  2PYP A;  4HBU A;  4HI4 A;  3IT9 A;  4LCM A;  4YIN A;  3TG9 A;  1P0Z A;  3V3S A;  5CEC A;  1IFQ A;  3EOI A;  4XT2 B;  3UDF A;  2QHK A;  4KQQ A;  1J9M A;  5I5L A;  1H8Y A;  4WN5 A;  2J3T D;  2P9V A;  3PTE A;  4KZ5 A;  4EV4 A;  1TDG A;  4HBT A;  3FPW A;  2BG1 A;  3A3I A;  4DXC A;  3GV9 A;  1ALQ A;  2ZC4 B;  3IF5 A;  1LHY A;  3C8C A;  1MKM A;  2WK0 A;  2ZQA A;  2O99 A;  3OOV A;  2VK3 A;  1NYY A;  2WZZ A;  3RXX A;  4EQI A;  4E6W A;  3G34 A;  3TJZ C;  4BD0 A;  3IX3 A;  2XQZ A;  4F3L A;  1K25 A;  3PR6 A;  1LSX A;  2H28 A;  4LRX C;  1ES4 A;  4Y5F A;  1K57 C;  4RA7 A;  2K2N A;  1K56 D;  5DKK A;  1FQG A;  1RGY A;  5EVI B;  3TRC A;  2M1C A;  4OQG A;  2WKP A;  4UEY A;  3DWZ A;  2XRN A;  2V8C A;  3G2Z A;  3OPL A;  5EPH A;  5A90 A;  5EVI D;  2YKH A;  3HJK A;  3GSG A;  4JGQ A;  3ZYT A;  1YLY A;  4GHI A;  3LIE A;  1TS7 A;  4P85 A;  3MZD A;  1V9Y A;  3BFE A;  4A5R A;  3HRE A;  3BFC A;  5AQB A;  1CJF A;  4WF0 A;  5L2F A;  3H9W A;  3FG8 A;  2PHY A;  2LB9 A;  2ZJ9 A;  1XGJ A;  3G32 A;  2Z6D A;  5FQQ A;  4S2N C;  3CG5 A;  5J8X A;  1P9W A;  4PM8 A;  4KQD A;  4ARZ B;  3LIC A;  3CI6 A;  2PU4 A;  3E0Y A;  4GB7 A;  5CTM A;  2H0Y A;  1LL5 A;  3BQA A;  2ZL1 B;  3UNW A;  4JXG A;  2K7S A;  2ZQC A;  3V50 A;  4MMN A;  5U47 A;  3G35 A;  3SOI A;  1IYS A;  1Y54 A;  1E4D A;  3CWF A;  4O7D A;  1KGE A;  4R70 A;  3V67 A;  3QP4 A;  3F1N B;  2V1Z A;  3IBJ A;  4MDZ A;  1L0F A;  2Y2L A;  3DBA A;  4WYY A;  5FDH A;  5TFQ A;  2I72 A;  3H7W A;  5G4Y A;  5HWW A;  3HCY A;  3SH9 A;  2O9A A;  2XD1 A;  3HJI A;  3ZG5 A;  4S2J A;  4GDB A;  3UO9 A;  2Q9M A;  3CPT B;  4OQH A;  4B4Z A;  1TS6 A;  4G3K A;  4RQ9 A;  5J3W A;  2Y2H A;  4IUK A;  5AVE A;  1GCE A;  1QME A;  4WEL A;  3N8S A;  4LRZ E;  1GHI A;  4I3A A;  4DJ3 A;  3B42 A;  5EUA A;  2PR6 A;  3KX0 X;  2MJ6 A;  1K6R A;  5HWV A;  1YLT A;  1STZ A;  4U3T A;  1GA0 A;  4S2I A;  4X69 A;  4K91 A;  2EX6 A;  2J80 A;  3V3R A;  3MXQ A;  5F83 A;  3B3X A;  1XA1 A;  2VGJ A;  1LI0 A;  3UB5 P;  2OOL A;  1WYC A;  4ZJ3 A;  1CEG A;  1MZU A;  4LLO B;  3MKF A;  2KX6 A;  3RXW A;  2X71 A;  1NZO A;  3IF6 C;  4NET A;  2Z2M B;  4CLC D;  4WZ5 C;  1BT5 A;  4GD8 A;  1D7E A;  1MWS A;  5K5B A;  1YPR A;  2B18 A;  2PD8 A;  1L0G A;  1FCO A;  3T1Q B;  4WM9 A;  4BBU A;  5GHZ A;  4BMW A;  1LI9 A;  3C38 A;  3F1O A;  1IEL A;  1K6S A;  1G5U A;  1K0K A;  3H82 B;  3FPV A;  1L2S A;  4OPZ A;  4BL2 A;  5DVA A;  1OTD A;  2XH9 A;  4WEK A;  2XSS A;  1S4R A;  2O9B A;  3LY4 A;  5L09 A;  1KDS A;  4HIA A;  4N9L A;  4OQI A;  2EXB A;  4KZ3 A;  1G6O A;  1VEU A;  4KQO A;  4EEP A;  2JC7 A;  3IXH A;  2WGW A;  3HLC A;  1WYB A;  4KG5 A;  3W4O A;  4Y0O A;  3UB7 A;  5EFW A;  1T19 A;  2E8I A;  2P74 A;  3EQU A;  3Q1F A;  4CPK A;  2V0U A;  4FSF A;  3PBS A;  2Y8H A;  1PYY A;  1ESI A;  3NY4 A;  4O8G A;  4WMC D;  4Y0T A;  3L9K A;  2Y2I A;  3R4K A;  4B9O A;  5KIZ A;  3HBR A;  4O0P A;  1JWP A;  4XXR A;  2CC1 A;  4P6Z S;  5HAP A;  3M2K A;  2C5W B;  3UB9 A;  2QWS A;  4QU3 A;  1ZTU A;  3KSG A;  1BUE A;  4NXF A;  3UN7 A;  4B88 A;  4DE3 A;  3BFD A;  2WKH A;  5E2E A;  3BW6 A;  4F94 A;  4L9F A;  4EER A;  3ICY A;  3W2Z A;  4JF4 A;  4OP8 A;  5DFY A;  4RVA A;  5DTT A;  5LBR A;  1VM1 A;  4M4X A;  1GHM A;  3Q82 A;  2EFX A;  1OT6 A;  2HPB A;  4BD1 A;  3UPO A;  2ZMA A;  3AGD A;  1FCM A;  2M7U A;  2VGK A;  2HF6 A;  2P7J A;  2DMW A;  5CTN A;  3SW1 A;  2J3T C;  4MNR A;  3KSI A;  3IQA A;  4FD8 A;  3IS2 A;  2XEP A;  2H10 A;  2J9O A;  2ZC7 A;  1XJ3 A;  1Q2Q A;  4YNR A;  1I2W A;  2QMI A;  2P9V B;  1YT4 A;  4ZRR A;  1HZO A;  1XPB A;  3LGO A;  3V5M A;  3CUE A;  3PBO A;  1W5D A;  2JHE A;  3SS4 A;  1H5X A;  4X53 A;  1VHM A;  5AQA A;  3JYI A;  1GSW A;  4BBV A;  5DF9 A;  4QHC A;  2ZQ8 A;  3PBQ A;  2JE5 A;  1XFN A;  3MS6 A;  2EXA A;  3D3O A;  3SH7 A;  4NEE D;  3GDI A;  1CQA A;  3N7W A;  1L0D A;  2WAE A;  4ZAM A;  5FEF A;  2EX2 A;  5EVI C;  1ERO A;  1F9I A;  2A24 A;  2G2U A;  4IHQ A;  5IT5 A;  1KGF A;  1T18 A;  4HNB A;  3ZG7 B;  1JWZ A;  2R78 A;  4IVK A;  2W0N A;  4BL3 A;  1S1Z A;  4HH2 A;  2NUT C;  1JTG A;  2Y4A A;  5EM1 A;  1ZHH B;  3LEZ A;  4E3L A;  3S22 A;  1OME A;  2J9P A;  1X0O A;  3DTK A;  3PBT A;  4S2N A;  1KVM A;  2XA7 S;  4QPR A;  4HHD A;  4R3J A;  2JKR I;  4OON A;  5FI2 A;  2XK1 A;  5FQK A;  1XJ4 A;  1E3U A;  3QHY A;  2J3W A;  5F6A A;  2V0W A;  4Y3I A;  4GZB A;  3T4L A;  5F69 A;  2W1T A;  3GRJ A;  4DE0 A;  1DRM A;  1IEM A;  3TOI A;  4NXE A;  4EBN A;  1KGG A;  4EWF A;  3G31 A;  1SCW A;  3JVU A;  3DTM A;  1XXM A;  3D72 A;  5HDC A;  1DP6 A;  1E25 A;  4C6Y A;  3C2W A;  3BY9 A;  3N6I A;  3OCN A;  2O0Y A;  2IWB A;  1CI8 A;  3NDE A;  5A8B A;  2XF3 A;  4E3J A;  1GHP A;  4KG6 A;  4EW7 A;  4I5S A;  1SZV A;  2BAS A;  3EQV A;  1V9Z A;  1XP4 A;  3OC2 A;  3LI8 A;  3O87 A;  3ZG0 A;  1MKI A;  5J4E A;  2JN7 A;  3EGX C;  1FR1 A;  5HW3 A;  2ZBB A;  4E3O A;  1AXB A;  3T50 A;  2EFU A;  4E3N A;  1FSW A;  4FCF A;  4K08 A;  4DN0 A;  3IBR A;  5EE8 A;  1BLH A;  5DJU A;  3S7P A;  3UE0 A;  4HJ4 A;  5EVE A;  1N4O A;  1TS8 A;  4KZ4 A;  4EBP A;  1A0K A;  5F1G A;  5F82 A;  4X25 A;  2QYB A;  1QMF A;  2KOI A;  1ES3 A;  1PNE A;  3PAG A;  2XD5 A;  2H5S A;  4FH4 A;  2A3U A;  1W8Y A;  1MWU A;  2P08 A;  2HP9 A;  3CMZ A;  5FL3 A;  3IWO A;  3CUE C;  3BY8 A;  3A0R A;  4QB8 A;  3VFH A;  1NRF A;  1NXY A;  3MFD A;  1LT0 A;  4CLC C;  4S2O A;  3IF6 A;  4FUW A;  4WZ5 A;  5F68 A;  2L0W A;  3TE8 A;  2H0T A;  4L9E A;  1BZA A;  2HJE A;  5A92 A;  4GDN A;  5JYO A;  2EWW A;  3VFF A;  3C7V A;  1GSV A;  3MMH A;  2P04 A;  4L9G A;  3T4Q A;  3FKV A;  4GS9 A;  1G28 A;  3WRZ A;  1AWI A;  4JF6 A;  4JBF A;  4X1M A;  3I7J A;  3O5Y A;  1YAX A;  3SS3 A;  3A3D A;  3Q7V B;  4OPY A;  4JXW A;  4PPR A;  2B5R A;  4ME4 A;  3EEH A;  4WUJ A;  4IVI A;  1WA9 A;  1CF0 A;  3QNC A;  3F1O B;  2VX8 A;  4Z9Q A;  4O01 A;  5TBM A;  4ESP A;  2ZC6 B;  1ZKJ A;  2Y2P A;  1BYW A;  2INW A;  1ES2 A;  2Y2M A;  1BUL A;  4LV0 A;  2GNX A;  1BLC A;  3D4F A;  4WLA A;  2JKT M;  1U60 A;  1SKO A;  1P97 A;  3VP1 A;  2DRW A;  3DW0 A;  3FKW A;  3BQ8 A;  3ZHH A;  5FEG A;  1VEU B;  3T4O A;  1DJA A;  4H6J A;  3MKE A;  4NKP A;  1D06 A;  2WGW B;  2FFY A;  1OTB A;  3HLD A;  4C3Q A;  1Z6F A;  4EUV A;  3T1S A;  4BBT A;  1CK3 A;  3HLF A;  4HP9 A;  3NI9 A;  3DTE A;  5HAQ A;  3EGD C;  4HJ3 A;  1HLU P;  3LID A;  5IHV A;  4OH0 A;  2Y2J A;  2B02 A;  1KE3 A;  4KUO A;  3R7W B;  3IX8 A;  1FSY A;  3IH8 A;  5CGW A;  1W63 Q;  3PXP A;  2XR0 A;  3MBZ A;  1GSX A;  1SDN A;  3SH8 A;  4DDY A;  4C75 A;  3BRM A;  3VSL A;  5HL1 A;  2PD7 A;  4CLC E;  3KSH A;  3Q7Z A;  2FZ0 A;  3OPH A;  2HDQ A;  3D9Y A;  1DJC A;  2EX9 A;  3OPR A;  4R4S A;  3G30 A;  2OAP 1;  3ZG9 B;  4IUH A;  4YWZ A;  1N9N A;  2Z2L B;  3UB8 A;  4ZJ2 A;  2XGN A;  5DF7 A;  2GZA A;  1OTA A;  2PR5 A;  4L0L A;  4S2P A;  1FCN A;  3OCL A;  4KZ8 A;  4JXS A;  5GLA A;  3U4L P;  4DXB A;  4ETX A;  4N9K A;  4Q8I A;  3A0S A;  5IS1 A;  1S67 L;  2OLV A;  4S2K A;  2HV1 A;  1K56 A;  2G2W A;  2UV0 E;  5HFO A;  1O07 A;  4X68 A;  3ZVW A;  3AGE A;  3LIF A;  3P09 A;  2V2F F;  2XFT A;  2ZC5 B;  4EES A;  2A2L A;  5EVI A;  3HL9 A;  3HLB A;  5EVL A;  2VLG A;  3T1R A;  4EQ1 A;  4R38 A;  1ONH A;  4BQM A;  4PAU A;  2WAF A;  5F5Y A;  2XFS A;  4I39 A;  1VET B;  2WKQ A;  3B47 A;  2XRO A;  1OT9 A;  1PWC A;  2Y79 A;  3GEC A;  1SDE A;  2WKI A;  1OJ5 A;  1SKF A;  5HL6 A;  5HX9 A;  2VV6 A;  5FAQ A;  2ZQD A;  1F5M A;  4KEN B;  5HSQ A;  3LR4 A;  4OOY A;  3IXB A;  4EEU A;  1ZG6 A;  1JWV A;  1YM1 A;  5TGF A;  3GMW A;  3MJQ A;  1K4E A;  4MBH A;  3MFX A;  1PZP A;  3T4S A;  4G3W A;  3E4P A;  4LV2 A;  3NIA A;  3O86 A;  1KOU A;  2VV8 A;  4KUK A;  3VOY A;  4OKP A;  3W8K A;  1MBL A;  3IXG A;  3LIA A;  3UY6 A;  4FOF A;  4DKI A;  1K54 C;  2GDN A;  1S0W A;  1S4S A;  3IHA A;  4PKY A;  3QNB A;  4I3J A;  3KYE A;  4DE1 A;  4GKU A;  4HOI A;  2WKE A;  4HES A;  3M6H A;  5FQ9 A;  4KQR A;  3CZD A;  5GHX A;  2GJ3 A;  3E2K A;  2IWC A;  3OLO A;  5M1A A;  2IWD A;  5C5K A;  4OOM A;  3VSK A;  4OQ0 A;  2G7U A;  3UE1 A;  3T1X A;  4S2L A;  3UME A;  1NRJ A;  2DCF A;  3DAV A;  1Y28 A;  3VP0 A;  1TVF A;  2W3F A;  1PIO A;  5HPI A;  2JKF A;  1YLZ A;  1S66 L;  1LSW A;  3VE3 A;  3ZGA B;  4ZTK A;  1K38 A;  1PRQ A;  5TR7 A;  5E2G A;  2EA9 A;  3ULF A;  3UPN A;  5KZH A;  2QJ7 A;  3KO6 A;  2Q0O A;  1FIL A;  4R3B A;  2WUQ A;  5HAR A;  4N1H A;  4BJP A;  4EET B;  4IED A;  4X56 A;  3EEA A;  1H0M A;  5DTK A;  1MWR A;  3BEB A;  2OWH A;  1XFQ A;  3K2N A;  4II7 A;  4OPQ A;  4LEN A;  4KZB A;  1K55 C;  2BLS A;  2JKR M;  3M2J A;  4CLC A;  3RTY A;  4OVD A;  2BTF P;  1DP9 A;  4F3L B;  1PW1 A;  1T1C A;  3JPU A;  3IF6 B;  5L8M A;  1YQS A;  4P6Z M;  2HP5 A;  5FAO A;  3RJU A;  2YKF A;  4HH3 A;  5KSH A;  1NZU A;  2ZMV A;  3S1Y A;  1BSG A;  5CGS A;  2V20 A;  4WEJ A;  4Y17 A;  1UWP X;  3C30 A;  1TS0 A;  4MN5 A;  3WS0 A;  3JVV A;  1IYP A;  1OTE A;  1OPX A;  4GHI B;  5J7E A;  2OLU A;  3WS2 A;  4R1G A;  3G4P A;  2QJ5 A;  2PT7 A;  4RYE A;  3N4I A;  5FSR A;  4NXG A;  2W3H A;  4I38 A;  3CHW P;  3SZT A;  1I2S A;  3HUN A;  5FDS A;  2OV5 A;  5FI6 A;  4JLF A;  2GX5 A;  2VZW A;  4Q0J A;  3C4P A;  1NLZ A;  2Y91 A;  1ERQ A;  4E6X A;  3U2A A;  3F1P A;  2L4R A;  4U0T A;  2OWJ A;  1H8Z A;  2PDR A;  1LLB A;  4GW9 A;  3IWQ A;  4MN6 A;  2VA0 A;  4GJ4 A;  4UA7 A;  2B95 A;  4HP4 A;  4H8R A;  2V1B A;  2X02 A;  1ES5 A;  3KSF A;  4R23 A;  2I9V A;  4Y7P A;  1T1A A;  4GNU A;  1G6A A;  5CX7 A;  3MSH A;  4EU0 A;  4WMC A;  3KYZ A;  2JBF A;  4WZ4 A;  1Y4O A;  4LV3 A;  2PYR A;  3BM6 A;  2HZ5 A;  4MBF A;  1N9O A;  5FAT A;  1H8M A;  4LGW A;  4Y13 A;  2HDU A;  3PAE A;  1TF1 A;  5HWT A;  3RH8 B;  1DY6 A;  1W79 A;  5FQJ A;  2HJ9 C;  1XX2 A;  2R9X A;  3H7W B;  3IH9 A;  1PI5 A;  3CJM A;  2NUP C;  3BLS A;  3E4O A;  2E8J A;  5HD5 A;  1D1J A;  2FFF B;  4Y0U A;  3MQO A;  3UE6 A;  5GLB A;  1S6R A;  2XA7 M;  1PWD A;  1XJ6 A;  1LL9 A;  1YMS A;  4PM9 A; 
#chains in the Genus database with same CATH homology
 2Q9N A;  3ZDJ A;  2J7V A;  1PZO A;  2XH9 A;  5DVA A;  2ZC3 B;  4WEK A;  3NI9 A;  3WS1 A;  3ZNT A;  4CJN A;  4JPM A;  5HAQ A;  4JXV A;  3LY4 A;  4IBX A;  2ZQ9 A;  5G18 A;  5CHU A;  2PU2 A;  4K0X A;  1XA7 A;  1KDS A;  2ZM2 A;  4P0M A;  4N9L A;  5FA7 A;  4OQI A;  4E3M A;  2EXB A;  4OP5 A;  3BEC A;  4KZ3 A;  2HDR A;  1K57 A;  2WYX A;  5M19 A;  3UPP A;  1IYO A;  5IHV A;  4OH0 A;  4KQO A;  4OPR A;  2JC7 A;  5EOE A;  3ZNY A;  3IXH A;  2WGW A;  2Y2J A;  3HLC A;  3MXS A;  4E3I A;  4LV1 A;  5GHY A;  1WYB A;  1KE3 A;  4KG5 A;  4DRT A;  1IYQ A;  5KMW A;  3W4O A;  4Y0O A;  1M6K A;  1FSY A;  1VQQ A;  3IH8 A;  3UE3 A;  5FQI A;  2E8I A;  5CGW A;  3A3F A;  3LY3 A;  1RCJ A;  2XR0 A;  3MBZ A;  2P74 A;  1EWZ A;  1W8Q A;  1SDN A;  3EQU A;  5FAP A;  3SH8 A;  4DDY A;  3Q1F A;  4CPK A;  4C75 A;  4DF6 A;  3BRM A;  1XGI A;  3VSL A;  5HL1 A;  1KDW A;  1YLJ A;  1FR6 A;  4M3K A;  4FSF A;  3PBS A;  2ZM0 A;  5AQ7 A;  2Y59 A;  1HVB A;  1IKG A;  3Q7Z A;  1PYY A;  3DWK A;  1ESI A;  5CRF A;  3OPH A;  4NK3 A;  2HDQ A;  3GQZ A;  1N9B A;  3NY4 A;  4IBR A;  1RP5 A;  1JTD A;  1DJC A;  2EX9 A;  4WMC D;  3OPR A;  4R4S A;  5CER A;  3E2L A;  4Y0T A;  5CGX A;  3G30 A;  1BLS A;  4RX3 A;  3WWX A;  2Y2I A;  3HVF A;  4MLL A;  4P87 A;  4PM6 A;  3ZG9 B;  1PW8 A;  4OLG A;  2PBY A;  4EUZ A;  2Y2O A;  4PM5 A;  1MY8 A;  3HBR A;  4UHU A;  4XUX A;  1JWP A;  2Z2L B;  4XXR A;  3W4P A;  2WZX A;  3IHB A;  3IWI A;  2CC1 A;  4KZ6 A;  2DNS A;  2XGN A;  4PM7 A;  5DF7 A;  4ZJ2 A;  2Y2Q A;  4ID4 A;  3FZC A;  5HAP A;  3M2K A;  2C5W B;  3FWL A;  3HUO A;  1C3B A;  4QU3 A;  4P6B A;  3PBN A;  1BUE A;  4L0L A;  3BFF A;  4S2P A;  4QY5 A;  1FCN A;  3OCL A;  3UN7 A;  4B88 A;  4BEN A;  3BFD A;  2WKH A;  5EEC A;  4DE3 A;  4KZ8 A;  5E2E A;  4F94 A;  4JXS A;  5GLA A;  2UWX A;  4DXB A;  3VP3 A;  4N9K A;  4JF4 A;  4OP8 A;  5DTT A;  4RVA A;  4Q8I A;  1VM1 A;  2OLV A;  2ZM8 A;  2WGI A;  5M18 A;  4S2K A;  5GL9 A;  1GHM A;  3Q82 A;  2EFX A;  2WGV A;  5CXW A;  4DDS A;  2HPB A;  1K56 A;  3NBL A;  2G2W A;  3IXD A;  1CEF A;  4UAA A;  4BD1 A;  2ZMA A;  5HFO A;  3UPO A;  3N8L A;  1O07 A;  3AGD A;  3FYZ A;  4X68 A;  3OZH A;  4X6T A;  3AGE A;  1FCM A;  3P09 A;  3ZVW A;  2C6W B;  2VGK A;  2V2F F;  4XUZ A;  2XFT A;  3VOZ A;  5CTN A;  5A93 A;  2ZC5 B;  4MBK A;  5CEB A;  5EVI A;  3HL9 A;  3HLB A;  4E3K A;  1FOF A;  5EVL A;  4MNR A;  1IKI A;  1HD8 A;  3GVB A;  3IQA A;  4FD8 A;  3C4O A;  2A49 A;  2XEP A;  1ONH A;  3SS5 A;  4BQM A;  2H10 A;  2J9O A;  2ZC7 A;  3G2Y A;  1Q2Q A;  2ZQ7 A;  4QD4 A;  2Y2G A;  4QY6 A;  1I2W A;  2XLN A;  5EOO A;  2QMI A;  1YLW A;  1MPL A;  2WAF A;  2Y2N A;  5A91 A;  2P9V B;  1YT4 A;  4R4R A;  2XFS A;  3C5A A;  3BFG A;  2QPN A;  3A3E A;  4RX2 A;  3ZVT A;  5AQ9 A;  1HZO A;  5FI7 A;  1XPB A;  1ESU A;  3V5M A;  4JF5 A;  3PBO A;  1W5D A;  1DJB A;  1PWC A;  4U0X A;  1K54 A;  1NJ4 A;  1H5X A;  3SS4 A;  4X53 A;  1SDE A;  2WKI A;  5AQA A;  3OPP A;  1SKF A;  3JYI A;  4K0W A;  3VMA A;  4WBG A;  5DF9 A;  4QHC A;  5FAQ A;  5HX9 A;  2ZQ8 A;  3ISG A;  2JE5 A;  2ZQD A;  1RGZ A;  3PBQ A;  5CHM A;  2Y2K A;  5FAS A;  4KEN B;  2HDS A;  3MXR A;  4OOY A;  2EXA A;  2R9W A;  4JKT A;  1K4F A;  4YFM A;  3SH7 A;  3IXB A;  1YLP A;  2QZ6 A;  1ZG6 A;  1JWV A;  3NDG A;  4MEZ A;  4HBU A;  3N7W A;  1L0D A;  1YM1 A;  2WAE A;  3IT9 A;  5TGF A;  3GMW A;  4LCM A;  4YIN A;  3TG9 A;  4ZAM A;  3A3J A;  1KE4 A;  1K4E A;  1YMX A;  4MBH A;  2EX2 A;  3V3S A;  5EVI C;  4UA6 A;  1ERO A;  5CEC A;  1PZP A;  1HTZ A;  2G2U A;  3UDF A;  4KQQ A;  1KGF A;  1J9M A;  1H8Y A;  3PTE A;  2P9V A;  1Q2P A;  4KZ5 A;  4EV4 A;  4LV2 A;  3NIA A;  1TDG A;  4HBT A;  4X55 A;  2BG1 A;  3A3I A;  3ZG7 B;  4DXC A;  3O86 A;  5JYP A;  3GV9 A;  1JWZ A;  1ALQ A;  2ZC4 B;  3IF5 A;  4IVK A;  1LHY A;  4BL3 A;  3MZE A;  3VOY A;  2WK0 A;  2ZQA A;  2OSU A;  4OKP A;  1JTG A;  2Y4A A;  3W8K A;  1MBL A;  1NYY A;  3IXG A;  2WZZ A;  1G68 A;  3VP2 A;  3RXX A;  3LEZ A;  3UY6 A;  4DKI A;  4E3L A;  4EQI A;  3S22 A;  1OME A;  1K54 C;  4E6W A;  2GDN A;  3G34 A;  2J9P A;  4BD0 A;  1S0W A;  4EBL A;  3IHA A;  3ITB A;  2XQZ A;  1K25 A;  3PBT A;  2JCH A;  5GLC A;  4S2N A;  1ES4 A;  1KVM A;  3LO7 A;  3QNB A;  1K57 C;  3P98 A;  1MXO A;  4DE1 A;  4RA7 A;  4GKU A;  3ZFZ A;  2WKE A;  1K56 D;  1FQG A;  4HES A;  2WAD A;  2HP6 A;  1RGY A;  3M6H A;  4R3J A;  5EVI B;  5FQ9 A;  4KQR A;  4OON A;  4OQG A;  3CZD A;  3M6B A;  3DWZ A;  5FI2 A;  5GHX A;  2XK1 A;  5FQK A;  3G2Z A;  3OPL A;  3E2K A;  1E3U A;  2IWC A;  3BLM A;  5M1A A;  2IWD A;  3QHY A;  5EPH A;  5E43 A;  4OOM A;  5A90 A;  5EVI D;  3VSK A;  4OQ0 A;  3UE1 A;  1K55 A;  3GSG A;  4S2L A;  3O88 A;  3BYD A;  3UDX A;  2DCF A;  3S4X A;  1YLY A;  4S2M A;  4GZB A;  4DE2 A;  1ONG A;  4P85 A;  3MZD A;  5D3O A;  3BFE A;  1KE0 A;  4GD6 A;  3HLG A;  4A5R A;  3HRE A;  1TVF A;  2ZLY A;  3GRJ A;  3BFC A;  1IEM A;  5AQB A;  3VP0 A;  4DE0 A;  3AGF A;  3TOI A;  4KZA A;  5L2F A;  1PIO A;  4EBN A;  1KGG A;  2ZJ9 A;  1YLZ A;  4EWF A;  1XGJ A;  3G31 A;  3G32 A;  1SCW A;  1NY0 A;  3ZGA B;  4ZTK A;  5FQQ A;  4S2N C;  3CG5 A;  3HLE A;  1PWG A;  1K38 A;  3DTM A;  5J8X A;  1XXM A;  4PM8 A;  5TR7 A;  5BOH A;  1E25 A;  2PU4 A;  5E2G A;  4C6Y A;  3UPN A;  4GB7 A;  4KZ9 A;  5KZH A;  4UA9 A;  3TSG A;  5CTM A;  2H0Y A;  3MZF A;  4LCL A;  3N6I A;  1LL5 A;  3OCN A;  4R3B A;  2IWB A;  1CI8 A;  2WUQ A;  5HAR A;  4N1H A;  3NDE A;  4BJP A;  4IED A;  2XF3 A;  4X56 A;  2ZD8 A;  4QJG A;  5DTK A;  3Q7V A;  1MWR A;  3BEB A;  4E3J A;  1GHP A;  4KG6 A;  3UNW A;  4OPQ A;  3EQV A;  4JXG A;  2ZQC A;  4LEN A;  3V50 A;  4KZB A;  1K55 C;  2RL3 A;  1XP4 A;  1BLP A;  2BLS A;  3OC2 A;  3O87 A;  3ZG0 A;  1MKI A;  3M2J A;  1W7F A;  1FR1 A;  5U47 A;  3G35 A;  5HW3 A;  3ITA A;  4OVD A;  1IYS A;  3SOI A;  4E3O A;  1Y54 A;  1AXB A;  1E4D A;  1PW1 A;  4GOG A;  4O7D A;  1KGE A;  3IF6 B;  2EFU A;  4E3N A;  1FSW A;  3V39 A;  4FCF A;  1M40 A;  1YQS A;  2V1Z A;  2HP5 A;  5FAO A;  5EE8 A;  3RJU A;  1BLH A;  1EI5 A;  5DTS A;  3W4Q A;  4D2O A;  3UE0 A;  1L0F A;  2Y2L A;  5KSH A;  1N4O A;  1NZU A;  4KZ4 A;  3LCE A;  4EBP A;  4WYY A;  1PI4 A;  5F1G A;  5F82 A;  3S1Y A;  1BSG A;  5CGS A;  5FDH A;  5DF8 A;  4ZBE A;  5TFQ A;  1QMF A;  2I72 A;  2V20 A;  4WEJ A;  1ES3 A;  3PAG A;  2XD5 A;  2H5S A;  4FH4 A;  2A3U A;  1W8Y A;  1MWU A;  3SH9 A;  4B4X A;  4KZ7 A;  2HP9 A;  2XD1 A;  3CMZ A;  3WS0 A;  3IWO A;  3ZG5 A;  1IYP A;  3WRT A;  1E3U D;  4S2J A;  4GDB A;  3C7U A;  3UO9 A;  2Q9M A;  4QB8 A;  3VFH A;  3HLW A;  3NC8 A;  2OLU A;  1NRF A;  1NXY A;  3WS2 A;  3MFD A;  3G4P A;  4OQH A;  4R1G A;  4B4Z A;  4S2O A;  1BTL A;  3IF6 A;  3Q81 A;  4RYE A;  3N4I A;  2Y2H A;  5FSR A;  4WZ5 A;  2Y55 A;  5E2H A;  2H0T A;  1GCE A;  5GLD A;  1QME A;  1BZA A;  1I5Q A;  4OLD A;  4WEL A;  3N8S A;  1GHI A;  5A92 A;  5F1F A;  1KVL A;  3WS5 A;  1I2S A;  1WE4 A;  5EUA A;  3HUN A;  1ERM A;  2OV5 A;  4GDN A;  1MWT A;  2XDM A;  5FI6 A;  4JLF A;  3UDI A;  3VFF A;  5JYO A;  5FQM A;  3C7V A;  3C4P A;  1K6R A;  2Y91 A;  1ERQ A;  4E6X A;  3FKV A;  3WRZ A;  1YLT A;  4U0T A;  1NYM A;  4U3T A;  1GA0 A;  4S2I A;  1H8Z A;  1ZC2 A;  1LLB A;  4JF6 A;  4JBF A;  3I7J A;  3IWQ A;  3SS3 A;  3A3D A;  3Q7V B;  4OPY A;  1CI9 A;  2EX6 A;  4JXW A;  4K91 A;  4X69 A;  4ZJ1 A;  4UA7 A;  4PPR A;  1ZG4 A;  2B5R A;  3V3R A;  4ZDX A;  4H8R A;  5F83 A;  2X02 A;  3B3X A;  1XA1 A;  4IVI A;  2EX8 A;  1ES5 A;  5E2F A;  4R23 A;  4Y7P A;  4HEF A;  3QNC A;  4R0Q A;  2VGJ A;  3FV7 A;  4Z9Q A;  4GNU A;  1LI0 A;  3HUM A;  1WYC A;  1G6A A;  3PBR A;  4ZJ3 A;  1CEG A;  4N1X A;  5KSC A;  2X01 A;  3MKF A;  3Q07 A;  4WMC A;  1JVJ A;  2JBF A;  3RXW A;  2ZC6 B;  4N92 A;  4LV3 A;  4WZ4 A;  2X71 A;  1XKZ A;  3BM6 A;  1NZO A;  1ZKJ A;  1TDL A;  2Y2P A;  3IF6 C;  4MBF A;  2Z2M B;  4NET A;  5FAT A;  1ES2 A;  3ZG8 B;  4WZ5 C;  2Y2M A;  3N8R A;  1BUL A;  1BT5 A;  4GD8 A;  2HDU A;  4LV0 A;  3VP4 A;  3PAE A;  1BLC A;  5CED A;  3D4F A;  1MWS A;  1DY6 A;  1W79 A;  1GA9 A;  5FQJ A;  4KG2 A;  5CHJ A;  4BLM A;  1U60 A;  4GN2 A;  4PMA A;  1TEM A;  1XX2 A;  3VP1 A;  5I94 A;  2DRW A;  3DW0 A;  2R9X A;  3FKW A;  1L0G A;  3ZHH A;  1FCO A;  3GTC A;  3IH9 A;  1DJA A;  1O7E A;  1PI5 A;  3MKE A;  4WM9 A;  3NCK A;  5HAI A;  3CJM A;  2WGW B;  3ZCZ A;  3BLS A;  3O3V A;  5GHZ A;  1LI9 A;  2FFF B;  1SHV A;  1L0E A;  2FFY A;  4FH2 A;  4Y0U A;  4OOL A;  3GR2 A;  2J8Y A;  2RCX A;  3HLD A;  1IEL A;  1K6S A;  4C3Q A;  5GLB A;  1Z6F A;  1S6R A;  1PWD A;  1L2S A;  1CK3 A;  4OPZ A;  4BL2 A;  1LL9 A;  3HLF A;  3WS4 A;  1YMS A;  4PM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...