5FQKA

W229d and f290w mutant of the last common ancestor of gram-negative bacteria (gnca4) beta-lactamase class a bound to 5(6)-nitrobenzotriazole (ts-analog)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
263
structure length
263
Chain Sequence
b'AALSEQLAELEKRSGGRLGVAVLDTATGRRFGYRGDERFPMCSTFKALLAAAVLARVDQGKENLDRRITYGKEDLVDYSPVTEKHVGDGMTVAELCEAAITYSDNTAANLLLEALGGPAALTAFLRSIGDNVTRLDRWEPELNTAAPGDPRDTTTPAAMAATLRTLLLGDVLSPASRQQLVDWLIANKTGDKRLRAGLPADDRVGDKTGTGEHGTTNDIAVIWPPNRAPILVAVYLTESQVDADARDAVIAEVARLVVAAWHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GNCA4 LACTAMASE W229D AND F290W
publication title De novo active sites for resurrected Precambrian enzymes.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Hydrolase
total genus 99
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5fqkA00
1ESUA 1L0DA 1MWRA 3NI9A 4KZ9A 1GHMA 2Y2KA 1ZC2A 4KZ4A 5EVIA 3IXGA 2P9VA 2XR0A 3IF6A 3SOIA 1BLSA 5AQ9A 4WYYA 3IWIA 4FSFA 2Y2IA 1K38A 1XP4A 2WAEA 4JXVA 2X02A 4LCLA 1M40A 4U0XA 3BFCA 3N8RA 4S2PA 4Y7PA 1TVFA 3FZCA 2PBYA 5HFOA 1MBLA 4IBRA 4DE1A 1YLYA 5AQAA 3OCLA 4WZ5C 2OLUA 1XA7A 5E2FA 1L0FA 1K4FA 2ZC4B 2RCXA 4GN2A 5FI6A 4DXCA 1MWTA 4HESA 2OSUA 1JVJA 1MXOA 1XGJA 2HPBA 4S2JA 3S4XA 1IYPA 4N9LA 2WGWA 4UAAA 4O7DA 2ZD8A 2DRWA 2EX6A 1Z6FA 1H8ZA 3ITBA 4LV2A 4IBXA 1GHPA 5GLCA 1ZG4A 2H0YA 1PIOA 1YLZA 1BLPA 2XQZA 3HLWA 1XX2A 5AQ7A 5EVIB 2WKIA 2HP6A 2P9VB 2PU4A 4EV4A 3ZNYA 5FA7A 5A93A 4UA7A 4U0TA 3IT9A 1K54A 3BFDA 3FV7A 4GZBA 3ITAA 4HEFA 5HAQA 1FQGA 2Q9NA 4D2OA 3CZDA 3SH8A 5M19A 2WZZA 4IEDA 3N4IA 3TSGA 3OC2A 3BECA 2Y2GA 2ZQAA 3GMWA 3O87A 1YLJA 2WUQA 2WZXA 4PM6A 3UPOA 3NBLA 1ESIA 1L0GA 2EFXA 3QNCA 4OQGA 4KENB 4Y0TA 3PAGA 4UHUA 4C75A 1PW8A 3SH9A 1PWCA 2Y4AA 3C7VA 3WWXA 5U47A 1DJCA 1KE4A 5FQIA 4GKUA 1IYQA 4K91A 1K55C 2H10A 3ISGA 1DJBA 4P87A 2ZMAA 3CJMA 5BOHA 2XF3A 1YMSA 4NK3A 1YLPA 2EX2A 2A49A 2XK1A 3NDGA 4OQ0A 3O3VA 2Y91A 5AQBA 4QU3A 3WS0A 4B88A 4RX3A 4MBKA 3BM6A 5E2HA 3Q7VA 2EX9A 5CERA 4QB8A 1WE4A 2XGNA 5E43A 1Q2QA 3O86A 4OQIA 4E3MA 5CEDA 3UO9A 2DNSA 4YINA 5FSRA 4BL3A 5GLAA 4DF6A 4WBGA 4MBHA 1TDLA 4GDNA 2FFFB 4PM5A 1I2SA 4S2KA 1W79A 4JF4A 4WELA 1FOFA 3EQVA 3Q81A 4JXGA 1YLTA 5A91A 2JC7A 2WYXA 2Y2PA 3VP1A 1KGFA 1BTLA 2X71A 4ZBEA 3TOIA 4GOGA 3ZVWA 3OZHA 3S1YA 3UDIA 4H8RA 3WRZA 5FASA 1U60A 1J9MA 2XH9A 1OMEA 1K6RA 5FQQA 4DE3A 4KG6A 3AGFA 3IXHA 4DXBA 3HLFA 1TDGA 1RP5A 1VQQA 1XXMA 1I5QA 1PWDA 2J9PA 3IXBA 3GV9A 3Q7VB 3BFEA 5FQMA 5CTMA 3WRTA 2IWDA 2WKEA 3C4OA 4OPYA 1MY8A 2QPNA 4E3NA 3SS3A 2XEPA 5F1GA 3HLDA 3HUMA 5CGXA 2ZC6B 4S2MA 4C3QA 4KZ5A 1KVLA 2R9XA 1K57A 1ZKJA 3DWZA 2J9OA 4KZ7A 1NYMA 5DVAA 4DDYA 5CGSA 3LY4A 5EVLA 3V3SA 2EFUA 1FSWA 4P85A 2OLVA 2XFTA 3IQAA 3VOZA 1SCWA 3BFFA 3GSGA 4N9KA 1XA1A 4OKPA 3PAEA 3V50A 3ZG7B 2J8YA 1FCMA 3BLSA 4JF5A 4DE2A 1IKGA 3PBTA 1VM1A 2XD1A 5FQKA 1SKFA 4KG2A 1FR1A 4EWFA 2GDNA 5TGFA 4KZ3A 2ZQ7A 3NCKA 3AGEA 4WM9A 4ZJ2A 3MBZA 1NY0A 1CEFA 3FKVA 3FYZA 4LV1A 4X68A 3MZDA 1Y54A 3HUOA 3FWLA 5FQJA 3GQZA 3P09A 3WS2A 1IYSA 4XUZA 5F83A 4E3LA 3A3IA 5CEBA 1BULA 5G18A 3VP0A 3UE1A 2Y2MA 2FFYA 4QD4A 3RXXA 4QJGA 4U3TA 5EVIC 3EQUA 5KZHA 2Y55A 5FI2A 1JWZA 2OV5A 3IF6C 4UA6A 3HLEA 1K4EA 2ZM0A 3SH7A 1KE3A 3BFGA 4B4XA 3WS1A 2V20A 3E2KA 3G4PA 2P74A 3IF6B 3VOYA 5EECA 1RGYA 3UPNA 5GHZA 1YLWA 4K0WA 5DF9A 1ES2A 4OVDA 2A3UA 4OQHA 2XLNA 4JBFA 3O88A 5EUAA 3OPPA 3NDEA 1KGGA 4OOYA 3V39A 1KDSA 4S2OA 4ID4A 1W8YA 1LLBA 2ZQ9A 5L2FA 2JE5A 1GA9A 3ZGAB 4C6YA 4K0XA 2VGKA 4QY6A 4F94A 2WGWB 4OH0A 3VP2A 4DE0A 2WADA 1IELA 3E2LA 4BD1A 3ZHHA 5GHYA 4DDSA 4MBFA 3ZNTA 1ES3A 2QMIA 3FKWA 4N1HA 3RJUA 2XFSA 4ZJ1A 3W4OA 3G32A 4R4SA 4OPQA 1WYBA 5M1AA 5DTSA 1LL5A 4ZDXA 1K54C 4A5RA 1ERMA 3N6IA 3HBRA 3DTMA 3Q7ZA 4KZBA 3WS5A 4KQQA 3ZG0A 2E8IA 4X69A 1CI9A 3IH8A 1EROA 3PBQA 4E3JA 3IHBA 2ZM2A 3ZDJA 3ZG9B 1SDEA 5JYPA 5CGWA 2Y2LA 1JWVA 3BLMA 4WEJA 1DJAA 3GTCA 4KQOA 1KVMA 3IXDA 1JTDA 2ZC3B 4S2IA 1K56D 5CHUA 3LO7A 4Z9QA 3TG9A 3UDFA 2Z2LB 4JF6A 4LENA 3MKFA 1EWZA 4GD6A 4P0MA 4ZTKA 4N92A 2Y2QA 2Y59A 4S2NA 3UE3A 1ES4A 3S22A 3W4QA 3C7UA 5IHVA 4NETA 4GD8A 4QHCA 2C5WB 1XPBA 3ZFZA 5CECA 3M2JA 5HL1A 3HLCA 5FAOA 2QZ6A 3UNWA 1PZPA 1YM1A 3QHYA 1ONGA 5TR7A 1LHYA 5F82A 4E3KA 1FCOA 4OPRA 1XGIA 3M6HA 3VP4A 1KE0A 2R9WA 3GVBA 2ZM8A 2G2UA 3NIAA 3Q1FA 1ONHA 3HVFA 3SS4A 1FR6A 1LI9A 3A3FA 4RX2A 2EX8A 4OONA 2BG1A 5TFQA 4RA7A 3V5MA 3G2ZA 4E6XA 2Y2JA 3LY3A 3ZVTA 1QMFA 3A3DA 3IH9A 5HAPA 3MXSA 2V1ZA 1BSGA 4QY5A 2C6WB 3IWOA 2WK0A 5EOEA 2ZQ8A 4HBUA 2H0TA 4JXWA 3PBSA 1CI8A 4M3KA 1E25A 1NRFA 2XD5A 5DTTA 5KSCA 1KGEA 1MWUA 3C4PA 4HBTA 1QMEA 4JPMA 4PPRA 4UA9A 5GHXA 4R0QA 4EBPA 4EUZA 3V3RA 1K56A 3G31A 1HTZA 3VP3A 4GNUA 5CXWA 1IEMA 4WZ5A 3A3EA 2HP9A 3M6BA 5DTKA 5E2GA 5FAQA 3IWQA 3BYDA 1N4OA 4X55A 3VMAA 1W8QA 4BD0A 4KQRA 1SDNA 4OP5A 3IF5A 4E6WA 3N8LA 2VGJA 4XUXA 4XXRA 1LI0A 4R4RA 3BEBA 1PZOA 4WZ4A 2JBFA 3JYIA 1IYOA 2BLSA 1BLCA 2CC1A 1NZUA 2Y2NA 4LCMA 1K57C 1L0EA 1ERQA 3G2YA 1PWGA 2WKHA 1NXYA 3IHAA 1PI5A 1DY6A 4KG5A 3RXWA 1YQSA 3UY6A 4YFMA 4CPKA 2J7VA 5D3OA 1S6RA 3D4FA 1HVBA 5F1FA 4BL2A 3PBRA 1RCJA 5I94A 3P98A 1K6SA 5HX9A 4OLGA 3HLBA 1MKIA 2B5RA 3WS4A 4X53A 2Z2MB 4OOLA 4BJPA 4PM7A 5J8XA 3OCNA 3I7JA 1GHIA 4R3JA 5FI7A 4E3OA 2IWBA 1N9BA 2V2FF 3GR2A 3ZCZA 1PI4A 3G35A 3MFDA 3QNBA 4X56A 4Q8IA 4DRTA 1TEMA 4OP8A 1MWSA 1E3UD 1HD8A 1E4DA 3C5AA 1GCEA 4FH4A 3NY4A 1K25A 1PYYA 3OPHA 2EXBA 1HZOA 4N1XA 3W4PA 1G68A 5FQ9A 4FH2A 4E3IA 1XKZA 1YT4A 4S2LA 1IKIA 3Q07A 1CEGA 1K55A 2Y2OA 2HDRA 5KMWA 4R3BA 2IWCA 3DWKA 4LV0A 4EBNA 2JCHA 1L2SA 3BRMA 4MLLA 3CMZA 3OPLA 2WAFA 3MZFA 3AGDA 1ALQA 5FDHA 3HLGA 3CG5A 5E2EA 4JXSA 4PM9A 5M18A 3A3JA 4MNRA 3UDXA 2RL3A 1S0WA 4P6BA 1SHVA 5A90A 1LL9A 4LV3A 3GRJA 3HREA 4Y0OA 3VFHA 3G30A 3PTEA 1I2WA 1H5XA 2G2WA 2Y2HA 3SS5A 4OLDA 1FSYA 1C3BA 4EBLA 5KSHA 5FAPA 4MEZA 1JTGA 1O07A 4FCFA 2PU2A 1RGZA 1W5DA 2I72A 4RVAA 3VSKA 4WMCD 1PW1A 5HW3A 4GDBA 5EOOA 3MXRA 3ZG5A 4BLMA 1YMXA 2EXAA 1CK3A 4JLFA 1NYYA 4WEKA 1BT5A 4BENA 1E3UA 5EE8A 5CTNA 5GLDA 2HDUA 2WGVA 5EVID 2HDSA 3PBNA 3VSLA 2HP5A 2ZQCA 3N7WA 3LCEA 3DW0A 2HDQA 3Q82A 1NZOA 3OPRA 4ZAMA 3UE0A 5DF7A 2UWXA 4B4ZA 3PBOA 4DKIA 1W7FA 3UN7A 1BZAA 5CHJA 5FATA 1GA0A 2Q9MA 4PMAA 4GB7A 1ES5A 1JWPA 3W8KA 3LEZA 2ZC5B 4X6TA 5CHMA 4CJNA 1FCNA 5A92A 4R1GA 5DF8A 2ZQDA 3MZEA 5GL9A 1WYCA 5HARA 3B3XA 4OPZA 4S2NC 1G6AA 5CRFA 3VFFA 5JYOA 4ZJ3A 2ZC7A 2WGIA 3ZG8B 4KZAA 4PM8A 4BQMA 2XDMA 2ZLYA 3MKEA 3N8SA 4Y0UA 1BUEA 3UPPA 1H8YA 4IVIA 4OOMA 1EI5A 2ZJ9A 2X01A 1BLHA 5GLBA 3M2KA 4RYEA 2H5SA 1KDWA 1NJ4A 1ZG6A 3NC8A 4WMCA 5EPHA 2DCFA 1M6KA 4L0LA 3G34A 1O7EA 1MPLA 5HAIA 4R23A 4FD8A 4JKTA 4EQIA 1Q2PA 1AXBA 3HUNA 4IVKA 4KZ6A 4KZ8A 3HL9A
chains in the Genus database with same CATH superfamily
1L0DA 4NXEA 3NI9A 2Y2KA 1ZC2A 3NOPC 3IXGA 2P9VA 3SOIA 5AQ9A 1K38A 5C5KA 2X02A 1M40A 4K08A 1TVFA 3FZCA 3NJAA 4DE1A 5AQAA 3OCLA 1L0FA 1K4FA 2PDRA 2ZC4B 3TJZC 4O01A 2OSUA 1MXOA 1EW0A 4S2JA 3F1PA 4N9LA 2DRWA 4F3LA 1LSVA 3VV4A 4O8GA 4MN5A 4P6ZM 4Y13A 2PU4A 4ETZA 5HWWA 2O9AA 4EV4A 5A93A 5FA7A 4HEFA 2Q9NA 5M19A 1F9IA 2VGLS 4X25A 3U2AA 2WZZA 2VEAA 3BECA 2P08A 2Y2GA 3O87A 1YLJA 2WUQA 5DFYA 1OJ5A 3T50A 4Y0TA 1PW8A 2BASA 2UV0E 3WWXA 3KSGA 5U47A 1DJCA 1DJBA 2XF3A 3P7NA 3NDGA 2Y91A 5EM0A 4R70A 4PKYG 2XGNA 2JN7A 1Q2QA 4D60A 4PM5A 4S2KA 4WELA 1FOFA 1YLTA 3H7WB 3MMHA 3TOIA 3OZHA 2VLGA 1N9OA 4H8RA 4JGQA 3WRZA 3OLOA 2LB5A 2XH9A 1XJ4A 3AGFA 3IXHA 1TDGA 4FOFA 1I5QA 1G28A 3U4LP 4WF0A 5FQMA 3WRTA 5IS1A 4Y5FA 2ZC6B 4C3QA 1K57A 4KZ7A 2J3WA 3E4OA 4DDYA 4B9OA 1T1AA 3BWLA 4M4XA 4JF5A 1H0MA 1VM1A 5FQKA 4EETB 4WM9A 4X1MA 3FYZA 5J3WA 3H82A 3HUOA 5FQJA 3WS2A 4XUZA 3QP2A 3A3IA 3NOTC 3UE1A 4QD4A 2QHKA 1D06A 3RXXA 3EQUA 2OV5A 2VA0A 4B4XA 5DKKA 3E2KA 3IF6B 2P74A 4HOIA 5EECA 1UWNX 5GHZA 1N9LA 3A0RA 1ES2A 3FG8A 4OVDA 2QJ7A 3O88A 1V9ZA 4ID4A 5HWVA 4F94A 1N9NA 2VJWA 2WADA 3E2LA 3HJIA 3KYEA 4DDSA 1ES3A 2QMIA 3FKWA 2XFSA 4ZJ1A 2XA7M 1LT0A 4R4SA 1ZTUA 1WYBA 5M1AA 1K54C 2IA2A 3WS5A 4X69A 5HZHA 1EROA 4MN7A 4E3JA 3IHBA 2PYRA 3ZG9B 5JYPA 3CLOA 4WEJA 1JTDA 4JGRA 3LEQA 3LO7A 3UDFA 2Z2LB 1XFQA 2ZOIA 3S22A 3C7UA 5IHVA 5HL1A 3HLCA 5FAOA 3UNWA 1PZPA 1YM1A 5F82A 4E04A 2R9WA 3Q1FA 3HVFA 1FR6A 4NXBA 2W0NA 3TE8A 3VE3A 3G2ZA 4KUKA 5HAPA 2WK0A 5EOEA 4JXWA 4G3WA 1CI8A 4HBTA 4PPRA 4UA9A 3LR0A 4EBPA 3VP3A 5CXWA 5E2GA 4WZ5A 5DTKA 3IWQA 3VMAA 1N4OA 4BD0A 5L10A 4EESA 3QP1A 5HL6A 3IF5A 4E6WA 3N8LA 3T4JA 4R4RA 3BEBA 4WZ4A 1IYOA 2BLSA 1BLCA 2V1BA 1YSQA 5TBMA 1P97A 2J7VA 3S7NA 1S6RA 5HX9A 4IHQA 4BJPA 2ZMFA 1GHIA 3C38A 5FI7A 2PR5A 2IWBA 1N9BA 2V2FF 2PR6A 1PI4A 3MFDA 1E3UD 2OWHA 3LYXA 4FH4A 2PYPA 3NOUC 1G68A 5FQ9A 4FH2A 1XKZA 1IKIA 3KSHA 2GX5A 5KMWA 2JCHA 3MQ0A 1S67L 1ALQA 5FDHA 2M7VA 5E2EA 3PHYA 5M18A 2A24A 3A3JA 1S1ZA 3UDXA 3LIEA 1S0WA 4P6BA 1SHVA 3GRJA 1NRJA 3PTEA 3H7WA 4OLDA 1FSYA 1C3BA 5KSHA 1JTGA 2PU2A 3TW8A 1XJ3A 1D7EA 3ZG5A 4BLMA 1SKOB 1CK3A 1E3UA 3UB8A 5EVID 2HDSA 3T1XA 3PBNA 2HP5A 3A0VA 2HDQA 3Q82A 1NZOA 3OPRA 4ZAMA 3IX8A 3UE0A 3PBOA 4FUWA 1GA0A 2Q9MA 4X6TA 4LFUA 1FCNA 4QWOA 5A92A 4S2NC 1VEUB 1G6AA 3UB9A 4ZJ3A 4PM8A 4BQMA 3IS2B 3MKEA 4Y0UA 3UPPA 2L4RA 4BBUA 4WUJA 3EGXC 2BTFP 5EPHA 4L0LA 5L8MA 1O7EA 4EQIA 4KZ8A 4KZ6A 3HL9A 3R7WB 4KZ9A 1GHMA 4XT2B 5EVIA 4KZ4A 3IF6A 1BLSA 1XP4A 4JXVA 3QP5A 4LCLA 3BFCA 3N8RA 4S2PA 3KX0X 4Y7PA 2PBYA 2OLUA 1G6OA 4Z1WA 1SZVA 4HESA 2B02A 2HPBA 2W1RA 2ZD8A 4NXFA 3BW6A 1TS7A 2H0YA 1PIOA 4MCWA 2XQZA 5AQ7A 1S4SA 5CX7A 4U0TA 2V0WA 4GZBA 5HAQA 4HJ6A 3SH8A 3T4LA 4R38A 1MZUA 3UMEA 1XFNA 5DJTA 4IEDA 1YPRA 3DAVA 5HPFA 2ZQAA 2WZXA 3NBLA 2AVXA 3OOVA 3EEAA 3LUQA 3ICYA 4KENB 3C7VA 1T18A 1K55C 5BOHA 3T1SA 4YNRA 4NK3A 5LBRA 4B88A 2P04A 5F6AA 5AVFA 3Q7VA 4QB8A 1WE4A 5E43A 3O86A 4OQIA 2OAQ1 5L07A 3CPTA 4DF6A 1TDLA 3DBAA 2FFFB 2YKHA 3QP4A 2H28A 3RTYA 5EM1A 2WYXA 1YSPA 3P01A 3VP1A 3CUEA 1W63Q 3ZVWA 4BBTA 3QP8A 4MMNA 3K2NA 4NXGA 4DE3A 1PRQA 5HWTA 2L1MA 3D3OA 1XXMA 1PWDA 3C4OA 2WKEA 4OPYA 2QPNA 4HY8A 3SS3A 2JKGA 1P0ZA 1ZKJA 5DVAA 3CI6A 5CGSA 5EVLA 5HPIA 1FSWA 4P85A 2OLVA 2JHEA 5G4ZA 3IQAA 3O5YA 3T4OA 1OT9A 3BFFA 4N9KA 2WKQA 5FL3A 1FCMA 3BLSA 4I3IA 1X0OA 1STZA 2XD1A 4DJ3A 1FR1A 3K3CA 3CITA 5TGFA 3NCKA 4ME4A 3BQ8A 3MZDA 3FWLA 3GQZA 3P09A 1IYSA 1YKDA 4E3LA 1BULA 2Y2MA 2FFYA 4L9GA 4QJGA 4U3TA 2Y55A 1JWZA 1K4EA 3SH7A 3VOLA 2P7JA 4L9FA 4R3AA 3G4PA 2V8FA 3LGOA 3UB7A 5DF9A 2A3UA 4OQHA 2XLNA 4JBFA 1V9YA 5EUAA 2GNXA 3OPPA 4OOYA 4HH3A 4S2OA 1W8YA 2O0YA 1LLBA 2ZQ9A 2EWWA 1GA9A 2R78A 2VGKA 4QY6A 1IELA 1SKOA 4PAUA 2GJ3A 3ZNTA 3F1OA 4ESPA 3KYQA 4OPQA 5DTSA 1LL5A 3LIAA 2Z6CA 3IBRA 1ERMA 2W3EA 3HBRA 4KZBA 3ZG0A 3IH8A 3PBQA 4Y2FA 1GSVA 3MJQA 3HCYA 5CGWA 2Y2LA 1JWVA 1DJAA 1UWPX 3GTCA 4JGOA 3KYZA 4S2IA 5CHUA 3TG9A 4Z9QA 4JF6A 3MKFA 3LR3A 4P0MA 4ZTKA 4N92A 1ES4A 3IS2A 3W4QA 4GHIB 4NETA 4EU0A 3M2JA 4E3KA 1LHYA 4OPRA 1XGIA 5HD3A 2ZM8A 4CLCB 1VHMA 3C8CA 1LI9A 3MFXA 2BG1A 2ZBBA 1F5MA 2O9BA 3ZVTA 1QMFA 3IH9A 2O99A 2GZAA 2C6WB 3F1NB 2WKPA 4HBUA 5IU1A 4M3KA 2XD5A 1ZHHB 5DTTA 5KSCA 1KGEA 1MWUA 4EUZA 1QMEA 4HP9A 5GHXA 5HD5A 4RQ9A 1HTZA 3B42A 5HDDA 1W8QA 4KQRA 4XXRA 1PZOA 2JBFA 3CAXA 3JYIA 2PHYA 1VETA 4LCMA 1K57C 4Y15A 1PWGA 2WKHA 1DY6A 4KG5A 1YQSA 4EQ1A 4P6ZS 5D3OA 5F1FA 3T4SA 4BL2A 3PBRA 1RCJA 3P98A 1K6SA 3WS4A 3OCNA 3I7JA 2I9VA 3QNBA 3C5AA 1E4DA 1K25A 2HV1A 2W3DA 3OPHA 1HZOA 3W4PA 2VZWA 3MXQA 4S2LA 3R4KA 2IWCA 3DWKA 3OPLA 5EVEA 4DN0A 3HLGA 3CG5A 1Y4OA 4JXSA 4ZRRA 4MNRA 3C30A 4LV3A 3MSHA 4Y0OA 3VFHA 3G30A 4NKPA 2Y2HA 1DP6A 2QJ5A 1O07A 1JNUA 3S7PA 2ZL1B 3MR0A 2I72A 2J3TD 4UQIM 5HW3A 3MXRA 4II7A 1YMXA 3T1RA 4JLFA 5GLDA 5AVEA 1Y28A 2ZQCA 5J4EA 3DTIA 2W1TB 5DF7A 2UWXA 1J3WA 2VV7A 1W7FA 5CHJA 5FATA 1ES5A 1JWPA 3W8KA 3LEZA 3E4PA 4ETXA 5DF8A 3RFBA 5GL9A 3VFFA 3B3XA 2ZC7A 2V9AA 3ZG8B 4EXOA 4OOMA 2ZJ9A 2X01A 1OTDA 4HQAA 3M2KA 3EWKA 1KDWA 3NC8A 2DCFA 1M6KA 3G34A 1MPLA 5HAIA 4R23A 4I3AA 1Q2PA 3HUNA 4FSFA 4Q0JA 4HIAA 4U0XA 1TF1A 2FZ0A 1MBLA 4IBRA 4WZ5C 1XA7A 2RCXA 2K2NA 3NHQA 4DXCA 3T1QB 1MWTA 2JKTI 2OAP1 1JVJA 4CLCD 1YAXA 3S4XA 4UAAA 3UE6A 1H8ZA 4LV2A 4IBXA 1GHPA 1ZG4A 1OTAA 2D01A 1BLPA 1TS0A 3HLWA 1XX2A 2P9VB 2XA7S 3RH8B 3IT9A 3FV7A 1FQGA 3CZDA 4KQDA 1NLYA 3N4IA 3BY9A 3OC2A 3TSGA 4CQHA 4PM6A 3UPOA 1OPXA 2Z6DA 3T4QA 1L0GA 3F1PB 4GS9B 1S66L 4CLCE 4UHUA 3SH9A 2JKTM 2VKSA 2Y4AA 4GHIA 4BMWA 4UQIS 4EUVA 5FQIA 1IYQA 2H10A 3ISGA 3KO6A 1DP8A 4P87A 2ZMAA 3CJMA 1YMSA 1YLPA 2A49A 1XJ6A 2XK1A 5AQBA 4CLCA 4QU3A 4RX3A 4MBKA 4LRYC 3BM6A 2OWJA 3MQQA 4YINA 4BL3A 5GLAA 1DRMA 4MBHA 2NUPC 4GDNA 1W79A 4JF4A 1CF0A 3EQVA 3F1NA 5A91A 2JC7A 1KGFA 1BTLA 2X71A 4GOGA 3S1YA 5FASA 2EA9A 1IFQA 1OMEA 5FQQA 4DJ2A 1DP9A 1OTBA 4KG6A 4NEED 4DXBA 5K5BA 1RP5A 1VQQA 1S4RA 2J9PA 3IXBA 1K0KA 2IWDA 1MY8A 2XEPA 2XRNA 3HUMA 3C2WA 4HJ4A 1NLZA 2M1CA 2R9XA 3DWZA 3CWFA 1TS8A 1NYMA 4BBVA 3T12B 2VV8A 2XFTA 4HJ3A 4WL9A 3GSGA 5FEGA 1T19A 1LSWA 3V50A 3LR4A 1VB6A 4DE2A 3KSIA 1SKFA 4EWFA 2GDNA 4KZ3A 3AGEA 4ZJ2A 1MC0A 3FKVA 4X68A 2QWSA 3IBJA 3BY8A 5F83A 4L9EA 5CEBA 5G18A 3VP0A 2W3GA 2XROA 5EVIC 5FI2A 3IF6C 3HLEA 2ZM0A 4HP4A 2V20A 4G3VA 2FH5A 1NWZA 3UB5P 3UPNA 4AFIA 4K0WA 1H8MA 2A2LA 3NDEA 2INWA 3V39A 1KDSA 3JVVA 2ZL1A 5L2FA 2JE5A 3HJKA 5DJUA 3LIFA 2WGWB 3VP2A 4IJGA 3MF0A 4QPRA 4LRZE 3ZHHA 5GHYA 4MBFA 4N1HA 4YOFA 3PR6A 4ZDXA 1ODVA 2W3HA 3N6IA 3DTMA 3Q7ZA 2VGLM 1CI9A 3ZDJA 3LI9A 2Q0OA 3SW1A 2KX6A 4KQOA 1KVMA 2YKFA 1K56D 4GD6A 1EWZA 3IX4A 3MQOA 2Y2QA 1S1YA 3UE3A 2DMWA 3LICA 1XPBA 3ZFZA 2W27A 4EERA 1ONGA 5TR7A 3M6HA 1FIKA 2B95A 5HSQA 1T1BA 3SS4A 4RX2A 5TFQA 2HZ5A 4RA7A 2V0UA 3V5MA 1KOUA 2Y2JA 4E6XA 3LY3A 3A3DA 3MXSA 1BSGA 3EEHA 3CUEC 3LIBA 2PAVP 2H0TA 5F5YA 3A0SA 4JPMA 1K56A 3G31A 3LIDA 2MJ6A 1IEMA 3A3EA 2HP9A 3M6BA 5FAQA 3BYDA 1ACFA 3G6OA 1LI0A 5DKLA 3ZQ5A 2CC1A 1NZUA 2Y2NA 3GECA 2PRFA 1ERQA 3NULA 3IHAA 1PI5A 3RXWA 4YFMA 4I5SA 2JKFA 4OLGA 1MKIA 2Z2MB 4PM7A 5J8XA 3ZCZA 3EOIA 3G35A 3IX3A 4GS9A 1TEMA 1MWSA 1HD8A 3NY4A 2HGVA 2EXBA 4N1XA 5TBMB 4HI4A 1CEGA 2Y2OA 2D02A 4R3BA 4LV0A 5FDSA 3CMZA 2WAFA 3MZFA 3AGDA 5AJGA 5HDSA 1UGUA 1TS6A 4PM9A 5A90A 5KIZA 3L9KA 5F68A 3HREA 1H3QA 4HH2A 2KOIA 1I2WA 3SS5A 3DTEA 4EBLA 4MEZA 4FCFA 1RGZA 1W5DA 4YWZA 1VEUA 4RVAA 3VSKA 4LRXC 4WMCD 1PW1A 4GDBA 3LR5A 4WEKA 4BENA 5CTNA 2WGVA 3VSLA 2HJEA 2A24B 4B4ZA 3LI8A 4X1LA 3UN7A 4GB7A 3R7WA 3ULFA 4XT2A 2ZC5B 4CJNA 3JVUA 4R1GA 2M7UA 2ZQDA 3MZEA 1WYCA 2WGIA 1OT6A 4KZAA 3N8SA 1BUEA 1H8YA 1EI5A 5TJJA 3PXPA 5GLBA 2B18A 4RYEA 4WMCA 3QP6A 5DFXA 1AXBA 2HF6A 1ESUA 4EW7A 1MWRA 3B33A 2XR0A 2EWVA 4WYYA 3IWIA 2Y2IA 2WAEA 1F2KA 5HFOA 2G7UA 3K3DA 1YLYA 5E2FA 3FPVA 4GN2A 5FI6A 1CJFA 1XGJA 1IYPA 2WGWA 5EV0A 1GSWA 4WLAA 4O7DA 2EX6A 1Z6FA 3ITBA 5GLCA 1YLZA 5EVIB 2WKIA 2HP6A 1WA9A 3ZNYA 4UA7A 1K54A 2PBDP 3BFDA 3ITAA 3CHWP 4D2OA 3DTKA 3UB6A 4KUOA 1A0KA 3GMWA 1ESIA 3FC7A 4MN6A 2EFXA 3QNCA 4OQGA 4GJ4A 3PAGA 4C75A 3D72A 1PWCA 1MKMA 1KE4A 4GKUA 4K91A 2Y8HA 1D1JA 2EX2A 4OQ0A 3O3VA 3WS0A 2PD8A 2ZOHA 5E2HA 2EX9A 5CERA 3UMDA 3PYPA 4E3MA 4GLQA 3UO9A 5CEDA 2DNSA 5FSRA 4WBGA 4I38A 3BJNA 1I2SA 4ARZB 3Q81A 4JXGA 4B93A 2Y2PA 4ZBEA 4FTXA 4LGWA 4IUKA 3UDIA 4H6JB 1U60A 2XSSA 1J9MA 1K6RA 3VE4A 3HLFA 1HLUP 3S7QA 3GV9A 3Q7VB 3BFEA 5CTMA 4E3NA 5F1GA 3CPTB 3HLDA 5CGXA 4S2MA 4KZ5A 1KVLA 3ZYTA 2J9OA 4I3JA 1PNEA 3LY4A 1TD5A 3V3SA 2EFUA 2PT7A 3SZTA 3VOZA 1SCWA 3T4KA 5A8BA 1XA1A 2V8CA 4OKPA 3PAEA 4EEPA 3ZG7B 2J8YA 1IKGA 3PBTA 4KG2A 2VV6A 4HNBA 5G4YA 2ZQ7A 2NUTC 2J3TC 4UEYA 3MBZA 1NY0A 1CEFA 4LV1A 1Y54A 3TRCA 3V67A 4Q0IA 5KZHA 3S7OA 4GCZA 3E98A 4UA6A 1KE3A 4R6LA 3BFGA 3WS1A 2J80A 3VOYA 1P9RA 4EEUA 1RGYA 1YLWA 1G5UA 3L7HA 1F98A 1KGGA 3MS6A 4DMZA 2ACGA 3ZGAB 4C6YA 4K0XA 1CQAA 4OH0A 4DE0A 2QYBA 4BD1A 1Z09A 4F3LB 3RJUA 1PFLA 3W4OA 3G32A 4O0PA 4A5RA 1OTEA 4KQQA 2E8IA 2W3FA 2ZM2A 4PHTA 3GDIA 1SDEA 2PD7A 3H9WA 3BLMA 5IT5A 5J7EA 3IXDA 2ZC3B 1AWIA 3OBFA 4LENA 2Y59A 4S2NA 5HDCA 4JGPA 3F1OB 4GD8A 4QHCA 2C5WB 5CECA 2QZ6A 3QHYA 1FCOA 4CLCC 4NG2A 1LL8A 3EGDC 3VP4A 1OJGA 1KE0A 3GVBA 4Y17A 2G2UA 3NIAA 5L09A 1ONHA 3A3FA 2EX8A 4OONA 2V1ZA 4QY5A 1OTIA 3IWOA 4LPZA 1XJ2A 2ZQ8A 3PBSA 2CMNA 4IUHA 1E25A 1NRFA 1L3LA 3C4PA 4R0QA 3V3RA 4GNUA 2L0WA 2KLIA 4X55A 1SDNA 4OP5A 2VGJA 4XUXA 4Q0HA 3T4TA 5EFWA 1L0EA 3G2YA 5MC7A 1NXYA 1T1CA 3UY6A 2Y79A 4CPKA 1FILA 1IOUA 3D4FA 1HVBA 3W2ZA 5I94A 3HLBA 3KSFA 2B5RA 4X53A 4OOLA 4R3JA 4E3OA 1LSXA 2KDKA 3GR2A 4HHDA 4Q8IA 4X56A 2VX8A 4DRTA 4OP8A 1GCEA 1PYYA 3H82B 1VETB 4E3IA 1YT4A 3Q07A 1K55A 2HDRA 4EBNA 3D9YA 1L2SA 3BRMA 4MLLA 4WN5A 2E8JA 2ZMVA 4BWIA 2WKRA 2HJ9C 4PKYA 2W1TA 2RL3A 4MDZA 1LL9A 3E4QA 4ARZA 2OOLA 1W63M 1H5XA 2G2WA 2QKPA 3BQAA 5FAPA 5FEFA 1BYWA 4H6JA 5EOOA 2LB9A 5F69A 2EXAA 1NYYA 3B47A 3FPWA 1BT5A 5EE8A 2HDUA 3N7WA 2V1AA 3LCEA 3JPUA 1GSXA 2JKRI 3DW0A 2K7SA 4DKIA 1BZAA 4PMAA 4I39A 5CHMA 4G3KA 5HARA 4OPZA 5CRFA 5JYOA 2K31A 3E0YA 2XDMA 2ZLYA 4IVIA 2VK3A 2O9CA 1BLHA 1P9WA 3LFVA 2H5SA 1NJ4A 1ZG6A 4GW9A 5I5LA 4Y3IA 4LLOB 4FD8A 4JKTA 3NECA 2JKRM 4IVKA
chains in the Genus database with same CATH topology
1ESUA 1L0DA 1MWRA 3NI9A 4KZ9A 1GHMA 2Y2KA 1ZC2A 4KZ4A 5EVIA 3IXGA 2P9VA 2XR0A 3IF6A 3SOIA 1BLSA 5AQ9A 4WYYA 3IWIA 4FSFA 2Y2IA 1K38A 1XP4A 2WAEA 4JXVA 2X02A 4LCLA 1M40A 4U0XA 3BFCA 3N8RA 4S2PA 4Y7PA 1TVFA 3FZCA 2PBYA 5HFOA 1MBLA 4IBRA 4DE1A 1YLYA 5AQAA 3OCLA 4WZ5C 2OLUA 1XA7A 5E2FA 1L0FA 1K4FA 2ZC4B 2RCXA 4GN2A 5FI6A 4DXCA 1MWTA 4HESA 2OSUA 1JVJA 1MXOA 1XGJA 2HPBA 4S2JA 3S4XA 1IYPA 4N9LA 2WGWA 4UAAA 4O7DA 2ZD8A 2DRWA 2EX6A 1Z6FA 1H8ZA 3ITBA 4LV2A 4IBXA 1GHPA 5GLCA 1ZG4A 2H0YA 1PIOA 1YLZA 1BLPA 2XQZA 3HLWA 1XX2A 5AQ7A 5EVIB 2WKIA 2HP6A 2P9VB 2PU4A 4EV4A 3ZNYA 5FA7A 5A93A 4UA7A 4U0TA 3IT9A 1K54A 3BFDA 3FV7A 4GZBA 3ITAA 4HEFA 5HAQA 1FQGA 2Q9NA 4D2OA 3CZDA 3SH8A 5M19A 2WZZA 4IEDA 3N4IA 3TSGA 3OC2A 3BECA 2Y2GA 2ZQAA 3GMWA 3O87A 1YLJA 2WUQA 2WZXA 4PM6A 3UPOA 3NBLA 1ESIA 1L0GA 2EFXA 3QNCA 4OQGA 4KENB 4Y0TA 3PAGA 4UHUA 4C75A 1PW8A 3SH9A 1PWCA 2Y4AA 3C7VA 3WWXA 5U47A 1DJCA 1KE4A 5FQIA 4GKUA 1IYQA 4K91A 1K55C 2H10A 3ISGA 1DJBA 4P87A 2ZMAA 3CJMA 5BOHA 2XF3A 1YMSA 4NK3A 1YLPA 2EX2A 2A49A 2XK1A 3NDGA 4OQ0A 3O3VA 2Y91A 5AQBA 4QU3A 3WS0A 4B88A 4RX3A 4MBKA 3BM6A 5E2HA 3Q7VA 2EX9A 5CERA 4QB8A 1WE4A 2XGNA 5E43A 1Q2QA 3O86A 4OQIA 4E3MA 5CEDA 3UO9A 2DNSA 4YINA 5FSRA 4BL3A 5GLAA 4DF6A 4WBGA 4MBHA 1TDLA 4GDNA 2FFFB 4PM5A 1I2SA 4S2KA 1W79A 4JF4A 4WELA 1FOFA 3EQVA 3Q81A 4JXGA 1YLTA 5A91A 2JC7A 2WYXA 2Y2PA 3VP1A 1KGFA 1BTLA 2X71A 4ZBEA 3TOIA 4GOGA 3ZVWA 3OZHA 3S1YA 3UDIA 4H8RA 3WRZA 5FASA 1U60A 1J9MA 2XH9A 1OMEA 1K6RA 5FQQA 4DE3A 4KG6A 3AGFA 3IXHA 4DXBA 3HLFA 1TDGA 1RP5A 1VQQA 1XXMA 1I5QA 1PWDA 2J9PA 3IXBA 3GV9A 3Q7VB 3BFEA 5FQMA 5CTMA 3WRTA 2IWDA 2WKEA 3C4OA 4OPYA 1MY8A 2QPNA 4E3NA 3SS3A 2XEPA 5F1GA 3HLDA 3HUMA 5CGXA 2ZC6B 4S2MA 4C3QA 4KZ5A 1KVLA 2R9XA 1K57A 1ZKJA 3DWZA 2J9OA 4KZ7A 1NYMA 5DVAA 4DDYA 5CGSA 3LY4A 5EVLA 3V3SA 2EFUA 1FSWA 4P85A 2OLVA 2XFTA 3IQAA 3VOZA 1SCWA 3BFFA 3GSGA 4N9KA 1XA1A 4OKPA 3PAEA 3V50A 3ZG7B 2J8YA 1FCMA 3BLSA 4JF5A 4DE2A 1IKGA 3PBTA 1VM1A 2XD1A 5FQKA 1SKFA 4KG2A 1FR1A 4EWFA 2GDNA 5TGFA 4KZ3A 2ZQ7A 3NCKA 3AGEA 4WM9A 4ZJ2A 3MBZA 1NY0A 1CEFA 3FKVA 3FYZA 4LV1A 4X68A 3MZDA 1Y54A 3HUOA 3FWLA 5FQJA 3GQZA 3P09A 3WS2A 1IYSA 4XUZA 5F83A 4E3LA 3A3IA 5CEBA 1BULA 5G18A 3VP0A 3UE1A 2Y2MA 2FFYA 4QD4A 3RXXA 4QJGA 4U3TA 5EVIC 3EQUA 5KZHA 2Y55A 5FI2A 1JWZA 2OV5A 3IF6C 4UA6A 3HLEA 1K4EA 2ZM0A 3SH7A 1KE3A 3BFGA 4B4XA 3WS1A 2V20A 3E2KA 3G4PA 2P74A 3IF6B 3VOYA 5EECA 1RGYA 3UPNA 5GHZA 1YLWA 4K0WA 5DF9A 1ES2A 4OVDA 2A3UA 4OQHA 2XLNA 4JBFA 3O88A 5EUAA 3OPPA 3NDEA 1KGGA 4OOYA 3V39A 1KDSA 4S2OA 4ID4A 1W8YA 1LLBA 2ZQ9A 5L2FA 2JE5A 1GA9A 3ZGAB 4C6YA 4K0XA 2VGKA 4QY6A 4F94A 2WGWB 4OH0A 3VP2A 4DE0A 2WADA 1IELA 3E2LA 4BD1A 3ZHHA 5GHYA 4DDSA 4MBFA 3ZNTA 1ES3A 2QMIA 3FKWA 4N1HA 3RJUA 2XFSA 4ZJ1A 3W4OA 3G32A 4R4SA 4OPQA 1WYBA 5M1AA 5DTSA 1LL5A 4ZDXA 1K54C 4A5RA 1ERMA 3N6IA 3HBRA 3DTMA 3Q7ZA 4KZBA 3WS5A 4KQQA 3ZG0A 2E8IA 4X69A 1CI9A 3IH8A 1EROA 3PBQA 4E3JA 3IHBA 2ZM2A 3ZDJA 3ZG9B 1SDEA 5JYPA 5CGWA 2Y2LA 1JWVA 3BLMA 4WEJA 1DJAA 3GTCA 4KQOA 1KVMA 3IXDA 1JTDA 2ZC3B 4S2IA 1K56D 5CHUA 3LO7A 4Z9QA 3TG9A 3UDFA 2Z2LB 4JF6A 4LENA 3MKFA 1EWZA 4GD6A 4P0MA 4ZTKA 4N92A 2Y2QA 2Y59A 4S2NA 3UE3A 1ES4A 3S22A 3W4QA 3C7UA 5IHVA 4NETA 4GD8A 4QHCA 2C5WB 1XPBA 3ZFZA 5CECA 3M2JA 5HL1A 3HLCA 5FAOA 2QZ6A 3UNWA 1PZPA 1YM1A 3QHYA 1ONGA 5TR7A 1LHYA 5F82A 4E3KA 1FCOA 4OPRA 1XGIA 3M6HA 3VP4A 1KE0A 2R9WA 3GVBA 2ZM8A 2G2UA 3NIAA 3Q1FA 1ONHA 3HVFA 3SS4A 1FR6A 1LI9A 3A3FA 4RX2A 2EX8A 4OONA 2BG1A 5TFQA 4RA7A 3V5MA 3G2ZA 4E6XA 2Y2JA 3LY3A 3ZVTA 1QMFA 3A3DA 3IH9A 5HAPA 3MXSA 2V1ZA 1BSGA 4QY5A 2C6WB 3IWOA 2WK0A 5EOEA 2ZQ8A 4HBUA 2H0TA 4JXWA 3PBSA 1CI8A 4M3KA 1E25A 1NRFA 2XD5A 5DTTA 5KSCA 1KGEA 1MWUA 3C4PA 4HBTA 1QMEA 4JPMA 4PPRA 4UA9A 5GHXA 4R0QA 4EBPA 4EUZA 3V3RA 1K56A 3G31A 1HTZA 3VP3A 4GNUA 5CXWA 1IEMA 4WZ5A 3A3EA 2HP9A 3M6BA 5DTKA 5E2GA 5FAQA 3IWQA 3BYDA 1N4OA 4X55A 3VMAA 1W8QA 4BD0A 4KQRA 1SDNA 4OP5A 3IF5A 4E6WA 3N8LA 2VGJA 4XUXA 4XXRA 1LI0A 4R4RA 3BEBA 1PZOA 4WZ4A 2JBFA 3JYIA 1IYOA 2BLSA 1BLCA 2CC1A 1NZUA 2Y2NA 4LCMA 1K57C 1L0EA 1ERQA 3G2YA 1PWGA 2WKHA 1NXYA 3IHAA 1PI5A 1DY6A 4KG5A 3RXWA 1YQSA 3UY6A 4YFMA 4CPKA 2J7VA 5D3OA 1S6RA 3D4FA 1HVBA 5F1FA 4BL2A 3PBRA 1RCJA 5I94A 3P98A 1K6SA 5HX9A 4OLGA 3HLBA 1MKIA 2B5RA 3WS4A 4X53A 2Z2MB 4OOLA 4BJPA 4PM7A 5J8XA 3OCNA 3I7JA 1GHIA 4R3JA 5FI7A 4E3OA 2IWBA 1N9BA 2V2FF 3GR2A 3ZCZA 1PI4A 3G35A 3MFDA 3QNBA 4X56A 4Q8IA 4DRTA 1TEMA 4OP8A 1MWSA 1E3UD 1HD8A 1E4DA 3C5AA 1GCEA 4FH4A 3NY4A 1K25A 1PYYA 3OPHA 2EXBA 1HZOA 4N1XA 3W4PA 1G68A 5FQ9A 4FH2A 4E3IA 1XKZA 1YT4A 4S2LA 1IKIA 3Q07A 1CEGA 1K55A 2Y2OA 2HDRA 5KMWA 4R3BA 2IWCA 3DWKA 4LV0A 4EBNA 2JCHA 1L2SA 3BRMA 4MLLA 3CMZA 3OPLA 2WAFA 3MZFA 3AGDA 1ALQA 5FDHA 3HLGA 3CG5A 5E2EA 4JXSA 4PM9A 5M18A 3A3JA 4MNRA 3UDXA 2RL3A 1S0WA 4P6BA 1SHVA 5A90A 1LL9A 4LV3A 3GRJA 3HREA 4Y0OA 3VFHA 3G30A 3PTEA 1I2WA 1H5XA 2G2WA 2Y2HA 3SS5A 4OLDA 1FSYA 1C3BA 4EBLA 5KSHA 5FAPA 4MEZA 1JTGA 1O07A 4FCFA 2PU2A 1RGZA 1W5DA 2I72A 4RVAA 3VSKA 4WMCD 1PW1A 5HW3A 4GDBA 5EOOA 3MXRA 3ZG5A 4BLMA 1YMXA 2EXAA 1CK3A 4JLFA 1NYYA 4WEKA 1BT5A 4BENA 1E3UA 5EE8A 5CTNA 5GLDA 2HDUA 2WGVA 5EVID 2HDSA 3PBNA 3VSLA 2HP5A 2ZQCA 3N7WA 3LCEA 3DW0A 2HDQA 3Q82A 1NZOA 3OPRA 4ZAMA 3UE0A 5DF7A 2UWXA 4B4ZA 3PBOA 4DKIA 1W7FA 3UN7A 1BZAA 5CHJA 5FATA 1GA0A 2Q9MA 4PMAA 4GB7A 1ES5A 1JWPA 3W8KA 3LEZA 2ZC5B 4X6TA 5CHMA 4CJNA 1FCNA 5A92A 4R1GA 5DF8A 2ZQDA 3MZEA 5GL9A 1WYCA 5HARA 3B3XA 4OPZA 4S2NC 1G6AA 5CRFA 3VFFA 5JYOA 4ZJ3A 2ZC7A 2WGIA 3ZG8B 4KZAA 4PM8A 4BQMA 2XDMA 2ZLYA 3MKEA 3N8SA 4Y0UA 1BUEA 3UPPA 1H8YA 4IVIA 4OOMA 1EI5A 2ZJ9A 2X01A 1BLHA 5GLBA 3M2KA 4RYEA 2H5SA 1KDWA 1NJ4A 1ZG6A 3NC8A 4WMCA 5EPHA 2DCFA 1M6KA 4L0LA 3G34A 1O7EA 1MPLA 5HAIA 4R23A 4FD8A 4JKTA 4EQIA 1Q2PA 1AXBA 3HUNA 4IVKA 4KZ6A 4KZ8A 3HL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ESU A;  1L0D A;  1MWR A;  3NI9 A;  4KZ9 A;  1GHM A;  2Y2K A;  1ZC2 A;  4KZ4 A;  5EVI A;  3IXG A;  2P9V A;  2XR0 A;  3IF6 A;  3SOI A;  1BLS A;  5AQ9 A;  4WYY A;  3IWI A;  4FSF A;  2Y2I A;  1K38 A;  1XP4 A;  2WAE A;  4JXV A;  2X02 A;  4LCL A;  1M40 A;  4U0X A;  3BFC A;  3N8R A;  4S2P A;  4Y7P A;  1TVF A;  3FZC A;  2PBY A;  5HFO A;  1MBL A;  4IBR A;  4DE1 A;  1YLY A;  5AQA A;  3OCL A;  4WZ5 C;  2OLU A;  1XA7 A;  5E2F A;  1L0F A;  1K4F A;  2ZC4 B;  2RCX A;  4GN2 A;  5FI6 A;  4DXC A;  1MWT A;  4HES A;  2OSU A;  1JVJ A;  1MXO A;  1XGJ A;  2HPB A;  4S2J A;  3S4X A;  1IYP A;  4N9L A;  2WGW A;  4UAA A;  4O7D A;  2ZD8 A;  2DRW A;  2EX6 A;  1Z6F A;  1H8Z A;  3ITB A;  4LV2 A;  4IBX A;  1GHP A;  5GLC A;  1ZG4 A;  2H0Y A;  1PIO A;  1YLZ A;  1BLP A;  2XQZ A;  3HLW A;  1XX2 A;  5AQ7 A;  5EVI B;  2WKI A;  2HP6 A;  2P9V B;  2PU4 A;  4EV4 A;  3ZNY A;  5FA7 A;  5A93 A;  4UA7 A;  4U0T A;  3IT9 A;  1K54 A;  3BFD A;  3FV7 A;  4GZB A;  3ITA A;  4HEF A;  5HAQ A;  1FQG A;  2Q9N A;  4D2O A;  3CZD A;  3SH8 A;  5M19 A;  2WZZ A;  4IED A;  3N4I A;  3TSG A;  3OC2 A;  3BEC A;  2Y2G A;  2ZQA A;  3GMW A;  3O87 A;  1YLJ A;  2WUQ A;  2WZX A;  4PM6 A;  3UPO A;  3NBL A;  1ESI A;  1L0G A;  2EFX A;  3QNC A;  4OQG A;  4KEN B;  4Y0T A;  3PAG A;  4UHU A;  4C75 A;  1PW8 A;  3SH9 A;  1PWC A;  2Y4A A;  3C7V A;  3WWX A;  5U47 A;  1DJC A;  1KE4 A;  5FQI A;  4GKU A;  1IYQ A;  4K91 A;  1K55 C;  2H10 A;  3ISG A;  1DJB A;  4P87 A;  2ZMA A;  3CJM A;  5BOH A;  2XF3 A;  1YMS A;  4NK3 A;  1YLP A;  2EX2 A;  2A49 A;  2XK1 A;  3NDG A;  4OQ0 A;  3O3V A;  2Y91 A;  5AQB A;  4QU3 A;  3WS0 A;  4B88 A;  4RX3 A;  4MBK A;  3BM6 A;  5E2H A;  3Q7V A;  2EX9 A;  5CER A;  4QB8 A;  1WE4 A;  2XGN A;  5E43 A;  1Q2Q A;  3O86 A;  4OQI A;  4E3M A;  5CED A;  3UO9 A;  2DNS A;  4YIN A;  5FSR A;  4BL3 A;  5GLA A;  4DF6 A;  4WBG A;  4MBH A;  1TDL A;  4GDN A;  2FFF B;  4PM5 A;  1I2S A;  4S2K A;  1W79 A;  4JF4 A;  4WEL A;  1FOF A;  3EQV A;  3Q81 A;  4JXG A;  1YLT A;  5A91 A;  2JC7 A;  2WYX A;  2Y2P A;  3VP1 A;  1KGF A;  1BTL A;  2X71 A;  4ZBE A;  3TOI A;  4GOG A;  3ZVW A;  3OZH A;  3S1Y A;  3UDI A;  4H8R A;  3WRZ A;  5FAS A;  1U60 A;  1J9M A;  2XH9 A;  1OME A;  1K6R A;  5FQQ A;  4DE3 A;  4KG6 A;  3AGF A;  3IXH A;  4DXB A;  3HLF A;  1TDG A;  1RP5 A;  1VQQ A;  1XXM A;  1I5Q A;  1PWD A;  2J9P A;  3IXB A;  3GV9 A;  3Q7V B;  3BFE A;  5FQM A;  5CTM A;  3WRT A;  2IWD A;  2WKE A;  3C4O A;  4OPY A;  1MY8 A;  2QPN A;  4E3N A;  3SS3 A;  2XEP A;  5F1G A;  3HLD A;  3HUM A;  5CGX A;  2ZC6 B;  4S2M A;  4C3Q A;  4KZ5 A;  1KVL A;  2R9X A;  1K57 A;  1ZKJ A;  3DWZ A;  2J9O A;  4KZ7 A;  1NYM A;  5DVA A;  4DDY A;  5CGS A;  3LY4 A;  5EVL A;  3V3S A;  2EFU A;  1FSW A;  4P85 A;  2OLV A;  2XFT A;  3IQA A;  3VOZ A;  1SCW A;  3BFF A;  3GSG A;  4N9K A;  1XA1 A;  4OKP A;  3PAE A;  3V50 A;  3ZG7 B;  2J8Y A;  1FCM A;  3BLS A;  4JF5 A;  4DE2 A;  1IKG A;  3PBT A;  1VM1 A;  2XD1 A;  5FQK A;  1SKF A;  4KG2 A;  1FR1 A;  4EWF A;  2GDN A;  5TGF A;  4KZ3 A;  2ZQ7 A;  3NCK A;  3AGE A;  4WM9 A;  4ZJ2 A;  3MBZ A;  1NY0 A;  1CEF A;  3FKV A;  3FYZ A;  4LV1 A;  4X68 A;  3MZD A;  1Y54 A;  3HUO A;  3FWL A;  5FQJ A;  3GQZ A;  3P09 A;  3WS2 A;  1IYS A;  4XUZ A;  5F83 A;  4E3L A;  3A3I A;  5CEB A;  1BUL A;  5G18 A;  3VP0 A;  3UE1 A;  2Y2M A;  2FFY A;  4QD4 A;  3RXX A;  4QJG A;  4U3T A;  5EVI C;  3EQU A;  5KZH A;  2Y55 A;  5FI2 A;  1JWZ A;  2OV5 A;  3IF6 C;  4UA6 A;  3HLE A;  1K4E A;  2ZM0 A;  3SH7 A;  1KE3 A;  3BFG A;  4B4X A;  3WS1 A;  2V20 A;  3E2K A;  3G4P A;  2P74 A;  3IF6 B;  3VOY A;  5EEC A;  1RGY A;  3UPN A;  5GHZ A;  1YLW A;  4K0W A;  5DF9 A;  1ES2 A;  4OVD A;  2A3U A;  4OQH A;  2XLN A;  4JBF A;  3O88 A;  5EUA A;  3OPP A;  3NDE A;  1KGG A;  4OOY A;  3V39 A;  1KDS A;  4S2O A;  4ID4 A;  1W8Y A;  1LLB A;  2ZQ9 A;  5L2F A;  2JE5 A;  1GA9 A;  3ZGA B;  4C6Y A;  4K0X A;  2VGK A;  4QY6 A;  4F94 A;  2WGW B;  4OH0 A;  3VP2 A;  4DE0 A;  2WAD A;  1IEL A;  3E2L A;  4BD1 A;  3ZHH A;  5GHY A;  4DDS A;  4MBF A;  3ZNT A;  1ES3 A;  2QMI A;  3FKW A;  4N1H A;  3RJU A;  2XFS A;  4ZJ1 A;  3W4O A;  3G32 A;  4R4S A;  4OPQ A;  1WYB A;  5M1A A;  5DTS A;  1LL5 A;  4ZDX A;  1K54 C;  4A5R A;  1ERM A;  3N6I A;  3HBR A;  3DTM A;  3Q7Z A;  4KZB A;  3WS5 A;  4KQQ A;  3ZG0 A;  2E8I A;  4X69 A;  1CI9 A;  3IH8 A;  1ERO A;  3PBQ A;  4E3J A;  3IHB A;  2ZM2 A;  3ZDJ A;  3ZG9 B;  1SDE A;  5JYP A;  5CGW A;  2Y2L A;  1JWV A;  3BLM A;  4WEJ A;  1DJA A;  3GTC A;  4KQO A;  1KVM A;  3IXD A;  1JTD A;  2ZC3 B;  4S2I A;  1K56 D;  5CHU A;  3LO7 A;  4Z9Q A;  3TG9 A;  3UDF A;  2Z2L B;  4JF6 A;  4LEN A;  3MKF A;  1EWZ A;  4GD6 A;  4P0M A;  4ZTK A;  4N92 A;  2Y2Q A;  2Y59 A;  4S2N A;  3UE3 A;  1ES4 A;  3S22 A;  3W4Q A;  3C7U A;  5IHV A;  4NET A;  4GD8 A;  4QHC A;  2C5W B;  1XPB A;  3ZFZ A;  5CEC A;  3M2J A;  5HL1 A;  3HLC A;  5FAO A;  2QZ6 A;  3UNW A;  1PZP A;  1YM1 A;  3QHY A;  1ONG A;  5TR7 A;  1LHY A;  5F82 A;  4E3K A;  1FCO A;  4OPR A;  1XGI A;  3M6H A;  3VP4 A;  1KE0 A;  2R9W A;  3GVB A;  2ZM8 A;  2G2U A;  3NIA A;  3Q1F A;  1ONH A;  3HVF A;  3SS4 A;  1FR6 A;  1LI9 A;  3A3F A;  4RX2 A;  2EX8 A;  4OON A;  2BG1 A;  5TFQ A;  4RA7 A;  3V5M A;  3G2Z A;  4E6X A;  2Y2J A;  3LY3 A;  3ZVT A;  1QMF A;  3A3D A;  3IH9 A;  5HAP A;  3MXS A;  2V1Z A;  1BSG A;  4QY5 A;  2C6W B;  3IWO A;  2WK0 A;  5EOE A;  2ZQ8 A;  4HBU A;  2H0T A;  4JXW A;  3PBS A;  1CI8 A;  4M3K A;  1E25 A;  1NRF A;  2XD5 A;  5DTT A;  5KSC A;  1KGE A;  1MWU A;  3C4P A;  4HBT A;  1QME A;  4JPM A;  4PPR A;  4UA9 A;  5GHX A;  4R0Q A;  4EBP A;  4EUZ A;  3V3R A;  1K56 A;  3G31 A;  1HTZ A;  3VP3 A;  4GNU A;  5CXW A;  1IEM A;  4WZ5 A;  3A3E A;  2HP9 A;  3M6B A;  5DTK A;  5E2G A;  5FAQ A;  3IWQ A;  3BYD A;  1N4O A;  4X55 A;  3VMA A;  1W8Q A;  4BD0 A;  4KQR A;  1SDN A;  4OP5 A;  3IF5 A;  4E6W A;  3N8L A;  2VGJ A;  4XUX A;  4XXR A;  1LI0 A;  4R4R A;  3BEB A;  1PZO A;  4WZ4 A;  2JBF A;  3JYI A;  1IYO A;  2BLS A;  1BLC A;  2CC1 A;  1NZU A;  2Y2N A;  4LCM A;  1K57 C;  1L0E A;  1ERQ A;  3G2Y A;  1PWG A;  2WKH A;  1NXY A;  3IHA A;  1PI5 A;  1DY6 A;  4KG5 A;  3RXW A;  1YQS A;  3UY6 A;  4YFM A;  4CPK A;  2J7V A;  5D3O A;  1S6R A;  3D4F A;  1HVB A;  5F1F A;  4BL2 A;  3PBR A;  1RCJ A;  5I94 A;  3P98 A;  1K6S A;  5HX9 A;  4OLG A;  3HLB A;  1MKI A;  2B5R A;  3WS4 A;  4X53 A;  2Z2M B;  4OOL A;  4BJP A;  4PM7 A;  5J8X A;  3OCN A;  3I7J A;  1GHI A;  4R3J A;  5FI7 A;  4E3O A;  2IWB A;  1N9B A;  2V2F F;  3GR2 A;  3ZCZ A;  1PI4 A;  3G35 A;  3MFD A;  3QNB A;  4X56 A;  4Q8I A;  4DRT A;  1TEM A;  4OP8 A;  1MWS A;  1E3U D;  1HD8 A;  1E4D A;  3C5A A;  1GCE A;  4FH4 A;  3NY4 A;  1K25 A;  1PYY A;  3OPH A;  2EXB A;  1HZO A;  4N1X A;  3W4P A;  1G68 A;  5FQ9 A;  4FH2 A;  4E3I A;  1XKZ A;  1YT4 A;  4S2L A;  1IKI A;  3Q07 A;  1CEG A;  1K55 A;  2Y2O A;  2HDR A;  5KMW A;  4R3B A;  2IWC A;  3DWK A;  4LV0 A;  4EBN A;  2JCH A;  1L2S A;  3BRM A;  4MLL A;  3CMZ A;  3OPL A;  2WAF A;  3MZF A;  3AGD A;  1ALQ A;  5FDH A;  3HLG A;  3CG5 A;  5E2E A;  4JXS A;  4PM9 A;  5M18 A;  3A3J A;  4MNR A;  3UDX A;  2RL3 A;  1S0W A;  4P6B A;  1SHV A;  5A90 A;  1LL9 A;  4LV3 A;  3GRJ A;  3HRE A;  4Y0O A;  3VFH A;  3G30 A;  3PTE A;  1I2W A;  1H5X A;  2G2W A;  2Y2H A;  3SS5 A;  4OLD A;  1FSY A;  1C3B A;  4EBL A;  5KSH A;  5FAP A;  4MEZ A;  1JTG A;  1O07 A;  4FCF A;  2PU2 A;  1RGZ A;  1W5D A;  2I72 A;  4RVA A;  3VSK A;  4WMC D;  1PW1 A;  5HW3 A;  4GDB A;  5EOO A;  3MXR A;  3ZG5 A;  4BLM A;  1YMX A;  2EXA A;  1CK3 A;  4JLF A;  1NYY A;  4WEK A;  1BT5 A;  4BEN A;  1E3U A;  5EE8 A;  5CTN A;  5GLD A;  2HDU A;  2WGV A;  5EVI D;  2HDS A;  3PBN A;  3VSL A;  2HP5 A;  2ZQC A;  3N7W A;  3LCE A;  3DW0 A;  2HDQ A;  3Q82 A;  1NZO A;  3OPR A;  4ZAM A;  3UE0 A;  5DF7 A;  2UWX A;  4B4Z A;  3PBO A;  4DKI A;  1W7F A;  3UN7 A;  1BZA A;  5CHJ A;  5FAT A;  1GA0 A;  2Q9M A;  4PMA A;  4GB7 A;  1ES5 A;  1JWP A;  3W8K A;  3LEZ A;  2ZC5 B;  4X6T A;  5CHM A;  4CJN A;  1FCN A;  5A92 A;  4R1G A;  5DF8 A;  2ZQD A;  3MZE A;  5GL9 A;  1WYC A;  5HAR A;  3B3X A;  4OPZ A;  4S2N C;  1G6A A;  5CRF A;  3VFF A;  5JYO A;  4ZJ3 A;  2ZC7 A;  2WGI A;  3ZG8 B;  4KZA A;  4PM8 A;  4BQM A;  2XDM A;  2ZLY A;  3MKE A;  3N8S A;  4Y0U A;  1BUE A;  3UPP A;  1H8Y A;  4IVI A;  4OOM A;  1EI5 A;  2ZJ9 A;  2X01 A;  1BLH A;  5GLB A;  3M2K A;  4RYE A;  2H5S A;  1KDW A;  1NJ4 A;  1ZG6 A;  3NC8 A;  4WMC A;  5EPH A;  2DCF A;  1M6K A;  4L0L A;  3G34 A;  1O7E A;  1MPL A;  5HAI A;  4R23 A;  4FD8 A;  4JKT A;  4EQI A;  1Q2P A;  1AXB A;  3HUN A;  4IVK A;  4KZ6 A;  4KZ8 A;  3HL9 A; 
#chains in the Genus database with same CATH topology
 1L0D A;  4NXE A;  3NI9 A;  2Y2K A;  1ZC2 A;  3NOP C;  3IXG A;  2P9V A;  3SOI A;  5AQ9 A;  1K38 A;  5C5K A;  2X02 A;  1M40 A;  4K08 A;  1TVF A;  3FZC A;  3NJA A;  4DE1 A;  5AQA A;  3OCL A;  1L0F A;  1K4F A;  2PDR A;  2ZC4 B;  3TJZ C;  4O01 A;  2OSU A;  1MXO A;  1EW0 A;  4S2J A;  3F1P A;  4N9L A;  2DRW A;  4F3L A;  1LSV A;  3VV4 A;  4O8G A;  4MN5 A;  4P6Z M;  4Y13 A;  2PU4 A;  4ETZ A;  5HWW A;  2O9A A;  4EV4 A;  5A93 A;  5FA7 A;  4HEF A;  2Q9N A;  5M19 A;  1F9I A;  2VGL S;  4X25 A;  3U2A A;  2WZZ A;  2VEA A;  3BEC A;  2P08 A;  2Y2G A;  3O87 A;  1YLJ A;  2WUQ A;  5DFY A;  1OJ5 A;  3T50 A;  4Y0T A;  1PW8 A;  2BAS A;  2UV0 E;  3WWX A;  3KSG A;  5U47 A;  1DJC A;  1DJB A;  2XF3 A;  3P7N A;  3NDG A;  2Y91 A;  5EM0 A;  4R70 A;  4PKY G;  2XGN A;  2JN7 A;  1Q2Q A;  4D60 A;  4PM5 A;  4S2K A;  4WEL A;  1FOF A;  1YLT A;  3H7W B;  3MMH A;  3TOI A;  3OZH A;  2VLG A;  1N9O A;  4H8R A;  4JGQ A;  3WRZ A;  3OLO A;  2LB5 A;  2XH9 A;  1XJ4 A;  3AGF A;  3IXH A;  1TDG A;  4FOF A;  1I5Q A;  1G28 A;  3U4L P;  4WF0 A;  5FQM A;  3WRT A;  5IS1 A;  4Y5F A;  2ZC6 B;  4C3Q A;  1K57 A;  4KZ7 A;  2J3W A;  3E4O A;  4DDY A;  4B9O A;  1T1A A;  3BWL A;  4M4X A;  4JF5 A;  1H0M A;  1VM1 A;  5FQK A;  4EET B;  4WM9 A;  4X1M A;  3FYZ A;  5J3W A;  3H82 A;  3HUO A;  5FQJ A;  3WS2 A;  4XUZ A;  3QP2 A;  3A3I A;  3NOT C;  3UE1 A;  4QD4 A;  2QHK A;  1D06 A;  3RXX A;  3EQU A;  2OV5 A;  2VA0 A;  4B4X A;  5DKK A;  3E2K A;  3IF6 B;  2P74 A;  4HOI A;  5EEC A;  1UWN X;  5GHZ A;  1N9L A;  3A0R A;  1ES2 A;  3FG8 A;  4OVD A;  2QJ7 A;  3O88 A;  1V9Z A;  4ID4 A;  5HWV A;  4F94 A;  1N9N A;  2VJW A;  2WAD A;  3E2L A;  3HJI A;  3KYE A;  4DDS A;  1ES3 A;  2QMI A;  3FKW A;  2XFS A;  4ZJ1 A;  2XA7 M;  1LT0 A;  4R4S A;  1ZTU A;  1WYB A;  5M1A A;  1K54 C;  2IA2 A;  3WS5 A;  4X69 A;  5HZH A;  1ERO A;  4MN7 A;  4E3J A;  3IHB A;  2PYR A;  3ZG9 B;  5JYP A;  3CLO A;  4WEJ A;  1JTD A;  4JGR A;  3LEQ A;  3LO7 A;  3UDF A;  2Z2L B;  1XFQ A;  2ZOI A;  3S22 A;  3C7U A;  5IHV A;  5HL1 A;  3HLC A;  5FAO A;  3UNW A;  1PZP A;  1YM1 A;  5F82 A;  4E04 A;  2R9W A;  3Q1F A;  3HVF A;  1FR6 A;  4NXB A;  2W0N A;  3TE8 A;  3VE3 A;  3G2Z A;  4KUK A;  5HAP A;  2WK0 A;  5EOE A;  4JXW A;  4G3W A;  1CI8 A;  4HBT A;  4PPR A;  4UA9 A;  3LR0 A;  4EBP A;  3VP3 A;  5CXW A;  5E2G A;  4WZ5 A;  5DTK A;  3IWQ A;  3VMA A;  1N4O A;  4BD0 A;  5L10 A;  4EES A;  3QP1 A;  5HL6 A;  3IF5 A;  4E6W A;  3N8L A;  3T4J A;  4R4R A;  3BEB A;  4WZ4 A;  1IYO A;  2BLS A;  1BLC A;  2V1B A;  1YSQ A;  5TBM A;  1P97 A;  2J7V A;  3S7N A;  1S6R A;  5HX9 A;  4IHQ A;  4BJP A;  2ZMF A;  1GHI A;  3C38 A;  5FI7 A;  2PR5 A;  2IWB A;  1N9B A;  2V2F F;  2PR6 A;  1PI4 A;  3MFD A;  1E3U D;  2OWH A;  3LYX A;  4FH4 A;  2PYP A;  3NOU C;  1G68 A;  5FQ9 A;  4FH2 A;  1XKZ A;  1IKI A;  3KSH A;  2GX5 A;  5KMW A;  2JCH A;  3MQ0 A;  1S67 L;  1ALQ A;  5FDH A;  2M7V A;  5E2E A;  3PHY A;  5M18 A;  2A24 A;  3A3J A;  1S1Z A;  3UDX A;  3LIE A;  1S0W A;  4P6B A;  1SHV A;  3GRJ A;  1NRJ A;  3PTE A;  3H7W A;  4OLD A;  1FSY A;  1C3B A;  5KSH A;  1JTG A;  2PU2 A;  3TW8 A;  1XJ3 A;  1D7E A;  3ZG5 A;  4BLM A;  1SKO B;  1CK3 A;  1E3U A;  3UB8 A;  5EVI D;  2HDS A;  3T1X A;  3PBN A;  2HP5 A;  3A0V A;  2HDQ A;  3Q82 A;  1NZO A;  3OPR A;  4ZAM A;  3IX8 A;  3UE0 A;  3PBO A;  4FUW A;  1GA0 A;  2Q9M A;  4X6T A;  4LFU A;  1FCN A;  4QWO A;  5A92 A;  4S2N C;  1VEU B;  1G6A A;  3UB9 A;  4ZJ3 A;  4PM8 A;  4BQM A;  3IS2 B;  3MKE A;  4Y0U A;  3UPP A;  2L4R A;  4BBU A;  4WUJ A;  3EGX C;  2BTF P;  5EPH A;  4L0L A;  5L8M A;  1O7E A;  4EQI A;  4KZ8 A;  4KZ6 A;  3HL9 A;  3R7W B;  4KZ9 A;  1GHM A;  4XT2 B;  5EVI A;  4KZ4 A;  3IF6 A;  1BLS A;  1XP4 A;  4JXV A;  3QP5 A;  4LCL A;  3BFC A;  3N8R A;  4S2P A;  3KX0 X;  4Y7P A;  2PBY A;  2OLU A;  1G6O A;  4Z1W A;  1SZV A;  4HES A;  2B02 A;  2HPB A;  2W1R A;  2ZD8 A;  4NXF A;  3BW6 A;  1TS7 A;  2H0Y A;  1PIO A;  4MCW A;  2XQZ A;  5AQ7 A;  1S4S A;  5CX7 A;  4U0T A;  2V0W A;  4GZB A;  5HAQ A;  4HJ6 A;  3SH8 A;  3T4L A;  4R38 A;  1MZU A;  3UME A;  1XFN A;  5DJT A;  4IED A;  1YPR A;  3DAV A;  5HPF A;  2ZQA A;  2WZX A;  3NBL A;  2AVX A;  3OOV A;  3EEA A;  3LUQ A;  3ICY A;  4KEN B;  3C7V A;  1T18 A;  1K55 C;  5BOH A;  3T1S A;  4YNR A;  4NK3 A;  5LBR A;  4B88 A;  2P04 A;  5F6A A;  5AVF A;  3Q7V A;  4QB8 A;  1WE4 A;  5E43 A;  3O86 A;  4OQI A;  2OAQ 1;  5L07 A;  3CPT A;  4DF6 A;  1TDL A;  3DBA A;  2FFF B;  2YKH A;  3QP4 A;  2H28 A;  3RTY A;  5EM1 A;  2WYX A;  1YSP A;  3P01 A;  3VP1 A;  3CUE A;  1W63 Q;  3ZVW A;  4BBT A;  3QP8 A;  4MMN A;  3K2N A;  4NXG A;  4DE3 A;  1PRQ A;  5HWT A;  2L1M A;  3D3O A;  1XXM A;  1PWD A;  3C4O A;  2WKE A;  4OPY A;  2QPN A;  4HY8 A;  3SS3 A;  2JKG A;  1P0Z A;  1ZKJ A;  5DVA A;  3CI6 A;  5CGS A;  5EVL A;  5HPI A;  1FSW A;  4P85 A;  2OLV A;  2JHE A;  5G4Z A;  3IQA A;  3O5Y A;  3T4O A;  1OT9 A;  3BFF A;  4N9K A;  2WKQ A;  5FL3 A;  1FCM A;  3BLS A;  4I3I A;  1X0O A;  1STZ A;  2XD1 A;  4DJ3 A;  1FR1 A;  3K3C A;  3CIT A;  5TGF A;  3NCK A;  4ME4 A;  3BQ8 A;  3MZD A;  3FWL A;  3GQZ A;  3P09 A;  1IYS A;  1YKD A;  4E3L A;  1BUL A;  2Y2M A;  2FFY A;  4L9G A;  4QJG A;  4U3T A;  2Y55 A;  1JWZ A;  1K4E A;  3SH7 A;  3VOL A;  2P7J A;  4L9F A;  4R3A A;  3G4P A;  2V8F A;  3LGO A;  3UB7 A;  5DF9 A;  2A3U A;  4OQH A;  2XLN A;  4JBF A;  1V9Y A;  5EUA A;  2GNX A;  3OPP A;  4OOY A;  4HH3 A;  4S2O A;  1W8Y A;  2O0Y A;  1LLB A;  2ZQ9 A;  2EWW A;  1GA9 A;  2R78 A;  2VGK A;  4QY6 A;  1IEL A;  1SKO A;  4PAU A;  2GJ3 A;  3ZNT A;  3F1O A;  4ESP A;  3KYQ A;  4OPQ A;  5DTS A;  1LL5 A;  3LIA A;  2Z6C A;  3IBR A;  1ERM A;  2W3E A;  3HBR A;  4KZB A;  3ZG0 A;  3IH8 A;  3PBQ A;  4Y2F A;  1GSV A;  3MJQ A;  3HCY A;  5CGW A;  2Y2L A;  1JWV A;  1DJA A;  1UWP X;  3GTC A;  4JGO A;  3KYZ A;  4S2I A;  5CHU A;  3TG9 A;  4Z9Q A;  4JF6 A;  3MKF A;  3LR3 A;  4P0M A;  4ZTK A;  4N92 A;  1ES4 A;  3IS2 A;  3W4Q A;  4GHI B;  4NET A;  4EU0 A;  3M2J A;  4E3K A;  1LHY A;  4OPR A;  1XGI A;  5HD3 A;  2ZM8 A;  4CLC B;  1VHM A;  3C8C A;  1LI9 A;  3MFX A;  2BG1 A;  2ZBB A;  1F5M A;  2O9B A;  3ZVT A;  1QMF A;  3IH9 A;  2O99 A;  2GZA A;  2C6W B;  3F1N B;  2WKP A;  4HBU A;  5IU1 A;  4M3K A;  2XD5 A;  1ZHH B;  5DTT A;  5KSC A;  1KGE A;  1MWU A;  4EUZ A;  1QME A;  4HP9 A;  5GHX A;  5HD5 A;  4RQ9 A;  1HTZ A;  3B42 A;  5HDD A;  1W8Q A;  4KQR A;  4XXR A;  1PZO A;  2JBF A;  3CAX A;  3JYI A;  2PHY A;  1VET A;  4LCM A;  1K57 C;  4Y15 A;  1PWG A;  2WKH A;  1DY6 A;  4KG5 A;  1YQS A;  4EQ1 A;  4P6Z S;  5D3O A;  5F1F A;  3T4S A;  4BL2 A;  3PBR A;  1RCJ A;  3P98 A;  1K6S A;  3WS4 A;  3OCN A;  3I7J A;  2I9V A;  3QNB A;  3C5A A;  1E4D A;  1K25 A;  2HV1 A;  2W3D A;  3OPH A;  1HZO A;  3W4P A;  2VZW A;  3MXQ A;  4S2L A;  3R4K A;  2IWC A;  3DWK A;  3OPL A;  5EVE A;  4DN0 A;  3HLG A;  3CG5 A;  1Y4O A;  4JXS A;  4ZRR A;  4MNR A;  3C30 A;  4LV3 A;  3MSH A;  4Y0O A;  3VFH A;  3G30 A;  4NKP A;  2Y2H A;  1DP6 A;  2QJ5 A;  1O07 A;  1JNU A;  3S7P A;  2ZL1 B;  3MR0 A;  2I72 A;  2J3T D;  4UQI M;  5HW3 A;  3MXR A;  4II7 A;  1YMX A;  3T1R A;  4JLF A;  5GLD A;  5AVE A;  1Y28 A;  2ZQC A;  5J4E A;  3DTI A;  2W1T B;  5DF7 A;  2UWX A;  1J3W A;  2VV7 A;  1W7F A;  5CHJ A;  5FAT A;  1ES5 A;  1JWP A;  3W8K A;  3LEZ A;  3E4P A;  4ETX A;  5DF8 A;  3RFB A;  5GL9 A;  3VFF A;  3B3X A;  2ZC7 A;  2V9A A;  3ZG8 B;  4EXO A;  4OOM A;  2ZJ9 A;  2X01 A;  1OTD A;  4HQA A;  3M2K A;  3EWK A;  1KDW A;  3NC8 A;  2DCF A;  1M6K A;  3G34 A;  1MPL A;  5HAI A;  4R23 A;  4I3A A;  1Q2P A;  3HUN A;  4FSF A;  4Q0J A;  4HIA A;  4U0X A;  1TF1 A;  2FZ0 A;  1MBL A;  4IBR A;  4WZ5 C;  1XA7 A;  2RCX A;  2K2N A;  3NHQ A;  4DXC A;  3T1Q B;  1MWT A;  2JKT I;  2OAP 1;  1JVJ A;  4CLC D;  1YAX A;  3S4X A;  4UAA A;  3UE6 A;  1H8Z A;  4LV2 A;  4IBX A;  1GHP A;  1ZG4 A;  1OTA A;  2D01 A;  1BLP A;  1TS0 A;  3HLW A;  1XX2 A;  2P9V B;  2XA7 S;  3RH8 B;  3IT9 A;  3FV7 A;  1FQG A;  3CZD A;  4KQD A;  1NLY A;  3N4I A;  3BY9 A;  3OC2 A;  3TSG A;  4CQH A;  4PM6 A;  3UPO A;  1OPX A;  2Z6D A;  3T4Q A;  1L0G A;  3F1P B;  4GS9 B;  1S66 L;  4CLC E;  4UHU A;  3SH9 A;  2JKT M;  2VKS A;  2Y4A A;  4GHI A;  4BMW A;  4UQI S;  4EUV A;  5FQI A;  1IYQ A;  2H10 A;  3ISG A;  3KO6 A;  1DP8 A;  4P87 A;  2ZMA A;  3CJM A;  1YMS A;  1YLP A;  2A49 A;  1XJ6 A;  2XK1 A;  5AQB A;  4CLC A;  4QU3 A;  4RX3 A;  4MBK A;  4LRY C;  3BM6 A;  2OWJ A;  3MQQ A;  4YIN A;  4BL3 A;  5GLA A;  1DRM A;  4MBH A;  2NUP C;  4GDN A;  1W79 A;  4JF4 A;  1CF0 A;  3EQV A;  3F1N A;  5A91 A;  2JC7 A;  1KGF A;  1BTL A;  2X71 A;  4GOG A;  3S1Y A;  5FAS A;  2EA9 A;  1IFQ A;  1OME A;  5FQQ A;  4DJ2 A;  1DP9 A;  1OTB A;  4KG6 A;  4NEE D;  4DXB A;  5K5B A;  1RP5 A;  1VQQ A;  1S4R A;  2J9P A;  3IXB A;  1K0K A;  2IWD A;  1MY8 A;  2XEP A;  2XRN A;  3HUM A;  3C2W A;  4HJ4 A;  1NLZ A;  2M1C A;  2R9X A;  3DWZ A;  3CWF A;  1TS8 A;  1NYM A;  4BBV A;  3T12 B;  2VV8 A;  2XFT A;  4HJ3 A;  4WL9 A;  3GSG A;  5FEG A;  1T19 A;  1LSW A;  3V50 A;  3LR4 A;  1VB6 A;  4DE2 A;  3KSI A;  1SKF A;  4EWF A;  2GDN A;  4KZ3 A;  3AGE A;  4ZJ2 A;  1MC0 A;  3FKV A;  4X68 A;  2QWS A;  3IBJ A;  3BY8 A;  5F83 A;  4L9E A;  5CEB A;  5G18 A;  3VP0 A;  2W3G A;  2XRO A;  5EVI C;  5FI2 A;  3IF6 C;  3HLE A;  2ZM0 A;  4HP4 A;  2V20 A;  4G3V A;  2FH5 A;  1NWZ A;  3UB5 P;  3UPN A;  4AFI A;  4K0W A;  1H8M A;  2A2L A;  3NDE A;  2INW A;  3V39 A;  1KDS A;  3JVV A;  2ZL1 A;  5L2F A;  2JE5 A;  3HJK A;  5DJU A;  3LIF A;  2WGW B;  3VP2 A;  4IJG A;  3MF0 A;  4QPR A;  4LRZ E;  3ZHH A;  5GHY A;  4MBF A;  4N1H A;  4YOF A;  3PR6 A;  4ZDX A;  1ODV A;  2W3H A;  3N6I A;  3DTM A;  3Q7Z A;  2VGL M;  1CI9 A;  3ZDJ A;  3LI9 A;  2Q0O A;  3SW1 A;  2KX6 A;  4KQO A;  1KVM A;  2YKF A;  1K56 D;  4GD6 A;  1EWZ A;  3IX4 A;  3MQO A;  2Y2Q A;  1S1Y A;  3UE3 A;  2DMW A;  3LIC A;  1XPB A;  3ZFZ A;  2W27 A;  4EER A;  1ONG A;  5TR7 A;  3M6H A;  1FIK A;  2B95 A;  5HSQ A;  1T1B A;  3SS4 A;  4RX2 A;  5TFQ A;  2HZ5 A;  4RA7 A;  2V0U A;  3V5M A;  1KOU A;  2Y2J A;  4E6X A;  3LY3 A;  3A3D A;  3MXS A;  1BSG A;  3EEH A;  3CUE C;  3LIB A;  2PAV P;  2H0T A;  5F5Y A;  3A0S A;  4JPM A;  1K56 A;  3G31 A;  3LID A;  2MJ6 A;  1IEM A;  3A3E A;  2HP9 A;  3M6B A;  5FAQ A;  3BYD A;  1ACF A;  3G6O A;  1LI0 A;  5DKL A;  3ZQ5 A;  2CC1 A;  1NZU A;  2Y2N A;  3GEC A;  2PRF A;  1ERQ A;  3NUL A;  3IHA A;  1PI5 A;  3RXW A;  4YFM A;  4I5S A;  2JKF A;  4OLG A;  1MKI A;  2Z2M B;  4PM7 A;  5J8X A;  3ZCZ A;  3EOI A;  3G35 A;  3IX3 A;  4GS9 A;  1TEM A;  1MWS A;  1HD8 A;  3NY4 A;  2HGV A;  2EXB A;  4N1X A;  5TBM B;  4HI4 A;  1CEG A;  2Y2O A;  2D02 A;  4R3B A;  4LV0 A;  5FDS A;  3CMZ A;  2WAF A;  3MZF A;  3AGD A;  5AJG A;  5HDS A;  1UGU A;  1TS6 A;  4PM9 A;  5A90 A;  5KIZ A;  3L9K A;  5F68 A;  3HRE A;  1H3Q A;  4HH2 A;  2KOI A;  1I2W A;  3SS5 A;  3DTE A;  4EBL A;  4MEZ A;  4FCF A;  1RGZ A;  1W5D A;  4YWZ A;  1VEU A;  4RVA A;  3VSK A;  4LRX C;  4WMC D;  1PW1 A;  4GDB A;  3LR5 A;  4WEK A;  4BEN A;  5CTN A;  2WGV A;  3VSL A;  2HJE A;  2A24 B;  4B4Z A;  3LI8 A;  4X1L A;  3UN7 A;  4GB7 A;  3R7W A;  3ULF A;  4XT2 A;  2ZC5 B;  4CJN A;  3JVU A;  4R1G A;  2M7U A;  2ZQD A;  3MZE A;  1WYC A;  2WGI A;  1OT6 A;  4KZA A;  3N8S A;  1BUE A;  1H8Y A;  1EI5 A;  5TJJ A;  3PXP A;  5GLB A;  2B18 A;  4RYE A;  4WMC A;  3QP6 A;  5DFX A;  1AXB A;  2HF6 A;  1ESU A;  4EW7 A;  1MWR A;  3B33 A;  2XR0 A;  2EWV A;  4WYY A;  3IWI A;  2Y2I A;  2WAE A;  1F2K A;  5HFO A;  2G7U A;  3K3D A;  1YLY A;  5E2F A;  3FPV A;  4GN2 A;  5FI6 A;  1CJF A;  1XGJ A;  1IYP A;  2WGW A;  5EV0 A;  1GSW A;  4WLA A;  4O7D A;  2EX6 A;  1Z6F A;  3ITB A;  5GLC A;  1YLZ A;  5EVI B;  2WKI A;  2HP6 A;  1WA9 A;  3ZNY A;  4UA7 A;  1K54 A;  2PBD P;  3BFD A;  3ITA A;  3CHW P;  4D2O A;  3DTK A;  3UB6 A;  4KUO A;  1A0K A;  3GMW A;  1ESI A;  3FC7 A;  4MN6 A;  2EFX A;  3QNC A;  4OQG A;  4GJ4 A;  3PAG A;  4C75 A;  3D72 A;  1PWC A;  1MKM A;  1KE4 A;  4GKU A;  4K91 A;  2Y8H A;  1D1J A;  2EX2 A;  4OQ0 A;  3O3V A;  3WS0 A;  2PD8 A;  2ZOH A;  5E2H A;  2EX9 A;  5CER A;  3UMD A;  3PYP A;  4E3M A;  4GLQ A;  3UO9 A;  5CED A;  2DNS A;  5FSR A;  4WBG A;  4I38 A;  3BJN A;  1I2S A;  4ARZ B;  3Q81 A;  4JXG A;  4B93 A;  2Y2P A;  4ZBE A;  4FTX A;  4LGW A;  4IUK A;  3UDI A;  4H6J B;  1U60 A;  2XSS A;  1J9M A;  1K6R A;  3VE4 A;  3HLF A;  1HLU P;  3S7Q A;  3GV9 A;  3Q7V B;  3BFE A;  5CTM A;  4E3N A;  5F1G A;  3CPT B;  3HLD A;  5CGX A;  4S2M A;  4KZ5 A;  1KVL A;  3ZYT A;  2J9O A;  4I3J A;  1PNE A;  3LY4 A;  1TD5 A;  3V3S A;  2EFU A;  2PT7 A;  3SZT A;  3VOZ A;  1SCW A;  3T4K A;  5A8B A;  1XA1 A;  2V8C A;  4OKP A;  3PAE A;  4EEP A;  3ZG7 B;  2J8Y A;  1IKG A;  3PBT A;  4KG2 A;  2VV6 A;  4HNB A;  5G4Y A;  2ZQ7 A;  2NUT C;  2J3T C;  4UEY A;  3MBZ A;  1NY0 A;  1CEF A;  4LV1 A;  1Y54 A;  3TRC A;  3V67 A;  4Q0I A;  5KZH A;  3S7O A;  4GCZ A;  3E98 A;  4UA6 A;  1KE3 A;  4R6L A;  3BFG A;  3WS1 A;  2J80 A;  3VOY A;  1P9R A;  4EEU A;  1RGY A;  1YLW A;  1G5U A;  3L7H A;  1F98 A;  1KGG A;  3MS6 A;  4DMZ A;  2ACG A;  3ZGA B;  4C6Y A;  4K0X A;  1CQA A;  4OH0 A;  4DE0 A;  2QYB A;  4BD1 A;  1Z09 A;  4F3L B;  3RJU A;  1PFL A;  3W4O A;  3G32 A;  4O0P A;  4A5R A;  1OTE A;  4KQQ A;  2E8I A;  2W3F A;  2ZM2 A;  4PHT A;  3GDI A;  1SDE A;  2PD7 A;  3H9W A;  3BLM A;  5IT5 A;  5J7E A;  3IXD A;  2ZC3 B;  1AWI A;  3OBF A;  4LEN A;  2Y59 A;  4S2N A;  5HDC A;  4JGP A;  3F1O B;  4GD8 A;  4QHC A;  2C5W B;  5CEC A;  2QZ6 A;  3QHY A;  1FCO A;  4CLC C;  4NG2 A;  1LL8 A;  3EGD C;  3VP4 A;  1OJG A;  1KE0 A;  3GVB A;  4Y17 A;  2G2U A;  3NIA A;  5L09 A;  1ONH A;  3A3F A;  2EX8 A;  4OON A;  2V1Z A;  4QY5 A;  1OTI A;  3IWO A;  4LPZ A;  1XJ2 A;  2ZQ8 A;  3PBS A;  2CMN A;  4IUH A;  1E25 A;  1NRF A;  1L3L A;  3C4P A;  4R0Q A;  3V3R A;  4GNU A;  2L0W A;  2KLI A;  4X55 A;  1SDN A;  4OP5 A;  2VGJ A;  4XUX A;  4Q0H A;  3T4T A;  5EFW A;  1L0E A;  3G2Y A;  5MC7 A;  1NXY A;  1T1C A;  3UY6 A;  2Y79 A;  4CPK A;  1FIL A;  1IOU A;  3D4F A;  1HVB A;  3W2Z A;  5I94 A;  3HLB A;  3KSF A;  2B5R A;  4X53 A;  4OOL A;  4R3J A;  4E3O A;  1LSX A;  2KDK A;  3GR2 A;  4HHD A;  4Q8I A;  4X56 A;  2VX8 A;  4DRT A;  4OP8 A;  1GCE A;  1PYY A;  3H82 B;  1VET B;  4E3I A;  1YT4 A;  3Q07 A;  1K55 A;  2HDR A;  4EBN A;  3D9Y A;  1L2S A;  3BRM A;  4MLL A;  4WN5 A;  2E8J A;  2ZMV A;  4BWI A;  2WKR A;  2HJ9 C;  4PKY A;  2W1T A;  2RL3 A;  4MDZ A;  1LL9 A;  3E4Q A;  4ARZ A;  2OOL A;  1W63 M;  1H5X A;  2G2W A;  2QKP A;  3BQA A;  5FAP A;  5FEF A;  1BYW A;  4H6J A;  5EOO A;  2LB9 A;  5F69 A;  2EXA A;  1NYY A;  3B47 A;  3FPW A;  1BT5 A;  5EE8 A;  2HDU A;  3N7W A;  2V1A A;  3LCE A;  3JPU A;  1GSX A;  2JKR I;  3DW0 A;  2K7S A;  4DKI A;  1BZA A;  4PMA A;  4I39 A;  5CHM A;  4G3K A;  5HAR A;  4OPZ A;  5CRF A;  5JYO A;  2K31 A;  3E0Y A;  2XDM A;  2ZLY A;  4IVI A;  2VK3 A;  2O9C A;  1BLH A;  1P9W A;  3LFV A;  2H5S A;  1NJ4 A;  1ZG6 A;  4GW9 A;  5I5L A;  4Y3I A;  4LLO B;  4FD8 A;  4JKT A;  3NEC A;  2JKR M;  4IVK A; 
#chains in the Genus database with same CATH homology
 1ESU A;  1L0D A;  1MWR A;  3NI9 A;  4KZ9 A;  1GHM A;  2Y2K A;  1ZC2 A;  4KZ4 A;  5EVI A;  3IXG A;  2P9V A;  2XR0 A;  3IF6 A;  3SOI A;  1BLS A;  5AQ9 A;  4WYY A;  3IWI A;  4FSF A;  2Y2I A;  1K38 A;  1XP4 A;  2WAE A;  4JXV A;  2X02 A;  4LCL A;  1M40 A;  4U0X A;  3BFC A;  3N8R A;  4S2P A;  4Y7P A;  1TVF A;  3FZC A;  2PBY A;  5HFO A;  1MBL A;  4IBR A;  4DE1 A;  1YLY A;  5AQA A;  3OCL A;  4WZ5 C;  2OLU A;  1XA7 A;  5E2F A;  1L0F A;  1K4F A;  2ZC4 B;  2RCX A;  4GN2 A;  5FI6 A;  4DXC A;  1MWT A;  4HES A;  2OSU A;  1JVJ A;  1MXO A;  1XGJ A;  2HPB A;  4S2J A;  3S4X A;  1IYP A;  4N9L A;  2WGW A;  4UAA A;  4O7D A;  2ZD8 A;  2DRW A;  2EX6 A;  1Z6F A;  1H8Z A;  3ITB A;  4LV2 A;  4IBX A;  1GHP A;  5GLC A;  1ZG4 A;  2H0Y A;  1PIO A;  1YLZ A;  1BLP A;  2XQZ A;  3HLW A;  1XX2 A;  5AQ7 A;  5EVI B;  2WKI A;  2HP6 A;  2P9V B;  2PU4 A;  4EV4 A;  3ZNY A;  5FA7 A;  5A93 A;  4UA7 A;  4U0T A;  3IT9 A;  1K54 A;  3BFD A;  3FV7 A;  4GZB A;  3ITA A;  4HEF A;  5HAQ A;  1FQG A;  2Q9N A;  4D2O A;  3CZD A;  3SH8 A;  5M19 A;  2WZZ A;  4IED A;  3N4I A;  3TSG A;  3OC2 A;  3BEC A;  2Y2G A;  2ZQA A;  3GMW A;  3O87 A;  1YLJ A;  2WUQ A;  2WZX A;  4PM6 A;  3UPO A;  3NBL A;  1ESI A;  1L0G A;  2EFX A;  3QNC A;  4OQG A;  4KEN B;  4Y0T A;  3PAG A;  4UHU A;  4C75 A;  1PW8 A;  3SH9 A;  1PWC A;  2Y4A A;  3C7V A;  3WWX A;  5U47 A;  1DJC A;  1KE4 A;  5FQI A;  4GKU A;  1IYQ A;  4K91 A;  1K55 C;  2H10 A;  3ISG A;  1DJB A;  4P87 A;  2ZMA A;  3CJM A;  5BOH A;  2XF3 A;  1YMS A;  4NK3 A;  1YLP A;  2EX2 A;  2A49 A;  2XK1 A;  3NDG A;  4OQ0 A;  3O3V A;  2Y91 A;  5AQB A;  4QU3 A;  3WS0 A;  4B88 A;  4RX3 A;  4MBK A;  3BM6 A;  5E2H A;  3Q7V A;  2EX9 A;  5CER A;  4QB8 A;  1WE4 A;  2XGN A;  5E43 A;  1Q2Q A;  3O86 A;  4OQI A;  4E3M A;  5CED A;  3UO9 A;  2DNS A;  4YIN A;  5FSR A;  4BL3 A;  5GLA A;  4DF6 A;  4WBG A;  4MBH A;  1TDL A;  4GDN A;  2FFF B;  4PM5 A;  1I2S A;  4S2K A;  1W79 A;  4JF4 A;  4WEL A;  1FOF A;  3EQV A;  3Q81 A;  4JXG A;  1YLT A;  5A91 A;  2JC7 A;  2WYX A;  2Y2P A;  3VP1 A;  1KGF A;  1BTL A;  2X71 A;  4ZBE A;  3TOI A;  4GOG A;  3ZVW A;  3OZH A;  3S1Y A;  3UDI A;  4H8R A;  3WRZ A;  5FAS A;  1U60 A;  1J9M A;  2XH9 A;  1OME A;  1K6R A;  5FQQ A;  4DE3 A;  4KG6 A;  3AGF A;  3IXH A;  4DXB A;  3HLF A;  1TDG A;  1RP5 A;  1VQQ A;  1XXM A;  1I5Q A;  1PWD A;  2J9P A;  3IXB A;  3GV9 A;  3Q7V B;  3BFE A;  5FQM A;  5CTM A;  3WRT A;  2IWD A;  2WKE A;  3C4O A;  4OPY A;  1MY8 A;  2QPN A;  4E3N A;  3SS3 A;  2XEP A;  5F1G A;  3HLD A;  3HUM A;  5CGX A;  2ZC6 B;  4S2M A;  4C3Q A;  4KZ5 A;  1KVL A;  2R9X A;  1K57 A;  1ZKJ A;  3DWZ A;  2J9O A;  4KZ7 A;  1NYM A;  5DVA A;  4DDY A;  5CGS A;  3LY4 A;  5EVL A;  3V3S A;  2EFU A;  1FSW A;  4P85 A;  2OLV A;  2XFT A;  3IQA A;  3VOZ A;  1SCW A;  3BFF A;  3GSG A;  4N9K A;  1XA1 A;  4OKP A;  3PAE A;  3V50 A;  3ZG7 B;  2J8Y A;  1FCM A;  3BLS A;  4JF5 A;  4DE2 A;  1IKG A;  3PBT A;  1VM1 A;  2XD1 A;  5FQK A;  1SKF A;  4KG2 A;  1FR1 A;  4EWF A;  2GDN A;  5TGF A;  4KZ3 A;  2ZQ7 A;  3NCK A;  3AGE A;  4WM9 A;  4ZJ2 A;  3MBZ A;  1NY0 A;  1CEF A;  3FKV A;  3FYZ A;  4LV1 A;  4X68 A;  3MZD A;  1Y54 A;  3HUO A;  3FWL A;  5FQJ A;  3GQZ A;  3P09 A;  3WS2 A;  1IYS A;  4XUZ A;  5F83 A;  4E3L A;  3A3I A;  5CEB A;  1BUL A;  5G18 A;  3VP0 A;  3UE1 A;  2Y2M A;  2FFY A;  4QD4 A;  3RXX A;  4QJG A;  4U3T A;  5EVI C;  3EQU A;  5KZH A;  2Y55 A;  5FI2 A;  1JWZ A;  2OV5 A;  3IF6 C;  4UA6 A;  3HLE A;  1K4E A;  2ZM0 A;  3SH7 A;  1KE3 A;  3BFG A;  4B4X A;  3WS1 A;  2V20 A;  3E2K A;  3G4P A;  2P74 A;  3IF6 B;  3VOY A;  5EEC A;  1RGY A;  3UPN A;  5GHZ A;  1YLW A;  4K0W A;  5DF9 A;  1ES2 A;  4OVD A;  2A3U A;  4OQH A;  2XLN A;  4JBF A;  3O88 A;  5EUA A;  3OPP A;  3NDE A;  1KGG A;  4OOY A;  3V39 A;  1KDS A;  4S2O A;  4ID4 A;  1W8Y A;  1LLB A;  2ZQ9 A;  5L2F A;  2JE5 A;  1GA9 A;  3ZGA B;  4C6Y A;  4K0X A;  2VGK A;  4QY6 A;  4F94 A;  2WGW B;  4OH0 A;  3VP2 A;  4DE0 A;  2WAD A;  1IEL A;  3E2L A;  4BD1 A;  3ZHH A;  5GHY A;  4DDS A;  4MBF A;  3ZNT A;  1ES3 A;  2QMI A;  3FKW A;  4N1H A;  3RJU A;  2XFS A;  4ZJ1 A;  3W4O A;  3G32 A;  4R4S A;  4OPQ A;  1WYB A;  5M1A A;  5DTS A;  1LL5 A;  4ZDX A;  1K54 C;  4A5R A;  1ERM A;  3N6I A;  3HBR A;  3DTM A;  3Q7Z A;  4KZB A;  3WS5 A;  4KQQ A;  3ZG0 A;  2E8I A;  4X69 A;  1CI9 A;  3IH8 A;  1ERO A;  3PBQ A;  4E3J A;  3IHB A;  2ZM2 A;  3ZDJ A;  3ZG9 B;  1SDE A;  5JYP A;  5CGW A;  2Y2L A;  1JWV A;  3BLM A;  4WEJ A;  1DJA A;  3GTC A;  4KQO A;  1KVM A;  3IXD A;  1JTD A;  2ZC3 B;  4S2I A;  1K56 D;  5CHU A;  3LO7 A;  4Z9Q A;  3TG9 A;  3UDF A;  2Z2L B;  4JF6 A;  4LEN A;  3MKF A;  1EWZ A;  4GD6 A;  4P0M A;  4ZTK A;  4N92 A;  2Y2Q A;  2Y59 A;  4S2N A;  3UE3 A;  1ES4 A;  3S22 A;  3W4Q A;  3C7U A;  5IHV A;  4NET A;  4GD8 A;  4QHC A;  2C5W B;  1XPB A;  3ZFZ A;  5CEC A;  3M2J A;  5HL1 A;  3HLC A;  5FAO A;  2QZ6 A;  3UNW A;  1PZP A;  1YM1 A;  3QHY A;  1ONG A;  5TR7 A;  1LHY A;  5F82 A;  4E3K A;  1FCO A;  4OPR A;  1XGI A;  3M6H A;  3VP4 A;  1KE0 A;  2R9W A;  3GVB A;  2ZM8 A;  2G2U A;  3NIA A;  3Q1F A;  1ONH A;  3HVF A;  3SS4 A;  1FR6 A;  1LI9 A;  3A3F A;  4RX2 A;  2EX8 A;  4OON A;  2BG1 A;  5TFQ A;  4RA7 A;  3V5M A;  3G2Z A;  4E6X A;  2Y2J A;  3LY3 A;  3ZVT A;  1QMF A;  3A3D A;  3IH9 A;  5HAP A;  3MXS A;  2V1Z A;  1BSG A;  4QY5 A;  2C6W B;  3IWO A;  2WK0 A;  5EOE A;  2ZQ8 A;  4HBU A;  2H0T A;  4JXW A;  3PBS A;  1CI8 A;  4M3K A;  1E25 A;  1NRF A;  2XD5 A;  5DTT A;  5KSC A;  1KGE A;  1MWU A;  3C4P A;  4HBT A;  1QME A;  4JPM A;  4PPR A;  4UA9 A;  5GHX A;  4R0Q A;  4EBP A;  4EUZ A;  3V3R A;  1K56 A;  3G31 A;  1HTZ A;  3VP3 A;  4GNU A;  5CXW A;  1IEM A;  4WZ5 A;  3A3E A;  2HP9 A;  3M6B A;  5DTK A;  5E2G A;  5FAQ A;  3IWQ A;  3BYD A;  1N4O A;  4X55 A;  3VMA A;  1W8Q A;  4BD0 A;  4KQR A;  1SDN A;  4OP5 A;  3IF5 A;  4E6W A;  3N8L A;  2VGJ A;  4XUX A;  4XXR A;  1LI0 A;  4R4R A;  3BEB A;  1PZO A;  4WZ4 A;  2JBF A;  3JYI A;  1IYO A;  2BLS A;  1BLC A;  2CC1 A;  1NZU A;  2Y2N A;  4LCM A;  1K57 C;  1L0E A;  1ERQ A;  3G2Y A;  1PWG A;  2WKH A;  1NXY A;  3IHA A;  1PI5 A;  1DY6 A;  4KG5 A;  3RXW A;  1YQS A;  3UY6 A;  4YFM A;  4CPK A;  2J7V A;  5D3O A;  1S6R A;  3D4F A;  1HVB A;  5F1F A;  4BL2 A;  3PBR A;  1RCJ A;  5I94 A;  3P98 A;  1K6S A;  5HX9 A;  4OLG A;  3HLB A;  1MKI A;  2B5R A;  3WS4 A;  4X53 A;  2Z2M B;  4OOL A;  4BJP A;  4PM7 A;  5J8X A;  3OCN A;  3I7J A;  1GHI A;  4R3J A;  5FI7 A;  4E3O A;  2IWB A;  1N9B A;  2V2F F;  3GR2 A;  3ZCZ A;  1PI4 A;  3G35 A;  3MFD A;  3QNB A;  4X56 A;  4Q8I A;  4DRT A;  1TEM A;  4OP8 A;  1MWS A;  1E3U D;  1HD8 A;  1E4D A;  3C5A A;  1GCE A;  4FH4 A;  3NY4 A;  1K25 A;  1PYY A;  3OPH A;  2EXB A;  1HZO A;  4N1X A;  3W4P A;  1G68 A;  5FQ9 A;  4FH2 A;  4E3I A;  1XKZ A;  1YT4 A;  4S2L A;  1IKI A;  3Q07 A;  1CEG A;  1K55 A;  2Y2O A;  2HDR A;  5KMW A;  4R3B A;  2IWC A;  3DWK A;  4LV0 A;  4EBN A;  2JCH A;  1L2S A;  3BRM A;  4MLL A;  3CMZ A;  3OPL A;  2WAF A;  3MZF A;  3AGD A;  1ALQ A;  5FDH A;  3HLG A;  3CG5 A;  5E2E A;  4JXS A;  4PM9 A;  5M18 A;  3A3J A;  4MNR A;  3UDX A;  2RL3 A;  1S0W A;  4P6B A;  1SHV A;  5A90 A;  1LL9 A;  4LV3 A;  3GRJ A;  3HRE A;  4Y0O A;  3VFH A;  3G30 A;  3PTE A;  1I2W A;  1H5X A;  2G2W A;  2Y2H A;  3SS5 A;  4OLD A;  1FSY A;  1C3B A;  4EBL A;  5KSH A;  5FAP A;  4MEZ A;  1JTG A;  1O07 A;  4FCF A;  2PU2 A;  1RGZ A;  1W5D A;  2I72 A;  4RVA A;  3VSK A;  4WMC D;  1PW1 A;  5HW3 A;  4GDB A;  5EOO A;  3MXR A;  3ZG5 A;  4BLM A;  1YMX A;  2EXA A;  1CK3 A;  4JLF A;  1NYY A;  4WEK A;  1BT5 A;  4BEN A;  1E3U A;  5EE8 A;  5CTN A;  5GLD A;  2HDU A;  2WGV A;  5EVI D;  2HDS A;  3PBN A;  3VSL A;  2HP5 A;  2ZQC A;  3N7W A;  3LCE A;  3DW0 A;  2HDQ A;  3Q82 A;  1NZO A;  3OPR A;  4ZAM A;  3UE0 A;  5DF7 A;  2UWX A;  4B4Z A;  3PBO A;  4DKI A;  1W7F A;  3UN7 A;  1BZA A;  5CHJ A;  5FAT A;  1GA0 A;  2Q9M A;  4PMA A;  4GB7 A;  1ES5 A;  1JWP A;  3W8K A;  3LEZ A;  2ZC5 B;  4X6T A;  5CHM A;  4CJN A;  1FCN A;  5A92 A;  4R1G A;  5DF8 A;  2ZQD A;  3MZE A;  5GL9 A;  1WYC A;  5HAR A;  3B3X A;  4OPZ A;  4S2N C;  1G6A A;  5CRF A;  3VFF A;  5JYO A;  4ZJ3 A;  2ZC7 A;  2WGI A;  3ZG8 B;  4KZA A;  4PM8 A;  4BQM A;  2XDM A;  2ZLY A;  3MKE A;  3N8S A;  4Y0U A;  1BUE A;  3UPP A;  1H8Y A;  4IVI A;  4OOM A;  1EI5 A;  2ZJ9 A;  2X01 A;  1BLH A;  5GLB A;  3M2K A;  4RYE A;  2H5S A;  1KDW A;  1NJ4 A;  1ZG6 A;  3NC8 A;  4WMC A;  5EPH A;  2DCF A;  1M6K A;  4L0L A;  3G34 A;  1O7E A;  1MPL A;  5HAI A;  4R23 A;  4FD8 A;  4JKT A;  4EQI A;  1Q2P A;  1AXB A;  3HUN A;  4IVK A;  4KZ6 A;  4KZ8 A;  3HL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...