5FQKA

W229d and f290w mutant of the last common ancestor of gram-negative bacteria (gnca4) beta-lactamase class a bound to 5(6)-nitrobenzotriazole (ts-analog)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
263
structure length
263
Chain Sequence
AALSEQLAELEKRSGGRLGVAVLDTATGRRFGYRGDERFPMCSTFKALLAAAVLARVDQGKENLDRRITYGKEDLVDYSPVTEKHVGDGMTVAELCEAAITYSDNTAANLLLEALGGPAALTAFLRSIGDNVTRLDRWEPELNTAAPGDPRDTTTPAAMAATLRTLLLGDVLSPASRQQLVDWLIANKTGDKRLRAGLPADDRVGDKTGTGEHGTTNDIAVIWPPNRAPILVAVYLTESQVDADARDAVIAEVARLVVAAWHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GNCA4 LACTAMASE W229D AND F290W
publication title De novo active sites for resurrected Precambrian enzymes.
pubmed doi rcsb
source organism Synthetic construct
total genus 99
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5fqkA00
4LENA 4QU3A 1YLYA 1SDNA 3GTCA 3ZNTA 4GB7A 5L2FA 3W8KA 4E3KA 4IBRA 4GD6A 4N92A 3VMAA 3O86A 4B4ZA 1S0WA 1K55A 1PWDA 2Y91A 1IKGA 1OMEA 3A3DA 3IXHA 4IEDA 4UHUA 4E3LA 3NIAA 1IYSA 4WEJA 3GRJA 3G4PA 3UE3A 5HL1A 3O87A 3SS5A 3BFGA 1M6KA 3ZDJA 3HLFA 4GN2A 5HAIA 5FATA 2A3UA 3V3RA 5DF9A 3IF6B 1PW8A 1E3UA 1I2SA 4PMAA 1EI5A 2G2UA 1YMSA 4IBXA 4EV4A 3NDEA 1NYMA 3BEBA 4KZ4A 1KVLA 4P6BA 2OV5A 3HL9A 3MXSA 4OPRA 1KE3A 1PI5A 4MEZA 5F1FA 4MBFA 2WGWB 4KZ5A 1K54A 2WAFA 4JKTA 1FR6A 1ERMA 4EBLA 4DXBA 4L0LA 5EPHA 4DE3A 2Y2OA 2FFFB 3BM6A 3WWXA 2V2FF 1EROA 2Y2KA 1RGYA 4N9KA 1PIOA 3HREA 2I72A 1O7EA 5CEBA 4WBGA 1GA9A 2ZQDA 5GL9A 3HUMA 4FSFA 4FH2A 4OOLA 5IHVA 1K38A 4S2PA 4JXSA 1SHVA 3OC2A 3IF6A 4FH4A 1DJAA 1XX2A 3N4IA 5EUAA 4NETA 5F82A 4EQIA 4X6TA 4EWFA 4KZAA 2Y2PA 2OSUA 4OKPA 4LV3A 3A3IA 1ES4A 3AGDA 4WEKA 4ID4A 1MY8A 5DF8A 4WZ4A 2ZC4B 4GZBA 2WGWA 4JLFA 2EXAA 1IELA 5I94A 3TSGA 1IYOA 3UPOA 4KZ6A 4DDYA 3IT9A 3UDFA 4WM9A 2RL3A 2Y2NA 2VGKA 4BL2A 4IVIA 3PBOA 4JBFA 3GVBA 1MWTA 3Q07A 5JYPA 1W7FA 2ZMAA 4GOGA 3VFFA 4BD0A 1NRFA 4H8RA 4U0XA 3VP0A 3HLWA 4N9LA 4UAAA 3W4OA 1LLBA 3NBLA 1JWZA 3N6IA 4KZ9A 3A3JA 2ZD8A 3V50A 1ES3A 4UA7A 3M6HA 2X71A 3SH7A 1ZG6A 1KGEA 4QY5A 3RXWA 2QMIA 3S22A 4EUZA 3WS0A 1K4EA 2HPBA 4KZBA 1DJBA 4WZ5A 3SOIA 1RP5A 3GV9A 2ZQ7A 5E2EA 1LI0A 2EX6A 3SH8A 1BLSA 1ERQA 3M6BA 2ZC6B 2Y2QA 3PBSA 1I2WA 2JBFA 3SS4A 2B5RA 1L0FA 1PW1A 2J9OA 3LO7A 4P85A 3ZNYA 4BENA 5CGSA 2Z2LB 3C4OA 3QNBA 4S2MA 3WRZA 4OPYA 5DTTA 1S6RA 4CJNA 1L0DA 3HLCA 1ONGA 4C6YA 3PBRA 3BRMA 4DE1A 3S1YA 2WZXA 4JPMA 1MKIA 5M19A 3UE1A 3JYIA 3UPPA 1XPBA 4OQGA 2Y2HA 2JC7A 5GLDA 1VM1A 1JVJA 3CZDA 2RCXA 3LEZA 4DF6A 5EVID 1YLWA 1GHMA 2Y2LA 5FASA 2XLNA 1K55C 1LHYA 2ZQ8A 2DNSA 3PBTA 4O7DA 4ZAMA 1NZUA 1ALQA 1DJCA 3FV7A 5FSRA 2XFTA 3TG9A 5CECA 1ES2A 1FCNA 2ZQAA 4S2KA 5FQKA 5J8XA 4E3NA 1NYYA 1FQGA 5EOEA 3W4PA 1G68A 3OPHA 3WS1A 4U0TA 1K6RA 1XP4A 4KG2A 4RYEA 1RGZA 3ZVTA 2ZC7A 1JTDA 3QNCA 4JXWA 4P87A 4R4RA 4GDBA 2XQZA 5HARA 4HBTA 1K54C 1HZOA 4KG6A 2C6WB 4WMCD 1ONHA 4P0MA 2HDRA 3ZGAB 2HDSA 1GHPA 4EBNA 2XFSA 2ZC5B 3E2LA 3UO9A 3G35A 3HLGA 1PWGA 4GKUA 3QHYA 3MBZA 5TFQA 3TOIA 5KSHA 4FD8A 4E6XA 1MPLA 1PYYA 1LL5A 2EX8A 5FQQA 3IF6C 4ZJ2A 2H0TA 4HEFA 3PBQA 3LY4A 3NDGA 3CJMA 4LV1A 1ESIA 5FAOA 1KDWA 2Y2GA 3MXRA 5EE8A 3ZHHA 1JTGA 4X56A 1FR1A 1WE4A 3OCLA 2HDQA 4KZ3A 3VSKA 3OPPA 5EECA 2OLUA 4N1HA 3ITAA 1G6AA 2H10A 4OQHA 1MBLA 4MLLA 1K4FA 3ZG0A 1AXBA 1FCMA 1FSYA 2J7VA 5HFOA 1FSWA 4ZDXA 1EWZA 4Y7PA 1KE4A 4E3MA 4KQQA 1K57A 3O3VA 2J8YA 3CMZA 3IWOA 4RVAA 1PWCA 3UE0A 1KGFA 3PBNA 3IWIA 4MNRA 5DTSA 2XF3A 5DVAA 1SCWA 4JXVA 4ZBEA 5CEDA 5CERA 3V5MA 4N1XA 4WMCA 3IXBA 4U3TA 2WGVA 4QB8A 2BLSA 2HP5A 3Q7ZA 1PZPA 3MKFA 1IYPA 3M2KA 4OP5A 3A3EA 2EX2A 5A91A 4WZ5C 2ZLYA 1E4DA 1I5QA 2WGIA 4LCMA 1H8YA 1ZKJA 3Q7VB 3N8SA 2WKHA 5E2HA 5KMWA 1BLPA 2ZC3B 2PU2A 3IHAA 4R0QA 3BLMA 2VGJA 4B88A 3ZG9B 4DE0A 2IWCA 2Q9MA 1BUEA 2C5WB 2Y2MA 3DWZA 3VOYA 3ZG7B 1NXYA 4UA9A 3GMWA 1GCEA 1N9BA 4Y0UA 5G18A 4YINA 2QZ6A 2HDUA 1FOFA 1O07A 3UNWA 4DRTA 2Z2MB 4MBHA 1YT4A 1J9MA 1HVBA 3P98A 1IKIA 5EVLA 4DDSA 3MZEA 2H0YA 5CHUA 5AQ7A 1IYQA 2P74A 1Q2QA 5CHMA 3P09A 3VP2A 3RJUA 3GSGA 2XGNA 4X68A 2HP9A 1QMEA 1XA1A 4Q8IA 1K25A 5HAPA 3G2ZA 3Q82A 4K0XA 3UY6A 5DF7A 1C3BA 4S2NA 3G2YA 1DY6A 5AQBA 5HAQA 5AQAA 2ZQ9A 4LCLA 1BZAA 2WAEA 3WS4A 4KG5A 1NJ4A 4JF4A 1TVFA 2XD1A 3NY4A 4GNUA 4R3JA 1H8ZA 3I7JA 1W8QA 1PI4A 1WYCA 4IVKA 4R4SA 3O88A 4YFMA 4QY6A 5F83A 3V3SA 5CRFA 3HUNA 3IQAA 4PM9A 4X53A 5GHYA 4OQ0A 5CXWA 2Q9NA 3ISGA 2H5SA 5EOOA 2IWBA 5GHZA 1IEMA 3UDXA 5BOHA 5FA7A 3MZDA 1W79A 2X01A 3SH9A 2PBYA 3B3XA 3V39A 3HLEA 5A92A 2ZM2A 2XEPA 3G30A 1CEGA 3ZVWA 1E3UD 3DTMA 4B4XA 5JYOA 1MWUA 2Y55A 3AGFA 3Q1FA 5CHJA 3UPNA 1WYBA 2WK0A 4OH0A 5U47A 3CG5A 2R9WA 5CGXA 5EVIB 3ZFZA 1YLTA 2R9XA 5EVIC 1KDSA 2CC1A 3NI9A 2Y2IA 4PPRA 3SS3A 4S2IA 1N4OA 1SKFA 4DXCA 5A93A 1L2SA 1BTLA 5FDHA 1ZG4A 2EFXA 4M3KA 5CTNA 4XUXA 1ZC2A 3GQZA 1YMXA 5AQ9A 3W4QA 3OPLA 1BLCA 2ZQCA 4PM8A 4GD8A 1L0GA 3WS2A 4BLMA 1K57C 4ZJ3A 1XA7A 1Y54A 4S2JA 4WYYA 4XUZA 3VFHA 4CPKA 3BECA 4BJPA 4KENB 2X02A 3HUOA 4OOMA 5FI2A 4QD4A 5EVIA 5HW3A 3LCEA 2UWXA 1BULA 3EQVA 3IH8A 4OONA 3IH9A 1YLPA 5FAQA 4D2OA 3BFEA 4GDNA 3M2JA 3HLBA 3D4FA 3EQUA 3LY3A 4XXRA 4K0WA 3VP3A 4LV2A 4X69A 1NY0A 4OLDA 3UDIA 1CI9A 4DE2A 2ZM0A 1ESUA 1YQSA 4BQMA 4C3QA 2XK1A 1L0EA 3FKWA 3Q81A 3IXDA 4OQIA 1FCOA 2WKEA 3BFCA 1BSGA 1HD8A 5FI6A 5GLAA 3N8RA 4ZJ1A 3WRTA 1QMFA 3MFDA 4JXGA 1Q2PA 4A5RA 3HVFA 4PM7A 2DCFA 3FYZA 1U60A 1BT5A 3ITBA 2XD5A 3N8LA 2J9PA 5GLBA 3E2KA 3G31A 2HP6A 3IWQA 5A90A 2JE5A 3DWKA 4F94A 4Z9QA 1M40A 4R3BA 4LV0A 5F1GA 1LI9A 2DRWA 4Y0OA 5E2GA 2JCHA 1YM1A 5FQJA 1MWSA 2P9VB 3IXGA 3C7VA 4S2LA 4HBUA 4MBKA 2Y59A 2WYXA 1K56D 2BG1A 1LL9A 4S2NC 2EXBA 1KVMA 1GA0A 4RX2A 4EBPA 2FFYA 2EX9A 5FQIA 2EFUA 4OP8A 3S4XA 5M18A 3OPRA 4BL3A 2WKIA 3PAEA 3MZFA 4QJGA 1TDLA 3WS5A 4KQOA 1NZOA 3G34A 1JWPA 4FCFA 4UA6A 2ZM8A 1TDGA 2V20A 4KZ7A 3G32A 4R23A 4WELA 5FQMA 4PM5A 3N7WA 5M1AA 5GLCA 4OPZA 5FI7A 3Q7VA 3ZCZA 1CI8A 5TGFA 5KZHA 2WADA 1K6SA 5TR7A 2P9VA 3VOZA 3HLDA 1XKZA 3GR2A 1E25A 4OPQA 1KGGA 3BFFA 2A49A 4JF6A 4RA7A 3C4PA 4E6WA 1H5XA 3BLSA 5D3OA 4ZTKA 3C5AA 3AGEA 1RCJA 2OLVA 5FAPA 2PU4A 5CTMA 4OOYA 4S2OA 5GHXA 4E3IA 5FQ9A 4X55A 3IF5A 4DKIA 4PM6A 5E2FA 1HTZA 3VP1A 1BLHA 4R1GA 4E3JA 2G2WA 4OVDA 1K56A 3OCNA 1XGJA 3BFDA 3UN7A 2Y2JA 3HBRA 4RX3A 4E3OA 5KSCA 3BYDA 2ZJ9A 2V1ZA 4NK3A 4OLGA 5E43A 1GHIA 3NCKA 1CEFA 1YLJA 3IHBA 1SDEA 4KQRA 3VSLA 2GDNA 1JWVA 3PTEA 1Z6FA 3RXXA 3C7UA 2WUQA 1ES5A 1TEMA 3A3FA 2XH9A 2QPNA 4KZ8A 2WZZA 4BD1A 5CGWA 3FWLA 3VP4A 2E8IA 4QHCA 3FZCA 3ZG8B 3DW0A 1YLZA 4C75A 1XGIA 3FKVA 4HESA 2Y4AA 3OZHA 1XXMA 3NC8A 4K91A 5DTKA 4Y0TA 1PZOA 2XDMA 3PAGA 3ZG5A 1MWRA 2XR0A 3MKEA 1KE0A 1W8YA 4JF5A 1VQQA 1W5DA 1CK3A 2IWDA 1MXOA 5HX9A
chains in the Genus database with same CATH superfamily
1NRJA 3LIFA 4LENA 4QU3A 3W8KA 4E3KA 3R7WB 1FIKA 1CQAA 3IX4A 4N92A 3VMAA 2PYRA 5J4EA 4UHUA 4E3LA 1H0MA 1Y28A 1T18A 3G4PA 5HL1A 1M6KA 3HLFA 4GN2A 3V3RA 3IF6B 1PW8A 2G2UA 3C38A 2W1TA 4EV4A 3GDIA 2OV5A 4WUJA 2VZWA 4MEZA 4MBFA 2WGWB 4WLAA 4KZ5A 1FR6A 4KQDA 5EPHA 2FFFB 3BM6A 2KOIA 1EROA 4KUKA 2Z6CA 5CEBA 4WBGA 2ZQDA 4X1MA 4FSFA 5IHVA 4JXSA 2BASA 3E98A 3N4IA 2OSUA 1DP8A 5F5YA 5DF8A 1F5MA 1XFNA 2EXAA 4EW7A 1IELA 1IYOA 2LB9A 4KZ6A 4IVIA 3QP1A 1MWTA 5G4ZA 4GOGA 4NXGA 4N9LA 4UAAA 1P9WA 4BBUA 1JWZA 4KZ9A 1DP9A 2QJ5A 4UA7A 2L1MA 3NULA 4HH3A 1NWZA 4WZ5A 4G3WA 1LI0A 1BLSA 1ERQA 2Y2QA 1BYWA 1L0FA 1PW1A 2B18A 1X0OA 2Z2LB 5CGSA 5DTTA 1S6RA 1L0DA 4XT2B 1ONGA 1YPRA 4DE1A 3TE8A 3LIEA 2PD7A 2ZBBA 4Z1WA 4JPMA 1MKIA 3NOPC 3JYIA 3LIAA 4IUKA 3BW6A 3LUQA 1MZUA 5GLDA 1JVJA 2RCXA 5AVFA 4ETXA 1ACFA 2V0UA 2W3GA 2ZQ8A 2DNSA 3PBTA 1NZUA 1ALQA 1DJCA 3LICA 3TG9A 5CECA 3W4PA 3OPHA 3WS1A 4KG2A 4RYEA 1RGZA 4P87A 4GDBA 4HBTA 4WMCD 5HPFA 3KSHA 2HF6A 3G35A 4GKUA 4I3AA 3TOIA 1V9YA 4WF0A 1K0KA 1ZTUA 1T1BA 3A0VA 1ESIA 2Y2GA 3MXRA 5KIZA 4KZ3A 3VSKA 5EECA 4EERA 1MBLA 4MLLA 4HQAA 1FSYA 5DJUA 1XJ3A 3IWOA 3UE0A 5DTSA 2OWJA 4I39A 5DVAA 5F69A 4ZBEA 5IT5A 5CERA 3M2KA 5A91A 1D7EA 4M4XA 4WZ5C 3NJAA 1E4DA 5KMWA 1H8YA 1ZKJA 2G7UA 2PU2A 2VGJA 2IWCA 4P6ZM 2DMWA 1BUEA 2PDRA 3VOYA 1NXYA 4HP9A 5FEFA 1N9BA 5G18A 4YINA 4B93A 1J9MA 1HVBA 2VLGA 3P98A 3MZEA 5CHUA 2PYPA 1IYQA 5CHMA 2HP9A 1XA1A 1K25A 4K0XA 1C3BA 1DY6A 4HH2A 3MSHA 2WAEA 1NJ4A 4FOFA 5F83A 2XA7M 4YFMA 4QY6A 4DJ3A 3NOTC 5CRFA 3LR4A 5GHYA 5CXWA 4I3JA 5EOOA 4I3IA 5GHZA 3P01A 3MZDA 1OPXA 2X01A 2Y79A 1E3UD 3NOUC 1VEUB 1MWUA 5TBMB 4OH0A 2AVXA 3CG5A 1ZHHB 3ZFZA 3DBAA 2HJ9C 3CPTA 5EVIC 2Y2IA 4PPRA 1BTLA 4EETB 5AQ9A 4ARZA 4HIAA 3OPLA 1BLCA 3WS2A 4BLMA 1Y54A 4S2JA 4HHDA 1VETA 2GX5A 4LRYC 2PR5A 4QD4A 1TD5A 4O8GA 2W27A 4D2OA 3MQOA 4LV2A 1NY0A 1CI9A 1W63M 2XK1A 3FKWA 4OQIA 4HP4A 3WRTA 4BWIA 3N8RA 1QMFA 2ZOHA 3ITBA 3N8LA 3S7NA 5A90A 3IWQA 2JE5A 2QJ7A 1P9RA 4LV0A 1LI9A 4Y0OA 3IXGA 4GS9B 4EBPA 1CF0A 5FQIA 3S4XA 3OPRA 3MZFA 3F1PA 4KQOA 1NZOA 4FCFA 1JWPA 4ESPA 4KZ7A 4WELA 3N7WA 4OPZA 2WADA 3VOZA 3GR2A 4R38A 2A49A 3C4PA 4E6WA 1H5XA 4K08A 3TRCA 2K2NA 2PU4A 4OOYA 1Z09A 4DKIA 2VV6A 5E2FA 2G2WA 1OT9A 4OVDA 4CLCD 1XGJA 3UN7A 5KSCA 3BYDA 3RFBA 2J3TC 3NCKA 2GDNA 3PTEA 1Z6FA 4IUHA 3RXXA 3T4QA 4KZ8A 2QPNA 4HJ6A 1YKDA 4Y3IA 3ZG8B 2PR6A 1YLZA 4Y0TA 3PAGA 5IU1A 1MWRA 2XR0A 1F2KA 3C8CA 1MXOA 3IS2A 3UB5P 1TS6A 1SDNA 1S1ZA 4GB7A 1W63Q 4IBRA 4LRZE 4B4ZA 3MS6A 1TS0A 1ODVA 1DRMA 3NIAA 3IBRA 1IYSA 1GSVA 2V8FA 3SS5A 3ZDJA 5FATA 2A3UA 5DF9A 3NDEA 3MJQA 2E8JA 1OJGA 1KE3A 4O01A 1K54A 4EBLA 2O9CA 4L0LA 4DE3A 2WKRA 1PIOA 2W3FA 4JGRA 1S67L 3HUMA 4O0PA 5L8MA 4S2PA 5KSHA 1SHVA 5EUAA 2Z6DA 4FH4A 1DJAA 2VX8A 4EWFA 4OKPA 1ES4A 2OWHA 5AJGA 4ID4A 1VB6A 4GZBA 3OOVA 4JLFA 5I94A 3UDFA 1N9NA 4EU0A 3PBOA 4JBFA 3Q07A 3T4JA 1MC0A 3VFFA 1NRFA 4H8RA 3S7PA 3HLWA 1LLBA 1LSVA 3N6IA 2JN7A 2YKHA 2ZL1B 2X71A 1ZG6A 2EWVA 3F1OB 1DJBA 3SOIA 3GV9A 5E2EA 2EX6A 1TS7A 2ZC6B 3PBSA 2B5RA 4BENA 4P85A 3C4OA 2WKQA 3WRZA 2VGLS 3S1YA 3CI6A 3DAVA 3RTYA 4LRXC 3UE1A 4R70A 1XPBA 1YLWA 2VKSA 2Y2LA 2XLNA 3CWFA 4O7DA 4R6LA 3FV7A 5FSRA 4Q0JA 1ES2A 5J8XA 1FQGA 3T4TA 2V1AA 4JXWA 4R4RA 2A24A 2XQZA 1K54C 2C6WB 2HDRA 3ZGAB 2HDSA 5EVEA 2ZC5B 3UO9A 3QHYA 1PFLA 1V9ZA 1MPLA 1S66L 4MMNA 4ZJ2A 2H0TA 3NDGA 4LV1A 5FAOA 1KDWA 1YSPA 1WE4A 3EEHA 4EESA 2VK3A 1A0KA 1G6AA 2H10A 4GCZA 1J3WA 3LR0A 1K4FA 1FSWA 5EM0A 4Y7PA 1K57A 4RVAA 1KGFA 3PBNA 4YOFA 4WMCA 3IXBA 2GNXA 4QB8A 5F68A 1PZPA 1IYPA 4OP5A 2EX2A 2ZLYA 4LCMA 3N8SA 1OTEA 3IHAA 4R0QA 3BLMA 4B88A 5AVEA 3ZG9B 3NECA 3ZG7B 2QYBA 2V8CA 3GMWA 1GCEA 2P7JA 3CAXA 1FOFA 1O07A 3UNWA 3H82B 4MBHA 3IX8A 3LI9A 1P97A 2V1BA 2XSSA 3UB7A 3P09A 3GSGA 2XGNA 4Q8IA 5HAPA 3G2ZA 4GHIA 4UEYA 5AQBA 5HAQA 5TJJA 3QP8A 4II7A 3E0YA 1BZAA 4KG5A 4GNUA 1H8ZA 1WYCA 4R4SA 3O88A 3IQAA 4HJ4A 4PM9A 4I38A 4OQ0A 2Q9NA 4X1LA 1FILA 2JKFA 2JKRM 3UDXA 1IFQA 3PYPA 3SH9A 3B3XA 2XEPA 3ZVWA 4QPRA 2D01A 4AFIA 5JYOA 1L3LA 2Y55A 3KSFA 3UPNA 2IA2A 5U47A 2R9WA 1YLTA 2R9XA 3T4KA 1KDSA 1N4OA 5A93A 4Q0HA 5FDHA 1ZG4A 2EFXA 5CTNA 1ZC2A 1YMXA 3K2NA 2ZQCA 2M1CA 4GD8A 1K57C 4ZJ3A 1XA7A 4WYYA 4XUZA 4BJPA 4FUWA 3HUOA 5FI2A 4Y15A 1EW0A 5EVIA 3LCEA 1BULA 4OONA 1SKOB 4EQ1A 1H8MA 1UWPX 4GDNA 3M2JA 3LY3A 4XXRA 3BY9A 1F9IA 2HJEA 3CITA 3VP3A 4DE2A 2M7VA 4C3QA 3Q81A 4L9GA 4ZJ1A 4LLOB 4JXGA 4LPZA 3FYZA 1U60A 1BT5A 2ZOIA 4Z9QA 5F1GA 3U2AA 5E2GA 1P0ZA 2P9VB 3C2WA 1OT6A 3BQ8A 4MBKA 5EM1A 3SW1A 2BG1A 1LL9A 2W3EA 2W3DA 1KVMA 1GA0A 2FFYA 2EX9A 4BBTA 5M18A 4BL3A 2WKIA 5K5BA 1TDLA 3JPUA 3H7WB 2XRNA 5J7EA 1TDGA 5M1AA 3Q7VA 4PHTA 3TJZC 3C30A 3F1NA 5L07A 2VV8A 1UGUA 5HL6A 2HZ5A 1STZA 3BLSA 2OLVA 4S2OA 5FQ9A 4X55A 3G6OA 5MC7A 4H6JB 4E3JA 1G5UA 3OCNA 3FC7A 2Y2JA 3HBRA 4E3OA 2V1ZA 1CEFA 4KQRA 2WUQA 3A3FA 4BMWA 3FWLA 3VP4A 4QHCA 3FZCA 5HWVA 3FKVA 4EXOA 4HESA 3OZHA 1XXMA 3NC8A 1PZOA 3VE4A 3ZG5A 1T19A 3LFVA 1W8YA 2W1TB 2IWDA 3KYEA 1YLYA 4LGWA 3K3CA 4MN5A 3UMEA 3MQQA 3O86A 2V0WA 4CLCA 1K55A 3IXHA 4IEDA 4F3LA 3FPWA 4WEJA 3O87A 3BFGA 4PMAA 2R78A 1NYMA 1KVLA 1G6OA 4IJGA 4NKPA 2FH5A 3HL9A 2OAP1 3MXSA 4OPRA 2JHEA 3R7WA 2WAFA 1ERMA 2LB5A 1IOUA 5DKKA 2V2FF 3WWXA 2Y2KA 1RGYA 5HPIA 2I72A 5C5KA 4OOLA 1K38A 2VEAA 3IF6A 4NETA 4X6TA 2Y2PA 4ZRRA 4LV3A 3A3IA 5I5LA 4WEKA 2ZC4B 2JKGA 1WA9A 2WGWA 1YSQA 3MFXA 4JGPA 4NXFA 3UPOA 3IT9A 2V9AA 2RL3A 2Y2NA 2OAQ1 2ZMAA 4BD0A 4Y17A 1T1AA 3NBLA 2MJ6A 2ZD8A 3V50A 3M6HA 3EWKA 1KGEA 4QY5A 3RXWA 3S22A 1UWNX 1K4EA 2H28A 2HPBA 2Y8HA 5J3WA 1RP5A 3M6BA 4HNBA 4NG2A 2J9OA 3ZNYA 2HGVA 4OPYA 4CJNA 4ME4A 3LGOA 4C6YA 1OTBA 3PBRA 3BRMA 2JKTM 1SZVA 1S1YA 4OQGA 2JC7A 1VM1A 3LEZA 1GSXA 4CLCC 4DMZA 1K55C 2K31A 4ETZA 4ZAMA 4HI4A 5HDSA 2XFTA 2ZQAA 4XT2A 4E3NA 1NYYA 1G68A 1XP4A 2ZC7A 3L7HA 5HARA 4KG6A 1HZOA 1ONHA 4LFUA 1GHPA 4EBNA 3PXPA 1PWGA 3ULFA 5TFQA 1LL5A 2EX8A 2VV7A 3IF6C 4E04A 2UV0E 4X56A 1FR1A 2L4RA 3OCLA 2HDQA 1S4SA 2OLUA 4N1HA 3E4PA 4I5SA 3ITAA 4OQHA 5DJTA 4JGQA 3ZG0A 1AXBA 1FCMA 5HFOA 3BWLA 1EWZA 1KE4A 4KQQA 3O3VA 2J8YA 1PWCA 3IWIA 4MNRA 5FDSA 1SCWA 3JVUA 5L10A 4U3TA 3BY8A 2WGVA 2BLSA 3Q7ZA 3A3EA 3ZQ5A 2WGIA 3LR5A 3Q7VB 1BLPA 2XROA 2ZC3B 3KO6A 3R4KA 3DWZA 3IBJA 2M7UA 2O99A 3VV4A 2HDUA 2Z2MB 1YT4A 5DFXA 4DDSA 4YWZA 2P74A 3KSIA 3NHQA 4B9OA 3CHWP 3EGXC 3HJIA 3UY6A 5DF7A 5HWTA 3A0SA 5AQAA 2ZQ9A 5HD3A 3L9KA 3PHYA 3WS4A 4JF4A 1TVFA 2XD1A 3NY4A 3I7JA 4JGOA 1W8QA 3CPTB 4MCWA 3V3SA 2I9VA 2KDKA 3S7QA 3ISGA 2H5SA 1D06A 5BOHA 2XA7S 5FA7A 4ARZB 1W79A 3HLEA 3T1QB 3ICYA 5A92A 2ZM2A 3DTMA 2ACGA 4B4XA 1KOUA 1VETB 3AGFA 1WYBA 5CGXA 4QWOA 2B02A 3NI9A 4EEPA 1LSWA 4S2IA 4DXCA 4KUOA 1L2SA 3HCYA 4XUXA 3W4QA 4Y13A 3K3DA 3T4OA 3E4OA 4CPKA 3VFHA 3BECA 1VEUA 4KENB 2X02A 4L9EA 4OOMA 2NUTC 5TBMA 3PR6A 5HW3A 2UWXA 3EQVA 1YLPA 3D4FA 3EQUA 4K0WA 3UDIA 4OLDA 3MF0A 2ZM0A 1TS8A 1L0EA 2PRFA 3BFCA 1BSGA 1HD8A 3F1PB 3MFDA 1HLUP 5G4YA 4PM7A 2DCFA 2QWSA 2XD5A 3E2KA 3G31A 3DWKA 1M40A 1CJFA 4R3BA 2PAVP 2DRWA 4S2LA 2Y59A 2WYXA 1K56D 2EXBA 3EOIA 4UQIS 4OP8A 3PAEA 4QJGA 3B33A 3G34A 1XJ6A 4UA6A 2VJWA 1PNEA 2ZM8A 4PM5A 5FQMA 5FI7A 2CMNA 3ZCZA 5TGFA 2J80A 5KZHA 5TR7A 3HLDA 1XKZA 3MQ0A 3MMHA 4OPQA 1E25A 3UE6A 1KGGA 3BFFA 4RA7A 4GS9A 2L0WA 3DTEA 5D3OA 2W1RA 3C5AA 3U4LP 3AGEA 5FAPA 5CTMA 2QKPA 4X25A 5LBRA 1HTZA 3VP1A 1BLHA 3BFDA 4NK3A 3IS2B 3VE3A 2OOLA 3UB9A 3T1XA 1XFQA 1AWIA 1XJ2A 4DN0A 2D02A 3HJKA 1SDEA 2PD8A 4Y5FA 1JWVA 3C7UA 3CUEA 5HDDA 2XH9A 2WZZA 5CGWA 2B95A 3DW0A 2KLIA 5DFYA 1XGIA 2Y4AA 4K91A 5DTKA 2XDMA 3LEQA 3T4SA 1KE0A 4JF5A 1F98A 1VQQA 3QP2A 1CK3A 2EWWA 3GTCA 3ZNTA 5L2FA 4GD6A 2JKRI 3OBFA 1S0WA 5F6AA 1PWDA 2Y91A 1IKGA 1OMEA 3A3DA 1NLZA 3GRJA 3UE3A 5HAIA 1JNUA 5A8BA 1E3UA 1I2SA 1OTDA 1EI5A 3D3OA 1YMSA 4IBXA 3BEBA 4KZ4A 4P6BA 3VOLA 1PI5A 5F1FA 4R3AA 4JKTA 4DXBA 2Y2OA 4N9KA 3HREA 3RH8B 1O7EA 4HY8A 1GA9A 5GL9A 4CLCE 4FH2A 3OC2A 5F82A 4EQIA 1XX2A 4KZAA 3AGDA 1MY8A 3QP4A 4WZ4A 4GJ4A 3TSGA 4DDYA 4WM9A 4BL2A 2VGKA 3GVBA 5JYPA 1W7FA 3LI8A 3KX0X 4U0XA 3VP0A 3W2ZA 3W4OA 3B42A 4NXBA 1MKMA 5EV0A 3A3JA 1ES3A 5FL3A 3SH7A 2QMIA 4EUZA 3WS0A 4KZBA 4L9FA 3CUEC 3T1RA 2ZQ7A 3T50A 3T12B 3SH8A 2NUPC 2VGLM 2VA0A 2O0YA 3V67A 1I2WA 2JBFA 3SS4A 3LO7A 3TW8A 3QNBA 4S2MA 3P7NA 3HLCA 3MR0A 2WZXA 2ZL1A 4G3VA 5M19A 2A24B 3F1OA 1VHMA 3UPPA 2Y2HA 3CZDA 4NEED 3QP5A 4DF6A 5EVID 1GHMA 5FASA 4WL9A 1LHYA 2W0NA 1FCNA 5FQKA 3CLOA 4S2KA 3BQAA 1XJ4A 5EOEA 4U0TA 1K6RA 3ZVTA 5FEGA 1JTDA 3QNCA 3SZTA 3OLOA 4NXEA 3UB6A 4EUVA 4P0MA 4PAUA 2XFSA 3E2LA 3HLGA 2INWA 3JVVA 3MBZA 4FD8A 4FTXA 4E6XA 1PYYA 2FZ0A 5FQQA 4HEFA 3PBQA 3LY4A 1DP6A 3BJNA 3CJMA 3ZHHA 5EE8A 1JTGA 4MDZA 1GSWA 1LSXA 3OPPA 4RQ9A 5DKLA 3D9YA 2J7VA 4ZDXA 4E3MA 3LR3A 3CMZA 2YKFA 2HV1A 2XF3A 4JXVA 5CEDA 5L09A 3V5MA 5HWWA 4N1XA 2HP5A 3MKFA 4PKYG 2PHYA 1I5QA 5E2HA 2WKHA 3EGDC 4UQIM 4DE0A 3LYXA 2Q9MA 2C5WB 2Y2MA 4GHIB 4UA9A 1S4RA 4Y0UA 1G28A 2QZ6A 4DRTA 1IKIA 4HOIA 5EVLA 2H0YA 2EA9A 5AQ7A 1Q2QA 3VP2A 3RJUA 4X68A 1QMEA 3LIBA 3Q82A 4S2NA 3G2YA 4HJ3A 4IHQA 3T4LA 3MXQA 3KYQA 4LCLA 2J3TD 4R3JA 3ZYTA 4IVKA 1PI4A 3H82A 3S7OA 3HUNA 4MN7A 4X53A 2IWBA 1N9OA 1IEMA 4Q0IA 1H3QA 2PBYA 3V39A 3G30A 4EEUA 1CEGA 2BTFP 2A2LA 2WKPA 1NLYA 3Q1FA 5CHJA 5HZHA 2WK0A 5EVIB 2CC1A 2ZMFA 3SS3A 3UMDA 1SKFA 4M3KA 2JKTI 4BBVA 3GQZA 4WN5A 1OTAA 4D60A 4PM8A 1L0GA 1D1JA 5EFWA 2J3WA 5HSQA 2QHKA 3IH8A 4PKYA 3IH9A 5FAQA 1OJ5A 3BFEA 2ZMVA 3HLBA 2W3HA 4X69A 1ESUA 3IX3A 1YQSA 4BQMA 4YNRA 3IXDA 1PRQA 2K7SA 1FCOA 2WKEA 5FI6A 4E3IA 3KSGA 5GLAA 3EEAA 3DTKA 1Q2PA 4A5RA 3HVFA 1OTIA 5GLBA 2J9PA 2HP6A 1SKOA 4F94A 2PBDP 2JCHA 1YM1A 5FQJA 1MWSA 3C7VA 3F1NB 4HBUA 1LL8A 4S2NC 4GLQA 4RX2A 2EFUA 4P6ZS 3WS5A 5IS1A 2GJ3A 3B47A 2V20A 4R23A 3G32A 5CX7A 3FPVA 5GLCA 3D72A 1CI8A 1LT0A 1K6SA 2P9VA 1TF1A 3KYZA 2O9BA 4JF6A 4CQHA 4Y2FA 4ZTKA 1RCJA 2KX6A 2Q0OA 1YAXA 3H7WA 5GHXA 3IF5A 4PM6A 3QP6A 4R1GA 2P04A 5HDCA 1K56A 4RX3A 2P08A 5HD5A 3DTIA 2ZJ9A 3O5YA 1N9LA 4OLGA 5E43A 3GECA 1GHIA 2GZAA 3IHBA 1YLJA 3UB8A 2PT7A 3VSLA 1T1CA 1ES5A 1TEMA 4DJ2A 4BD1A 1Y4OA 2E8IA 3FG8A 4CLCB 4C75A 4F3LB 2O9AA 3E4QA 3LIDA 4H6JA 3MKEA 3H9WA 4MN6A 4G3KA 3T1SA 1W5DA 3A0RA 4GW9A 5HX9A
chains in the Genus database with same CATH topology
4LENA 4QU3A 1YLYA 1SDNA 3GTCA 3ZNTA 4GB7A 5L2FA 3W8KA 4E3KA 4IBRA 4GD6A 4N92A 3VMAA 3O86A 4B4ZA 1S0WA 1K55A 1PWDA 2Y91A 1IKGA 1OMEA 3A3DA 3IXHA 4IEDA 4UHUA 4E3LA 3NIAA 1IYSA 4WEJA 3GRJA 3G4PA 3UE3A 5HL1A 3O87A 3SS5A 3BFGA 1M6KA 3ZDJA 3HLFA 4GN2A 5HAIA 5FATA 2A3UA 3V3RA 5DF9A 3IF6B 1PW8A 1E3UA 1I2SA 4PMAA 1EI5A 2G2UA 1YMSA 4IBXA 4EV4A 3NDEA 1NYMA 3BEBA 4KZ4A 1KVLA 4P6BA 2OV5A 3HL9A 3MXSA 4OPRA 1KE3A 1PI5A 4MEZA 5F1FA 4MBFA 2WGWB 4KZ5A 1K54A 2WAFA 4JKTA 1FR6A 1ERMA 4EBLA 4DXBA 4L0LA 5EPHA 4DE3A 2Y2OA 2FFFB 3BM6A 3WWXA 2V2FF 1EROA 2Y2KA 1RGYA 4N9KA 1PIOA 3HREA 2I72A 1O7EA 5CEBA 4WBGA 1GA9A 2ZQDA 5GL9A 3HUMA 4FSFA 4FH2A 4OOLA 5IHVA 1K38A 4S2PA 4JXSA 1SHVA 3OC2A 3IF6A 4FH4A 1DJAA 1XX2A 3N4IA 5EUAA 4NETA 5F82A 4EQIA 4X6TA 4EWFA 4KZAA 2Y2PA 2OSUA 4OKPA 4LV3A 3A3IA 1ES4A 3AGDA 4WEKA 4ID4A 1MY8A 5DF8A 4WZ4A 2ZC4B 4GZBA 2WGWA 4JLFA 2EXAA 1IELA 5I94A 3TSGA 1IYOA 3UPOA 4KZ6A 4DDYA 3IT9A 3UDFA 4WM9A 2RL3A 2Y2NA 2VGKA 4BL2A 4IVIA 3PBOA 4JBFA 3GVBA 1MWTA 3Q07A 5JYPA 1W7FA 2ZMAA 4GOGA 3VFFA 4BD0A 1NRFA 4H8RA 4U0XA 3VP0A 3HLWA 4N9LA 4UAAA 3W4OA 1LLBA 3NBLA 1JWZA 3N6IA 4KZ9A 3A3JA 2ZD8A 3V50A 1ES3A 4UA7A 3M6HA 2X71A 3SH7A 1ZG6A 1KGEA 4QY5A 3RXWA 2QMIA 3S22A 4EUZA 3WS0A 1K4EA 2HPBA 4KZBA 1DJBA 4WZ5A 3SOIA 1RP5A 3GV9A 2ZQ7A 5E2EA 1LI0A 2EX6A 3SH8A 1BLSA 1ERQA 3M6BA 2ZC6B 2Y2QA 3PBSA 1I2WA 2JBFA 3SS4A 2B5RA 1L0FA 1PW1A 2J9OA 3LO7A 4P85A 3ZNYA 4BENA 5CGSA 2Z2LB 3C4OA 3QNBA 4S2MA 3WRZA 4OPYA 5DTTA 1S6RA 4CJNA 1L0DA 3HLCA 1ONGA 4C6YA 3PBRA 3BRMA 4DE1A 3S1YA 2WZXA 4JPMA 1MKIA 5M19A 3UE1A 3JYIA 3UPPA 1XPBA 4OQGA 2Y2HA 2JC7A 5GLDA 1VM1A 1JVJA 3CZDA 2RCXA 3LEZA 4DF6A 5EVID 1YLWA 1GHMA 2Y2LA 5FASA 2XLNA 1K55C 1LHYA 2ZQ8A 2DNSA 3PBTA 4O7DA 4ZAMA 1NZUA 1ALQA 1DJCA 3FV7A 5FSRA 2XFTA 3TG9A 5CECA 1ES2A 1FCNA 2ZQAA 4S2KA 5FQKA 5J8XA 4E3NA 1NYYA 1FQGA 5EOEA 3W4PA 1G68A 3OPHA 3WS1A 4U0TA 1K6RA 1XP4A 4KG2A 4RYEA 1RGZA 3ZVTA 2ZC7A 1JTDA 3QNCA 4JXWA 4P87A 4R4RA 4GDBA 2XQZA 5HARA 4HBTA 1K54C 1HZOA 4KG6A 2C6WB 4WMCD 1ONHA 4P0MA 2HDRA 3ZGAB 2HDSA 1GHPA 4EBNA 2XFSA 2ZC5B 3E2LA 3UO9A 3G35A 3HLGA 1PWGA 4GKUA 3QHYA 3MBZA 5TFQA 3TOIA 5KSHA 4FD8A 4E6XA 1MPLA 1PYYA 1LL5A 2EX8A 5FQQA 3IF6C 4ZJ2A 2H0TA 4HEFA 3PBQA 3LY4A 3NDGA 3CJMA 4LV1A 1ESIA 5FAOA 1KDWA 2Y2GA 3MXRA 5EE8A 3ZHHA 1JTGA 4X56A 1FR1A 1WE4A 3OCLA 2HDQA 4KZ3A 3VSKA 3OPPA 5EECA 2OLUA 4N1HA 3ITAA 1G6AA 2H10A 4OQHA 1MBLA 4MLLA 1K4FA 3ZG0A 1AXBA 1FCMA 1FSYA 2J7VA 5HFOA 1FSWA 4ZDXA 1EWZA 4Y7PA 1KE4A 4E3MA 4KQQA 1K57A 3O3VA 2J8YA 3CMZA 3IWOA 4RVAA 1PWCA 3UE0A 1KGFA 3PBNA 3IWIA 4MNRA 5DTSA 2XF3A 5DVAA 1SCWA 4JXVA 4ZBEA 5CEDA 5CERA 3V5MA 4N1XA 4WMCA 3IXBA 4U3TA 2WGVA 4QB8A 2BLSA 2HP5A 3Q7ZA 1PZPA 3MKFA 1IYPA 3M2KA 4OP5A 3A3EA 2EX2A 5A91A 4WZ5C 2ZLYA 1E4DA 1I5QA 2WGIA 4LCMA 1H8YA 1ZKJA 3Q7VB 3N8SA 2WKHA 5E2HA 5KMWA 1BLPA 2ZC3B 2PU2A 3IHAA 4R0QA 3BLMA 2VGJA 4B88A 3ZG9B 4DE0A 2IWCA 2Q9MA 1BUEA 2C5WB 2Y2MA 3DWZA 3VOYA 3ZG7B 1NXYA 4UA9A 3GMWA 1GCEA 1N9BA 4Y0UA 5G18A 4YINA 2QZ6A 2HDUA 1FOFA 1O07A 3UNWA 4DRTA 2Z2MB 4MBHA 1YT4A 1J9MA 1HVBA 3P98A 1IKIA 5EVLA 4DDSA 3MZEA 2H0YA 5CHUA 5AQ7A 1IYQA 2P74A 1Q2QA 5CHMA 3P09A 3VP2A 3RJUA 3GSGA 2XGNA 4X68A 2HP9A 1QMEA 1XA1A 4Q8IA 1K25A 5HAPA 3G2ZA 3Q82A 4K0XA 3UY6A 5DF7A 1C3BA 4S2NA 3G2YA 1DY6A 5AQBA 5HAQA 5AQAA 2ZQ9A 4LCLA 1BZAA 2WAEA 3WS4A 4KG5A 1NJ4A 4JF4A 1TVFA 2XD1A 3NY4A 4GNUA 4R3JA 1H8ZA 3I7JA 1W8QA 1PI4A 1WYCA 4IVKA 4R4SA 3O88A 4YFMA 4QY6A 5F83A 3V3SA 5CRFA 3HUNA 3IQAA 4PM9A 4X53A 5GHYA 4OQ0A 5CXWA 2Q9NA 3ISGA 2H5SA 5EOOA 2IWBA 5GHZA 1IEMA 3UDXA 5BOHA 5FA7A 3MZDA 1W79A 2X01A 3SH9A 2PBYA 3B3XA 3V39A 3HLEA 5A92A 2ZM2A 2XEPA 3G30A 1CEGA 3ZVWA 1E3UD 3DTMA 4B4XA 5JYOA 1MWUA 2Y55A 3AGFA 3Q1FA 5CHJA 3UPNA 1WYBA 2WK0A 4OH0A 5U47A 3CG5A 2R9WA 5CGXA 5EVIB 3ZFZA 1YLTA 2R9XA 5EVIC 1KDSA 2CC1A 3NI9A 2Y2IA 4PPRA 3SS3A 4S2IA 1N4OA 1SKFA 4DXCA 5A93A 1L2SA 1BTLA 5FDHA 1ZG4A 2EFXA 4M3KA 5CTNA 4XUXA 1ZC2A 3GQZA 1YMXA 5AQ9A 3W4QA 3OPLA 1BLCA 2ZQCA 4PM8A 4GD8A 1L0GA 3WS2A 4BLMA 1K57C 4ZJ3A 1XA7A 1Y54A 4S2JA 4WYYA 4XUZA 3VFHA 4CPKA 3BECA 4BJPA 4KENB 2X02A 3HUOA 4OOMA 5FI2A 4QD4A 5EVIA 5HW3A 3LCEA 2UWXA 1BULA 3EQVA 3IH8A 4OONA 3IH9A 1YLPA 5FAQA 4D2OA 3BFEA 4GDNA 3M2JA 3HLBA 3D4FA 3EQUA 3LY3A 4XXRA 4K0WA 3VP3A 4LV2A 4X69A 1NY0A 4OLDA 3UDIA 1CI9A 4DE2A 2ZM0A 1ESUA 1YQSA 4BQMA 4C3QA 2XK1A 1L0EA 3FKWA 3Q81A 3IXDA 4OQIA 1FCOA 2WKEA 3BFCA 1BSGA 1HD8A 5FI6A 5GLAA 3N8RA 4ZJ1A 3WRTA 1QMFA 3MFDA 4JXGA 1Q2PA 4A5RA 3HVFA 4PM7A 2DCFA 3FYZA 1U60A 1BT5A 3ITBA 2XD5A 3N8LA 2J9PA 5GLBA 3E2KA 3G31A 2HP6A 3IWQA 5A90A 2JE5A 3DWKA 4F94A 4Z9QA 1M40A 4R3BA 4LV0A 5F1GA 1LI9A 2DRWA 4Y0OA 5E2GA 2JCHA 1YM1A 5FQJA 1MWSA 2P9VB 3IXGA 3C7VA 4S2LA 4HBUA 4MBKA 2Y59A 2WYXA 1K56D 2BG1A 1LL9A 4S2NC 2EXBA 1KVMA 1GA0A 4RX2A 4EBPA 2FFYA 2EX9A 5FQIA 2EFUA 4OP8A 3S4XA 5M18A 3OPRA 4BL3A 2WKIA 3PAEA 3MZFA 4QJGA 1TDLA 3WS5A 4KQOA 1NZOA 3G34A 1JWPA 4FCFA 4UA6A 2ZM8A 1TDGA 2V20A 4KZ7A 3G32A 4R23A 4WELA 5FQMA 4PM5A 3N7WA 5M1AA 5GLCA 4OPZA 5FI7A 3Q7VA 3ZCZA 1CI8A 5TGFA 5KZHA 2WADA 1K6SA 5TR7A 2P9VA 3VOZA 3HLDA 1XKZA 3GR2A 1E25A 4OPQA 1KGGA 3BFFA 2A49A 4JF6A 4RA7A 3C4PA 4E6WA 1H5XA 3BLSA 5D3OA 4ZTKA 3C5AA 3AGEA 1RCJA 2OLVA 5FAPA 2PU4A 5CTMA 4OOYA 4S2OA 5GHXA 4E3IA 5FQ9A 4X55A 3IF5A 4DKIA 4PM6A 5E2FA 1HTZA 3VP1A 1BLHA 4R1GA 4E3JA 2G2WA 4OVDA 1K56A 3OCNA 1XGJA 3BFDA 3UN7A 2Y2JA 3HBRA 4RX3A 4E3OA 5KSCA 3BYDA 2ZJ9A 2V1ZA 4NK3A 4OLGA 5E43A 1GHIA 3NCKA 1CEFA 1YLJA 3IHBA 1SDEA 4KQRA 3VSLA 2GDNA 1JWVA 3PTEA 1Z6FA 3RXXA 3C7UA 2WUQA 1ES5A 1TEMA 3A3FA 2XH9A 2QPNA 4KZ8A 2WZZA 4BD1A 5CGWA 3FWLA 3VP4A 2E8IA 4QHCA 3FZCA 3ZG8B 3DW0A 1YLZA 4C75A 1XGIA 3FKVA 4HESA 2Y4AA 3OZHA 1XXMA 3NC8A 4K91A 5DTKA 4Y0TA 1PZOA 2XDMA 3PAGA 3ZG5A 1MWRA 2XR0A 3MKEA 1KE0A 1W8YA 4JF5A 1VQQA 1W5DA 1CK3A 2IWDA 1MXOA 5HX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LEN A;  4QU3 A;  1YLY A;  1SDN A;  3GTC A;  3ZNT A;  4GB7 A;  5L2F A;  3W8K A;  4E3K A;  4IBR A;  4GD6 A;  4N92 A;  3VMA A;  3O86 A;  4B4Z A;  1S0W A;  1K55 A;  1PWD A;  2Y91 A;  1IKG A;  1OME A;  3A3D A;  3IXH A;  4IED A;  4UHU A;  4E3L A;  3NIA A;  1IYS A;  4WEJ A;  3GRJ A;  3G4P A;  3UE3 A;  5HL1 A;  3O87 A;  3SS5 A;  3BFG A;  1M6K A;  3ZDJ A;  3HLF A;  4GN2 A;  5HAI A;  5FAT A;  2A3U A;  3V3R A;  5DF9 A;  3IF6 B;  1PW8 A;  1E3U A;  1I2S A;  4PMA A;  1EI5 A;  2G2U A;  1YMS A;  4IBX A;  4EV4 A;  3NDE A;  1NYM A;  3BEB A;  4KZ4 A;  1KVL A;  4P6B A;  2OV5 A;  3HL9 A;  3MXS A;  4OPR A;  1KE3 A;  1PI5 A;  4MEZ A;  5F1F A;  4MBF A;  2WGW B;  4KZ5 A;  1K54 A;  2WAF A;  4JKT A;  1FR6 A;  1ERM A;  4EBL A;  4DXB A;  4L0L A;  5EPH A;  4DE3 A;  2Y2O A;  2FFF B;  3BM6 A;  3WWX A;  2V2F F;  1ERO A;  2Y2K A;  1RGY A;  4N9K A;  1PIO A;  3HRE A;  2I72 A;  1O7E A;  5CEB A;  4WBG A;  1GA9 A;  2ZQD A;  5GL9 A;  3HUM A;  4FSF A;  4FH2 A;  4OOL A;  5IHV A;  1K38 A;  4S2P A;  4JXS A;  1SHV A;  3OC2 A;  3IF6 A;  4FH4 A;  1DJA A;  1XX2 A;  3N4I A;  5EUA A;  4NET A;  5F82 A;  4EQI A;  4X6T A;  4EWF A;  4KZA A;  2Y2P A;  2OSU A;  4OKP A;  4LV3 A;  3A3I A;  1ES4 A;  3AGD A;  4WEK A;  4ID4 A;  1MY8 A;  5DF8 A;  4WZ4 A;  2ZC4 B;  4GZB A;  2WGW A;  4JLF A;  2EXA A;  1IEL A;  5I94 A;  3TSG A;  1IYO A;  3UPO A;  4KZ6 A;  4DDY A;  3IT9 A;  3UDF A;  4WM9 A;  2RL3 A;  2Y2N A;  2VGK A;  4BL2 A;  4IVI A;  3PBO A;  4JBF A;  3GVB A;  1MWT A;  3Q07 A;  5JYP A;  1W7F A;  2ZMA A;  4GOG A;  3VFF A;  4BD0 A;  1NRF A;  4H8R A;  4U0X A;  3VP0 A;  3HLW A;  4N9L A;  4UAA A;  3W4O A;  1LLB A;  3NBL A;  1JWZ A;  3N6I A;  4KZ9 A;  3A3J A;  2ZD8 A;  3V50 A;  1ES3 A;  4UA7 A;  3M6H A;  2X71 A;  3SH7 A;  1ZG6 A;  1KGE A;  4QY5 A;  3RXW A;  2QMI A;  3S22 A;  4EUZ A;  3WS0 A;  1K4E A;  2HPB A;  4KZB A;  1DJB A;  4WZ5 A;  3SOI A;  1RP5 A;  3GV9 A;  2ZQ7 A;  5E2E A;  1LI0 A;  2EX6 A;  3SH8 A;  1BLS A;  1ERQ A;  3M6B A;  2ZC6 B;  2Y2Q A;  3PBS A;  1I2W A;  2JBF A;  3SS4 A;  2B5R A;  1L0F A;  1PW1 A;  2J9O A;  3LO7 A;  4P85 A;  3ZNY A;  4BEN A;  5CGS A;  2Z2L B;  3C4O A;  3QNB A;  4S2M A;  3WRZ A;  4OPY A;  5DTT A;  1S6R A;  4CJN A;  1L0D A;  3HLC A;  1ONG A;  4C6Y A;  3PBR A;  3BRM A;  4DE1 A;  3S1Y A;  2WZX A;  4JPM A;  1MKI A;  5M19 A;  3UE1 A;  3JYI A;  3UPP A;  1XPB A;  4OQG A;  2Y2H A;  2JC7 A;  5GLD A;  1VM1 A;  1JVJ A;  3CZD A;  2RCX A;  3LEZ A;  4DF6 A;  5EVI D;  1YLW A;  1GHM A;  2Y2L A;  5FAS A;  2XLN A;  1K55 C;  1LHY A;  2ZQ8 A;  2DNS A;  3PBT A;  4O7D A;  4ZAM A;  1NZU A;  1ALQ A;  1DJC A;  3FV7 A;  5FSR A;  2XFT A;  3TG9 A;  5CEC A;  1ES2 A;  1FCN A;  2ZQA A;  4S2K A;  5FQK A;  5J8X A;  4E3N A;  1NYY A;  1FQG A;  5EOE A;  3W4P A;  1G68 A;  3OPH A;  3WS1 A;  4U0T A;  1K6R A;  1XP4 A;  4KG2 A;  4RYE A;  1RGZ A;  3ZVT A;  2ZC7 A;  1JTD A;  3QNC A;  4JXW A;  4P87 A;  4R4R A;  4GDB A;  2XQZ A;  5HAR A;  4HBT A;  1K54 C;  1HZO A;  4KG6 A;  2C6W B;  4WMC D;  1ONH A;  4P0M A;  2HDR A;  3ZGA B;  2HDS A;  1GHP A;  4EBN A;  2XFS A;  2ZC5 B;  3E2L A;  3UO9 A;  3G35 A;  3HLG A;  1PWG A;  4GKU A;  3QHY A;  3MBZ A;  5TFQ A;  3TOI A;  5KSH A;  4FD8 A;  4E6X A;  1MPL A;  1PYY A;  1LL5 A;  2EX8 A;  5FQQ A;  3IF6 C;  4ZJ2 A;  2H0T A;  4HEF A;  3PBQ A;  3LY4 A;  3NDG A;  3CJM A;  4LV1 A;  1ESI A;  5FAO A;  1KDW A;  2Y2G A;  3MXR A;  5EE8 A;  3ZHH A;  1JTG A;  4X56 A;  1FR1 A;  1WE4 A;  3OCL A;  2HDQ A;  4KZ3 A;  3VSK A;  3OPP A;  5EEC A;  2OLU A;  4N1H A;  3ITA A;  1G6A A;  2H10 A;  4OQH A;  1MBL A;  4MLL A;  1K4F A;  3ZG0 A;  1AXB A;  1FCM A;  1FSY A;  2J7V A;  5HFO A;  1FSW A;  4ZDX A;  1EWZ A;  4Y7P A;  1KE4 A;  4E3M A;  4KQQ A;  1K57 A;  3O3V A;  2J8Y A;  3CMZ A;  3IWO A;  4RVA A;  1PWC A;  3UE0 A;  1KGF A;  3PBN A;  3IWI A;  4MNR A;  5DTS A;  2XF3 A;  5DVA A;  1SCW A;  4JXV A;  4ZBE A;  5CED A;  5CER A;  3V5M A;  4N1X A;  4WMC A;  3IXB A;  4U3T A;  2WGV A;  4QB8 A;  2BLS A;  2HP5 A;  3Q7Z A;  1PZP A;  3MKF A;  1IYP A;  3M2K A;  4OP5 A;  3A3E A;  2EX2 A;  5A91 A;  4WZ5 C;  2ZLY A;  1E4D A;  1I5Q A;  2WGI A;  4LCM A;  1H8Y A;  1ZKJ A;  3Q7V B;  3N8S A;  2WKH A;  5E2H A;  5KMW A;  1BLP A;  2ZC3 B;  2PU2 A;  3IHA A;  4R0Q A;  3BLM A;  2VGJ A;  4B88 A;  3ZG9 B;  4DE0 A;  2IWC A;  2Q9M A;  1BUE A;  2C5W B;  2Y2M A;  3DWZ A;  3VOY A;  3ZG7 B;  1NXY A;  4UA9 A;  3GMW A;  1GCE A;  1N9B A;  4Y0U A;  5G18 A;  4YIN A;  2QZ6 A;  2HDU A;  1FOF A;  1O07 A;  3UNW A;  4DRT A;  2Z2M B;  4MBH A;  1YT4 A;  1J9M A;  1HVB A;  3P98 A;  1IKI A;  5EVL A;  4DDS A;  3MZE A;  2H0Y A;  5CHU A;  5AQ7 A;  1IYQ A;  2P74 A;  1Q2Q A;  5CHM A;  3P09 A;  3VP2 A;  3RJU A;  3GSG A;  2XGN A;  4X68 A;  2HP9 A;  1QME A;  1XA1 A;  4Q8I A;  1K25 A;  5HAP A;  3G2Z A;  3Q82 A;  4K0X A;  3UY6 A;  5DF7 A;  1C3B A;  4S2N A;  3G2Y A;  1DY6 A;  5AQB A;  5HAQ A;  5AQA A;  2ZQ9 A;  4LCL A;  1BZA A;  2WAE A;  3WS4 A;  4KG5 A;  1NJ4 A;  4JF4 A;  1TVF A;  2XD1 A;  3NY4 A;  4GNU A;  4R3J A;  1H8Z A;  3I7J A;  1W8Q A;  1PI4 A;  1WYC A;  4IVK A;  4R4S A;  3O88 A;  4YFM A;  4QY6 A;  5F83 A;  3V3S A;  5CRF A;  3HUN A;  3IQA A;  4PM9 A;  4X53 A;  5GHY A;  4OQ0 A;  5CXW A;  2Q9N A;  3ISG A;  2H5S A;  5EOO A;  2IWB A;  5GHZ A;  1IEM A;  3UDX A;  5BOH A;  5FA7 A;  3MZD A;  1W79 A;  2X01 A;  3SH9 A;  2PBY A;  3B3X A;  3V39 A;  3HLE A;  5A92 A;  2ZM2 A;  2XEP A;  3G30 A;  1CEG A;  3ZVW A;  1E3U D;  3DTM A;  4B4X A;  5JYO A;  1MWU A;  2Y55 A;  3AGF A;  3Q1F A;  5CHJ A;  3UPN A;  1WYB A;  2WK0 A;  4OH0 A;  5U47 A;  3CG5 A;  2R9W A;  5CGX A;  5EVI B;  3ZFZ A;  1YLT A;  2R9X A;  5EVI C;  1KDS A;  2CC1 A;  3NI9 A;  2Y2I A;  4PPR A;  3SS3 A;  4S2I A;  1N4O A;  1SKF A;  4DXC A;  5A93 A;  1L2S A;  1BTL A;  5FDH A;  1ZG4 A;  2EFX A;  4M3K A;  5CTN A;  4XUX A;  1ZC2 A;  3GQZ A;  1YMX A;  5AQ9 A;  3W4Q A;  3OPL A;  1BLC A;  2ZQC A;  4PM8 A;  4GD8 A;  1L0G A;  3WS2 A;  4BLM A;  1K57 C;  4ZJ3 A;  1XA7 A;  1Y54 A;  4S2J A;  4WYY A;  4XUZ A;  3VFH A;  4CPK A;  3BEC A;  4BJP A;  4KEN B;  2X02 A;  3HUO A;  4OOM A;  5FI2 A;  4QD4 A;  5EVI A;  5HW3 A;  3LCE A;  2UWX A;  1BUL A;  3EQV A;  3IH8 A;  4OON A;  3IH9 A;  1YLP A;  5FAQ A;  4D2O A;  3BFE A;  4GDN A;  3M2J A;  3HLB A;  3D4F A;  3EQU A;  3LY3 A;  4XXR A;  4K0W A;  3VP3 A;  4LV2 A;  4X69 A;  1NY0 A;  4OLD A;  3UDI A;  1CI9 A;  4DE2 A;  2ZM0 A;  1ESU A;  1YQS A;  4BQM A;  4C3Q A;  2XK1 A;  1L0E A;  3FKW A;  3Q81 A;  3IXD A;  4OQI A;  1FCO A;  2WKE A;  3BFC A;  1BSG A;  1HD8 A;  5FI6 A;  5GLA A;  3N8R A;  4ZJ1 A;  3WRT A;  1QMF A;  3MFD A;  4JXG A;  1Q2P A;  4A5R A;  3HVF A;  4PM7 A;  2DCF A;  3FYZ A;  1U60 A;  1BT5 A;  3ITB A;  2XD5 A;  3N8L A;  2J9P A;  5GLB A;  3E2K A;  3G31 A;  2HP6 A;  3IWQ A;  5A90 A;  2JE5 A;  3DWK A;  4F94 A;  4Z9Q A;  1M40 A;  4R3B A;  4LV0 A;  5F1G A;  1LI9 A;  2DRW A;  4Y0O A;  5E2G A;  2JCH A;  1YM1 A;  5FQJ A;  1MWS A;  2P9V B;  3IXG A;  3C7V A;  4S2L A;  4HBU A;  4MBK A;  2Y59 A;  2WYX A;  1K56 D;  2BG1 A;  1LL9 A;  4S2N C;  2EXB A;  1KVM A;  1GA0 A;  4RX2 A;  4EBP A;  2FFY A;  2EX9 A;  5FQI A;  2EFU A;  4OP8 A;  3S4X A;  5M18 A;  3OPR A;  4BL3 A;  2WKI A;  3PAE A;  3MZF A;  4QJG A;  1TDL A;  3WS5 A;  4KQO A;  1NZO A;  3G34 A;  1JWP A;  4FCF A;  4UA6 A;  2ZM8 A;  1TDG A;  2V20 A;  4KZ7 A;  3G32 A;  4R23 A;  4WEL A;  5FQM A;  4PM5 A;  3N7W A;  5M1A A;  5GLC A;  4OPZ A;  5FI7 A;  3Q7V A;  3ZCZ A;  1CI8 A;  5TGF A;  5KZH A;  2WAD A;  1K6S A;  5TR7 A;  2P9V A;  3VOZ A;  3HLD A;  1XKZ A;  3GR2 A;  1E25 A;  4OPQ A;  1KGG A;  3BFF A;  2A49 A;  4JF6 A;  4RA7 A;  3C4P A;  4E6W A;  1H5X A;  3BLS A;  5D3O A;  4ZTK A;  3C5A A;  3AGE A;  1RCJ A;  2OLV A;  5FAP A;  2PU4 A;  5CTM A;  4OOY A;  4S2O A;  5GHX A;  4E3I A;  5FQ9 A;  4X55 A;  3IF5 A;  4DKI A;  4PM6 A;  5E2F A;  1HTZ A;  3VP1 A;  1BLH A;  4R1G A;  4E3J A;  2G2W A;  4OVD A;  1K56 A;  3OCN A;  1XGJ A;  3BFD A;  3UN7 A;  2Y2J A;  3HBR A;  4RX3 A;  4E3O A;  5KSC A;  3BYD A;  2ZJ9 A;  2V1Z A;  4NK3 A;  4OLG A;  5E43 A;  1GHI A;  3NCK A;  1CEF A;  1YLJ A;  3IHB A;  1SDE A;  4KQR A;  3VSL A;  2GDN A;  1JWV A;  3PTE A;  1Z6F A;  3RXX A;  3C7U A;  2WUQ A;  1ES5 A;  1TEM A;  3A3F A;  2XH9 A;  2QPN A;  4KZ8 A;  2WZZ A;  4BD1 A;  5CGW A;  3FWL A;  3VP4 A;  2E8I A;  4QHC A;  3FZC A;  3ZG8 B;  3DW0 A;  1YLZ A;  4C75 A;  1XGI A;  3FKV A;  4HES A;  2Y4A A;  3OZH A;  1XXM A;  3NC8 A;  4K91 A;  5DTK A;  4Y0T A;  1PZO A;  2XDM A;  3PAG A;  3ZG5 A;  1MWR A;  2XR0 A;  3MKE A;  1KE0 A;  1W8Y A;  4JF5 A;  1VQQ A;  1W5D A;  1CK3 A;  2IWD A;  1MXO A;  5HX9 A; 
#chains in the Genus database with same CATH topology
 1NRJ A;  3LIF A;  4LEN A;  4QU3 A;  3W8K A;  4E3K A;  3R7W B;  1FIK A;  1CQA A;  3IX4 A;  4N92 A;  3VMA A;  2PYR A;  5J4E A;  4UHU A;  4E3L A;  1H0M A;  1Y28 A;  1T18 A;  3G4P A;  5HL1 A;  1M6K A;  3HLF A;  4GN2 A;  3V3R A;  3IF6 B;  1PW8 A;  2G2U A;  3C38 A;  2W1T A;  4EV4 A;  3GDI A;  2OV5 A;  4WUJ A;  2VZW A;  4MEZ A;  4MBF A;  2WGW B;  4WLA A;  4KZ5 A;  1FR6 A;  4KQD A;  5EPH A;  2FFF B;  3BM6 A;  2KOI A;  1ERO A;  4KUK A;  2Z6C A;  5CEB A;  4WBG A;  2ZQD A;  4X1M A;  4FSF A;  5IHV A;  4JXS A;  2BAS A;  3E98 A;  3N4I A;  2OSU A;  1DP8 A;  5F5Y A;  5DF8 A;  1F5M A;  1XFN A;  2EXA A;  4EW7 A;  1IEL A;  1IYO A;  2LB9 A;  4KZ6 A;  4IVI A;  3QP1 A;  1MWT A;  5G4Z A;  4GOG A;  4NXG A;  4N9L A;  4UAA A;  1P9W A;  4BBU A;  1JWZ A;  4KZ9 A;  1DP9 A;  2QJ5 A;  4UA7 A;  2L1M A;  3NUL A;  4HH3 A;  1NWZ A;  4WZ5 A;  4G3W A;  1LI0 A;  1BLS A;  1ERQ A;  2Y2Q A;  1BYW A;  1L0F A;  1PW1 A;  2B18 A;  1X0O A;  2Z2L B;  5CGS A;  5DTT A;  1S6R A;  1L0D A;  4XT2 B;  1ONG A;  1YPR A;  4DE1 A;  3TE8 A;  3LIE A;  2PD7 A;  2ZBB A;  4Z1W A;  4JPM A;  1MKI A;  3NOP C;  3JYI A;  3LIA A;  4IUK A;  3BW6 A;  3LUQ A;  1MZU A;  5GLD A;  1JVJ A;  2RCX A;  5AVF A;  4ETX A;  1ACF A;  2V0U A;  2W3G A;  2ZQ8 A;  2DNS A;  3PBT A;  1NZU A;  1ALQ A;  1DJC A;  3LIC A;  3TG9 A;  5CEC A;  3W4P A;  3OPH A;  3WS1 A;  4KG2 A;  4RYE A;  1RGZ A;  4P87 A;  4GDB A;  4HBT A;  4WMC D;  5HPF A;  3KSH A;  2HF6 A;  3G35 A;  4GKU A;  4I3A A;  3TOI A;  1V9Y A;  4WF0 A;  1K0K A;  1ZTU A;  1T1B A;  3A0V A;  1ESI A;  2Y2G A;  3MXR A;  5KIZ A;  4KZ3 A;  3VSK A;  5EEC A;  4EER A;  1MBL A;  4MLL A;  4HQA A;  1FSY A;  5DJU A;  1XJ3 A;  3IWO A;  3UE0 A;  5DTS A;  2OWJ A;  4I39 A;  5DVA A;  5F69 A;  4ZBE A;  5IT5 A;  5CER A;  3M2K A;  5A91 A;  1D7E A;  4M4X A;  4WZ5 C;  3NJA A;  1E4D A;  5KMW A;  1H8Y A;  1ZKJ A;  2G7U A;  2PU2 A;  2VGJ A;  2IWC A;  4P6Z M;  2DMW A;  1BUE A;  2PDR A;  3VOY A;  1NXY A;  4HP9 A;  5FEF A;  1N9B A;  5G18 A;  4YIN A;  4B93 A;  1J9M A;  1HVB A;  2VLG A;  3P98 A;  3MZE A;  5CHU A;  2PYP A;  1IYQ A;  5CHM A;  2HP9 A;  1XA1 A;  1K25 A;  4K0X A;  1C3B A;  1DY6 A;  4HH2 A;  3MSH A;  2WAE A;  1NJ4 A;  4FOF A;  5F83 A;  2XA7 M;  4YFM A;  4QY6 A;  4DJ3 A;  3NOT C;  5CRF A;  3LR4 A;  5GHY A;  5CXW A;  4I3J A;  5EOO A;  4I3I A;  5GHZ A;  3P01 A;  3MZD A;  1OPX A;  2X01 A;  2Y79 A;  1E3U D;  3NOU C;  1VEU B;  1MWU A;  5TBM B;  4OH0 A;  2AVX A;  3CG5 A;  1ZHH B;  3ZFZ A;  3DBA A;  2HJ9 C;  3CPT A;  5EVI C;  2Y2I A;  4PPR A;  1BTL A;  4EET B;  5AQ9 A;  4ARZ A;  4HIA A;  3OPL A;  1BLC A;  3WS2 A;  4BLM A;  1Y54 A;  4S2J A;  4HHD A;  1VET A;  2GX5 A;  4LRY C;  2PR5 A;  4QD4 A;  1TD5 A;  4O8G A;  2W27 A;  4D2O A;  3MQO A;  4LV2 A;  1NY0 A;  1CI9 A;  1W63 M;  2XK1 A;  3FKW A;  4OQI A;  4HP4 A;  3WRT A;  4BWI A;  3N8R A;  1QMF A;  2ZOH A;  3ITB A;  3N8L A;  3S7N A;  5A90 A;  3IWQ A;  2JE5 A;  2QJ7 A;  1P9R A;  4LV0 A;  1LI9 A;  4Y0O A;  3IXG A;  4GS9 B;  4EBP A;  1CF0 A;  5FQI A;  3S4X A;  3OPR A;  3MZF A;  3F1P A;  4KQO A;  1NZO A;  4FCF A;  1JWP A;  4ESP A;  4KZ7 A;  4WEL A;  3N7W A;  4OPZ A;  2WAD A;  3VOZ A;  3GR2 A;  4R38 A;  2A49 A;  3C4P A;  4E6W A;  1H5X A;  4K08 A;  3TRC A;  2K2N A;  2PU4 A;  4OOY A;  1Z09 A;  4DKI A;  2VV6 A;  5E2F A;  2G2W A;  1OT9 A;  4OVD A;  4CLC D;  1XGJ A;  3UN7 A;  5KSC A;  3BYD A;  3RFB A;  2J3T C;  3NCK A;  2GDN A;  3PTE A;  1Z6F A;  4IUH A;  3RXX A;  3T4Q A;  4KZ8 A;  2QPN A;  4HJ6 A;  1YKD A;  4Y3I A;  3ZG8 B;  2PR6 A;  1YLZ A;  4Y0T A;  3PAG A;  5IU1 A;  1MWR A;  2XR0 A;  1F2K A;  3C8C A;  1MXO A;  3IS2 A;  3UB5 P;  1TS6 A;  1SDN A;  1S1Z A;  4GB7 A;  1W63 Q;  4IBR A;  4LRZ E;  4B4Z A;  3MS6 A;  1TS0 A;  1ODV A;  1DRM A;  3NIA A;  3IBR A;  1IYS A;  1GSV A;  2V8F A;  3SS5 A;  3ZDJ A;  5FAT A;  2A3U A;  5DF9 A;  3NDE A;  3MJQ A;  2E8J A;  1OJG A;  1KE3 A;  4O01 A;  1K54 A;  4EBL A;  2O9C A;  4L0L A;  4DE3 A;  2WKR A;  1PIO A;  2W3F A;  4JGR A;  1S67 L;  3HUM A;  4O0P A;  5L8M A;  4S2P A;  5KSH A;  1SHV A;  5EUA A;  2Z6D A;  4FH4 A;  1DJA A;  2VX8 A;  4EWF A;  4OKP A;  1ES4 A;  2OWH A;  5AJG A;  4ID4 A;  1VB6 A;  4GZB A;  3OOV A;  4JLF A;  5I94 A;  3UDF A;  1N9N A;  4EU0 A;  3PBO A;  4JBF A;  3Q07 A;  3T4J A;  1MC0 A;  3VFF A;  1NRF A;  4H8R A;  3S7P A;  3HLW A;  1LLB A;  1LSV A;  3N6I A;  2JN7 A;  2YKH A;  2ZL1 B;  2X71 A;  1ZG6 A;  2EWV A;  3F1O B;  1DJB A;  3SOI A;  3GV9 A;  5E2E A;  2EX6 A;  1TS7 A;  2ZC6 B;  3PBS A;  2B5R A;  4BEN A;  4P85 A;  3C4O A;  2WKQ A;  3WRZ A;  2VGL S;  3S1Y A;  3CI6 A;  3DAV A;  3RTY A;  4LRX C;  3UE1 A;  4R70 A;  1XPB A;  1YLW A;  2VKS A;  2Y2L A;  2XLN A;  3CWF A;  4O7D A;  4R6L A;  3FV7 A;  5FSR A;  4Q0J A;  1ES2 A;  5J8X A;  1FQG A;  3T4T A;  2V1A A;  4JXW A;  4R4R A;  2A24 A;  2XQZ A;  1K54 C;  2C6W B;  2HDR A;  3ZGA B;  2HDS A;  5EVE A;  2ZC5 B;  3UO9 A;  3QHY A;  1PFL A;  1V9Z A;  1MPL A;  1S66 L;  4MMN A;  4ZJ2 A;  2H0T A;  3NDG A;  4LV1 A;  5FAO A;  1KDW A;  1YSP A;  1WE4 A;  3EEH A;  4EES A;  2VK3 A;  1A0K A;  1G6A A;  2H10 A;  4GCZ A;  1J3W A;  3LR0 A;  1K4F A;  1FSW A;  5EM0 A;  4Y7P A;  1K57 A;  4RVA A;  1KGF A;  3PBN A;  4YOF A;  4WMC A;  3IXB A;  2GNX A;  4QB8 A;  5F68 A;  1PZP A;  1IYP A;  4OP5 A;  2EX2 A;  2ZLY A;  4LCM A;  3N8S A;  1OTE A;  3IHA A;  4R0Q A;  3BLM A;  4B88 A;  5AVE A;  3ZG9 B;  3NEC A;  3ZG7 B;  2QYB A;  2V8C A;  3GMW A;  1GCE A;  2P7J A;  3CAX A;  1FOF A;  1O07 A;  3UNW A;  3H82 B;  4MBH A;  3IX8 A;  3LI9 A;  1P97 A;  2V1B A;  2XSS A;  3UB7 A;  3P09 A;  3GSG A;  2XGN A;  4Q8I A;  5HAP A;  3G2Z A;  4GHI A;  4UEY A;  5AQB A;  5HAQ A;  5TJJ A;  3QP8 A;  4II7 A;  3E0Y A;  1BZA A;  4KG5 A;  4GNU A;  1H8Z A;  1WYC A;  4R4S A;  3O88 A;  3IQA A;  4HJ4 A;  4PM9 A;  4I38 A;  4OQ0 A;  2Q9N A;  4X1L A;  1FIL A;  2JKF A;  2JKR M;  3UDX A;  1IFQ A;  3PYP A;  3SH9 A;  3B3X A;  2XEP A;  3ZVW A;  4QPR A;  2D01 A;  4AFI A;  5JYO A;  1L3L A;  2Y55 A;  3KSF A;  3UPN A;  2IA2 A;  5U47 A;  2R9W A;  1YLT A;  2R9X A;  3T4K A;  1KDS A;  1N4O A;  5A93 A;  4Q0H A;  5FDH A;  1ZG4 A;  2EFX A;  5CTN A;  1ZC2 A;  1YMX A;  3K2N A;  2ZQC A;  2M1C A;  4GD8 A;  1K57 C;  4ZJ3 A;  1XA7 A;  4WYY A;  4XUZ A;  4BJP A;  4FUW A;  3HUO A;  5FI2 A;  4Y15 A;  1EW0 A;  5EVI A;  3LCE A;  1BUL A;  4OON A;  1SKO B;  4EQ1 A;  1H8M A;  1UWP X;  4GDN A;  3M2J A;  3LY3 A;  4XXR A;  3BY9 A;  1F9I A;  2HJE A;  3CIT A;  3VP3 A;  4DE2 A;  2M7V A;  4C3Q A;  3Q81 A;  4L9G A;  4ZJ1 A;  4LLO B;  4JXG A;  4LPZ A;  3FYZ A;  1U60 A;  1BT5 A;  2ZOI A;  4Z9Q A;  5F1G A;  3U2A A;  5E2G A;  1P0Z A;  2P9V B;  3C2W A;  1OT6 A;  3BQ8 A;  4MBK A;  5EM1 A;  3SW1 A;  2BG1 A;  1LL9 A;  2W3E A;  2W3D A;  1KVM A;  1GA0 A;  2FFY A;  2EX9 A;  4BBT A;  5M18 A;  4BL3 A;  2WKI A;  5K5B A;  1TDL A;  3JPU A;  3H7W B;  2XRN A;  5J7E A;  1TDG A;  5M1A A;  3Q7V A;  4PHT A;  3TJZ C;  3C30 A;  3F1N A;  5L07 A;  2VV8 A;  1UGU A;  5HL6 A;  2HZ5 A;  1STZ A;  3BLS A;  2OLV A;  4S2O A;  5FQ9 A;  4X55 A;  3G6O A;  5MC7 A;  4H6J B;  4E3J A;  1G5U A;  3OCN A;  3FC7 A;  2Y2J A;  3HBR A;  4E3O A;  2V1Z A;  1CEF A;  4KQR A;  2WUQ A;  3A3F A;  4BMW A;  3FWL A;  3VP4 A;  4QHC A;  3FZC A;  5HWV A;  3FKV A;  4EXO A;  4HES A;  3OZH A;  1XXM A;  3NC8 A;  1PZO A;  3VE4 A;  3ZG5 A;  1T19 A;  3LFV A;  1W8Y A;  2W1T B;  2IWD A;  3KYE A;  1YLY A;  4LGW A;  3K3C A;  4MN5 A;  3UME A;  3MQQ A;  3O86 A;  2V0W A;  4CLC A;  1K55 A;  3IXH A;  4IED A;  4F3L A;  3FPW A;  4WEJ A;  3O87 A;  3BFG A;  4PMA A;  2R78 A;  1NYM A;  1KVL A;  1G6O A;  4IJG A;  4NKP A;  2FH5 A;  3HL9 A;  2OAP 1;  3MXS A;  4OPR A;  2JHE A;  3R7W A;  2WAF A;  1ERM A;  2LB5 A;  1IOU A;  5DKK A;  2V2F F;  3WWX A;  2Y2K A;  1RGY A;  5HPI A;  2I72 A;  5C5K A;  4OOL A;  1K38 A;  2VEA A;  3IF6 A;  4NET A;  4X6T A;  2Y2P A;  4ZRR A;  4LV3 A;  3A3I A;  5I5L A;  4WEK A;  2ZC4 B;  2JKG A;  1WA9 A;  2WGW A;  1YSQ A;  3MFX A;  4JGP A;  4NXF A;  3UPO A;  3IT9 A;  2V9A A;  2RL3 A;  2Y2N A;  2OAQ 1;  2ZMA A;  4BD0 A;  4Y17 A;  1T1A A;  3NBL A;  2MJ6 A;  2ZD8 A;  3V50 A;  3M6H A;  3EWK A;  1KGE A;  4QY5 A;  3RXW A;  3S22 A;  1UWN X;  1K4E A;  2H28 A;  2HPB A;  2Y8H A;  5J3W A;  1RP5 A;  3M6B A;  4HNB A;  4NG2 A;  2J9O A;  3ZNY A;  2HGV A;  4OPY A;  4CJN A;  4ME4 A;  3LGO A;  4C6Y A;  1OTB A;  3PBR A;  3BRM A;  2JKT M;  1SZV A;  1S1Y A;  4OQG A;  2JC7 A;  1VM1 A;  3LEZ A;  1GSX A;  4CLC C;  4DMZ A;  1K55 C;  2K31 A;  4ETZ A;  4ZAM A;  4HI4 A;  5HDS A;  2XFT A;  2ZQA A;  4XT2 A;  4E3N A;  1NYY A;  1G68 A;  1XP4 A;  2ZC7 A;  3L7H A;  5HAR A;  4KG6 A;  1HZO A;  1ONH A;  4LFU A;  1GHP A;  4EBN A;  3PXP A;  1PWG A;  3ULF A;  5TFQ A;  1LL5 A;  2EX8 A;  2VV7 A;  3IF6 C;  4E04 A;  2UV0 E;  4X56 A;  1FR1 A;  2L4R A;  3OCL A;  2HDQ A;  1S4S A;  2OLU A;  4N1H A;  3E4P A;  4I5S A;  3ITA A;  4OQH A;  5DJT A;  4JGQ A;  3ZG0 A;  1AXB A;  1FCM A;  5HFO A;  3BWL A;  1EWZ A;  1KE4 A;  4KQQ A;  3O3V A;  2J8Y A;  1PWC A;  3IWI A;  4MNR A;  5FDS A;  1SCW A;  3JVU A;  5L10 A;  4U3T A;  3BY8 A;  2WGV A;  2BLS A;  3Q7Z A;  3A3E A;  3ZQ5 A;  2WGI A;  3LR5 A;  3Q7V B;  1BLP A;  2XRO A;  2ZC3 B;  3KO6 A;  3R4K A;  3DWZ A;  3IBJ A;  2M7U A;  2O99 A;  3VV4 A;  2HDU A;  2Z2M B;  1YT4 A;  5DFX A;  4DDS A;  4YWZ A;  2P74 A;  3KSI A;  3NHQ A;  4B9O A;  3CHW P;  3EGX C;  3HJI A;  3UY6 A;  5DF7 A;  5HWT A;  3A0S A;  5AQA A;  2ZQ9 A;  5HD3 A;  3L9K A;  3PHY A;  3WS4 A;  4JF4 A;  1TVF A;  2XD1 A;  3NY4 A;  3I7J A;  4JGO A;  1W8Q A;  3CPT B;  4MCW A;  3V3S A;  2I9V A;  2KDK A;  3S7Q A;  3ISG A;  2H5S A;  1D06 A;  5BOH A;  2XA7 S;  5FA7 A;  4ARZ B;  1W79 A;  3HLE A;  3T1Q B;  3ICY A;  5A92 A;  2ZM2 A;  3DTM A;  2ACG A;  4B4X A;  1KOU A;  1VET B;  3AGF A;  1WYB A;  5CGX A;  4QWO A;  2B02 A;  3NI9 A;  4EEP A;  1LSW A;  4S2I A;  4DXC A;  4KUO A;  1L2S A;  3HCY A;  4XUX A;  3W4Q A;  4Y13 A;  3K3D A;  3T4O A;  3E4O A;  4CPK A;  3VFH A;  3BEC A;  1VEU A;  4KEN B;  2X02 A;  4L9E A;  4OOM A;  2NUT C;  5TBM A;  3PR6 A;  5HW3 A;  2UWX A;  3EQV A;  1YLP A;  3D4F A;  3EQU A;  4K0W A;  3UDI A;  4OLD A;  3MF0 A;  2ZM0 A;  1TS8 A;  1L0E A;  2PRF A;  3BFC A;  1BSG A;  1HD8 A;  3F1P B;  3MFD A;  1HLU P;  5G4Y A;  4PM7 A;  2DCF A;  2QWS A;  2XD5 A;  3E2K A;  3G31 A;  3DWK A;  1M40 A;  1CJF A;  4R3B A;  2PAV P;  2DRW A;  4S2L A;  2Y59 A;  2WYX A;  1K56 D;  2EXB A;  3EOI A;  4UQI S;  4OP8 A;  3PAE A;  4QJG A;  3B33 A;  3G34 A;  1XJ6 A;  4UA6 A;  2VJW A;  1PNE A;  2ZM8 A;  4PM5 A;  5FQM A;  5FI7 A;  2CMN A;  3ZCZ A;  5TGF A;  2J80 A;  5KZH A;  5TR7 A;  3HLD A;  1XKZ A;  3MQ0 A;  3MMH A;  4OPQ A;  1E25 A;  3UE6 A;  1KGG A;  3BFF A;  4RA7 A;  4GS9 A;  2L0W A;  3DTE A;  5D3O A;  2W1R A;  3C5A A;  3U4L P;  3AGE A;  5FAP A;  5CTM A;  2QKP A;  4X25 A;  5LBR A;  1HTZ A;  3VP1 A;  1BLH A;  3BFD A;  4NK3 A;  3IS2 B;  3VE3 A;  2OOL A;  3UB9 A;  3T1X A;  1XFQ A;  1AWI A;  1XJ2 A;  4DN0 A;  2D02 A;  3HJK A;  1SDE A;  2PD8 A;  4Y5F A;  1JWV A;  3C7U A;  3CUE A;  5HDD A;  2XH9 A;  2WZZ A;  5CGW A;  2B95 A;  3DW0 A;  2KLI A;  5DFY A;  1XGI A;  2Y4A A;  4K91 A;  5DTK A;  2XDM A;  3LEQ A;  3T4S A;  1KE0 A;  4JF5 A;  1F98 A;  1VQQ A;  3QP2 A;  1CK3 A;  2EWW A;  3GTC A;  3ZNT A;  5L2F A;  4GD6 A;  2JKR I;  3OBF A;  1S0W A;  5F6A A;  1PWD A;  2Y91 A;  1IKG A;  1OME A;  3A3D A;  1NLZ A;  3GRJ A;  3UE3 A;  5HAI A;  1JNU A;  5A8B A;  1E3U A;  1I2S A;  1OTD A;  1EI5 A;  3D3O A;  1YMS A;  4IBX A;  3BEB A;  4KZ4 A;  4P6B A;  3VOL A;  1PI5 A;  5F1F A;  4R3A A;  4JKT A;  4DXB A;  2Y2O A;  4N9K A;  3HRE A;  3RH8 B;  1O7E A;  4HY8 A;  1GA9 A;  5GL9 A;  4CLC E;  4FH2 A;  3OC2 A;  5F82 A;  4EQI A;  1XX2 A;  4KZA A;  3AGD A;  1MY8 A;  3QP4 A;  4WZ4 A;  4GJ4 A;  3TSG A;  4DDY A;  4WM9 A;  4BL2 A;  2VGK A;  3GVB A;  5JYP A;  1W7F A;  3LI8 A;  3KX0 X;  4U0X A;  3VP0 A;  3W2Z A;  3W4O A;  3B42 A;  4NXB A;  1MKM A;  5EV0 A;  3A3J A;  1ES3 A;  5FL3 A;  3SH7 A;  2QMI A;  4EUZ A;  3WS0 A;  4KZB A;  4L9F A;  3CUE C;  3T1R A;  2ZQ7 A;  3T50 A;  3T12 B;  3SH8 A;  2NUP C;  2VGL M;  2VA0 A;  2O0Y A;  3V67 A;  1I2W A;  2JBF A;  3SS4 A;  3LO7 A;  3TW8 A;  3QNB A;  4S2M A;  3P7N A;  3HLC A;  3MR0 A;  2WZX A;  2ZL1 A;  4G3V A;  5M19 A;  2A24 B;  3F1O A;  1VHM A;  3UPP A;  2Y2H A;  3CZD A;  4NEE D;  3QP5 A;  4DF6 A;  5EVI D;  1GHM A;  5FAS A;  4WL9 A;  1LHY A;  2W0N A;  1FCN A;  5FQK A;  3CLO A;  4S2K A;  3BQA A;  1XJ4 A;  5EOE A;  4U0T A;  1K6R A;  3ZVT A;  5FEG A;  1JTD A;  3QNC A;  3SZT A;  3OLO A;  4NXE A;  3UB6 A;  4EUV A;  4P0M A;  4PAU A;  2XFS A;  3E2L A;  3HLG A;  2INW A;  3JVV A;  3MBZ A;  4FD8 A;  4FTX A;  4E6X A;  1PYY A;  2FZ0 A;  5FQQ A;  4HEF A;  3PBQ A;  3LY4 A;  1DP6 A;  3BJN A;  3CJM A;  3ZHH A;  5EE8 A;  1JTG A;  4MDZ A;  1GSW A;  1LSX A;  3OPP A;  4RQ9 A;  5DKL A;  3D9Y A;  2J7V A;  4ZDX A;  4E3M A;  3LR3 A;  3CMZ A;  2YKF A;  2HV1 A;  2XF3 A;  4JXV A;  5CED A;  5L09 A;  3V5M A;  5HWW A;  4N1X A;  2HP5 A;  3MKF A;  4PKY G;  2PHY A;  1I5Q A;  5E2H A;  2WKH A;  3EGD C;  4UQI M;  4DE0 A;  3LYX A;  2Q9M A;  2C5W B;  2Y2M A;  4GHI B;  4UA9 A;  1S4R A;  4Y0U A;  1G28 A;  2QZ6 A;  4DRT A;  1IKI A;  4HOI A;  5EVL A;  2H0Y A;  2EA9 A;  5AQ7 A;  1Q2Q A;  3VP2 A;  3RJU A;  4X68 A;  1QME A;  3LIB A;  3Q82 A;  4S2N A;  3G2Y A;  4HJ3 A;  4IHQ A;  3T4L A;  3MXQ A;  3KYQ A;  4LCL A;  2J3T D;  4R3J A;  3ZYT A;  4IVK A;  1PI4 A;  3H82 A;  3S7O A;  3HUN A;  4MN7 A;  4X53 A;  2IWB A;  1N9O A;  1IEM A;  4Q0I A;  1H3Q A;  2PBY A;  3V39 A;  3G30 A;  4EEU A;  1CEG A;  2BTF P;  2A2L A;  2WKP A;  1NLY A;  3Q1F A;  5CHJ A;  5HZH A;  2WK0 A;  5EVI B;  2CC1 A;  2ZMF A;  3SS3 A;  3UMD A;  1SKF A;  4M3K A;  2JKT I;  4BBV A;  3GQZ A;  4WN5 A;  1OTA A;  4D60 A;  4PM8 A;  1L0G A;  1D1J A;  5EFW A;  2J3W A;  5HSQ A;  2QHK A;  3IH8 A;  4PKY A;  3IH9 A;  5FAQ A;  1OJ5 A;  3BFE A;  2ZMV A;  3HLB A;  2W3H A;  4X69 A;  1ESU A;  3IX3 A;  1YQS A;  4BQM A;  4YNR A;  3IXD A;  1PRQ A;  2K7S A;  1FCO A;  2WKE A;  5FI6 A;  4E3I A;  3KSG A;  5GLA A;  3EEA A;  3DTK A;  1Q2P A;  4A5R A;  3HVF A;  1OTI A;  5GLB A;  2J9P A;  2HP6 A;  1SKO A;  4F94 A;  2PBD P;  2JCH A;  1YM1 A;  5FQJ A;  1MWS A;  3C7V A;  3F1N B;  4HBU A;  1LL8 A;  4S2N C;  4GLQ A;  4RX2 A;  2EFU A;  4P6Z S;  3WS5 A;  5IS1 A;  2GJ3 A;  3B47 A;  2V20 A;  4R23 A;  3G32 A;  5CX7 A;  3FPV A;  5GLC A;  3D72 A;  1CI8 A;  1LT0 A;  1K6S A;  2P9V A;  1TF1 A;  3KYZ A;  2O9B A;  4JF6 A;  4CQH A;  4Y2F A;  4ZTK A;  1RCJ A;  2KX6 A;  2Q0O A;  1YAX A;  3H7W A;  5GHX A;  3IF5 A;  4PM6 A;  3QP6 A;  4R1G A;  2P04 A;  5HDC A;  1K56 A;  4RX3 A;  2P08 A;  5HD5 A;  3DTI A;  2ZJ9 A;  3O5Y A;  1N9L A;  4OLG A;  5E43 A;  3GEC A;  1GHI A;  2GZA A;  3IHB A;  1YLJ A;  3UB8 A;  2PT7 A;  3VSL A;  1T1C A;  1ES5 A;  1TEM A;  4DJ2 A;  4BD1 A;  1Y4O A;  2E8I A;  3FG8 A;  4CLC B;  4C75 A;  4F3L B;  2O9A A;  3E4Q A;  3LID A;  4H6J A;  3MKE A;  3H9W A;  4MN6 A;  4G3K A;  3T1S A;  1W5D A;  3A0R A;  4GW9 A;  5HX9 A; 
#chains in the Genus database with same CATH homology
 4LEN A;  4QU3 A;  1YLY A;  1SDN A;  3GTC A;  3ZNT A;  4GB7 A;  5L2F A;  3W8K A;  4E3K A;  4IBR A;  4GD6 A;  4N92 A;  3VMA A;  3O86 A;  4B4Z A;  1S0W A;  1K55 A;  1PWD A;  2Y91 A;  1IKG A;  1OME A;  3A3D A;  3IXH A;  4IED A;  4UHU A;  4E3L A;  3NIA A;  1IYS A;  4WEJ A;  3GRJ A;  3G4P A;  3UE3 A;  5HL1 A;  3O87 A;  3SS5 A;  3BFG A;  1M6K A;  3ZDJ A;  3HLF A;  4GN2 A;  5HAI A;  5FAT A;  2A3U A;  3V3R A;  5DF9 A;  3IF6 B;  1PW8 A;  1E3U A;  1I2S A;  4PMA A;  1EI5 A;  2G2U A;  1YMS A;  4IBX A;  4EV4 A;  3NDE A;  1NYM A;  3BEB A;  4KZ4 A;  1KVL A;  4P6B A;  2OV5 A;  3HL9 A;  3MXS A;  4OPR A;  1KE3 A;  1PI5 A;  4MEZ A;  5F1F A;  4MBF A;  2WGW B;  4KZ5 A;  1K54 A;  2WAF A;  4JKT A;  1FR6 A;  1ERM A;  4EBL A;  4DXB A;  4L0L A;  5EPH A;  4DE3 A;  2Y2O A;  2FFF B;  3BM6 A;  3WWX A;  2V2F F;  1ERO A;  2Y2K A;  1RGY A;  4N9K A;  1PIO A;  3HRE A;  2I72 A;  1O7E A;  5CEB A;  4WBG A;  1GA9 A;  2ZQD A;  5GL9 A;  3HUM A;  4FSF A;  4FH2 A;  4OOL A;  5IHV A;  1K38 A;  4S2P A;  4JXS A;  1SHV A;  3OC2 A;  3IF6 A;  4FH4 A;  1DJA A;  1XX2 A;  3N4I A;  5EUA A;  4NET A;  5F82 A;  4EQI A;  4X6T A;  4EWF A;  4KZA A;  2Y2P A;  2OSU A;  4OKP A;  4LV3 A;  3A3I A;  1ES4 A;  3AGD A;  4WEK A;  4ID4 A;  1MY8 A;  5DF8 A;  4WZ4 A;  2ZC4 B;  4GZB A;  2WGW A;  4JLF A;  2EXA A;  1IEL A;  5I94 A;  3TSG A;  1IYO A;  3UPO A;  4KZ6 A;  4DDY A;  3IT9 A;  3UDF A;  4WM9 A;  2RL3 A;  2Y2N A;  2VGK A;  4BL2 A;  4IVI A;  3PBO A;  4JBF A;  3GVB A;  1MWT A;  3Q07 A;  5JYP A;  1W7F A;  2ZMA A;  4GOG A;  3VFF A;  4BD0 A;  1NRF A;  4H8R A;  4U0X A;  3VP0 A;  3HLW A;  4N9L A;  4UAA A;  3W4O A;  1LLB A;  3NBL A;  1JWZ A;  3N6I A;  4KZ9 A;  3A3J A;  2ZD8 A;  3V50 A;  1ES3 A;  4UA7 A;  3M6H A;  2X71 A;  3SH7 A;  1ZG6 A;  1KGE A;  4QY5 A;  3RXW A;  2QMI A;  3S22 A;  4EUZ A;  3WS0 A;  1K4E A;  2HPB A;  4KZB A;  1DJB A;  4WZ5 A;  3SOI A;  1RP5 A;  3GV9 A;  2ZQ7 A;  5E2E A;  1LI0 A;  2EX6 A;  3SH8 A;  1BLS A;  1ERQ A;  3M6B A;  2ZC6 B;  2Y2Q A;  3PBS A;  1I2W A;  2JBF A;  3SS4 A;  2B5R A;  1L0F A;  1PW1 A;  2J9O A;  3LO7 A;  4P85 A;  3ZNY A;  4BEN A;  5CGS A;  2Z2L B;  3C4O A;  3QNB A;  4S2M A;  3WRZ A;  4OPY A;  5DTT A;  1S6R A;  4CJN A;  1L0D A;  3HLC A;  1ONG A;  4C6Y A;  3PBR A;  3BRM A;  4DE1 A;  3S1Y A;  2WZX A;  4JPM A;  1MKI A;  5M19 A;  3UE1 A;  3JYI A;  3UPP A;  1XPB A;  4OQG A;  2Y2H A;  2JC7 A;  5GLD A;  1VM1 A;  1JVJ A;  3CZD A;  2RCX A;  3LEZ A;  4DF6 A;  5EVI D;  1YLW A;  1GHM A;  2Y2L A;  5FAS A;  2XLN A;  1K55 C;  1LHY A;  2ZQ8 A;  2DNS A;  3PBT A;  4O7D A;  4ZAM A;  1NZU A;  1ALQ A;  1DJC A;  3FV7 A;  5FSR A;  2XFT A;  3TG9 A;  5CEC A;  1ES2 A;  1FCN A;  2ZQA A;  4S2K A;  5FQK A;  5J8X A;  4E3N A;  1NYY A;  1FQG A;  5EOE A;  3W4P A;  1G68 A;  3OPH A;  3WS1 A;  4U0T A;  1K6R A;  1XP4 A;  4KG2 A;  4RYE A;  1RGZ A;  3ZVT A;  2ZC7 A;  1JTD A;  3QNC A;  4JXW A;  4P87 A;  4R4R A;  4GDB A;  2XQZ A;  5HAR A;  4HBT A;  1K54 C;  1HZO A;  4KG6 A;  2C6W B;  4WMC D;  1ONH A;  4P0M A;  2HDR A;  3ZGA B;  2HDS A;  1GHP A;  4EBN A;  2XFS A;  2ZC5 B;  3E2L A;  3UO9 A;  3G35 A;  3HLG A;  1PWG A;  4GKU A;  3QHY A;  3MBZ A;  5TFQ A;  3TOI A;  5KSH A;  4FD8 A;  4E6X A;  1MPL A;  1PYY A;  1LL5 A;  2EX8 A;  5FQQ A;  3IF6 C;  4ZJ2 A;  2H0T A;  4HEF A;  3PBQ A;  3LY4 A;  3NDG A;  3CJM A;  4LV1 A;  1ESI A;  5FAO A;  1KDW A;  2Y2G A;  3MXR A;  5EE8 A;  3ZHH A;  1JTG A;  4X56 A;  1FR1 A;  1WE4 A;  3OCL A;  2HDQ A;  4KZ3 A;  3VSK A;  3OPP A;  5EEC A;  2OLU A;  4N1H A;  3ITA A;  1G6A A;  2H10 A;  4OQH A;  1MBL A;  4MLL A;  1K4F A;  3ZG0 A;  1AXB A;  1FCM A;  1FSY A;  2J7V A;  5HFO A;  1FSW A;  4ZDX A;  1EWZ A;  4Y7P A;  1KE4 A;  4E3M A;  4KQQ A;  1K57 A;  3O3V A;  2J8Y A;  3CMZ A;  3IWO A;  4RVA A;  1PWC A;  3UE0 A;  1KGF A;  3PBN A;  3IWI A;  4MNR A;  5DTS A;  2XF3 A;  5DVA A;  1SCW A;  4JXV A;  4ZBE A;  5CED A;  5CER A;  3V5M A;  4N1X A;  4WMC A;  3IXB A;  4U3T A;  2WGV A;  4QB8 A;  2BLS A;  2HP5 A;  3Q7Z A;  1PZP A;  3MKF A;  1IYP A;  3M2K A;  4OP5 A;  3A3E A;  2EX2 A;  5A91 A;  4WZ5 C;  2ZLY A;  1E4D A;  1I5Q A;  2WGI A;  4LCM A;  1H8Y A;  1ZKJ A;  3Q7V B;  3N8S A;  2WKH A;  5E2H A;  5KMW A;  1BLP A;  2ZC3 B;  2PU2 A;  3IHA A;  4R0Q A;  3BLM A;  2VGJ A;  4B88 A;  3ZG9 B;  4DE0 A;  2IWC A;  2Q9M A;  1BUE A;  2C5W B;  2Y2M A;  3DWZ A;  3VOY A;  3ZG7 B;  1NXY A;  4UA9 A;  3GMW A;  1GCE A;  1N9B A;  4Y0U A;  5G18 A;  4YIN A;  2QZ6 A;  2HDU A;  1FOF A;  1O07 A;  3UNW A;  4DRT A;  2Z2M B;  4MBH A;  1YT4 A;  1J9M A;  1HVB A;  3P98 A;  1IKI A;  5EVL A;  4DDS A;  3MZE A;  2H0Y A;  5CHU A;  5AQ7 A;  1IYQ A;  2P74 A;  1Q2Q A;  5CHM A;  3P09 A;  3VP2 A;  3RJU A;  3GSG A;  2XGN A;  4X68 A;  2HP9 A;  1QME A;  1XA1 A;  4Q8I A;  1K25 A;  5HAP A;  3G2Z A;  3Q82 A;  4K0X A;  3UY6 A;  5DF7 A;  1C3B A;  4S2N A;  3G2Y A;  1DY6 A;  5AQB A;  5HAQ A;  5AQA A;  2ZQ9 A;  4LCL A;  1BZA A;  2WAE A;  3WS4 A;  4KG5 A;  1NJ4 A;  4JF4 A;  1TVF A;  2XD1 A;  3NY4 A;  4GNU A;  4R3J A;  1H8Z A;  3I7J A;  1W8Q A;  1PI4 A;  1WYC A;  4IVK A;  4R4S A;  3O88 A;  4YFM A;  4QY6 A;  5F83 A;  3V3S A;  5CRF A;  3HUN A;  3IQA A;  4PM9 A;  4X53 A;  5GHY A;  4OQ0 A;  5CXW A;  2Q9N A;  3ISG A;  2H5S A;  5EOO A;  2IWB A;  5GHZ A;  1IEM A;  3UDX A;  5BOH A;  5FA7 A;  3MZD A;  1W79 A;  2X01 A;  3SH9 A;  2PBY A;  3B3X A;  3V39 A;  3HLE A;  5A92 A;  2ZM2 A;  2XEP A;  3G30 A;  1CEG A;  3ZVW A;  1E3U D;  3DTM A;  4B4X A;  5JYO A;  1MWU A;  2Y55 A;  3AGF A;  3Q1F A;  5CHJ A;  3UPN A;  1WYB A;  2WK0 A;  4OH0 A;  5U47 A;  3CG5 A;  2R9W A;  5CGX A;  5EVI B;  3ZFZ A;  1YLT A;  2R9X A;  5EVI C;  1KDS A;  2CC1 A;  3NI9 A;  2Y2I A;  4PPR A;  3SS3 A;  4S2I A;  1N4O A;  1SKF A;  4DXC A;  5A93 A;  1L2S A;  1BTL A;  5FDH A;  1ZG4 A;  2EFX A;  4M3K A;  5CTN A;  4XUX A;  1ZC2 A;  3GQZ A;  1YMX A;  5AQ9 A;  3W4Q A;  3OPL A;  1BLC A;  2ZQC A;  4PM8 A;  4GD8 A;  1L0G A;  3WS2 A;  4BLM A;  1K57 C;  4ZJ3 A;  1XA7 A;  1Y54 A;  4S2J A;  4WYY A;  4XUZ A;  3VFH A;  4CPK A;  3BEC A;  4BJP A;  4KEN B;  2X02 A;  3HUO A;  4OOM A;  5FI2 A;  4QD4 A;  5EVI A;  5HW3 A;  3LCE A;  2UWX A;  1BUL A;  3EQV A;  3IH8 A;  4OON A;  3IH9 A;  1YLP A;  5FAQ A;  4D2O A;  3BFE A;  4GDN A;  3M2J A;  3HLB A;  3D4F A;  3EQU A;  3LY3 A;  4XXR A;  4K0W A;  3VP3 A;  4LV2 A;  4X69 A;  1NY0 A;  4OLD A;  3UDI A;  1CI9 A;  4DE2 A;  2ZM0 A;  1ESU A;  1YQS A;  4BQM A;  4C3Q A;  2XK1 A;  1L0E A;  3FKW A;  3Q81 A;  3IXD A;  4OQI A;  1FCO A;  2WKE A;  3BFC A;  1BSG A;  1HD8 A;  5FI6 A;  5GLA A;  3N8R A;  4ZJ1 A;  3WRT A;  1QMF A;  3MFD A;  4JXG A;  1Q2P A;  4A5R A;  3HVF A;  4PM7 A;  2DCF A;  3FYZ A;  1U60 A;  1BT5 A;  3ITB A;  2XD5 A;  3N8L A;  2J9P A;  5GLB A;  3E2K A;  3G31 A;  2HP6 A;  3IWQ A;  5A90 A;  2JE5 A;  3DWK A;  4F94 A;  4Z9Q A;  1M40 A;  4R3B A;  4LV0 A;  5F1G A;  1LI9 A;  2DRW A;  4Y0O A;  5E2G A;  2JCH A;  1YM1 A;  5FQJ A;  1MWS A;  2P9V B;  3IXG A;  3C7V A;  4S2L A;  4HBU A;  4MBK A;  2Y59 A;  2WYX A;  1K56 D;  2BG1 A;  1LL9 A;  4S2N C;  2EXB A;  1KVM A;  1GA0 A;  4RX2 A;  4EBP A;  2FFY A;  2EX9 A;  5FQI A;  2EFU A;  4OP8 A;  3S4X A;  5M18 A;  3OPR A;  4BL3 A;  2WKI A;  3PAE A;  3MZF A;  4QJG A;  1TDL A;  3WS5 A;  4KQO A;  1NZO A;  3G34 A;  1JWP A;  4FCF A;  4UA6 A;  2ZM8 A;  1TDG A;  2V20 A;  4KZ7 A;  3G32 A;  4R23 A;  4WEL A;  5FQM A;  4PM5 A;  3N7W A;  5M1A A;  5GLC A;  4OPZ A;  5FI7 A;  3Q7V A;  3ZCZ A;  1CI8 A;  5TGF A;  5KZH A;  2WAD A;  1K6S A;  5TR7 A;  2P9V A;  3VOZ A;  3HLD A;  1XKZ A;  3GR2 A;  1E25 A;  4OPQ A;  1KGG A;  3BFF A;  2A49 A;  4JF6 A;  4RA7 A;  3C4P A;  4E6W A;  1H5X A;  3BLS A;  5D3O A;  4ZTK A;  3C5A A;  3AGE A;  1RCJ A;  2OLV A;  5FAP A;  2PU4 A;  5CTM A;  4OOY A;  4S2O A;  5GHX A;  4E3I A;  5FQ9 A;  4X55 A;  3IF5 A;  4DKI A;  4PM6 A;  5E2F A;  1HTZ A;  3VP1 A;  1BLH A;  4R1G A;  4E3J A;  2G2W A;  4OVD A;  1K56 A;  3OCN A;  1XGJ A;  3BFD A;  3UN7 A;  2Y2J A;  3HBR A;  4RX3 A;  4E3O A;  5KSC A;  3BYD A;  2ZJ9 A;  2V1Z A;  4NK3 A;  4OLG A;  5E43 A;  1GHI A;  3NCK A;  1CEF A;  1YLJ A;  3IHB A;  1SDE A;  4KQR A;  3VSL A;  2GDN A;  1JWV A;  3PTE A;  1Z6F A;  3RXX A;  3C7U A;  2WUQ A;  1ES5 A;  1TEM A;  3A3F A;  2XH9 A;  2QPN A;  4KZ8 A;  2WZZ A;  4BD1 A;  5CGW A;  3FWL A;  3VP4 A;  2E8I A;  4QHC A;  3FZC A;  3ZG8 B;  3DW0 A;  1YLZ A;  4C75 A;  1XGI A;  3FKV A;  4HES A;  2Y4A A;  3OZH A;  1XXM A;  3NC8 A;  4K91 A;  5DTK A;  4Y0T A;  1PZO A;  2XDM A;  3PAG A;  3ZG5 A;  1MWR A;  2XR0 A;  3MKE A;  1KE0 A;  1W8Y A;  4JF5 A;  1VQQ A;  1W5D A;  1CK3 A;  2IWD A;  1MXO A;  5HX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...