1GSWA

Crystal structure of the p65 crystal form of photoactive yellow protein g51s mutant
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
122
structure length
122
Chain Sequence
VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITSRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Engineering Photocycle Dynamics: Crystal Structures and Kinetics of Three Photoactive Yellow Protein Hinge-Bending Mutants
pubmed doi rcsb
source organism Ectothiorhodospira halophila
molecule tags Photosynthesis
total genus 33
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2002-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1gswA00
4HP4A 5IS1A 5AVFA 1XJ2A 1WA9A 4MN5A 3LI8A 4HI4A 2VV7A 2R78A 1V9YA 3MR0A 4HY8A 3LIDA 1UWNX 4HJ3A 3MQOA 2V1BA 2PR5A 1OTAA 4I3JA 4M4XA 1BYWA 2D01A 3VOLA 3F1OB 4XT2A 2PYRA 4JGRA 2ZOHA 1OTBA 4GS9A 4EESA 1OJGA 3BWLA 3LIBA 2BASA 3UE6A 5G4YA 2V1AA 1OTIA 3CLOA 5AVEA 1D06A 2OWJA 1XJ6A 4KUOA 4EEUA 3OLOA 3IBRA 4WL9A 3UMDA 3A0RA 1GSVA 3K3CA 4LRXC 3FG8A 2A24A 2WKQA 2M1CA 4HIAA 1LSXA 3VE3A 1XFQA 4HJ4A 4DJ3A 1S4SA 1TS6A 4H6JA 1EW0A 2L4RA 2QWSA 4EW7A 4XT2B 3C2WA 4NXEA 2VLGA 3IS2B 4HH2A 1DP9A 2L1MA 3NOUC 5F5YA 3NOPC 5HD5A 4JGQA 2PDRA 1N9OA 2YKFA 3F1PA 2INWA 1Y28A 3F1NB 3K3DA 5HSQA 1NWZA 1D7EA 4LRYC 4GCZA 4R38A 1F98A 5KIZA 2A24B 3D72A 2QJ7A 5HDCA 4F3LA 5J4EA 2OWHA 4L9GA 4R70A 3NHQA 3H9WA 4LLOB 3GECA 1XJ4A 2HV1A 3ZQ5A 1LL8A 3ICYA 4HP9A 3LICA 3GDIA 4NXGA 4I5SA 5F69A 3H7WB 4EEPA 3NOTC 3H82A 2W0NA 3F1PB 3LYXA 4HJ6A 4DJ2A 1TS0A 3MXQA 4I38A 1S1ZA 5DKLA 1OJ5A 1DP8A 1UGUA 4HOIA 3UB9A 4GHIA 2VEAA 2W27A 3G6OA 4PKYA 1XFNA 2ZOIA 1T1BA 2QKPA 4WF0A 1TS7A 4RQ9A 2WKRA 2JN7A 2QHKA 1N9LA 4EETB 4I3IA 3PHYA 4HNBA 1TS8A 4KUKA 4WN5A 2Z6CA 4BBVA 4MN6A 1DRMA 1LSVA 2V0UA 4B9OA 2B02A 1S67L 2VV6A 5HD3A 4GS9B 2H28A 2PYPA 1DP6A 4WLAA 2CMNA 4LPZA 4I3AA 4EERA 2K7SA 3F1OA 5TBMA 5HZHA 1T19A 4GHIB 4PKYG 3HJKA 3HJIA 4L9FA 4NXFA 3VE4A 4KQDA 4R3AA 4WUJA 3BY9A 3RTYA 2L0WA 3CWFA 3B33A 4JGOA 3LIFA 2QJ5A 2JHEA 1S66L 4K08A 1P0ZA 1VB6A 2PR6A 5DJUA 1GSXA 4H6JB 3UB7A 2V0WA 3NJAA 2KX6A 1V9ZA 5A8BA 1OT9A 1ODVA 4HQAA 3UB6A 5HDSA 1OTEA 2J80A 5DKKA 1T18A 4YWZA 5J3WA 1OT6A 4JGPA 3EWKA 5F6AA 1F9IA 5IU1A 5TBMB 3PYPA 1T1CA 4LRZE 2ZBBA 3IS2A 3A0SA 3FC7A 5F68A 2D02A 1XJ3A 2P7JA 2VV8A 1T1AA 5J7EA 4BBUA 2KDKA 3MFXA 1G28A 5HDDA 4F3LB 3P7NA 3F1NA 4HHDA 3MJQA 3EEHA 2GJ3A 3BY8A 3SW1A 2V9AA 3ULFA 3LI9A 3MQQA 3E4OA 5HWWA 2PD7A 4EQ1A 2WKPA 5G4ZA 3KX0X 5DJTA 5EFWA 1S1YA 2I9VA 1LSWA 3LUQA 3H82B 1KOUA 2YKHA 1OTDA 2EA9A 1UWPX 3LIEA 3A0VA 3E4PA 4EXOA 2Z6DA 4I39A 4NXBA 1JNUA 4R6LA 4BBTA 1GSWA 3H7WA 3T50A 1MZUA 4HH3A 1X0OA 1S4RA 5HWTA 4GW9A 1P97A 3RH8B 5HWVA 1N9NA 3E4QA 4E04A 3UMEA 2PD8A 5I5LA 2OOLA 3LIAA 2PHYA 3CAXA 3UB8A 1LT0A 4L9EA 3C8CA
chains in the Genus database with same CATH superfamily
5DF8A 3DTIA 4BQMA 4OOLA 3KSIA 4N1HA 1WA9A 4MN5A 2Y2JA 1IKIA 2ZM0A 3HREA 3ZG5A 3MR0A 3MSHA 5JYPA 3ZNTA 4DF6A 3MQOA 1LHYA 1BLCA 2PR5A 4OQ0A 3MXSA 3MZDA 1NYYA 3MFDA 4F94A 5CECA 2ZOHA 3IF6A 1CEGA 1F2KA 4B4ZA 5G4YA 4LV3A 3SH9A 3QNBA 3HBRA 1JTDA 2J3TC 1PW8A 3T12B 3IBJA 3HLDA 4OH0A 1D06A 2OWJA 2X02A 2QYBA 1KDWA 2W1RA 4JXGA 3IBRA 4WL9A 3E98A 5EECA 4KZ4A 1HTZA 3IF5A 1TEMA 5L07A 4BD0A 5FL3A 2WGWA 1VETB 3FG8A 4EU0A 2A24A 1EWZA 3HUOA 4E6WA 2M1CA 3DWZA 4UA6A 4G3WA 4HJ4A 2GZAA 1KVLA 1ERQA 2V1ZA 3D3OA 1IYPA 5F5YA 5HD5A 1BT5A 2JKTI 2YKFA 4CLCA 2P74A 1Y28A 4QD4A 5A91A 1H8ZA 5EVIC 2HP9A 3BLMA 2ZMFA 2Y8HA 3SH8A 3HCYA 4Y7PA 1MKMA 4ARZA 1G6AA 4C75A 4JBFA 1F98A 4WEJA 2WGWB 2R9WA 1H3QA 2A24B 4KQQA 5J4EA 4KZ3A 2OV5A 4E3IA 1BTLA 3W2ZA 3NHQA 4Y0UA 3HL9A 4Q0IA 4LLOB 5CGSA 2HPBA 1QMFA 3WS4A 1HVBA 2VZWA 4ZTKA 3ZQ5A 3GDIA 3JYIA 1WYBA 2PAVP 3IXGA 4OQIA 1IKGA 3FPVA 1FR6A 3BFFA 1PZOA 2ZQCA 1J9MA 3DW0A 2ZC7A 3IX8A 4KZAA 4IEDA 4N92A 4EBPA 1XPBA 4K91A 3ZVWA 4Y0OA 2FZ0A 2Y2OA 4N1XA 3UB9A 4GHIA 4DN0A 5FAOA 2VEAA 2DCFA 2W27A 4ZJ2A 4PKYA 2ZOIA 1Q2PA 1T1BA 4CPKA 5L2FA 3OBFA 4E3LA 4OQHA 3ITBA 4P0MA 5CHUA 3M6BA 2B95A 4X6TA 1N9LA 2JBFA 4DE2A 3O5YA 3VP0A 1ZTUA 5E2FA 3IXBA 4ZJ3A 2P9VB 1FR1A 1IFQA 4FOFA 1LSVA 2V0UA 4Z9QA 3HLGA 1CQAA 3BEBA 5EVIA 2B02A 4WMCA 2VV6A 2LB5A 4PM8A 4R0QA 2VX8A 3IHBA 1YLYA 2ZC5B 4OLGA 3VSKA 4IUKA 3EEAA 3SOIA 4Y0TA 3ITAA 5KSCA 4S2JA 5C5KA 3S7PA 4YFMA 1F5MA 4OPQA 3TSGA 2XH9A 1T19A 2WK0A 4GHIB 4GB7A 4WZ5C 5FI2A 3GTCA 3HJIA 4K0XA 4L9FA 3C7VA 1OPXA 3D4FA 3NCKA 3RTYA 2XSSA 2DRWA 3PAGA 3B33A 4RYEA 3BLSA 2Y91A 4P6ZM 3G32A 3OPLA 1JVJA 1DY6A 2PR6A 3M2JA 5DJUA 3VMAA 4H6JB 3RJUA 3LR0A 3VOZA 1AWIA 3R7WB 2HJEA 1HD8A 5A8BA 1BLPA 1E4DA 3HLEA 4CLCE 3IX4A 1CJFA 1VHMA 5HDSA 1OTEA 4EWFA 3ZG8B 2XD1A 3HLCA 4KZ6A 5I94A 1Z09A 1FCNA 1YLJA 4JGPA 4LCMA 4FUWA 3R4KA 3W4PA 1TDGA 1F9IA 3MQ0A 2I72A 3IS2A 2GDNA 3ZGAB 5J7EA 2M7VA 5IHVA 4BBUA 5CX7A 1GA9A 1ES3A 2OAP1 2JC7A 2XFTA 4QB8A 4GOGA 3OCLA 3EEHA 3SW1A 5GHZA 3SS5A 3NECA 2ZQ7A 4GNUA 3T4TA 3LI9A 3MQQA 2Q0OA 3E4OA 3G2ZA 5DFXA 3EGXC 3PBOA 1XXMA 1LLBA 1U60A 1K56A 5DJTA 5HFOA 3BJNA 4KG5A 3IX3A 2XK1A 3NDEA 5U47A 2ZM8A 4WZ5A 3LIEA 1K4EA 4KG6A 3A0VA 5LBRA 4EXOA 4KZ7A 3WRZA 2Z6DA 1XA7A 3DBAA 4QWOA 3UY6A 3LEQA 3LFVA 4BL2A 3V3SA 3UPPA 4N9LA 2HP5A 3ZHHA 3BW6A 1MZUA 4NETA 1X0OA 3EOIA 5FI6A 1L3LA 1K25A 3PBQA 1KGGA 5I5LA 4OPZA 3T1XA 3LIAA 2PHYA 5GHXA 3CAXA 3NI9A 1TVFA 2GX5A 5AVFA 2ZC3B 1RGYA 3GR2A 4ETZA 3CMZA 3MKFA 2VV7A 2ZC4B 2XD5A 3HLWA 3KO6A 3NBLA 2OSUA 2XGNA 2XEPA 2RL3A 4L0LA 4QHCA 4M4XA 1WYCA 5GLCA 3O3VA 4NK3A 3HUMA 5HW3A 2W3HA 3HVFA 2WGIA 2JE5A 3IWIA 3ZVTA 1K0KA 2ZQDA 4X1MA 1OTBA 4RVAA 3CPTB 1OJGA 2Z2MB 1IOUA 2BASA 4DMZA 2EX8A 2BLSA 1FOFA 2H10A 2V1AA 3G34A 3MS6A 1ZG6A 1L0DA 3QP5A 4P6BA 3MZEA 1OTIA 4QY6A 3Q7ZA 3LEZA 1XJ6A 1I2WA 4EEUA 3OLOA 1I2SA 1YM1A 1FCMA 1I5QA 4BD1A 3EGDC 5EM0A 4JPMA 5FEFA 4R3JA 1MWUA 2WKQA 3DTKA 4Y13A 5FQQA 4DJ3A 1S4SA 4P87A 3VV4A 3GRJA 5HX9A 4GJ4A 2HGVA 1EW0A 1YQSA 3DAVA 4XUXA 5KSHA 1L0GA 2WZZA 3C2WA 2QMIA 4NXEA 4HH2A 1DP9A 1K55C 3NOPC 3ZNYA 2XRNA 4JGQA 3B42A 4R4SA 2W3DA 2NUTC 3F1PA 3A3IA 1NJ4A 5L10A 4DE3A 4H8RA 3T1RA 2OLVA 2V20A 1O7EA 4LFUA 5CHJA 5HSQA 2JKRM 1NWZA 3G4PA 1CEFA 2FH5A 5DTKA 4D2OA 1E3UD 2OLUA 1ES5A 3L9KA 5FDSA 5F82A 3IQAA 2JKGA 4GCZA 5FI7A 1M6KA 4O7DA 2V2FF 3EQVA 2DNSA 4X69A 5HDCA 3D72A 3WS5A 4F3LA 2W3GA 3KSGA 3E0YA 1LL5A 5HPIA 1Y4OA 3H9WA 4S2MA 2XR0A 3NULA 3GECA 1MXOA 1XJ4A 1K56D 3OCNA 3MZFA 4ZJ1A 4LGWA 3Q07A 1SCWA 1JWPA 5EPHA 3DTEA 3LGOA 3A3DA 1LL8A 3ICYA 1L0EA 4MNRA 4B88A 1KGFA 1SKOA 2JKFA 3T1QB 1CK3A 1MY8A 5F69A 5AQAA 4O8GA 2WUQA 1STZA 3H7WB 4EEPA 1MKIA 3H82A 3LYXA 3F1PB 2J7VA 3Q82A 1DJAA 3PBNA 4YOFA 4Y17A 2VKSA 4I38A 4LCLA 3IWQA 4LV2A 1OJ5A 2Y2HA 3SH7A 3LR3A 1UGUA 1MWSA 5CHMA 4BJPA 4IUHA 4WM9A 4HEFA 2XFSA 1SDNA 5HL6A 1SHVA 2ZC6B 2HDRA 3G6OA 1XFNA 2QKPA 4WF0A 4RQ9A 1ONGA 4KZ9A 1HLUP 4OKPA 3S7OA 3T4JA 3V5MA 4GZBA 5DF7A 1W8YA 1SDEA 3D9YA 1K55A 5IT5A 5HAQA 3A3FA 2AVXA 3ZDJA 1IYSA 1MC0A 1TS8A 2Z6CA 4MN6A 4R3BA 2PBDP 5FEGA 3S7NA 3IF6B 5HD3A 3JVVA 3TRCA 3QNCA 3BFEA 4QPRA 2XA7S 2XQZA 2O9BA 3NY4A 2A49A 4WEKA 1YKDA 4Z1WA 3V67A 1KGEA 1K4FA 1FSYA 3O86A 2K7SA 3F1OA 2WKIA 3A3JA 2K31A 5HARA 3S4XA 2VGLS 2OAQ1 3MF0A 5HZHA 4ZBEA 4N9KA 2PT7A 3LR4A 2VA0A 3CZDA 4R3AA 4WUJA 4EV4A 4PAUA 4DE0A 3BYDA 5HPFA 5FQIA 1K54C 1G5UA 2L0WA 3CWFA 5KMWA 3PR6A 1S0WA 3VP3A 1S66L 2FFFB 1GSXA 3GV9A 3SS3A 5E43A 1BLHA 1HZOA 2KX6A 1MPLA 4LV0A 4QJGA 3L7HA 1XGIA 1ODVA 3CUEA 3DWKA 4CLCB 3G2YA 4M3KA 4P85A 1BZAA 3Q7VA 3EWKA 5F6AA 5A93A 4KZ8A 1SZVA 2J9OA 3U2AA 5KZHA 5IU1A 4JXVA 3PYPA 4LRZE 1YLZA 2ZBBA 4JF4A 2K2NA 4ARZB 2EX6A 3IWOA 1PW1A 5DTTA 4JLFA 4PM9A 2KDKA 3OPPA 1RGZA 3P7NA 3F1NA 4HHDA 3MJQA 2G2UA 2GJ3A 3BY8A 3CI6A 3G30A 4IBXA 5TFQA 1H8MA 5EVLA 2M7UA 4JXWA 3UE3A 2WAEA 3AGEA 3KX0X 4D60A 3MMHA 5EFWA 2JCHA 3QP1A 5DTSA 4GDNA 1S1YA 3KSHA 1ZHHB 1LSWA 3LUQA 4B93A 2YKHA 4GD8A 3QP6A 1UWPX 4ESPA 3V39A 4G3KA 2O99A 4KZBA 4MMNA 2Y2LA 1PI5A 1KE4A 2HDQA 2J8YA 5GLDA 1K54A 3P98A 3T50A 3UDFA 1N4OA 3T4QA 5HWVA 3FWLA 4E04A 5TJJA 2PD8A 4E3MA 2HJ9C 4ZRRA 2Z2LB 1W79A 3UB8A 1LT0A 4L9EA 4Y3IA 1GHMA 3C8CA 4HP4A 3C7UA 4OLDA 4ZDXA 5IS1A 2IA2A 1XJ2A 2Y2QA 4E3JA 4KZ5A 3FPWA 3LI8A 5EE8A 1LI0A 4PM5A 1CI9A 3AGFA 4GDBA 4OP5A 4HI4A 2BTFP 4GN2A 2JKRI 1W63M 1NYMA 5EVIB 3I7JA 4HY8A 3LIDA 1UWNX 1PWCA 1JWZA 1VM1A 3WS0A 4HJ3A 1XGJA 2V1BA 4I3JA 2Y2PA 1BYWA 1G6OA 2D01A 4O01A 3S1YA 4XT2A 3UB5P 4IJGA 4IVIA 5AQBA 4JGRA 4OQGA 4GS9A 2EFXA 1AXBA 4EESA 1KE3A 3UE6A 1E3UA 3SS4A 1XX2A 4Y5FA 1W7FA 1C3BA 3MBZA 4JF5A 5AVEA 1IYQA 1W63Q 1YMXA 5GLBA 1GA0A 2RCXA 2LB9A 4OPRA 1NLZA 2EX9A 3PXPA 5BOHA 4PPRA 4Y2FA 3S7QA 2XF3A 3P09A 1VEUA 4OVDA 4PM6A 3VE3A 5F1GA 4DXBA 3PAEA 5AQ9A 1K6SA 3LCEA 4BMWA 2EWWA 1YSQA 1TS6A 2P04A 5GL9A 1ERMA 3GMWA 3K2NA 2QWSA 2ZD8A 4EW7A 3TW8A 4XT2B 3TJZC 2H0YA 1H0MA 2VLGA 4U0XA 3IS2B 4WYYA 2L1MA 3NOUC 3B3XA 2ACGA 3IH8A 2PDRA 1N9OA 1PWGA 2W1TA 2O9AA 2XA7M 3WWXA 1PWDA 2PU4A 3WS2A 3KYZA 3CHWP 2EWVA 4NEED 1IEMA 5DF9A 1D7EA 2VGLM 5CGXA 1FQGA 3LO7A 4IVKA 4Q0JA 1YAXA 3VFFA 5KIZA 4PMAA 2QJ7A 5GHYA 5FASA 2G7UA 5E2HA 1DJCA 2OWHA 1NZUA 5A90A 3NIAA 1MBLA 2B5RA 4IBRA 3LY4A 2BG1A 2PU2A 3FYZA 5EV0A 3GQZA 4MEZA 4HP9A 3LICA 4Y15A 4NXGA 3OPRA 4I5SA 2VJWA 4EUVA 1RCJA 3C38A 2Q9MA 2ZJ9A 3DTMA 4HJ6A 3WRTA 3MXQA 4DRTA 5DVAA 3HLFA 1BULA 1FILA 1S1ZA 5DKLA 5G18A 4HOIA 5F1FA 2E8IA 3O88A 4OP8A 4MBFA 3VOYA 1YSPA 3QP4A 5HL1A 4OPYA 1TS7A 3OC2A 3RXXA 1WE4A 2C6WB 2WKRA 5HAPA 2JN7A 2QHKA 3QP8A 2PBYA 1JTGA 3PBTA 2FFYA 1ALQA 4EETB 4I3IA 5A92A 1FCOA 3Q1FA 3ZG0A 3N8LA 4KUKA 5FDHA 4WN5A 5CXWA 2WAFA 3W4QA 1Y54A 4BBVA 1VQQA 1ES4A 1DRMA 4FH2A 1S67L 1XKZA 5D3OA 2J3WA 2H28A 2ZLYA 2PYPA 2B18A 4WLAA 1N9BA 1PZPA 3CG5A 2Y2MA 4BLMA 4JF6A 5TBMA 4UHUA 1IELA 3T4LA 3V3RA 4FH4A 3BQAA 4DXCA 2HF6A 1NRFA 4PKYG 3S22A 4R23A 3HJKA 4HBTA 3UNWA 1PNEA 4PHTA 2XROA 3TE8A 2EFUA 4KQDA 1Q2QA 4C6YA 3T4OA 1PRQA 4NG2A 4KG2A 3BY9A 3ZG7B 2EXBA 3PTEA 2IWDA 4JGOA 5FAQA 1P9RA 4O0PA 2JHEA 5L09A 1PYYA 2IWCA 4GLQA 3LY3A 1PFLA 3QP2A 3VP1A 4RX2A 3UB7A 4FSFA 2Y59A 2VGKA 1V9ZA 1OT9A 1VETA 3C5AA 3T4KA 3QHYA 3C30A 5HAIA 2J80A 5DKKA 3VFHA 2O0YA 2Y79A 3GVBA 1OT6A 2O9CA 2G2WA 1BSGA 5FAPA 3CUEC 2W3FA 5TBMB 4S2KA 4MBHA 1W5DA 3A0SA 2P08A 1ACFA 3FC7A 5F68A 2D02A 2P7JA 4S2IA 2VV8A 5TGFA 1TD5A 1FIKA 1J3WA 4PM7A 4KQOA 1ZKJA 5FA7A 4FTXA 2HP6A 2ZM2A 1G28A 5HDDA 4F3LB 2E8JA 3UO9A 1NY0A 1ES2A 1NLYA 3IXHA 5HWWA 2PD7A 4EQ1A 2ZL1A 4CQHA 1SKOB 5CRFA 1K57C 3UDXA 4EQIA 4X53A 2HZ5A 3N7WA 3H82B 1KOUA 3NDGA 4QU3A 1EROA 3E4PA 3IHAA 2DMWA 3ZCZA 4NXBA 4EBNA 3A3EA 1JNUA 4R6LA 1GSWA 4ETXA 1L2SA 1E25A 2A2LA 5HWTA 4GW9A 3N8SA 3E4QA 2WKHA 4RX3A 4X56A 3UMEA 4UEYA 3KYEA 5M1AA 3UE0A 4UA9A 3P01A 2ZL1B 4MDZA 2XLNA 3HLBA 3MKEA 2R78A 1V9YA 2A3UA 5FQ9A 4E3OA 2MJ6A 3O87A 1CI8A 4Q0HA 1ESIA 1PIOA 3N8RA 3CJMA 1OTAA 4OONA 3VOLA 3F1OB 2P9VA 1NRJA 1GHIA 2PYRA 5EOOA 5AQ7A 2GNXA 3UPOA 2V8CA 2NUPC 4YINA 4RA7A 4KENB 2QZ6A 1P9WA 1W8QA 3ZG9B 5L8MA 3BWLA 3LIBA 4S2LA 4ZAMA 1G68A 4FCFA 3VSLA 3C4PA 3Q81A 2HDSA 5CEBA 3IT9A 3CLOA 3BQ8A 3FV7A 1K57A 4KUOA 3LR5A 4X68A 4AFIA 3UMDA 3A0RA 4FD8A 4KQRA 4GKUA 1GSVA 3IXDA 4S2PA 5FQKA 5EOEA 3K3CA 4LRXC 5J8XA 4MN7A 1TDLA 3UPNA 4X55A 4B4XA 4GD6A 1M40A 2ZQ8A 1YT4A 1KE0A 3G31A 4HIAA 1LSXA 1XFQA 3W4OA 4WBGA 4JKTA 3Q7VB 4H6JA 2L4RA 3ISGA 4JXSA 3V50A 4HESA 5F83A 3R7WA 3G35A 2Y4AA 3RFBA 4MCWA 4LV1A 1ESUA 5E2GA 4DDYA 3E2LA 4BWIA 1S6RA 2INWA 4UQIS 1H5XA 1BUEA 3F1NB 4LENA 3K3DA 3W8KA 2Y2GA 1BLSA 2X71A 1O07A 2H0TA 4BL3A 5K5BA 3VP2A 4LRYC 1ZG4A 4XXRA 2C5WB 4R38A 2Y55A 4L9GA 4R70A 4WELA 3HUNA 1Z6FA 3JPUA 5EM1A 2HV1A 3B47A 4MLLA 2UWXA 5FQMA 3MXRA 1QMEA 3IH9A 4UAAA 2WKEA 3CITA 2ZMVA 3RXWA 5EVEA 4S2OA 3NOTC 2XDMA 2W0NA 1YPRA 4DJ2A 4EBLA 1TS0A 1CF0A 2H5SA 5E2EA 2Y2IA 1DP8A 2KLIA 2WGVA 3BECA 4K0WA 4CLCD 1YLWA 5FSRA 2EXAA 1H8YA 2UV0E 5JYOA 1MWTA 4DE1A 4HBUA 4Q8IA 3UE1A 1RP5A 1ONHA 1NZOA 1ZC2A 5CTNA 3FKWA 4OOMA 4R1GA 2VK3A 4NKPA 2JKTM 3PHYA 5FQJA 4HNBA 4E3KA 3SZTA 3E2KA 1KVMA 4B9OA 2WZXA 4GS9B 5M19A 4X25A 4XUZA 4A5RA 1K38A 1DP6A 4IHQA 5MC7A 3KSFA 2CMNA 2ZQAA 4LPZA 4I3AA 4EERA 1LI9A 5DFYA 2J3TD 2IWBA 2X01A 5TR7A 3NC8A 2EX2A 4C3QA 3AGDA 4U3TA 3PBSA 3TOIA 3CPTA 3N6IA 4NXFA 3JVUA 3VE4A 4WZ4A 3ZFZA 1JWVA 2R9XA 1VEUB 3BM6A 5AJGA 3LIFA 2QJ5A 4S2NC 4MBKA 4QY5A 3FZCA 3EQUA 1EI5A 3GSGA 3ZYTA 4K08A 3WS1A 1P0ZA 1VB6A 3FKVA 3BFDA 3U4LP 3OOVA 4OOYA 2V0WA 3NJAA 1D1JA 5EUAA 5CEDA 4ID4A 4HQAA 3UB6A 4X1LA 1K6RA 3BFGA 2W1TB 1T18A 4YWZA 2W3EA 5J3WA 2J9PA 2CC1A 3PBRA 5EVID 4WMCD 1A0KA 1DJBA 3TG9A 2WADA 1T1CA 3N4IA 3T1SA 1YLTA 1XJ3A 5CERA 3UDIA 1T1AA 1GCEA 1PI4A 4II7A 3UN7A 4BENA 2V8FA 3C4OA 3MFXA 2KOIA 1FSWA 3BFCA 4U0TA 1KDSA 1LL9A 4EUZA 3IF6C 4E6XA 2Y2NA 2V9AA 3OPHA 3ULFA 4E3NA 3M2KA 4YNRA 1L0FA 2WKPA 1SKFA 5G4ZA 4ME4A 2ZQ9A 3BRMA 4UA7A 4DKIA 1GHPA 5FATA 2I9VA 1IYOA 1YLPA 1NXYA 1OTDA 3VP4A 2EA9A 1XA1A 2Y2KA 2PRFA 2ZMAA 5CTMA 4R4RA 4I39A 2HDUA 2QPNA 3KYQA 5GLAA 1OMEA 1TF1A 3M6HA 1XP4A 2WYXA 4BBTA 3H7WA 1YMSA 4G3VA 4HH3A 4S2NA 4DDSA 5CGWA 5M18A 1S4RA 4CJNA 3T4SA 1P97A 3RH8B 1N9NA 4UQIM 2Q9NA 2OOLA 3OZHA 4P6ZS 1MWRA 4CLCC 2VGJA
chains in the Genus database with same CATH topology
2GX5A 4HP4A 3P01A 4OOLA 3KSIA 5IS1A 2IA2A 5AVFA 1XJ2A 1WA9A 4MN5A 4MDZA 3FPWA 3LI8A 4HI4A 4ETZA 2VV7A 2JKRI 1W63M 2R78A 1V9YA 3MR0A 3KO6A 2MJ6A 4HY8A 3LIDA 1UWNX 4Q0HA 4HJ3A 3MQOA 2V1BA 4L0LA 2PR5A 1OTAA 4I3JA 4M4XA 1BYWA 1G6OA 2D01A 3VOLA 4O01A 3F1OB 1NRJA 4XT2A 2PYRA 2W3HA 4IJGA 2GNXA 2NUPC 4JGRA 2ZOHA 1OTBA 4GS9A 1P9WA 4EESA 1OJGA 5L8MA 3BWLA 3LIBA 1IOUA 2BASA 3UE6A 5G4YA 4DMZA 2V1AA 4Y5FA 2J3TC 1OTIA 3IBJA 3CLOA 5AVEA 1D06A 2OWJA 3BQ8A 2QYBA 1XJ6A 1W63Q 2W1RA 4KUOA 4EEUA 3OLOA 3IBRA 4WL9A 3LR5A 3E98A 4AFIA 3UMDA 3A0RA 1GSVA 3EGDC 2LB9A 1NLZA 3K3CA 4LRXC 3PXPA 5FL3A 4MN7A 3FG8A 4EU0A 2A24A 4Y2FA 3S7QA 2WKQA 2M1CA 4HIAA 1LSXA 4G3WA 3VE3A 1XFQA 4HJ4A 4DJ3A 1S4SA 2GZAA 3VV4A 4BMWA 2EWWA 4GJ4A 1YSQA 1TS6A 2HGVA 2P04A 4H6JA 1EW0A 2L4RA 3D3OA 3K2NA 5KSHA 2QWSA 3R7WA 4EW7A 3TW8A 4XT2B 3TJZC 3C2WA 4NXEA 2VLGA 3IS2B 4HH2A 1DP9A 2L1MA 3RFBA 3NOUC 4MCWA 5F5YA 3NOPC 2XRNA 5HD5A 4JGQA 3B42A 2JKTI 2PDRA 2W3DA 1N9OA 2YKFA 2NUTC 3F1PA 4BWIA 4CLCA 2INWA 2W1TA 2O9AA 1Y28A 2XA7M 4UQIS 3F1NB 3K3DA 3KYZA 2JKRM 1NWZA 5HSQA 2EWVA 4NEED 2ZMFA 2Y8HA 2FH5A 5K5BA 5DF9A 3HCYA 1D7EA 2VGLM 1MKMA 4ARZA 4LRYC 4GCZA 4Q0JA 4R38A 1YAXA 1F98A 4WEJA 5KIZA 3EQVA 1H3QA 2A24B 3D72A 2QJ7A 5HDCA 2W3GA 4F3LA 3KSGA 3E0YA 2G7UA 5J4EA 2OWHA 4L9GA 4R70A 4WELA 5HPIA 3W2ZA 3NHQA 4Q0IA 3H9WA 4LLOB 3GECA 1XJ4A 3OCNA 2HV1A 3B47A 2VZWA 3ZQ5A 1LL8A 3ICYA 4HP9A 3LICA 3GDIA 4NXGA 3CITA 4I5SA 5F69A 2VJWA 2ZMVA 4O8GA 4EUVA 1STZA 3H7WB 4EEPA 3NOTC 3FPVA 3H82A 2W0NA 3C38A 3F1PB 3LYXA 4HJ6A 4DJ2A 1TS0A 3MXQA 4YOFA 3PBNA 2VKSA 4I38A 1S1ZA 5DKLA 1OJ5A 1DP8A 3LR3A 1UGUA 2KLIA 4BJPA 2FZ0A 4IUHA 4CLCD 4HOIA 3UB9A 4GHIA 4DN0A 2VEAA 5HL6A 2W27A 1YSPA 3G6OA 4PKYA 1XFNA 2ZOIA 1T1BA 2QKPA 4WF0A 1TS7A 3OC2A 4RQ9A 2WKRA 3S7OA 3OBFA 3T4JA 2JN7A 2QHKA 3PBTA 1N9LA 4OOMA 4EETB 4I3IA 4NKPA 2JKTM 3PHYA 5IT5A 3O5YA 4HNBA 1ZTUA 1MC0A 1TS8A 4KUKA 4WN5A 2Z6CA 4BBVA 1IFQA 4MN6A 4FOFA 1DRMA 1LSVA 2V0UA 4B9OA 2B02A 3S7NA 1S67L 2VV6A 5HD3A 2LB5A 4GS9B 3JVVA 2VX8A 2J3WA 3TRCA 2H28A 4QPRA 2PYPA 2XA7S 5MC7A 1DP6A 2O9BA 4IHQA 2B18A 4IUKA 4WLAA 3EEAA 3KSFA 1YKDA 2CMNA 4WEKA 4LPZA 4I3AA 4Z1WA 3V67A 5C5KA 4EERA 5DFYA 3S7PA 2J3TD 2K7SA 3F1OA 1F5MA 5TBMA 2K31A 3T4LA 2VGLS 2OAQ1 3MF0A 5HZHA 1T19A 3BQAA 4GHIB 2HF6A 3PBSA 4PKYG 3HJKA 2PT7A 3HJIA 3LR4A 2VA0A 4L9FA 4PHTA 2XROA 4NXFA 3TE8A 3JVUA 3VE4A 4KQDA 4R3AA 4WUJA 3T4OA 4PAUA 1OPXA 5HPFA 3BY9A 3RTYA 2XSSA 2L0WA 3CWFA 3B33A 4JGOA 3PR6A 5AJGA 3LIFA 2QJ5A 1P9RA 4O0PA 2JHEA 4P6ZM 3EQUA 1S66L 3ZYTA 4GLQA 4K08A 1P0ZA 1VB6A 2PR6A 5DJUA 1GSXA 4H6JB 3OOVA 3LR0A 3UB7A 2V0WA 3NJAA 4FSFA 3R7WB 2HJEA 2KX6A 1V9ZA 5A8BA 1OT9A 4CLCE 1ODVA 4HQAA 3UB6A 3CUEA 1VHMA 3T4KA 5HDSA 3C30A 1OTEA 2J80A 5DKKA 4CLCB 2W1TB 1T18A 2O0YA 2Y79A 4YWZA 2W3EA 1OT6A 2O9CA 5J3WA 3PBRA 4JGPA 3EWKA 3CUEC 5F6AA 3U2AA 3R4KA 2W3FA 1F9IA 3MQ0A 5IU1A 5TBMB 3PYPA 1T1CA 4LRZE 2ZBBA 3IS2A 3A0SA 2P08A 2K2NA 3FC7A 5F68A 4ARZB 2D02A 1XJ3A 2P7JA 2VV8A 1T1AA 1TD5A 5J7EA 2M7VA 4II7A 4KQOA 4BBUA 5CX7A 2OAP1 2KDKA 3MFXA 2KOIA 1G28A 5HDDA 4F3LB 3P7NA 3F1NA 4HHDA 3MJQA 3OCLA 3EEHA 2GJ3A 3BY8A 3CI6A 3SW1A 2V9AA 1NLYA 3ULFA 3T4TA 3LI9A 3MQQA 3E4OA 1H8MA 5DFXA 3EGXC 5HWWA 4YNRA 2PD7A 3PBOA 4EQ1A 2M7UA 2WKPA 3UE3A 5G4ZA 4ME4A 4CQHA 3KX0X 5DJTA 3MMHA 3BJNA 5EFWA 1S1YA 3KSHA 1ZHHB 2I9VA 1LSWA 3LUQA 3H82B 1KOUA 4B93A 2YKHA 1OTDA 2EA9A 1UWPX 3LIEA 5LBRA 3A0VA 4G3KA 3E4PA 4EXOA 2O99A 2Z6DA 4MMNA 3DBAA 2DMWA 4I39A 4NXBA 3LFVA 3KYQA 1JNUA 1TF1A 4R6LA 4BBTA 1GSWA 3H7WA 3T50A 4ETXA 3BW6A 4G3VA 1MZUA 4HH3A 1X0OA 1S4RA 3EOIA 2A2LA 5HWTA 4GW9A 1P97A 3T4SA 3RH8B 3T4QA 5HWVA 1N9NA 3E4QA 3PBQA 4E04A 4UQIM 3UMEA 5TJJA 2PD8A 5I5LA 2HJ9C 4UEYA 2OOLA 4ZRRA 3LIAA 2PHYA 4P6ZS 3CAXA 3UB8A 1LT0A 4L9EA 4Y3IA 4CLCC 3C8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HP4 A;  5IS1 A;  5AVF A;  1XJ2 A;  1WA9 A;  4MN5 A;  3LI8 A;  4HI4 A;  2VV7 A;  2R78 A;  1V9Y A;  3MR0 A;  4HY8 A;  3LID A;  1UWN X;  4HJ3 A;  3MQO A;  2V1B A;  2PR5 A;  1OTA A;  4I3J A;  4M4X A;  1BYW A;  2D01 A;  3VOL A;  3F1O B;  4XT2 A;  2PYR A;  4JGR A;  2ZOH A;  1OTB A;  4GS9 A;  4EES A;  1OJG A;  3BWL A;  3LIB A;  2BAS A;  3UE6 A;  5G4Y A;  2V1A A;  1OTI A;  3CLO A;  5AVE A;  1D06 A;  2OWJ A;  1XJ6 A;  4KUO A;  4EEU A;  3OLO A;  3IBR A;  4WL9 A;  3UMD A;  3A0R A;  1GSV A;  3K3C A;  4LRX C;  3FG8 A;  2A24 A;  2WKQ A;  2M1C A;  4HIA A;  1LSX A;  3VE3 A;  1XFQ A;  4HJ4 A;  4DJ3 A;  1S4S A;  1TS6 A;  4H6J A;  1EW0 A;  2L4R A;  2QWS A;  4EW7 A;  4XT2 B;  3C2W A;  4NXE A;  2VLG A;  3IS2 B;  4HH2 A;  1DP9 A;  2L1M A;  3NOU C;  5F5Y A;  3NOP C;  5HD5 A;  4JGQ A;  2PDR A;  1N9O A;  2YKF A;  3F1P A;  2INW A;  1Y28 A;  3F1N B;  3K3D A;  5HSQ A;  1NWZ A;  1D7E A;  4LRY C;  4GCZ A;  4R38 A;  1F98 A;  5KIZ A;  2A24 B;  3D72 A;  2QJ7 A;  5HDC A;  4F3L A;  5J4E A;  2OWH A;  4L9G A;  4R70 A;  3NHQ A;  3H9W A;  4LLO B;  3GEC A;  1XJ4 A;  2HV1 A;  3ZQ5 A;  1LL8 A;  3ICY A;  4HP9 A;  3LIC A;  3GDI A;  4NXG A;  4I5S A;  5F69 A;  3H7W B;  4EEP A;  3NOT C;  3H82 A;  2W0N A;  3F1P B;  3LYX A;  4HJ6 A;  4DJ2 A;  1TS0 A;  3MXQ A;  4I38 A;  1S1Z A;  5DKL A;  1OJ5 A;  1DP8 A;  1UGU A;  4HOI A;  3UB9 A;  4GHI A;  2VEA A;  2W27 A;  3G6O A;  4PKY A;  1XFN A;  2ZOI A;  1T1B A;  2QKP A;  4WF0 A;  1TS7 A;  4RQ9 A;  2WKR A;  2JN7 A;  2QHK A;  1N9L A;  4EET B;  4I3I A;  3PHY A;  4HNB A;  1TS8 A;  4KUK A;  4WN5 A;  2Z6C A;  4BBV A;  4MN6 A;  1DRM A;  1LSV A;  2V0U A;  4B9O A;  2B02 A;  1S67 L;  2VV6 A;  5HD3 A;  4GS9 B;  2H28 A;  2PYP A;  1DP6 A;  4WLA A;  2CMN A;  4LPZ A;  4I3A A;  4EER A;  2K7S A;  3F1O A;  5TBM A;  5HZH A;  1T19 A;  4GHI B;  4PKY G;  3HJK A;  3HJI A;  4L9F A;  4NXF A;  3VE4 A;  4KQD A;  4R3A A;  4WUJ A;  3BY9 A;  3RTY A;  2L0W A;  3CWF A;  3B33 A;  4JGO A;  3LIF A;  2QJ5 A;  2JHE A;  1S66 L;  4K08 A;  1P0Z A;  1VB6 A;  2PR6 A;  5DJU A;  1GSX A;  4H6J B;  3UB7 A;  2V0W A;  3NJA A;  2KX6 A;  1V9Z A;  5A8B A;  1OT9 A;  1ODV A;  4HQA A;  3UB6 A;  5HDS A;  1OTE A;  2J80 A;  5DKK A;  1T18 A;  4YWZ A;  5J3W A;  1OT6 A;  4JGP A;  3EWK A;  5F6A A;  1F9I A;  5IU1 A;  5TBM B;  3PYP A;  1T1C A;  4LRZ E;  2ZBB A;  3IS2 A;  3A0S A;  3FC7 A;  5F68 A;  2D02 A;  1XJ3 A;  2P7J A;  2VV8 A;  1T1A A;  5J7E A;  4BBU A;  2KDK A;  3MFX A;  1G28 A;  5HDD A;  4F3L B;  3P7N A;  3F1N A;  4HHD A;  3MJQ A;  3EEH A;  2GJ3 A;  3BY8 A;  3SW1 A;  2V9A A;  3ULF A;  3LI9 A;  3MQQ A;  3E4O A;  5HWW A;  2PD7 A;  4EQ1 A;  2WKP A;  5G4Z A;  3KX0 X;  5DJT A;  5EFW A;  1S1Y A;  2I9V A;  1LSW A;  3LUQ A;  3H82 B;  1KOU A;  2YKH A;  1OTD A;  2EA9 A;  1UWP X;  3LIE A;  3A0V A;  3E4P A;  4EXO A;  2Z6D A;  4I39 A;  4NXB A;  1JNU A;  4R6L A;  4BBT A;  1GSW A;  3H7W A;  3T50 A;  1MZU A;  4HH3 A;  1X0O A;  1S4R A;  5HWT A;  4GW9 A;  1P97 A;  3RH8 B;  5HWV A;  1N9N A;  3E4Q A;  4E04 A;  3UME A;  2PD8 A;  5I5L A;  2OOL A;  3LIA A;  2PHY A;  3CAX A;  3UB8 A;  1LT0 A;  4L9E A;  3C8C A; 
#chains in the Genus database with same CATH topology
 5DF8 A;  3DTI A;  4BQM A;  4OOL A;  3KSI A;  4N1H A;  1WA9 A;  4MN5 A;  2Y2J A;  1IKI A;  2ZM0 A;  3HRE A;  3ZG5 A;  3MR0 A;  3MSH A;  5JYP A;  3ZNT A;  4DF6 A;  3MQO A;  1LHY A;  1BLC A;  2PR5 A;  4OQ0 A;  3MXS A;  3MZD A;  1NYY A;  3MFD A;  4F94 A;  5CEC A;  2ZOH A;  3IF6 A;  1CEG A;  1F2K A;  4B4Z A;  5G4Y A;  4LV3 A;  3SH9 A;  3QNB A;  3HBR A;  1JTD A;  2J3T C;  1PW8 A;  3T12 B;  3IBJ A;  3HLD A;  4OH0 A;  1D06 A;  2OWJ A;  2X02 A;  2QYB A;  1KDW A;  2W1R A;  4JXG A;  3IBR A;  4WL9 A;  3E98 A;  5EEC A;  4KZ4 A;  1HTZ A;  3IF5 A;  1TEM A;  5L07 A;  4BD0 A;  5FL3 A;  2WGW A;  1VET B;  3FG8 A;  4EU0 A;  2A24 A;  1EWZ A;  3HUO A;  4E6W A;  2M1C A;  3DWZ A;  4UA6 A;  4G3W A;  4HJ4 A;  2GZA A;  1KVL A;  1ERQ A;  2V1Z A;  3D3O A;  1IYP A;  5F5Y A;  5HD5 A;  1BT5 A;  2JKT I;  2YKF A;  4CLC A;  2P74 A;  1Y28 A;  4QD4 A;  5A91 A;  1H8Z A;  5EVI C;  2HP9 A;  3BLM A;  2ZMF A;  2Y8H A;  3SH8 A;  3HCY A;  4Y7P A;  1MKM A;  4ARZ A;  1G6A A;  4C75 A;  4JBF A;  1F98 A;  4WEJ A;  2WGW B;  2R9W A;  1H3Q A;  2A24 B;  4KQQ A;  5J4E A;  4KZ3 A;  2OV5 A;  4E3I A;  1BTL A;  3W2Z A;  3NHQ A;  4Y0U A;  3HL9 A;  4Q0I A;  4LLO B;  5CGS A;  2HPB A;  1QMF A;  3WS4 A;  1HVB A;  2VZW A;  4ZTK A;  3ZQ5 A;  3GDI A;  3JYI A;  1WYB A;  2PAV P;  3IXG A;  4OQI A;  1IKG A;  3FPV A;  1FR6 A;  3BFF A;  1PZO A;  2ZQC A;  1J9M A;  3DW0 A;  2ZC7 A;  3IX8 A;  4KZA A;  4IED A;  4N92 A;  4EBP A;  1XPB A;  4K91 A;  3ZVW A;  4Y0O A;  2FZ0 A;  2Y2O A;  4N1X A;  3UB9 A;  4GHI A;  4DN0 A;  5FAO A;  2VEA A;  2DCF A;  2W27 A;  4ZJ2 A;  4PKY A;  2ZOI A;  1Q2P A;  1T1B A;  4CPK A;  5L2F A;  3OBF A;  4E3L A;  4OQH A;  3ITB A;  4P0M A;  5CHU A;  3M6B A;  2B95 A;  4X6T A;  1N9L A;  2JBF A;  4DE2 A;  3O5Y A;  3VP0 A;  1ZTU A;  5E2F A;  3IXB A;  4ZJ3 A;  2P9V B;  1FR1 A;  1IFQ A;  4FOF A;  1LSV A;  2V0U A;  4Z9Q A;  3HLG A;  1CQA A;  3BEB A;  5EVI A;  2B02 A;  4WMC A;  2VV6 A;  2LB5 A;  4PM8 A;  4R0Q A;  2VX8 A;  3IHB A;  1YLY A;  2ZC5 B;  4OLG A;  3VSK A;  4IUK A;  3EEA A;  3SOI A;  4Y0T A;  3ITA A;  5KSC A;  4S2J A;  5C5K A;  3S7P A;  4YFM A;  1F5M A;  4OPQ A;  3TSG A;  2XH9 A;  1T19 A;  2WK0 A;  4GHI B;  4GB7 A;  4WZ5 C;  5FI2 A;  3GTC A;  3HJI A;  4K0X A;  4L9F A;  3C7V A;  1OPX A;  3D4F A;  3NCK A;  3RTY A;  2XSS A;  2DRW A;  3PAG A;  3B33 A;  4RYE A;  3BLS A;  2Y91 A;  4P6Z M;  3G32 A;  3OPL A;  1JVJ A;  1DY6 A;  2PR6 A;  3M2J A;  5DJU A;  3VMA A;  4H6J B;  3RJU A;  3LR0 A;  3VOZ A;  1AWI A;  3R7W B;  2HJE A;  1HD8 A;  5A8B A;  1BLP A;  1E4D A;  3HLE A;  4CLC E;  3IX4 A;  1CJF A;  1VHM A;  5HDS A;  1OTE A;  4EWF A;  3ZG8 B;  2XD1 A;  3HLC A;  4KZ6 A;  5I94 A;  1Z09 A;  1FCN A;  1YLJ A;  4JGP A;  4LCM A;  4FUW A;  3R4K A;  3W4P A;  1TDG A;  1F9I A;  3MQ0 A;  2I72 A;  3IS2 A;  2GDN A;  3ZGA B;  5J7E A;  2M7V A;  5IHV A;  4BBU A;  5CX7 A;  1GA9 A;  1ES3 A;  2OAP 1;  2JC7 A;  2XFT A;  4QB8 A;  4GOG A;  3OCL A;  3EEH A;  3SW1 A;  5GHZ A;  3SS5 A;  3NEC A;  2ZQ7 A;  4GNU A;  3T4T A;  3LI9 A;  3MQQ A;  2Q0O A;  3E4O A;  3G2Z A;  5DFX A;  3EGX C;  3PBO A;  1XXM A;  1LLB A;  1U60 A;  1K56 A;  5DJT A;  5HFO A;  3BJN A;  4KG5 A;  3IX3 A;  2XK1 A;  3NDE A;  5U47 A;  2ZM8 A;  4WZ5 A;  3LIE A;  1K4E A;  4KG6 A;  3A0V A;  5LBR A;  4EXO A;  4KZ7 A;  3WRZ A;  2Z6D A;  1XA7 A;  3DBA A;  4QWO A;  3UY6 A;  3LEQ A;  3LFV A;  4BL2 A;  3V3S A;  3UPP A;  4N9L A;  2HP5 A;  3ZHH A;  3BW6 A;  1MZU A;  4NET A;  1X0O A;  3EOI A;  5FI6 A;  1L3L A;  1K25 A;  3PBQ A;  1KGG A;  5I5L A;  4OPZ A;  3T1X A;  3LIA A;  2PHY A;  5GHX A;  3CAX A;  3NI9 A;  1TVF A;  2GX5 A;  5AVF A;  2ZC3 B;  1RGY A;  3GR2 A;  4ETZ A;  3CMZ A;  3MKF A;  2VV7 A;  2ZC4 B;  2XD5 A;  3HLW A;  3KO6 A;  3NBL A;  2OSU A;  2XGN A;  2XEP A;  2RL3 A;  4L0L A;  4QHC A;  4M4X A;  1WYC A;  5GLC A;  3O3V A;  4NK3 A;  3HUM A;  5HW3 A;  2W3H A;  3HVF A;  2WGI A;  2JE5 A;  3IWI A;  3ZVT A;  1K0K A;  2ZQD A;  4X1M A;  1OTB A;  4RVA A;  3CPT B;  1OJG A;  2Z2M B;  1IOU A;  2BAS A;  4DMZ A;  2EX8 A;  2BLS A;  1FOF A;  2H10 A;  2V1A A;  3G34 A;  3MS6 A;  1ZG6 A;  1L0D A;  3QP5 A;  4P6B A;  3MZE A;  1OTI A;  4QY6 A;  3Q7Z A;  3LEZ A;  1XJ6 A;  1I2W A;  4EEU A;  3OLO A;  1I2S A;  1YM1 A;  1FCM A;  1I5Q A;  4BD1 A;  3EGD C;  5EM0 A;  4JPM A;  5FEF A;  4R3J A;  1MWU A;  2WKQ A;  3DTK A;  4Y13 A;  5FQQ A;  4DJ3 A;  1S4S A;  4P87 A;  3VV4 A;  3GRJ A;  5HX9 A;  4GJ4 A;  2HGV A;  1EW0 A;  1YQS A;  3DAV A;  4XUX A;  5KSH A;  1L0G A;  2WZZ A;  3C2W A;  2QMI A;  4NXE A;  4HH2 A;  1DP9 A;  1K55 C;  3NOP C;  3ZNY A;  2XRN A;  4JGQ A;  3B42 A;  4R4S A;  2W3D A;  2NUT C;  3F1P A;  3A3I A;  1NJ4 A;  5L10 A;  4DE3 A;  4H8R A;  3T1R A;  2OLV A;  2V20 A;  1O7E A;  4LFU A;  5CHJ A;  5HSQ A;  2JKR M;  1NWZ A;  3G4P A;  1CEF A;  2FH5 A;  5DTK A;  4D2O A;  1E3U D;  2OLU A;  1ES5 A;  3L9K A;  5FDS A;  5F82 A;  3IQA A;  2JKG A;  4GCZ A;  5FI7 A;  1M6K A;  4O7D A;  2V2F F;  3EQV A;  2DNS A;  4X69 A;  5HDC A;  3D72 A;  3WS5 A;  4F3L A;  2W3G A;  3KSG A;  3E0Y A;  1LL5 A;  5HPI A;  1Y4O A;  3H9W A;  4S2M A;  2XR0 A;  3NUL A;  3GEC A;  1MXO A;  1XJ4 A;  1K56 D;  3OCN A;  3MZF A;  4ZJ1 A;  4LGW A;  3Q07 A;  1SCW A;  1JWP A;  5EPH A;  3DTE A;  3LGO A;  3A3D A;  1LL8 A;  3ICY A;  1L0E A;  4MNR A;  4B88 A;  1KGF A;  1SKO A;  2JKF A;  3T1Q B;  1CK3 A;  1MY8 A;  5F69 A;  5AQA A;  4O8G A;  2WUQ A;  1STZ A;  3H7W B;  4EEP A;  1MKI A;  3H82 A;  3LYX A;  3F1P B;  2J7V A;  3Q82 A;  1DJA A;  3PBN A;  4YOF A;  4Y17 A;  2VKS A;  4I38 A;  4LCL A;  3IWQ A;  4LV2 A;  1OJ5 A;  2Y2H A;  3SH7 A;  3LR3 A;  1UGU A;  1MWS A;  5CHM A;  4BJP A;  4IUH A;  4WM9 A;  4HEF A;  2XFS A;  1SDN A;  5HL6 A;  1SHV A;  2ZC6 B;  2HDR A;  3G6O A;  1XFN A;  2QKP A;  4WF0 A;  4RQ9 A;  1ONG A;  4KZ9 A;  1HLU P;  4OKP A;  3S7O A;  3T4J A;  3V5M A;  4GZB A;  5DF7 A;  1W8Y A;  1SDE A;  3D9Y A;  1K55 A;  5IT5 A;  5HAQ A;  3A3F A;  2AVX A;  3ZDJ A;  1IYS A;  1MC0 A;  1TS8 A;  2Z6C A;  4MN6 A;  4R3B A;  2PBD P;  5FEG A;  3S7N A;  3IF6 B;  5HD3 A;  3JVV A;  3TRC A;  3QNC A;  3BFE A;  4QPR A;  2XA7 S;  2XQZ A;  2O9B A;  3NY4 A;  2A49 A;  4WEK A;  1YKD A;  4Z1W A;  3V67 A;  1KGE A;  1K4F A;  1FSY A;  3O86 A;  2K7S A;  3F1O A;  2WKI A;  3A3J A;  2K31 A;  5HAR A;  3S4X A;  2VGL S;  2OAQ 1;  3MF0 A;  5HZH A;  4ZBE A;  4N9K A;  2PT7 A;  3LR4 A;  2VA0 A;  3CZD A;  4R3A A;  4WUJ A;  4EV4 A;  4PAU A;  4DE0 A;  3BYD A;  5HPF A;  5FQI A;  1K54 C;  1G5U A;  2L0W A;  3CWF A;  5KMW A;  3PR6 A;  1S0W A;  3VP3 A;  1S66 L;  2FFF B;  1GSX A;  3GV9 A;  3SS3 A;  5E43 A;  1BLH A;  1HZO A;  2KX6 A;  1MPL A;  4LV0 A;  4QJG A;  3L7H A;  1XGI A;  1ODV A;  3CUE A;  3DWK A;  4CLC B;  3G2Y A;  4M3K A;  4P85 A;  1BZA A;  3Q7V A;  3EWK A;  5F6A A;  5A93 A;  4KZ8 A;  1SZV A;  2J9O A;  3U2A A;  5KZH A;  5IU1 A;  4JXV A;  3PYP A;  4LRZ E;  1YLZ A;  2ZBB A;  4JF4 A;  2K2N A;  4ARZ B;  2EX6 A;  3IWO A;  1PW1 A;  5DTT A;  4JLF A;  4PM9 A;  2KDK A;  3OPP A;  1RGZ A;  3P7N A;  3F1N A;  4HHD A;  3MJQ A;  2G2U A;  2GJ3 A;  3BY8 A;  3CI6 A;  3G30 A;  4IBX A;  5TFQ A;  1H8M A;  5EVL A;  2M7U A;  4JXW A;  3UE3 A;  2WAE A;  3AGE A;  3KX0 X;  4D60 A;  3MMH A;  5EFW A;  2JCH A;  3QP1 A;  5DTS A;  4GDN A;  1S1Y A;  3KSH A;  1ZHH B;  1LSW A;  3LUQ A;  4B93 A;  2YKH A;  4GD8 A;  3QP6 A;  1UWP X;  4ESP A;  3V39 A;  4G3K A;  2O99 A;  4KZB A;  4MMN A;  2Y2L A;  1PI5 A;  1KE4 A;  2HDQ A;  2J8Y A;  5GLD A;  1K54 A;  3P98 A;  3T50 A;  3UDF A;  1N4O A;  3T4Q A;  5HWV A;  3FWL A;  4E04 A;  5TJJ A;  2PD8 A;  4E3M A;  2HJ9 C;  4ZRR A;  2Z2L B;  1W79 A;  3UB8 A;  1LT0 A;  4L9E A;  4Y3I A;  1GHM A;  3C8C A;  4HP4 A;  3C7U A;  4OLD A;  4ZDX A;  5IS1 A;  2IA2 A;  1XJ2 A;  2Y2Q A;  4E3J A;  4KZ5 A;  3FPW A;  3LI8 A;  5EE8 A;  1LI0 A;  4PM5 A;  1CI9 A;  3AGF A;  4GDB A;  4OP5 A;  4HI4 A;  2BTF P;  4GN2 A;  2JKR I;  1W63 M;  1NYM A;  5EVI B;  3I7J A;  4HY8 A;  3LID A;  1UWN X;  1PWC A;  1JWZ A;  1VM1 A;  3WS0 A;  4HJ3 A;  1XGJ A;  2V1B A;  4I3J A;  2Y2P A;  1BYW A;  1G6O A;  2D01 A;  4O01 A;  3S1Y A;  4XT2 A;  3UB5 P;  4IJG A;  4IVI A;  5AQB A;  4JGR A;  4OQG A;  4GS9 A;  2EFX A;  1AXB A;  4EES A;  1KE3 A;  3UE6 A;  1E3U A;  3SS4 A;  1XX2 A;  4Y5F A;  1W7F A;  1C3B A;  3MBZ A;  4JF5 A;  5AVE A;  1IYQ A;  1W63 Q;  1YMX A;  5GLB A;  1GA0 A;  2RCX A;  2LB9 A;  4OPR A;  1NLZ A;  2EX9 A;  3PXP A;  5BOH A;  4PPR A;  4Y2F A;  3S7Q A;  2XF3 A;  3P09 A;  1VEU A;  4OVD A;  4PM6 A;  3VE3 A;  5F1G A;  4DXB A;  3PAE A;  5AQ9 A;  1K6S A;  3LCE A;  4BMW A;  2EWW A;  1YSQ A;  1TS6 A;  2P04 A;  5GL9 A;  1ERM A;  3GMW A;  3K2N A;  2QWS A;  2ZD8 A;  4EW7 A;  3TW8 A;  4XT2 B;  3TJZ C;  2H0Y A;  1H0M A;  2VLG A;  4U0X A;  3IS2 B;  4WYY A;  2L1M A;  3NOU C;  3B3X A;  2ACG A;  3IH8 A;  2PDR A;  1N9O A;  1PWG A;  2W1T A;  2O9A A;  2XA7 M;  3WWX A;  1PWD A;  2PU4 A;  3WS2 A;  3KYZ A;  3CHW P;  2EWV A;  4NEE D;  1IEM A;  5DF9 A;  1D7E A;  2VGL M;  5CGX A;  1FQG A;  3LO7 A;  4IVK A;  4Q0J A;  1YAX A;  3VFF A;  5KIZ A;  4PMA A;  2QJ7 A;  5GHY A;  5FAS A;  2G7U A;  5E2H A;  1DJC A;  2OWH A;  1NZU A;  5A90 A;  3NIA A;  1MBL A;  2B5R A;  4IBR A;  3LY4 A;  2BG1 A;  2PU2 A;  3FYZ A;  5EV0 A;  3GQZ A;  4MEZ A;  4HP9 A;  3LIC A;  4Y15 A;  4NXG A;  3OPR A;  4I5S A;  2VJW A;  4EUV A;  1RCJ A;  3C38 A;  2Q9M A;  2ZJ9 A;  3DTM A;  4HJ6 A;  3WRT A;  3MXQ A;  4DRT A;  5DVA A;  3HLF A;  1BUL A;  1FIL A;  1S1Z A;  5DKL A;  5G18 A;  4HOI A;  5F1F A;  2E8I A;  3O88 A;  4OP8 A;  4MBF A;  3VOY A;  1YSP A;  3QP4 A;  5HL1 A;  4OPY A;  1TS7 A;  3OC2 A;  3RXX A;  1WE4 A;  2C6W B;  2WKR A;  5HAP A;  2JN7 A;  2QHK A;  3QP8 A;  2PBY A;  1JTG A;  3PBT A;  2FFY A;  1ALQ A;  4EET B;  4I3I A;  5A92 A;  1FCO A;  3Q1F A;  3ZG0 A;  3N8L A;  4KUK A;  5FDH A;  4WN5 A;  5CXW A;  2WAF A;  3W4Q A;  1Y54 A;  4BBV A;  1VQQ A;  1ES4 A;  1DRM A;  4FH2 A;  1S67 L;  1XKZ A;  5D3O A;  2J3W A;  2H28 A;  2ZLY A;  2PYP A;  2B18 A;  4WLA A;  1N9B A;  1PZP A;  3CG5 A;  2Y2M A;  4BLM A;  4JF6 A;  5TBM A;  4UHU A;  1IEL A;  3T4L A;  3V3R A;  4FH4 A;  3BQA A;  4DXC A;  2HF6 A;  1NRF A;  4PKY G;  3S22 A;  4R23 A;  3HJK A;  4HBT A;  3UNW A;  1PNE A;  4PHT A;  2XRO A;  3TE8 A;  2EFU A;  4KQD A;  1Q2Q A;  4C6Y A;  3T4O A;  1PRQ A;  4NG2 A;  4KG2 A;  3BY9 A;  3ZG7 B;  2EXB A;  3PTE A;  2IWD A;  4JGO A;  5FAQ A;  1P9R A;  4O0P A;  2JHE A;  5L09 A;  1PYY A;  2IWC A;  4GLQ A;  3LY3 A;  1PFL A;  3QP2 A;  3VP1 A;  4RX2 A;  3UB7 A;  4FSF A;  2Y59 A;  2VGK A;  1V9Z A;  1OT9 A;  1VET A;  3C5A A;  3T4K A;  3QHY A;  3C30 A;  5HAI A;  2J80 A;  5DKK A;  3VFH A;  2O0Y A;  2Y79 A;  3GVB A;  1OT6 A;  2O9C A;  2G2W A;  1BSG A;  5FAP A;  3CUE C;  2W3F A;  5TBM B;  4S2K A;  4MBH A;  1W5D A;  3A0S A;  2P08 A;  1ACF A;  3FC7 A;  5F68 A;  2D02 A;  2P7J A;  4S2I A;  2VV8 A;  5TGF A;  1TD5 A;  1FIK A;  1J3W A;  4PM7 A;  4KQO A;  1ZKJ A;  5FA7 A;  4FTX A;  2HP6 A;  2ZM2 A;  1G28 A;  5HDD A;  4F3L B;  2E8J A;  3UO9 A;  1NY0 A;  1ES2 A;  1NLY A;  3IXH A;  5HWW A;  2PD7 A;  4EQ1 A;  2ZL1 A;  4CQH A;  1SKO B;  5CRF A;  1K57 C;  3UDX A;  4EQI A;  4X53 A;  2HZ5 A;  3N7W A;  3H82 B;  1KOU A;  3NDG A;  4QU3 A;  1ERO A;  3E4P A;  3IHA A;  2DMW A;  3ZCZ A;  4NXB A;  4EBN A;  3A3E A;  1JNU A;  4R6L A;  1GSW A;  4ETX A;  1L2S A;  1E25 A;  2A2L A;  5HWT A;  4GW9 A;  3N8S A;  3E4Q A;  2WKH A;  4RX3 A;  4X56 A;  3UME A;  4UEY A;  3KYE A;  5M1A A;  3UE0 A;  4UA9 A;  3P01 A;  2ZL1 B;  4MDZ A;  2XLN A;  3HLB A;  3MKE A;  2R78 A;  1V9Y A;  2A3U A;  5FQ9 A;  4E3O A;  2MJ6 A;  3O87 A;  1CI8 A;  4Q0H A;  1ESI A;  1PIO A;  3N8R A;  3CJM A;  1OTA A;  4OON A;  3VOL A;  3F1O B;  2P9V A;  1NRJ A;  1GHI A;  2PYR A;  5EOO A;  5AQ7 A;  2GNX A;  3UPO A;  2V8C A;  2NUP C;  4YIN A;  4RA7 A;  4KEN B;  2QZ6 A;  1P9W A;  1W8Q A;  3ZG9 B;  5L8M A;  3BWL A;  3LIB A;  4S2L A;  4ZAM A;  1G68 A;  4FCF A;  3VSL A;  3C4P A;  3Q81 A;  2HDS A;  5CEB A;  3IT9 A;  3CLO A;  3BQ8 A;  3FV7 A;  1K57 A;  4KUO A;  3LR5 A;  4X68 A;  4AFI A;  3UMD A;  3A0R A;  4FD8 A;  4KQR A;  4GKU A;  1GSV A;  3IXD A;  4S2P A;  5FQK A;  5EOE A;  3K3C A;  4LRX C;  5J8X A;  4MN7 A;  1TDL A;  3UPN A;  4X55 A;  4B4X A;  4GD6 A;  1M40 A;  2ZQ8 A;  1YT4 A;  1KE0 A;  3G31 A;  4HIA A;  1LSX A;  1XFQ A;  3W4O A;  4WBG A;  4JKT A;  3Q7V B;  4H6J A;  2L4R A;  3ISG A;  4JXS A;  3V50 A;  4HES A;  5F83 A;  3R7W A;  3G35 A;  2Y4A A;  3RFB A;  4MCW A;  4LV1 A;  1ESU A;  5E2G A;  4DDY A;  3E2L A;  4BWI A;  1S6R A;  2INW A;  4UQI S;  1H5X A;  1BUE A;  3F1N B;  4LEN A;  3K3D A;  3W8K A;  2Y2G A;  1BLS A;  2X71 A;  1O07 A;  2H0T A;  4BL3 A;  5K5B A;  3VP2 A;  4LRY C;  1ZG4 A;  4XXR A;  2C5W B;  4R38 A;  2Y55 A;  4L9G A;  4R70 A;  4WEL A;  3HUN A;  1Z6F A;  3JPU A;  5EM1 A;  2HV1 A;  3B47 A;  4MLL A;  2UWX A;  5FQM A;  3MXR A;  1QME A;  3IH9 A;  4UAA A;  2WKE A;  3CIT A;  2ZMV A;  3RXW A;  5EVE A;  4S2O A;  3NOT C;  2XDM A;  2W0N A;  1YPR A;  4DJ2 A;  4EBL A;  1TS0 A;  1CF0 A;  2H5S A;  5E2E A;  2Y2I A;  1DP8 A;  2KLI A;  2WGV A;  3BEC A;  4K0W A;  4CLC D;  1YLW A;  5FSR A;  2EXA A;  1H8Y A;  2UV0 E;  5JYO A;  1MWT A;  4DE1 A;  4HBU A;  4Q8I A;  3UE1 A;  1RP5 A;  1ONH A;  1NZO A;  1ZC2 A;  5CTN A;  3FKW A;  4OOM A;  4R1G A;  2VK3 A;  4NKP A;  2JKT M;  3PHY A;  5FQJ A;  4HNB A;  4E3K A;  3SZT A;  3E2K A;  1KVM A;  4B9O A;  2WZX A;  4GS9 B;  5M19 A;  4X25 A;  4XUZ A;  4A5R A;  1K38 A;  1DP6 A;  4IHQ A;  5MC7 A;  3KSF A;  2CMN A;  2ZQA A;  4LPZ A;  4I3A A;  4EER A;  1LI9 A;  5DFY A;  2J3T D;  2IWB A;  2X01 A;  5TR7 A;  3NC8 A;  2EX2 A;  4C3Q A;  3AGD A;  4U3T A;  3PBS A;  3TOI A;  3CPT A;  3N6I A;  4NXF A;  3JVU A;  3VE4 A;  4WZ4 A;  3ZFZ A;  1JWV A;  2R9X A;  1VEU B;  3BM6 A;  5AJG A;  3LIF A;  2QJ5 A;  4S2N C;  4MBK A;  4QY5 A;  3FZC A;  3EQU A;  1EI5 A;  3GSG A;  3ZYT A;  4K08 A;  3WS1 A;  1P0Z A;  1VB6 A;  3FKV A;  3BFD A;  3U4L P;  3OOV A;  4OOY A;  2V0W A;  3NJA A;  1D1J A;  5EUA A;  5CED A;  4ID4 A;  4HQA A;  3UB6 A;  4X1L A;  1K6R A;  3BFG A;  2W1T B;  1T18 A;  4YWZ A;  2W3E A;  5J3W A;  2J9P A;  2CC1 A;  3PBR A;  5EVI D;  4WMC D;  1A0K A;  1DJB A;  3TG9 A;  2WAD A;  1T1C A;  3N4I A;  3T1S A;  1YLT A;  1XJ3 A;  5CER A;  3UDI A;  1T1A A;  1GCE A;  1PI4 A;  4II7 A;  3UN7 A;  4BEN A;  2V8F A;  3C4O A;  3MFX A;  2KOI A;  1FSW A;  3BFC A;  4U0T A;  1KDS A;  1LL9 A;  4EUZ A;  3IF6 C;  4E6X A;  2Y2N A;  2V9A A;  3OPH A;  3ULF A;  4E3N A;  3M2K A;  4YNR A;  1L0F A;  2WKP A;  1SKF A;  5G4Z A;  4ME4 A;  2ZQ9 A;  3BRM A;  4UA7 A;  4DKI A;  1GHP A;  5FAT A;  2I9V A;  1IYO A;  1YLP A;  1NXY A;  1OTD A;  3VP4 A;  2EA9 A;  1XA1 A;  2Y2K A;  2PRF A;  2ZMA A;  5CTM A;  4R4R A;  4I39 A;  2HDU A;  2QPN A;  3KYQ A;  5GLA A;  1OME A;  1TF1 A;  3M6H A;  1XP4 A;  2WYX A;  4BBT A;  3H7W A;  1YMS A;  4G3V A;  4HH3 A;  4S2N A;  4DDS A;  5CGW A;  5M18 A;  1S4R A;  4CJN A;  3T4S A;  1P97 A;  3RH8 B;  1N9N A;  4UQI M;  2Q9N A;  2OOL A;  3OZH A;  4P6Z S;  1MWR A;  4CLC C;  2VGJ A; 
#chains in the Genus database with same CATH homology
 2GX5 A;  4HP4 A;  3P01 A;  4OOL A;  3KSI A;  5IS1 A;  2IA2 A;  5AVF A;  1XJ2 A;  1WA9 A;  4MN5 A;  4MDZ A;  3FPW A;  3LI8 A;  4HI4 A;  4ETZ A;  2VV7 A;  2JKR I;  1W63 M;  2R78 A;  1V9Y A;  3MR0 A;  3KO6 A;  2MJ6 A;  4HY8 A;  3LID A;  1UWN X;  4Q0H A;  4HJ3 A;  3MQO A;  2V1B A;  4L0L A;  2PR5 A;  1OTA A;  4I3J A;  4M4X A;  1BYW A;  1G6O A;  2D01 A;  3VOL A;  4O01 A;  3F1O B;  1NRJ A;  4XT2 A;  2PYR A;  2W3H A;  4IJG A;  2GNX A;  2NUP C;  4JGR A;  2ZOH A;  1OTB A;  4GS9 A;  1P9W A;  4EES A;  1OJG A;  5L8M A;  3BWL A;  3LIB A;  1IOU A;  2BAS A;  3UE6 A;  5G4Y A;  4DMZ A;  2V1A A;  4Y5F A;  2J3T C;  1OTI A;  3IBJ A;  3CLO A;  5AVE A;  1D06 A;  2OWJ A;  3BQ8 A;  2QYB A;  1XJ6 A;  1W63 Q;  2W1R A;  4KUO A;  4EEU A;  3OLO A;  3IBR A;  4WL9 A;  3LR5 A;  3E98 A;  4AFI A;  3UMD A;  3A0R A;  1GSV A;  3EGD C;  2LB9 A;  1NLZ A;  3K3C A;  4LRX C;  3PXP A;  5FL3 A;  4MN7 A;  3FG8 A;  4EU0 A;  2A24 A;  4Y2F A;  3S7Q A;  2WKQ A;  2M1C A;  4HIA A;  1LSX A;  4G3W A;  3VE3 A;  1XFQ A;  4HJ4 A;  4DJ3 A;  1S4S A;  2GZA A;  3VV4 A;  4BMW A;  2EWW A;  4GJ4 A;  1YSQ A;  1TS6 A;  2HGV A;  2P04 A;  4H6J A;  1EW0 A;  2L4R A;  3D3O A;  3K2N A;  5KSH A;  2QWS A;  3R7W A;  4EW7 A;  3TW8 A;  4XT2 B;  3TJZ C;  3C2W A;  4NXE A;  2VLG A;  3IS2 B;  4HH2 A;  1DP9 A;  2L1M A;  3RFB A;  3NOU C;  4MCW A;  5F5Y A;  3NOP C;  2XRN A;  5HD5 A;  4JGQ A;  3B42 A;  2JKT I;  2PDR A;  2W3D A;  1N9O A;  2YKF A;  2NUT C;  3F1P A;  4BWI A;  4CLC A;  2INW A;  2W1T A;  2O9A A;  1Y28 A;  2XA7 M;  4UQI S;  3F1N B;  3K3D A;  3KYZ A;  2JKR M;  1NWZ A;  5HSQ A;  2EWV A;  4NEE D;  2ZMF A;  2Y8H A;  2FH5 A;  5K5B A;  5DF9 A;  3HCY A;  1D7E A;  2VGL M;  1MKM A;  4ARZ A;  4LRY C;  4GCZ A;  4Q0J A;  4R38 A;  1YAX A;  1F98 A;  4WEJ A;  5KIZ A;  3EQV A;  1H3Q A;  2A24 B;  3D72 A;  2QJ7 A;  5HDC A;  2W3G A;  4F3L A;  3KSG A;  3E0Y A;  2G7U A;  5J4E A;  2OWH A;  4L9G A;  4R70 A;  4WEL A;  5HPI A;  3W2Z A;  3NHQ A;  4Q0I A;  3H9W A;  4LLO B;  3GEC A;  1XJ4 A;  3OCN A;  2HV1 A;  3B47 A;  2VZW A;  3ZQ5 A;  1LL8 A;  3ICY A;  4HP9 A;  3LIC A;  3GDI A;  4NXG A;  3CIT A;  4I5S A;  5F69 A;  2VJW A;  2ZMV A;  4O8G A;  4EUV A;  1STZ A;  3H7W B;  4EEP A;  3NOT C;  3FPV A;  3H82 A;  2W0N A;  3C38 A;  3F1P B;  3LYX A;  4HJ6 A;  4DJ2 A;  1TS0 A;  3MXQ A;  4YOF A;  3PBN A;  2VKS A;  4I38 A;  1S1Z A;  5DKL A;  1OJ5 A;  1DP8 A;  3LR3 A;  1UGU A;  2KLI A;  4BJP A;  2FZ0 A;  4IUH A;  4CLC D;  4HOI A;  3UB9 A;  4GHI A;  4DN0 A;  2VEA A;  5HL6 A;  2W27 A;  1YSP A;  3G6O A;  4PKY A;  1XFN A;  2ZOI A;  1T1B A;  2QKP A;  4WF0 A;  1TS7 A;  3OC2 A;  4RQ9 A;  2WKR A;  3S7O A;  3OBF A;  3T4J A;  2JN7 A;  2QHK A;  3PBT A;  1N9L A;  4OOM A;  4EET B;  4I3I A;  4NKP A;  2JKT M;  3PHY A;  5IT5 A;  3O5Y A;  4HNB A;  1ZTU A;  1MC0 A;  1TS8 A;  4KUK A;  4WN5 A;  2Z6C A;  4BBV A;  1IFQ A;  4MN6 A;  4FOF A;  1DRM A;  1LSV A;  2V0U A;  4B9O A;  2B02 A;  3S7N A;  1S67 L;  2VV6 A;  5HD3 A;  2LB5 A;  4GS9 B;  3JVV A;  2VX8 A;  2J3W A;  3TRC A;  2H28 A;  4QPR A;  2PYP A;  2XA7 S;  5MC7 A;  1DP6 A;  2O9B A;  4IHQ A;  2B18 A;  4IUK A;  4WLA A;  3EEA A;  3KSF A;  1YKD A;  2CMN A;  4WEK A;  4LPZ A;  4I3A A;  4Z1W A;  3V67 A;  5C5K A;  4EER A;  5DFY A;  3S7P A;  2J3T D;  2K7S A;  3F1O A;  1F5M A;  5TBM A;  2K31 A;  3T4L A;  2VGL S;  2OAQ 1;  3MF0 A;  5HZH A;  1T19 A;  3BQA A;  4GHI B;  2HF6 A;  3PBS A;  4PKY G;  3HJK A;  2PT7 A;  3HJI A;  3LR4 A;  2VA0 A;  4L9F A;  4PHT A;  2XRO A;  4NXF A;  3TE8 A;  3JVU A;  3VE4 A;  4KQD A;  4R3A A;  4WUJ A;  3T4O A;  4PAU A;  1OPX A;  5HPF A;  3BY9 A;  3RTY A;  2XSS A;  2L0W A;  3CWF A;  3B33 A;  4JGO A;  3PR6 A;  5AJG A;  3LIF A;  2QJ5 A;  1P9R A;  4O0P A;  2JHE A;  4P6Z M;  3EQU A;  1S66 L;  3ZYT A;  4GLQ A;  4K08 A;  1P0Z A;  1VB6 A;  2PR6 A;  5DJU A;  1GSX A;  4H6J B;  3OOV A;  3LR0 A;  3UB7 A;  2V0W A;  3NJA A;  4FSF A;  3R7W B;  2HJE A;  2KX6 A;  1V9Z A;  5A8B A;  1OT9 A;  4CLC E;  1ODV A;  4HQA A;  3UB6 A;  3CUE A;  1VHM A;  3T4K A;  5HDS A;  3C30 A;  1OTE A;  2J80 A;  5DKK A;  4CLC B;  2W1T B;  1T18 A;  2O0Y A;  2Y79 A;  4YWZ A;  2W3E A;  1OT6 A;  2O9C A;  5J3W A;  3PBR A;  4JGP A;  3EWK A;  3CUE C;  5F6A A;  3U2A A;  3R4K A;  2W3F A;  1F9I A;  3MQ0 A;  5IU1 A;  5TBM B;  3PYP A;  1T1C A;  4LRZ E;  2ZBB A;  3IS2 A;  3A0S A;  2P08 A;  2K2N A;  3FC7 A;  5F68 A;  4ARZ B;  2D02 A;  1XJ3 A;  2P7J A;  2VV8 A;  1T1A A;  1TD5 A;  5J7E A;  2M7V A;  4II7 A;  4KQO A;  4BBU A;  5CX7 A;  2OAP 1;  2KDK A;  3MFX A;  2KOI A;  1G28 A;  5HDD A;  4F3L B;  3P7N A;  3F1N A;  4HHD A;  3MJQ A;  3OCL A;  3EEH A;  2GJ3 A;  3BY8 A;  3CI6 A;  3SW1 A;  2V9A A;  1NLY A;  3ULF A;  3T4T A;  3LI9 A;  3MQQ A;  3E4O A;  1H8M A;  5DFX A;  3EGX C;  5HWW A;  4YNR A;  2PD7 A;  3PBO A;  4EQ1 A;  2M7U A;  2WKP A;  3UE3 A;  5G4Z A;  4ME4 A;  4CQH A;  3KX0 X;  5DJT A;  3MMH A;  3BJN A;  5EFW A;  1S1Y A;  3KSH A;  1ZHH B;  2I9V A;  1LSW A;  3LUQ A;  3H82 B;  1KOU A;  4B93 A;  2YKH A;  1OTD A;  2EA9 A;  1UWP X;  3LIE A;  5LBR A;  3A0V A;  4G3K A;  3E4P A;  4EXO A;  2O99 A;  2Z6D A;  4MMN A;  3DBA A;  2DMW A;  4I39 A;  4NXB A;  3LFV A;  3KYQ A;  1JNU A;  1TF1 A;  4R6L A;  4BBT A;  1GSW A;  3H7W A;  3T50 A;  4ETX A;  3BW6 A;  4G3V A;  1MZU A;  4HH3 A;  1X0O A;  1S4R A;  3EOI A;  2A2L A;  5HWT A;  4GW9 A;  1P97 A;  3T4S A;  3RH8 B;  3T4Q A;  5HWV A;  1N9N A;  3E4Q A;  3PBQ A;  4E04 A;  4UQI M;  3UME A;  5TJJ A;  2PD8 A;  5I5L A;  2HJ9 C;  4UEY A;  2OOL A;  4ZRR A;  3LIA A;  2PHY A;  4P6Z S;  3CAX A;  3UB8 A;  1LT0 A;  4L9E A;  4Y3I A;  4CLC C;  3C8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...