1GSWA

Crystal structure of the p65 crystal form of photoactive yellow protein g51s mutant
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
122
structure length
122
Chain Sequence
VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITSRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Engineering Photocycle Dynamics: Crystal Structures and Kinetics of Three Photoactive Yellow Protein Hinge-Bending Mutants
pubmed doi rcsb
source organism Ectothiorhodospira halophila
total genus 33
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2002-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1gswA00
4MN5A 4HOIA 2M1CA 3MQOA 3LIEA 1DRMA 5F5YA 3NJAA 3RH8B 1TS7A 4WF0A 3MJQA 4HHDA 5G4YA 1JNUA 1D7EA 4HI4A 1T1AA 1V9ZA 2EA9A 4NXBA 1BYWA 2QWSA 2OOLA 4I39A 3ZQ5A 3D72A 4RQ9A 1LSXA 1UWPX 2P7JA 4M4XA 3UMEA 3UMDA 4DJ2A 2ZBBA 1XJ2A 3F1OB 2JN7A 3LYXA 5AVEA 5KIZA 3ICYA 3KX0X 4PKYG 3E4PA 3MXQA 1OT9A 1N9NA 5HDCA 1OT6A 2YKHA 2INWA 2WKQA 4L9GA 5IU1A 4YWZA 1S1YA 4BBVA 4EESA 3LIBA 1DP8A 1NWZA 3NOTC 2V1BA 4GHIA 1UWNX 3C8CA 4R3AA 5HDDA 5HZHA 3LUQA 2KDKA 2QJ5A 1F9IA 1Y28A 4K08A 1T18A 3LIAA 2PHYA 1LL8A 3F1PA 3CLOA 3BY8A 1P97A 3C2WA 2HV1A 4HJ3A 5F6AA 2WKPA 3IS2A 1XFQA 3VE3A 2ZOHA 3P7NA 4BBTA 4R70A 3FC7A 3UB7A 4L9EA 4WN5A 4LRYC 3FG8A 3HJKA 4HP4A 3F1PB 4E04A 4MN6A 3RTYA 1T1BA 2PDRA 3CWFA 3NHQA 3IS2B 4HJ4A 4KUKA 2PD8A 4HQAA 3F1OA 4NXEA 2PR5A 3NOPC 4H6JA 4XT2B 5IS1A 3VOLA 4LRXC 5DKKA 5F68A 1OTDA 3UB9A 1T1CA 4B9OA 4HJ6A 5G4ZA 3UB8A 1V9YA 2JHEA 3H7WA 1WA9A 3E4QA 3PYPA 4WLAA 2K7SA 1XJ4A 3BY9A 3GDIA 4H6JB 2VEAA 4JGPA 2PD7A 1UGUA 2QHKA 3HJIA 4EEPA 3UB6A 2VV6A 4BBUA 4JGQA 5J4EA 5HD3A 2YKFA 3IBRA 2H28A 3BWLA 3H7WB 1GSWA 5HD5A 3LI8A 3F1NA 3LIDA 4LPZA 2CMNA 3VE4A 3MQQA 4DJ3A 4I3AA 2OWHA 3K3CA 2V0WA 3EEHA 1S4RA 4LRZE 2W0NA 1D06A 2V9AA 1OTEA 3B33A 1VB6A 2R78A 2QJ7A 4HY8A 2L1MA 3MFXA 2KX6A 5HWVA 2Z6DA 3ULFA 3F1NB 3G6OA 3H82B 2W27A 2A24A 2VV8A 4R38A 3A0SA 1G28A 4HH2A 4GCZA 4XT2A 5DJTA 5J7EA 4JGRA 3LICA 4HNBA 5HWWA 2J80A 1P0ZA 1OJ5A 4HH3A 4KUOA 4WL9A 2I9VA 3LI9A 4F3LB 2V0UA 4I5SA 1F98A 1OTAA 2OWJA 2L4RA 1LSVA 5DJUA 2D01A 1EW0A 4I3IA 4EEUA 2A24B 2WKRA 1X0OA 2Z6CA 4EW7A 1T19A 1TS0A 3NOUC 4HIAA 4EERA 5AVFA 3CAXA 4NXFA 2QKPA 4GS9B 4NXGA 2B02A 1N9OA 3A0RA 2V1AA 3E4OA 1MZUA 4EXOA 3A0VA 5DKLA 1S4SA 2VLGA 3SW1A 1OJGA 1TS8A 4GW9A 1GSXA 2L0WA 2PYRA 1XJ3A 2VV7A 4PKYA 5J3WA 3GECA 5TBMA 3OLOA 1OTIA 3H9WA 5HDSA 3T50A 3UE6A 1XFNA 2ZOIA 4EETB 1TS6A 1KOUA 1S67L 4HP9A 3H82A 2PR6A 4I3JA 1XJ6A 3K3DA 1S66L 3MR0A 4EQ1A 4L9FA 1N9LA 1LSWA 2PYPA 5TBMB 4R6LA 1OTBA 1S1ZA 2BASA 4I38A 1DP6A 3PHYA 4F3LA 1LT0A 5I5LA 4KQDA 5F69A 3EWKA 1GSVA 4LLOB 4WUJA 5EFWA 5A8BA 3LIFA 5HWTA 4GS9A 2D02A 4GHIB 2GJ3A 1DP9A 5HSQA 1ODVA 4JGOA
chains in the Genus database with same CATH superfamily
2M1CA 3MQOA 2Y2GA 4OLDA 1CK3A 4KZAA 2HPBA 1F2KA 3ZGAB 4PPRA 1JNUA 2G2UA 3QNCA 4YOFA 2EA9A 2Q0OA 2HZ5A 1BTLA 3Q81A 3E98A 3ZYTA 4KQQA 4E3KA 4QY5A 3D72A 4RQ9A 1G6OA 1OMEA 3KYQA 3UMEA 3C5AA 1NRJA 4JXVA 1IFQA 1SCWA 1DY6A 3IHBA 1YAXA 4S2IA 1XXMA 2J7VA 5AVEA 1HD8A 4E3OA 3A3JA 5EVIA 2XLNA 3ICYA 4CLCA 1OT9A 4R3JA 3D4FA 3T4SA 4P6ZM 3V3SA 3C4PA 5FAPA 3T4QA 3A3FA 4Z9QA 3CUEC 2INWA 4CLCE 2HJ9C 5KZHA 2XA7S 3CMZA 4P0MA 3DWZA 5CERA 1K56D 1DJAA 4EESA 3P98A 2W3EA 3OPHA 4KZBA 2Y8HA 3C8CA 3IWOA 4UQIM 3S7OA 2KDKA 5JYPA 1F9IA 5GLAA 3BJNA 3ZVTA 2ZC3B 3TSGA 3MSHA 4PMAA 2PHYA 4LV3A 1KDSA 4JBFA 1TDLA 2H0TA 2BG1A 5A90A 4DE2A 3ZG7B 3WS5A 1TD5A 5TFQA 2HV1A 1W63Q 2WKPA 4NKPA 3IS2A 4QY6A 1XFQA 2ZJ9A 4BD0A 4OOMA 3T4TA 2M7UA 4LGWA 4EUZA 4UA9A 3FC7A 4L9EA 4WN5A 2ZQDA 4QWOA 2G2WA 3FG8A 3PAEA 3N6IA 4HP4A 2WGWA 3IF5A 2J3TC 3IF6A 1K56A 2Q9NA 5GLCA 4N1HA 3A3DA 4ESPA 4IBRA 2ZM0A 4KUKA 4OOLA 2PD8A 4XUZA 3F1OA 3PXPA 4NXEA 4FD8A 2QZ6A 4DDYA 3T4OA 2WZXA 4WEJA 1YKDA 1K54C 2XH9A 3G2ZA 5FI2A 2KLIA 2HGVA 4GN2A 3IX4A 4PM7A 3T1SA 1T1CA 2EXAA 5A93A 1J9MA 3WS0A 3NDGA 3SZTA 4KZ8A 1ONGA 4UA7A 1V9YA 3FKWA 3VP4A 3PYPA 1TVFA 4O01A 3T12B 1Q2PA 4OP8A 5J8XA 3N4IA 4IVKA 1S6RA 3DWKA 1XJ4A 4H6JB 3CPTB 4EV4A 2A2LA 1SKFA 4X69A 5CGSA 3ITBA 4MLLA 1L0FA 1PRQA 5HD3A 3FPVA 4Q0HA 2H28A 5AJGA 1VETB 3H7WB 1ERMA 5GL9A 1BLPA 5FSRA 3LIDA 2X02A 5JYOA 3BRMA 3D9YA 3C7VA 1IKGA 2OLUA 1G5UA 1KGFA 3VFFA 5DTTA 4II7A 1FQGA 2A3UA 3N8SA 1D06A 5DF8A 1Z09A 3HLDA 1K38A 4HY8A 3NECA 3S22A 1CI9A 3HLBA 5CECA 1NZUA 2O0YA 1W8YA 3ULFA 3N8RA 1IOUA 2JKRI 3Q1FA 2P04A 3A0SA 1G28A 4XUXA 4LCLA 3W8KA 4DE0A 4ZRRA 2X71A 2HJEA 4XT2A 5DJTA 3RXWA 5J7EA 3KSGA 5HPFA 4JGRA 5HFOA 5FQJA 2J80A 4GOGA 3HLWA 2NUPC 2Y2MA 2XK1A 5HL6A 3KSFA 3UPOA 1E25A 4F3LB 1NLYA 3Q7VB 3Q07A 3NULA 3AGDA 3UE0A 1K57C 1LSVA 2D01A 4JXSA 5EUAA 2A24B 3UDXA 2WKRA 3TE8A 5FA7A 2Y79A 2XSSA 4EQIA 3DTEA 3VSKA 5K5BA 5MC7A 4OVDA 1TS0A 3GV9A 1CJFA 4O8GA 4X1MA 4NXGA 3OCNA 3CG5A 2I72A 2V1AA 3E4OA 3A0VA 3BW6A 2VLGA 3RFBA 1N4OA 3CUEA 3NY4A 1SKOB 1JTGA 2PBDP 4KG6A 3WS4A 1TS8A 4OQGA 2ZC4B 4ZTKA 2O99A 2QYBA 1E4DA 3EEAA 2R9WA 3PBQA 5EM1A 1OTIA 1ZKJA 3H9WA 3R7WA 2LB9A 1XA1A 4B4ZA 3BM6A 3S1YA 2ZOIA 4PM9A 3T1XA 1YSQA 1KOUA 1S67L 4I3JA 3ZCZA 1G6AA 5EVIC 3VV4A 4CLCC 3WWXA 2Y2JA 4BQMA 4PAUA 2WKIA 3G32A 4DF6A 3OZHA 1NRFA 4RX2A 2ZMFA 2KOIA 4GD8A 3LGOA 3QHYA 3IQAA 3PHYA 2IWBA 3MQ0A 3MFDA 2XROA 1FR6A 3KSIA 5F83A 4EBNA 4MMNA 2HDRA 3QNBA 4EWFA 1XPBA 3HLEA 2JCHA 2EWVA 3JVVA 3IXBA 5F69A 1GSVA 2UWXA 3FPWA 3QP5A 1PWGA 1ES4A 1MPLA 2C5WB 1GA0A 3NBLA 4GS9A 3ITAA 2OLVA 4RA7A 2VKSA 1DJBA 3BLMA 3HBRA 4QU3A 2R9XA 1FILA 2B95A 3A3EA 2XFSA 4MDZA 2EX2A 5I94A 5AQAA 2VK3A 5HAPA 3ISGA 4MN5A 5TR7A 2XR0A 1DRMA 1PI5A 4LCMA 3NJAA 4D60A 1GHPA 2EFXA 2XF3A 3JYIA 2JKTM 4KQOA 5G4YA 2K31A 2HDUA 1D7EA 4GD6A 4HI4A 2PU4A 3IF6C 2ZQ8A 1T1AA 2HF6A 3GR2A 1GHMA 4NXBA 4QPRA 2QWSA 4K0WA 2OOLA 4C6YA 3IWIA 3SS4A 3KYEA 1O07A 3NDEA 2HDQA 3FZCA 4DJ2A 1VM1A 2ZQAA 4S2JA 5DF9A 1LLBA 2ZL1B 1BT5A 1KE3A 5EVLA 3F1OB 3EGXC 1YPRA 3DTKA 4HBUA 3QP2A 3E4PA 5EECA 5HDCA 4Y7PA 4HBTA 1JWVA 3BYDA 4Y0TA 1PIOA 1PWDA 1OT6A 1ZC2A 2G7UA 2B5RA 4L9GA 5IU1A 5GHZA 3HLGA 3IX8A 5EPHA 1S1YA 3OPRA 2ZM8A 1N9BA 2Y2PA 5M1AA 4Y5FA 1JTDA 4BBVA 4WEKA 2HP9A 3LIBA 5F1FA 4DN0A 3P01A 3MZDA 1ESIA 5IT5A 5HDDA 1BUEA 3LEQA 3LUQA 4E3IA 1PZOA 5KSCA 4KZ7A 3W4OA 1YLTA 3C7UA 3NC8A 3V3RA 3BY8A 3C2WA 4JF4A 5KMWA 3CHWP 4KZ9A 3N8LA 4MBHA 2LB5A 2JBFA 2JKFA 2VZWA 1H8MA 2V2FF 1I5QA 2EWWA 4BBTA 3GTCA 3IT9A 2OAP1 3IXGA 3UB7A 3HVFA 3HLFA 4LRYC 4Q0IA 3HJKA 1C3BA 3V67A 2Y2IA 3F1PB 3O88A 3UPNA 2PU2A 3ZG5A 3G2YA 1RGYA 1H0MA 2PDRA 3NHQA 3PBSA 2EXBA 4HQAA 3NIAA 4QJGA 2H5SA 5FEGA 4UQIS 5DFYA 4XT2B 3O87A 4CJNA 3V50A 3OPPA 3SH7A 5FAOA 4LRXC 4NETA 5F68A 4OPQA 1OTDA 4OONA 2C6WB 3UB9A 3MXRA 1LHYA 1E3UD 2JHEA 1WA9A 1YMSA 4WLAA 3LR3A 2O9BA 3OPLA 2ZMAA 5CEDA 2OSUA 4WELA 3BQ8A 4OPYA 5DTKA 2W1TA 1KGGA 1F5MA 2VEAA 2WK0A 4ARZA 1FCOA 2O9CA 4LENA 2PD7A 1UGUA 2Y2LA 1RP5A 2QHKA 3HJIA 2W1RA 3MF0A 3G35A 5FATA 4X25A 3KYZA 2DMWA 5HX9A 4BBUA 4JGQA 5J4EA 4IJGA 2YKFA 4KG5A 2CC1A 4D2OA 4UAAA 5HD5A 4KQRA 3U2AA 3CITA 3I7JA 1IYSA 4DXCA 3CZDA 3QP6A 4I3AA 4BL2A 2V0WA 3EEHA 2DCFA 2W0NA 2V9AA 3KSHA 1QMFA 1Z6FA 4O7DA 5E43A 2R78A 2O9AA 2QJ7A 1YM1A 2VGKA 3PBNA 3R7WB 5GLDA 2Q9MA 1E3UA 3BFFA 3P09A 3JVUA 1ESUA 3VFHA 2Z2LB 3F1NB 1ERQA 2JE5A 2JKGA 2ZQ9A 1PI4A 3MKFA 4YINA 2H0YA 3TRCA 4R1GA 3PBTA 2W3HA 3T4JA 4S2OA 4IUHA 4E3JA 4OOYA 4Y0OA 2I9VA 5FAQA 4I5SA 1F98A 1OTAA 4BWIA 2H10A 4KENB 3L7HA 1L0EA 4EEUA 1XGJA 3GVBA 1X0OA 2Z6CA 2GX5A 4RX3A 3M6HA 5D3OA 1NYMA 3NOUC 4HIAA 4EERA 3GSGA 4JF5A 4NXFA 4NEED 4GS9B 3A0RA 2W3DA 4FH4A 5DVAA 3G31A 3QP8A 3BFGA 4EXOA 1S4SA 4KZ6A 3SW1A 3IXDA 5FEFA 3LEZA 3RJUA 1OJGA 4FTXA 3OOVA 4S2LA 2Y55A 3EOIA 2PYRA 5C5KA 2ZC6B 4WYYA 3GECA 1LI9A 5HPIA 3LY4A 5HDSA 1NJ4A 4JLFA 3DTMA 3MMHA 5GLBA 3EQUA 1TS6A 2X01A 4IEDA 4ZAMA 4BD1A 3H82A 2Y2OA 3VOZA 2Y59A 4JPMA 4FOFA 3UE1A 1HTZA 1S66L 1ES2A 3A3IA 1LSWA 4FCFA 2P9VA 2PYPA 4FH2A 5TBMB 4WZ4A 4E6XA 4OQHA 1FCMA 3OCLA 4BENA 1H3QA 4NG2A 1S0WA 4FSFA 1LT0A 4IHQA 4P87A 1I2SA 4KQDA 2M7VA 3BFDA 3EQVA 5A8BA 2VX8A 5HWTA 4N9KA 2D02A 2GJ3A 2E8JA 1TF1A 4ZBEA 2ZMVA 3HLCA 2Y2HA 2Y2NA 4R0QA 3LCEA 2V1ZA 2EFUA 2OV5A 1PW1A 3LIEA 4X53A 4EU0A 1TS7A 4WF0A 1TDGA 4N92A 5IHVA 4HHDA 3HL9A 3O5YA 4KZ4A 1W8QA 1ZTUA 4C3QA 5E2HA 2FZ0A 4DDSA 1K6SA 1UWPX 4BJPA 2P7JA 4AFIA 4LFUA 4M4XA 1VQQA 4DMZA 3UMDA 2V8CA 2ZBBA 1XJ2A 4WBGA 3LYXA 4ZDXA 3T1QB 4EUVA 5KIZA 3KX0X 3IX3A 4PKYG 3MXQA 4CQHA 4GDBA 3WS1A 5E2GA 2QPNA 4E3MA 1IYOA 2J8YA 4GKUA 3G34A 4EBLA 2WKQA 5AQBA 4YWZA 2HDSA 2WKHA 2FH5A 5FI7A 2VGLM 3Q82A 2WKEA 3MZFA 3DAVA 4GLQA 3T4LA 5EOOA 1NWZA 3GMWA 3NOTC 2V1BA 5EVIB 1VEUA 2W1TB 4X6TA 5EM0A 4CLCB 1MWUA 4OP5A 5HZHA 2QJ5A 2VJWA 4ARZB 3VP1A 4Y17A 1Y28A 4K08A 1T18A 1IYQA 5FQIA 2VA0A 5HAIA 2ZQCA 1LL8A 1FIKA 4E6WA 1K25A 3CLOA 5M18A 4RVAA 4XXRA 1PNEA 3SH9A 1RCJA 4HJ3A 4X68A 1WE4A 5CHMA 3KO6A 3VE3A 2ZOHA 3P7NA 1KE4A 3PBOA 1Y4OA 5EVEA 4K0XA 1MY8A 1XP4A 4ME4A 5DFXA 2XDMA 4E04A 4MN6A 4Z1WA 3RTYA 3L9KA 4MBKA 4X56A 1T1BA 3GQZA 5A91A 2Y2QA 3IS2B 4HJ4A 3OBFA 1SDEA 3D3OA 4DE1A 2ZD8A 1XA7A 3ZG8B 1IYPA 2PR5A 4WMCD 4H6JA 1MWRA 3UY6A 3CPTA 5IS1A 5FQQA 3MKEA 1M40A 1TEMA 3VOLA 5DKKA 1RGZA 5HW3A 3PBRA 1AWIA 3HUMA 4DE3A 4S2PA 2WGWB 5FI6A 4ZJ2A 3IF6B 4HJ6A 2EX6A 5G4ZA 3UB8A 2EX9A 1VETA 4DKIA 3H7WA 3E4QA 3W4PA 1YQSA 2BLSA 1HZOA 2K7SA 1JWPA 2WUQA 4OPZA 3O3VA 4G3VA 3UB6A 1YLWA 3BFEA 1GSWA 2XQZA 4S2KA 4LPZA 3TOIA 4F94A 1P9RA 2CMNA 3VE4A 1PWCA 4DJ3A 4WMCA 2OWHA 4LV0A 1S4RA 4LRZE 2FFFB 4U0TA 3SS3A 3MXSA 1VB6A 1PYYA 2UV0E 2J9PA 2L1MA 2JKTI 3LR4A 3MFXA 1Q2QA 5HWVA 2Z6DA 4X1LA 4OH0A 3G6OA 2K2NA 3H82B 1CF0A 2OAQ1 2A24A 2VV8A 3BECA 1W7FA 5KSHA 2Y91A 3ZHHA 3G30A 4P6ZS 1BLHA 4GDNA 3M6BA 1K4EA 2P9VB 5HL1A 5CHUA 4HNBA 3LFVA 4JKTA 3BFCA 5HWWA 1OJ5A 1P0ZA 2HP5A 4IBXA 4N9LA 3DTIA 3LY3A 2VGJA 4KUOA 3WS2A 4WL9A 1GHIA 3Q7ZA 3T1RA 1K6RA 1O7EA 2OWJA 5DJUA 3C4OA 1H8YA 4R23A 1EW0A 4R3BA 3E2LA 4I3IA 1K0KA 1SKOA 1PFLA 4R4RA 4MNRA 1GCEA 3QP1A 3VSLA 3O86A 4KZ5A 4EW7A 2GNXA 1T19A 2ZQ7A 5A92A 4FUWA 2DRWA 1KVMA 1EROA 1OPXA 4HEFA 5AVFA 2QKPA 2B02A 5FQ9A 1JVJA 1HVBA 4UEYA 2IA2A 5DF7A 1FSYA 2XD1A 3WRTA 1W63M 3RXXA 1GSXA 2XGNA 1XJ3A 3ZNTA 2GDNA 2VV7A 4PKYA 5J3WA 4MBFA 3V39A 4ZJ3A 1K55A 3E2KA 3OLOA 3VP2A 2ACGA 1LL5A 3SH8A 4LV1A 3DW0A 3HUNA 3SS5A 1CEFA 1MXOA 2W3GA 2PR6A 3PAGA 5L8MA 4P85A 3K3DA 3M2KA 3MR0A 3G4PA 4EQ1A 1N9LA 3TJZC 1D1JA 4R6LA 1QMEA 3TG9A 3OC2A 1PW8A 4Y13A 5HAQA 2ZC7A 3IXHA 2P74A 2PT7A 1YSPA 5CHJA 1FR1A 5I5LA 1NXYA 2A49A 4YFMA 5DTSA 3AGFA 3EWKA 4P6BA 4LLOB 4BMWA 4KG2A 5EFWA 1K4FA 3MZEA 4Y3IA 2B18A 3LIFA 3LR5A 4S2NA 4ETXA 3NCKA 1I2WA 1NYYA 1VEUB 1FOFA 1CI8A 3QP4A 1DP9A 1SZVA 3WRZA 5L2FA 1XGIA 1JWZA 1YLPA 5FQKA 5TJJA 4JGOA 4HOIA 1P9WA 1EI5A 2XA7M 5E2EA 5F5YA 3HUOA 3RH8B 1XKZA 2ZL1A 1WYCA 1HLUP 5L07A 3MJQA 1ACFA 4RYEA 3ZNYA 1BULA 4Y2FA 4E3NA 1V9ZA 4K91A 3BEBA 2P08A 1ES3A 1BYWA 4I39A 2JKRM 5AQ7A 3ZQ5A 5M19A 1KE0A 1LSXA 3VP3A 4CPKA 3HREA 2RCXA 3U4LP 5G18A 2J9OA 4Q8IA 4B4XA 1G68A 2JN7A 1SDNA 3ZG9B 5FASA 1N9NA 1M6KA 2YKHA 3V5MA 3W4QA 2V20A 4GB7A 2PBYA 4GNUA 4Y15A 4MEZA 2V8FA 3C30A 4OKPA 1CQAA 1DP8A 2QMIA 2PAVP 5AQ9A 1YLZA 4GHIA 1EWZA 1UWNX 2ZM2A 2E8IA 4GJ4A 4R3AA 4WZ5A 3UO9A 3LIAA 2Y4AA 4R4SA 3PR6A 1J3WA 2WAFA 3F1PA 1KDWA 1P97A 3MBZA 1PZPA 5F6AA 2BTFP 4Y0UA 4OLGA 1NY0A 3S7QA 1YMXA 2WYXA 4MCWA 3CI6A 4B88A 3HCYA 1STZA 4R70A 2DNSA 4BLMA 3K2NA 3EGDC 4S2MA 2NUTC 4DXBA 2PRFA 2RL3A 2VGLS 5L10A 5FQMA 3FWLA 3UE3A 2WGIA 5CTMA 4C75A 3CWFA 4HESA 3B42A 4A5RA 4L0LA 4PHTA 1Y54A 1A0KA 3NOPC 3BQAA 1FSWA 2WZZA 5CTNA 4U3TA 4PM5A 1W79A 3ZDJA 3ZVWA 3NI9A 1BLCA 1MC0A 4B9OA 4E3LA 1GA9A 1W5DA 3UB5P 2XD5A 3ZG0A 1ONHA 4Q0JA 1SHVA 3LR0A 3W2ZA 2J3WA 1H5XA 3UPPA 3VP0A 3BY9A 3GDIA 2J3TD 4U0XA 4JGPA 5E2FA 2FFYA 4EEPA 4UHUA 4YNRA 2VV6A 4IVIA 5L09A 3IBRA 1ZHHB 3BWLA 3GRJA 5HARA 3IH9A 3LI8A 5FL3A 3F1NA 3FKVA 3S7NA 1MKMA 3FV7A 3C38A 5EOEA 1K55C 3MQQA 1CEGA 1ES5A 3AGEA 1YLYA 1IEMA 4JXWA 4WM9A 5GHXA 3K3CA 3LO7A 4QB8A 5F1GA 1OTEA 3B33A 4ETZA 1FCNA 2XFTA 4X55A 1DJCA 1LL9A 3CJMA 3R4KA 3SOIA 4GZBA 2KX6A 3ZFZA 3UNWA 5GHYA 4ZJ1A 2W27A 4R38A 1MKIA 4HH2A 3S7PA 4GCZA 5U47A 1LI0A 2MJ6A 3LICA 1MWSA 1BSGA 4BL3A 4HH3A 4JF6A 1NZOA 4QD4A 1NLZA 3LI9A 2V0UA 2Y2KA 5CEBA 2GZAA 3IBJA 2AVXA 1K54A 2L4RA 2ZLYA 4EBPA 4H8RA 4S2NC 5F82A 1MWTA 5CGXA 5CGWA 3N7WA 1U60A 3PTEA 5EV0A 3CAXA 3DBAA 1MBLA 1N9OA 1YT4A 4MN7A 3T4KA 1IELA 1MZUA 5DKLA 2WGVA 5TGFA 4QHCA 2Z2MB 1ALQA 2ZC5B 2W3FA 4OQIA 5CX7A 4GW9A 5CXWA 2L0WA 4NK3A 1H8ZA 2EX8A 3E0YA 3JPUA 5TBMA 2HP6A 5FDHA 1KVLA 3M2JA 3UDIA 3IH8A 3T50A 3UE6A 3MS6A 3VMAA 1XFNA 3IHAA 4EETB 4O0PA 5LBRA 1KGEA 1ZG4A 4HP9A 3IWQA 5EE8A 3S4XA 4PM8A 1XX2A 2IWDA 1AXBA 1XJ6A 1L0GA 2JC7A 4L9FA 4IUKA 4UA6A 2WADA 4OQ0A 1OTBA 1YLJA 4I38A 1S1ZA 2BASA 2XEPA 1L2SA 1DP6A 4F3LA 4LV2A 4JXGA 1VHMA 3Q7VA 4PM6A 1IKIA 3B3XA 1L0DA 3TW8A 4G3WA 3BLSA 1L3LA 1BZAA 4WZ5C 2WAEA 4WUJA 4OPRA 1K57A 3VOYA 1BLSA 1ZG6A 3B47A 4KZ3A 2XRNA 4GHIB 4DRTA 5BOHA 4B93A 4G3KA 5EVID 5FDSA 3FYZA 4M3KA 4CLCD 5CRFA 4ID4A 5HSQA 1WYBA 2IWCA 3UDFA 3UN7A 4N1XA 1ODVA
chains in the Genus database with same CATH topology
4MN5A 4HOIA 2M1CA 3MQOA 1P9WA 3LIEA 2XA7M 1DRMA 5F5YA 3NJAA 3RH8B 4EU0A 1TS7A 4WF0A 3MJQA 4HHDA 2JKTM 4KQOA 5G4YA 3O5YA 1JNUA 2K31A 1ZTUA 4Y2FA 1D7EA 4HI4A 1T1AA 1V9ZA 4YOFA 2FZ0A 2HF6A 2EA9A 4NXBA 4QPRA 2P08A 1BYWA 2QWSA 3E98A 3ZYTA 2OOLA 4I39A 2JKRM 3ZQ5A 3D72A 4RQ9A 1LSXA 1G6OA 1UWPX 4BJPA 2P7JA 4AFIA 3KYQA 4M4XA 3UMEA 4DMZA 1NRJA 3UMDA 1IFQA 4DJ2A 5DF9A 2ZBBA 1YAXA 1XJ2A 3F1OB 2JN7A 3LYXA 5AVEA 3EGXC 4EUVA 5KIZA 3ICYA 3KX0X 4CLCA 4PKYG 3E4PA 3MXQA 1OT9A 4CQHA 1N9NA 5HDCA 3T4SA 4P6ZM 3T4QA 1OT6A 2YKHA 3CUEC 2INWA 2G7UA 2WKQA 4L9GA 5IU1A 4YWZA 4CLCE 2FH5A 2HJ9C 1S1YA 2XA7S 2VGLM 4Y5FA 4BBVA 4WEKA 4EESA 4GLQA 3LIBA 3C30A 3T4LA 2W3EA 1DP8A 1NWZA 4DN0A 2Y8HA 3NOTC 3P01A 2V1BA 4GHIA 1UWNX 2W1TB 5IT5A 3C8CA 4GJ4A 4R3AA 5HDDA 4CLCB 5HZHA 4UQIM 3LUQA 2KDKA 2QJ5A 2VJWA 3S7OA 1F9IA 4ARZB 3BJNA 1Y28A 4K08A 1T18A 3LIAA 2VA0A 2PHYA 3PR6A 1LL8A 3F1PA 3CLOA 1TD5A 3BY8A 1P97A 3C2WA 2HV1A 1W63Q 4HJ3A 2LB5A 5F6AA 2WKPA 4NKPA 3IS2A 1XFQA 3KO6A 4OOMA 3T4TA 3VE3A 2VZWA 1H8MA 2ZOHA 3S7QA 2M7UA 3P7NA 2EWWA 4BBTA 4MCWA 3CI6A 3HCYA 1STZA 2OAP1 4R70A 3PBOA 3FC7A 3UB7A 4L9EA 4WN5A 4LRYC 3FG8A 4Q0IA 3HJKA 4ME4A 5DFXA 3K2NA 3EGDC 2NUTC 4HP4A 3V67A 3F1PB 4E04A 4MN6A 2VGLS 2J3TC 4Z1WA 3RTYA 1T1BA 3UE3A 2PDRA 3CWFA 3NHQA 3IS2B 4OOLA 4HJ4A 4KUKA 3PBSA 3B42A 3OBFA 2PD8A 3D3OA 4HQAA 3F1OA 3PXPA 4L0LA 4NXEA 4PHTA 4UQIS 5DFYA 2PR5A 3NOPC 4H6JA 3BQAA 4XT2B 5IS1A 3T4OA 4WEJA 3VOLA 1YKDA 4LRXC 5DKKA 5F68A 1OTDA 2KLIA 2HGVA 3PBRA 3UB9A 1MC0A 1T1CA 4B9OA 4HJ6A 5G4ZA 3UB8A 1V9YA 2JHEA 3H7WA 1WA9A 3E4QA 4Q0JA 3PYPA 4O01A 3LR0A 3W2ZA 4WLAA 2J3WA 3LR3A 2O9BA 4WELA 3BQ8A 2K7SA 2W1TA 1XJ4A 3BY9A 3GDIA 4H6JB 1F5MA 2J3TD 2A2LA 2VEAA 4ARZA 4JGPA 2O9CA 2PD7A 1UGUA 2QHKA 3HJIA 2W1RA 3MF0A 3KYZA 4EEPA 2DMWA 4YNRA 4G3VA 3UB6A 2VV6A 4BBUA 4JGQA 5J4EA 5HD3A 4IJGA 2YKFA 3IBRA 3FPVA 4Q0HA 2H28A 1ZHHB 3BWLA 5AJGA 3H7WB 1GSWA 5HD5A 3LI8A 5FL3A 3F1NA 3LIDA 4LPZA 3S7NA 1MKMA 3U2AA 3C38A 1P9RA 3CITA 2CMNA 3VE4A 3MQQA 4DJ3A 4I3AA 2OWHA 3K3CA 4II7A 2V0WA 3EEHA 1S4RA 4LRZE 2W0NA 1D06A 2V9AA 1OTEA 3B33A 3KSHA 1VB6A 4ETZA 2R78A 2O9AA 2QJ7A 4HY8A 2L1MA 3PBNA 2JKTI 3LR4A 3R7WB 3MFXA 3R4KA 3JVUA 2KX6A 5HWVA 2Z6DA 2O0YA 3ULFA 3F1NB 3G6OA 1IOUA 2K2NA 3H82B 2OAQ1 2W27A 2A24A 2VV8A 2JKRI 4R38A 2P04A 3A0SA 1G28A 4HH2A 4GCZA 3S7PA 5KSHA 4ZRRA 2HJEA 4XT2A 4P6ZS 5DJTA 3TRCA 5J7EA 2MJ6A 3KSGA 5HPFA 4JGRA 3LICA 3LFVA 4HNBA 5HWWA 2J80A 2W3HA 3PBTA 1P0ZA 1OJ5A 3T4JA 2NUPC 4IUHA 4HH3A 4KUOA 4WL9A 5HL6A 3KSFA 1NLZA 2I9VA 3LI9A 4F3LB 1NLYA 2V0UA 4I5SA 1F98A 1OTAA 4BWIA 2GZAA 3IBJA 2OWJA 2L4RA 1LSVA 5DJUA 2D01A 1EW0A 4I3IA 4EEUA 2A24B 2WKRA 3TE8A 1X0OA 2Y79A 2XSSA 2Z6CA 4EW7A 2GNXA 1T19A 2GX5A 5K5BA 5MC7A 1OPXA 1TS0A 3NOUC 4HIAA 4EERA 5AVFA 3CAXA 4NXFA 4O8GA 2QKPA 3DBAA 4NEED 4GS9B 4NXGA 2B02A 1N9OA 3A0RA 2W3DA 3OCNA 4MN7A 3T4KA 4UEYA 2IA2A 2V1AA 3E4OA 1MZUA 4EXOA 3A0VA 3BW6A 5DKLA 1S4SA 2VLGA 3SW1A 3RFBA 3CUEA 1OJGA 1W63M 3OOVA 2W3FA 1TS8A 5CX7A 4GW9A 1GSXA 2L0WA 3EOIA 2PYRA 1XJ3A 2O99A 3E0YA 5C5KA 2QYBA 2VV7A 4PKYA 5J3WA 3GECA 5TBMA 5HPIA 3EEAA 3OLOA 3PBQA 1OTIA 3H9WA 5HDSA 3T50A 3R7WA 2LB9A 3UE6A 3MMHA 1XFNA 2ZOIA 4EETB 3EQUA 4O0PA 1TS6A 5LBRA 1YSQA 1KOUA 1S67L 4HP9A 3H82A 2W3GA 2PR6A 5L8MA 4I3JA 4FOFA 1XJ6A 3K3DA 1S66L 3MR0A 3VV4A 4CLCC 4EQ1A 4L9FA 1N9LA 1LSWA 4IUKA 2PYPA 3TJZC 4PAUA 5TBMB 4R6LA 1OTBA 2ZMFA 1S1ZA 2BASA 2KOIA 4I38A 3OCLA 1DP6A 3PHYA 4F3LA 1VHMA 1H3QA 3OC2A 3MQ0A 4FSFA 2XROA 1LT0A 3KSIA 2PT7A 4IHQA 1YSPA 5I5LA 4MMNA 3TW8A 4G3WA 2EWVA 3JVVA 4KQDA 5F69A 3EWKA 2M7VA 1GSVA 4LLOB 4WUJA 4BMWA 3EQVA 5EFWA 3FPWA 4Y3IA 5A8BA 2B18A 3LIFA 2VX8A 3LR5A 5HWTA 4GS9A 4ETXA 3B47A 2XRNA 2D02A 4GHIB 2GJ3A 2VKSA 4B93A 1TF1A 4G3KA 4CLCD 2ZMVA 1DP9A 5HSQA 4MDZA 1ODVA 5TJJA 4JGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MN5 A;  4HOI A;  2M1C A;  3MQO A;  3LIE A;  1DRM A;  5F5Y A;  3NJA A;  3RH8 B;  1TS7 A;  4WF0 A;  3MJQ A;  4HHD A;  5G4Y A;  1JNU A;  1D7E A;  4HI4 A;  1T1A A;  1V9Z A;  2EA9 A;  4NXB A;  1BYW A;  2QWS A;  2OOL A;  4I39 A;  3ZQ5 A;  3D72 A;  4RQ9 A;  1LSX A;  1UWP X;  2P7J A;  4M4X A;  3UME A;  3UMD A;  4DJ2 A;  2ZBB A;  1XJ2 A;  3F1O B;  2JN7 A;  3LYX A;  5AVE A;  5KIZ A;  3ICY A;  3KX0 X;  4PKY G;  3E4P A;  3MXQ A;  1OT9 A;  1N9N A;  5HDC A;  1OT6 A;  2YKH A;  2INW A;  2WKQ A;  4L9G A;  5IU1 A;  4YWZ A;  1S1Y A;  4BBV A;  4EES A;  3LIB A;  1DP8 A;  1NWZ A;  3NOT C;  2V1B A;  4GHI A;  1UWN X;  3C8C A;  4R3A A;  5HDD A;  5HZH A;  3LUQ A;  2KDK A;  2QJ5 A;  1F9I A;  1Y28 A;  4K08 A;  1T18 A;  3LIA A;  2PHY A;  1LL8 A;  3F1P A;  3CLO A;  3BY8 A;  1P97 A;  3C2W A;  2HV1 A;  4HJ3 A;  5F6A A;  2WKP A;  3IS2 A;  1XFQ A;  3VE3 A;  2ZOH A;  3P7N A;  4BBT A;  4R70 A;  3FC7 A;  3UB7 A;  4L9E A;  4WN5 A;  4LRY C;  3FG8 A;  3HJK A;  4HP4 A;  3F1P B;  4E04 A;  4MN6 A;  3RTY A;  1T1B A;  2PDR A;  3CWF A;  3NHQ A;  3IS2 B;  4HJ4 A;  4KUK A;  2PD8 A;  4HQA A;  3F1O A;  4NXE A;  2PR5 A;  3NOP C;  4H6J A;  4XT2 B;  5IS1 A;  3VOL A;  4LRX C;  5DKK A;  5F68 A;  1OTD A;  3UB9 A;  1T1C A;  4B9O A;  4HJ6 A;  5G4Z A;  3UB8 A;  1V9Y A;  2JHE A;  3H7W A;  1WA9 A;  3E4Q A;  3PYP A;  4WLA A;  2K7S A;  1XJ4 A;  3BY9 A;  3GDI A;  4H6J B;  2VEA A;  4JGP A;  2PD7 A;  1UGU A;  2QHK A;  3HJI A;  4EEP A;  3UB6 A;  2VV6 A;  4BBU A;  4JGQ A;  5J4E A;  5HD3 A;  2YKF A;  3IBR A;  2H28 A;  3BWL A;  3H7W B;  1GSW A;  5HD5 A;  3LI8 A;  3F1N A;  3LID A;  4LPZ A;  2CMN A;  3VE4 A;  3MQQ A;  4DJ3 A;  4I3A A;  2OWH A;  3K3C A;  2V0W A;  3EEH A;  1S4R A;  4LRZ E;  2W0N A;  1D06 A;  2V9A A;  1OTE A;  3B33 A;  1VB6 A;  2R78 A;  2QJ7 A;  4HY8 A;  2L1M A;  3MFX A;  2KX6 A;  5HWV A;  2Z6D A;  3ULF A;  3F1N B;  3G6O A;  3H82 B;  2W27 A;  2A24 A;  2VV8 A;  4R38 A;  3A0S A;  1G28 A;  4HH2 A;  4GCZ A;  4XT2 A;  5DJT A;  5J7E A;  4JGR A;  3LIC A;  4HNB A;  5HWW A;  2J80 A;  1P0Z A;  1OJ5 A;  4HH3 A;  4KUO A;  4WL9 A;  2I9V A;  3LI9 A;  4F3L B;  2V0U A;  4I5S A;  1F98 A;  1OTA A;  2OWJ A;  2L4R A;  1LSV A;  5DJU A;  2D01 A;  1EW0 A;  4I3I A;  4EEU A;  2A24 B;  2WKR A;  1X0O A;  2Z6C A;  4EW7 A;  1T19 A;  1TS0 A;  3NOU C;  4HIA A;  4EER A;  5AVF A;  3CAX A;  4NXF A;  2QKP A;  4GS9 B;  4NXG A;  2B02 A;  1N9O A;  3A0R A;  2V1A A;  3E4O A;  1MZU A;  4EXO A;  3A0V A;  5DKL A;  1S4S A;  2VLG A;  3SW1 A;  1OJG A;  1TS8 A;  4GW9 A;  1GSX A;  2L0W A;  2PYR A;  1XJ3 A;  2VV7 A;  4PKY A;  5J3W A;  3GEC A;  5TBM A;  3OLO A;  1OTI A;  3H9W A;  5HDS A;  3T50 A;  3UE6 A;  1XFN A;  2ZOI A;  4EET B;  1TS6 A;  1KOU A;  1S67 L;  4HP9 A;  3H82 A;  2PR6 A;  4I3J A;  1XJ6 A;  3K3D A;  1S66 L;  3MR0 A;  4EQ1 A;  4L9F A;  1N9L A;  1LSW A;  2PYP A;  5TBM B;  4R6L A;  1OTB A;  1S1Z A;  2BAS A;  4I38 A;  1DP6 A;  3PHY A;  4F3L A;  1LT0 A;  5I5L A;  4KQD A;  5F69 A;  3EWK A;  1GSV A;  4LLO B;  4WUJ A;  5EFW A;  5A8B A;  3LIF A;  5HWT A;  4GS9 A;  2D02 A;  4GHI B;  2GJ3 A;  1DP9 A;  5HSQ A;  1ODV A;  4JGO A; 
#chains in the Genus database with same CATH topology
 2M1C A;  3MQO A;  2Y2G A;  4OLD A;  1CK3 A;  4KZA A;  2HPB A;  1F2K A;  3ZGA B;  4PPR A;  1JNU A;  2G2U A;  3QNC A;  4YOF A;  2EA9 A;  2Q0O A;  2HZ5 A;  1BTL A;  3Q81 A;  3E98 A;  3ZYT A;  4KQQ A;  4E3K A;  4QY5 A;  3D72 A;  4RQ9 A;  1G6O A;  1OME A;  3KYQ A;  3UME A;  3C5A A;  1NRJ A;  4JXV A;  1IFQ A;  1SCW A;  1DY6 A;  3IHB A;  1YAX A;  4S2I A;  1XXM A;  2J7V A;  5AVE A;  1HD8 A;  4E3O A;  3A3J A;  5EVI A;  2XLN A;  3ICY A;  4CLC A;  1OT9 A;  4R3J A;  3D4F A;  3T4S A;  4P6Z M;  3V3S A;  3C4P A;  5FAP A;  3T4Q A;  3A3F A;  4Z9Q A;  3CUE C;  2INW A;  4CLC E;  2HJ9 C;  5KZH A;  2XA7 S;  3CMZ A;  4P0M A;  3DWZ A;  5CER A;  1K56 D;  1DJA A;  4EES A;  3P98 A;  2W3E A;  3OPH A;  4KZB A;  2Y8H A;  3C8C A;  3IWO A;  4UQI M;  3S7O A;  2KDK A;  5JYP A;  1F9I A;  5GLA A;  3BJN A;  3ZVT A;  2ZC3 B;  3TSG A;  3MSH A;  4PMA A;  2PHY A;  4LV3 A;  1KDS A;  4JBF A;  1TDL A;  2H0T A;  2BG1 A;  5A90 A;  4DE2 A;  3ZG7 B;  3WS5 A;  1TD5 A;  5TFQ A;  2HV1 A;  1W63 Q;  2WKP A;  4NKP A;  3IS2 A;  4QY6 A;  1XFQ A;  2ZJ9 A;  4BD0 A;  4OOM A;  3T4T A;  2M7U A;  4LGW A;  4EUZ A;  4UA9 A;  3FC7 A;  4L9E A;  4WN5 A;  2ZQD A;  4QWO A;  2G2W A;  3FG8 A;  3PAE A;  3N6I A;  4HP4 A;  2WGW A;  3IF5 A;  2J3T C;  3IF6 A;  1K56 A;  2Q9N A;  5GLC A;  4N1H A;  3A3D A;  4ESP A;  4IBR A;  2ZM0 A;  4KUK A;  4OOL A;  2PD8 A;  4XUZ A;  3F1O A;  3PXP A;  4NXE A;  4FD8 A;  2QZ6 A;  4DDY A;  3T4O A;  2WZX A;  4WEJ A;  1YKD A;  1K54 C;  2XH9 A;  3G2Z A;  5FI2 A;  2KLI A;  2HGV A;  4GN2 A;  3IX4 A;  4PM7 A;  3T1S A;  1T1C A;  2EXA A;  5A93 A;  1J9M A;  3WS0 A;  3NDG A;  3SZT A;  4KZ8 A;  1ONG A;  4UA7 A;  1V9Y A;  3FKW A;  3VP4 A;  3PYP A;  1TVF A;  4O01 A;  3T12 B;  1Q2P A;  4OP8 A;  5J8X A;  3N4I A;  4IVK A;  1S6R A;  3DWK A;  1XJ4 A;  4H6J B;  3CPT B;  4EV4 A;  2A2L A;  1SKF A;  4X69 A;  5CGS A;  3ITB A;  4MLL A;  1L0F A;  1PRQ A;  5HD3 A;  3FPV A;  4Q0H A;  2H28 A;  5AJG A;  1VET B;  3H7W B;  1ERM A;  5GL9 A;  1BLP A;  5FSR A;  3LID A;  2X02 A;  5JYO A;  3BRM A;  3D9Y A;  3C7V A;  1IKG A;  2OLU A;  1G5U A;  1KGF A;  3VFF A;  5DTT A;  4II7 A;  1FQG A;  2A3U A;  3N8S A;  1D06 A;  5DF8 A;  1Z09 A;  3HLD A;  1K38 A;  4HY8 A;  3NEC A;  3S22 A;  1CI9 A;  3HLB A;  5CEC A;  1NZU A;  2O0Y A;  1W8Y A;  3ULF A;  3N8R A;  1IOU A;  2JKR I;  3Q1F A;  2P04 A;  3A0S A;  1G28 A;  4XUX A;  4LCL A;  3W8K A;  4DE0 A;  4ZRR A;  2X71 A;  2HJE A;  4XT2 A;  5DJT A;  3RXW A;  5J7E A;  3KSG A;  5HPF A;  4JGR A;  5HFO A;  5FQJ A;  2J80 A;  4GOG A;  3HLW A;  2NUP C;  2Y2M A;  2XK1 A;  5HL6 A;  3KSF A;  3UPO A;  1E25 A;  4F3L B;  1NLY A;  3Q7V B;  3Q07 A;  3NUL A;  3AGD A;  3UE0 A;  1K57 C;  1LSV A;  2D01 A;  4JXS A;  5EUA A;  2A24 B;  3UDX A;  2WKR A;  3TE8 A;  5FA7 A;  2Y79 A;  2XSS A;  4EQI A;  3DTE A;  3VSK A;  5K5B A;  5MC7 A;  4OVD A;  1TS0 A;  3GV9 A;  1CJF A;  4O8G A;  4X1M A;  4NXG A;  3OCN A;  3CG5 A;  2I72 A;  2V1A A;  3E4O A;  3A0V A;  3BW6 A;  2VLG A;  3RFB A;  1N4O A;  3CUE A;  3NY4 A;  1SKO B;  1JTG A;  2PBD P;  4KG6 A;  3WS4 A;  1TS8 A;  4OQG A;  2ZC4 B;  4ZTK A;  2O99 A;  2QYB A;  1E4D A;  3EEA A;  2R9W A;  3PBQ A;  5EM1 A;  1OTI A;  1ZKJ A;  3H9W A;  3R7W A;  2LB9 A;  1XA1 A;  4B4Z A;  3BM6 A;  3S1Y A;  2ZOI A;  4PM9 A;  3T1X A;  1YSQ A;  1KOU A;  1S67 L;  4I3J A;  3ZCZ A;  1G6A A;  5EVI C;  3VV4 A;  4CLC C;  3WWX A;  2Y2J A;  4BQM A;  4PAU A;  2WKI A;  3G32 A;  4DF6 A;  3OZH A;  1NRF A;  4RX2 A;  2ZMF A;  2KOI A;  4GD8 A;  3LGO A;  3QHY A;  3IQA A;  3PHY A;  2IWB A;  3MQ0 A;  3MFD A;  2XRO A;  1FR6 A;  3KSI A;  5F83 A;  4EBN A;  4MMN A;  2HDR A;  3QNB A;  4EWF A;  1XPB A;  3HLE A;  2JCH A;  2EWV A;  3JVV A;  3IXB A;  5F69 A;  1GSV A;  2UWX A;  3FPW A;  3QP5 A;  1PWG A;  1ES4 A;  1MPL A;  2C5W B;  1GA0 A;  3NBL A;  4GS9 A;  3ITA A;  2OLV A;  4RA7 A;  2VKS A;  1DJB A;  3BLM A;  3HBR A;  4QU3 A;  2R9X A;  1FIL A;  2B95 A;  3A3E A;  2XFS A;  4MDZ A;  2EX2 A;  5I94 A;  5AQA A;  2VK3 A;  5HAP A;  3ISG A;  4MN5 A;  5TR7 A;  2XR0 A;  1DRM A;  1PI5 A;  4LCM A;  3NJA A;  4D60 A;  1GHP A;  2EFX A;  2XF3 A;  3JYI A;  2JKT M;  4KQO A;  5G4Y A;  2K31 A;  2HDU A;  1D7E A;  4GD6 A;  4HI4 A;  2PU4 A;  3IF6 C;  2ZQ8 A;  1T1A A;  2HF6 A;  3GR2 A;  1GHM A;  4NXB A;  4QPR A;  2QWS A;  4K0W A;  2OOL A;  4C6Y A;  3IWI A;  3SS4 A;  3KYE A;  1O07 A;  3NDE A;  2HDQ A;  3FZC A;  4DJ2 A;  1VM1 A;  2ZQA A;  4S2J A;  5DF9 A;  1LLB A;  2ZL1 B;  1BT5 A;  1KE3 A;  5EVL A;  3F1O B;  3EGX C;  1YPR A;  3DTK A;  4HBU A;  3QP2 A;  3E4P A;  5EEC A;  5HDC A;  4Y7P A;  4HBT A;  1JWV A;  3BYD A;  4Y0T A;  1PIO A;  1PWD A;  1OT6 A;  1ZC2 A;  2G7U A;  2B5R A;  4L9G A;  5IU1 A;  5GHZ A;  3HLG A;  3IX8 A;  5EPH A;  1S1Y A;  3OPR A;  2ZM8 A;  1N9B A;  2Y2P A;  5M1A A;  4Y5F A;  1JTD A;  4BBV A;  4WEK A;  2HP9 A;  3LIB A;  5F1F A;  4DN0 A;  3P01 A;  3MZD A;  1ESI A;  5IT5 A;  5HDD A;  1BUE A;  3LEQ A;  3LUQ A;  4E3I A;  1PZO A;  5KSC A;  4KZ7 A;  3W4O A;  1YLT A;  3C7U A;  3NC8 A;  3V3R A;  3BY8 A;  3C2W A;  4JF4 A;  5KMW A;  3CHW P;  4KZ9 A;  3N8L A;  4MBH A;  2LB5 A;  2JBF A;  2JKF A;  2VZW A;  1H8M A;  2V2F F;  1I5Q A;  2EWW A;  4BBT A;  3GTC A;  3IT9 A;  2OAP 1;  3IXG A;  3UB7 A;  3HVF A;  3HLF A;  4LRY C;  4Q0I A;  3HJK A;  1C3B A;  3V67 A;  2Y2I A;  3F1P B;  3O88 A;  3UPN A;  2PU2 A;  3ZG5 A;  3G2Y A;  1RGY A;  1H0M A;  2PDR A;  3NHQ A;  3PBS A;  2EXB A;  4HQA A;  3NIA A;  4QJG A;  2H5S A;  5FEG A;  4UQI S;  5DFY A;  4XT2 B;  3O87 A;  4CJN A;  3V50 A;  3OPP A;  3SH7 A;  5FAO A;  4LRX C;  4NET A;  5F68 A;  4OPQ A;  1OTD A;  4OON A;  2C6W B;  3UB9 A;  3MXR A;  1LHY A;  1E3U D;  2JHE A;  1WA9 A;  1YMS A;  4WLA A;  3LR3 A;  2O9B A;  3OPL A;  2ZMA A;  5CED A;  2OSU A;  4WEL A;  3BQ8 A;  4OPY A;  5DTK A;  2W1T A;  1KGG A;  1F5M A;  2VEA A;  2WK0 A;  4ARZ A;  1FCO A;  2O9C A;  4LEN A;  2PD7 A;  1UGU A;  2Y2L A;  1RP5 A;  2QHK A;  3HJI A;  2W1R A;  3MF0 A;  3G35 A;  5FAT A;  4X25 A;  3KYZ A;  2DMW A;  5HX9 A;  4BBU A;  4JGQ A;  5J4E A;  4IJG A;  2YKF A;  4KG5 A;  2CC1 A;  4D2O A;  4UAA A;  5HD5 A;  4KQR A;  3U2A A;  3CIT A;  3I7J A;  1IYS A;  4DXC A;  3CZD A;  3QP6 A;  4I3A A;  4BL2 A;  2V0W A;  3EEH A;  2DCF A;  2W0N A;  2V9A A;  3KSH A;  1QMF A;  1Z6F A;  4O7D A;  5E43 A;  2R78 A;  2O9A A;  2QJ7 A;  1YM1 A;  2VGK A;  3PBN A;  3R7W B;  5GLD A;  2Q9M A;  1E3U A;  3BFF A;  3P09 A;  3JVU A;  1ESU A;  3VFH A;  2Z2L B;  3F1N B;  1ERQ A;  2JE5 A;  2JKG A;  2ZQ9 A;  1PI4 A;  3MKF A;  4YIN A;  2H0Y A;  3TRC A;  4R1G A;  3PBT A;  2W3H A;  3T4J A;  4S2O A;  4IUH A;  4E3J A;  4OOY A;  4Y0O A;  2I9V A;  5FAQ A;  4I5S A;  1F98 A;  1OTA A;  4BWI A;  2H10 A;  4KEN B;  3L7H A;  1L0E A;  4EEU A;  1XGJ A;  3GVB A;  1X0O A;  2Z6C A;  2GX5 A;  4RX3 A;  3M6H A;  5D3O A;  1NYM A;  3NOU C;  4HIA A;  4EER A;  3GSG A;  4JF5 A;  4NXF A;  4NEE D;  4GS9 B;  3A0R A;  2W3D A;  4FH4 A;  5DVA A;  3G31 A;  3QP8 A;  3BFG A;  4EXO A;  1S4S A;  4KZ6 A;  3SW1 A;  3IXD A;  5FEF A;  3LEZ A;  3RJU A;  1OJG A;  4FTX A;  3OOV A;  4S2L A;  2Y55 A;  3EOI A;  2PYR A;  5C5K A;  2ZC6 B;  4WYY A;  3GEC A;  1LI9 A;  5HPI A;  3LY4 A;  5HDS A;  1NJ4 A;  4JLF A;  3DTM A;  3MMH A;  5GLB A;  3EQU A;  1TS6 A;  2X01 A;  4IED A;  4ZAM A;  4BD1 A;  3H82 A;  2Y2O A;  3VOZ A;  2Y59 A;  4JPM A;  4FOF A;  3UE1 A;  1HTZ A;  1S66 L;  1ES2 A;  3A3I A;  1LSW A;  4FCF A;  2P9V A;  2PYP A;  4FH2 A;  5TBM B;  4WZ4 A;  4E6X A;  4OQH A;  1FCM A;  3OCL A;  4BEN A;  1H3Q A;  4NG2 A;  1S0W A;  4FSF A;  1LT0 A;  4IHQ A;  4P87 A;  1I2S A;  4KQD A;  2M7V A;  3BFD A;  3EQV A;  5A8B A;  2VX8 A;  5HWT A;  4N9K A;  2D02 A;  2GJ3 A;  2E8J A;  1TF1 A;  4ZBE A;  2ZMV A;  3HLC A;  2Y2H A;  2Y2N A;  4R0Q A;  3LCE A;  2V1Z A;  2EFU A;  2OV5 A;  1PW1 A;  3LIE A;  4X53 A;  4EU0 A;  1TS7 A;  4WF0 A;  1TDG A;  4N92 A;  5IHV A;  4HHD A;  3HL9 A;  3O5Y A;  4KZ4 A;  1W8Q A;  1ZTU A;  4C3Q A;  5E2H A;  2FZ0 A;  4DDS A;  1K6S A;  1UWP X;  4BJP A;  2P7J A;  4AFI A;  4LFU A;  4M4X A;  1VQQ A;  4DMZ A;  3UMD A;  2V8C A;  2ZBB A;  1XJ2 A;  4WBG A;  3LYX A;  4ZDX A;  3T1Q B;  4EUV A;  5KIZ A;  3KX0 X;  3IX3 A;  4PKY G;  3MXQ A;  4CQH A;  4GDB A;  3WS1 A;  5E2G A;  2QPN A;  4E3M A;  1IYO A;  2J8Y A;  4GKU A;  3G34 A;  4EBL A;  2WKQ A;  5AQB A;  4YWZ A;  2HDS A;  2WKH A;  2FH5 A;  5FI7 A;  2VGL M;  3Q82 A;  2WKE A;  3MZF A;  3DAV A;  4GLQ A;  3T4L A;  5EOO A;  1NWZ A;  3GMW A;  3NOT C;  2V1B A;  5EVI B;  1VEU A;  2W1T B;  4X6T A;  5EM0 A;  4CLC B;  1MWU A;  4OP5 A;  5HZH A;  2QJ5 A;  2VJW A;  4ARZ B;  3VP1 A;  4Y17 A;  1Y28 A;  4K08 A;  1T18 A;  1IYQ A;  5FQI A;  2VA0 A;  5HAI A;  2ZQC A;  1LL8 A;  1FIK A;  4E6W A;  1K25 A;  3CLO A;  5M18 A;  4RVA A;  4XXR A;  1PNE A;  3SH9 A;  1RCJ A;  4HJ3 A;  4X68 A;  1WE4 A;  5CHM A;  3KO6 A;  3VE3 A;  2ZOH A;  3P7N A;  1KE4 A;  3PBO A;  1Y4O A;  5EVE A;  4K0X A;  1MY8 A;  1XP4 A;  4ME4 A;  5DFX A;  2XDM A;  4E04 A;  4MN6 A;  4Z1W A;  3RTY A;  3L9K A;  4MBK A;  4X56 A;  1T1B A;  3GQZ A;  5A91 A;  2Y2Q A;  3IS2 B;  4HJ4 A;  3OBF A;  1SDE A;  3D3O A;  4DE1 A;  2ZD8 A;  1XA7 A;  3ZG8 B;  1IYP A;  2PR5 A;  4WMC D;  4H6J A;  1MWR A;  3UY6 A;  3CPT A;  5IS1 A;  5FQQ A;  3MKE A;  1M40 A;  1TEM A;  3VOL A;  5DKK A;  1RGZ A;  5HW3 A;  3PBR A;  1AWI A;  3HUM A;  4DE3 A;  4S2P A;  2WGW B;  5FI6 A;  4ZJ2 A;  3IF6 B;  4HJ6 A;  2EX6 A;  5G4Z A;  3UB8 A;  2EX9 A;  1VET A;  4DKI A;  3H7W A;  3E4Q A;  3W4P A;  1YQS A;  2BLS A;  1HZO A;  2K7S A;  1JWP A;  2WUQ A;  4OPZ A;  3O3V A;  4G3V A;  3UB6 A;  1YLW A;  3BFE A;  1GSW A;  2XQZ A;  4S2K A;  4LPZ A;  3TOI A;  4F94 A;  1P9R A;  2CMN A;  3VE4 A;  1PWC A;  4DJ3 A;  4WMC A;  2OWH A;  4LV0 A;  1S4R A;  4LRZ E;  2FFF B;  4U0T A;  3SS3 A;  3MXS A;  1VB6 A;  1PYY A;  2UV0 E;  2J9P A;  2L1M A;  2JKT I;  3LR4 A;  3MFX A;  1Q2Q A;  5HWV A;  2Z6D A;  4X1L A;  4OH0 A;  3G6O A;  2K2N A;  3H82 B;  1CF0 A;  2OAQ 1;  2A24 A;  2VV8 A;  3BEC A;  1W7F A;  5KSH A;  2Y91 A;  3ZHH A;  3G30 A;  4P6Z S;  1BLH A;  4GDN A;  3M6B A;  1K4E A;  2P9V B;  5HL1 A;  5CHU A;  4HNB A;  3LFV A;  4JKT A;  3BFC A;  5HWW A;  1OJ5 A;  1P0Z A;  2HP5 A;  4IBX A;  4N9L A;  3DTI A;  3LY3 A;  2VGJ A;  4KUO A;  3WS2 A;  4WL9 A;  1GHI A;  3Q7Z A;  3T1R A;  1K6R A;  1O7E A;  2OWJ A;  5DJU A;  3C4O A;  1H8Y A;  4R23 A;  1EW0 A;  4R3B A;  3E2L A;  4I3I A;  1K0K A;  1SKO A;  1PFL A;  4R4R A;  4MNR A;  1GCE A;  3QP1 A;  3VSL A;  3O86 A;  4KZ5 A;  4EW7 A;  2GNX A;  1T19 A;  2ZQ7 A;  5A92 A;  4FUW A;  2DRW A;  1KVM A;  1ERO A;  1OPX A;  4HEF A;  5AVF A;  2QKP A;  2B02 A;  5FQ9 A;  1JVJ A;  1HVB A;  4UEY A;  2IA2 A;  5DF7 A;  1FSY A;  2XD1 A;  3WRT A;  1W63 M;  3RXX A;  1GSX A;  2XGN A;  1XJ3 A;  3ZNT A;  2GDN A;  2VV7 A;  4PKY A;  5J3W A;  4MBF A;  3V39 A;  4ZJ3 A;  1K55 A;  3E2K A;  3OLO A;  3VP2 A;  2ACG A;  1LL5 A;  3SH8 A;  4LV1 A;  3DW0 A;  3HUN A;  3SS5 A;  1CEF A;  1MXO A;  2W3G A;  2PR6 A;  3PAG A;  5L8M A;  4P85 A;  3K3D A;  3M2K A;  3MR0 A;  3G4P A;  4EQ1 A;  1N9L A;  3TJZ C;  1D1J A;  4R6L A;  1QME A;  3TG9 A;  3OC2 A;  1PW8 A;  4Y13 A;  5HAQ A;  2ZC7 A;  3IXH A;  2P74 A;  2PT7 A;  1YSP A;  5CHJ A;  1FR1 A;  5I5L A;  1NXY A;  2A49 A;  4YFM A;  5DTS A;  3AGF A;  3EWK A;  4P6B A;  4LLO B;  4BMW A;  4KG2 A;  5EFW A;  1K4F A;  3MZE A;  4Y3I A;  2B18 A;  3LIF A;  3LR5 A;  4S2N A;  4ETX A;  3NCK A;  1I2W A;  1NYY A;  1VEU B;  1FOF A;  1CI8 A;  3QP4 A;  1DP9 A;  1SZV A;  3WRZ A;  5L2F A;  1XGI A;  1JWZ A;  1YLP A;  5FQK A;  5TJJ A;  4JGO A;  4HOI A;  1P9W A;  1EI5 A;  2XA7 M;  5E2E A;  5F5Y A;  3HUO A;  3RH8 B;  1XKZ A;  2ZL1 A;  1WYC A;  1HLU P;  5L07 A;  3MJQ A;  1ACF A;  4RYE A;  3ZNY A;  1BUL A;  4Y2F A;  4E3N A;  1V9Z A;  4K91 A;  3BEB A;  2P08 A;  1ES3 A;  1BYW A;  4I39 A;  2JKR M;  5AQ7 A;  3ZQ5 A;  5M19 A;  1KE0 A;  1LSX A;  3VP3 A;  4CPK A;  3HRE A;  2RCX A;  3U4L P;  5G18 A;  2J9O A;  4Q8I A;  4B4X A;  1G68 A;  2JN7 A;  1SDN A;  3ZG9 B;  5FAS A;  1N9N A;  1M6K A;  2YKH A;  3V5M A;  3W4Q A;  2V20 A;  4GB7 A;  2PBY A;  4GNU A;  4Y15 A;  4MEZ A;  2V8F A;  3C30 A;  4OKP A;  1CQA A;  1DP8 A;  2QMI A;  2PAV P;  5AQ9 A;  1YLZ A;  4GHI A;  1EWZ A;  1UWN X;  2ZM2 A;  2E8I A;  4GJ4 A;  4R3A A;  4WZ5 A;  3UO9 A;  3LIA A;  2Y4A A;  4R4S A;  3PR6 A;  1J3W A;  2WAF A;  3F1P A;  1KDW A;  1P97 A;  3MBZ A;  1PZP A;  5F6A A;  2BTF P;  4Y0U A;  4OLG A;  1NY0 A;  3S7Q A;  1YMX A;  2WYX A;  4MCW A;  3CI6 A;  4B88 A;  3HCY A;  1STZ A;  4R70 A;  2DNS A;  4BLM A;  3K2N A;  3EGD C;  4S2M A;  2NUT C;  4DXB A;  2PRF A;  2RL3 A;  2VGL S;  5L10 A;  5FQM A;  3FWL A;  3UE3 A;  2WGI A;  5CTM A;  4C75 A;  3CWF A;  4HES A;  3B42 A;  4A5R A;  4L0L A;  4PHT A;  1Y54 A;  1A0K A;  3NOP C;  3BQA A;  1FSW A;  2WZZ A;  5CTN A;  4U3T A;  4PM5 A;  1W79 A;  3ZDJ A;  3ZVW A;  3NI9 A;  1BLC A;  1MC0 A;  4B9O A;  4E3L A;  1GA9 A;  1W5D A;  3UB5 P;  2XD5 A;  3ZG0 A;  1ONH A;  4Q0J A;  1SHV A;  3LR0 A;  3W2Z A;  2J3W A;  1H5X A;  3UPP A;  3VP0 A;  3BY9 A;  3GDI A;  2J3T D;  4U0X A;  4JGP A;  5E2F A;  2FFY A;  4EEP A;  4UHU A;  4YNR A;  2VV6 A;  4IVI A;  5L09 A;  3IBR A;  1ZHH B;  3BWL A;  3GRJ A;  5HAR A;  3IH9 A;  3LI8 A;  5FL3 A;  3F1N A;  3FKV A;  3S7N A;  1MKM A;  3FV7 A;  3C38 A;  5EOE A;  1K55 C;  3MQQ A;  1CEG A;  1ES5 A;  3AGE A;  1YLY A;  1IEM A;  4JXW A;  4WM9 A;  5GHX A;  3K3C A;  3LO7 A;  4QB8 A;  5F1G A;  1OTE A;  3B33 A;  4ETZ A;  1FCN A;  2XFT A;  4X55 A;  1DJC A;  1LL9 A;  3CJM A;  3R4K A;  3SOI A;  4GZB A;  2KX6 A;  3ZFZ A;  3UNW A;  5GHY A;  4ZJ1 A;  2W27 A;  4R38 A;  1MKI A;  4HH2 A;  3S7P A;  4GCZ A;  5U47 A;  1LI0 A;  2MJ6 A;  3LIC A;  1MWS A;  1BSG A;  4BL3 A;  4HH3 A;  4JF6 A;  1NZO A;  4QD4 A;  1NLZ A;  3LI9 A;  2V0U A;  2Y2K A;  5CEB A;  2GZA A;  3IBJ A;  2AVX A;  1K54 A;  2L4R A;  2ZLY A;  4EBP A;  4H8R A;  4S2N C;  5F82 A;  1MWT A;  5CGX A;  5CGW A;  3N7W A;  1U60 A;  3PTE A;  5EV0 A;  3CAX A;  3DBA A;  1MBL A;  1N9O A;  1YT4 A;  4MN7 A;  3T4K A;  1IEL A;  1MZU A;  5DKL A;  2WGV A;  5TGF A;  4QHC A;  2Z2M B;  1ALQ A;  2ZC5 B;  2W3F A;  4OQI A;  5CX7 A;  4GW9 A;  5CXW A;  2L0W A;  4NK3 A;  1H8Z A;  2EX8 A;  3E0Y A;  3JPU A;  5TBM A;  2HP6 A;  5FDH A;  1KVL A;  3M2J A;  3UDI A;  3IH8 A;  3T50 A;  3UE6 A;  3MS6 A;  3VMA A;  1XFN A;  3IHA A;  4EET B;  4O0P A;  5LBR A;  1KGE A;  1ZG4 A;  4HP9 A;  3IWQ A;  5EE8 A;  3S4X A;  4PM8 A;  1XX2 A;  2IWD A;  1AXB A;  1XJ6 A;  1L0G A;  2JC7 A;  4L9F A;  4IUK A;  4UA6 A;  2WAD A;  4OQ0 A;  1OTB A;  1YLJ A;  4I38 A;  1S1Z A;  2BAS A;  2XEP A;  1L2S A;  1DP6 A;  4F3L A;  4LV2 A;  4JXG A;  1VHM A;  3Q7V A;  4PM6 A;  1IKI A;  3B3X A;  1L0D A;  3TW8 A;  4G3W A;  3BLS A;  1L3L A;  1BZA A;  4WZ5 C;  2WAE A;  4WUJ A;  4OPR A;  1K57 A;  3VOY A;  1BLS A;  1ZG6 A;  3B47 A;  4KZ3 A;  2XRN A;  4GHI B;  4DRT A;  5BOH A;  4B93 A;  4G3K A;  5EVI D;  5FDS A;  3FYZ A;  4M3K A;  4CLC D;  5CRF A;  4ID4 A;  5HSQ A;  1WYB A;  2IWC A;  3UDF A;  3UN7 A;  4N1X A;  1ODV A; 
#chains in the Genus database with same CATH homology
 4MN5 A;  4HOI A;  2M1C A;  3MQO A;  1P9W A;  3LIE A;  2XA7 M;  1DRM A;  5F5Y A;  3NJA A;  3RH8 B;  4EU0 A;  1TS7 A;  4WF0 A;  3MJQ A;  4HHD A;  2JKT M;  4KQO A;  5G4Y A;  3O5Y A;  1JNU A;  2K31 A;  1ZTU A;  4Y2F A;  1D7E A;  4HI4 A;  1T1A A;  1V9Z A;  4YOF A;  2FZ0 A;  2HF6 A;  2EA9 A;  4NXB A;  4QPR A;  2P08 A;  1BYW A;  2QWS A;  3E98 A;  3ZYT A;  2OOL A;  4I39 A;  2JKR M;  3ZQ5 A;  3D72 A;  4RQ9 A;  1LSX A;  1G6O A;  1UWP X;  4BJP A;  2P7J A;  4AFI A;  3KYQ A;  4M4X A;  3UME A;  4DMZ A;  1NRJ A;  3UMD A;  1IFQ A;  4DJ2 A;  5DF9 A;  2ZBB A;  1YAX A;  1XJ2 A;  3F1O B;  2JN7 A;  3LYX A;  5AVE A;  3EGX C;  4EUV A;  5KIZ A;  3ICY A;  3KX0 X;  4CLC A;  4PKY G;  3E4P A;  3MXQ A;  1OT9 A;  4CQH A;  1N9N A;  5HDC A;  3T4S A;  4P6Z M;  3T4Q A;  1OT6 A;  2YKH A;  3CUE C;  2INW A;  2G7U A;  2WKQ A;  4L9G A;  5IU1 A;  4YWZ A;  4CLC E;  2FH5 A;  2HJ9 C;  1S1Y A;  2XA7 S;  2VGL M;  4Y5F A;  4BBV A;  4WEK A;  4EES A;  4GLQ A;  3LIB A;  3C30 A;  3T4L A;  2W3E A;  1DP8 A;  1NWZ A;  4DN0 A;  2Y8H A;  3NOT C;  3P01 A;  2V1B A;  4GHI A;  1UWN X;  2W1T B;  5IT5 A;  3C8C A;  4GJ4 A;  4R3A A;  5HDD A;  4CLC B;  5HZH A;  4UQI M;  3LUQ A;  2KDK A;  2QJ5 A;  2VJW A;  3S7O A;  1F9I A;  4ARZ B;  3BJN A;  1Y28 A;  4K08 A;  1T18 A;  3LIA A;  2VA0 A;  2PHY A;  3PR6 A;  1LL8 A;  3F1P A;  3CLO A;  1TD5 A;  3BY8 A;  1P97 A;  3C2W A;  2HV1 A;  1W63 Q;  4HJ3 A;  2LB5 A;  5F6A A;  2WKP A;  4NKP A;  3IS2 A;  1XFQ A;  3KO6 A;  4OOM A;  3T4T A;  3VE3 A;  2VZW A;  1H8M A;  2ZOH A;  3S7Q A;  2M7U A;  3P7N A;  2EWW A;  4BBT A;  4MCW A;  3CI6 A;  3HCY A;  1STZ A;  2OAP 1;  4R70 A;  3PBO A;  3FC7 A;  3UB7 A;  4L9E A;  4WN5 A;  4LRY C;  3FG8 A;  4Q0I A;  3HJK A;  4ME4 A;  5DFX A;  3K2N A;  3EGD C;  2NUT C;  4HP4 A;  3V67 A;  3F1P B;  4E04 A;  4MN6 A;  2VGL S;  2J3T C;  4Z1W A;  3RTY A;  1T1B A;  3UE3 A;  2PDR A;  3CWF A;  3NHQ A;  3IS2 B;  4OOL A;  4HJ4 A;  4KUK A;  3PBS A;  3B42 A;  3OBF A;  2PD8 A;  3D3O A;  4HQA A;  3F1O A;  3PXP A;  4L0L A;  4NXE A;  4PHT A;  4UQI S;  5DFY A;  2PR5 A;  3NOP C;  4H6J A;  3BQA A;  4XT2 B;  5IS1 A;  3T4O A;  4WEJ A;  3VOL A;  1YKD A;  4LRX C;  5DKK A;  5F68 A;  1OTD A;  2KLI A;  2HGV A;  3PBR A;  3UB9 A;  1MC0 A;  1T1C A;  4B9O A;  4HJ6 A;  5G4Z A;  3UB8 A;  1V9Y A;  2JHE A;  3H7W A;  1WA9 A;  3E4Q A;  4Q0J A;  3PYP A;  4O01 A;  3LR0 A;  3W2Z A;  4WLA A;  2J3W A;  3LR3 A;  2O9B A;  4WEL A;  3BQ8 A;  2K7S A;  2W1T A;  1XJ4 A;  3BY9 A;  3GDI A;  4H6J B;  1F5M A;  2J3T D;  2A2L A;  2VEA A;  4ARZ A;  4JGP A;  2O9C A;  2PD7 A;  1UGU A;  2QHK A;  3HJI A;  2W1R A;  3MF0 A;  3KYZ A;  4EEP A;  2DMW A;  4YNR A;  4G3V A;  3UB6 A;  2VV6 A;  4BBU A;  4JGQ A;  5J4E A;  5HD3 A;  4IJG A;  2YKF A;  3IBR A;  3FPV A;  4Q0H A;  2H28 A;  1ZHH B;  3BWL A;  5AJG A;  3H7W B;  1GSW A;  5HD5 A;  3LI8 A;  5FL3 A;  3F1N A;  3LID A;  4LPZ A;  3S7N A;  1MKM A;  3U2A A;  3C38 A;  1P9R A;  3CIT A;  2CMN A;  3VE4 A;  3MQQ A;  4DJ3 A;  4I3A A;  2OWH A;  3K3C A;  4II7 A;  2V0W A;  3EEH A;  1S4R A;  4LRZ E;  2W0N A;  1D06 A;  2V9A A;  1OTE A;  3B33 A;  3KSH A;  1VB6 A;  4ETZ A;  2R78 A;  2O9A A;  2QJ7 A;  4HY8 A;  2L1M A;  3PBN A;  2JKT I;  3LR4 A;  3R7W B;  3MFX A;  3R4K A;  3JVU A;  2KX6 A;  5HWV A;  2Z6D A;  2O0Y A;  3ULF A;  3F1N B;  3G6O A;  1IOU A;  2K2N A;  3H82 B;  2OAQ 1;  2W27 A;  2A24 A;  2VV8 A;  2JKR I;  4R38 A;  2P04 A;  3A0S A;  1G28 A;  4HH2 A;  4GCZ A;  3S7P A;  5KSH A;  4ZRR A;  2HJE A;  4XT2 A;  4P6Z S;  5DJT A;  3TRC A;  5J7E A;  2MJ6 A;  3KSG A;  5HPF A;  4JGR A;  3LIC A;  3LFV A;  4HNB A;  5HWW A;  2J80 A;  2W3H A;  3PBT A;  1P0Z A;  1OJ5 A;  3T4J A;  2NUP C;  4IUH A;  4HH3 A;  4KUO A;  4WL9 A;  5HL6 A;  3KSF A;  1NLZ A;  2I9V A;  3LI9 A;  4F3L B;  1NLY A;  2V0U A;  4I5S A;  1F98 A;  1OTA A;  4BWI A;  2GZA A;  3IBJ A;  2OWJ A;  2L4R A;  1LSV A;  5DJU A;  2D01 A;  1EW0 A;  4I3I A;  4EEU A;  2A24 B;  2WKR A;  3TE8 A;  1X0O A;  2Y79 A;  2XSS A;  2Z6C A;  4EW7 A;  2GNX A;  1T19 A;  2GX5 A;  5K5B A;  5MC7 A;  1OPX A;  1TS0 A;  3NOU C;  4HIA A;  4EER A;  5AVF A;  3CAX A;  4NXF A;  4O8G A;  2QKP A;  3DBA A;  4NEE D;  4GS9 B;  4NXG A;  2B02 A;  1N9O A;  3A0R A;  2W3D A;  3OCN A;  4MN7 A;  3T4K A;  4UEY A;  2IA2 A;  2V1A A;  3E4O A;  1MZU A;  4EXO A;  3A0V A;  3BW6 A;  5DKL A;  1S4S A;  2VLG A;  3SW1 A;  3RFB A;  3CUE A;  1OJG A;  1W63 M;  3OOV A;  2W3F A;  1TS8 A;  5CX7 A;  4GW9 A;  1GSX A;  2L0W A;  3EOI A;  2PYR A;  1XJ3 A;  2O99 A;  3E0Y A;  5C5K A;  2QYB A;  2VV7 A;  4PKY A;  5J3W A;  3GEC A;  5TBM A;  5HPI A;  3EEA A;  3OLO A;  3PBQ A;  1OTI A;  3H9W A;  5HDS A;  3T50 A;  3R7W A;  2LB9 A;  3UE6 A;  3MMH A;  1XFN A;  2ZOI A;  4EET B;  3EQU A;  4O0P A;  1TS6 A;  5LBR A;  1YSQ A;  1KOU A;  1S67 L;  4HP9 A;  3H82 A;  2W3G A;  2PR6 A;  5L8M A;  4I3J A;  4FOF A;  1XJ6 A;  3K3D A;  1S66 L;  3MR0 A;  3VV4 A;  4CLC C;  4EQ1 A;  4L9F A;  1N9L A;  1LSW A;  4IUK A;  2PYP A;  3TJZ C;  4PAU A;  5TBM B;  4R6L A;  1OTB A;  2ZMF A;  1S1Z A;  2BAS A;  2KOI A;  4I38 A;  3OCL A;  1DP6 A;  3PHY A;  4F3L A;  1VHM A;  1H3Q A;  3OC2 A;  3MQ0 A;  4FSF A;  2XRO A;  1LT0 A;  3KSI A;  2PT7 A;  4IHQ A;  1YSP A;  5I5L A;  4MMN A;  3TW8 A;  4G3W A;  2EWV A;  3JVV A;  4KQD A;  5F69 A;  3EWK A;  2M7V A;  1GSV A;  4LLO B;  4WUJ A;  4BMW A;  3EQV A;  5EFW A;  3FPW A;  4Y3I A;  5A8B A;  2B18 A;  3LIF A;  2VX8 A;  3LR5 A;  5HWT A;  4GS9 A;  4ETX A;  3B47 A;  2XRN A;  2D02 A;  4GHI B;  2GJ3 A;  2VKS A;  4B93 A;  1TF1 A;  4G3K A;  4CLC D;  2ZMV A;  1DP9 A;  5HSQ A;  4MDZ A;  1ODV A;  5TJJ A;  4JGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...