4U0XA

Structure of adc-7 beta-lactamase in complex with boronic acid inhibitor s02030
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
355
structure length
355
Chain Sequence
KDQEIKKLVDQNFKPLLEKYDVPGMAVGVIQNNKKYEMYYGLQSVQDKKAVNSNTIFELGSVSKLFTATAGGYAKNKGKISFDDTPGKYWKELKNTPIDQVNLLQLATYTSGNLALQFPDEVQTDQQVLTFFKDWKPKNPIGEYRQYSNPSIGLFGKVVALSMNKPFDQVLEKTIFPALGLKHSYVNVPKTQMQNYAFGYNQENQPIRVNPGPLDAPAYGVKSTLPDMLSFIHANLNPQKYPTDIQRAINETHQGRYQVNTMYQALGWEEFSYPATLQTLLDSNSEQIVMKPNKVTAISKEPSVKMYHKTGSTSGFGTYVVFIPKENIGLVMLTNKRIPNEERIKAAYVVLNAIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ADC-7 beta-lactamase
publication title Biochemical and Structural Analysis of Inhibitors Targeting the ADC-7 Cephalosporinase of Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 117
structure length 355
sequence length 355
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4u0xA00
4F94A 2HDSA 4Y0TA 3VP4A 3WWXA 3HREA 1KVMA 2OLVA 4N9LA 5F82A 3QHYA 4GB7A 3ZCZA 3DTMA 1Z6FA 2WZXA 4KZ5A 5EVLA 3RJUA 4BJPA 3N8SA 2ZM0A 3SS3A 4OP8A 3G4PA 5GHYA 2BG1A 4PM6A 1GHMA 1LHYA 3O86A 1PZOA 4S2PA 4P85A 4IEDA 2EXBA 2EX8A 4WELA 3C4OA 5FQQA 1ES5A 3S1YA 3V3RA 3HUMA 2Y2MA 1HZOA 1H8YA 3NY4A 4HEFA 4P87A 4MBHA 3WS0A 5EOEA 1K56A 2Y55A 4PMAA 1BLSA 1MWUA 3CG5A 4QJGA 4R3JA 5EUAA 4BENA 1JTDA 4KG2A 4QY6A 4PM5A 4JF5A 3M6BA 2Y2KA 3EQUA 4S2JA 4BQMA 2Z2MB 1YT4A 1KDWA 3IWQA 5M19A 5HAQA 3A3EA 3OPHA 4HBTA 5FI7A 4E3MA 2Q9MA 4N1XA 3HUNA 4DE1A 5HAPA 3HLCA 4OQGA 3UE3A 2B5RA 3TSGA 3A3FA 1E3UD 4X6TA 1FCMA 3QNBA 3MZFA 1KVLA 3HLEA 2OSUA 4XXRA 2A3UA 1ZKJA 2JE5A 5DVAA 4E3KA 3V3SA 2WK0A 3BEBA 2EX2A 2ZC3B 3E2KA 3MFDA 4FD8A 5FQJA 3HLBA 4OQHA 1L2SA 1JVJA 4O7DA 4DDSA 1NZUA 4EBLA 2XF3A 3VOZA 1K54C 3B3XA 3IHBA 2EXAA 1BZAA 5FAQA 4Y0UA 4JLFA 4JXVA 5AQBA 4E6XA 1MWSA 5FI2A 3PBQA 4FH2A 1MY8A 4FCFA 5KZHA 4OVDA 3MKEA 5CXWA 3G30A 1CK3A 1G68A 3SH9A 3TOIA 3M6HA 3Q82A 1DJBA 3UO9A 3ZHHA 3HVFA 2WAEA 4K0XA 2JCHA 1RGZA 5EE8A 3NIAA 3IXGA 4OOLA 2Y4AA 4QD4A 3GVBA 1MPLA 3UDXA 1ESIA 3LO7A 5E2GA 3VOYA 5CEBA 2PU4A 4S2IA 3SS5A 4R1GA 1FR6A 4LV2A 1ERQA 1NZOA 1TEMA 5GLAA 1XX2A 2Y2QA 3BRMA 1NYMA 1G6AA 3BYDA 1LL5A 4OQIA 3VFHA 1ZG4A 4X53A 5E2EA 4DKIA 3PAEA 3HUOA 1IYQA 2HP5A 3S22A 1QMEA 1FOFA 2Y91A 4DXBA 5A90A 3SH8A 2H5SA 1K25A 1PYYA 4ZTKA 3CMZA 5AQ7A 1IEMA 2Z2LB 3IF6A 1H5XA 2X02A 4IVIA 3BFCA 4KG6A 4H8RA 4ZJ1A 5A93A 3UNWA 2WZZA 4K0WA 4C6YA 4JF4A 4KQOA 3N8RA 3PBSA 5KMWA 2ZQCA 1AXBA 4ZDXA 1K4FA 5DTSA 1ERMA 1EWZA 3BFEA 1SDEA 2IWBA 2WAFA 4S2MA 3SS4A 5D3OA 3OCNA 4RYEA 1YLYA 4DDYA 3IH9A 5E43A 3PBNA 3HLGA 4IBRA 5F1GA 3WS2A 2UWXA 5CGXA 1KGFA 1SDNA 4BLMA 3IWIA 1PI5A 3O88A 3N6IA 1JWZA 3UE0A 1WYCA 4QU3A 1DJCA 1DY6A 1YLWA 3G31A 3FKWA 3I7JA 1O7EA 3MXRA 4UA9A 4U0XA 2V1ZA 1IKGA 4PM9A 3BLMA 3A3IA 1VQQA 4LCMA 2Y2NA 4GDNA 4JBFA 1XGIA 3AGFA 1GHIA 4HBUA 4OLDA 2WUQA 4KZ3A 1YM1A 1L0EA 1YMSA 3IF6B 1ES2A 4MNRA 1ZG6A 4ZBEA 3S4XA 4WYYA 4JPMA 3HLFA 4NK3A 4OOYA 5A91A 5DTKA 3PBRA 3ZG7B 2WKHA 3CZDA 4UA6A 4X68A 3NCKA 4KQRA 3VP0A 3MXSA 2Y2HA 4FSFA 4R0QA 4S2LA 1VM1A 2Y2JA 3V5MA 2XLNA 3P98A 3NDEA 5BOHA 4R4SA 4ID4A 3FYZA 5FI6A 1NRFA 2BLSA 3OPLA 3Q7VB 4OONA 3UPOA 3V39A 1K56D 3MKFA 1L0DA 1OMEA 2ZLYA 3IXHA 4R23A 3ZNYA 1WYBA 4GKUA 2WKEA 4JKTA 2Y59A 5FSRA 3N8LA 2X01A 3IF6C 4IVKA 2RCXA 5FQMA 3HLDA 1BULA 5TFQA 3O87A 3MBZA 3ISGA 2IWDA 5FATA 4WBGA 1MXOA 1I2WA 3ZFZA 1ES3A 1BLPA 3DWZA 5IHVA 4DF6A 4WMCA 1XXMA 2ZQAA 4OKPA 3DWKA 1KDSA 2ZC7A 1PIOA 3ZNTA 2WGWA 1XPBA 4OPRA 4B88A 1QMFA 4JF6A 4OPZA 2ZMAA 3Q81A 5CEDA 2ZC5B 1MWTA 3N7WA 5FA7A 4E3JA 4EQIA 2EFXA 4C3QA 4PM8A 1NYYA 1IYPA 2Y2GA 5L2FA 1RGYA 3VSKA 2HPBA 4WMCD 4EV4A 3GRJA 5HX9A 5I94A 2PBYA 1Y54A 1LLBA 2J8YA 4FH4A 1N9BA 1YQSA 3SH7A 1K4EA 3M2JA 4MEZA 2DCFA 3PAGA 4MLLA 4RX3A 2HDUA 1W5DA 3C7VA 5EVIA 4S2NA 4UA7A 2Y2OA 2QZ6A 4UHUA 5F1FA 4LCLA 5CERA 4CJNA 2FFFB 2E8IA 3NI9A 1YLTA 3FZCA 3GR2A 3IH8A 4KZ9A 5TR7A 1RP5A 4Z9QA 1GA0A 5G18A 3AGEA 5JYPA 4KZ4A 3VFFA 3TG9A 2OLUA 4L0LA 4QB8A 5EVID 1FQGA 1KE3A 3FV7A 4UAAA 5GLDA 3W4OA 1K57A 3OPRA 1CEFA 2V2FF 2VGJA 5FQ9A 4CPKA 1NJ4A 3ITBA 4GZBA 2V20A 3UY6A 2WGWB 4Y0OA 3UDIA 4P0MA 1YLZA 4GDBA 4A5RA 4OP5A 5FASA 2PU2A 2EX6A 3LY4A 2C6WB 4E3NA 2G2UA 3HLWA 4LV3A 2ZQ7A 1ALQA 1N4OA 4KZBA 3DW0A 4U0TA 5AQAA 5FQIA 3V50A 1ES4A 4JXGA 2HP9A 4BD1A 3O3VA 1K55A 2XDMA 3PTEA 4P6BA 4EWFA 1C3BA 3W4PA 2Y2LA 2ZQ8A 3Q7ZA 5CHMA 2XD1A 4LV1A 5EVIB 3AGDA 3PBOA 3ZVTA 1PZPA 2XFSA 3IXBA 3A3JA 2R9WA 2C5WB 4DXCA 2XGNA 3HL9A 3Q7VA 1KE0A 3C4PA 4K91A 4XUZA 5TGFA 4B4XA 1TVFA 3A3DA 5EPHA 1J9MA 1E25A 4R3BA 4XUXA 2J7VA 4GN2A 2GDNA 4B4ZA 3ZGAB 1IKIA 2H0TA 2XK1A 5GLCA 5A92A 3BM6A 4RX2A 1MBLA 4EBNA 1W8YA 4U3TA 1L0FA 1YMXA 3IF5A 1EROA 4WM9A 1PWDA 3N4IA 5U47A 2HDRA 5E2FA 1FSWA 1BUEA 1SHVA 1TDGA 5CHUA 1YLPA 4QY5A 5CGWA 3UN7A 2JC7A 2VGKA 3W8KA 2HDQA 2DNSA 4PM7A 5GHXA 4E3LA 2WKIA 4WEKA 1E4DA 4PPRA 5EVIC 5M1AA 4S2NC 2A49A 3ZDJA 5HL1A 3NC8A 3EQVA 2Y2IA 5FAOA 1PI4A 4DRTA 3OPPA 4EUZA 1CEGA 3ZG5A 2X71A 4ZJ3A 4QHCA 2OV5A 1RCJA 1GHPA 2H10A 3G32A 5CRFA 1IYOA 1ONGA 3C5AA 5E2HA 1K57C 4X55A 5DF9A 4WZ5A 1K6SA 2XR0A 4HESA 3Q1FA 4OH0A 5HAIA 2HP6A 1ONHA 2WGIA 1KGEA 2P9VA 4RVAA 1HVBA 3ITAA 1S6RA 1SCWA 5CTMA 3IXDA 1IYSA 4D2OA 1K38A 1PW1A 4BD0A 4YINA 4KZ6A 4Y7PA 3MZDA 3VP3A 4GNUA 4LENA 5M18A 2Y2PA 3CJMA 4WZ4A 2H0YA 1MWRA 5J8XA 2XD5A 3NDGA 1JTGA 1U60A 1CI9A 2QMIA 4BL3A 4KG5A 1K55C 4KQQA 3PBTA 3G2ZA 5JYOA 2Q9NA 5HFOA 3ZVWA 3NBLA 2XQZA 3D4FA 1E3UA 1SKFA 3VMAA 3VP1A 1MKIA 2QPNA 5CGSA 1XA1A 2ZQ9A 5F83A 2EFUA 2XFTA 3G34A 1BLHA 4MBFA 4KENB 1WE4A 1XA7A 1W79A 2ZD8A 3UDFA 5KSCA 4GD8A 5FQKA 4OPQA 4JXWA 4R4RA 4ZAMA 4NETA 2WGVA 3G2YA 1KGGA 1Q2QA 1JWVA 4OLGA 5GL9A 1YLJA 3UPPA 3W4QA 4DE3A 4M3KA 2P9VB 1K6RA 4YFMA 5EOOA 3UPNA 2RL3A 1EI5A 1NXYA 2XH9A 3JYIA 4X69A 4OQ0A 2G2WA 1XGJA 3VP2A 3FWLA 2R9XA 4E6WA 2ZJ9A 5DF7A 3IWOA 1O07A 2J9PA 1Q2PA 1I2SA 1BSGA 1PWGA 5KSHA 2ZC6B 3RXXA 3MZEA 5DTTA 2FFYA 1KE4A 3P09A 1FR1A 1BT5A 2EX9A 3GQZA 1NY0A 3LY3A 5AQ9A 5GLBA 1GCEA 4WZ5C 4KZ7A 5EECA 1GA9A 2JBFA 2ZM2A 4IBXA 4MBKA 1JWPA 3BFGA 3IQAA 3SOIA 1HTZA 5FAPA 4ZJ2A 4C75A 4OOMA 3WS5A 1PWCA 1DJAA 1PW8A 3WS1A 4OPYA 3LCEA 3OC2A 3IHAA 1W8QA 4S2OA 5FDHA 1BLCA 3FKVA 4KZ8A 4RA7A 4S2KA 1M40A 3GSGA 3BECA 1H8ZA 3QNCA 2J9OA 3ZG0A 4DE2A 5CECA 2ZC4B 1CI8A 1S0WA 1BTLA 1IELA 4GOGA 4WEJA 5HW3A 1FSYA 2WYXA 4X56A 2WADA 3WRZA 5DF8A 3LEZA 3WS4A 5GHZA 2I72A 3WRTA 1LL9A 4JXSA 4N92A 1L0GA 3E2LA 4LV0A 1FCOA 3HBRA 3GMWA 2IWCA 3ZG8B 3UE1A 4Q8IA 1FCNA 2ZQDA 3BFFA 1HD8A 1LI0A 2P74A 1XKZA 4GD6A 5CTNA 4N9KA 4KZAA 1M6KA 3BFDA 3OCLA 4N1HA 4E3IA 5HARA 2ZM8A 1I5QA 3BLSA 3Q07A 4BL2A 4E3OA 3ZG9B 3GV9A 3GTCA 3M2KA 4DE0A 5CHJA 1XP4A 1LI9A 4EBPA 1K54A 2CC1A 3C7UA 3IT9A 3RXWA 3VSLA 1TDLA 1ZC2A 1ESUA 3G35A 3OZHA 1W7FA 2DRWA 2XEPA
chains in the Genus database with same CATH superfamily
3WWXA 2VGLM 2PT7A 5F5YA 3ZCZA 3DTMA 1DP6A 1Z6FA 4BJPA 2ZM0A 4PM6A 1GHMA 1OTDA 1PZOA 4WELA 3ZYTA 3DTIA 3NY4A 4HEFA 4P87A 1OJ5A 1K56A 4LLOB 4EQ1A 1MWUA 3CG5A 4R3JA 5FL3A 3M6BA 4LRYC 1YT4A 3A3EA 3OLOA 4HBTA 3HUNA 3HLCA 5IU1A 3VE3A 1E3UD 4JGOA 3MZFA 2OSUA 5DVAA 1XJ3A 3E2KA 2EX2A 3MFDA 5FQJA 3HLBA 1L2SA 1NZUA 4EBLA 3FPVA 1K54C 1YKDA 3B3XA 4PKYA 2EXAA 3UB5P 5FAQA 4JLFA 3MS6A 4JXVA 1Y4OA 3C38A 3RH8B 4X1MA 3PBQA 4FH2A 3LI9A 3EOIA 1MY8A 3MKEA 1CK3A 3HJKA 3HVFA 3IBRA 1RGZA 1P0ZA 3IXGA 3GVBA 1MPLA 3LO7A 5E2GA 3VOYA 1OTIA 2JKRI 1XX2A 3BRMA 5J4EA 4OQIA 4EERA 1ZG4A 5L10A 5E2EA 3HUOA 5MC7A 3JVVA 1QMEA 3T4QA 5A90A 4DXBA 2H5SA 2J3TC 1IEMA 3IF6A 1S1YA 1XJ2A 5A93A 3UNWA 2WZZA 4K0WA 1W63M 2M1CA 1ERMA 4CLCA 1SDEA 4RYEA 5E43A 3MJQA 4IBRA 1XJ4A 3WS2A 2V9AA 2J3WA 1KGFA 3N6IA 1JWZA 1WYCA 1WA9A 4QU3A 2VV7A 3I7JA 3MXRA 4UA9A 4U0XA 1LSXA 3A3IA 2Z6CA 2G7UA 3JPUA 4DMZA 4OLDA 4KUOA 4KZ3A 3S7OA 3IF6B 2JKTM 3LIBA 5A91A 3A0VA 3CZDA 5L07A 2Y2HA 4CLCB 3K3DA 4IUKA 2KLIA 1VM1A 3NDEA 3PYPA 4ID4A 3NULA 4RQ9A 4YNRA 2BLSA 3UPOA 3RTYA 1K56D 2ZMFA 4PAUA 3PHYA 3UB9A 3U4LP 5C5KA 4GKUA 3H82A 5G4ZA 2H28A 4WUJA 5FQMA 3HLDA 1BULA 3O87A 1H0MA 3EGXC 1BLPA 5HL6A 4DF6A 2ZC7A 4HY8A 1XPBA 1G5UA 3Q81A 5FA7A 4C3QA 3KYZA 4EEUA 4PM8A 2Y2GA 3U2AA 1RGYA 3VSKA 2HPBA 4EV4A 5I94A 2PBYA 2OAQ1 3QP4A 2W3EA 4Z1WA 1K4EA 2DCFA 4HH3A 3PAGA 1W5DA 2EWWA 4UA7A 2QZ6A 3CWFA 3CHWP 5F1FA 5CERA 4I39A 3H82B 2Z6DA 3NI9A 4HNBA 1GA0A 3AGEA 4KZ4A 4EEPA 3W4OA 1CEFA 2K7SA 2P08A 4Y0OA 5EM0A 3G6OA 2WKRA 4E04A 4QWOA 4O01A 3FPWA 5AQAA 5FQIA 3V50A 3UB7A 3VV4A 2HP9A 3PTEA 4HQAA 4QPRA 3Q7ZA 4LV1A 2B02A 3PBOA 3ZVTA 1PZPA 2PAVP 4K91A 1Y28A 4CLCD 2Q0OA 1XJ6A 3IF5A 1YMXA 5U47A 2HDRA 5E2FA 1FSWA 3P01A 1TDGA 5CHUA 3MSHA 5HDDA 1YAXA 2GNXA 2O9CA 2WKIA 4HH2A 3ZDJA 5EVIC 4E3LA 4S2NC 2Y2IA 5FAOA 4H6JA 1PI4A 4DRTA 4ZJ3A 1OPXA 4QHCA 2W27A 1GHPA 2H10A 3G32A 1ONGA 1K57C 4LRXC 4ETXA 3BQAA 2XR0A 4OH0A 2HP6A 4DJ2A 1HVBA 1Z09A 4EETB 3IXDA 1K38A 3VOLA 3CUEC 2XSSA 2M7VA 2PD8A 4LENA 1S66L 2H0YA 2FZ0A 2YKHA 1BYWA 1VETB 2Q9NA 2XQZA 3D4FA 3VMAA 3VP1A 1DP9A 1XA1A 4H6JB 3G34A 5KSCA 2ZD8A 1F5MA 4NETA 3G2YA 3MQOA 1KGGA 1Q2QA 3KSFA 1JWVA 2VEAA 3C2WA 2O99A 4M3KA 4YFMA 5J3WA 5AVFA 2XH9A 1P9RA 4OQ0A 2G2WA 4E6WA 5DF7A 1GSXA 2PYPA 3T4OA 1Q2PA 5HPIA 1BSGA 2ZC6B 5DTTA 1KE4A 2EX9A 2LB5A 3T50A 2JKGA 3CPTA 4WZ5C 1A0KA 4KZ7A 5EECA 4NXEA 1HTZA 4OOMA 1PWCA 3DBAA 3WS1A 4HHDA 1W8QA 4HP9A 4LGWA 4G3KA 3FKVA 4RA7A 1M40A 4DE2A 3TRCA 1S0WA 1BTLA 1IELA 4GOGA 4JGQA 4X56A 3WRZA 3LEZA 1D06A 2XA7S 4XT2A 1LL9A 3HBRA 3GMWA 2PHYA 2A24A 5FEGA 2V8FA 3UMEA 1FCNA 1HD8A 2P74A 5CTNA 1M6KA 3BFDA 1I5QA 4E3OA 3CPTB 3RXWA 1TDLA 1G28A 3G35A 4MBKA 3T1RA 1NWZA 4F94A 4Y0TA 3IX3A 3O5YA 4L9GA 2W0NA 3LYXA 4N9LA 4BBVA 4GB7A 5EVLA 3N8SA 4FUWA 3G4PA 5DFXA 1ODVA 3DTEA 1N9OA 4S2PA 4P85A 2EXBA 3C4OA 4XT2B 2EA9A 5FQQA 4MCWA 5TBMA 3V3RA 2A24B 3GECA 2Y2MA 2W3FA 2ZOHA 4PMAA 3MFXA 4QJGA 4BENA 4MN6A 1JTDA 4QY6A 4JF5A 4BQMA 2Y2KA 2VX8A 2Z2MB 1KDWA 5M19A 5FI7A 4Y13A 4L9EA 4N1XA 1TF1A 4DE1A 1D1JA 2JKTI 3T1XA 5HPFA 1N9NA 4X6TA 1KVLA 2JE5A 4E3KA 3QP1A 3BEBA 3QP6A 2DMWA 5TBMB 4O7DA 4DDSA 2XF3A 3E0YA 2R78A 3IHBA 4Y0UA 1MKMA 1MWSA 4I38A 2PD7A 2NUTC 4FCFA 3UO9A 3CITA 5DJUA 3ZHHA 2WAEA 2B95A 4OOLA 2OWJA 1V9ZA 3KSGA 2PU4A 4R1GA 1YPRA 1ERQA 1NZOA 5GLAA 2Y2QA 3NHQA 1G6AA 3BYDA 3VFHA 4B93A 4X53A 2QJ7A 1F2KA 1IYQA 2QWSA 1FOFA 4LFUA 3OBFA 1K25A 1P97A 4IVIA 3BFCA 4DJ3A 4C6YA 1MC0A 4ZRRA 2ZQCA 3S7NA 3LIFA 4ZDXA 1K4FA 1EWZA 3SZTA 5F1GA 4BLMA 1KOUA 1DY6A 1O7EA 1IKGA 4PM9A 3UB8A 4EXOA 1L3LA 4AFIA 4LCMA 4GDNA 1GHIA 2WUQA 1L0EA 1G6OA 4IJGA 4WYYA 3HLFA 4OOYA 3IS2A 3ZG7B 3PBRA 4X68A 3NCKA 4KQRA 3VP0A 4R0QA 3V5MA 4UQIS 2KOIA 1DP8A 1S1ZA 4Q0HA 4X25A 4R23A 1VEUA 2WKEA 5FSRA 3N8LA 3IF6C 4IVKA 2NUPC 3MBZA 3ISGA 2FH5A 1I2WA 3ZFZA 3CI6A 3LR5A 1XXMA 3DWKA 1KDSA 4CLCC 2YKFA 1QMFA 2K31A 5CEDA 2GX5A 3N7WA 4EQIA 1IYPA 3IS2B 1V9YA 3GRJA 2B18A 4CLCE 3M2JA 1S4RA 4UHUA 2V8CA 4CJNA 1VEUB 4G3VA 3IH8A 3GR2A 3HJIA 1RP5A 3QP5A 5G18A 3VFFA 4QB8A 4MN7A 3KYEA 1FQGA 2J80A 3UE6A 1KE3A 5GLDA 2ZBBA 3BJNA 5L09A 1NJ4A 4GZBA 2V20A 3UDIA 1YLZA 4A5RA 4OP5A 3MQQA 2PU2A 4NG2A 2C6WB 4E3NA 3HLWA 1ALQA 1N4OA 3TJZC 2I9VA 1PFLA 1AWIA 5HWVA 3W4PA 2Y2LA 4I3JA 5CHMA 2XD1A 3IXBA 4DXCA 3LFVA 3KSHA 1KE0A 1LSVA 1SKOA 3A3DA 5EPHA 4R3BA 2Y79A 3IX4A 2J7VA 2GDNA 4B4ZA 5GLCA 4EESA 4LPZA 4WM9A 4U3TA 4WLAA 1PWDA 3N4IA 1TD5A 1BUEA 1SHVA 1T19A 4HJ4A 3LR3A 2JC7A 2DNSA 2QKPA 3FC7A 5EFWA 2A49A 3T1SA 1OTAA 3ZG5A 2VV8A 2OV5A 5CRFA 1IYOA 4GJ4A 4X55A 5DF9A 1K6SA 4HESA 5HAIA 3MXQA 1ONHA 1SKOB 3ITAA 1S6RA 4I5SA 4D2OA 2O9BA 3EWKA 4YINA 2MJ6A 2PYRA 5J8XA 2PDRA 3NDGA 1JTGA 1CI9A 3KX0X 2QMIA 4KG5A 5HFOA 3NBLA 1OT6A 1MKIA 3BQ8A 2QPNA 1OTBA 3LGOA 2EFUA 4MBFA 4KENB 3JVUA 1WE4A 4M4XA 4OPQA 5HDSA 4NXGA 3E98A 2WGVA 4OLGA 3T1QB 2XROA 4PHTA 3UPPA 5EOOA 2L4RA 1NXYA 5HDCA 3VP2A 2ZJ9A 5DFYA 1OJGA 2J9PA 2XRNA 1PWGA 1ZHHB 4IUHA 3LICA 3RXXA 4L9FA 3GQZA 2V0UA 2JBFA 4IBXA 1JWPA 1PW8A 3OC2A 4S2OA 5FDHA 4GCZA 1BLCA 4KZ8A 3BECA 3PR6A 2WADA 5GHZA 3F1OA 2I72A 2HGVA 4DN0A 2W1TA 2IWCA 1S4SA 3UE1A 4UEYA 4Q8IA 4N9KA 3OCLA 4MMNA 5HARA 2ZM8A 4IHQA 1VETA 3GTCA 2VK3A 4DE0A 3C7UA 3VSLA 1ZC2A 1E4DA 2JHEA 4FTXA 4O0PA 3MMHA 3VP4A 1UGUA 2P7JA 3HREA 2OLVA 1CJFA 2OAP1 1D7EA 3RJUA 5GHYA 2BG1A 1LHYA 3O86A 4Y17A 3F1OB 4IEDA 4UQIM 2W1TB 3B33A 3HUMA 1H8YA 2AVXA 3NJAA 4GS9A 3WS0A 3MF0A 2JN7A 3LI8A 2Y55A 5EUAA 4X1LA 4KG2A 2V1BA 4PM5A 4S2JA 3IWQA 1NLZA 5HAQA 1LL8A 2Q9MA 3T4JA 5HAPA 3A0RA 4NXBA 4FOFA 2L1MA 2B5RA 3TSGA 1H3QA 2BTFP 3LIDA 2EWVA 4XXRA 2A3UA 1ZKJA 5L8MA 1CF0A 4PKYG 2WK0A 5K5BA 2ZC3B 4FD8A 4II7A 3HCYA 1JVJA 5AVEA 3PXPA 1TS6A 4GS9B 1BZAA 4E6XA 5AQBA 3MR0A 5FI2A 4OVDA 5CXWA 1G68A 3SH9A 3TOIA 3M6HA 4K0XA 3NIAA 2Y4AA 4QD4A 2HV1A 3UDXA 5EVEA 5CEBA 4S2IA 3T4KA 1FR6A 1TS7A 1TEMA 1LL5A 5AJGA 4DKIA 3PAEA 3S22A 2Y91A 3SH8A 3ZQ5A 1PYYA 4ZTKA 5AQ7A 4BBUA 2Z2LB 5HZHA 3CUEA 4KG6A 4ZJ1A 4Q0IA 5KMWA 1AXBA 5DTSA 3GDIA 2IWBA 2WAFA 4S2MA 3SS4A 5D3OA 4NEED 3OCNA 1YLYA 2PR6A 4DDYA 3B47A 2HJEA 3HLGA 2UWXA 3BWLA 3D72A 3IWIA 1PI5A 1YLWA 3G31A 2V1ZA 2HF6A 1VQQA 2Y2NA 3D3OA 3AGFA 4HBUA 3BY9A 4ZBEA 3S4XA 3T4LA 4NK3A 3LIEA 5DTKA 2WKHA 5F69A 2BASA 1T18A 4KQDA 2XLNA 4EW7A 3P98A 2W3DA 5BOHA 4GHIA 3FYZA 3LUQA 3Q7VB 3T4TA 4NKPA 3MKFA 2ZLYA 3C30A 3ZNYA 1WYBA 2RCXA 1PRQA 2IWDA 5EM1A 3F1PA 1T1CA 3ZNTA 4OPRA 4B88A 4JF6A 2ZC5B 1MWTA 2EFXA 1NYYA 2INWA 4WMCD 5HX9A 1LLBA 2J8YA 4FH4A 5G4YA 4GHIB 4MLLA 4RX3A 2K2NA 2Y2OA 4LCLA 3UB6A 3V67A 2E8IA 3FZCA 4WN5A 5TR7A 1W63Q 5JYPA 3TG9A 2VJWA 4L0LA 5EVID 3F1PB 3FV7A 3S7PA 5FQ9A 3EEHA 2EX6A 3LY4A 2W1RA 2ZQ7A 4B9OA 3DAVA 5HWTA 2VKSA 4JXGA 4BD1A 3O3VA 1K55A 2GJ3A 4K08A 4EWFA 4P6ZS 5F6AA 4HIAA 3AGDA 1GSWA 2XFSA 3A3JA 2R9WA 2C5WB 5KIZA 3C4PA 4XUZA 2OOLA 5TGFA 5HSQA 1TVFA 3L9KA 1J9MA 1E25A 3ZGAB 2XK1A 2H0TA 5A92A 4RX2A 1MBLA 1L0FA 1EROA 3S7QA 4R3AA 3UMDA 1YLPA 4MN5A 5HL1A 3EQVA 4R70A 1CEGA 4GW9A 2QJ5A 3C5AA 5J7EA 4EU0A 4HJ3A 3Q1FA 5F68A 1XFNA 2WGIA 2P9VA 4RVAA 5CTMA 1SCWA 3T4SA 1PW1A 4F3LA 1NLYA 4WZ4A 1MWRA 2XD5A 1MZUA 4KQQA 3PBTA 3G2ZA 5JYOA 3ZVWA 3KSIA 3ULFA 2ZQ9A 2PBDP 3NOPC 5A8BA 3UDFA 5FQKA 4R4RA 4ZAMA 1YLJA 3W4QA 2P9VB 1K6RA 3LEQA 4LRZE 1EI5A 2WKQA 3P7NA 4F3LB 3JYIA 2VZWA 1F98A 4X69A 1XGJA 1SZVA 2V0WA 3IWOA 1O07A 1K0KA 5KSHA 3MZEA 5DKKA 3P09A 5GLBA 2D02A 1GCEA 3H7WA 3BFGA 3SOIA 3WS5A 2XA7M 3NOUC 4S2KA 3GSGA 3QNCA 4Y5FA 3ZG0A 2J9OA 2ZC4B 4WEJA 5HW3A 2WYXA 4I3IA 5DKLA 3WS4A 3RFBA 4N92A 3E2LA 1FCOA 2ZQDA 3BFFA 4BMWA 3NOTC 4KZAA 3E4OA 1GSVA 4N1HA 4E3IA 1P9WA 1FIKA 3KO6A 3ZG9B 4G3WA 3VE4A 5CHJA 4EBPA 1K54A 2CC1A 1TS0A 3H7WB 3OZHA 1W7FA 3DW0A 2HDSA 2ZL1A 1KVMA 5F82A 3QHYA 2WZXA 4KZ5A 4Y15A 3SS3A 1H8MA 4OP8A 1NRJA 2ACGA 2EX8A 4HJ6A 1ES5A 3S1YA 1UWPX 1HZOA 2GZAA 2LB9A 4MBHA 2A2LA 5EOEA 2VA0A 1BLSA 4YWZA 3EQUA 2OWHA 5HD5A 3OPHA 4E3MA 5FEFA 4OQGA 3UE3A 1JNUA 2ZL1B 3A3FA 1XFQA 1FCMA 3QNBA 3HLEA 3V3SA 1VHMA 2HZ5A 4OQHA 3VOZA 1T1BA 3TE8A 2QHKA 4JGRA 4YOFA 5KZHA 3G30A 3Q82A 1DJBA 4WL9A 2JCHA 5EE8A 1ESIA 4CQHA 3SS5A 4LV2A 2ZOIA 2O9AA 3MQ0A 1NYMA 2HP5A 1N9LA 4P6ZM 3CMZA 2UV0E 3BY8A 4HP4A 1H5XA 2X02A 4D60A 4H8RA 3FG8A 4JF4A 5LBRA 4KQOA 3EGDC 3R7WA 3N8RA 3PBSA 3NECA 3BFEA 3EEAA 3IH9A 3D9YA 3PBNA 5CGXA 4MDZA 1SDNA 4ARZA 3O88A 4Y2FA 3UE0A 1DJCA 3BW6A 1J3WA 3FKWA 2PRFA 4Y3IA 3BLMA 2W3HA 4NXFA 3T12B 4JBFA 1LT0A 1XGIA 1YM1A 1YMSA 1ES2A 4MNRA 3ICYA 2VGLS 5HD3A 1ZG6A 2M7UA 4JPMA 3R7WB 4ESPA 4UA6A 1S67L 3MXSA 3KYQA 4FSFA 4S2LA 2Y2JA 2ZMVA 3IX8A 1HLUP 4ETZA 3R4KA 4R4SA 5FI6A 1NRFA 4OONA 3OPLA 5EV0A 3V39A 1L0DA 1OMEA 3QP8A 4ARZB 3IXHA 4Q0JA 4JKTA 2Y59A 2X01A 5TFQA 3DTKA 2J3TD 1DRMA 5FATA 4WBGA 1MXOA 1ES3A 3DWZA 5IHVA 4WMCA 5DJTA 2ZQAA 4OKPA 1PIOA 2WGWA 4OPZA 2ZMAA 5HWWA 4E3JA 2JKFA 2JKRM 3A0SA 5L2FA 2O0YA 1Y54A 1N9BA 1YQSA 3SH7A 4MEZA 1YSQA 2HDUA 3C7VA 5EVIA 4KUKA 4S2NA 2HJ9C 3C8CA 3L7HA 2FFFB 1YLTA 4KZ9A 3E4QA 1IFQA 4Z9QA 2CMNA 1ZTUA 2OLUA 4UAAA 1K57A 2VV6A 3OPRA 2V2FF 2VGJA 4BBTA 4CPKA 5IT5A 3ITBA 5IS1A 2IA2A 2E8JA 2WGWB 3UY6A 4P0MA 4GDBA 5FASA 2W3GA 2G2UA 3H9WA 4LV3A 4KZBA 4I3AA 4U0TA 1ES4A 4O8GA 2XDMA 4P6BA 3IBJA 1C3BA 2ZQ8A 5EVIB 1YSPA 2XGNA 3HL9A 3Q7VA 5FDSA 4R6LA 2Y8HA 4B4XA 4XUXA 2KDKA 4GN2A 1IKIA 3BM6A 3F1NA 4EBNA 1W8YA 5CX7A 4QY5A 5CGWA 3UN7A 2VGKA 3W8KA 2HDQA 4PM7A 5GHXA 4WEKA 5M1AA 4HOIA 4PPRA 4BWIA 3NC8A 2P04A 4WF0A 3OPPA 4EUZA 2X71A 3CAXA 3LIAA 1CQAA 1RCJA 1PNEA 5E2HA 3CLOA 1F9IA 4WZ5A 2WKPA 1KGEA 3OOVA 1IYSA 4BD0A 1ACFA 4KZ6A 1OTEA 3F1NB 4Y7PA 3MZDA 3VP3A 4GNUA 5M18A 2Y2PA 3CJMA 1U60A 4BL3A 1K55C 3LR4A 1E3UA 1SKFA 3K3CA 1EW0A 5CGSA 1LSWA 1FILA 3B42A 5F83A 2XFTA 1BLHA 1IOUA 1XA7A 1VB6A 1W79A 3TW8A 4GD8A 4JXWA 2D01A 1T1AA 5GL9A 4DE3A 2QYBA 4HI4A 5TJJA 3UPNA 2RL3A 2VLGA 1STZA 3K2NA 1OT9A 4ME4A 3FWLA 2R9XA 1I2SA 1UWNX 2FFYA 3SW1A 1FR1A 1BT5A 3LY3A 5AQ9A 1NY0A 3W2ZA 1GA9A 2ZM2A 3IQAA 5FAPA 5I5LA 4ZJ2A 4C75A 1DJAA 4OPYA 3LCEA 3IHAA 4GLQA 1H8ZA 4EUVA 5CECA 1X0OA 1CI8A 2KX6A 1FSYA 5DF8A 2L0WA 2PR5A 3WRTA 4JXSA 2V1AA 1L0GA 4LV0A 4JGPA 3ZG8B 1LI0A 1XKZA 4GD6A 3BLSA 3Q07A 4BL2A 3QP2A 1TS8A 3GV9A 3M2KA 3LR0A 1XP4A 1LI9A 3IT9A 4R38A 1ESUA 3E4PA 2DRWA 2XEPA
chains in the Genus database with same CATH topology
4F94A 2HDSA 4Y0TA 3VP4A 3WWXA 3HREA 1KVMA 2OLVA 4N9LA 5F82A 3QHYA 4GB7A 3ZCZA 3DTMA 1Z6FA 2WZXA 4KZ5A 5EVLA 3RJUA 4BJPA 3N8SA 2ZM0A 3SS3A 4OP8A 3G4PA 5GHYA 2BG1A 4PM6A 1GHMA 1LHYA 3O86A 1PZOA 4S2PA 4P85A 4IEDA 2EXBA 2EX8A 4WELA 3C4OA 5FQQA 1ES5A 3S1YA 3V3RA 3HUMA 2Y2MA 1HZOA 1H8YA 3NY4A 4HEFA 4P87A 4MBHA 3WS0A 5EOEA 1K56A 2Y55A 4PMAA 1BLSA 1MWUA 3CG5A 4QJGA 4R3JA 5EUAA 4BENA 1JTDA 4KG2A 4QY6A 4PM5A 4JF5A 3M6BA 2Y2KA 3EQUA 4S2JA 4BQMA 2Z2MB 1YT4A 1KDWA 3IWQA 5M19A 5HAQA 3A3EA 3OPHA 4HBTA 5FI7A 4E3MA 2Q9MA 4N1XA 3HUNA 4DE1A 5HAPA 3HLCA 4OQGA 3UE3A 2B5RA 3TSGA 3A3FA 1E3UD 4X6TA 1FCMA 3QNBA 3MZFA 1KVLA 3HLEA 2OSUA 4XXRA 2A3UA 1ZKJA 2JE5A 5DVAA 4E3KA 3V3SA 2WK0A 3BEBA 2EX2A 2ZC3B 3E2KA 3MFDA 4FD8A 5FQJA 3HLBA 4OQHA 1L2SA 1JVJA 4O7DA 4DDSA 1NZUA 4EBLA 2XF3A 3VOZA 1K54C 3B3XA 3IHBA 2EXAA 1BZAA 5FAQA 4Y0UA 4JLFA 4JXVA 5AQBA 4E6XA 1MWSA 5FI2A 3PBQA 4FH2A 1MY8A 4FCFA 5KZHA 4OVDA 3MKEA 5CXWA 3G30A 1CK3A 1G68A 3SH9A 3TOIA 3M6HA 3Q82A 1DJBA 3UO9A 3ZHHA 3HVFA 2WAEA 4K0XA 2JCHA 1RGZA 5EE8A 3NIAA 3IXGA 4OOLA 2Y4AA 4QD4A 3GVBA 1MPLA 3UDXA 1ESIA 3LO7A 5E2GA 3VOYA 5CEBA 2PU4A 4S2IA 3SS5A 4R1GA 1FR6A 4LV2A 1ERQA 1NZOA 1TEMA 5GLAA 1XX2A 2Y2QA 3BRMA 1NYMA 1G6AA 3BYDA 1LL5A 4OQIA 3VFHA 1ZG4A 4X53A 5E2EA 4DKIA 3PAEA 3HUOA 1IYQA 2HP5A 3S22A 1QMEA 1FOFA 2Y91A 4DXBA 5A90A 3SH8A 2H5SA 1K25A 1PYYA 4ZTKA 3CMZA 5AQ7A 1IEMA 2Z2LB 3IF6A 1H5XA 2X02A 4IVIA 3BFCA 4KG6A 4H8RA 4ZJ1A 5A93A 3UNWA 2WZZA 4K0WA 4C6YA 4JF4A 4KQOA 3N8RA 3PBSA 5KMWA 2ZQCA 1AXBA 4ZDXA 1K4FA 5DTSA 1ERMA 1EWZA 3BFEA 1SDEA 2IWBA 2WAFA 4S2MA 3SS4A 5D3OA 3OCNA 4RYEA 1YLYA 4DDYA 3IH9A 5E43A 3PBNA 3HLGA 4IBRA 5F1GA 3WS2A 2UWXA 5CGXA 1KGFA 1SDNA 4BLMA 3IWIA 1PI5A 3O88A 3N6IA 1JWZA 3UE0A 1WYCA 4QU3A 1DJCA 1DY6A 1YLWA 3G31A 3FKWA 3I7JA 1O7EA 3MXRA 4UA9A 4U0XA 2V1ZA 1IKGA 4PM9A 3BLMA 3A3IA 1VQQA 4LCMA 2Y2NA 4GDNA 4JBFA 1XGIA 3AGFA 1GHIA 4HBUA 4OLDA 2WUQA 4KZ3A 1YM1A 1L0EA 1YMSA 3IF6B 1ES2A 4MNRA 1ZG6A 4ZBEA 3S4XA 4WYYA 4JPMA 3HLFA 4NK3A 4OOYA 5A91A 5DTKA 3PBRA 3ZG7B 2WKHA 3CZDA 4UA6A 4X68A 3NCKA 4KQRA 3VP0A 3MXSA 2Y2HA 4FSFA 4R0QA 4S2LA 1VM1A 2Y2JA 3V5MA 2XLNA 3P98A 3NDEA 5BOHA 4R4SA 4ID4A 3FYZA 5FI6A 1NRFA 2BLSA 3OPLA 3Q7VB 4OONA 3UPOA 3V39A 1K56D 3MKFA 1L0DA 1OMEA 2ZLYA 3IXHA 4R23A 3ZNYA 1WYBA 4GKUA 2WKEA 4JKTA 2Y59A 5FSRA 3N8LA 2X01A 3IF6C 4IVKA 2RCXA 5FQMA 3HLDA 1BULA 5TFQA 3O87A 3MBZA 3ISGA 2IWDA 5FATA 4WBGA 1MXOA 1I2WA 3ZFZA 1ES3A 1BLPA 3DWZA 5IHVA 4DF6A 4WMCA 1XXMA 2ZQAA 4OKPA 3DWKA 1KDSA 2ZC7A 1PIOA 3ZNTA 2WGWA 1XPBA 4OPRA 4B88A 1QMFA 4JF6A 4OPZA 2ZMAA 3Q81A 5CEDA 2ZC5B 1MWTA 3N7WA 5FA7A 4E3JA 4EQIA 2EFXA 4C3QA 4PM8A 1NYYA 1IYPA 2Y2GA 5L2FA 1RGYA 3VSKA 2HPBA 4WMCD 4EV4A 3GRJA 5HX9A 5I94A 2PBYA 1Y54A 1LLBA 2J8YA 4FH4A 1N9BA 1YQSA 3SH7A 1K4EA 3M2JA 4MEZA 2DCFA 3PAGA 4MLLA 4RX3A 2HDUA 1W5DA 3C7VA 5EVIA 4S2NA 4UA7A 2Y2OA 2QZ6A 4UHUA 5F1FA 4LCLA 5CERA 4CJNA 2FFFB 2E8IA 3NI9A 1YLTA 3FZCA 3GR2A 3IH8A 4KZ9A 5TR7A 1RP5A 4Z9QA 1GA0A 5G18A 3AGEA 5JYPA 4KZ4A 3VFFA 3TG9A 2OLUA 4L0LA 4QB8A 5EVID 1FQGA 1KE3A 3FV7A 4UAAA 5GLDA 3W4OA 1K57A 3OPRA 1CEFA 2V2FF 2VGJA 5FQ9A 4CPKA 1NJ4A 3ITBA 4GZBA 2V20A 3UY6A 2WGWB 4Y0OA 3UDIA 4P0MA 1YLZA 4GDBA 4A5RA 4OP5A 5FASA 2PU2A 2EX6A 3LY4A 2C6WB 4E3NA 2G2UA 3HLWA 4LV3A 2ZQ7A 1ALQA 1N4OA 4KZBA 3DW0A 4U0TA 5AQAA 5FQIA 3V50A 1ES4A 4JXGA 2HP9A 4BD1A 3O3VA 1K55A 2XDMA 3PTEA 4P6BA 4EWFA 1C3BA 3W4PA 2Y2LA 2ZQ8A 3Q7ZA 5CHMA 2XD1A 4LV1A 5EVIB 3AGDA 3PBOA 3ZVTA 1PZPA 2XFSA 3IXBA 3A3JA 2R9WA 2C5WB 4DXCA 2XGNA 3HL9A 3Q7VA 1KE0A 3C4PA 4K91A 4XUZA 5TGFA 4B4XA 1TVFA 3A3DA 5EPHA 1J9MA 1E25A 4R3BA 4XUXA 2J7VA 4GN2A 2GDNA 4B4ZA 3ZGAB 1IKIA 2H0TA 2XK1A 5GLCA 5A92A 3BM6A 4RX2A 1MBLA 4EBNA 1W8YA 4U3TA 1L0FA 1YMXA 3IF5A 1EROA 4WM9A 1PWDA 3N4IA 5U47A 2HDRA 5E2FA 1FSWA 1BUEA 1SHVA 1TDGA 5CHUA 1YLPA 4QY5A 5CGWA 3UN7A 2JC7A 2VGKA 3W8KA 2HDQA 2DNSA 4PM7A 5GHXA 4E3LA 2WKIA 4WEKA 1E4DA 4PPRA 5EVIC 5M1AA 4S2NC 2A49A 3ZDJA 5HL1A 3NC8A 3EQVA 2Y2IA 5FAOA 1PI4A 4DRTA 3OPPA 4EUZA 1CEGA 3ZG5A 2X71A 4ZJ3A 4QHCA 2OV5A 1RCJA 1GHPA 2H10A 3G32A 5CRFA 1IYOA 1ONGA 3C5AA 5E2HA 1K57C 4X55A 5DF9A 4WZ5A 1K6SA 2XR0A 4HESA 3Q1FA 4OH0A 5HAIA 2HP6A 1ONHA 2WGIA 1KGEA 2P9VA 4RVAA 1HVBA 3ITAA 1S6RA 1SCWA 5CTMA 3IXDA 1IYSA 4D2OA 1K38A 1PW1A 4BD0A 4YINA 4KZ6A 4Y7PA 3MZDA 3VP3A 4GNUA 4LENA 5M18A 2Y2PA 3CJMA 4WZ4A 2H0YA 1MWRA 5J8XA 2XD5A 3NDGA 1JTGA 1U60A 1CI9A 2QMIA 4BL3A 4KG5A 1K55C 4KQQA 3PBTA 3G2ZA 5JYOA 2Q9NA 5HFOA 3ZVWA 3NBLA 2XQZA 3D4FA 1E3UA 1SKFA 3VMAA 3VP1A 1MKIA 2QPNA 5CGSA 1XA1A 2ZQ9A 5F83A 2EFUA 2XFTA 3G34A 1BLHA 4MBFA 4KENB 1WE4A 1XA7A 1W79A 2ZD8A 3UDFA 5KSCA 4GD8A 5FQKA 4OPQA 4JXWA 4R4RA 4ZAMA 4NETA 2WGVA 3G2YA 1KGGA 1Q2QA 1JWVA 4OLGA 5GL9A 1YLJA 3UPPA 3W4QA 4DE3A 4M3KA 2P9VB 1K6RA 4YFMA 5EOOA 3UPNA 2RL3A 1EI5A 1NXYA 2XH9A 3JYIA 4X69A 4OQ0A 2G2WA 1XGJA 3VP2A 3FWLA 2R9XA 4E6WA 2ZJ9A 5DF7A 3IWOA 1O07A 2J9PA 1Q2PA 1I2SA 1BSGA 1PWGA 5KSHA 2ZC6B 3RXXA 3MZEA 5DTTA 2FFYA 1KE4A 3P09A 1FR1A 1BT5A 2EX9A 3GQZA 1NY0A 3LY3A 5AQ9A 5GLBA 1GCEA 4WZ5C 4KZ7A 5EECA 1GA9A 2JBFA 2ZM2A 4IBXA 4MBKA 1JWPA 3BFGA 3IQAA 3SOIA 1HTZA 5FAPA 4ZJ2A 4C75A 4OOMA 3WS5A 1PWCA 1DJAA 1PW8A 3WS1A 4OPYA 3LCEA 3OC2A 3IHAA 1W8QA 4S2OA 5FDHA 1BLCA 3FKVA 4KZ8A 4RA7A 4S2KA 1M40A 3GSGA 3BECA 1H8ZA 3QNCA 2J9OA 3ZG0A 4DE2A 5CECA 2ZC4B 1CI8A 1S0WA 1BTLA 1IELA 4GOGA 4WEJA 5HW3A 1FSYA 2WYXA 4X56A 2WADA 3WRZA 5DF8A 3LEZA 3WS4A 5GHZA 2I72A 3WRTA 1LL9A 4JXSA 4N92A 1L0GA 3E2LA 4LV0A 1FCOA 3HBRA 3GMWA 2IWCA 3ZG8B 3UE1A 4Q8IA 1FCNA 2ZQDA 3BFFA 1HD8A 1LI0A 2P74A 1XKZA 4GD6A 5CTNA 4N9KA 4KZAA 1M6KA 3BFDA 3OCLA 4N1HA 4E3IA 5HARA 2ZM8A 1I5QA 3BLSA 3Q07A 4BL2A 4E3OA 3ZG9B 3GV9A 3GTCA 3M2KA 4DE0A 5CHJA 1XP4A 1LI9A 4EBPA 1K54A 2CC1A 3C7UA 3IT9A 3RXWA 3VSLA 1TDLA 1ZC2A 1ESUA 3G35A 3OZHA 1W7FA 2DRWA 2XEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F94 A;  2HDS A;  4Y0T A;  3VP4 A;  3WWX A;  3HRE A;  1KVM A;  2OLV A;  4N9L A;  5F82 A;  3QHY A;  4GB7 A;  3ZCZ A;  3DTM A;  1Z6F A;  2WZX A;  4KZ5 A;  5EVL A;  3RJU A;  4BJP A;  3N8S A;  2ZM0 A;  3SS3 A;  4OP8 A;  3G4P A;  5GHY A;  2BG1 A;  4PM6 A;  1GHM A;  1LHY A;  3O86 A;  1PZO A;  4S2P A;  4P85 A;  4IED A;  2EXB A;  2EX8 A;  4WEL A;  3C4O A;  5FQQ A;  1ES5 A;  3S1Y A;  3V3R A;  3HUM A;  2Y2M A;  1HZO A;  1H8Y A;  3NY4 A;  4HEF A;  4P87 A;  4MBH A;  3WS0 A;  5EOE A;  1K56 A;  2Y55 A;  4PMA A;  1BLS A;  1MWU A;  3CG5 A;  4QJG A;  4R3J A;  5EUA A;  4BEN A;  1JTD A;  4KG2 A;  4QY6 A;  4PM5 A;  4JF5 A;  3M6B A;  2Y2K A;  3EQU A;  4S2J A;  4BQM A;  2Z2M B;  1YT4 A;  1KDW A;  3IWQ A;  5M19 A;  5HAQ A;  3A3E A;  3OPH A;  4HBT A;  5FI7 A;  4E3M A;  2Q9M A;  4N1X A;  3HUN A;  4DE1 A;  5HAP A;  3HLC A;  4OQG A;  3UE3 A;  2B5R A;  3TSG A;  3A3F A;  1E3U D;  4X6T A;  1FCM A;  3QNB A;  3MZF A;  1KVL A;  3HLE A;  2OSU A;  4XXR A;  2A3U A;  1ZKJ A;  2JE5 A;  5DVA A;  4E3K A;  3V3S A;  2WK0 A;  3BEB A;  2EX2 A;  2ZC3 B;  3E2K A;  3MFD A;  4FD8 A;  5FQJ A;  3HLB A;  4OQH A;  1L2S A;  1JVJ A;  4O7D A;  4DDS A;  1NZU A;  4EBL A;  2XF3 A;  3VOZ A;  1K54 C;  3B3X A;  3IHB A;  2EXA A;  1BZA A;  5FAQ A;  4Y0U A;  4JLF A;  4JXV A;  5AQB A;  4E6X A;  1MWS A;  5FI2 A;  3PBQ A;  4FH2 A;  1MY8 A;  4FCF A;  5KZH A;  4OVD A;  3MKE A;  5CXW A;  3G30 A;  1CK3 A;  1G68 A;  3SH9 A;  3TOI A;  3M6H A;  3Q82 A;  1DJB A;  3UO9 A;  3ZHH A;  3HVF A;  2WAE A;  4K0X A;  2JCH A;  1RGZ A;  5EE8 A;  3NIA A;  3IXG A;  4OOL A;  2Y4A A;  4QD4 A;  3GVB A;  1MPL A;  3UDX A;  1ESI A;  3LO7 A;  5E2G A;  3VOY A;  5CEB A;  2PU4 A;  4S2I A;  3SS5 A;  4R1G A;  1FR6 A;  4LV2 A;  1ERQ A;  1NZO A;  1TEM A;  5GLA A;  1XX2 A;  2Y2Q A;  3BRM A;  1NYM A;  1G6A A;  3BYD A;  1LL5 A;  4OQI A;  3VFH A;  1ZG4 A;  4X53 A;  5E2E A;  4DKI A;  3PAE A;  3HUO A;  1IYQ A;  2HP5 A;  3S22 A;  1QME A;  1FOF A;  2Y91 A;  4DXB A;  5A90 A;  3SH8 A;  2H5S A;  1K25 A;  1PYY A;  4ZTK A;  3CMZ A;  5AQ7 A;  1IEM A;  2Z2L B;  3IF6 A;  1H5X A;  2X02 A;  4IVI A;  3BFC A;  4KG6 A;  4H8R A;  4ZJ1 A;  5A93 A;  3UNW A;  2WZZ A;  4K0W A;  4C6Y A;  4JF4 A;  4KQO A;  3N8R A;  3PBS A;  5KMW A;  2ZQC A;  1AXB A;  4ZDX A;  1K4F A;  5DTS A;  1ERM A;  1EWZ A;  3BFE A;  1SDE A;  2IWB A;  2WAF A;  4S2M A;  3SS4 A;  5D3O A;  3OCN A;  4RYE A;  1YLY A;  4DDY A;  3IH9 A;  5E43 A;  3PBN A;  3HLG A;  4IBR A;  5F1G A;  3WS2 A;  2UWX A;  5CGX A;  1KGF A;  1SDN A;  4BLM A;  3IWI A;  1PI5 A;  3O88 A;  3N6I A;  1JWZ A;  3UE0 A;  1WYC A;  4QU3 A;  1DJC A;  1DY6 A;  1YLW A;  3G31 A;  3FKW A;  3I7J A;  1O7E A;  3MXR A;  4UA9 A;  4U0X A;  2V1Z A;  1IKG A;  4PM9 A;  3BLM A;  3A3I A;  1VQQ A;  4LCM A;  2Y2N A;  4GDN A;  4JBF A;  1XGI A;  3AGF A;  1GHI A;  4HBU A;  4OLD A;  2WUQ A;  4KZ3 A;  1YM1 A;  1L0E A;  1YMS A;  3IF6 B;  1ES2 A;  4MNR A;  1ZG6 A;  4ZBE A;  3S4X A;  4WYY A;  4JPM A;  3HLF A;  4NK3 A;  4OOY A;  5A91 A;  5DTK A;  3PBR A;  3ZG7 B;  2WKH A;  3CZD A;  4UA6 A;  4X68 A;  3NCK A;  4KQR A;  3VP0 A;  3MXS A;  2Y2H A;  4FSF A;  4R0Q A;  4S2L A;  1VM1 A;  2Y2J A;  3V5M A;  2XLN A;  3P98 A;  3NDE A;  5BOH A;  4R4S A;  4ID4 A;  3FYZ A;  5FI6 A;  1NRF A;  2BLS A;  3OPL A;  3Q7V B;  4OON A;  3UPO A;  3V39 A;  1K56 D;  3MKF A;  1L0D A;  1OME A;  2ZLY A;  3IXH A;  4R23 A;  3ZNY A;  1WYB A;  4GKU A;  2WKE A;  4JKT A;  2Y59 A;  5FSR A;  3N8L A;  2X01 A;  3IF6 C;  4IVK A;  2RCX A;  5FQM A;  3HLD A;  1BUL A;  5TFQ A;  3O87 A;  3MBZ A;  3ISG A;  2IWD A;  5FAT A;  4WBG A;  1MXO A;  1I2W A;  3ZFZ A;  1ES3 A;  1BLP A;  3DWZ A;  5IHV A;  4DF6 A;  4WMC A;  1XXM A;  2ZQA A;  4OKP A;  3DWK A;  1KDS A;  2ZC7 A;  1PIO A;  3ZNT A;  2WGW A;  1XPB A;  4OPR A;  4B88 A;  1QMF A;  4JF6 A;  4OPZ A;  2ZMA A;  3Q81 A;  5CED A;  2ZC5 B;  1MWT A;  3N7W A;  5FA7 A;  4E3J A;  4EQI A;  2EFX A;  4C3Q A;  4PM8 A;  1NYY A;  1IYP A;  2Y2G A;  5L2F A;  1RGY A;  3VSK A;  2HPB A;  4WMC D;  4EV4 A;  3GRJ A;  5HX9 A;  5I94 A;  2PBY A;  1Y54 A;  1LLB A;  2J8Y A;  4FH4 A;  1N9B A;  1YQS A;  3SH7 A;  1K4E A;  3M2J A;  4MEZ A;  2DCF A;  3PAG A;  4MLL A;  4RX3 A;  2HDU A;  1W5D A;  3C7V A;  5EVI A;  4S2N A;  4UA7 A;  2Y2O A;  2QZ6 A;  4UHU A;  5F1F A;  4LCL A;  5CER A;  4CJN A;  2FFF B;  2E8I A;  3NI9 A;  1YLT A;  3FZC A;  3GR2 A;  3IH8 A;  4KZ9 A;  5TR7 A;  1RP5 A;  4Z9Q A;  1GA0 A;  5G18 A;  3AGE A;  5JYP A;  4KZ4 A;  3VFF A;  3TG9 A;  2OLU A;  4L0L A;  4QB8 A;  5EVI D;  1FQG A;  1KE3 A;  3FV7 A;  4UAA A;  5GLD A;  3W4O A;  1K57 A;  3OPR A;  1CEF A;  2V2F F;  2VGJ A;  5FQ9 A;  4CPK A;  1NJ4 A;  3ITB A;  4GZB A;  2V20 A;  3UY6 A;  2WGW B;  4Y0O A;  3UDI A;  4P0M A;  1YLZ A;  4GDB A;  4A5R A;  4OP5 A;  5FAS A;  2PU2 A;  2EX6 A;  3LY4 A;  2C6W B;  4E3N A;  2G2U A;  3HLW A;  4LV3 A;  2ZQ7 A;  1ALQ A;  1N4O A;  4KZB A;  3DW0 A;  4U0T A;  5AQA A;  5FQI A;  3V50 A;  1ES4 A;  4JXG A;  2HP9 A;  4BD1 A;  3O3V A;  1K55 A;  2XDM A;  3PTE A;  4P6B A;  4EWF A;  1C3B A;  3W4P A;  2Y2L A;  2ZQ8 A;  3Q7Z A;  5CHM A;  2XD1 A;  4LV1 A;  5EVI B;  3AGD A;  3PBO A;  3ZVT A;  1PZP A;  2XFS A;  3IXB A;  3A3J A;  2R9W A;  2C5W B;  4DXC A;  2XGN A;  3HL9 A;  3Q7V A;  1KE0 A;  3C4P A;  4K91 A;  4XUZ A;  5TGF A;  4B4X A;  1TVF A;  3A3D A;  5EPH A;  1J9M A;  1E25 A;  4R3B A;  4XUX A;  2J7V A;  4GN2 A;  2GDN A;  4B4Z A;  3ZGA B;  1IKI A;  2H0T A;  2XK1 A;  5GLC A;  5A92 A;  3BM6 A;  4RX2 A;  1MBL A;  4EBN A;  1W8Y A;  4U3T A;  1L0F A;  1YMX A;  3IF5 A;  1ERO A;  4WM9 A;  1PWD A;  3N4I A;  5U47 A;  2HDR A;  5E2F A;  1FSW A;  1BUE A;  1SHV A;  1TDG A;  5CHU A;  1YLP A;  4QY5 A;  5CGW A;  3UN7 A;  2JC7 A;  2VGK A;  3W8K A;  2HDQ A;  2DNS A;  4PM7 A;  5GHX A;  4E3L A;  2WKI A;  4WEK A;  1E4D A;  4PPR A;  5EVI C;  5M1A A;  4S2N C;  2A49 A;  3ZDJ A;  5HL1 A;  3NC8 A;  3EQV A;  2Y2I A;  5FAO A;  1PI4 A;  4DRT A;  3OPP A;  4EUZ A;  1CEG A;  3ZG5 A;  2X71 A;  4ZJ3 A;  4QHC A;  2OV5 A;  1RCJ A;  1GHP A;  2H10 A;  3G32 A;  5CRF A;  1IYO A;  1ONG A;  3C5A A;  5E2H A;  1K57 C;  4X55 A;  5DF9 A;  4WZ5 A;  1K6S A;  2XR0 A;  4HES A;  3Q1F A;  4OH0 A;  5HAI A;  2HP6 A;  1ONH A;  2WGI A;  1KGE A;  2P9V A;  4RVA A;  1HVB A;  3ITA A;  1S6R A;  1SCW A;  5CTM A;  3IXD A;  1IYS A;  4D2O A;  1K38 A;  1PW1 A;  4BD0 A;  4YIN A;  4KZ6 A;  4Y7P A;  3MZD A;  3VP3 A;  4GNU A;  4LEN A;  5M18 A;  2Y2P A;  3CJM A;  4WZ4 A;  2H0Y A;  1MWR A;  5J8X A;  2XD5 A;  3NDG A;  1JTG A;  1U60 A;  1CI9 A;  2QMI A;  4BL3 A;  4KG5 A;  1K55 C;  4KQQ A;  3PBT A;  3G2Z A;  5JYO A;  2Q9N A;  5HFO A;  3ZVW A;  3NBL A;  2XQZ A;  3D4F A;  1E3U A;  1SKF A;  3VMA A;  3VP1 A;  1MKI A;  2QPN A;  5CGS A;  1XA1 A;  2ZQ9 A;  5F83 A;  2EFU A;  2XFT A;  3G34 A;  1BLH A;  4MBF A;  4KEN B;  1WE4 A;  1XA7 A;  1W79 A;  2ZD8 A;  3UDF A;  5KSC A;  4GD8 A;  5FQK A;  4OPQ A;  4JXW A;  4R4R A;  4ZAM A;  4NET A;  2WGV A;  3G2Y A;  1KGG A;  1Q2Q A;  1JWV A;  4OLG A;  5GL9 A;  1YLJ A;  3UPP A;  3W4Q A;  4DE3 A;  4M3K A;  2P9V B;  1K6R A;  4YFM A;  5EOO A;  3UPN A;  2RL3 A;  1EI5 A;  1NXY A;  2XH9 A;  3JYI A;  4X69 A;  4OQ0 A;  2G2W A;  1XGJ A;  3VP2 A;  3FWL A;  2R9X A;  4E6W A;  2ZJ9 A;  5DF7 A;  3IWO A;  1O07 A;  2J9P A;  1Q2P A;  1I2S A;  1BSG A;  1PWG A;  5KSH A;  2ZC6 B;  3RXX A;  3MZE A;  5DTT A;  2FFY A;  1KE4 A;  3P09 A;  1FR1 A;  1BT5 A;  2EX9 A;  3GQZ A;  1NY0 A;  3LY3 A;  5AQ9 A;  5GLB A;  1GCE A;  4WZ5 C;  4KZ7 A;  5EEC A;  1GA9 A;  2JBF A;  2ZM2 A;  4IBX A;  4MBK A;  1JWP A;  3BFG A;  3IQA A;  3SOI A;  1HTZ A;  5FAP A;  4ZJ2 A;  4C75 A;  4OOM A;  3WS5 A;  1PWC A;  1DJA A;  1PW8 A;  3WS1 A;  4OPY A;  3LCE A;  3OC2 A;  3IHA A;  1W8Q A;  4S2O A;  5FDH A;  1BLC A;  3FKV A;  4KZ8 A;  4RA7 A;  4S2K A;  1M40 A;  3GSG A;  3BEC A;  1H8Z A;  3QNC A;  2J9O A;  3ZG0 A;  4DE2 A;  5CEC A;  2ZC4 B;  1CI8 A;  1S0W A;  1BTL A;  1IEL A;  4GOG A;  4WEJ A;  5HW3 A;  1FSY A;  2WYX A;  4X56 A;  2WAD A;  3WRZ A;  5DF8 A;  3LEZ A;  3WS4 A;  5GHZ A;  2I72 A;  3WRT A;  1LL9 A;  4JXS A;  4N92 A;  1L0G A;  3E2L A;  4LV0 A;  1FCO A;  3HBR A;  3GMW A;  2IWC A;  3ZG8 B;  3UE1 A;  4Q8I A;  1FCN A;  2ZQD A;  3BFF A;  1HD8 A;  1LI0 A;  2P74 A;  1XKZ A;  4GD6 A;  5CTN A;  4N9K A;  4KZA A;  1M6K A;  3BFD A;  3OCL A;  4N1H A;  4E3I A;  5HAR A;  2ZM8 A;  1I5Q A;  3BLS A;  3Q07 A;  4BL2 A;  4E3O A;  3ZG9 B;  3GV9 A;  3GTC A;  3M2K A;  4DE0 A;  5CHJ A;  1XP4 A;  1LI9 A;  4EBP A;  1K54 A;  2CC1 A;  3C7U A;  3IT9 A;  3RXW A;  3VSL A;  1TDL A;  1ZC2 A;  1ESU A;  3G35 A;  3OZH A;  1W7F A;  2DRW A;  2XEP A; 
#chains in the Genus database with same CATH topology
 3WWX A;  2VGL M;  2PT7 A;  5F5Y A;  3ZCZ A;  3DTM A;  1DP6 A;  1Z6F A;  4BJP A;  2ZM0 A;  4PM6 A;  1GHM A;  1OTD A;  1PZO A;  4WEL A;  3ZYT A;  3DTI A;  3NY4 A;  4HEF A;  4P87 A;  1OJ5 A;  1K56 A;  4LLO B;  4EQ1 A;  1MWU A;  3CG5 A;  4R3J A;  5FL3 A;  3M6B A;  4LRY C;  1YT4 A;  3A3E A;  3OLO A;  4HBT A;  3HUN A;  3HLC A;  5IU1 A;  3VE3 A;  1E3U D;  4JGO A;  3MZF A;  2OSU A;  5DVA A;  1XJ3 A;  3E2K A;  2EX2 A;  3MFD A;  5FQJ A;  3HLB A;  1L2S A;  1NZU A;  4EBL A;  3FPV A;  1K54 C;  1YKD A;  3B3X A;  4PKY A;  2EXA A;  3UB5 P;  5FAQ A;  4JLF A;  3MS6 A;  4JXV A;  1Y4O A;  3C38 A;  3RH8 B;  4X1M A;  3PBQ A;  4FH2 A;  3LI9 A;  3EOI A;  1MY8 A;  3MKE A;  1CK3 A;  3HJK A;  3HVF A;  3IBR A;  1RGZ A;  1P0Z A;  3IXG A;  3GVB A;  1MPL A;  3LO7 A;  5E2G A;  3VOY A;  1OTI A;  2JKR I;  1XX2 A;  3BRM A;  5J4E A;  4OQI A;  4EER A;  1ZG4 A;  5L10 A;  5E2E A;  3HUO A;  5MC7 A;  3JVV A;  1QME A;  3T4Q A;  5A90 A;  4DXB A;  2H5S A;  2J3T C;  1IEM A;  3IF6 A;  1S1Y A;  1XJ2 A;  5A93 A;  3UNW A;  2WZZ A;  4K0W A;  1W63 M;  2M1C A;  1ERM A;  4CLC A;  1SDE A;  4RYE A;  5E43 A;  3MJQ A;  4IBR A;  1XJ4 A;  3WS2 A;  2V9A A;  2J3W A;  1KGF A;  3N6I A;  1JWZ A;  1WYC A;  1WA9 A;  4QU3 A;  2VV7 A;  3I7J A;  3MXR A;  4UA9 A;  4U0X A;  1LSX A;  3A3I A;  2Z6C A;  2G7U A;  3JPU A;  4DMZ A;  4OLD A;  4KUO A;  4KZ3 A;  3S7O A;  3IF6 B;  2JKT M;  3LIB A;  5A91 A;  3A0V A;  3CZD A;  5L07 A;  2Y2H A;  4CLC B;  3K3D A;  4IUK A;  2KLI A;  1VM1 A;  3NDE A;  3PYP A;  4ID4 A;  3NUL A;  4RQ9 A;  4YNR A;  2BLS A;  3UPO A;  3RTY A;  1K56 D;  2ZMF A;  4PAU A;  3PHY A;  3UB9 A;  3U4L P;  5C5K A;  4GKU A;  3H82 A;  5G4Z A;  2H28 A;  4WUJ A;  5FQM A;  3HLD A;  1BUL A;  3O87 A;  1H0M A;  3EGX C;  1BLP A;  5HL6 A;  4DF6 A;  2ZC7 A;  4HY8 A;  1XPB A;  1G5U A;  3Q81 A;  5FA7 A;  4C3Q A;  3KYZ A;  4EEU A;  4PM8 A;  2Y2G A;  3U2A A;  1RGY A;  3VSK A;  2HPB A;  4EV4 A;  5I94 A;  2PBY A;  2OAQ 1;  3QP4 A;  2W3E A;  4Z1W A;  1K4E A;  2DCF A;  4HH3 A;  3PAG A;  1W5D A;  2EWW A;  4UA7 A;  2QZ6 A;  3CWF A;  3CHW P;  5F1F A;  5CER A;  4I39 A;  3H82 B;  2Z6D A;  3NI9 A;  4HNB A;  1GA0 A;  3AGE A;  4KZ4 A;  4EEP A;  3W4O A;  1CEF A;  2K7S A;  2P08 A;  4Y0O A;  5EM0 A;  3G6O A;  2WKR A;  4E04 A;  4QWO A;  4O01 A;  3FPW A;  5AQA A;  5FQI A;  3V50 A;  3UB7 A;  3VV4 A;  2HP9 A;  3PTE A;  4HQA A;  4QPR A;  3Q7Z A;  4LV1 A;  2B02 A;  3PBO A;  3ZVT A;  1PZP A;  2PAV P;  4K91 A;  1Y28 A;  4CLC D;  2Q0O A;  1XJ6 A;  3IF5 A;  1YMX A;  5U47 A;  2HDR A;  5E2F A;  1FSW A;  3P01 A;  1TDG A;  5CHU A;  3MSH A;  5HDD A;  1YAX A;  2GNX A;  2O9C A;  2WKI A;  4HH2 A;  3ZDJ A;  5EVI C;  4E3L A;  4S2N C;  2Y2I A;  5FAO A;  4H6J A;  1PI4 A;  4DRT A;  4ZJ3 A;  1OPX A;  4QHC A;  2W27 A;  1GHP A;  2H10 A;  3G32 A;  1ONG A;  1K57 C;  4LRX C;  4ETX A;  3BQA A;  2XR0 A;  4OH0 A;  2HP6 A;  4DJ2 A;  1HVB A;  1Z09 A;  4EET B;  3IXD A;  1K38 A;  3VOL A;  3CUE C;  2XSS A;  2M7V A;  2PD8 A;  4LEN A;  1S66 L;  2H0Y A;  2FZ0 A;  2YKH A;  1BYW A;  1VET B;  2Q9N A;  2XQZ A;  3D4F A;  3VMA A;  3VP1 A;  1DP9 A;  1XA1 A;  4H6J B;  3G34 A;  5KSC A;  2ZD8 A;  1F5M A;  4NET A;  3G2Y A;  3MQO A;  1KGG A;  1Q2Q A;  3KSF A;  1JWV A;  2VEA A;  3C2W A;  2O99 A;  4M3K A;  4YFM A;  5J3W A;  5AVF A;  2XH9 A;  1P9R A;  4OQ0 A;  2G2W A;  4E6W A;  5DF7 A;  1GSX A;  2PYP A;  3T4O A;  1Q2P A;  5HPI A;  1BSG A;  2ZC6 B;  5DTT A;  1KE4 A;  2EX9 A;  2LB5 A;  3T50 A;  2JKG A;  3CPT A;  4WZ5 C;  1A0K A;  4KZ7 A;  5EEC A;  4NXE A;  1HTZ A;  4OOM A;  1PWC A;  3DBA A;  3WS1 A;  4HHD A;  1W8Q A;  4HP9 A;  4LGW A;  4G3K A;  3FKV A;  4RA7 A;  1M40 A;  4DE2 A;  3TRC A;  1S0W A;  1BTL A;  1IEL A;  4GOG A;  4JGQ A;  4X56 A;  3WRZ A;  3LEZ A;  1D06 A;  2XA7 S;  4XT2 A;  1LL9 A;  3HBR A;  3GMW A;  2PHY A;  2A24 A;  5FEG A;  2V8F A;  3UME A;  1FCN A;  1HD8 A;  2P74 A;  5CTN A;  1M6K A;  3BFD A;  1I5Q A;  4E3O A;  3CPT B;  3RXW A;  1TDL A;  1G28 A;  3G35 A;  4MBK A;  3T1R A;  1NWZ A;  4F94 A;  4Y0T A;  3IX3 A;  3O5Y A;  4L9G A;  2W0N A;  3LYX A;  4N9L A;  4BBV A;  4GB7 A;  5EVL A;  3N8S A;  4FUW A;  3G4P A;  5DFX A;  1ODV A;  3DTE A;  1N9O A;  4S2P A;  4P85 A;  2EXB A;  3C4O A;  4XT2 B;  2EA9 A;  5FQQ A;  4MCW A;  5TBM A;  3V3R A;  2A24 B;  3GEC A;  2Y2M A;  2W3F A;  2ZOH A;  4PMA A;  3MFX A;  4QJG A;  4BEN A;  4MN6 A;  1JTD A;  4QY6 A;  4JF5 A;  4BQM A;  2Y2K A;  2VX8 A;  2Z2M B;  1KDW A;  5M19 A;  5FI7 A;  4Y13 A;  4L9E A;  4N1X A;  1TF1 A;  4DE1 A;  1D1J A;  2JKT I;  3T1X A;  5HPF A;  1N9N A;  4X6T A;  1KVL A;  2JE5 A;  4E3K A;  3QP1 A;  3BEB A;  3QP6 A;  2DMW A;  5TBM B;  4O7D A;  4DDS A;  2XF3 A;  3E0Y A;  2R78 A;  3IHB A;  4Y0U A;  1MKM A;  1MWS A;  4I38 A;  2PD7 A;  2NUT C;  4FCF A;  3UO9 A;  3CIT A;  5DJU A;  3ZHH A;  2WAE A;  2B95 A;  4OOL A;  2OWJ A;  1V9Z A;  3KSG A;  2PU4 A;  4R1G A;  1YPR A;  1ERQ A;  1NZO A;  5GLA A;  2Y2Q A;  3NHQ A;  1G6A A;  3BYD A;  3VFH A;  4B93 A;  4X53 A;  2QJ7 A;  1F2K A;  1IYQ A;  2QWS A;  1FOF A;  4LFU A;  3OBF A;  1K25 A;  1P97 A;  4IVI A;  3BFC A;  4DJ3 A;  4C6Y A;  1MC0 A;  4ZRR A;  2ZQC A;  3S7N A;  3LIF A;  4ZDX A;  1K4F A;  1EWZ A;  3SZT A;  5F1G A;  4BLM A;  1KOU A;  1DY6 A;  1O7E A;  1IKG A;  4PM9 A;  3UB8 A;  4EXO A;  1L3L A;  4AFI A;  4LCM A;  4GDN A;  1GHI A;  2WUQ A;  1L0E A;  1G6O A;  4IJG A;  4WYY A;  3HLF A;  4OOY A;  3IS2 A;  3ZG7 B;  3PBR A;  4X68 A;  3NCK A;  4KQR A;  3VP0 A;  4R0Q A;  3V5M A;  4UQI S;  2KOI A;  1DP8 A;  1S1Z A;  4Q0H A;  4X25 A;  4R23 A;  1VEU A;  2WKE A;  5FSR A;  3N8L A;  3IF6 C;  4IVK A;  2NUP C;  3MBZ A;  3ISG A;  2FH5 A;  1I2W A;  3ZFZ A;  3CI6 A;  3LR5 A;  1XXM A;  3DWK A;  1KDS A;  4CLC C;  2YKF A;  1QMF A;  2K31 A;  5CED A;  2GX5 A;  3N7W A;  4EQI A;  1IYP A;  3IS2 B;  1V9Y A;  3GRJ A;  2B18 A;  4CLC E;  3M2J A;  1S4R A;  4UHU A;  2V8C A;  4CJN A;  1VEU B;  4G3V A;  3IH8 A;  3GR2 A;  3HJI A;  1RP5 A;  3QP5 A;  5G18 A;  3VFF A;  4QB8 A;  4MN7 A;  3KYE A;  1FQG A;  2J80 A;  3UE6 A;  1KE3 A;  5GLD A;  2ZBB A;  3BJN A;  5L09 A;  1NJ4 A;  4GZB A;  2V20 A;  3UDI A;  1YLZ A;  4A5R A;  4OP5 A;  3MQQ A;  2PU2 A;  4NG2 A;  2C6W B;  4E3N A;  3HLW A;  1ALQ A;  1N4O A;  3TJZ C;  2I9V A;  1PFL A;  1AWI A;  5HWV A;  3W4P A;  2Y2L A;  4I3J A;  5CHM A;  2XD1 A;  3IXB A;  4DXC A;  3LFV A;  3KSH A;  1KE0 A;  1LSV A;  1SKO A;  3A3D A;  5EPH A;  4R3B A;  2Y79 A;  3IX4 A;  2J7V A;  2GDN A;  4B4Z A;  5GLC A;  4EES A;  4LPZ A;  4WM9 A;  4U3T A;  4WLA A;  1PWD A;  3N4I A;  1TD5 A;  1BUE A;  1SHV A;  1T19 A;  4HJ4 A;  3LR3 A;  2JC7 A;  2DNS A;  2QKP A;  3FC7 A;  5EFW A;  2A49 A;  3T1S A;  1OTA A;  3ZG5 A;  2VV8 A;  2OV5 A;  5CRF A;  1IYO A;  4GJ4 A;  4X55 A;  5DF9 A;  1K6S A;  4HES A;  5HAI A;  3MXQ A;  1ONH A;  1SKO B;  3ITA A;  1S6R A;  4I5S A;  4D2O A;  2O9B A;  3EWK A;  4YIN A;  2MJ6 A;  2PYR A;  5J8X A;  2PDR A;  3NDG A;  1JTG A;  1CI9 A;  3KX0 X;  2QMI A;  4KG5 A;  5HFO A;  3NBL A;  1OT6 A;  1MKI A;  3BQ8 A;  2QPN A;  1OTB A;  3LGO A;  2EFU A;  4MBF A;  4KEN B;  3JVU A;  1WE4 A;  4M4X A;  4OPQ A;  5HDS A;  4NXG A;  3E98 A;  2WGV A;  4OLG A;  3T1Q B;  2XRO A;  4PHT A;  3UPP A;  5EOO A;  2L4R A;  1NXY A;  5HDC A;  3VP2 A;  2ZJ9 A;  5DFY A;  1OJG A;  2J9P A;  2XRN A;  1PWG A;  1ZHH B;  4IUH A;  3LIC A;  3RXX A;  4L9F A;  3GQZ A;  2V0U A;  2JBF A;  4IBX A;  1JWP A;  1PW8 A;  3OC2 A;  4S2O A;  5FDH A;  4GCZ A;  1BLC A;  4KZ8 A;  3BEC A;  3PR6 A;  2WAD A;  5GHZ A;  3F1O A;  2I72 A;  2HGV A;  4DN0 A;  2W1T A;  2IWC A;  1S4S A;  3UE1 A;  4UEY A;  4Q8I A;  4N9K A;  3OCL A;  4MMN A;  5HAR A;  2ZM8 A;  4IHQ A;  1VET A;  3GTC A;  2VK3 A;  4DE0 A;  3C7U A;  3VSL A;  1ZC2 A;  1E4D A;  2JHE A;  4FTX A;  4O0P A;  3MMH A;  3VP4 A;  1UGU A;  2P7J A;  3HRE A;  2OLV A;  1CJF A;  2OAP 1;  1D7E A;  3RJU A;  5GHY A;  2BG1 A;  1LHY A;  3O86 A;  4Y17 A;  3F1O B;  4IED A;  4UQI M;  2W1T B;  3B33 A;  3HUM A;  1H8Y A;  2AVX A;  3NJA A;  4GS9 A;  3WS0 A;  3MF0 A;  2JN7 A;  3LI8 A;  2Y55 A;  5EUA A;  4X1L A;  4KG2 A;  2V1B A;  4PM5 A;  4S2J A;  3IWQ A;  1NLZ A;  5HAQ A;  1LL8 A;  2Q9M A;  3T4J A;  5HAP A;  3A0R A;  4NXB A;  4FOF A;  2L1M A;  2B5R A;  3TSG A;  1H3Q A;  2BTF P;  3LID A;  2EWV A;  4XXR A;  2A3U A;  1ZKJ A;  5L8M A;  1CF0 A;  4PKY G;  2WK0 A;  5K5B A;  2ZC3 B;  4FD8 A;  4II7 A;  3HCY A;  1JVJ A;  5AVE A;  3PXP A;  1TS6 A;  4GS9 B;  1BZA A;  4E6X A;  5AQB A;  3MR0 A;  5FI2 A;  4OVD A;  5CXW A;  1G68 A;  3SH9 A;  3TOI A;  3M6H A;  4K0X A;  3NIA A;  2Y4A A;  4QD4 A;  2HV1 A;  3UDX A;  5EVE A;  5CEB A;  4S2I A;  3T4K A;  1FR6 A;  1TS7 A;  1TEM A;  1LL5 A;  5AJG A;  4DKI A;  3PAE A;  3S22 A;  2Y91 A;  3SH8 A;  3ZQ5 A;  1PYY A;  4ZTK A;  5AQ7 A;  4BBU A;  2Z2L B;  5HZH A;  3CUE A;  4KG6 A;  4ZJ1 A;  4Q0I A;  5KMW A;  1AXB A;  5DTS A;  3GDI A;  2IWB A;  2WAF A;  4S2M A;  3SS4 A;  5D3O A;  4NEE D;  3OCN A;  1YLY A;  2PR6 A;  4DDY A;  3B47 A;  2HJE A;  3HLG A;  2UWX A;  3BWL A;  3D72 A;  3IWI A;  1PI5 A;  1YLW A;  3G31 A;  2V1Z A;  2HF6 A;  1VQQ A;  2Y2N A;  3D3O A;  3AGF A;  4HBU A;  3BY9 A;  4ZBE A;  3S4X A;  3T4L A;  4NK3 A;  3LIE A;  5DTK A;  2WKH A;  5F69 A;  2BAS A;  1T18 A;  4KQD A;  2XLN A;  4EW7 A;  3P98 A;  2W3D A;  5BOH A;  4GHI A;  3FYZ A;  3LUQ A;  3Q7V B;  3T4T A;  4NKP A;  3MKF A;  2ZLY A;  3C30 A;  3ZNY A;  1WYB A;  2RCX A;  1PRQ A;  2IWD A;  5EM1 A;  3F1P A;  1T1C A;  3ZNT A;  4OPR A;  4B88 A;  4JF6 A;  2ZC5 B;  1MWT A;  2EFX A;  1NYY A;  2INW A;  4WMC D;  5HX9 A;  1LLB A;  2J8Y A;  4FH4 A;  5G4Y A;  4GHI B;  4MLL A;  4RX3 A;  2K2N A;  2Y2O A;  4LCL A;  3UB6 A;  3V67 A;  2E8I A;  3FZC A;  4WN5 A;  5TR7 A;  1W63 Q;  5JYP A;  3TG9 A;  2VJW A;  4L0L A;  5EVI D;  3F1P B;  3FV7 A;  3S7P A;  5FQ9 A;  3EEH A;  2EX6 A;  3LY4 A;  2W1R A;  2ZQ7 A;  4B9O A;  3DAV A;  5HWT A;  2VKS A;  4JXG A;  4BD1 A;  3O3V A;  1K55 A;  2GJ3 A;  4K08 A;  4EWF A;  4P6Z S;  5F6A A;  4HIA A;  3AGD A;  1GSW A;  2XFS A;  3A3J A;  2R9W A;  2C5W B;  5KIZ A;  3C4P A;  4XUZ A;  2OOL A;  5TGF A;  5HSQ A;  1TVF A;  3L9K A;  1J9M A;  1E25 A;  3ZGA B;  2XK1 A;  2H0T A;  5A92 A;  4RX2 A;  1MBL A;  1L0F A;  1ERO A;  3S7Q A;  4R3A A;  3UMD A;  1YLP A;  4MN5 A;  5HL1 A;  3EQV A;  4R70 A;  1CEG A;  4GW9 A;  2QJ5 A;  3C5A A;  5J7E A;  4EU0 A;  4HJ3 A;  3Q1F A;  5F68 A;  1XFN A;  2WGI A;  2P9V A;  4RVA A;  5CTM A;  1SCW A;  3T4S A;  1PW1 A;  4F3L A;  1NLY A;  4WZ4 A;  1MWR A;  2XD5 A;  1MZU A;  4KQQ A;  3PBT A;  3G2Z A;  5JYO A;  3ZVW A;  3KSI A;  3ULF A;  2ZQ9 A;  2PBD P;  3NOP C;  5A8B A;  3UDF A;  5FQK A;  4R4R A;  4ZAM A;  1YLJ A;  3W4Q A;  2P9V B;  1K6R A;  3LEQ A;  4LRZ E;  1EI5 A;  2WKQ A;  3P7N A;  4F3L B;  3JYI A;  2VZW A;  1F98 A;  4X69 A;  1XGJ A;  1SZV A;  2V0W A;  3IWO A;  1O07 A;  1K0K A;  5KSH A;  3MZE A;  5DKK A;  3P09 A;  5GLB A;  2D02 A;  1GCE A;  3H7W A;  3BFG A;  3SOI A;  3WS5 A;  2XA7 M;  3NOU C;  4S2K A;  3GSG A;  3QNC A;  4Y5F A;  3ZG0 A;  2J9O A;  2ZC4 B;  4WEJ A;  5HW3 A;  2WYX A;  4I3I A;  5DKL A;  3WS4 A;  3RFB A;  4N92 A;  3E2L A;  1FCO A;  2ZQD A;  3BFF A;  4BMW A;  3NOT C;  4KZA A;  3E4O A;  1GSV A;  4N1H A;  4E3I A;  1P9W A;  1FIK A;  3KO6 A;  3ZG9 B;  4G3W A;  3VE4 A;  5CHJ A;  4EBP A;  1K54 A;  2CC1 A;  1TS0 A;  3H7W B;  3OZH A;  1W7F A;  3DW0 A;  2HDS A;  2ZL1 A;  1KVM A;  5F82 A;  3QHY A;  2WZX A;  4KZ5 A;  4Y15 A;  3SS3 A;  1H8M A;  4OP8 A;  1NRJ A;  2ACG A;  2EX8 A;  4HJ6 A;  1ES5 A;  3S1Y A;  1UWP X;  1HZO A;  2GZA A;  2LB9 A;  4MBH A;  2A2L A;  5EOE A;  2VA0 A;  1BLS A;  4YWZ A;  3EQU A;  2OWH A;  5HD5 A;  3OPH A;  4E3M A;  5FEF A;  4OQG A;  3UE3 A;  1JNU A;  2ZL1 B;  3A3F A;  1XFQ A;  1FCM A;  3QNB A;  3HLE A;  3V3S A;  1VHM A;  2HZ5 A;  4OQH A;  3VOZ A;  1T1B A;  3TE8 A;  2QHK A;  4JGR A;  4YOF A;  5KZH A;  3G30 A;  3Q82 A;  1DJB A;  4WL9 A;  2JCH A;  5EE8 A;  1ESI A;  4CQH A;  3SS5 A;  4LV2 A;  2ZOI A;  2O9A A;  3MQ0 A;  1NYM A;  2HP5 A;  1N9L A;  4P6Z M;  3CMZ A;  2UV0 E;  3BY8 A;  4HP4 A;  1H5X A;  2X02 A;  4D60 A;  4H8R A;  3FG8 A;  4JF4 A;  5LBR A;  4KQO A;  3EGD C;  3R7W A;  3N8R A;  3PBS A;  3NEC A;  3BFE A;  3EEA A;  3IH9 A;  3D9Y A;  3PBN A;  5CGX A;  4MDZ A;  1SDN A;  4ARZ A;  3O88 A;  4Y2F A;  3UE0 A;  1DJC A;  3BW6 A;  1J3W A;  3FKW A;  2PRF A;  4Y3I A;  3BLM A;  2W3H A;  4NXF A;  3T12 B;  4JBF A;  1LT0 A;  1XGI A;  1YM1 A;  1YMS A;  1ES2 A;  4MNR A;  3ICY A;  2VGL S;  5HD3 A;  1ZG6 A;  2M7U A;  4JPM A;  3R7W B;  4ESP A;  4UA6 A;  1S67 L;  3MXS A;  3KYQ A;  4FSF A;  4S2L A;  2Y2J A;  2ZMV A;  3IX8 A;  1HLU P;  4ETZ A;  3R4K A;  4R4S A;  5FI6 A;  1NRF A;  4OON A;  3OPL A;  5EV0 A;  3V39 A;  1L0D A;  1OME A;  3QP8 A;  4ARZ B;  3IXH A;  4Q0J A;  4JKT A;  2Y59 A;  2X01 A;  5TFQ A;  3DTK A;  2J3T D;  1DRM A;  5FAT A;  4WBG A;  1MXO A;  1ES3 A;  3DWZ A;  5IHV A;  4WMC A;  5DJT A;  2ZQA A;  4OKP A;  1PIO A;  2WGW A;  4OPZ A;  2ZMA A;  5HWW A;  4E3J A;  2JKF A;  2JKR M;  3A0S A;  5L2F A;  2O0Y A;  1Y54 A;  1N9B A;  1YQS A;  3SH7 A;  4MEZ A;  1YSQ A;  2HDU A;  3C7V A;  5EVI A;  4KUK A;  4S2N A;  2HJ9 C;  3C8C A;  3L7H A;  2FFF B;  1YLT A;  4KZ9 A;  3E4Q A;  1IFQ A;  4Z9Q A;  2CMN A;  1ZTU A;  2OLU A;  4UAA A;  1K57 A;  2VV6 A;  3OPR A;  2V2F F;  2VGJ A;  4BBT A;  4CPK A;  5IT5 A;  3ITB A;  5IS1 A;  2IA2 A;  2E8J A;  2WGW B;  3UY6 A;  4P0M A;  4GDB A;  5FAS A;  2W3G A;  2G2U A;  3H9W A;  4LV3 A;  4KZB A;  4I3A A;  4U0T A;  1ES4 A;  4O8G A;  2XDM A;  4P6B A;  3IBJ A;  1C3B A;  2ZQ8 A;  5EVI B;  1YSP A;  2XGN A;  3HL9 A;  3Q7V A;  5FDS A;  4R6L A;  2Y8H A;  4B4X A;  4XUX A;  2KDK A;  4GN2 A;  1IKI A;  3BM6 A;  3F1N A;  4EBN A;  1W8Y A;  5CX7 A;  4QY5 A;  5CGW A;  3UN7 A;  2VGK A;  3W8K A;  2HDQ A;  4PM7 A;  5GHX A;  4WEK A;  5M1A A;  4HOI A;  4PPR A;  4BWI A;  3NC8 A;  2P04 A;  4WF0 A;  3OPP A;  4EUZ A;  2X71 A;  3CAX A;  3LIA A;  1CQA A;  1RCJ A;  1PNE A;  5E2H A;  3CLO A;  1F9I A;  4WZ5 A;  2WKP A;  1KGE A;  3OOV A;  1IYS A;  4BD0 A;  1ACF A;  4KZ6 A;  1OTE A;  3F1N B;  4Y7P A;  3MZD A;  3VP3 A;  4GNU A;  5M18 A;  2Y2P A;  3CJM A;  1U60 A;  4BL3 A;  1K55 C;  3LR4 A;  1E3U A;  1SKF A;  3K3C A;  1EW0 A;  5CGS A;  1LSW A;  1FIL A;  3B42 A;  5F83 A;  2XFT A;  1BLH A;  1IOU A;  1XA7 A;  1VB6 A;  1W79 A;  3TW8 A;  4GD8 A;  4JXW A;  2D01 A;  1T1A A;  5GL9 A;  4DE3 A;  2QYB A;  4HI4 A;  5TJJ A;  3UPN A;  2RL3 A;  2VLG A;  1STZ A;  3K2N A;  1OT9 A;  4ME4 A;  3FWL A;  2R9X A;  1I2S A;  1UWN X;  2FFY A;  3SW1 A;  1FR1 A;  1BT5 A;  3LY3 A;  5AQ9 A;  1NY0 A;  3W2Z A;  1GA9 A;  2ZM2 A;  3IQA A;  5FAP A;  5I5L A;  4ZJ2 A;  4C75 A;  1DJA A;  4OPY A;  3LCE A;  3IHA A;  4GLQ A;  1H8Z A;  4EUV A;  5CEC A;  1X0O A;  1CI8 A;  2KX6 A;  1FSY A;  5DF8 A;  2L0W A;  2PR5 A;  3WRT A;  4JXS A;  2V1A A;  1L0G A;  4LV0 A;  4JGP A;  3ZG8 B;  1LI0 A;  1XKZ A;  4GD6 A;  3BLS A;  3Q07 A;  4BL2 A;  3QP2 A;  1TS8 A;  3GV9 A;  3M2K A;  3LR0 A;  1XP4 A;  1LI9 A;  3IT9 A;  4R38 A;  1ESU A;  3E4P A;  2DRW A;  2XEP A; 
#chains in the Genus database with same CATH homology
 4F94 A;  2HDS A;  4Y0T A;  3VP4 A;  3WWX A;  3HRE A;  1KVM A;  2OLV A;  4N9L A;  5F82 A;  3QHY A;  4GB7 A;  3ZCZ A;  3DTM A;  1Z6F A;  2WZX A;  4KZ5 A;  5EVL A;  3RJU A;  4BJP A;  3N8S A;  2ZM0 A;  3SS3 A;  4OP8 A;  3G4P A;  5GHY A;  2BG1 A;  4PM6 A;  1GHM A;  1LHY A;  3O86 A;  1PZO A;  4S2P A;  4P85 A;  4IED A;  2EXB A;  2EX8 A;  4WEL A;  3C4O A;  5FQQ A;  1ES5 A;  3S1Y A;  3V3R A;  3HUM A;  2Y2M A;  1HZO A;  1H8Y A;  3NY4 A;  4HEF A;  4P87 A;  4MBH A;  3WS0 A;  5EOE A;  1K56 A;  2Y55 A;  4PMA A;  1BLS A;  1MWU A;  3CG5 A;  4QJG A;  4R3J A;  5EUA A;  4BEN A;  1JTD A;  4KG2 A;  4QY6 A;  4PM5 A;  4JF5 A;  3M6B A;  2Y2K A;  3EQU A;  4S2J A;  4BQM A;  2Z2M B;  1YT4 A;  1KDW A;  3IWQ A;  5M19 A;  5HAQ A;  3A3E A;  3OPH A;  4HBT A;  5FI7 A;  4E3M A;  2Q9M A;  4N1X A;  3HUN A;  4DE1 A;  5HAP A;  3HLC A;  4OQG A;  3UE3 A;  2B5R A;  3TSG A;  3A3F A;  1E3U D;  4X6T A;  1FCM A;  3QNB A;  3MZF A;  1KVL A;  3HLE A;  2OSU A;  4XXR A;  2A3U A;  1ZKJ A;  2JE5 A;  5DVA A;  4E3K A;  3V3S A;  2WK0 A;  3BEB A;  2EX2 A;  2ZC3 B;  3E2K A;  3MFD A;  4FD8 A;  5FQJ A;  3HLB A;  4OQH A;  1L2S A;  1JVJ A;  4O7D A;  4DDS A;  1NZU A;  4EBL A;  2XF3 A;  3VOZ A;  1K54 C;  3B3X A;  3IHB A;  2EXA A;  1BZA A;  5FAQ A;  4Y0U A;  4JLF A;  4JXV A;  5AQB A;  4E6X A;  1MWS A;  5FI2 A;  3PBQ A;  4FH2 A;  1MY8 A;  4FCF A;  5KZH A;  4OVD A;  3MKE A;  5CXW A;  3G30 A;  1CK3 A;  1G68 A;  3SH9 A;  3TOI A;  3M6H A;  3Q82 A;  1DJB A;  3UO9 A;  3ZHH A;  3HVF A;  2WAE A;  4K0X A;  2JCH A;  1RGZ A;  5EE8 A;  3NIA A;  3IXG A;  4OOL A;  2Y4A A;  4QD4 A;  3GVB A;  1MPL A;  3UDX A;  1ESI A;  3LO7 A;  5E2G A;  3VOY A;  5CEB A;  2PU4 A;  4S2I A;  3SS5 A;  4R1G A;  1FR6 A;  4LV2 A;  1ERQ A;  1NZO A;  1TEM A;  5GLA A;  1XX2 A;  2Y2Q A;  3BRM A;  1NYM A;  1G6A A;  3BYD A;  1LL5 A;  4OQI A;  3VFH A;  1ZG4 A;  4X53 A;  5E2E A;  4DKI A;  3PAE A;  3HUO A;  1IYQ A;  2HP5 A;  3S22 A;  1QME A;  1FOF A;  2Y91 A;  4DXB A;  5A90 A;  3SH8 A;  2H5S A;  1K25 A;  1PYY A;  4ZTK A;  3CMZ A;  5AQ7 A;  1IEM A;  2Z2L B;  3IF6 A;  1H5X A;  2X02 A;  4IVI A;  3BFC A;  4KG6 A;  4H8R A;  4ZJ1 A;  5A93 A;  3UNW A;  2WZZ A;  4K0W A;  4C6Y A;  4JF4 A;  4KQO A;  3N8R A;  3PBS A;  5KMW A;  2ZQC A;  1AXB A;  4ZDX A;  1K4F A;  5DTS A;  1ERM A;  1EWZ A;  3BFE A;  1SDE A;  2IWB A;  2WAF A;  4S2M A;  3SS4 A;  5D3O A;  3OCN A;  4RYE A;  1YLY A;  4DDY A;  3IH9 A;  5E43 A;  3PBN A;  3HLG A;  4IBR A;  5F1G A;  3WS2 A;  2UWX A;  5CGX A;  1KGF A;  1SDN A;  4BLM A;  3IWI A;  1PI5 A;  3O88 A;  3N6I A;  1JWZ A;  3UE0 A;  1WYC A;  4QU3 A;  1DJC A;  1DY6 A;  1YLW A;  3G31 A;  3FKW A;  3I7J A;  1O7E A;  3MXR A;  4UA9 A;  4U0X A;  2V1Z A;  1IKG A;  4PM9 A;  3BLM A;  3A3I A;  1VQQ A;  4LCM A;  2Y2N A;  4GDN A;  4JBF A;  1XGI A;  3AGF A;  1GHI A;  4HBU A;  4OLD A;  2WUQ A;  4KZ3 A;  1YM1 A;  1L0E A;  1YMS A;  3IF6 B;  1ES2 A;  4MNR A;  1ZG6 A;  4ZBE A;  3S4X A;  4WYY A;  4JPM A;  3HLF A;  4NK3 A;  4OOY A;  5A91 A;  5DTK A;  3PBR A;  3ZG7 B;  2WKH A;  3CZD A;  4UA6 A;  4X68 A;  3NCK A;  4KQR A;  3VP0 A;  3MXS A;  2Y2H A;  4FSF A;  4R0Q A;  4S2L A;  1VM1 A;  2Y2J A;  3V5M A;  2XLN A;  3P98 A;  3NDE A;  5BOH A;  4R4S A;  4ID4 A;  3FYZ A;  5FI6 A;  1NRF A;  2BLS A;  3OPL A;  3Q7V B;  4OON A;  3UPO A;  3V39 A;  1K56 D;  3MKF A;  1L0D A;  1OME A;  2ZLY A;  3IXH A;  4R23 A;  3ZNY A;  1WYB A;  4GKU A;  2WKE A;  4JKT A;  2Y59 A;  5FSR A;  3N8L A;  2X01 A;  3IF6 C;  4IVK A;  2RCX A;  5FQM A;  3HLD A;  1BUL A;  5TFQ A;  3O87 A;  3MBZ A;  3ISG A;  2IWD A;  5FAT A;  4WBG A;  1MXO A;  1I2W A;  3ZFZ A;  1ES3 A;  1BLP A;  3DWZ A;  5IHV A;  4DF6 A;  4WMC A;  1XXM A;  2ZQA A;  4OKP A;  3DWK A;  1KDS A;  2ZC7 A;  1PIO A;  3ZNT A;  2WGW A;  1XPB A;  4OPR A;  4B88 A;  1QMF A;  4JF6 A;  4OPZ A;  2ZMA A;  3Q81 A;  5CED A;  2ZC5 B;  1MWT A;  3N7W A;  5FA7 A;  4E3J A;  4EQI A;  2EFX A;  4C3Q A;  4PM8 A;  1NYY A;  1IYP A;  2Y2G A;  5L2F A;  1RGY A;  3VSK A;  2HPB A;  4WMC D;  4EV4 A;  3GRJ A;  5HX9 A;  5I94 A;  2PBY A;  1Y54 A;  1LLB A;  2J8Y A;  4FH4 A;  1N9B A;  1YQS A;  3SH7 A;  1K4E A;  3M2J A;  4MEZ A;  2DCF A;  3PAG A;  4MLL A;  4RX3 A;  2HDU A;  1W5D A;  3C7V A;  5EVI A;  4S2N A;  4UA7 A;  2Y2O A;  2QZ6 A;  4UHU A;  5F1F A;  4LCL A;  5CER A;  4CJN A;  2FFF B;  2E8I A;  3NI9 A;  1YLT A;  3FZC A;  3GR2 A;  3IH8 A;  4KZ9 A;  5TR7 A;  1RP5 A;  4Z9Q A;  1GA0 A;  5G18 A;  3AGE A;  5JYP A;  4KZ4 A;  3VFF A;  3TG9 A;  2OLU A;  4L0L A;  4QB8 A;  5EVI D;  1FQG A;  1KE3 A;  3FV7 A;  4UAA A;  5GLD A;  3W4O A;  1K57 A;  3OPR A;  1CEF A;  2V2F F;  2VGJ A;  5FQ9 A;  4CPK A;  1NJ4 A;  3ITB A;  4GZB A;  2V20 A;  3UY6 A;  2WGW B;  4Y0O A;  3UDI A;  4P0M A;  1YLZ A;  4GDB A;  4A5R A;  4OP5 A;  5FAS A;  2PU2 A;  2EX6 A;  3LY4 A;  2C6W B;  4E3N A;  2G2U A;  3HLW A;  4LV3 A;  2ZQ7 A;  1ALQ A;  1N4O A;  4KZB A;  3DW0 A;  4U0T A;  5AQA A;  5FQI A;  3V50 A;  1ES4 A;  4JXG A;  2HP9 A;  4BD1 A;  3O3V A;  1K55 A;  2XDM A;  3PTE A;  4P6B A;  4EWF A;  1C3B A;  3W4P A;  2Y2L A;  2ZQ8 A;  3Q7Z A;  5CHM A;  2XD1 A;  4LV1 A;  5EVI B;  3AGD A;  3PBO A;  3ZVT A;  1PZP A;  2XFS A;  3IXB A;  3A3J A;  2R9W A;  2C5W B;  4DXC A;  2XGN A;  3HL9 A;  3Q7V A;  1KE0 A;  3C4P A;  4K91 A;  4XUZ A;  5TGF A;  4B4X A;  1TVF A;  3A3D A;  5EPH A;  1J9M A;  1E25 A;  4R3B A;  4XUX A;  2J7V A;  4GN2 A;  2GDN A;  4B4Z A;  3ZGA B;  1IKI A;  2H0T A;  2XK1 A;  5GLC A;  5A92 A;  3BM6 A;  4RX2 A;  1MBL A;  4EBN A;  1W8Y A;  4U3T A;  1L0F A;  1YMX A;  3IF5 A;  1ERO A;  4WM9 A;  1PWD A;  3N4I A;  5U47 A;  2HDR A;  5E2F A;  1FSW A;  1BUE A;  1SHV A;  1TDG A;  5CHU A;  1YLP A;  4QY5 A;  5CGW A;  3UN7 A;  2JC7 A;  2VGK A;  3W8K A;  2HDQ A;  2DNS A;  4PM7 A;  5GHX A;  4E3L A;  2WKI A;  4WEK A;  1E4D A;  4PPR A;  5EVI C;  5M1A A;  4S2N C;  2A49 A;  3ZDJ A;  5HL1 A;  3NC8 A;  3EQV A;  2Y2I A;  5FAO A;  1PI4 A;  4DRT A;  3OPP A;  4EUZ A;  1CEG A;  3ZG5 A;  2X71 A;  4ZJ3 A;  4QHC A;  2OV5 A;  1RCJ A;  1GHP A;  2H10 A;  3G32 A;  5CRF A;  1IYO A;  1ONG A;  3C5A A;  5E2H A;  1K57 C;  4X55 A;  5DF9 A;  4WZ5 A;  1K6S A;  2XR0 A;  4HES A;  3Q1F A;  4OH0 A;  5HAI A;  2HP6 A;  1ONH A;  2WGI A;  1KGE A;  2P9V A;  4RVA A;  1HVB A;  3ITA A;  1S6R A;  1SCW A;  5CTM A;  3IXD A;  1IYS A;  4D2O A;  1K38 A;  1PW1 A;  4BD0 A;  4YIN A;  4KZ6 A;  4Y7P A;  3MZD A;  3VP3 A;  4GNU A;  4LEN A;  5M18 A;  2Y2P A;  3CJM A;  4WZ4 A;  2H0Y A;  1MWR A;  5J8X A;  2XD5 A;  3NDG A;  1JTG A;  1U60 A;  1CI9 A;  2QMI A;  4BL3 A;  4KG5 A;  1K55 C;  4KQQ A;  3PBT A;  3G2Z A;  5JYO A;  2Q9N A;  5HFO A;  3ZVW A;  3NBL A;  2XQZ A;  3D4F A;  1E3U A;  1SKF A;  3VMA A;  3VP1 A;  1MKI A;  2QPN A;  5CGS A;  1XA1 A;  2ZQ9 A;  5F83 A;  2EFU A;  2XFT A;  3G34 A;  1BLH A;  4MBF A;  4KEN B;  1WE4 A;  1XA7 A;  1W79 A;  2ZD8 A;  3UDF A;  5KSC A;  4GD8 A;  5FQK A;  4OPQ A;  4JXW A;  4R4R A;  4ZAM A;  4NET A;  2WGV A;  3G2Y A;  1KGG A;  1Q2Q A;  1JWV A;  4OLG A;  5GL9 A;  1YLJ A;  3UPP A;  3W4Q A;  4DE3 A;  4M3K A;  2P9V B;  1K6R A;  4YFM A;  5EOO A;  3UPN A;  2RL3 A;  1EI5 A;  1NXY A;  2XH9 A;  3JYI A;  4X69 A;  4OQ0 A;  2G2W A;  1XGJ A;  3VP2 A;  3FWL A;  2R9X A;  4E6W A;  2ZJ9 A;  5DF7 A;  3IWO A;  1O07 A;  2J9P A;  1Q2P A;  1I2S A;  1BSG A;  1PWG A;  5KSH A;  2ZC6 B;  3RXX A;  3MZE A;  5DTT A;  2FFY A;  1KE4 A;  3P09 A;  1FR1 A;  1BT5 A;  2EX9 A;  3GQZ A;  1NY0 A;  3LY3 A;  5AQ9 A;  5GLB A;  1GCE A;  4WZ5 C;  4KZ7 A;  5EEC A;  1GA9 A;  2JBF A;  2ZM2 A;  4IBX A;  4MBK A;  1JWP A;  3BFG A;  3IQA A;  3SOI A;  1HTZ A;  5FAP A;  4ZJ2 A;  4C75 A;  4OOM A;  3WS5 A;  1PWC A;  1DJA A;  1PW8 A;  3WS1 A;  4OPY A;  3LCE A;  3OC2 A;  3IHA A;  1W8Q A;  4S2O A;  5FDH A;  1BLC A;  3FKV A;  4KZ8 A;  4RA7 A;  4S2K A;  1M40 A;  3GSG A;  3BEC A;  1H8Z A;  3QNC A;  2J9O A;  3ZG0 A;  4DE2 A;  5CEC A;  2ZC4 B;  1CI8 A;  1S0W A;  1BTL A;  1IEL A;  4GOG A;  4WEJ A;  5HW3 A;  1FSY A;  2WYX A;  4X56 A;  2WAD A;  3WRZ A;  5DF8 A;  3LEZ A;  3WS4 A;  5GHZ A;  2I72 A;  3WRT A;  1LL9 A;  4JXS A;  4N92 A;  1L0G A;  3E2L A;  4LV0 A;  1FCO A;  3HBR A;  3GMW A;  2IWC A;  3ZG8 B;  3UE1 A;  4Q8I A;  1FCN A;  2ZQD A;  3BFF A;  1HD8 A;  1LI0 A;  2P74 A;  1XKZ A;  4GD6 A;  5CTN A;  4N9K A;  4KZA A;  1M6K A;  3BFD A;  3OCL A;  4N1H A;  4E3I A;  5HAR A;  2ZM8 A;  1I5Q A;  3BLS A;  3Q07 A;  4BL2 A;  4E3O A;  3ZG9 B;  3GV9 A;  3GTC A;  3M2K A;  4DE0 A;  5CHJ A;  1XP4 A;  1LI9 A;  4EBP A;  1K54 A;  2CC1 A;  3C7U A;  3IT9 A;  3RXW A;  3VSL A;  1TDL A;  1ZC2 A;  1ESU A;  3G35 A;  3OZH A;  1W7F A;  2DRW A;  2XEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...