1OTDA

Strong hydrogen bonds in photoactive yellow protein and their role in its photocycle
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
b'SQLDNLAFGAIQLDGDGTILQYNAAEGDITGRNPKEVIGKNFFKDVAPCTDSPEFSGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
molecule tags Signaling protein
source organism Halorhodospira halophila
publication title Short hydrogen bonds in photoactive yellow protein.
pubmed doi rcsb
total genus 30
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1otdA00
5HSQA 1N9NA 1F98A 2KX6A 1UGUA 4GW9A 4HIAA 1LSVA 2H28A 1D06A 2ZBBA 3G6OA 1EW0A 1V9YA 3MQOA 4XT2B 5G4YA 3GECA 3ZQ5A 1GSVA 2QKPA 1S1ZA 2R78A 5J7EA 4E04A 2VLGA 2EA9A 3K3CA 5HWWA 2YKFA 3ICYA 1DP9A 1S67L 1BYWA 4HOIA 4EESA 1XJ4A 3E4OA 5J3WA 4DJ2A 2VV6A 2A24B 2ZOIA 1TS7A 4MN5A 4EQ1A 3LIAA 2INWA 2QHKA 3F1PB 4NXBA 1OTDA 3PHYA 4HJ3A 2K7SA 1Y28A 4I3AA 4NXEA 3H9WA 4F3LA 1KOUA 4I38A 3A0SA 3FC7A 2PYPA 5I5LA 2JN7A 3OLOA 4H6JB 4WLAA 2PD7A 4WN5A 3UB9A 3LI8A 3VE4A 4BBTA 3KX0X 3LIFA 5HWTA 1T1CA 1GSXA 1N9LA 3VOLA 3F1PA 3HJKA 4JGOA 4BBVA 3UE6A 2VV7A 3LYXA 4WF0A 1ODVA 4HJ4A 3F1OA 3P7NA 4MN6A 4NXFA 3BWLA 4I3IA 4WUJA 1LL8A 2I9VA 5HDDA 5IS1A 4I3JA 3LUQA 3BY8A 3LIDA 2OOLA 3NOPC 4JGRA 4LLOB 1UWPX 5HWVA 4LRXC 1S1YA 4EW7A 2WKPA 3CLOA 3EEHA 4HH3A 5G4ZA 4K08A 1MZUA 4M4XA 5J4EA 4R70A 1DRMA 5F69A 3NOUC 2WKRA 3LICA 5AVEA 5A8BA 4L9EA 1OJ5A 4PKYG 5F6AA 3F1OB 5HDCA 1T19A 4YWZA 1DP8A 1D7EA 3UMEA 5KIZA 5F68A 5F5YA 1G28A 4BBUA 2ZOHA 1OTBA 5DJTA 4GHIB 4HNBA 2D02A 5DKKA 5HD3A 1T1BA 3F1NB 4HI4A 4GS9A 4KUOA 4NXGA 3UB6A 4B9OA 1GSWA 3FG8A 4WL9A 3H7WB 2HV1A 2PYRA 3E4PA 2Z6CA 3NJAA 4L9GA 1N9OA 3CAXA 2VV8A 3LIBA 1V9ZA 4F3LB 2W0NA 1TS8A 1S4RA 1XJ6A 2L1MA 2QWSA 3SW1A 4H6JA 4HHDA 4JGPA 3EWKA 3MR0A 3MJQA 4EEUA 2J80A 4R3AA 1DP6A 1T18A 2B02A 2V0UA 2YKHA 3IS2A 1LSXA 4GS9B 4EXOA 2WKQA 1OTIA 1JNUA 2QJ7A 4I5SA 1P97A 4LRZE 3ULFA 3A0VA 3A0RA 2V1BA 1XFNA 5DJUA 5HD5A 1XJ2A 1XJ3A 2JHEA 3CWFA 1OJGA 1LSWA 3C8CA 4KUKA 3T50A 2V0WA 1LT0A 4LPZA 1OT9A 2Z6DA 2CMNA 1P0ZA 4DJ3A 4PKYA 5DKLA 1XFQA 2P7JA 1WA9A 5HDSA 4GCZA 5TBMB 3RTYA 3UB8A 1NWZA 2PDRA 4R6LA 3LIEA 4HP4A 1VB6A 1OTEA 4L9FA 1UWNX 1TS0A 2W27A 3B33A 3IBRA 5IU1A 5AVFA 4EERA 4EEPA 3D72A 4EETB 5EFWA 4KQDA 1S4SA 2L4RA 2V9AA 2BASA 4I39A 1OT6A 2PD8A 3H82A 2OWHA 4GHIA 3K3DA 4JGQA 1T1AA 4HH2A 4HJ6A 2KDKA 3BY9A 3F1NA 3PYPA 5TBMA 3VE3A 3MXQA 2VEAA 3H7WA 4R38A 3E4QA 4HQAA 4RQ9A 1TS6A 2PHYA 3UMDA 4XT2A 1OTAA 3C2WA 3LI9A 2L0WA 3MQQA 3UB7A 2QJ5A 2PR6A 5HZHA 3NOTC 2D01A 1S66L 2M1CA 2GJ3A 2OWJA 2V1AA 3GDIA 4HY8A 3H82B 3MFXA 3RH8B 1X0OA 3HJIA 4HP9A 2PR5A 3NHQA 3IS2B 1F9IA 4LRYC 2A24A
chains in the Genus database with same CATH superfamily
5FEGA 3T4OA 1S0WA 3BLSA 5HWWA 1MWRA 5CEDA 2OLUA 1MWUA 1TS7A 3S1YA 4XUZA 3WS0A 3CJMA 4MBFA 3FC7A 2PYPA 2OAP1 3UB9A 4KZ7A 4X25A 4B4XA 3M6HA 3B42A 4S2NA 1MKIA 3FPWA 1BSGA 1PIOA 4NXFA 1NJ4A 3IX4A 1QMFA 3LUQA 4WMCA 3EEHA 5F6AA 4R4RA 3F1NB 4QPRA 3DWKA 1FOFA 2WGWA 3NJAA 1YLYA 2XGNA 4ETXA 2ZC7A 1V9ZA 4DE1A 4F3LB 1TS8A 5A92A 3UY6A 5DJUA 4QJGA 3V5MA 2V0WA 4CLCA 3S22A 1XFQA 2O99A 4UA6A 3W8KA 3A3DA 5FASA 5FDSA 1VB6A 2Y2HA 1YLZA 4EERA 2Y79A 3C38A 2XSSA 2G7UA 4ZJ3A 5DF7A 5EM1A 3VFHA 4BJPA 3UMDA 3VMAA 2Y2KA 3LI9A 1YLTA 2Y2MA 3N8LA 4JXSA 1IEMA 1LSVA 3NBLA 3GECA 1GSVA 1K4FA 4PAUA 1K55C 3SS5A 4HOIA 3S7NA 1EWZA 4OLDA 2ZOIA 3BFDA 4P6ZS 3LR5A 3PHYA 1CEFA 5I5LA 3A3EA 1MXOA 3VE4A 4A5RA 4S2MA 1L2SA 1L0DA 4IJGA 4KG6A 2HJEA 4NK3A 4JF5A 3QP2A 1FSWA 2XROA 5EE8A 2WKHA 3QP1A 2J9OA 3BLMA 5HDCA 1Z6FA 1OTBA 1GA0A 1T1BA 2J9PA 1K6SA 4JPMA 1KVLA 3C7VA 3Q7VB 2VV8A 1H8ZA 3IWQA 3MMHA 1W8QA 2JKRM 4X1LA 1ZHHB 2Q9MA 5FA7A 3SS3A 3MBZA 2HDQA 3A3IA 4LPZA 1MKMA 4O8GA 4DJ3A 1KE4A 2OAQ1 1ZG4A 5E43A 4BLMA 3B33A 5EV0A 4KZ5A 3VOYA 2FH5A 1SKOA 4QY5A 3BY9A 4E3LA 2ZQAA 2VEAA 1JWZA 4QY6A 2G2WA 5HZHA 4WYYA 1S66L 1PNEA 3DW0A 4DMZA 1BUEA 3Q7ZA 4Y15A 5G4YA 3T4LA 2FFFB 1S1ZA 4DE0A 1AWIA 5FEFA 5HFOA 2JKRI 3A3FA 3E4OA 3OPHA 1CF0A 3LIAA 2EX6A 2V8CA 4OPQA 1RP5A 1JWVA 2PBDP 3ZG8B 4LCMA 3UPOA 2ZMVA 3OLOA 1Q2PA 3PTEA 4MLLA 4WEKA 3KYEA 3HJKA 1CEGA 4HEFA 4P0MA 1PWGA 3P98A 5IS1A 2Q0OA 1ZTUA 3S4XA 5K5BA 5EUAA 3ITBA 2PT7A 4R3BA 4RX3A 2H5SA 4D2OA 4BWIA 4HBUA 3SH7A 3GMWA 2ZC3B 4HHDA 3I7JA 3VP0A 1LSXA 3ULFA 2XDMA 3MKEA 4ID4A 3HVFA 4EBNA 2XD1A 1YLPA 2EXAA 1NXYA 4II7A 2ZC5B 3IWIA 3WS2A 4JXWA 2JKTI 3UE0A 4E3OA 4AFIA 1UWNX 3WS1A 1CI9A 5DVAA 2V8FA 1EI5A 1IYOA 3H82A 4GHIA 3VE3A 1T1AA 1WYCA 3BFCA 5HAQA 2AVXA 5DF9A 1JTGA 2HP6A 1KDWA 1A0KA 2E8IA 4Q0HA 4M3KA 4EETB 4QD4A 5M1AA 2VV6A 2A24B 1YMXA 1G6OA 1H5XA 1FCNA 1L0GA 3GSGA 1YSQA 3AGDA 3F1PA 3HCYA 4XXRA 4BBVA 1IYPA 3B47A 3L9KA 4GN2A 3F1OA 4K0XA 3BWLA 3BW6A 5G18A 2VA0A 4JLFA 1S1YA 4FTXA 3C4PA 5G4ZA 3VP3A 3QHYA 2IWBA 3NOUC 1TDLA 1T19A 3MQ0A 2Y2NA 1BZAA 5FI2A 4MBKA 2Y8HA 4LV3A 1OPXA 2HDSA 3P01A 1P9RA 3BFEA 4OKPA 4DKIA 1XJ2A 2ZM2A 1BLPA 3PXPA 1VQQA 5CGSA 3UE3A 1IKGA 3GR2A 4EBPA 4N1XA 3C5AA 2EFXA 2I72A 3PR6A 3HLEA 2PHYA 5EVIA 3IF6A 2GDNA 2ZQ9A 3G30A 3T4KA 1KVMA 3H82B 2RCXA 2XF3A 4HP9A 3HL9A 1LL5A 4OQHA 1KE0A 2WYXA 2XQZA 3IBJA 2XEPA 3K3CA 3NIAA 5HPFA 3DTKA 3CPTB 3AGFA 4OOYA 3CI6A 3UNWA 1GCEA 5HWTA 5CRFA 1SZVA 5TGFA 3VSLA 3G34A 1W5DA 2O9CA 3LFVA 4EQIA 3VOZA 5HDDA 3LY3A 3PBNA 1Y54A 1TEMA 4EUZA 1DRMA 3LICA 1F5MA 1GHIA 3V3SA 2RL3A 5FATA 5E2GA 3DTEA 5DKKA 2Y2IA 1GSWA 4PM8A 3FG8A 4G3KA 2Z6CA 1S4RA 5FQIA 4O7DA 4ZJ2A 4N9KA 1DP6A 1ESIA 2YKHA 4GB7A 1JNUA 3P09A 3A0RA 4KZAA 2P74A 5HL1A 2WKIA 2JBFA 3MFDA 4JKTA 2W1TB 5TBMB 3IH9A 3RTYA 4DDSA 3TRCA 4DRTA 4KG2A 3VV4A 1SHVA 3M2KA 3T1QB 4UQIS 3ZG0A 5FDHA 4JF6A 1NZOA 4OOMA 3F1NA 2JC7A 2OLVA 1N4OA 4R0QA 3R4KA 1P9WA 5M19A 4R23A 2HJ9C 3FKVA 2H10A 3UB7A 1E3UA 3T4QA 4CJNA 3SW1A 4R4SA 3WS4A 1K38A 3HLCA 2X02A 3MQOA 2ZBBA 3KSGA 1PRQA 1G6AA 1ERMA 2R78A 1XGJA 1E3UD 2Q9NA 3EOIA 5DTTA 1S67L 1BYWA 3V3RA 1XJ4A 1SDEA 4OH0A 3HLBA 3LR4A 3UDFA 3RXXA 2EWVA 3LEZA 5DF8A 4I38A 1YAXA 1XPBA 2ZQCA 4S2OA 2W3FA 2XK1A 3OCNA 2Y4AA 5FQ9A 4HJ4A 5TR7A 4Y13A 2DMWA 4CPKA 3BY8A 4BL2A 4S2PA 4R70A 1KGFA 4GLQA 3T4JA 5A8BA 4L9EA 2R9XA 2K31A 1KGEA 3VP1A 2VK3A 2ZOHA 3B3XA 1ONGA 4HI4A 3QP4A 3E4PA 2GZAA 2XD5A 5EVIC 3EWKA 2ZM0A 1CK3A 3ZG9B 5I94A 4GZBA 1XP4A 5GLDA 3C8CA 2WZXA 3VP2A 5CXWA 3WRTA 4ZTKA 5HDSA 3SZTA 5DTSA 3G31A 4L9FA 4ARZB 1H8MA 5IU1A 2DNSA 1MPLA 3N4IA 4I39A 4JGQA 1IYSA 2OWHA 1L0EA 2Y59A 4R1GA 4Y0OA 2ZLYA 3E4QA 4RQ9A 4WELA 1SDNA 3GDIA 1ES2A 1KDSA 3RH8B 1TVFA 2EXBA 4CQHA 4QU3A 5KSHA 2PBYA 2VJWA 4EWFA 3OZHA 2YKFA 4OVDA 1RCJA 4OPYA 4NXBA 2Y2QA 4WBGA 1Y28A 2QZ6A 1NLYA 5CGXA 4BBTA 5BOHA 3O86A 4KG5A 4X55A 3W4OA 4JGOA 4JXVA 3JPUA 3G2YA 2DRWA 4PM9A 4LLOB 3ZCZA 5CTMA 1MZUA 4WMCD 5HAIA 4K91A 4MCWA 3N8SA 4S2NC 4B9OA 4KUOA 5DTKA 3EGXC 3LR0A 4LFUA 2UWXA 3UPPA 2XRNA 3ZFZA 4F94A 2J80A 2WKQA 4B93A 1OTIA 4I5SA 1J9MA 3CWFA 4P6ZM 5AJGA 1LT0A 2Z6DA 4E3JA 4IBRA 4IHQA 3IT9A 4IVIA 2IWDA 2P08A 5KMWA 1Q2QA 2BG1A 1ACFA 2PD8A 3PBOA 3HLWA 1FQGA 4FCFA 4B88A 5F82A 2ZC6B 1BT5A 1ZC2A 3C7UA 5GHZA 3EQVA 5CERA 1N9NA 1E25A 4LENA 5AQBA 4N9LA 1NRJA 4E3MA 5EOEA 1PZPA 4DF6A 1IELA 4EQ1A 1FR1A 1TF1A 2QYBA 4PM7A 5EPHA 3LEQA 3O88A 1KOUA 4BQMA 3LIFA 3BQ8A 1RGYA 2UV0E 1W79A 3DTIA 2EX2A 2I9VA 4DXBA 4KZ4A 4HH3A 4K08A 2ZQDA 3BRMA 3V50A 5AVEA 2WAEA 3UMEA 1D7EA 5F68A 3D9YA 1IYQA 4PPRA 4JBFA 1ONHA 3N7WA 1F2KA 4K0WA 3C30A 2W0NA 3V67A 4DN0A 1ESUA 4X1MA 3ZNTA 3N6IA 5HARA 4U3TA 3OCLA 1VHMA 1LSWA 4WZ4A 1NYMA 4ZRRA 5DKLA 4BMWA 1XKZA 3UB8A 2PDRA 2B95A 2WGIA 1K6RA 1TS0A 3MZFA 1CI8A 2XFSA 3IBRA 3D72A 5EFWA 4Y17A 2ZD8A 4JXGA 1TD5A 5FSRA 2ZL1A 1TS6A 3ZG5A 3OPLA 3U4LP 3C2WA 2L0WA 5HX9A 3RJUA 4Y2FA 3FV7A 2D01A 4KQQA 3MZDA 2A24A 3V39A 3WRZA 3FKWA 4XUXA 1PW1A 2EA9A 3MSHA 1PZOA 4EESA 3SS4A 2XA7M 2O0YA 3Q7VA 3F1PB 2XFTA 1OTDA 4I3AA 4WN5A 3NCKA 2P9VA 3JVVA 1XA1A 3IHAA 3BM6A 4E3IA 4S2KA 2W3EA 2E8JA 4GDBA 3RXWA 4Q8IA 1I2SA 5HPIA 4E6XA 5EOOA 2ZJ9A 3Q1FA 1LI9A 1DJCA 5GHXA 1OJ5A 3TG9A 4GD8A 4KQRA 5F5YA 4WEJA 1M40A 3H7WB 2HV1A 5M18A 4L9GA 3CAXA 3O3VA 5CEBA 2QWSA 4CLCB 1M6KA 3IF6C 3DAVA 3FWLA 4EEUA 2HDUA 1G68A 3IS2A 2R9WA 4RX2A 4OONA 5EVLA 4EV4A 1HD8A 1ALQA 3RFBA 2B18A 1PWCA 2GX5A 3QP6A 1NWZA 4YNRA 1OTEA 5GLBA 4EUVA 2VGJA 3LCEA 4NG2A 3ZDJA 2H0YA 2X01A 3K2NA 3CUEC 3JYIA 1MBLA 1LHYA 2G2UA 4KZ9A 4X68A 4X6TA 4DXCA 1ZKJA 4RYEA 5EVID 2JKFA 3IS2B 2ACGA 1UGUA 4GW9A 5AQ9A 3OBFA 3ZNYA 4UA9A 3QP8A 4KZ8A 2V1ZA 3FPVA 5FI7A 3IWOA 2Y2OA 3NECA 3BECA 2Z2LB 2W3HA 2HPBA 5L2FA 2Y91A 1HVBA 4OP8A 3VOLA 1AXBA 4UA7A 1FILA 3ZHHA 2CC1A 2K2NA 4OOLA 1C3BA 3T1SA 1KE3A 4KZBA 2V2FF 4ZBEA 1ZG6A 3O5YA 5HL6A 3HREA 5KIZA 1DP8A 1FSYA 5HD3A 2IWCA 2D02A 2ZQ7A 3NC8A 4GS9A 4IBXA 3ZGAB 5CECA 2C5WB 2W1RA 1DY6A 3OPPA 4H6JA 4G3VA 4Y3IA 2B02A 1T18A 3HLGA 3T4SA 4EXOA 1NZUA 2EX9A 4CLCE 1P97A 1XFNA 4MMNA 1XJ3A 1OMEA 1OJGA 3KYQA 2LB5A 4DDYA 3NY4A 1GA9A 3ZVWA 4PHTA 5FQMA 3MS6A 3N8RA 1GHMA 4Y5FA 4UQIM 1S4SA 1BLHA 1YKDA 1JTDA 3OC2A 3UN7A 3BYDA 3C4OA 1J3WA 1K54A 1I2WA 3MFXA 3HUOA 3HJIA 4P6BA 3NHQA 5E2EA 2KX6A 1YSPA 2ZL1B 3IXDA 4CLCC 2EFUA 3IF6B 3LO7A 3T4TA 4Q0IA 3IXGA 2A3UA 2WAFA 3OOVA 3NDGA 3QNBA 3TW8A 4LV2A 4D60A 1GSXA 2JKGA 2VGLM 3UE6A 3KYZA 4GNUA 1Y4OA 5L10A 4IUKA 3NOPC 1UWPX 3KSIA 1ES5A 5TJJA 3EGDC 4S2IA 3UB5P 4S2JA 1K56A 1K4EA 1W7FA 4WL9A 4HBTA 5IHVA 1PI5A 2J3WA 1XGIA 2C6WB 2HF6A 2JKTM 5A93A 3MR0A 1XX2A 4OQIA 1K0KA 3NI9A 3GRJA 4ARZA 1N9BA 1VM1A 1OT9A 2DCFA 3SOIA 2VX8A 3GV9A 1HZOA 3CPTA 4R6LA 3IQAA 1YT4A 4EEPA 5DFYA 2A2LA 3GQZA 1WE4A 1L3LA 4KENB 2HP9A 4HQAA 4NEED 4B4ZA 3CITA 4C6YA 1YLWA 2PR6A 3KSFA 4KQOA 2V1AA 1W8YA 1X0OA 4FD8A 5TFQA 2NUTC 1EROA 5CHMA 4LV1A 4GD6A 3G6OA 1D06A 3U2AA 1H0MA 1FIKA 5J7EA 2VLGA 3ICYA 1SKFA 4MN5A 3IX8A 3D4FA 4HJ3A 1IFQA 4F3LA 3H9WA 1DJBA 5FAOA 4O01A 2VKSA 5L8MA 4WZ5A 2FFYA 4E3KA 3AGEA 3ISGA 1PYYA 3LR3A 1GHPA 2FZ0A 4WUJA 4FH2A 1NRFA 3LIDA 3G2ZA 3BFGA 3FYZA 4LRXC 4EW7A 2QPNA 5HW3A 3FZCA 3G35A 3D3OA 2MJ6A 4X53A 4YWZA 4PMAA 5LBRA 1W63M 3UB6A 5JYOA 2Y2LA 5JYPA 5FAQA 5GHYA 1YM1A 3LGOA 2QJ7A 1VEUA 2XR0A 1O7EA 4GDNA 2CMNA 1S6RA 5GL9A 3T1RA 2P7JA 5KZHA 4GCZA 3R7WA 3LIEA 1HLUP 3UDIA 3W4QA 3ITAA 1NLZA 3DWZA 3IF5A 4LCLA 2L4RA 2V9AA 2WZZA 5KSCA 5FL3A 2OV5A 4R3JA 4RVAA 4C3QA 2PU4A 3BEBA 4ZDXA 2WGWB 1BLCA 2PRFA 3CG5A 1L0FA 2O9BA 2M1CA 2OWJA 4QWOA 5CTNA 3KO6A 1F9IA 5HSQA 4DE2A 5AQ7A 4GJ4A 1V9YA 4MN7A 2HP5A 2H0TA 3DBAA 5J3WA 2XLNA 3IH8A 1H8YA 4YINA 3T1XA 3CUEA 2PD7A 1NY0A 2W3GA 4NKPA 5E2FA 3EEAA 1N9LA 3PAEA 1CQAA 2J7VA 1YQSA 2VV7A 3HBRA 4X56A 5C5KA 1PWDA 4JGRA 4ESPA 4PM5A 3KSHA 3MKFA 4FSFA 3F1OB 2KLIA 3HUNA 2OSUA 4NXGA 1SCWA 1YMSA 1XJ6A 2L1MA 2Y55A 3HLDA 3A3JA 5F83A 3M6BA 3M2JA 2V0UA 5DFXA 5FQKA 3R7WB 4MEZA 2O9AA 4KUKA 1ERQA 5FI6A 3WWXA 5CX7A 4DE3A 4HP4A 1WYBA 1W63Q 2W27A 1K54C 5EVEA 1G5UA 4QHCA 4UHUA 4OQGA 4CLCD 2HDRA 3K3DA 4HJ6A 3PAGA 2J3TD 1U60A 4BENA 4XT2A 2WUQA 2WKEA 1BTLA 5FQJA 4FH4A 4BD1A 4ETZA 3ZG7B 2OOLA 1PI4A 3DTMA 2J3TC 3GTCA 2ZM8A 5CHJA 4XT2B 4E3NA 3ZQ5A 3LY4A 2VGLS 1PW8A 1ES3A 2A49A 4DJ2A 4EU0A 3IXBA 4NXEA 4N92A 2M7VA 4P87A 4YFMA 1QMEA 4KZ3A 3Q82A 3E98A 1DJAA 4U0XA 4S2LA 2W3DA 2VZWA 4OP5A 2Z2MB 1NYYA 3LYXA 4WF0A 4X69A 4Z1WA 1ODVA 3P7NA 5IT5A 1CJFA 3NDEA 5HAPA 2WK0A 3PBRA 1KGGA 1MWTA 3E2KA 2WKRA 1BULA 4PKYG 1LL9A 3QNCA 2GNXA 4Y7PA 2QMIA 3E0YA 4KZ6A 5FQQA 1MWSA 4R3AA 4GS9B 4ZAMA 3ZVTA 2BTFP 1MC0A 4LRZE 4C75A 2JHEA 4G3WA 4OLGA 1P0ZA 4MBHA 1I5QA 3CZDA 5F1FA 1FR6A 3EQUA 1JVJA 2ZMFA 5FAPA 5AVFA 4KQDA 2BASA 1K57A 3MF0A 3TOIA 1IOUA 4RA7A 2NUPC 3PYPA 2W1TA 5TBMA 3MXQA 3Q07A 2ZQ8A 3GVBA 4R38A 1TDGA 2Y2PA 4H8RA 4GKUA 3MQQA 5D3OA 3UPNA 2GJ3A 1HTZA 3ZYTA 2HGVA 1K57C 3S7QA 4LRYC 3BJNA 3BFFA 2BLSA 2ZMAA 4L0LA 5L07A 4WZ5C 1K56D 2QKPA 3IX3A 1DP9A 3MZEA 3L7HA 3S7OA 4N1HA 3T12B 1VETA 3A0SA 4BL3A 3IHBA 2JN7A 4H6JB 3LI8A 3KX0X 3NULA 1XXMA 5EVIB 4MN6A 3MXRA 3CMZA 1LLBA 3PBTA 3UE1A 5J4EA 5F69A 3E2LA 2KOIA 2HZ5A 1G28A 1BLSA 5EECA 2IA2A 4GHIB 4HNBA 3HUMA 5E2HA 2PYRA 5EM0A 3Q81A 1JWPA 3LIBA 1K25A 2J8YA 4Y0UA 5A90A 3TSGA 3MJQA 4Z9QA 5GLCA 2V1BA 5HD5A 2Y2GA 3UDXA 1PFLA 4ZJ1A 2XH9A 3PBQA 3SH9A 3G32A 1WA9A 1XA7A 1LI0A 4E6WA 4NETA 1YLJA 4QB8A 3VFFA 2EWWA 3W2ZA 2LB9A 4HH2A 2KDKA 5MC7A 1H3QA 4IVKA 3H7WA 1O07A 1OTAA 2EX8A 4HY8A 3TE8A 3WS5A 2PR5A 1YPRA 3VP4A 1F98A 1FCOA 4P85A 4HIAA 2H28A 1EW0A 2JE5A 3BQAA 4UEYA 2WGVA 3CHWP 4E04A 2ZC4B 4O0PA 2JCHA 2PU2A 2P04A 4BD0A 4FOFA 2INWA 2QHKA 1D1JA 3OPRA 2K7SA 5CHUA 2VGKA 4Q0JA 4WLAA 2XA7S 4UAAA 1K55A 3IXHA 1T1CA 4LGWA 1STZA 3W4PA 4MDZA 5F1GA 4I3IA 1LL8A 4I3JA 4WM9A 4PM6A 5HWVA 2WKPA 3CLOA 2X71A 4M4XA 3O87A 4YOFA 3QP5A 3SH8A 2V20A 4BBUA 4Y0TA 2B5RA 5DJTA 1SKOB 5GLAA 4IUHA 1N9OA 1RGZA 1IKIA 3MXSA 4IEDA 4JGPA 5J8XA 4U0TA 3HLFA 2M7UA 4MNRA 4OPZA 5U47A 3A0VA 1ES4A 3VSKA 4OQ0A 3JVUA 3T50A 5AQAA 3UO9A 4PKYA 5L09A 4EBLA 1E4DA 4HESA 4LV0A 1VEUB 1FCMA 3S7PA 1VETB 4FUWA 1OT6A 5CGWA 1MY8A 2P9VB 2PAVP 3PBSA 4ME4A 2Y2JA 4GOGA 5A91A 4OPRA 4JF4A 2QJ5A 3NOTC 2WADA 3TJZC 1Z09A 3G4PA
chains in the Genus database with same CATH topology
5HSQA 3T4OA 4GJ4A 1V9YA 4MN7A 3IBJA 2EA9A 3K3CA 5HWWA 4EESA 5HPFA 3DBAA 5J3WA 1TS7A 2XA7M 2O0YA 3F1PB 1OTDA 4I3AA 3CUEA 3FC7A 2PYPA 2OAP1 2PD7A 4WN5A 3CI6A 3UB9A 3JVVA 2W3GA 4NKPA 5HWTA 3EEAA 1N9LA 3B42A 2VV7A 3FPWA 2O9CA 3LFVA 4NXFA 5HDDA 2W3EA 5C5KA 3LUQA 3PBNA 5HPIA 4JGRA 3EEHA 3KSHA 1DRMA 3LICA 4FSFA 1F5MA 1OJ5A 5F6AA 3F1OB 5F5YA 2KLIA 5DKKA 4WEJA 3F1NB 4NXGA 4QPRA 1GSWA 3FG8A 3H7WB 2HV1A 4G3KA 2Z6CA 3NJAA 4L9GA 3CAXA 4ETXA 1V9ZA 4F3LB 1TS8A 1S4RA 1XJ6A 2L1MA 2QWSA 4CLCB 4EEUA 1DP6A 2YKHA 2V0UA 3IS2A 5DFXA 3R7WB 1JNUA 3A0RA 2O9AA 5DJUA 4KUKA 3RFBA 2V0WA 2B18A 4CLCA 1XFQA 2GX5A 2O99A 2W1TB 5CX7A 5TBMB 3RTYA 3TRCA 1NWZA 3VV4A 4YNRA 4HP4A 1VB6A 1W63Q 1OTEA 2W27A 4EUVA 4EERA 4UQIS 2Y79A 4CLCD 3C38A 3K2NA 4OOMA 3K3DA 2XSSA 2G7UA 3CUEC 4HJ6A 3F1NA 2J3TD 4BJPA 3R4KA 1P9WA 3UMDA 4XT2A 3LI9A 2HJ9C 3UB7A 4ETZA 3T4QA 3SW1A 3IS2B 2OOLA 1UGUA 4GW9A 2J3TC 1LSVA 2ZBBA 3MQOA 4XT2B 3KSGA 3ZQ5A 3GECA 1GSVA 2R78A 3OBFA 4PAUA 2VGLS 3EOIA 1S67L 1BYWA 4HOIA 3S7NA 1XJ4A 3FPVA 4DJ2A 2ZOIA 4EU0A 3LR4A 2EWVA 4P6ZS 3LR5A 3PHYA 4NXEA 2W3HA 4I38A 2M7VA 5I5LA 1YAXA 3VE4A 3E98A 2W3FA 3OCNA 3VOLA 2W3DA 2VZWA 3LYXA 4WF0A 4Z1WA 1ODVA 4HJ4A 4IJGA 3P7NA 2HJEA 5IT5A 2DMWA 2K2NA 4OOLA 3BY8A 3PBRA 2XROA 3O5YA 4R70A 5HL6A 4GLQA 3T4JA 2WKRA 5A8BA 4L9EA 4PKYG 5HDCA 5KIZA 2K31A 1DP8A 2ZOHA 1OTBA 5HD3A 2GNXA 2D02A 1T1BA 4HI4A 4GS9A 3E0YA 3E4PA 2VV8A 2W1RA 2GZAA 3MMHA 4H6JA 3EWKA 4G3VA 4Y3IA 4R3AA 2B02A 1T18A 2JKRM 4GS9B 3T4SA 4EXOA 1ZHHB 4CLCE 1MC0A 1P97A 4LRZE 1XFNA 4MMNA 1XJ3A 2JHEA 1OJGA 3C8CA 4G3WA 3KYQA 4LPZA 2LB5A 1MKMA 4O8GA 1P0ZA 4DJ3A 5HDSA 4PHTA 2OAQ1 4L9FA 3B33A 4ARZB 1H8MA 5IU1A 3EQUA 5AVFA 2ZMFA 4Y5FA 4KQDA 1S4SA 4UQIM 2BASA 4I39A 3MF0A 1YKDA 4JGQA 2FH5A 2OWHA 1IOUA 2NUPC 3BY9A 3PYPA 2W1TA 5TBMA 3MXQA 2VEAA 4R38A 3E4QA 3OC2A 4RQ9A 4WELA 3MQQA 5HZHA 3GDIA 1S66L 2GJ3A 3ZYTA 3RH8B 3MFXA 2HGVA 3HJIA 3NHQA 3S7QA 4LRYC 3BJNA 4DMZA 2KX6A 1YSPA 4CQHA 4CLCC 4L0LA 5G4YA 3T4LA 2QKPA 5KSHA 1S1ZA 2VJWA 3T4TA 2YKFA 1DP9A 4Q0IA 2JKRI 3E4OA 3S7OA 3OOVA 3LIAA 4NXBA 1Y28A 3A0SA 2ZMVA 2JN7A 3OLOA 4H6JB 3TW8A 1NLYA 3LI8A 4BBTA 3KX0X 4WEKA 1GSXA 2VGLM 3HJKA 4JGOA 3UE6A 3KYZA 4MN6A 5IS1A 4IUKA 4LLOB 3NOPC 1UWPX 1ZTUA 3KSIA 3PBTA 5J4EA 5K5BA 1MZUA 4MCWA 5F69A 5TJJA 2KOIA 3EGDC 1G28A 2IA2A 4GHIB 4HNBA 2PT7A 4B9OA 4KUOA 4WL9A 2PYRA 2J3WA 3EGXC 3LIBA 3LR0A 4BWIA 2HF6A 2JKTM 4HHDA 2XRNA 3MR0A 3MJQA 2J80A 1LSXA 2WKQA 4B93A 1OTIA 4I5SA 3ULFA 2V1BA 4ARZA 5HD5A 3CWFA 4P6ZM 5AJGA 3PBQA 1LT0A 1OT9A 2Z6DA 2VX8A 4IHQA 1WA9A 4II7A 4R6LA 2JKTI 2P08A 1UWNX 4AFIA 4EEPA 5DFYA 2A2LA 1F9IA 2PD8A 2EWWA 3H82A 4GHIA 2LB9A 3VE3A 1T1AA 4HH2A 3W2ZA 2KDKA 5MC7A 3PBOA 1H3QA 3H7WA 4HQAA 4NEED 3CITA 1OTAA 2PR6A 3KSFA 5DF9A 4KQOA 2V1AA 4HY8A 3TE8A 1X0OA 2PR5A 3EQVA 1N9NA 1F98A 2NUTC 4HIAA 4Q0HA 2H28A 3G6OA 1D06A 3U2AA 1EW0A 4EETB 3BQAA 4UEYA 1NRJA 5J7EA 4E04A 2VLGA 4O0PA 3ICYA 2P04A 2VV6A 2A24B 4MN5A 4EQ1A 1G6OA 1TF1A 4FOFA 2INWA 2QHKA 2QYBA 4HJ3A 1IFQA 2K7SA 4F3LA 3H9WA 1KOUA 4O01A 2VKSA 5L8MA 4Q0JA 4WLAA 2XA7S 1YSQA 3LIFA 3BQ8A 1T1CA 3F1PA 3HCYA 1STZA 3LR3A 4BBVA 2FZ0A 3B47A 4WUJA 3F1OA 4MDZA 3BWLA 4I3IA 1LL8A 2I9VA 3BW6A 4I3JA 2VA0A 3LIDA 5HWVA 4LRXC 1S1YA 4EW7A 2WKPA 3CLOA 4HH3A 5G4ZA 4K08A 4M4XA 3D3OA 2MJ6A 5AVEA 3NOUC 4YOFA 4YWZA 3UMEA 1T19A 1D7EA 3MQ0A 5F68A 4BBUA 5DJTA 5LBRA 4IUHA 1W63M 3UB6A 2Y8HA 1OPXA 1N9OA 3C30A 2W0NA 3P01A 1P9RA 3V67A 4DN0A 4JGPA 2M7UA 3OCLA 2QJ7A 3A0VA 1VHMA 1XJ2A 3JVUA 3T50A 1LSWA 3PXPA 2CMNA 4PKYA 4ZRRA 5DKLA 2P7JA 4BMWA 4GCZA 3UB8A 2PDRA 3UE3A 3R7WA 3LIEA 1TS0A 3IBRA 1NLZA 3D72A 3S7PA 5EFWA 2L4RA 2V9AA 1OT6A 5FL3A 1TD5A 3PR6A 3PBSA 4ME4A 1TS6A 2PHYA 3C2WA 2L0WA 2O9BA 2QJ5A 4Y2FA 3NOTC 2D01A 3T4KA 2M1CA 2OWJA 3H82B 3TJZC 4HP9A 3KO6A 2A24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HSQ A;  1N9N A;  1F98 A;  2KX6 A;  1UGU A;  4GW9 A;  4HIA A;  1LSV A;  2H28 A;  1D06 A;  2ZBB A;  3G6O A;  1EW0 A;  1V9Y A;  3MQO A;  4XT2 B;  5G4Y A;  3GEC A;  3ZQ5 A;  1GSV A;  2QKP A;  1S1Z A;  2R78 A;  5J7E A;  4E04 A;  2VLG A;  2EA9 A;  3K3C A;  5HWW A;  2YKF A;  3ICY A;  1DP9 A;  1S67 L;  1BYW A;  4HOI A;  4EES A;  1XJ4 A;  3E4O A;  5J3W A;  4DJ2 A;  2VV6 A;  2A24 B;  2ZOI A;  1TS7 A;  4MN5 A;  4EQ1 A;  3LIA A;  2INW A;  2QHK A;  3F1P B;  4NXB A;  1OTD A;  3PHY A;  4HJ3 A;  2K7S A;  1Y28 A;  4I3A A;  4NXE A;  3H9W A;  4F3L A;  1KOU A;  4I38 A;  3A0S A;  3FC7 A;  2PYP A;  5I5L A;  2JN7 A;  3OLO A;  4H6J B;  4WLA A;  2PD7 A;  4WN5 A;  3UB9 A;  3LI8 A;  3VE4 A;  4BBT A;  3KX0 X;  3LIF A;  5HWT A;  1T1C A;  1GSX A;  1N9L A;  3VOL A;  3F1P A;  3HJK A;  4JGO A;  4BBV A;  3UE6 A;  2VV7 A;  3LYX A;  4WF0 A;  1ODV A;  4HJ4 A;  3F1O A;  3P7N A;  4MN6 A;  4NXF A;  3BWL A;  4I3I A;  4WUJ A;  1LL8 A;  2I9V A;  5HDD A;  5IS1 A;  4I3J A;  3LUQ A;  3BY8 A;  3LID A;  2OOL A;  3NOP C;  4JGR A;  4LLO B;  1UWP X;  5HWV A;  4LRX C;  1S1Y A;  4EW7 A;  2WKP A;  3CLO A;  3EEH A;  4HH3 A;  5G4Z A;  4K08 A;  1MZU A;  4M4X A;  5J4E A;  4R70 A;  1DRM A;  5F69 A;  3NOU C;  2WKR A;  3LIC A;  5AVE A;  5A8B A;  4L9E A;  1OJ5 A;  4PKY G;  5F6A A;  3F1O B;  5HDC A;  1T19 A;  4YWZ A;  1DP8 A;  1D7E A;  3UME A;  5KIZ A;  5F68 A;  5F5Y A;  1G28 A;  4BBU A;  2ZOH A;  1OTB A;  5DJT A;  4GHI B;  4HNB A;  2D02 A;  5DKK A;  5HD3 A;  1T1B A;  3F1N B;  4HI4 A;  4GS9 A;  4KUO A;  4NXG A;  3UB6 A;  4B9O A;  1GSW A;  3FG8 A;  4WL9 A;  3H7W B;  2HV1 A;  2PYR A;  3E4P A;  2Z6C A;  3NJA A;  4L9G A;  1N9O A;  3CAX A;  2VV8 A;  3LIB A;  1V9Z A;  4F3L B;  2W0N A;  1TS8 A;  1S4R A;  1XJ6 A;  2L1M A;  2QWS A;  3SW1 A;  4H6J A;  4HHD A;  4JGP A;  3EWK A;  3MR0 A;  3MJQ A;  4EEU A;  2J80 A;  4R3A A;  1DP6 A;  1T18 A;  2B02 A;  2V0U A;  2YKH A;  3IS2 A;  1LSX A;  4GS9 B;  4EXO A;  2WKQ A;  1OTI A;  1JNU A;  2QJ7 A;  4I5S A;  1P97 A;  4LRZ E;  3ULF A;  3A0V A;  3A0R A;  2V1B A;  1XFN A;  5DJU A;  5HD5 A;  1XJ2 A;  1XJ3 A;  2JHE A;  3CWF A;  1OJG A;  1LSW A;  3C8C A;  4KUK A;  3T50 A;  2V0W A;  1LT0 A;  4LPZ A;  1OT9 A;  2Z6D A;  2CMN A;  1P0Z A;  4DJ3 A;  4PKY A;  5DKL A;  1XFQ A;  2P7J A;  1WA9 A;  5HDS A;  4GCZ A;  5TBM B;  3RTY A;  3UB8 A;  1NWZ A;  2PDR A;  4R6L A;  3LIE A;  4HP4 A;  1VB6 A;  1OTE A;  4L9F A;  1UWN X;  1TS0 A;  2W27 A;  3B33 A;  3IBR A;  5IU1 A;  5AVF A;  4EER A;  4EEP A;  3D72 A;  4EET B;  5EFW A;  4KQD A;  1S4S A;  2L4R A;  2V9A A;  2BAS A;  4I39 A;  1OT6 A;  2PD8 A;  3H82 A;  2OWH A;  4GHI A;  3K3D A;  4JGQ A;  1T1A A;  4HH2 A;  4HJ6 A;  2KDK A;  3BY9 A;  3F1N A;  3PYP A;  5TBM A;  3VE3 A;  3MXQ A;  2VEA A;  3H7W A;  4R38 A;  3E4Q A;  4HQA A;  4RQ9 A;  1TS6 A;  2PHY A;  3UMD A;  4XT2 A;  1OTA A;  3C2W A;  3LI9 A;  2L0W A;  3MQQ A;  3UB7 A;  2QJ5 A;  2PR6 A;  5HZH A;  3NOT C;  2D01 A;  1S66 L;  2M1C A;  2GJ3 A;  2OWJ A;  2V1A A;  3GDI A;  4HY8 A;  3H82 B;  3MFX A;  3RH8 B;  1X0O A;  3HJI A;  4HP9 A;  2PR5 A;  3NHQ A;  3IS2 B;  1F9I A;  4LRY C;  2A24 A; 
#chains in the Genus database with same CATH topology
 5FEG A;  3T4O A;  1S0W A;  3BLS A;  5HWW A;  1MWR A;  5CED A;  2OLU A;  1MWU A;  1TS7 A;  3S1Y A;  4XUZ A;  3WS0 A;  3CJM A;  4MBF A;  3FC7 A;  2PYP A;  2OAP 1;  3UB9 A;  4KZ7 A;  4X25 A;  4B4X A;  3M6H A;  3B42 A;  4S2N A;  1MKI A;  3FPW A;  1BSG A;  1PIO A;  4NXF A;  1NJ4 A;  3IX4 A;  1QMF A;  3LUQ A;  4WMC A;  3EEH A;  5F6A A;  4R4R A;  3F1N B;  4QPR A;  3DWK A;  1FOF A;  2WGW A;  3NJA A;  1YLY A;  2XGN A;  4ETX A;  2ZC7 A;  1V9Z A;  4DE1 A;  4F3L B;  1TS8 A;  5A92 A;  3UY6 A;  5DJU A;  4QJG A;  3V5M A;  2V0W A;  4CLC A;  3S22 A;  1XFQ A;  2O99 A;  4UA6 A;  3W8K A;  3A3D A;  5FAS A;  5FDS A;  1VB6 A;  2Y2H A;  1YLZ A;  4EER A;  2Y79 A;  3C38 A;  2XSS A;  2G7U A;  4ZJ3 A;  5DF7 A;  5EM1 A;  3VFH A;  4BJP A;  3UMD A;  3VMA A;  2Y2K A;  3LI9 A;  1YLT A;  2Y2M A;  3N8L A;  4JXS A;  1IEM A;  1LSV A;  3NBL A;  3GEC A;  1GSV A;  1K4F A;  4PAU A;  1K55 C;  3SS5 A;  4HOI A;  3S7N A;  1EWZ A;  4OLD A;  2ZOI A;  3BFD A;  4P6Z S;  3LR5 A;  3PHY A;  1CEF A;  5I5L A;  3A3E A;  1MXO A;  3VE4 A;  4A5R A;  4S2M A;  1L2S A;  1L0D A;  4IJG A;  4KG6 A;  2HJE A;  4NK3 A;  4JF5 A;  3QP2 A;  1FSW A;  2XRO A;  5EE8 A;  2WKH A;  3QP1 A;  2J9O A;  3BLM A;  5HDC A;  1Z6F A;  1OTB A;  1GA0 A;  1T1B A;  2J9P A;  1K6S A;  4JPM A;  1KVL A;  3C7V A;  3Q7V B;  2VV8 A;  1H8Z A;  3IWQ A;  3MMH A;  1W8Q A;  2JKR M;  4X1L A;  1ZHH B;  2Q9M A;  5FA7 A;  3SS3 A;  3MBZ A;  2HDQ A;  3A3I A;  4LPZ A;  1MKM A;  4O8G A;  4DJ3 A;  1KE4 A;  2OAQ 1;  1ZG4 A;  5E43 A;  4BLM A;  3B33 A;  5EV0 A;  4KZ5 A;  3VOY A;  2FH5 A;  1SKO A;  4QY5 A;  3BY9 A;  4E3L A;  2ZQA A;  2VEA A;  1JWZ A;  4QY6 A;  2G2W A;  5HZH A;  4WYY A;  1S66 L;  1PNE A;  3DW0 A;  4DMZ A;  1BUE A;  3Q7Z A;  4Y15 A;  5G4Y A;  3T4L A;  2FFF B;  1S1Z A;  4DE0 A;  1AWI A;  5FEF A;  5HFO A;  2JKR I;  3A3F A;  3E4O A;  3OPH A;  1CF0 A;  3LIA A;  2EX6 A;  2V8C A;  4OPQ A;  1RP5 A;  1JWV A;  2PBD P;  3ZG8 B;  4LCM A;  3UPO A;  2ZMV A;  3OLO A;  1Q2P A;  3PTE A;  4MLL A;  4WEK A;  3KYE A;  3HJK A;  1CEG A;  4HEF A;  4P0M A;  1PWG A;  3P98 A;  5IS1 A;  2Q0O A;  1ZTU A;  3S4X A;  5K5B A;  5EUA A;  3ITB A;  2PT7 A;  4R3B A;  4RX3 A;  2H5S A;  4D2O A;  4BWI A;  4HBU A;  3SH7 A;  3GMW A;  2ZC3 B;  4HHD A;  3I7J A;  3VP0 A;  1LSX A;  3ULF A;  2XDM A;  3MKE A;  4ID4 A;  3HVF A;  4EBN A;  2XD1 A;  1YLP A;  2EXA A;  1NXY A;  4II7 A;  2ZC5 B;  3IWI A;  3WS2 A;  4JXW A;  2JKT I;  3UE0 A;  4E3O A;  4AFI A;  1UWN X;  3WS1 A;  1CI9 A;  5DVA A;  2V8F A;  1EI5 A;  1IYO A;  3H82 A;  4GHI A;  3VE3 A;  1T1A A;  1WYC A;  3BFC A;  5HAQ A;  2AVX A;  5DF9 A;  1JTG A;  2HP6 A;  1KDW A;  1A0K A;  2E8I A;  4Q0H A;  4M3K A;  4EET B;  4QD4 A;  5M1A A;  2VV6 A;  2A24 B;  1YMX A;  1G6O A;  1H5X A;  1FCN A;  1L0G A;  3GSG A;  1YSQ A;  3AGD A;  3F1P A;  3HCY A;  4XXR A;  4BBV A;  1IYP A;  3B47 A;  3L9K A;  4GN2 A;  3F1O A;  4K0X A;  3BWL A;  3BW6 A;  5G18 A;  2VA0 A;  4JLF A;  1S1Y A;  4FTX A;  3C4P A;  5G4Z A;  3VP3 A;  3QHY A;  2IWB A;  3NOU C;  1TDL A;  1T19 A;  3MQ0 A;  2Y2N A;  1BZA A;  5FI2 A;  4MBK A;  2Y8H A;  4LV3 A;  1OPX A;  2HDS A;  3P01 A;  1P9R A;  3BFE A;  4OKP A;  4DKI A;  1XJ2 A;  2ZM2 A;  1BLP A;  3PXP A;  1VQQ A;  5CGS A;  3UE3 A;  1IKG A;  3GR2 A;  4EBP A;  4N1X A;  3C5A A;  2EFX A;  2I72 A;  3PR6 A;  3HLE A;  2PHY A;  5EVI A;  3IF6 A;  2GDN A;  2ZQ9 A;  3G30 A;  3T4K A;  1KVM A;  3H82 B;  2RCX A;  2XF3 A;  4HP9 A;  3HL9 A;  1LL5 A;  4OQH A;  1KE0 A;  2WYX A;  2XQZ A;  3IBJ A;  2XEP A;  3K3C A;  3NIA A;  5HPF A;  3DTK A;  3CPT B;  3AGF A;  4OOY A;  3CI6 A;  3UNW A;  1GCE A;  5HWT A;  5CRF A;  1SZV A;  5TGF A;  3VSL A;  3G34 A;  1W5D A;  2O9C A;  3LFV A;  4EQI A;  3VOZ A;  5HDD A;  3LY3 A;  3PBN A;  1Y54 A;  1TEM A;  4EUZ A;  1DRM A;  3LIC A;  1F5M A;  1GHI A;  3V3S A;  2RL3 A;  5FAT A;  5E2G A;  3DTE A;  5DKK A;  2Y2I A;  1GSW A;  4PM8 A;  3FG8 A;  4G3K A;  2Z6C A;  1S4R A;  5FQI A;  4O7D A;  4ZJ2 A;  4N9K A;  1DP6 A;  1ESI A;  2YKH A;  4GB7 A;  1JNU A;  3P09 A;  3A0R A;  4KZA A;  2P74 A;  5HL1 A;  2WKI A;  2JBF A;  3MFD A;  4JKT A;  2W1T B;  5TBM B;  3IH9 A;  3RTY A;  4DDS A;  3TRC A;  4DRT A;  4KG2 A;  3VV4 A;  1SHV A;  3M2K A;  3T1Q B;  4UQI S;  3ZG0 A;  5FDH A;  4JF6 A;  1NZO A;  4OOM A;  3F1N A;  2JC7 A;  2OLV A;  1N4O A;  4R0Q A;  3R4K A;  1P9W A;  5M19 A;  4R23 A;  2HJ9 C;  3FKV A;  2H10 A;  3UB7 A;  1E3U A;  3T4Q A;  4CJN A;  3SW1 A;  4R4S A;  3WS4 A;  1K38 A;  3HLC A;  2X02 A;  3MQO A;  2ZBB A;  3KSG A;  1PRQ A;  1G6A A;  1ERM A;  2R78 A;  1XGJ A;  1E3U D;  2Q9N A;  3EOI A;  5DTT A;  1S67 L;  1BYW A;  3V3R A;  1XJ4 A;  1SDE A;  4OH0 A;  3HLB A;  3LR4 A;  3UDF A;  3RXX A;  2EWV A;  3LEZ A;  5DF8 A;  4I38 A;  1YAX A;  1XPB A;  2ZQC A;  4S2O A;  2W3F A;  2XK1 A;  3OCN A;  2Y4A A;  5FQ9 A;  4HJ4 A;  5TR7 A;  4Y13 A;  2DMW A;  4CPK A;  3BY8 A;  4BL2 A;  4S2P A;  4R70 A;  1KGF A;  4GLQ A;  3T4J A;  5A8B A;  4L9E A;  2R9X A;  2K31 A;  1KGE A;  3VP1 A;  2VK3 A;  2ZOH A;  3B3X A;  1ONG A;  4HI4 A;  3QP4 A;  3E4P A;  2GZA A;  2XD5 A;  5EVI C;  3EWK A;  2ZM0 A;  1CK3 A;  3ZG9 B;  5I94 A;  4GZB A;  1XP4 A;  5GLD A;  3C8C A;  2WZX A;  3VP2 A;  5CXW A;  3WRT A;  4ZTK A;  5HDS A;  3SZT A;  5DTS A;  3G31 A;  4L9F A;  4ARZ B;  1H8M A;  5IU1 A;  2DNS A;  1MPL A;  3N4I A;  4I39 A;  4JGQ A;  1IYS A;  2OWH A;  1L0E A;  2Y59 A;  4R1G A;  4Y0O A;  2ZLY A;  3E4Q A;  4RQ9 A;  4WEL A;  1SDN A;  3GDI A;  1ES2 A;  1KDS A;  3RH8 B;  1TVF A;  2EXB A;  4CQH A;  4QU3 A;  5KSH A;  2PBY A;  2VJW A;  4EWF A;  3OZH A;  2YKF A;  4OVD A;  1RCJ A;  4OPY A;  4NXB A;  2Y2Q A;  4WBG A;  1Y28 A;  2QZ6 A;  1NLY A;  5CGX A;  4BBT A;  5BOH A;  3O86 A;  4KG5 A;  4X55 A;  3W4O A;  4JGO A;  4JXV A;  3JPU A;  3G2Y A;  2DRW A;  4PM9 A;  4LLO B;  3ZCZ A;  5CTM A;  1MZU A;  4WMC D;  5HAI A;  4K91 A;  4MCW A;  3N8S A;  4S2N C;  4B9O A;  4KUO A;  5DTK A;  3EGX C;  3LR0 A;  4LFU A;  2UWX A;  3UPP A;  2XRN A;  3ZFZ A;  4F94 A;  2J80 A;  2WKQ A;  4B93 A;  1OTI A;  4I5S A;  1J9M A;  3CWF A;  4P6Z M;  5AJG A;  1LT0 A;  2Z6D A;  4E3J A;  4IBR A;  4IHQ A;  3IT9 A;  4IVI A;  2IWD A;  2P08 A;  5KMW A;  1Q2Q A;  2BG1 A;  1ACF A;  2PD8 A;  3PBO A;  3HLW A;  1FQG A;  4FCF A;  4B88 A;  5F82 A;  2ZC6 B;  1BT5 A;  1ZC2 A;  3C7U A;  5GHZ A;  3EQV A;  5CER A;  1N9N A;  1E25 A;  4LEN A;  5AQB A;  4N9L A;  1NRJ A;  4E3M A;  5EOE A;  1PZP A;  4DF6 A;  1IEL A;  4EQ1 A;  1FR1 A;  1TF1 A;  2QYB A;  4PM7 A;  5EPH A;  3LEQ A;  3O88 A;  1KOU A;  4BQM A;  3LIF A;  3BQ8 A;  1RGY A;  2UV0 E;  1W79 A;  3DTI A;  2EX2 A;  2I9V A;  4DXB A;  4KZ4 A;  4HH3 A;  4K08 A;  2ZQD A;  3BRM A;  3V50 A;  5AVE A;  2WAE A;  3UME A;  1D7E A;  5F68 A;  3D9Y A;  1IYQ A;  4PPR A;  4JBF A;  1ONH A;  3N7W A;  1F2K A;  4K0W A;  3C30 A;  2W0N A;  3V67 A;  4DN0 A;  1ESU A;  4X1M A;  3ZNT A;  3N6I A;  5HAR A;  4U3T A;  3OCL A;  1VHM A;  1LSW A;  4WZ4 A;  1NYM A;  4ZRR A;  5DKL A;  4BMW A;  1XKZ A;  3UB8 A;  2PDR A;  2B95 A;  2WGI A;  1K6R A;  1TS0 A;  3MZF A;  1CI8 A;  2XFS A;  3IBR A;  3D72 A;  5EFW A;  4Y17 A;  2ZD8 A;  4JXG A;  1TD5 A;  5FSR A;  2ZL1 A;  1TS6 A;  3ZG5 A;  3OPL A;  3U4L P;  3C2W A;  2L0W A;  5HX9 A;  3RJU A;  4Y2F A;  3FV7 A;  2D01 A;  4KQQ A;  3MZD A;  2A24 A;  3V39 A;  3WRZ A;  3FKW A;  4XUX A;  1PW1 A;  2EA9 A;  3MSH A;  1PZO A;  4EES A;  3SS4 A;  2XA7 M;  2O0Y A;  3Q7V A;  3F1P B;  2XFT A;  1OTD A;  4I3A A;  4WN5 A;  3NCK A;  2P9V A;  3JVV A;  1XA1 A;  3IHA A;  3BM6 A;  4E3I A;  4S2K A;  2W3E A;  2E8J A;  4GDB A;  3RXW A;  4Q8I A;  1I2S A;  5HPI A;  4E6X A;  5EOO A;  2ZJ9 A;  3Q1F A;  1LI9 A;  1DJC A;  5GHX A;  1OJ5 A;  3TG9 A;  4GD8 A;  4KQR A;  5F5Y A;  4WEJ A;  1M40 A;  3H7W B;  2HV1 A;  5M18 A;  4L9G A;  3CAX A;  3O3V A;  5CEB A;  2QWS A;  4CLC B;  1M6K A;  3IF6 C;  3DAV A;  3FWL A;  4EEU A;  2HDU A;  1G68 A;  3IS2 A;  2R9W A;  4RX2 A;  4OON A;  5EVL A;  4EV4 A;  1HD8 A;  1ALQ A;  3RFB A;  2B18 A;  1PWC A;  2GX5 A;  3QP6 A;  1NWZ A;  4YNR A;  1OTE A;  5GLB A;  4EUV A;  2VGJ A;  3LCE A;  4NG2 A;  3ZDJ A;  2H0Y A;  2X01 A;  3K2N A;  3CUE C;  3JYI A;  1MBL A;  1LHY A;  2G2U A;  4KZ9 A;  4X68 A;  4X6T A;  4DXC A;  1ZKJ A;  4RYE A;  5EVI D;  2JKF A;  3IS2 B;  2ACG A;  1UGU A;  4GW9 A;  5AQ9 A;  3OBF A;  3ZNY A;  4UA9 A;  3QP8 A;  4KZ8 A;  2V1Z A;  3FPV A;  5FI7 A;  3IWO A;  2Y2O A;  3NEC A;  3BEC A;  2Z2L B;  2W3H A;  2HPB A;  5L2F A;  2Y91 A;  1HVB A;  4OP8 A;  3VOL A;  1AXB A;  4UA7 A;  1FIL A;  3ZHH A;  2CC1 A;  2K2N A;  4OOL A;  1C3B A;  3T1S A;  1KE3 A;  4KZB A;  2V2F F;  4ZBE A;  1ZG6 A;  3O5Y A;  5HL6 A;  3HRE A;  5KIZ A;  1DP8 A;  1FSY A;  5HD3 A;  2IWC A;  2D02 A;  2ZQ7 A;  3NC8 A;  4GS9 A;  4IBX A;  3ZGA B;  5CEC A;  2C5W B;  2W1R A;  1DY6 A;  3OPP A;  4H6J A;  4G3V A;  4Y3I A;  2B02 A;  1T18 A;  3HLG A;  3T4S A;  4EXO A;  1NZU A;  2EX9 A;  4CLC E;  1P97 A;  1XFN A;  4MMN A;  1XJ3 A;  1OME A;  1OJG A;  3KYQ A;  2LB5 A;  4DDY A;  3NY4 A;  1GA9 A;  3ZVW A;  4PHT A;  5FQM A;  3MS6 A;  3N8R A;  1GHM A;  4Y5F A;  4UQI M;  1S4S A;  1BLH A;  1YKD A;  1JTD A;  3OC2 A;  3UN7 A;  3BYD A;  3C4O A;  1J3W A;  1K54 A;  1I2W A;  3MFX A;  3HUO A;  3HJI A;  4P6B A;  3NHQ A;  5E2E A;  2KX6 A;  1YSP A;  2ZL1 B;  3IXD A;  4CLC C;  2EFU A;  3IF6 B;  3LO7 A;  3T4T A;  4Q0I A;  3IXG A;  2A3U A;  2WAF A;  3OOV A;  3NDG A;  3QNB A;  3TW8 A;  4LV2 A;  4D60 A;  1GSX A;  2JKG A;  2VGL M;  3UE6 A;  3KYZ A;  4GNU A;  1Y4O A;  5L10 A;  4IUK A;  3NOP C;  1UWP X;  3KSI A;  1ES5 A;  5TJJ A;  3EGD C;  4S2I A;  3UB5 P;  4S2J A;  1K56 A;  1K4E A;  1W7F A;  4WL9 A;  4HBT A;  5IHV A;  1PI5 A;  2J3W A;  1XGI A;  2C6W B;  2HF6 A;  2JKT M;  5A93 A;  3MR0 A;  1XX2 A;  4OQI A;  1K0K A;  3NI9 A;  3GRJ A;  4ARZ A;  1N9B A;  1VM1 A;  1OT9 A;  2DCF A;  3SOI A;  2VX8 A;  3GV9 A;  1HZO A;  3CPT A;  4R6L A;  3IQA A;  1YT4 A;  4EEP A;  5DFY A;  2A2L A;  3GQZ A;  1WE4 A;  1L3L A;  4KEN B;  2HP9 A;  4HQA A;  4NEE D;  4B4Z A;  3CIT A;  4C6Y A;  1YLW A;  2PR6 A;  3KSF A;  4KQO A;  2V1A A;  1W8Y A;  1X0O A;  4FD8 A;  5TFQ A;  2NUT C;  1ERO A;  5CHM A;  4LV1 A;  4GD6 A;  3G6O A;  1D06 A;  3U2A A;  1H0M A;  1FIK A;  5J7E A;  2VLG A;  3ICY A;  1SKF A;  4MN5 A;  3IX8 A;  3D4F A;  4HJ3 A;  1IFQ A;  4F3L A;  3H9W A;  1DJB A;  5FAO A;  4O01 A;  2VKS A;  5L8M A;  4WZ5 A;  2FFY A;  4E3K A;  3AGE A;  3ISG A;  1PYY A;  3LR3 A;  1GHP A;  2FZ0 A;  4WUJ A;  4FH2 A;  1NRF A;  3LID A;  3G2Z A;  3BFG A;  3FYZ A;  4LRX C;  4EW7 A;  2QPN A;  5HW3 A;  3FZC A;  3G35 A;  3D3O A;  2MJ6 A;  4X53 A;  4YWZ A;  4PMA A;  5LBR A;  1W63 M;  3UB6 A;  5JYO A;  2Y2L A;  5JYP A;  5FAQ A;  5GHY A;  1YM1 A;  3LGO A;  2QJ7 A;  1VEU A;  2XR0 A;  1O7E A;  4GDN A;  2CMN A;  1S6R A;  5GL9 A;  3T1R A;  2P7J A;  5KZH A;  4GCZ A;  3R7W A;  3LIE A;  1HLU P;  3UDI A;  3W4Q A;  3ITA A;  1NLZ A;  3DWZ A;  3IF5 A;  4LCL A;  2L4R A;  2V9A A;  2WZZ A;  5KSC A;  5FL3 A;  2OV5 A;  4R3J A;  4RVA A;  4C3Q A;  2PU4 A;  3BEB A;  4ZDX A;  2WGW B;  1BLC A;  2PRF A;  3CG5 A;  1L0F A;  2O9B A;  2M1C A;  2OWJ A;  4QWO A;  5CTN A;  3KO6 A;  1F9I A;  5HSQ A;  4DE2 A;  5AQ7 A;  4GJ4 A;  1V9Y A;  4MN7 A;  2HP5 A;  2H0T A;  3DBA A;  5J3W A;  2XLN A;  3IH8 A;  1H8Y A;  4YIN A;  3T1X A;  3CUE A;  2PD7 A;  1NY0 A;  2W3G A;  4NKP A;  5E2F A;  3EEA A;  1N9L A;  3PAE A;  1CQA A;  2J7V A;  1YQS A;  2VV7 A;  3HBR A;  4X56 A;  5C5K A;  1PWD A;  4JGR A;  4ESP A;  4PM5 A;  3KSH A;  3MKF A;  4FSF A;  3F1O B;  2KLI A;  3HUN A;  2OSU A;  4NXG A;  1SCW A;  1YMS A;  1XJ6 A;  2L1M A;  2Y55 A;  3HLD A;  3A3J A;  5F83 A;  3M6B A;  3M2J A;  2V0U A;  5DFX A;  5FQK A;  3R7W B;  4MEZ A;  2O9A A;  4KUK A;  1ERQ A;  5FI6 A;  3WWX A;  5CX7 A;  4DE3 A;  4HP4 A;  1WYB A;  1W63 Q;  2W27 A;  1K54 C;  5EVE A;  1G5U A;  4QHC A;  4UHU A;  4OQG A;  4CLC D;  2HDR A;  3K3D A;  4HJ6 A;  3PAG A;  2J3T D;  1U60 A;  4BEN A;  4XT2 A;  2WUQ A;  2WKE A;  1BTL A;  5FQJ A;  4FH4 A;  4BD1 A;  4ETZ A;  3ZG7 B;  2OOL A;  1PI4 A;  3DTM A;  2J3T C;  3GTC A;  2ZM8 A;  5CHJ A;  4XT2 B;  4E3N A;  3ZQ5 A;  3LY4 A;  2VGL S;  1PW8 A;  1ES3 A;  2A49 A;  4DJ2 A;  4EU0 A;  3IXB A;  4NXE A;  4N92 A;  2M7V A;  4P87 A;  4YFM A;  1QME A;  4KZ3 A;  3Q82 A;  3E98 A;  1DJA A;  4U0X A;  4S2L A;  2W3D A;  2VZW A;  4OP5 A;  2Z2M B;  1NYY A;  3LYX A;  4WF0 A;  4X69 A;  4Z1W A;  1ODV A;  3P7N A;  5IT5 A;  1CJF A;  3NDE A;  5HAP A;  2WK0 A;  3PBR A;  1KGG A;  1MWT A;  3E2K A;  2WKR A;  1BUL A;  4PKY G;  1LL9 A;  3QNC A;  2GNX A;  4Y7P A;  2QMI A;  3E0Y A;  4KZ6 A;  5FQQ A;  1MWS A;  4R3A A;  4GS9 B;  4ZAM A;  3ZVT A;  2BTF P;  1MC0 A;  4LRZ E;  4C75 A;  2JHE A;  4G3W A;  4OLG A;  1P0Z A;  4MBH A;  1I5Q A;  3CZD A;  5F1F A;  1FR6 A;  3EQU A;  1JVJ A;  2ZMF A;  5FAP A;  5AVF A;  4KQD A;  2BAS A;  1K57 A;  3MF0 A;  3TOI A;  1IOU A;  4RA7 A;  2NUP C;  3PYP A;  2W1T A;  5TBM A;  3MXQ A;  3Q07 A;  2ZQ8 A;  3GVB A;  4R38 A;  1TDG A;  2Y2P A;  4H8R A;  4GKU A;  3MQQ A;  5D3O A;  3UPN A;  2GJ3 A;  1HTZ A;  3ZYT A;  2HGV A;  1K57 C;  3S7Q A;  4LRY C;  3BJN A;  3BFF A;  2BLS A;  2ZMA A;  4L0L A;  5L07 A;  4WZ5 C;  1K56 D;  2QKP A;  3IX3 A;  1DP9 A;  3MZE A;  3L7H A;  3S7O A;  4N1H A;  3T12 B;  1VET A;  3A0S A;  4BL3 A;  3IHB A;  2JN7 A;  4H6J B;  3LI8 A;  3KX0 X;  3NUL A;  1XXM A;  5EVI B;  4MN6 A;  3MXR A;  3CMZ A;  1LLB A;  3PBT A;  3UE1 A;  5J4E A;  5F69 A;  3E2L A;  2KOI A;  2HZ5 A;  1G28 A;  1BLS A;  5EEC A;  2IA2 A;  4GHI B;  4HNB A;  3HUM A;  5E2H A;  2PYR A;  5EM0 A;  3Q81 A;  1JWP A;  3LIB A;  1K25 A;  2J8Y A;  4Y0U A;  5A90 A;  3TSG A;  3MJQ A;  4Z9Q A;  5GLC A;  2V1B A;  5HD5 A;  2Y2G A;  3UDX A;  1PFL A;  4ZJ1 A;  2XH9 A;  3PBQ A;  3SH9 A;  3G32 A;  1WA9 A;  1XA7 A;  1LI0 A;  4E6W A;  4NET A;  1YLJ A;  4QB8 A;  3VFF A;  2EWW A;  3W2Z A;  2LB9 A;  4HH2 A;  2KDK A;  5MC7 A;  1H3Q A;  4IVK A;  3H7W A;  1O07 A;  1OTA A;  2EX8 A;  4HY8 A;  3TE8 A;  3WS5 A;  2PR5 A;  1YPR A;  3VP4 A;  1F98 A;  1FCO A;  4P85 A;  4HIA A;  2H28 A;  1EW0 A;  2JE5 A;  3BQA A;  4UEY A;  2WGV A;  3CHW P;  4E04 A;  2ZC4 B;  4O0P A;  2JCH A;  2PU2 A;  2P04 A;  4BD0 A;  4FOF A;  2INW A;  2QHK A;  1D1J A;  3OPR A;  2K7S A;  5CHU A;  2VGK A;  4Q0J A;  4WLA A;  2XA7 S;  4UAA A;  1K55 A;  3IXH A;  1T1C A;  4LGW A;  1STZ A;  3W4P A;  4MDZ A;  5F1G A;  4I3I A;  1LL8 A;  4I3J A;  4WM9 A;  4PM6 A;  5HWV A;  2WKP A;  3CLO A;  2X71 A;  4M4X A;  3O87 A;  4YOF A;  3QP5 A;  3SH8 A;  2V20 A;  4BBU A;  4Y0T A;  2B5R A;  5DJT A;  1SKO B;  5GLA A;  4IUH A;  1N9O A;  1RGZ A;  1IKI A;  3MXS A;  4IED A;  4JGP A;  5J8X A;  4U0T A;  3HLF A;  2M7U A;  4MNR A;  4OPZ A;  5U47 A;  3A0V A;  1ES4 A;  3VSK A;  4OQ0 A;  3JVU A;  3T50 A;  5AQA A;  3UO9 A;  4PKY A;  5L09 A;  4EBL A;  1E4D A;  4HES A;  4LV0 A;  1VEU B;  1FCM A;  3S7P A;  1VET B;  4FUW A;  1OT6 A;  5CGW A;  1MY8 A;  2P9V B;  2PAV P;  3PBS A;  4ME4 A;  2Y2J A;  4GOG A;  5A91 A;  4OPR A;  4JF4 A;  2QJ5 A;  3NOT C;  2WAD A;  3TJZ C;  1Z09 A;  3G4P A; 
#chains in the Genus database with same CATH homology
 5HSQ A;  3T4O A;  4GJ4 A;  1V9Y A;  4MN7 A;  3IBJ A;  2EA9 A;  3K3C A;  5HWW A;  4EES A;  5HPF A;  3DBA A;  5J3W A;  1TS7 A;  2XA7 M;  2O0Y A;  3F1P B;  1OTD A;  4I3A A;  3CUE A;  3FC7 A;  2PYP A;  2OAP 1;  2PD7 A;  4WN5 A;  3CI6 A;  3UB9 A;  3JVV A;  2W3G A;  4NKP A;  5HWT A;  3EEA A;  1N9L A;  3B42 A;  2VV7 A;  3FPW A;  2O9C A;  3LFV A;  4NXF A;  5HDD A;  2W3E A;  5C5K A;  3LUQ A;  3PBN A;  5HPI A;  4JGR A;  3EEH A;  3KSH A;  1DRM A;  3LIC A;  4FSF A;  1F5M A;  1OJ5 A;  5F6A A;  3F1O B;  5F5Y A;  2KLI A;  5DKK A;  4WEJ A;  3F1N B;  4NXG A;  4QPR A;  1GSW A;  3FG8 A;  3H7W B;  2HV1 A;  4G3K A;  2Z6C A;  3NJA A;  4L9G A;  3CAX A;  4ETX A;  1V9Z A;  4F3L B;  1TS8 A;  1S4R A;  1XJ6 A;  2L1M A;  2QWS A;  4CLC B;  4EEU A;  1DP6 A;  2YKH A;  2V0U A;  3IS2 A;  5DFX A;  3R7W B;  1JNU A;  3A0R A;  2O9A A;  5DJU A;  4KUK A;  3RFB A;  2V0W A;  2B18 A;  4CLC A;  1XFQ A;  2GX5 A;  2O99 A;  2W1T B;  5CX7 A;  5TBM B;  3RTY A;  3TRC A;  1NWZ A;  3VV4 A;  4YNR A;  4HP4 A;  1VB6 A;  1W63 Q;  1OTE A;  2W27 A;  4EUV A;  4EER A;  4UQI S;  2Y79 A;  4CLC D;  3C38 A;  3K2N A;  4OOM A;  3K3D A;  2XSS A;  2G7U A;  3CUE C;  4HJ6 A;  3F1N A;  2J3T D;  4BJP A;  3R4K A;  1P9W A;  3UMD A;  4XT2 A;  3LI9 A;  2HJ9 C;  3UB7 A;  4ETZ A;  3T4Q A;  3SW1 A;  3IS2 B;  2OOL A;  1UGU A;  4GW9 A;  2J3T C;  1LSV A;  2ZBB A;  3MQO A;  4XT2 B;  3KSG A;  3ZQ5 A;  3GEC A;  1GSV A;  2R78 A;  3OBF A;  4PAU A;  2VGL S;  3EOI A;  1S67 L;  1BYW A;  4HOI A;  3S7N A;  1XJ4 A;  3FPV A;  4DJ2 A;  2ZOI A;  4EU0 A;  3LR4 A;  2EWV A;  4P6Z S;  3LR5 A;  3PHY A;  4NXE A;  2W3H A;  4I38 A;  2M7V A;  5I5L A;  1YAX A;  3VE4 A;  3E98 A;  2W3F A;  3OCN A;  3VOL A;  2W3D A;  2VZW A;  3LYX A;  4WF0 A;  4Z1W A;  1ODV A;  4HJ4 A;  4IJG A;  3P7N A;  2HJE A;  5IT5 A;  2DMW A;  2K2N A;  4OOL A;  3BY8 A;  3PBR A;  2XRO A;  3O5Y A;  4R70 A;  5HL6 A;  4GLQ A;  3T4J A;  2WKR A;  5A8B A;  4L9E A;  4PKY G;  5HDC A;  5KIZ A;  2K31 A;  1DP8 A;  2ZOH A;  1OTB A;  5HD3 A;  2GNX A;  2D02 A;  1T1B A;  4HI4 A;  4GS9 A;  3E0Y A;  3E4P A;  2VV8 A;  2W1R A;  2GZA A;  3MMH A;  4H6J A;  3EWK A;  4G3V A;  4Y3I A;  4R3A A;  2B02 A;  1T18 A;  2JKR M;  4GS9 B;  3T4S A;  4EXO A;  1ZHH B;  4CLC E;  1MC0 A;  1P97 A;  4LRZ E;  1XFN A;  4MMN A;  1XJ3 A;  2JHE A;  1OJG A;  3C8C A;  4G3W A;  3KYQ A;  4LPZ A;  2LB5 A;  1MKM A;  4O8G A;  1P0Z A;  4DJ3 A;  5HDS A;  4PHT A;  2OAQ 1;  4L9F A;  3B33 A;  4ARZ B;  1H8M A;  5IU1 A;  3EQU A;  5AVF A;  2ZMF A;  4Y5F A;  4KQD A;  1S4S A;  4UQI M;  2BAS A;  4I39 A;  3MF0 A;  1YKD A;  4JGQ A;  2FH5 A;  2OWH A;  1IOU A;  2NUP C;  3BY9 A;  3PYP A;  2W1T A;  5TBM A;  3MXQ A;  2VEA A;  4R38 A;  3E4Q A;  3OC2 A;  4RQ9 A;  4WEL A;  3MQQ A;  5HZH A;  3GDI A;  1S66 L;  2GJ3 A;  3ZYT A;  3RH8 B;  3MFX A;  2HGV A;  3HJI A;  3NHQ A;  3S7Q A;  4LRY C;  3BJN A;  4DMZ A;  2KX6 A;  1YSP A;  4CQH A;  4CLC C;  4L0L A;  5G4Y A;  3T4L A;  2QKP A;  5KSH A;  1S1Z A;  2VJW A;  3T4T A;  2YKF A;  1DP9 A;  4Q0I A;  2JKR I;  3E4O A;  3S7O A;  3OOV A;  3LIA A;  4NXB A;  1Y28 A;  3A0S A;  2ZMV A;  2JN7 A;  3OLO A;  4H6J B;  3TW8 A;  1NLY A;  3LI8 A;  4BBT A;  3KX0 X;  4WEK A;  1GSX A;  2VGL M;  3HJK A;  4JGO A;  3UE6 A;  3KYZ A;  4MN6 A;  5IS1 A;  4IUK A;  4LLO B;  3NOP C;  1UWP X;  1ZTU A;  3KSI A;  3PBT A;  5J4E A;  5K5B A;  1MZU A;  4MCW A;  5F69 A;  5TJJ A;  2KOI A;  3EGD C;  1G28 A;  2IA2 A;  4GHI B;  4HNB A;  2PT7 A;  4B9O A;  4KUO A;  4WL9 A;  2PYR A;  2J3W A;  3EGX C;  3LIB A;  3LR0 A;  4BWI A;  2HF6 A;  2JKT M;  4HHD A;  2XRN A;  3MR0 A;  3MJQ A;  2J80 A;  1LSX A;  2WKQ A;  4B93 A;  1OTI A;  4I5S A;  3ULF A;  2V1B A;  4ARZ A;  5HD5 A;  3CWF A;  4P6Z M;  5AJG A;  3PBQ A;  1LT0 A;  1OT9 A;  2Z6D A;  2VX8 A;  4IHQ A;  1WA9 A;  4II7 A;  4R6L A;  2JKT I;  2P08 A;  1UWN X;  4AFI A;  4EEP A;  5DFY A;  2A2L A;  1F9I A;  2PD8 A;  2EWW A;  3H82 A;  4GHI A;  2LB9 A;  3VE3 A;  1T1A A;  4HH2 A;  3W2Z A;  2KDK A;  5MC7 A;  3PBO A;  1H3Q A;  3H7W A;  4HQA A;  4NEE D;  3CIT A;  1OTA A;  2PR6 A;  3KSF A;  5DF9 A;  4KQO A;  2V1A A;  4HY8 A;  3TE8 A;  1X0O A;  2PR5 A;  3EQV A;  1N9N A;  1F98 A;  2NUT C;  4HIA A;  4Q0H A;  2H28 A;  3G6O A;  1D06 A;  3U2A A;  1EW0 A;  4EET B;  3BQA A;  4UEY A;  1NRJ A;  5J7E A;  4E04 A;  2VLG A;  4O0P A;  3ICY A;  2P04 A;  2VV6 A;  2A24 B;  4MN5 A;  4EQ1 A;  1G6O A;  1TF1 A;  4FOF A;  2INW A;  2QHK A;  2QYB A;  4HJ3 A;  1IFQ A;  2K7S A;  4F3L A;  3H9W A;  1KOU A;  4O01 A;  2VKS A;  5L8M A;  4Q0J A;  4WLA A;  2XA7 S;  1YSQ A;  3LIF A;  3BQ8 A;  1T1C A;  3F1P A;  3HCY A;  1STZ A;  3LR3 A;  4BBV A;  2FZ0 A;  3B47 A;  4WUJ A;  3F1O A;  4MDZ A;  3BWL A;  4I3I A;  1LL8 A;  2I9V A;  3BW6 A;  4I3J A;  2VA0 A;  3LID A;  5HWV A;  4LRX C;  1S1Y A;  4EW7 A;  2WKP A;  3CLO A;  4HH3 A;  5G4Z A;  4K08 A;  4M4X A;  3D3O A;  2MJ6 A;  5AVE A;  3NOU C;  4YOF A;  4YWZ A;  3UME A;  1T19 A;  1D7E A;  3MQ0 A;  5F68 A;  4BBU A;  5DJT A;  5LBR A;  4IUH A;  1W63 M;  3UB6 A;  2Y8H A;  1OPX A;  1N9O A;  3C30 A;  2W0N A;  3P01 A;  1P9R A;  3V67 A;  4DN0 A;  4JGP A;  2M7U A;  3OCL A;  2QJ7 A;  3A0V A;  1VHM A;  1XJ2 A;  3JVU A;  3T50 A;  1LSW A;  3PXP A;  2CMN A;  4PKY A;  4ZRR A;  5DKL A;  2P7J A;  4BMW A;  4GCZ A;  3UB8 A;  2PDR A;  3UE3 A;  3R7W A;  3LIE A;  1TS0 A;  3IBR A;  1NLZ A;  3D72 A;  3S7P A;  5EFW A;  2L4R A;  2V9A A;  1OT6 A;  5FL3 A;  1TD5 A;  3PR6 A;  3PBS A;  4ME4 A;  1TS6 A;  2PHY A;  3C2W A;  2L0W A;  2O9B A;  2QJ5 A;  4Y2F A;  3NOT C;  2D01 A;  3T4K A;  2M1C A;  2OWJ A;  3H82 B;  3TJZ C;  4HP9 A;  3KO6 A;  2A24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...