1OTDA

Strong hydrogen bonds in photoactive yellow protein and their role in its photocycle
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
SQLDNLAFGAIQLDGDGTILQYNAAEGDITGRNPKEVIGKNFFKDVAPCTDSPEFSGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Short hydrogen bonds in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
molecule keywords Photoactive yellow protein
total genus 30
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1otdA00
2ZBBA 1OT6A 4R38A 4KQDA 3E4OA 3UB7A 2W27A 4EQ1A 2QHKA 3NJAA 3HJIA 2EA9A 1T1BA 3C8CA 5HWWA 1OTDA 2B02A 2JN7A 3OLOA 4NXEA 1LSVA 5F6AA 3F1NA 4R3AA 5HD3A 4JGOA 3P7NA 5HWTA 3VE3A 5KIZA 1N9NA 1VB6A 3LIAA 4HIAA 4BBVA 2D01A 3LYXA 5F5YA 1XJ3A 5G4ZA 4HJ3A 5DKLA 1X0OA 2GJ3A 3LICA 3NOUC 4JGRA 1JNUA 1XFQA 3H7WA 4B9OA 1OJGA 1D7EA 3RTYA 1V9ZA 4HH2A 4GS9A 3H82A 4EETB 1T19A 2OWJA 4H6JA 3KX0X 5HDDA 4LPZA 2L4RA 3T50A 1OTEA 1S67L 2INWA 3ICYA 5IU1A 3UMEA 2V0UA 1NWZA 1GSXA 2VEAA 3K3DA 3LIFA 2PR6A 1EW0A 4EXOA 2VV8A 5AVEA 5G4YA 1S1ZA 4HJ6A 4HP9A 2QWSA 2W0NA 3VE4A 3NHQA 2PYRA 2WKRA 4I3AA 4GHIA 1LT0A 3PYPA 3MQOA 4R70A 1S4SA 5DJTA 1BYWA 3UB9A 4EERA 3BY9A 4HY8A 1WA9A 4LRXC 4RQ9A 4WN5A 4I39A 4I38A 3K3CA 3H82B 4GCZA 4I3IA 3CLOA 1T1CA 2V1BA 3CAXA 3FC7A 2ZOIA 3ULFA 4HHDA 3EEHA 5DJUA 5HDSA 1XJ2A 3HJKA 4LRZE 4BBTA 4F3LA 3BY8A 5J3WA 2A24A 2P7JA 3LI8A 1LSWA 2D02A 2ZOHA 2PD7A 3B33A 2VLGA 3IS2A 3MFXA 4HI4A 2JHEA 2M1CA 4DJ2A 1P0ZA 1P97A 1OT9A 1G28A 2VV7A 3EWKA 3MXQA 1S66L 1UGUA 4KUOA 4LLOB 1UWPX 3ZQ5A 4EESA 4GHIB 4L9GA 2WKPA 1OTBA 4R6LA 1V9YA 4HH3A 1MZUA 5AVFA 3UMDA 4BBUA 4EEUA 2V9AA 3H9WA 3NOTC 2KDKA 4MN5A 3LUQA 1N9LA 3GECA 5HDCA 1OTIA 1F98A 1UWNX 4HNBA 4YWZA 5F68A 4WUJA 5TBMB 3MR0A 1DP9A 4EW7A 4WLAA 1XJ4A 2L0WA 3C2WA 2PD8A 1TS8A 4I5SA 4F3LB 5HZHA 4XT2A 5HD5A 2A24B 2QJ7A 4NXFA 2PR5A 5HSQA 1OTAA 4WF0A 4HP4A 3F1PB 2Z6CA 3IS2B 3F1OA 4JGQA 3IBRA 2L1MA 1XFNA 4L9EA 3SW1A 3MJQA 3LIEA 2V0WA 3BWLA 3A0SA 3E4PA 4GW9A 2I9VA 1S1YA 5I5LA 3A0RA 1TS6A 3LIBA 3G6OA 4L9FA 4EEPA 1TS7A 1GSWA 4NXGA 5F69A 3E4QA 5A8BA 5EFWA 3UB6A 3RH8B 2PHYA 1GSVA 3FG8A 5TBMA 4LRYC 1DP8A 4K08A 1S4RA 2Z6DA 2HV1A 3UB8A 3LIDA 2V1AA 4XT2B 2QJ5A 4DJ3A 3LI9A 1DP6A 2YKHA 1F9IA 4KUKA 2K7SA 3A0VA 3F1PA 4WL9A 1XJ6A 1ODVA 1Y28A 4HJ4A 4MN6A 3UE6A 3F1OB 4PKYA 5IS1A 1LSXA 2J80A 2QKPA 3F1NB 5J4EA 1T1AA 2VV6A 1LL8A 1D06A 2KX6A 5DKKA 1T18A 1N9OA 2OWHA 3MQQA 2OOLA 4I3JA 2YKFA 2CMNA 1KOUA 1OJ5A 1TS0A 2H28A 2WKQA 4HOIA 2PDRA 4JGPA 1DRMA 2R78A 3GDIA 4HQAA 4M4XA 3NOPC 5J7EA 3H7WB 4NXBA 2BASA 4PKYG 3D72A 3PHYA 2PYPA 3CWFA 4E04A 4GS9B 3VOLA 5HWVA 4H6JB
chains in the Genus database with same CATH superfamily
3RXWA 2QHKA 5FQQA 3T12B 3FKWA 5HWTA 1O07A 2D01A 4JF5A 3E2KA 2Y8HA 1PZOA 1XFQA 1XKZA 4X25A 4H6JA 4OPQA 1MY8A 3T50A 4GZBA 3TSGA 4FTXA 4OH0A 3PBOA 5CERA 1EW0A 5TJJA 3JVVA 1NXYA 4HP9A 3C4OA 1M6KA 5FATA 4CLCC 4BL2A 1FIKA 4K91A 2Y2PA 2V1BA 3EEHA 4O8GA 2IWCA 5DTKA 5HL6A 2WAFA 3B33A 2Q9NA 4HI4A 3E2LA 4DJ2A 3KSGA 1Q2PA 1TF1A 4X68A 3MZEA 4HH3A 3ZNTA 3GRJA 4E6WA 3EOIA 2K31A 2PR5A 5CHUA 1JTDA 5FQJA 3UO9A 1A0KA 1W8QA 5F69A 3E4QA 2XRNA 5TBMA 4MN7A 5KMWA 3UB8A 3HUMA 4P6BA 3IWOA 2B5RA 1JTGA 3A0VA 2OV5A 4MN6A 1LHYA 4UA9A 3MMHA 4N1XA 4U0TA 3ISGA 3OPLA 2OLUA 5GLBA 1HLUP 3UE1A 4NXBA 2PYPA 4E04A 2Y2IA 4Z9QA 4DE3A 1MWSA 3NJAA 3VSLA 3HJIA 1T1BA 3K2NA 3OLOA 4NEED 1CI9A 4WM9A 5EUAA 3KYZA 5DKLA 2HZ5A 1P9WA 4JGRA 5IHVA 1NLYA 2JE5A 4H8RA 3H82A 4S2NA 3IWIA 1VEUB 5CHJA 4QHCA 4K0WA 4Y2FA 1S1ZA 2XK1A 2HDSA 1YLJA 2J9PA 2ACGA 3SH9A 1BYWA 2PRFA 3CLOA 2JBFA 3O5YA 3LFVA 1K38A 4PM6A 5CEBA 1P97A 4MLLA 5AVFA 4DKIA 2ZL1A 5HPIA 2BLSA 1EROA 1I2SA 5TFQA 5EECA 5FI2A 2H5SA 1L3LA 1Y54A 4P6ZS 2GZAA 3OC2A 1GHIA 4QU3A 2L1MA 2VA0A 5DVAA 2WKHA 1W63M 3LIEA 3SS5A 3G35A 2W3HA 3LIBA 3WS5A 5A8BA 4LCMA 3WS4A 1WE4A 2HV1A 2BG1A 1H0MA 4HBTA 1LL8A 4O01A 2QMIA 4OOLA 2WKQA 5GLCA 3GDIA 4E3JA 4EBPA 3CHWP 1NRJA 5FA7A 3VE3A 3P7NA 4OQGA 1KDWA 4UEYA 1XJ3A 2W3FA 3IX4A 4IUKA 4R4RA 3TOIA 1AWIA 5AJGA 1V9ZA 3BW6A 3MXSA 1W8YA 4R1GA 2PR6A 5AVEA 2FZ0A 4Z1WA 1KVLA 4KQRA 2HDQA 2WKRA 2FFYA 4C3QA 4EERA 2GDNA 4GD8A 1S4SA 3LCEA 2OSUA 2ZC7A 4B4XA 1KE3A 4E3NA 2ZM0A 3HJKA 3DTEA 2ZJ9A 3BY8A 2PU4A 3LR4A 3W4QA 3PAEA 2QPNA 3Q7ZA 4U3TA 3MFXA 1PW8A 3MS6A 1UGUA 3BQAA 4YWZA 1YM1A 3OCNA 4HNBA 1JWPA 4WUJA 2XROA 1XJ4A 4F3LB 1ESIA 2WADA 3LY3A 4Y5FA 4RA7A 5L10A 3NY4A 4JXWA 1TS6A 4X55A 5EVLA 2J3TC 1TDLA 3AGFA 1K57C 4ETXA 5JYOA 3OPRA 1XJ6A 3HVFA 3UE6A 3UE3A 2J80A 3AGEA 4EUZA 2KX6A 3U2AA 1T18A 4I3JA 2M7VA 1RGZA 5EVIB 4PAUA 3OBFA 5J7EA 1SZVA 2O9CA 4WEKA 1IYOA 1PW1A 3E4OA 4BD0A 2JN7A 2GNXA 3CUEA 4BQMA 4CQHA 4BBVA 1M40A 1ONGA 2PU2A 4B9OA 5E2HA 2RCXA 5HAPA 1TEMA 2J3WA 4NG2A 2L4RA 4R3BA 5IU1A 1NJ4A 4K0XA 4QD4A 3KYEA 2OAP1 4MCWA 4MEZA 4I3AA 5E2EA 3BFEA 4Y0OA 4WN5A 3GQZA 4N9LA 1G6OA 1K56A 2XEPA 2ZOIA 3QP6A 2W3EA 3A3EA 1J9MA 1LSWA 1PWGA 2EFUA 4BL3A 4U0XA 3MZFA 1RCJA 4MBHA 1OT9A 3ZFZA 4NK3A 2JKGA 4GHIB 4L9GA 4EEUA 3PBTA 4BMWA 3UN7A 4R23A 1N9BA 3QNBA 4G3VA 3IF6B 3V39A 4IUHA 4OKPA 2P9VA 4KZ5A 2ZLYA 2Y2QA 3BLMA 4JGQA 1IOUA 4OP8A 3Q82A 3MJQA 1KGFA 4GW9A 4L0LA 1W7FA 3PTEA 5EFWA 3HCYA 1SHVA 2H0YA 2EX2A 4K08A 1S4RA 3N7WA 3FYZA 1DJBA 3GVBA 4GN2A 2VGJA 1XPBA 4WMCA 4WELA 5FI7A 3S4XA 2AVXA 3PHYA 1Z6FA 1YLPA 2DCFA 4ARZB 1W79A 4DE2A 3SH7A 5HWWA 4NXEA 2C5WB 4JGOA 3LIAA 3S22A 3MKFA 2BTFP 5FAQA 5TGFA 5E43A 1K6RA 4DDSA 3L7HA 1YMXA 5EM1A 3K3DA 1IYPA 4S2IA 5FL3A 5G4YA 1ALQA 4ESPA 4MBFA 3VE4A 3UPOA 3BFDA 4GLQA 3PYPA 5DJTA 3UB9A 4S2LA 4DXCA 5CHMA 1YKDA 2OAQ1 4P87A 4BBTA 5FSRA 5HAIA 2ZQ7A 1E3UA 1CEFA 4QB8A 1ACFA 2VJWA 4S2JA 3R7WA 3I7JA 2OLVA 4B4ZA 3ZG8B 3MR0A 3CPTB 4DN0A 5L8MA 1PWDA 4PM5A 4FH4A 4Q0JA 2G2UA 5A93A 2ZC4B 4BD1A 3EGXC 4O7DA 4CLCA 1TS7A 1ONHA 3NIAA 3O86A 4OVDA 3FG8A 3VV4A 3TE8A 4S2OA 5FAOA 3JVUA 3LIDA 4KZ9A 1L0FA 3VP0A 4CJNA 4KZ6A 1ZC2A 1FR6A 1IEMA 1L0GA 1T1AA 2KOIA 4UA7A 4Y7PA 1FILA 4WEJA 3W8KA 1TS0A 2V1ZA 3KSIA 2UV0E 4UHUA 3H7WB 3IHAA 5G18A 4ZAMA 3UB7A 3C7VA 1H8YA 4JF6A 3C4PA 2B02A 1LSVA 1SCWA 3M2KA 3LGOA 4WZ4A 5HD3A 2W1TB 2WGWA 2HJ9C 4YNRA 3ITBA 4KZBA 3T1QB 3UE0A 4DRTA 2HGVA 4B93A 1NRFA 3ICYA 2QZ6A 4ME4A 1IYSA 4R70A 1G6AA 4LV0A 4ZJ3A 3IQAA 3K3CA 1JVJA 2B18A 3FC7A 1NYYA 3N4IA 1FQGA 2V20A 4GS9B 3LI8A 2HDUA 3T1SA 1IELA 2WZZA 1P0ZA 5K5BA 4LLOB 4FOFA 5DTTA 1V9YA 2XD1A 4EV4A 5E2FA 1E4DA 3TJZC 3MSHA 4QWOA 3FPWA 5HD5A 5HSQA 5L2FA 2ZMVA 1BUEA 4MBKA 3FZCA 3RXXA 5M18A 2EX8A 3GTCA 3SW1A 3FWLA 1Q2QA 3T4TA 2ZQ8A 5FEFA 1IYQA 4NXGA 2PBDP 1XXMA 3BJNA 4CLCD 3UB6A 1VETB 4F94A 5CRFA 2EX6A 4KQOA 3Q7VA 3B3XA 1DP6A 4WL9A 3DTMA 3U4LP 5DKKA 4MDZA 4JGPA 1H8ZA 1MPLA 1PWCA 4I5SA 2W27A 3MQ0A 2ZQAA 1PNEA 5F6AA 1XGJA 1FR1A 3IHBA 4DXBA 1YT4A 4Y15A 1T19A 4LPZA 1OTEA 3IT9A 1SKOB 2WUQA 5AQBA 3EQVA 2W0NA 2PYRA 2Y2JA 3HLBA 3MXRA 1WA9A 4KZ3A 5FEGA 2XSSA 1SDNA 3A3FA 1DY6A 4HHDA 1EI5A 2WGVA 1ES5A 5J8XA 2QYBA 2VV7A 3G2YA 3KYQA 1UWPX 2HJEA 3Q07A 5AQAA 1IKIA 1MZUA 5DFYA 4OQ0A 2V9AA 1JWVA 4GKUA 3T4LA 1UWNX 1YPRA 3AGDA 4HBUA 3HREA 1TS8A 5BOHA 1NZUA 4WF0A 3BEBA 5FDHA 2X71A 3ZVTA 2V2FF 3T4OA 5L09A 2X01A 3MBZA 3N8RA 3OPHA 3PAGA 4YFMA 3LI9A 2XA7S 3GR2A 5MC7A 2X02A 4X1MA 3ZCZA 2VV6A 3UB5P 1G5UA 1KOUA 5IS1A 2R78A 3NOPC 2P04A 2Y2MA 2BASA 1H3QA 1ZG6A 1CJFA 1H5XA 4BWIA 1BSGA 4R3AA 4OOMA 4S2MA 3SH8A 4D60A 4HIAA 4XUZA 1QMFA 1Z09A 4S2NC 5EVIA 4LENA 1D1JA 1H8MA 4GJ4A 4GS9A 2O99A 3DW0A 1E3UD 2Y2KA 5EM0A 3MFDA 1LT0A 2HP5A 3CI6A 1K4EA 5U47A 5DJUA 5DF8A 4R3JA 3QP2A 1BTLA 5HFOA 1VQQA 4UAAA 3IS2A 2VGLS 2CC1A 3EWKA 1S66L 2XA7M 4IVIA 5J4EA 1N4OA 1W5DA 4GB7A 2KDKA 4QPRA 5DTSA 1BULA 4EW7A 3DTIA 4M3KA 2B95A 2ZQ9A 5F82A 5EV0A 1QMEA 2ZC3B 3BFCA 1KVMA 3A0SA 1MKMA 3OZHA 1YSQA 4E3LA 5HL1A 4WMCD 4JLFA 2YKHA 3B42A 1ODVA 2ZQCA 4FD8A 2P9VB 1CQAA 3A3JA 4IEDA 4IBXA 1CF0A 1N9OA 3MQQA 2ZQDA 2CMNA 1OJ5A 1PFLA 3UDXA 1XA1A 5EOEA 4OQIA 1OMEA 3SOIA 3C8CA 4Y13A 2H0TA 4RX2A 3NBLA 4KZAA 1GA9A 2HP6A 5F5YA 1YMSA 3UPNA 4JPMA 1ES4A 3LEZA 1BLCA 1NZOA 1ES2A 3LY4A 2J8YA 2HDRA 1U60A 3O87A 3OCLA 5CTMA 1GA0A 3KSFA 1STZA 1XGIA 4PMAA 3IXBA 2VEAA 2PT7A 4KG2A 2NUTC 3KSHA 3HLFA 5EVID 2WGIA 2V8FA 4NKPA 3H82B 3VFFA 5DF9A 3GMWA 1XJ2A 1VM1A 3W4PA 2A24A 1JWZA 1K4FA 2VLGA 2G7UA 4KUOA 5M1AA 1PIOA 3NI9A 2JKFA 4R4SA 1I2WA 4Y0UA 4GNUA 3NOTC 2WK0A 5FQ9A 2WYXA 3EGDC 1DP9A 4YOFA 2J9OA 4ID4A 4XT2A 4MMNA 3TRCA 1CK3A 1OTAA 3FPVA 3T4QA 4HP4A 2Z6CA 1W63Q 1PYYA 1BT5A 4E3KA 3G6OA 4Q8IA 4UQIM 4X53A 3VSKA 1FCOA 3CPTA 3UDFA 2I72A 3NECA 3G34A 3VP2A 5EVIC 1DRMA 2IWBA 1S6RA 2M7UA 1OT6A 3EEAA 1BLHA 3ITAA 3V67A 1LI0A 3WS2A 3CG5A 2GJ3A 1YQSA 3NOUC 2IA2A 3H7WA 1OJGA 3BLSA 3UPPA 1SKFA 2XR0A 2R9WA 3LR3A 3MKEA 3PXPA 4JXGA 2W1TA 1YLTA 2Y2GA 2WGWB 3ZNYA 2MJ6A 3P98A 3QP1A 3T4KA 4LRXC 5FI6A 3T4SA 4I39A 3LR5A 4FH2A 2JC7A 3BRMA 2Y59A 4FSFA 3GV9A 1LL5A 1MWRA 2ZD8A 2Y4AA 4JBFA 3IF5A 4R6LA 2Y2LA 3UMDA 3WWXA 5KSCA 1K25A 1OTIA 1YSPA 1EWZA 3VFHA 4DDYA 5E2GA 3C2WA 5HZHA 5AQ7A 2QJ7A 3F1PB 4FCFA 3F1OA 3VOYA 4QJGA 4L9EA 3T4JA 3CJMA 4OPZA 2A2LA 3A0RA 4IBRA 4L9FA 2WKEA 2IWDA 4LRYC 3ZDJA 2V1AA 1ESUA 5CGSA 3S1YA 3CUEC 1HD8A 3NDGA 4KQQA 3NULA 1K54A 2XQZA 5LBRA 5FQIA 3LO7A 4PKYG 3OPPA 2PDRA 4DE1A 3Q1FA 2A3UA 1VETA 4Y3IA 5F83A 1F2KA 1VEUA 3SS3A 5GLDA 3Q7VB 2EA9A 1OTDA 4N1HA 1J3WA 1G68A 2Y2OA 3RTYA 4P6ZM 5C5KA 1Y4OA 2DRWA 2VKSA 4UQIS 1GSXA 3PBRA 3CZDA 4X56A 4EUVA 5GLAA 2JKRI 2ZL1B 4IVKA 1PRQA 3BY9A 4B88A 2E8IA 1PI5A 1PI4A 1VHMA 3CAXA 5D3OA 2O0YA 3UDIA 4YINA 2P7JA 2ZOHA 2VK3A 4P0MA 2XLNA 3BQ8A 1L0EA 4BLMA 4EESA 3GECA 1F98A 3WS1A 3IX3A 4DMZA 2L0WA 2PD8A 4C75A 2XFTA 1KE0A 3FV7A 3CITA 4ZJ2A 2DNSA 2I9VA 1S1YA 4PM8A 3OOVA 2HPBA 3ZG5A 4GDNA 1DP8A 4ZRRA 1ERQA 4HEFA 1CI8A 3DTKA 1Y28A 3F1NB 1XA7A 3P01A 3HLWA 5IT5A 3DWKA 4E3IA 1HVBA 4EU0A 3C30A 5CX7A 4EBNA 3V3RA 4WBGA 1MKIA 2G2WA 1MWTA 4KQDA 2K2NA 3T1XA 3IH9A 5KIZA 1VB6A 1K55A 5FDSA 5G4ZA 4HJ3A 3DWZA 1JNUA 2VX8A 5L07A 4HH2A 2VZWA 4RYEA 3IXGA 4Y17A 1S67L 2JCHA 4OLDA 2V0UA 3BECA 5A90A 2QWSA 3PBNA 2C6WB 2Y2NA 4OQHA 4RQ9A 1K55C 3R4KA 3SS4A 5TR7A 3LR0A 5JYPA 4F3LA 4LRZE 5J3WA 3ZG0A 4FUWA 2JHEA 3S7OA 3H9WA 1MBLA 1WYCA 3LUQA 1NY0A 3UY6A 3T1RA 3HBRA 4LFUA 3IXDA 2P08A 2NUPC 4DE0A 4E3MA 1MXOA 3IS2B 2H10A 3M2JA 1XFNA 3BWLA 3E4PA 5FASA 4G3KA 3R7WB 2EWWA 1GSVA 1RGYA 2Z6DA 3S7NA 4EWFA 3HLEA 2P74A 3IBJA 3ZG9B 4LGWA 2ZC6B 4IJGA 4PKYA 1ZHHB 4N9KA 2ZC5B 2ZMFA 1YLYA 2WZXA 3ZYTA 2EWVA 4BJPA 3CWFA 3VOLA 4H6JB 2ZM8A 4LV1A 1TVFA 1ES3A 3IWQA 3FKVA 5GL9A 3HLCA 1KGEA 1K56D 2PAVP 3NDEA 4CPKA 5EE8A 2LB9A 1XP4A 4QY5A 1BLPA 3VMAA 4MNRA 3ZG7B 3JPUA 1S0WA 1NWZA 4X1LA 2VV8A 4HJ6A 1ZTUA 3NHQA 3HLGA 2JKTI 3MQOA 4I38A 4GCZA 4I3IA 2R9XA 4AFIA 4E6XA 2O9BA 2RL3A 5AQ9A 1C3BA 1KE4A 3ZQ5A 3MXQA 2DMWA 2WKPA 3O3VA 4BBUA 3D9YA 3L9KA 1O7EA 4GOGA 3BYDA 5TBMB 3S7PA 1DJAA 2JKTM 3IBRA 5I5LA 3P09A 4EEPA 2VGKA 1P9RA 1CEGA 3N8LA 3QHYA 1MC0A 5A91A 3HUNA 4Y0TA 4DJ3A 2QJ5A 5FAPA 1F9IA 1YLWA 3E98A 3JYIA 5CGXA 4OP5A 2O9AA 3VP4A 4LV2A 4Q0HA 3D72A 3BM6A 3M6HA 5HWVA 5I94A 5A92A 1KGGA 2FFFB 4NETA 4BENA 2EXBA 1X0OA 4QY6A 3LICA 4OLGA 4LCLA 5CECA 3W4OA 3VP1A 1D7EA 2E8JA 4PPRA 3NC8A 2OWJA 4GDBA 2INWA 4DF6A 1ZKJA 4D2OA 1NLZA 4N92A 1GCEA 3C38A 4C6YA 3GSGA 5GHXA 2Q9MA 4X6TA 1T1CA 3IXHA 4E3OA 2D02A 5KZHA 1K6SA 2GX5A 3WRZA 4WZ5A 3TW8A 1NYMA 3QNCA 2Y2HA 4CLCB 3VOZA 4MN5A 2XGNA 2KLIA 1OPXA 5HAQA 5FQMA 3IF6C 3KO6A 3EQUA 4HESA 3SZTA 3N8SA 3RFBA 1IKGA 3G30A 1WYBA 4OONA 2V0WA 3VP3A 1TD5A 5GHZA 1PZPA 3RH8B 2PHYA 1L2SA 4PHTA 2EFXA 5EOOA 5EVEA 2W3GA 5CGWA 4S2PA 3F1PA 4ZBEA 3TG9A 3F1OB 3HLDA 1LSXA 1D06A 4UA6A 4X69A 2OWHA 4KG5A 1HZOA 3QP8A 3CMZA 4P85A 3ZHHA 3QP5A 4S2KA 3G32A 4KZ7A 4WYYA 1N9NA 2EXAA 5KSHA 3M6BA 4EETB 3KX0X 3G2ZA 5HDDA 3BFGA 1FCMA 1LLBA 3PBQA 4CLCE 3LIFA 1L0DA 3B47A 2PBYA 1K54C 2XF3A 5CXWA 2J3TD 3HUOA 3C7UA 2Z2LB 1DJCA 4JF4A 2XDMA 4KZ8A 4A5RA 4PM9A 1ZG4A 4ZDXA 1K57A 5M19A 5DF7A 3ULFA 4JKTA 1MWUA 2ZMAA 5HW3A 2FH5A 2PD7A 1G28A 3V3SA 2HP9A 2XFSA 3W2ZA 1RP5A 3MZDA 5HX9A 5HDCA 1SDEA 4WLAA 1TDGA 3G4PA 4ZTKA 4IHQA 2J7VA 3DAVA 2WAEA 4LV3A 5CEDA 2HF6A 3D3OA 2Y79A 1F5MA 4ETZA 3O88A 2V8CA 3V50A 4KG6A 4OPYA 2Q0OA 2K7SA 3D4FA 3QP4A 1E25A 2QKPA 3N6IA 2OOLA 2YKFA 3MF0A 4HOIA 3A3DA 4RX3A 1K0KA 1FSWA 2ZBBA 4R38A 4EQ1A 3WS0A 3HL9A 1BZAA 1FOFA 1YAXA 1SKOA 2A49A 3F1NA 3S7QA 3LYXA 1KDSA 4Q0IA 4JXVA 5FQKA 3BFFA 3A3IA 4OOYA 3UNWA 4R0QA 2ZM2A 1YLZA 3Q81A 2JKRM 2W3DA 2XH9A 3PBSA 3UMEA 4OPRA 4EXOA 5CTNA 1AXBA 4GHIA 1FSYA 3ZGAB 1FCNA 2Y55A 2Z2MB 1XX2A 4HY8A 3IX8A 4KZ4A 5HARA 3PR6A 1BLSA 1I5QA 4O0PA 4WZ5C 4XXRA 5HDSA 3IF6A 4KENB 5GHYA 4XUXA 2W1RA 2M1CA 3NCKA 1OTBA 2LB5A 2XD5A 4RVAA 1N9LA 3G31A 5F68A 4G3WA 1GHPA 2A24B 4NXFA 1HTZA 4EQIA 4ZJ1A 2UWXA 1IFQA 3V5MA 5HPFA 4EBLA 3LEQA 3RJUA 5F1FA 1GHMA 4JXSA 5DFXA 5EPHA 1GSWA 3WRTA 4II7A 4PM7A 3E0YA 1LL9A 4XT2B 4ARZA 4KUKA 1LI9A 2Y91A 1ERMA 4HJ4A 3ZVWA 3DBAA 3C5AA 2H28A 5F1GA 4GD6A 4HQAA 2EX9A 2WKIA 4M4XA 2VGLM 3IH8A
chains in the Genus database with same CATH topology
2QHKA 4ARZB 3C8CA 5HWWA 4NXEA 5HWTA 4JGOA 3LIAA 2D01A 5F5YA 2Y8HA 2LB9A 1XFQA 3OCLA 4H6JA 3KSFA 1STZA 3T50A 3K3DA 1NWZA 2VEAA 3PBOA 1EW0A 2VV8A 5FL3A 5TJJA 5G4YA 2PT7A 3JVVA 4HJ6A 1ZTUA 4HP9A 3VE4A 3NHQA 2NUTC 2JKTI 4GLQA 3KSHA 3PYPA 3MQOA 5DJTA 4CLCC 3UB9A 4I38A 4NKPA 3H82B 4GCZA 4I3IA 4AFIA 2V1BA 1YKDA 5DF9A 2OAQ1 2O9BA 3EEHA 4BBTA 1XJ2A 4O8GA 2A24A 5HL6A 3B33A 2VLGA 4HI4A 4DJ2A 3KSGA 2G7UA 3ZQ5A 1TF1A 3MXQA 4KUOA 2DMWA 2WKPA 2VJWA 4BBUA 4HH3A 3R7WA 3NOTC 3EOIA 5TBMB 3MR0A 3EGDC 2K31A 1DP9A 3S7PA 4YOFA 4DN0A 2JKTM 4XT2A 4MMNA 5L8MA 3TRCA 2PR5A 1OTAA 3FPVA 3T4QA 4HP4A 2Z6CA 4Q0JA 3IBRA 1W63Q 3EGXC 4CLCA 5I5LA 4EEPA 3G6OA 1P9RA 1TS7A 4UQIM 5F69A 3E4QA 2XRNA 3FG8A 5TBMA 1MC0A 4MN7A 3VV4A 3TE8A 3UB8A 3JVUA 3LIDA 4DJ3A 2QJ5A 1F9IA 3A0VA 4MN6A 3E98A 1T1AA 2KOIA 3MMHA 4WEJA 2O9AA 1TS0A 3KSIA 1DRMA 3H7WB 4NXBA 4Q0HA 3D72A 2M7UA 2PYPA 4E04A 5HWVA 1OT6A 3UB7A 3NJAA 3HJIA 1T1BA 3EEAA 3K2NA 2B02A 3OLOA 1LSVA 5HD3A 4NEED 3V67A 2W1TB 3KYZA 1X0OA 5DKLA 2GJ3A 3LICA 2HJ9C 3NOUC 4YNRA 1P9WA 4JGRA 2IA2A 3H7WA 1NLYA 1OJGA 1D7EA 3H82A 2OWJA 2HGVA 4B93A 2INWA 3ICYA 3LR3A 4Y2FA 1S1ZA 3PXPA 1NLZA 4ME4A 2W1TA 2MJ6A 4R70A 1BYWA 3T4KA 4LRXC 3C38A 3T4SA 4I39A 3LR5A 3K3CA 3CLOA 2B18A 1T1CA 3FC7A 3O5YA 3LFVA 4FSFA 3LI8A 2D02A 2GX5A 3TW8A 1P0ZA 1P97A 5AVFA 5K5BA 4LLOB 4FOFA 4R6LA 3UMDA 4CLCB 5HPIA 1V9YA 4MN5A 2KLIA 1OTIA 1YSPA 3TJZC 1OPXA 3C2WA 5HZHA 3FPWA 3KO6A 5HD5A 2QJ7A 5HSQA 2ZMVA 3F1PB 4P6ZS 3EQUA 3F1OA 2GZAA 3OC2A 4L9EA 2L1MA 3SW1A 2VA0A 3RFBA 3T4JA 1W63M 3LIEA 2V0WA 3T4TA 1TD5A 2A2LA 2W3HA 3A0RA 3LIBA 4L9FA 4NXGA 3BJNA 4CLCD 5A8BA 3UB6A 3RH8B 2PHYA 4PHTA 4LRYC 2HV1A 2V1AA 4KQOA 1DP6A 2W3GA 3F1PA 4WL9A 3F1OB 1LSXA 3CUEC 1LL8A 1D06A 5DKKA 4MDZA 2OWHA 5LBRA 4O01A 4OOLA 4JGPA 2WKQA 4PKYG 2PDRA 3GDIA 4Y3IA 4I5SA 2W27A 3MQ0A 2EA9A 1NRJA 1OTDA 5F6AA 3VE3A 3P7NA 1N9NA 4UEYA 1XJ3A 2W3FA 4IUKA 5KSHA 5AJGA 3RTYA 1V9ZA 4P6ZM 4EETB 1T19A 3BW6A 3KX0X 5HDDA 5C5KA 4LPZA 1OTEA 2VKSA 4UQIS 4CLCE 1GSXA 3PBQA 3LIFA 2PR6A 3PBRA 3B47A 5AVEA 2FZ0A 4Z1WA 4EUVA 3EQVA 2W0NA 2JKRI 2J3TD 2PYRA 2WKRA 4EERA 1S4SA 3BY9A 1WA9A 2XSSA 1VHMA 3CAXA 3ULFA 4HHDA 3HJKA 2O0YA 3BY8A 3LR4A 2P7JA 2ZOHA 2FH5A 2PD7A 3MFXA 1G28A 2QYBA 2VV7A 3BQ8A 1UGUA 3KYQA 3BQAA 4EESA 1UWPX 2HJEA 3W2ZA 1MZUA 5DFYA 2V9AA 3GECA 5HDCA 4YWZA 1F98A 1UWNX 4HNBA 3OCNA 3T4LA 4WUJA 4DMZA 2XROA 4WLAA 1XJ4A 2L0WA 2PD8A 1TS8A 4F3LB 4IHQA 4WF0A 4Y5FA 3CITA 2I9VA 1S1YA 1TS6A 2HF6A 3OOVA 2J3TC 3T4OA 3D3OA 2Y79A 1F5MA 4ETZA 4ETXA 1DP8A 4ZRRA 3LI9A 2XA7S 5MC7A 2K7SA 1XJ6A 1Y28A 3UE6A 3UE3A 2J80A 3F1NB 2QKPA 3P01A 2VV6A 2KX6A 5IT5A 3U2AA 1T18A 4I3JA 2OOLA 2YKFA 3MF0A 2M7VA 1KOUA 4PAUA 5IS1A 4HOIA 2R78A 4EU0A 3OBFA 3C30A 3NOPC 5J7EA 2P04A 5CX7A 2BASA 2O9CA 4WEKA 1H3QA 2ZBBA 4R38A 4KQDA 3E4OA 4EQ1A 2K2NA 1YAXA 2JN7A 4BWIA 2GNXA 3CUEA 3F1NA 4OOMA 4R3AA 5KIZA 1VB6A 4HIAA 3S7QA 4BBVA 4CQHA 3LYXA 4Q0IA 5G4ZA 4HJ3A 1JNUA 1H8MA 4B9OA 2VX8A 4GJ4A 4HH2A 4GS9A 2O99A 2VZWA 2J3WA 2L4RA 2JKRM 1S67L 2W3DA 3PBSA 5IU1A 3UMEA 2V0UA 4EXOA 2QWSA 2OAP1 4MCWA 3PBNA 4I3AA 4GHIA 1LT0A 4RQ9A 4HY8A 4WN5A 1G6OA 3CI6A 3R4KA 3PR6A 2ZOIA 4O0PA 3LR0A 5DJUA 5HDSA 4F3LA 4LRZE 2W3EA 5J3WA 1LSWA 2W1RA 3IS2A 2VGLS 2JHEA 2M1CA 3S7OA 3EWKA 1OT9A 1S66L 2XA7M 4GHIB 4L9GA 1OTBA 5J4EA 2LB5A 4EEUA 3PBTA 3H9WA 4BMWA 2KDKA 3LUQA 1N9LA 4QPRA 5F68A 4G3WA 4EW7A 4G3VA 2P08A 2NUPC 2A24B 4NXFA 4IUHA 3IS2B 4JGQA 1IOUA 1XFNA 1IFQA 5HPFA 3MJQA 4GW9A 3BWLA 3A0SA 3E4PA 4G3KA 1MKMA 4L0LA 3R7WB 5DFXA 1GSWA 2EWWA 1YSQA 4II7A 3E0YA 5EFWA 1GSVA 3HCYA 4K08A 1S4RA 2Z6DA 4XT2B 3S7NA 4ARZA 2YKHA 4KUKA 3B42A 3IBJA 1ODVA 4HJ4A 4PKYA 4IJGA 1ZHHB 3DBAA 1N9OA 3MQQA 2ZMFA 2CMNA 1OJ5A 2H28A 4M4XA 3ZYTA 4HQAA 4WELA 2EWVA 4BJPA 3PHYA 3CWFA 4GS9B 3VOLA 2VGLM 4H6JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZBB A;  1OT6 A;  4R38 A;  4KQD A;  3E4O A;  3UB7 A;  2W27 A;  4EQ1 A;  2QHK A;  3NJA A;  3HJI A;  2EA9 A;  1T1B A;  3C8C A;  5HWW A;  1OTD A;  2B02 A;  2JN7 A;  3OLO A;  4NXE A;  1LSV A;  5F6A A;  3F1N A;  4R3A A;  5HD3 A;  4JGO A;  3P7N A;  5HWT A;  3VE3 A;  5KIZ A;  1N9N A;  1VB6 A;  3LIA A;  4HIA A;  4BBV A;  2D01 A;  3LYX A;  5F5Y A;  1XJ3 A;  5G4Z A;  4HJ3 A;  5DKL A;  1X0O A;  2GJ3 A;  3LIC A;  3NOU C;  4JGR A;  1JNU A;  1XFQ A;  3H7W A;  4B9O A;  1OJG A;  1D7E A;  3RTY A;  1V9Z A;  4HH2 A;  4GS9 A;  3H82 A;  4EET B;  1T19 A;  2OWJ A;  4H6J A;  3KX0 X;  5HDD A;  4LPZ A;  2L4R A;  3T50 A;  1OTE A;  1S67 L;  2INW A;  3ICY A;  5IU1 A;  3UME A;  2V0U A;  1NWZ A;  1GSX A;  2VEA A;  3K3D A;  3LIF A;  2PR6 A;  1EW0 A;  4EXO A;  2VV8 A;  5AVE A;  5G4Y A;  1S1Z A;  4HJ6 A;  4HP9 A;  2QWS A;  2W0N A;  3VE4 A;  3NHQ A;  2PYR A;  2WKR A;  4I3A A;  4GHI A;  1LT0 A;  3PYP A;  3MQO A;  4R70 A;  1S4S A;  5DJT A;  1BYW A;  3UB9 A;  4EER A;  3BY9 A;  4HY8 A;  1WA9 A;  4LRX C;  4RQ9 A;  4WN5 A;  4I39 A;  4I38 A;  3K3C A;  3H82 B;  4GCZ A;  4I3I A;  3CLO A;  1T1C A;  2V1B A;  3CAX A;  3FC7 A;  2ZOI A;  3ULF A;  4HHD A;  3EEH A;  5DJU A;  5HDS A;  1XJ2 A;  3HJK A;  4LRZ E;  4BBT A;  4F3L A;  3BY8 A;  5J3W A;  2A24 A;  2P7J A;  3LI8 A;  1LSW A;  2D02 A;  2ZOH A;  2PD7 A;  3B33 A;  2VLG A;  3IS2 A;  3MFX A;  4HI4 A;  2JHE A;  2M1C A;  4DJ2 A;  1P0Z A;  1P97 A;  1OT9 A;  1G28 A;  2VV7 A;  3EWK A;  3MXQ A;  1S66 L;  1UGU A;  4KUO A;  4LLO B;  1UWP X;  3ZQ5 A;  4EES A;  4GHI B;  4L9G A;  2WKP A;  1OTB A;  4R6L A;  1V9Y A;  4HH3 A;  1MZU A;  5AVF A;  3UMD A;  4BBU A;  4EEU A;  2V9A A;  3H9W A;  3NOT C;  2KDK A;  4MN5 A;  3LUQ A;  1N9L A;  3GEC A;  5HDC A;  1OTI A;  1F98 A;  1UWN X;  4HNB A;  4YWZ A;  5F68 A;  4WUJ A;  5TBM B;  3MR0 A;  1DP9 A;  4EW7 A;  4WLA A;  1XJ4 A;  2L0W A;  3C2W A;  2PD8 A;  1TS8 A;  4I5S A;  4F3L B;  5HZH A;  4XT2 A;  5HD5 A;  2A24 B;  2QJ7 A;  4NXF A;  2PR5 A;  5HSQ A;  1OTA A;  4WF0 A;  4HP4 A;  3F1P B;  2Z6C A;  3IS2 B;  3F1O A;  4JGQ A;  3IBR A;  2L1M A;  1XFN A;  4L9E A;  3SW1 A;  3MJQ A;  3LIE A;  2V0W A;  3BWL A;  3A0S A;  3E4P A;  4GW9 A;  2I9V A;  1S1Y A;  5I5L A;  3A0R A;  1TS6 A;  3LIB A;  3G6O A;  4L9F A;  4EEP A;  1TS7 A;  1GSW A;  4NXG A;  5F69 A;  3E4Q A;  5A8B A;  5EFW A;  3UB6 A;  3RH8 B;  2PHY A;  1GSV A;  3FG8 A;  5TBM A;  4LRY C;  1DP8 A;  4K08 A;  1S4R A;  2Z6D A;  2HV1 A;  3UB8 A;  3LID A;  2V1A A;  4XT2 B;  2QJ5 A;  4DJ3 A;  3LI9 A;  1DP6 A;  2YKH A;  1F9I A;  4KUK A;  2K7S A;  3A0V A;  3F1P A;  4WL9 A;  1XJ6 A;  1ODV A;  1Y28 A;  4HJ4 A;  4MN6 A;  3UE6 A;  3F1O B;  4PKY A;  5IS1 A;  1LSX A;  2J80 A;  2QKP A;  3F1N B;  5J4E A;  1T1A A;  2VV6 A;  1LL8 A;  1D06 A;  2KX6 A;  5DKK A;  1T18 A;  1N9O A;  2OWH A;  3MQQ A;  2OOL A;  4I3J A;  2YKF A;  2CMN A;  1KOU A;  1OJ5 A;  1TS0 A;  2H28 A;  2WKQ A;  4HOI A;  2PDR A;  4JGP A;  1DRM A;  2R78 A;  3GDI A;  4HQA A;  4M4X A;  3NOP C;  5J7E A;  3H7W B;  4NXB A;  2BAS A;  4PKY G;  3D72 A;  3PHY A;  2PYP A;  3CWF A;  4E04 A;  4GS9 B;  3VOL A;  5HWV A;  4H6J B; 
#chains in the Genus database with same CATH topology
 3RXW A;  2QHK A;  5FQQ A;  3T12 B;  3FKW A;  5HWT A;  1O07 A;  2D01 A;  4JF5 A;  3E2K A;  2Y8H A;  1PZO A;  1XFQ A;  1XKZ A;  4X25 A;  4H6J A;  4OPQ A;  1MY8 A;  3T50 A;  4GZB A;  3TSG A;  4FTX A;  4OH0 A;  3PBO A;  5CER A;  1EW0 A;  5TJJ A;  3JVV A;  1NXY A;  4HP9 A;  3C4O A;  1M6K A;  5FAT A;  4CLC C;  4BL2 A;  1FIK A;  4K91 A;  2Y2P A;  2V1B A;  3EEH A;  4O8G A;  2IWC A;  5DTK A;  5HL6 A;  2WAF A;  3B33 A;  2Q9N A;  4HI4 A;  3E2L A;  4DJ2 A;  3KSG A;  1Q2P A;  1TF1 A;  4X68 A;  3MZE A;  4HH3 A;  3ZNT A;  3GRJ A;  4E6W A;  3EOI A;  2K31 A;  2PR5 A;  5CHU A;  1JTD A;  5FQJ A;  3UO9 A;  1A0K A;  1W8Q A;  5F69 A;  3E4Q A;  2XRN A;  5TBM A;  4MN7 A;  5KMW A;  3UB8 A;  3HUM A;  4P6B A;  3IWO A;  2B5R A;  1JTG A;  3A0V A;  2OV5 A;  4MN6 A;  1LHY A;  4UA9 A;  3MMH A;  4N1X A;  4U0T A;  3ISG A;  3OPL A;  2OLU A;  5GLB A;  1HLU P;  3UE1 A;  4NXB A;  2PYP A;  4E04 A;  2Y2I A;  4Z9Q A;  4DE3 A;  1MWS A;  3NJA A;  3VSL A;  3HJI A;  1T1B A;  3K2N A;  3OLO A;  4NEE D;  1CI9 A;  4WM9 A;  5EUA A;  3KYZ A;  5DKL A;  2HZ5 A;  1P9W A;  4JGR A;  5IHV A;  1NLY A;  2JE5 A;  4H8R A;  3H82 A;  4S2N A;  3IWI A;  1VEU B;  5CHJ A;  4QHC A;  4K0W A;  4Y2F A;  1S1Z A;  2XK1 A;  2HDS A;  1YLJ A;  2J9P A;  2ACG A;  3SH9 A;  1BYW A;  2PRF A;  3CLO A;  2JBF A;  3O5Y A;  3LFV A;  1K38 A;  4PM6 A;  5CEB A;  1P97 A;  4MLL A;  5AVF A;  4DKI A;  2ZL1 A;  5HPI A;  2BLS A;  1ERO A;  1I2S A;  5TFQ A;  5EEC A;  5FI2 A;  2H5S A;  1L3L A;  1Y54 A;  4P6Z S;  2GZA A;  3OC2 A;  1GHI A;  4QU3 A;  2L1M A;  2VA0 A;  5DVA A;  2WKH A;  1W63 M;  3LIE A;  3SS5 A;  3G35 A;  2W3H A;  3LIB A;  3WS5 A;  5A8B A;  4LCM A;  3WS4 A;  1WE4 A;  2HV1 A;  2BG1 A;  1H0M A;  4HBT A;  1LL8 A;  4O01 A;  2QMI A;  4OOL A;  2WKQ A;  5GLC A;  3GDI A;  4E3J A;  4EBP A;  3CHW P;  1NRJ A;  5FA7 A;  3VE3 A;  3P7N A;  4OQG A;  1KDW A;  4UEY A;  1XJ3 A;  2W3F A;  3IX4 A;  4IUK A;  4R4R A;  3TOI A;  1AWI A;  5AJG A;  1V9Z A;  3BW6 A;  3MXS A;  1W8Y A;  4R1G A;  2PR6 A;  5AVE A;  2FZ0 A;  4Z1W A;  1KVL A;  4KQR A;  2HDQ A;  2WKR A;  2FFY A;  4C3Q A;  4EER A;  2GDN A;  4GD8 A;  1S4S A;  3LCE A;  2OSU A;  2ZC7 A;  4B4X A;  1KE3 A;  4E3N A;  2ZM0 A;  3HJK A;  3DTE A;  2ZJ9 A;  3BY8 A;  2PU4 A;  3LR4 A;  3W4Q A;  3PAE A;  2QPN A;  3Q7Z A;  4U3T A;  3MFX A;  1PW8 A;  3MS6 A;  1UGU A;  3BQA A;  4YWZ A;  1YM1 A;  3OCN A;  4HNB A;  1JWP A;  4WUJ A;  2XRO A;  1XJ4 A;  4F3L B;  1ESI A;  2WAD A;  3LY3 A;  4Y5F A;  4RA7 A;  5L10 A;  3NY4 A;  4JXW A;  1TS6 A;  4X55 A;  5EVL A;  2J3T C;  1TDL A;  3AGF A;  1K57 C;  4ETX A;  5JYO A;  3OPR A;  1XJ6 A;  3HVF A;  3UE6 A;  3UE3 A;  2J80 A;  3AGE A;  4EUZ A;  2KX6 A;  3U2A A;  1T18 A;  4I3J A;  2M7V A;  1RGZ A;  5EVI B;  4PAU A;  3OBF A;  5J7E A;  1SZV A;  2O9C A;  4WEK A;  1IYO A;  1PW1 A;  3E4O A;  4BD0 A;  2JN7 A;  2GNX A;  3CUE A;  4BQM A;  4CQH A;  4BBV A;  1M40 A;  1ONG A;  2PU2 A;  4B9O A;  5E2H A;  2RCX A;  5HAP A;  1TEM A;  2J3W A;  4NG2 A;  2L4R A;  4R3B A;  5IU1 A;  1NJ4 A;  4K0X A;  4QD4 A;  3KYE A;  2OAP 1;  4MCW A;  4MEZ A;  4I3A A;  5E2E A;  3BFE A;  4Y0O A;  4WN5 A;  3GQZ A;  4N9L A;  1G6O A;  1K56 A;  2XEP A;  2ZOI A;  3QP6 A;  2W3E A;  3A3E A;  1J9M A;  1LSW A;  1PWG A;  2EFU A;  4BL3 A;  4U0X A;  3MZF A;  1RCJ A;  4MBH A;  1OT9 A;  3ZFZ A;  4NK3 A;  2JKG A;  4GHI B;  4L9G A;  4EEU A;  3PBT A;  4BMW A;  3UN7 A;  4R23 A;  1N9B A;  3QNB A;  4G3V A;  3IF6 B;  3V39 A;  4IUH A;  4OKP A;  2P9V A;  4KZ5 A;  2ZLY A;  2Y2Q A;  3BLM A;  4JGQ A;  1IOU A;  4OP8 A;  3Q82 A;  3MJQ A;  1KGF A;  4GW9 A;  4L0L A;  1W7F A;  3PTE A;  5EFW A;  3HCY A;  1SHV A;  2H0Y A;  2EX2 A;  4K08 A;  1S4R A;  3N7W A;  3FYZ A;  1DJB A;  3GVB A;  4GN2 A;  2VGJ A;  1XPB A;  4WMC A;  4WEL A;  5FI7 A;  3S4X A;  2AVX A;  3PHY A;  1Z6F A;  1YLP A;  2DCF A;  4ARZ B;  1W79 A;  4DE2 A;  3SH7 A;  5HWW A;  4NXE A;  2C5W B;  4JGO A;  3LIA A;  3S22 A;  3MKF A;  2BTF P;  5FAQ A;  5TGF A;  5E43 A;  1K6R A;  4DDS A;  3L7H A;  1YMX A;  5EM1 A;  3K3D A;  1IYP A;  4S2I A;  5FL3 A;  5G4Y A;  1ALQ A;  4ESP A;  4MBF A;  3VE4 A;  3UPO A;  3BFD A;  4GLQ A;  3PYP A;  5DJT A;  3UB9 A;  4S2L A;  4DXC A;  5CHM A;  1YKD A;  2OAQ 1;  4P87 A;  4BBT A;  5FSR A;  5HAI A;  2ZQ7 A;  1E3U A;  1CEF A;  4QB8 A;  1ACF A;  2VJW A;  4S2J A;  3R7W A;  3I7J A;  2OLV A;  4B4Z A;  3ZG8 B;  3MR0 A;  3CPT B;  4DN0 A;  5L8M A;  1PWD A;  4PM5 A;  4FH4 A;  4Q0J A;  2G2U A;  5A93 A;  2ZC4 B;  4BD1 A;  3EGX C;  4O7D A;  4CLC A;  1TS7 A;  1ONH A;  3NIA A;  3O86 A;  4OVD A;  3FG8 A;  3VV4 A;  3TE8 A;  4S2O A;  5FAO A;  3JVU A;  3LID A;  4KZ9 A;  1L0F A;  3VP0 A;  4CJN A;  4KZ6 A;  1ZC2 A;  1FR6 A;  1IEM A;  1L0G A;  1T1A A;  2KOI A;  4UA7 A;  4Y7P A;  1FIL A;  4WEJ A;  3W8K A;  1TS0 A;  2V1Z A;  3KSI A;  2UV0 E;  4UHU A;  3H7W B;  3IHA A;  5G18 A;  4ZAM A;  3UB7 A;  3C7V A;  1H8Y A;  4JF6 A;  3C4P A;  2B02 A;  1LSV A;  1SCW A;  3M2K A;  3LGO A;  4WZ4 A;  5HD3 A;  2W1T B;  2WGW A;  2HJ9 C;  4YNR A;  3ITB A;  4KZB A;  3T1Q B;  3UE0 A;  4DRT A;  2HGV A;  4B93 A;  1NRF A;  3ICY A;  2QZ6 A;  4ME4 A;  1IYS A;  4R70 A;  1G6A A;  4LV0 A;  4ZJ3 A;  3IQA A;  3K3C A;  1JVJ A;  2B18 A;  3FC7 A;  1NYY A;  3N4I A;  1FQG A;  2V20 A;  4GS9 B;  3LI8 A;  2HDU A;  3T1S A;  1IEL A;  2WZZ A;  1P0Z A;  5K5B A;  4LLO B;  4FOF A;  5DTT A;  1V9Y A;  2XD1 A;  4EV4 A;  5E2F A;  1E4D A;  3TJZ C;  3MSH A;  4QWO A;  3FPW A;  5HD5 A;  5HSQ A;  5L2F A;  2ZMV A;  1BUE A;  4MBK A;  3FZC A;  3RXX A;  5M18 A;  2EX8 A;  3GTC A;  3SW1 A;  3FWL A;  1Q2Q A;  3T4T A;  2ZQ8 A;  5FEF A;  1IYQ A;  4NXG A;  2PBD P;  1XXM A;  3BJN A;  4CLC D;  3UB6 A;  1VET B;  4F94 A;  5CRF A;  2EX6 A;  4KQO A;  3Q7V A;  3B3X A;  1DP6 A;  4WL9 A;  3DTM A;  3U4L P;  5DKK A;  4MDZ A;  4JGP A;  1H8Z A;  1MPL A;  1PWC A;  4I5S A;  2W27 A;  3MQ0 A;  2ZQA A;  1PNE A;  5F6A A;  1XGJ A;  1FR1 A;  3IHB A;  4DXB A;  1YT4 A;  4Y15 A;  1T19 A;  4LPZ A;  1OTE A;  3IT9 A;  1SKO B;  2WUQ A;  5AQB A;  3EQV A;  2W0N A;  2PYR A;  2Y2J A;  3HLB A;  3MXR A;  1WA9 A;  4KZ3 A;  5FEG A;  2XSS A;  1SDN A;  3A3F A;  1DY6 A;  4HHD A;  1EI5 A;  2WGV A;  1ES5 A;  5J8X A;  2QYB A;  2VV7 A;  3G2Y A;  3KYQ A;  1UWP X;  2HJE A;  3Q07 A;  5AQA A;  1IKI A;  1MZU A;  5DFY A;  4OQ0 A;  2V9A A;  1JWV A;  4GKU A;  3T4L A;  1UWN X;  1YPR A;  3AGD A;  4HBU A;  3HRE A;  1TS8 A;  5BOH A;  1NZU A;  4WF0 A;  3BEB A;  5FDH A;  2X71 A;  3ZVT A;  2V2F F;  3T4O A;  5L09 A;  2X01 A;  3MBZ A;  3N8R A;  3OPH A;  3PAG A;  4YFM A;  3LI9 A;  2XA7 S;  3GR2 A;  5MC7 A;  2X02 A;  4X1M A;  3ZCZ A;  2VV6 A;  3UB5 P;  1G5U A;  1KOU A;  5IS1 A;  2R78 A;  3NOP C;  2P04 A;  2Y2M A;  2BAS A;  1H3Q A;  1ZG6 A;  1CJF A;  1H5X A;  4BWI A;  1BSG A;  4R3A A;  4OOM A;  4S2M A;  3SH8 A;  4D60 A;  4HIA A;  4XUZ A;  1QMF A;  1Z09 A;  4S2N C;  5EVI A;  4LEN A;  1D1J A;  1H8M A;  4GJ4 A;  4GS9 A;  2O99 A;  3DW0 A;  1E3U D;  2Y2K A;  5EM0 A;  3MFD A;  1LT0 A;  2HP5 A;  3CI6 A;  1K4E A;  5U47 A;  5DJU A;  5DF8 A;  4R3J A;  3QP2 A;  1BTL A;  5HFO A;  1VQQ A;  4UAA A;  3IS2 A;  2VGL S;  2CC1 A;  3EWK A;  1S66 L;  2XA7 M;  4IVI A;  5J4E A;  1N4O A;  1W5D A;  4GB7 A;  2KDK A;  4QPR A;  5DTS A;  1BUL A;  4EW7 A;  3DTI A;  4M3K A;  2B95 A;  2ZQ9 A;  5F82 A;  5EV0 A;  1QME A;  2ZC3 B;  3BFC A;  1KVM A;  3A0S A;  1MKM A;  3OZH A;  1YSQ A;  4E3L A;  5HL1 A;  4WMC D;  4JLF A;  2YKH A;  3B42 A;  1ODV A;  2ZQC A;  4FD8 A;  2P9V B;  1CQA A;  3A3J A;  4IED A;  4IBX A;  1CF0 A;  1N9O A;  3MQQ A;  2ZQD A;  2CMN A;  1OJ5 A;  1PFL A;  3UDX A;  1XA1 A;  5EOE A;  4OQI A;  1OME A;  3SOI A;  3C8C A;  4Y13 A;  2H0T A;  4RX2 A;  3NBL A;  4KZA A;  1GA9 A;  2HP6 A;  5F5Y A;  1YMS A;  3UPN A;  4JPM A;  1ES4 A;  3LEZ A;  1BLC A;  1NZO A;  1ES2 A;  3LY4 A;  2J8Y A;  2HDR A;  1U60 A;  3O87 A;  3OCL A;  5CTM A;  1GA0 A;  3KSF A;  1STZ A;  1XGI A;  4PMA A;  3IXB A;  2VEA A;  2PT7 A;  4KG2 A;  2NUT C;  3KSH A;  3HLF A;  5EVI D;  2WGI A;  2V8F A;  4NKP A;  3H82 B;  3VFF A;  5DF9 A;  3GMW A;  1XJ2 A;  1VM1 A;  3W4P A;  2A24 A;  1JWZ A;  1K4F A;  2VLG A;  2G7U A;  4KUO A;  5M1A A;  1PIO A;  3NI9 A;  2JKF A;  4R4S A;  1I2W A;  4Y0U A;  4GNU A;  3NOT C;  2WK0 A;  5FQ9 A;  2WYX A;  3EGD C;  1DP9 A;  4YOF A;  2J9O A;  4ID4 A;  4XT2 A;  4MMN A;  3TRC A;  1CK3 A;  1OTA A;  3FPV A;  3T4Q A;  4HP4 A;  2Z6C A;  1W63 Q;  1PYY A;  1BT5 A;  4E3K A;  3G6O A;  4Q8I A;  4UQI M;  4X53 A;  3VSK A;  1FCO A;  3CPT A;  3UDF A;  2I72 A;  3NEC A;  3G34 A;  3VP2 A;  5EVI C;  1DRM A;  2IWB A;  1S6R A;  2M7U A;  1OT6 A;  3EEA A;  1BLH A;  3ITA A;  3V67 A;  1LI0 A;  3WS2 A;  3CG5 A;  2GJ3 A;  1YQS A;  3NOU C;  2IA2 A;  3H7W A;  1OJG A;  3BLS A;  3UPP A;  1SKF A;  2XR0 A;  2R9W A;  3LR3 A;  3MKE A;  3PXP A;  4JXG A;  2W1T A;  1YLT A;  2Y2G A;  2WGW B;  3ZNY A;  2MJ6 A;  3P98 A;  3QP1 A;  3T4K A;  4LRX C;  5FI6 A;  3T4S A;  4I39 A;  3LR5 A;  4FH2 A;  2JC7 A;  3BRM A;  2Y59 A;  4FSF A;  3GV9 A;  1LL5 A;  1MWR A;  2ZD8 A;  2Y4A A;  4JBF A;  3IF5 A;  4R6L A;  2Y2L A;  3UMD A;  3WWX A;  5KSC A;  1K25 A;  1OTI A;  1YSP A;  1EWZ A;  3VFH A;  4DDY A;  5E2G A;  3C2W A;  5HZH A;  5AQ7 A;  2QJ7 A;  3F1P B;  4FCF A;  3F1O A;  3VOY A;  4QJG A;  4L9E A;  3T4J A;  3CJM A;  4OPZ A;  2A2L A;  3A0R A;  4IBR A;  4L9F A;  2WKE A;  2IWD A;  4LRY C;  3ZDJ A;  2V1A A;  1ESU A;  5CGS A;  3S1Y A;  3CUE C;  1HD8 A;  3NDG A;  4KQQ A;  3NUL A;  1K54 A;  2XQZ A;  5LBR A;  5FQI A;  3LO7 A;  4PKY G;  3OPP A;  2PDR A;  4DE1 A;  3Q1F A;  2A3U A;  1VET A;  4Y3I A;  5F83 A;  1F2K A;  1VEU A;  3SS3 A;  5GLD A;  3Q7V B;  2EA9 A;  1OTD A;  4N1H A;  1J3W A;  1G68 A;  2Y2O A;  3RTY A;  4P6Z M;  5C5K A;  1Y4O A;  2DRW A;  2VKS A;  4UQI S;  1GSX A;  3PBR A;  3CZD A;  4X56 A;  4EUV A;  5GLA A;  2JKR I;  2ZL1 B;  4IVK A;  1PRQ A;  3BY9 A;  4B88 A;  2E8I A;  1PI5 A;  1PI4 A;  1VHM A;  3CAX A;  5D3O A;  2O0Y A;  3UDI A;  4YIN A;  2P7J A;  2ZOH A;  2VK3 A;  4P0M A;  2XLN A;  3BQ8 A;  1L0E A;  4BLM A;  4EES A;  3GEC A;  1F98 A;  3WS1 A;  3IX3 A;  4DMZ A;  2L0W A;  2PD8 A;  4C75 A;  2XFT A;  1KE0 A;  3FV7 A;  3CIT A;  4ZJ2 A;  2DNS A;  2I9V A;  1S1Y A;  4PM8 A;  3OOV A;  2HPB A;  3ZG5 A;  4GDN A;  1DP8 A;  4ZRR A;  1ERQ A;  4HEF A;  1CI8 A;  3DTK A;  1Y28 A;  3F1N B;  1XA7 A;  3P01 A;  3HLW A;  5IT5 A;  3DWK A;  4E3I A;  1HVB A;  4EU0 A;  3C30 A;  5CX7 A;  4EBN A;  3V3R A;  4WBG A;  1MKI A;  2G2W A;  1MWT A;  4KQD A;  2K2N A;  3T1X A;  3IH9 A;  5KIZ A;  1VB6 A;  1K55 A;  5FDS A;  5G4Z A;  4HJ3 A;  3DWZ A;  1JNU A;  2VX8 A;  5L07 A;  4HH2 A;  2VZW A;  4RYE A;  3IXG A;  4Y17 A;  1S67 L;  2JCH A;  4OLD A;  2V0U A;  3BEC A;  5A90 A;  2QWS A;  3PBN A;  2C6W B;  2Y2N A;  4OQH A;  4RQ9 A;  1K55 C;  3R4K A;  3SS4 A;  5TR7 A;  3LR0 A;  5JYP A;  4F3L A;  4LRZ E;  5J3W A;  3ZG0 A;  4FUW A;  2JHE A;  3S7O A;  3H9W A;  1MBL A;  1WYC A;  3LUQ A;  1NY0 A;  3UY6 A;  3T1R A;  3HBR A;  4LFU A;  3IXD A;  2P08 A;  2NUP C;  4DE0 A;  4E3M A;  1MXO A;  3IS2 B;  2H10 A;  3M2J A;  1XFN A;  3BWL A;  3E4P A;  5FAS A;  4G3K A;  3R7W B;  2EWW A;  1GSV A;  1RGY A;  2Z6D A;  3S7N A;  4EWF A;  3HLE A;  2P74 A;  3IBJ A;  3ZG9 B;  4LGW A;  2ZC6 B;  4IJG A;  4PKY A;  1ZHH B;  4N9K A;  2ZC5 B;  2ZMF A;  1YLY A;  2WZX A;  3ZYT A;  2EWV A;  4BJP A;  3CWF A;  3VOL A;  4H6J B;  2ZM8 A;  4LV1 A;  1TVF A;  1ES3 A;  3IWQ A;  3FKV A;  5GL9 A;  3HLC A;  1KGE A;  1K56 D;  2PAV P;  3NDE A;  4CPK A;  5EE8 A;  2LB9 A;  1XP4 A;  4QY5 A;  1BLP A;  3VMA A;  4MNR A;  3ZG7 B;  3JPU A;  1S0W A;  1NWZ A;  4X1L A;  2VV8 A;  4HJ6 A;  1ZTU A;  3NHQ A;  3HLG A;  2JKT I;  3MQO A;  4I38 A;  4GCZ A;  4I3I A;  2R9X A;  4AFI A;  4E6X A;  2O9B A;  2RL3 A;  5AQ9 A;  1C3B A;  1KE4 A;  3ZQ5 A;  3MXQ A;  2DMW A;  2WKP A;  3O3V A;  4BBU A;  3D9Y A;  3L9K A;  1O7E A;  4GOG A;  3BYD A;  5TBM B;  3S7P A;  1DJA A;  2JKT M;  3IBR A;  5I5L A;  3P09 A;  4EEP A;  2VGK A;  1P9R A;  1CEG A;  3N8L A;  3QHY A;  1MC0 A;  5A91 A;  3HUN A;  4Y0T A;  4DJ3 A;  2QJ5 A;  5FAP A;  1F9I A;  1YLW A;  3E98 A;  3JYI A;  5CGX A;  4OP5 A;  2O9A A;  3VP4 A;  4LV2 A;  4Q0H A;  3D72 A;  3BM6 A;  3M6H A;  5HWV A;  5I94 A;  5A92 A;  1KGG A;  2FFF B;  4NET A;  4BEN A;  2EXB A;  1X0O A;  4QY6 A;  3LIC A;  4OLG A;  4LCL A;  5CEC A;  3W4O A;  3VP1 A;  1D7E A;  2E8J A;  4PPR A;  3NC8 A;  2OWJ A;  4GDB A;  2INW A;  4DF6 A;  1ZKJ A;  4D2O A;  1NLZ A;  4N92 A;  1GCE A;  3C38 A;  4C6Y A;  3GSG A;  5GHX A;  2Q9M A;  4X6T A;  1T1C A;  3IXH A;  4E3O A;  2D02 A;  5KZH A;  1K6S A;  2GX5 A;  3WRZ A;  4WZ5 A;  3TW8 A;  1NYM A;  3QNC A;  2Y2H A;  4CLC B;  3VOZ A;  4MN5 A;  2XGN A;  2KLI A;  1OPX A;  5HAQ A;  5FQM A;  3IF6 C;  3KO6 A;  3EQU A;  4HES A;  3SZT A;  3N8S A;  3RFB A;  1IKG A;  3G30 A;  1WYB A;  4OON A;  2V0W A;  3VP3 A;  1TD5 A;  5GHZ A;  1PZP A;  3RH8 B;  2PHY A;  1L2S A;  4PHT A;  2EFX A;  5EOO A;  5EVE A;  2W3G A;  5CGW A;  4S2P A;  3F1P A;  4ZBE A;  3TG9 A;  3F1O B;  3HLD A;  1LSX A;  1D06 A;  4UA6 A;  4X69 A;  2OWH A;  4KG5 A;  1HZO A;  3QP8 A;  3CMZ A;  4P85 A;  3ZHH A;  3QP5 A;  4S2K A;  3G32 A;  4KZ7 A;  4WYY A;  1N9N A;  2EXA A;  5KSH A;  3M6B A;  4EET B;  3KX0 X;  3G2Z A;  5HDD A;  3BFG A;  1FCM A;  1LLB A;  3PBQ A;  4CLC E;  3LIF A;  1L0D A;  3B47 A;  2PBY A;  1K54 C;  2XF3 A;  5CXW A;  2J3T D;  3HUO A;  3C7U A;  2Z2L B;  1DJC A;  4JF4 A;  2XDM A;  4KZ8 A;  4A5R A;  4PM9 A;  1ZG4 A;  4ZDX A;  1K57 A;  5M19 A;  5DF7 A;  3ULF A;  4JKT A;  1MWU A;  2ZMA A;  5HW3 A;  2FH5 A;  2PD7 A;  1G28 A;  3V3S A;  2HP9 A;  2XFS A;  3W2Z A;  1RP5 A;  3MZD A;  5HX9 A;  5HDC A;  1SDE A;  4WLA A;  1TDG A;  3G4P A;  4ZTK A;  4IHQ A;  2J7V A;  3DAV A;  2WAE A;  4LV3 A;  5CED A;  2HF6 A;  3D3O A;  2Y79 A;  1F5M A;  4ETZ A;  3O88 A;  2V8C A;  3V50 A;  4KG6 A;  4OPY A;  2Q0O A;  2K7S A;  3D4F A;  3QP4 A;  1E25 A;  2QKP A;  3N6I A;  2OOL A;  2YKF A;  3MF0 A;  4HOI A;  3A3D A;  4RX3 A;  1K0K A;  1FSW A;  2ZBB A;  4R38 A;  4EQ1 A;  3WS0 A;  3HL9 A;  1BZA A;  1FOF A;  1YAX A;  1SKO A;  2A49 A;  3F1N A;  3S7Q A;  3LYX A;  1KDS A;  4Q0I A;  4JXV A;  5FQK A;  3BFF A;  3A3I A;  4OOY A;  3UNW A;  4R0Q A;  2ZM2 A;  1YLZ A;  3Q81 A;  2JKR M;  2W3D A;  2XH9 A;  3PBS A;  3UME A;  4OPR A;  4EXO A;  5CTN A;  1AXB A;  4GHI A;  1FSY A;  3ZGA B;  1FCN A;  2Y55 A;  2Z2M B;  1XX2 A;  4HY8 A;  3IX8 A;  4KZ4 A;  5HAR A;  3PR6 A;  1BLS A;  1I5Q A;  4O0P A;  4WZ5 C;  4XXR A;  5HDS A;  3IF6 A;  4KEN B;  5GHY A;  4XUX A;  2W1R A;  2M1C A;  3NCK A;  1OTB A;  2LB5 A;  2XD5 A;  4RVA A;  1N9L A;  3G31 A;  5F68 A;  4G3W A;  1GHP A;  2A24 B;  4NXF A;  1HTZ A;  4EQI A;  4ZJ1 A;  2UWX A;  1IFQ A;  3V5M A;  5HPF A;  4EBL A;  3LEQ A;  3RJU A;  5F1F A;  1GHM A;  4JXS A;  5DFX A;  5EPH A;  1GSW A;  3WRT A;  4II7 A;  4PM7 A;  3E0Y A;  1LL9 A;  4XT2 B;  4ARZ A;  4KUK A;  1LI9 A;  2Y91 A;  1ERM A;  4HJ4 A;  3ZVW A;  3DBA A;  3C5A A;  2H28 A;  5F1G A;  4GD6 A;  4HQA A;  2EX9 A;  2WKI A;  4M4X A;  2VGL M;  3IH8 A; 
#chains in the Genus database with same CATH homology
 2QHK A;  4ARZ B;  3C8C A;  5HWW A;  4NXE A;  5HWT A;  4JGO A;  3LIA A;  2D01 A;  5F5Y A;  2Y8H A;  2LB9 A;  1XFQ A;  3OCL A;  4H6J A;  3KSF A;  1STZ A;  3T50 A;  3K3D A;  1NWZ A;  2VEA A;  3PBO A;  1EW0 A;  2VV8 A;  5FL3 A;  5TJJ A;  5G4Y A;  2PT7 A;  3JVV A;  4HJ6 A;  1ZTU A;  4HP9 A;  3VE4 A;  3NHQ A;  2NUT C;  2JKT I;  4GLQ A;  3KSH A;  3PYP A;  3MQO A;  5DJT A;  4CLC C;  3UB9 A;  4I38 A;  4NKP A;  3H82 B;  4GCZ A;  4I3I A;  4AFI A;  2V1B A;  1YKD A;  5DF9 A;  2OAQ 1;  2O9B A;  3EEH A;  4BBT A;  1XJ2 A;  4O8G A;  2A24 A;  5HL6 A;  3B33 A;  2VLG A;  4HI4 A;  4DJ2 A;  3KSG A;  2G7U A;  3ZQ5 A;  1TF1 A;  3MXQ A;  4KUO A;  2DMW A;  2WKP A;  2VJW A;  4BBU A;  4HH3 A;  3R7W A;  3NOT C;  3EOI A;  5TBM B;  3MR0 A;  3EGD C;  2K31 A;  1DP9 A;  3S7P A;  4YOF A;  4DN0 A;  2JKT M;  4XT2 A;  4MMN A;  5L8M A;  3TRC A;  2PR5 A;  1OTA A;  3FPV A;  3T4Q A;  4HP4 A;  2Z6C A;  4Q0J A;  3IBR A;  1W63 Q;  3EGX C;  4CLC A;  5I5L A;  4EEP A;  3G6O A;  1P9R A;  1TS7 A;  4UQI M;  5F69 A;  3E4Q A;  2XRN A;  3FG8 A;  5TBM A;  1MC0 A;  4MN7 A;  3VV4 A;  3TE8 A;  3UB8 A;  3JVU A;  3LID A;  4DJ3 A;  2QJ5 A;  1F9I A;  3A0V A;  4MN6 A;  3E98 A;  1T1A A;  2KOI A;  3MMH A;  4WEJ A;  2O9A A;  1TS0 A;  3KSI A;  1DRM A;  3H7W B;  4NXB A;  4Q0H A;  3D72 A;  2M7U A;  2PYP A;  4E04 A;  5HWV A;  1OT6 A;  3UB7 A;  3NJA A;  3HJI A;  1T1B A;  3EEA A;  3K2N A;  2B02 A;  3OLO A;  1LSV A;  5HD3 A;  4NEE D;  3V67 A;  2W1T B;  3KYZ A;  1X0O A;  5DKL A;  2GJ3 A;  3LIC A;  2HJ9 C;  3NOU C;  4YNR A;  1P9W A;  4JGR A;  2IA2 A;  3H7W A;  1NLY A;  1OJG A;  1D7E A;  3H82 A;  2OWJ A;  2HGV A;  4B93 A;  2INW A;  3ICY A;  3LR3 A;  4Y2F A;  1S1Z A;  3PXP A;  1NLZ A;  4ME4 A;  2W1T A;  2MJ6 A;  4R70 A;  1BYW A;  3T4K A;  4LRX C;  3C38 A;  3T4S A;  4I39 A;  3LR5 A;  3K3C A;  3CLO A;  2B18 A;  1T1C A;  3FC7 A;  3O5Y A;  3LFV A;  4FSF A;  3LI8 A;  2D02 A;  2GX5 A;  3TW8 A;  1P0Z A;  1P97 A;  5AVF A;  5K5B A;  4LLO B;  4FOF A;  4R6L A;  3UMD A;  4CLC B;  5HPI A;  1V9Y A;  4MN5 A;  2KLI A;  1OTI A;  1YSP A;  3TJZ C;  1OPX A;  3C2W A;  5HZH A;  3FPW A;  3KO6 A;  5HD5 A;  2QJ7 A;  5HSQ A;  2ZMV A;  3F1P B;  4P6Z S;  3EQU A;  3F1O A;  2GZA A;  3OC2 A;  4L9E A;  2L1M A;  3SW1 A;  2VA0 A;  3RFB A;  3T4J A;  1W63 M;  3LIE A;  2V0W A;  3T4T A;  1TD5 A;  2A2L A;  2W3H A;  3A0R A;  3LIB A;  4L9F A;  4NXG A;  3BJN A;  4CLC D;  5A8B A;  3UB6 A;  3RH8 B;  2PHY A;  4PHT A;  4LRY C;  2HV1 A;  2V1A A;  4KQO A;  1DP6 A;  2W3G A;  3F1P A;  4WL9 A;  3F1O B;  1LSX A;  3CUE C;  1LL8 A;  1D06 A;  5DKK A;  4MDZ A;  2OWH A;  5LBR A;  4O01 A;  4OOL A;  4JGP A;  2WKQ A;  4PKY G;  2PDR A;  3GDI A;  4Y3I A;  4I5S A;  2W27 A;  3MQ0 A;  2EA9 A;  1NRJ A;  1OTD A;  5F6A A;  3VE3 A;  3P7N A;  1N9N A;  4UEY A;  1XJ3 A;  2W3F A;  4IUK A;  5KSH A;  5AJG A;  3RTY A;  1V9Z A;  4P6Z M;  4EET B;  1T19 A;  3BW6 A;  3KX0 X;  5HDD A;  5C5K A;  4LPZ A;  1OTE A;  2VKS A;  4UQI S;  4CLC E;  1GSX A;  3PBQ A;  3LIF A;  2PR6 A;  3PBR A;  3B47 A;  5AVE A;  2FZ0 A;  4Z1W A;  4EUV A;  3EQV A;  2W0N A;  2JKR I;  2J3T D;  2PYR A;  2WKR A;  4EER A;  1S4S A;  3BY9 A;  1WA9 A;  2XSS A;  1VHM A;  3CAX A;  3ULF A;  4HHD A;  3HJK A;  2O0Y A;  3BY8 A;  3LR4 A;  2P7J A;  2ZOH A;  2FH5 A;  2PD7 A;  3MFX A;  1G28 A;  2QYB A;  2VV7 A;  3BQ8 A;  1UGU A;  3KYQ A;  3BQA A;  4EES A;  1UWP X;  2HJE A;  3W2Z A;  1MZU A;  5DFY A;  2V9A A;  3GEC A;  5HDC A;  4YWZ A;  1F98 A;  1UWN X;  4HNB A;  3OCN A;  3T4L A;  4WUJ A;  4DMZ A;  2XRO A;  4WLA A;  1XJ4 A;  2L0W A;  2PD8 A;  1TS8 A;  4F3L B;  4IHQ A;  4WF0 A;  4Y5F A;  3CIT A;  2I9V A;  1S1Y A;  1TS6 A;  2HF6 A;  3OOV A;  2J3T C;  3T4O A;  3D3O A;  2Y79 A;  1F5M A;  4ETZ A;  4ETX A;  1DP8 A;  4ZRR A;  3LI9 A;  2XA7 S;  5MC7 A;  2K7S A;  1XJ6 A;  1Y28 A;  3UE6 A;  3UE3 A;  2J80 A;  3F1N B;  2QKP A;  3P01 A;  2VV6 A;  2KX6 A;  5IT5 A;  3U2A A;  1T18 A;  4I3J A;  2OOL A;  2YKF A;  3MF0 A;  2M7V A;  1KOU A;  4PAU A;  5IS1 A;  4HOI A;  2R78 A;  4EU0 A;  3OBF A;  3C30 A;  3NOP C;  5J7E A;  2P04 A;  5CX7 A;  2BAS A;  2O9C A;  4WEK A;  1H3Q A;  2ZBB A;  4R38 A;  4KQD A;  3E4O A;  4EQ1 A;  2K2N A;  1YAX A;  2JN7 A;  4BWI A;  2GNX A;  3CUE A;  3F1N A;  4OOM A;  4R3A A;  5KIZ A;  1VB6 A;  4HIA A;  3S7Q A;  4BBV A;  4CQH A;  3LYX A;  4Q0I A;  5G4Z A;  4HJ3 A;  1JNU A;  1H8M A;  4B9O A;  2VX8 A;  4GJ4 A;  4HH2 A;  4GS9 A;  2O99 A;  2VZW A;  2J3W A;  2L4R A;  2JKR M;  1S67 L;  2W3D A;  3PBS A;  5IU1 A;  3UME A;  2V0U A;  4EXO A;  2QWS A;  2OAP 1;  4MCW A;  3PBN A;  4I3A A;  4GHI A;  1LT0 A;  4RQ9 A;  4HY8 A;  4WN5 A;  1G6O A;  3CI6 A;  3R4K A;  3PR6 A;  2ZOI A;  4O0P A;  3LR0 A;  5DJU A;  5HDS A;  4F3L A;  4LRZ E;  2W3E A;  5J3W A;  1LSW A;  2W1R A;  3IS2 A;  2VGL S;  2JHE A;  2M1C A;  3S7O A;  3EWK A;  1OT9 A;  1S66 L;  2XA7 M;  4GHI B;  4L9G A;  1OTB A;  5J4E A;  2LB5 A;  4EEU A;  3PBT A;  3H9W A;  4BMW A;  2KDK A;  3LUQ A;  1N9L A;  4QPR A;  5F68 A;  4G3W A;  4EW7 A;  4G3V A;  2P08 A;  2NUP C;  2A24 B;  4NXF A;  4IUH A;  3IS2 B;  4JGQ A;  1IOU A;  1XFN A;  1IFQ A;  5HPF A;  3MJQ A;  4GW9 A;  3BWL A;  3A0S A;  3E4P A;  4G3K A;  1MKM A;  4L0L A;  3R7W B;  5DFX A;  1GSW A;  2EWW A;  1YSQ A;  4II7 A;  3E0Y A;  5EFW A;  1GSV A;  3HCY A;  4K08 A;  1S4R A;  2Z6D A;  4XT2 B;  3S7N A;  4ARZ A;  2YKH A;  4KUK A;  3B42 A;  3IBJ A;  1ODV A;  4HJ4 A;  4PKY A;  4IJG A;  1ZHH B;  3DBA A;  1N9O A;  3MQQ A;  2ZMF A;  2CMN A;  1OJ5 A;  2H28 A;  4M4X A;  3ZYT A;  4HQA A;  4WEL A;  2EWV A;  4BJP A;  3PHY A;  3CWF A;  4GS9 B;  3VOL A;  2VGL M;  4H6J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...