1OTDA

Strong hydrogen bonds in photoactive yellow protein and their role in its photocycle
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
SQLDNLAFGAIQLDGDGTILQYNAAEGDITGRNPKEVIGKNFFKDVAPCTDSPEFSGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Photoactive yellow protein
publication title Short hydrogen bonds in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 30
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1otdA00
2JN7A 1GSXA 4HJ3A 3FG8A 1XJ6A 4BBTA 1MZUA 2W0NA 1OT6A 4HY8A 3LIAA 3F1OB 3MJQA 4HJ6A 4L9EA 3ULFA 3H82A 4LRZE 2D01A 1XFQA 2VEAA 3CAXA 4WN5A 1T1AA 1S66L 3MR0A 5KIZA 1T1BA 1D06A 3IS2B 5HDCA 4EERA 2H28A 3E4PA 2HV1A 4I3IA 1OTDA 3HJIA 5DKLA 2WKRA 4HP9A 5DJUA 4GHIB 5J4EA 1P97A 5HWVA 2V0UA 2K7SA 2EA9A 3G6OA 1S1ZA 3A0SA 1T18A 3H7WA 2B02A 2PR6A 4KUOA 2I9VA 4PKYA 1DP6A 4WL9A 4F3LA 4PKYG 3NOPC 2YKFA 2VV7A 1S4SA 3B33A 4M4XA 2QJ7A 3VE4A 1F9IA 3NOUC 2PD8A 4HHDA 4GS9A 5HDSA 4HQAA 2PYPA 2R78A 3HJKA 4NXFA 4R6LA 5J3WA 3LI9A 3H82B 2PHYA 3EEHA 3RH8B 2OOLA 3GECA 2V1AA 4MN5A 3FC7A 4MN6A 1VB6A 4H6JA 4EW7A 5HDDA 4EEUA 3H9WA 5AVFA 3MQOA 5DKKA 1TS7A 4EETB 2WKQA 1OJ5A 2L0WA 2W27A 4K08A 3H7WB 4I5SA 4HIAA 3E4QA 2INWA 4KQDA 2CMNA 4F3LB 1D7EA 4BBVA 1Y28A 5F5YA 1LL8A 4GW9A 3T50A 1F98A 4HI4A 1N9NA 5HWWA 4GCZA 4GS9B 2BASA 3CWFA 3BWLA 4YWZA 2ZOHA 5F68A 2QJ5A 2Z6CA 2P7JA 3NOTC 2ZOIA 3ICYA 1P0ZA 1UGUA 4WF0A 2JHEA 1LT0A 2QWSA 5HD5A 1XJ4A 2PD7A 1S67L 4R70A 3PYPA 4EEPA 4JGQA 5IU1A 3A0RA 5G4ZA 4EESA 2YKHA 4H6JB 5HWTA 4I38A 1XFNA 4B9OA 2GJ3A 1T1CA 4L9FA 5HD3A 3MXQA 4HJ4A 4HH2A 3LYXA 5J7EA 2WKPA 1DP9A 4R3AA 2V9AA 1S1YA 3EWKA 3F1NB 2PDRA 2V1BA 3K3DA 4LRYC 2Z6DA 4E04A 2ZBBA 3UB6A 3LI8A 3LICA 3LIDA 2M1CA 3LIBA 5EFWA 3GDIA 1GSVA 1LSXA 1T19A 4LRXC 3UB9A 1TS6A 2OWJA 4R38A 3MQQA 1XJ3A 1OTBA 3C8CA 1OJGA 5DJTA 4DJ2A 5A8BA 3D72A 4RQ9A 3UB8A 2A24A 3F1NA 3F1PA 2KDKA 4NXBA 1V9ZA 3UMDA 4JGRA 1XJ2A 5HZHA 5I5LA 2QHKA 1OTEA 1N9OA 4EQ1A 3UB7A 5F6AA 4HH3A 4LLOB 2L4RA 3CLOA 3UMEA 4WLAA 4I3AA 1EW0A 2PR5A 1UWNX 5IS1A 2VV8A 3A0VA 3RTYA 3VOLA 3LIFA 1G28A 4HNBA 4I39A 1BYWA 1S4RA 2VV6A 4NXGA 1NWZA 1TS0A 3NJAA 3SW1A 3E4OA 2PYRA 4JGOA 4WUJA 4EXOA 4HP4A 2QKPA 1OTAA 4I3JA 3VE3A 1DRMA 1N9LA 3BY9A 3UE6A 1OT9A 4BBUA 1DP8A 3PHYA 5G4YA 4L9GA 3F1OA 1UWPX 1OTIA 5TBMB 3OLOA 2A24B 3F1PB 4XT2B 1V9YA 5HSQA 4HOIA 5F69A 3IBRA 3LIEA 5AVEA 1LSVA 3LUQA 1WA9A 3P7NA 1GSWA 1TS8A 3IS2A 4JGPA 2OWHA 4NXEA 3KX0X 1KOUA 1LSWA 3C2WA 3K3CA 4GHIA 4KUKA 3ZQ5A 1X0OA 2KX6A 2V0WA 1JNUA 4LPZA 5TBMA 2L1MA 1ODVA 4XT2A 3NHQA 2VLGA 2D02A 3BY8A 3MFXA 2J80A 4DJ3A
chains in the Genus database with same CATH superfamily
1LL9A 3IX8A 3C7UA 4LV1A 4R0QA 4OPRA 1QMFA 5CHUA 1NYYA 1OT6A 5FAQA 2VKSA 3PBQA 3MMHA 1W63M 1FOFA 4KZ8A 4WEKA 5A90A 3H82A 3IX3A 4JXGA 2D01A 2VEAA 2Y2NA 3BQAA 2VGKA 4WN5A 1T1AA 3GR2A 5HPIA 2Y2QA 1D06A 5EUAA 3OZHA 1PFLA 3IX4A 3IT9A 4R1GA 1KVMA 3M6BA 4C3QA 5DKLA 2WKRA 4X6TA 1G68A 4PAUA 3C7VA 2O9BA 1TD5A 4N1XA 2P04A 3A3EA 4EBLA 2V0UA 3A0SA 5M1AA 5FEFA 4OPYA 2W3FA 4GD6A 4C6YA 3OBFA 2QZ6A 3RJUA 3S1YA 4F3LA 4P6ZS 4CLCD 1H8MA 1NZUA 3NOPC 3G35A 2VV7A 3B33A 2QJ7A 1GA0A 2H10A 2JCHA 4II7A 2XD5A 2R78A 3G2ZA 4NXFA 3W4QA 4MBKA 4BMWA 5E2GA 5JYOA 3IXBA 2PHYA 4LCMA 4QWOA 1W7FA 1XA1A 1IYSA 3CMZA 3RH8B 1NXYA 2DMWA 3MKFA 5A91A 3TJZC 2J8YA 3UDIA 4Y0TA 3T12B 1MBLA 2EXBA 3FC7A 4H6JA 3CPTB 3FV7A 3IXGA 5HDDA 4E3MA 1KDSA 3B3XA 1XX2A 3LR4A 3HUOA 3MQOA 3TG9A 5EOOA 2Q0OA 4EETB 1L0FA 2Y4AA 3VFHA 1Y54A 5FI6A 2W3DA 4K08A 4E3NA 3FWLA 1D7EA 3AGDA 3FZCA 3SZTA 4GW9A 3UDXA 2HDQA 5KZHA 1W8YA 3V39A 3EQUA 4WYYA 5HWWA 1BLPA 2G7UA 4Y2FA 3P01A 1TDGA 2BTFP 5IT5A 2M7UA 2XFSA 4OLDA 4R3JA 5F68A 1K4FA 4K0XA 3NI9A 3NOTC 4D60A 4IUHA 2O99A 2V8CA 1L3LA 3QP4A 2PD7A 3RXXA 2PT7A 1S67L 4R70A 1H3QA 5HPFA 2R9XA 3S22A 1SKFA 3UB5P 4EEPA 3CJMA 2YKHA 4OQHA 5HWTA 5EVEA 4I38A 1FQGA 2GJ3A 2V2FF 3PTEA 2WYXA 1KVLA 2W1TA 2ZMFA 3QP6A 5HD3A 3IWIA 3Q82A 3VOYA 4Y0OA 5GLBA 5FA7A 3HVFA 3EGXC 3KYZA 2WKPA 1DP9A 3LEZA 1NLZA 4M3KA 3F1NB 3Q7ZA 4OP8A 2DNSA 3RXWA 4JPMA 1H0MA 4ARZA 3K3DA 3T1RA 2Z6DA 3IH9A 1ALQA 3NDGA 3FKWA 4KZ9A 3UB6A 4MMNA 2M1CA 4QY6A 3UPNA 2ZL1B 3LIBA 4IVIA 5EFWA 3GDIA 4DDYA 3ZFZA 3BM6A 2JC7A 3HCYA 3SOIA 1TS6A 2A49A 2Y2OA 4R38A 4KZ4A 5GHZA 3T1QB 4N92A 1XJ3A 2Y2HA 4D2OA 3Q7VB 1OJGA 2ZC5B 2VJWA 3N7WA 4X25A 2EX8A 1K0KA 5A8BA 3TE8A 4RVAA 2XROA 2JKRM 3FPWA 4NKPA 1NRFA 3OOVA 4GNUA 3O87A 4NXBA 4O01A 4OOYA 3KSFA 3ZG7B 4G3WA 5E43A 2QHKA 3DTIA 1OTEA 1VM1A 3EGDC 5F6AA 1IYPA 2XFTA 1FSWA 1HVBA 4MN7A 3CLOA 4I3AA 1G6OA 2P9VB 3UNWA 4OQGA 1PWDA 2VV8A 2BLSA 2AVXA 1ERMA 2XDMA 3LIFA 2NUPC 4Q0IA 1BYWA 4BWIA 2J3TC 1S4RA 3T4TA 1TEMA 1KDWA 4Y5FA 4KG2A 3M2JA 2ZM0A 3NJAA 1ACFA 4WZ5A 3E4OA 1RCJA 1BZAA 2W3EA 2JKRI 2EFUA 4WZ5C 1SDNA 3VE3A 1N9LA 3GTCA 2XD1A 3R7WA 1OT9A 1W5DA 5DF8A 3PBNA 1YLJA 2VX8A 4QY5A 5G4YA 1VEUA 3F1OA 4FTXA 1IKIA 2A24B 1P9RA 4OONA 4CJNA 1GHIA 3CITA 1GA9A 4WEJA 3SH8A 2NUTC 5HSQA 5DTSA 1XPBA 4ZJ3A 1SCWA 4FCFA 3IH8A 3NECA 1GSWA 2P08A 4NXEA 1LSWA 2IWDA 2JBFA 4GHIA 5CGSA 4GKUA 3HUNA 4RX3A 1LHYA 4PHTA 3T1XA 1X0OA 3IF6A 1JNUA 5TBMA 2OSUA 4MLLA 4S2KA 1HTZA 3IF6C 2J7VA 1MKMA 2ZQAA 1IYOA 4CLCB 4X69A 5AQ7A 3W8KA 4JF6A 1ONHA 2VZWA 3OCNA 1FCOA 2V20A 4BBTA 3D9YA 2FFYA 3HREA 3LIAA 3MJQA 4FH4A 3N8RA 1PI5A 4QB8A 4PM8A 4HJ6A 3ITBA 4LRZE 4IEDA 5FL3A 1XFQA 5HW3A 2QMIA 3G34A 5KIZA 2HP6A 4EBNA 2GNXA 2RL3A 2PBDP 3G2YA 1CEFA 1YT4A 5G18A 2OAQ1 5CHMA 3SS4A 3T4QA 4KZBA 4EU0A 4GOGA 2H28A 3E4PA 4KQQA 3E2LA 4I3IA 1J9MA 1IOUA 2Y2JA 1M40A 4DKIA 4HP9A 3Q1FA 1XXMA 3HLWA 1ZTUA 4WM9A 1H8ZA 1HZOA 2VA0A 5DF9A 5DF7A 3GMWA 2HPBA 2CC1A 4KZ5A 2I9VA 1ES2A 3QP5A 2WGWA 3VP1A 3ZHHA 2ZJ9A 4E3IA 1FSYA 2YKFA 1DJBA 1KGGA 3C5AA 4N1HA 3PBSA 4BD1A 3O3VA 1F9IA 4GS9A 4QJGA 5FQIA 1TDLA 3FPVA 2C5WB 2Y2LA 3MFDA 3V50A 2PYPA 1STZA 4R6LA 3N8LA 4Y3IA 4BLMA 4EUVA 1KE0A 3JYIA 1KGEA 1K6SA 1Z09A 3UO9A 2OOLA 3W4PA 2V1AA 1DJCA 4OVDA 2Y8HA 3QNCA 3GVBA 2OV5A 1BLSA 2Y91A 2HDRA 1I5QA 3MBZA 1TS7A 3OPRA 5GLDA 3U2AA 5MC7A 2L0WA 3H7WB 1F2KA 2HGVA 5FI2A 2EFXA 4KQDA 4S2OA 3ZNTA 4B4ZA 1FILA 2CMNA 3QP1A 4JXVA 1LL8A 2WKIA 3TW8A 3PAEA 3HL9A 1N9NA 4C75A 2BASA 3IWOA 5F1FA 3BWLA 4DXCA 5CECA 4KQOA 2P7JA 3UPOA 1FR6A 1P0ZA 2QWSA 1CF0A 1NJ4A 2K2NA 5FI7A 5FASA 3WS2A 5GLCA 1SKOB 5FDHA 4GJ4A 1EWZA 1L0DA 3PYPA 1H8YA 5IU1A 3A0RA 3W4OA 4PM9A 1XFNA 2ZMAA 2Y2MA 4B9OA 2H0TA 3EOIA 1DY6A 1T1CA 2HZ5A 4L9FA 1K4EA 1WE4A 3MXQA 4HH2A 5LBRA 4Q0HA 5EM0A 3MZEA 4Y0UA 4ZTKA 3SH7A 2IWBA 1XKZA 3UN7A 3CHWP 4GN2A 1K56D 5AQAA 4LRYC 3ZGAB 1O7EA 3LICA 3WWXA 3BFDA 3KYEA 1LSXA 4IUKA 1ES3A 4FUWA 3ZG5A 4KZ3A 5FSRA 3UB9A 3MQQA 4OPZA 3GRJA 4KZ6A 3U4LP 4Y17A 1OTBA 3C8CA 3WS4A 5KMWA 4X56A 1GHMA 4UA6A 5EM1A 4DRTA 3MF0A 1GHPA 1WYBA 3P98A 4CPKA 3UB8A 4WMCD 4JLFA 4IJGA 2XA7M 1TF1A 2Y55A 3F1PA 2Y2PA 1NYMA 2JKFA 1E25A 1XA7A 3SH9A 3UMDA 3MZFA 3R7WB 2G2UA 1CQAA 3LY3A 4EQ1A 4ZAMA 4HH3A 4IHQA 2XA7S 2L4RA 4DE0A 4WLAA 2PR5A 3P09A 1UWNX 2X02A 2WKHA 3OC2A 3MSHA 2ZQ9A 4KENB 1ZG6A 4QPRA 2VGLM 4HNBA 4I39A 1YLWA 5FATA 3T4SA 4NK3A 3N6IA 1NWZA 4GD8A 4A5RA 1BSGA 4HESA 3MXSA 4JGOA 4WUJA 5L09A 4EXOA 4BQMA 2QKPA 5L8MA 4I3JA 2K31A 2VGLS 3HLBA 2UWXA 3MXRA 1DRMA 3UE6A 5DFXA 4HBTA 5L2FA 4MEZA 4P87A 5EE8A 3GQZA 4RYEA 4EWFA 1L0GA 1OTIA 5EOEA 2WGVA 5TBMB 1ZC2A 1F5MA 1PNEA 5FEGA 3E2KA 1V9YA 4WBGA 5F69A 3IBRA 4UEYA 3LIEA 2ZQDA 5TGFA 5AVEA 5HX9A 1YLZA 3KSIA 5CTNA 3P7NA 3OPPA 3S7NA 3W2ZA 4CQHA 3KX0X 2EX6A 5CX7A 4N9LA 2XF3A 1G6AA 4PMAA 5GLAA 5EV0A 2KX6A 4GDBA 1K6RA 4LPZA 1YMXA 1MY8A 1ODVA 1PWGA 5CGXA 5M19A 1LL5A 4UA9A 2GX5A 2IA2A 2OLVA 2VLGA 1VETB 4E6XA 1AWIA 3BFGA 3LR3A 3G4PA 3BY8A 3I7JA 4X68A 2JN7A 1FCNA 1GSXA 5KSHA 3L7HA 4HJ3A 1K57A 5EECA 3FG8A 1XJ6A 4LV0A 1MKIA 1MZUA 1K57C 3B47A 3LFVA 3S7PA 5TR7A 2EX2A 4L9EA 3G32A 5EPHA 1S66L 3PBRA 3IBJA 3MR0A 3T4LA 3DTEA 3IHAA 3UE0A 3PXPA 3NIAA 2HF6A 3CPTA 4IVKA 3KO6A 3SS3A 3VP3A 2W3HA 3IS2B 2Y2IA 2HV1A 3QP2A 3BEBA 3HJIA 2WZXA 5DJUA 1S0WA 3HLCA 4UHUA 4IBRA 5HWVA 2K7SA 2EA9A 4LV2A 2WAEA 5HL6A 2B02A 4DDSA 3BLSA 4KUOA 2XK1A 1PZOA 1IEMA 2PU2A 1DP6A 2JKTI 4PKYG 1PYYA 2ZC4B 1YSQA 3O5YA 3UE1A 4Z1WA 5HL1A 4OLGA 3ZG0A 1DJAA 5HARA 1MXOA 4M4XA 3VE4A 1BLHA 3NOUC 2ZC7A 4P85A 2ZM8A 4E3JA 1YLPA 4OH0A 3JPUA 3LI9A 3V5MA 4RX2A 1JTDA 1J3WA 3H82B 1JVJA 2DRWA 3M2KA 1I2SA 1Z6FA 5F82A 1YLYA 3UDFA 3EEHA 3T1SA 4DE1A 3V67A 3GECA 1K25A 1XP4A 3A3JA 4KG5A 2V8FA 4EEUA 3H9WA 1IELA 1YSPA 4JF5A 4PM6A 3T4JA 5CEDA 4LCLA 2I72A 5DKKA 3E0YA 1PWCA 1MC0A 2WKQA 1KE3A 4KG6A 3FYZA 1OJ5A 4BL3A 5F1GA 2H0YA 2HDSA 2HDUA 3ZG8B 3WS5A 5E2EA 4NETA 1PI4A 3VP0A 3E4QA 2INWA 3NCKA 2ZL1A 1RGZA 4QHCA 4F3LB 4WZ4A 1MWTA 3WRZA 1Y28A 5DTTA 5F5YA 3T50A 4MCWA 4UQIM 4XUXA 1F98A 5GHXA 4HI4A 1K55A 3IQAA 3HUMA 4JXSA 1U60A 1K55C 4ZJ2A 3ZYTA 3Q7VA 3PBTA 4CLCE 2HJ9C 4X53A 3CWFA 5FQKA 2QJ5A 2Z6CA 1BUEA 3L9KA 1FIKA 2ZOIA 4UQIS 1Q2QA 3ICYA 1UGUA 1MWRA 3BYDA 1AXBA 3BJNA 1LT0A 2Z2MB 3DAVA 5HD5A 4FD8A 4YINA 4S2LA 2RCXA 1MWSA 1QMEA 3G31A 4H8RA 1YM1A 2JE5A 4JGQA 4EV4A 2A3UA 4EESA 5G4ZA 4H6JB 1CI9A 4X1MA 2Z2LB 5DTKA 4LGWA 1ES4A 2P9VA 3LYXA 2LB5A 5J7EA 4R3AA 2V9AA 2C6WB 3EWKA 3VP4A 5CGWA 4G3KA 4DMZA 2V1BA 4OOMA 2ACGA 5GL9A 4E04A 3LCEA 1VQQA 5EVIA 3LI8A 3LIDA 3LGOA 3SS5A 1ESIA 4OOLA 5EVIC 1E3UD 3DTKA 3TSGA 3HBRA 5D3OA 4E3LA 2FZ0A 3BFFA 5FAPA 2WGIA 4U3TA 3UY6A 4K0WA 3ZVTA 4OQIA 1GCEA 1SZVA 4DJ2A 5A92A 3N8SA 1S6RA 3G30A 4KQRA 1EROA 2M7VA 4AFIA 1ZKJA 2J9PA 2LB9A 1CK3A 4PM5A 2A24A 2WZZA 3IWQA 1YMSA 4HEFA 2KDKA 4F94A 5E2HA 3RFBA 2O9AA 1V9ZA 4JGRA 1XJ2A 5HZHA 5I5LA 3PR6A 4BD0A 3LY4A 2W1TB 3UMEA 3VMAA 2O0YA 1HD8A 1EW0A 1NY0A 3EQVA 5IS1A 2V1ZA 3A0VA 1O07A 4OPQA 3RTYA 2MJ6A 3KSHA 3M6HA 1W79A 3LR5A 4ARZB 4Y15A 3DBAA 2VV6A 4NXGA 3CG5A 5JYPA 1WYCA 2ZM2A 3SW1A 1K38A 3BECA 2PYRA 4CLCA 3WRTA 3BFCA 4ME4A 1OTAA 3C4OA 4CLCC 2ZC3B 4L0LA 4P6ZM 5I94A 3BY9A 4N9KA 2BG1A 4ZJ1A 4S2JA 3LR0A 3S4XA 3PHYA 1D1JA 1K56A 1BULA 1YKDA 4L9GA 1E4DA 4ID4A 1M6KA 3ZCZA 3GV9A 3OLOA 2OAP1 3N4IA 4E6WA 2E8JA 5HFOA 2E8IA 4X55A 3DWZA 2IWCA 5AJGA 1LSVA 1XGJA 3LUQA 4S2PA 1TS8A 5HAPA 4GDNA 4JGPA 3VSKA 1ERQA 2WKEA 2Q9NA 3C2WA 3KYQA 4Q8IA 3BFEA 4WMCA 4EQIA 5U47A 3ZQ5A 2ZC6B 4R23A 4U0XA 4MNRA 4BENA 1EI5A 3DW0A 2V0WA 1PW1A 2L1MA 1TVFA 1K54A 1SHVA 1NLYA 4XT2A 4RA7A 1K54C 5CRFA 4ZDXA 3WS0A 4DXBA 3PAGA 2D02A 2DCFA 3MFXA 2J80A 2XQZA 1VHMA 3MZDA 4P6BA 1RP5A 1W63Q 2QYBA 2W0NA 4LENA 4HY8A 1VEUB 2OLUA 3F1OB 3Q07A 3HLFA 2EWWA 5TFQA 3NY4A 1PZPA 2VGJA 5L10A 3C38A 1JWZA 3ULFA 1CEGA 4ETXA 3CAXA 4OQ0A 2HP5A 5AQ9A 4GLQA 1KGFA 4B4XA 5J8XA 4P0MA 5C5KA 3BW6A 1T1BA 4FSFA 1W8QA 2ZLYA 3C30A 4OKPA 4O8GA 5HDCA 4EERA 3HLEA 4QU3A 1OTDA 5FQQA 3TRCA 4MBFA 5CXWA 4GHIB 5J4EA 1P97A 4S2IA 4JKTA 1ONGA 1IYQA 1OPXA 2ZQ7A 3G6OA 1S1ZA 1T18A 3LEQA 3H7WA 2PR6A 2Y2KA 3IF6B 3PBOA 4GB7A 3NC8A 4K91A 1Q2PA 2X01A 4PKYA 4S2NA 3E98A 4WL9A 2B18A 4ZBEA 2PU4A 1JWPA 3D4FA 4LFUA 4S2NC 1SDEA 1ES5A 4E3KA 3ZG9B 1YQSA 4KZ7A 1S4SA 1IFQA 2PD8A 3AGEA 4X1LA 3R4KA 2EXAA 4HHDA 2B5RA 5HDSA 4HQAA 2W3GA 4EBPA 3K2NA 3HJKA 5F83A 5J3WA 4O0PA 3MKEA 5GHYA 3ISGA 2R9WA 1SKOA 3OPHA 3BRMA 5EVLA 1MPLA 4MN5A 4MN6A 1VB6A 4Z9QA 2J9OA 3A3DA 4EW7A 5AVFA 2FH5A 1JTGA 4R4SA 4PM7A 4Y13A 3VP2A 2WADA 3C4PA 1YPRA 2B95A 3KSGA 5M18A 2W27A 2JKTM 3QP8A 4I5SA 4UAAA 4HIAA 1BLCA 2WGWB 4BBVA 2XLNA 4KZAA 2W1RA 4DN0A 3EEAA 3Q81A 3VFFA 3HLGA 2GZAA 3BLMA 4GCZA 3O88A 1RGYA 4GS9B 3A3FA 5CHJA 2XR0A 4YWZA 2ZOHA 4U0TA 3ZNYA 3OPLA 1BTLA 5EVIB 4DE3A 4MBHA 4WF0A 2J3TD 1XGIA 4R3BA 2JHEA 2HJEA 1XJ4A 2X71A 4HBUA 3S7QA 2QPNA 5KSCA 3VOZA 3O86A 5DVAA 2J3WA 2Y2GA 5TJJA 1HLUP 5HAIA 3HLDA 1NZOA 4NEED 2H5SA 2EWVA 1C3BA 4HJ4A 1LI0A 4B93A 2UV0E 1S1YA 3B42A 2VK3A 3ITAA 2PDRA 1I2WA 4GZBA 1NRJA 3T4OA 2ZBBA 5A93A 1ZHHB 2PAVP 4ETZA 1FR1A 3WS1A 1GSVA 2KLIA 3TOIA 3V3SA 3DTMA 1T19A 2XH9A 1PIOA 4LRXC 4O7DA 2G2WA 5L07A 2OWJA 5CTMA 3QHYA 3D3OA 1G5UA 3T4KA 1MWUA 2HP9A 5DJTA 2FFFB 1N9BA 3IXDA 5IHVA 1CJFA 3D72A 2A2LA 4RQ9A 3AGFA 1L2SA 4YOFA 3F1NA 5FQJA 5CERA 3NBLA 1CI8A 3NULA 4WELA 5HAQA 4YFMA 2KOIA 4LV3A 4QD4A 1ESUA 2JKGA 4XXRA 4FH2A 1KE4A 5FDSA 3VSLA 1JWVA 1N9OA 3ZVWA 3UB7A 4LLOB 5K5BA 4BJPA 2XRNA 4IBXA 4BL2A 2WK0A 3ZDJA 5AQBA 4EUZA 4MDZA 1LLBA 5BOHA 4E3OA 1L0EA 4PPRA 3VOLA 2PBYA 1IKGA 4ESPA 3JVUA 1G28A 1ZG4A 3IXHA 1YAXA 4R4RA 3BQ8A 3VV4A 4DF6A 3A3IA 1TS0A 4ZRRA 2PRFA 3UPPA 5FQMA 3CUEA 4Y7PA 4DE2A 1VETA 2WAFA 4YNRA 4HP4A 3CUEC 4JF4A 3GSGA 4XUZA 3QNBA 2GDNA 4BBUA 1DP8A 2O9CA 2XSSA 4Q0JA 5DFYA 5FQ9A 3MS6A 3IF5A 3CI6A 4B88A 1UWPX 1N4OA 2ZQCA 4JBFA 3JVVA 3F1PB 4XT2B 2ZQ8A 3LO7A 2Q9MA 4HOIA 1E3UA 4JXWA 4OP5A 1WA9A 1OMEA 2XGNA 3FKVA 3IS2A 4UA7A 2OWHA 1A0KA 2ZD8A 1FCMA 4NG2A 1KOUA 1PRQA 4S2MA 5CEBA 3UE3A 3MQ0A 3K3CA 1P9WA 4FOFA 4KUKA 1PW8A 2XEPA 2ZMVA 3V3RA 1H5XA 3OCLA 5E2FA 5EVID 2Y59A 4G3VA 3DWKA 1LI9A 3NHQA 5FAOA 2WUQA 1BT5A 2Y79A 3IHBA 3S7OA 1YLTA 2P74A 3NDEA 4DJ3A 1Y4OA 3CZDA 2EX9A
chains in the Genus database with same CATH topology
2JN7A 1GSXA 5KSHA 4HJ3A 2VZWA 1W63Q 3OCNA 3FG8A 1XJ6A 4BBTA 1MZUA 2QYBA 2W0NA 1OT6A 4HY8A 3LIAA 2VKSA 3PBQA 3F1OB 3B47A 3MJQA 3LFVA 3S7PA 2EWWA 3MMHA 4HJ6A 1W63M 4L9EA 4WEKA 3C38A 3ULFA 3H82A 4LRZE 2D01A 5FL3A 1XFQA 2VEAA 3BQAA 3CAXA 4WN5A 4ETXA 1T1AA 1S66L 4GLQA 3PBRA 3IBJA 3MR0A 5C5KA 3T4LA 5KIZA 5HPIA 2GNXA 3BW6A 1T1BA 3PXPA 1D06A 2HF6A 4FSFA 3KO6A 3C30A 2OAQ1 4O8GA 3T4QA 2W3HA 3IS2B 5HDCA 4EU0A 4EERA 2H28A 3E4PA 2HV1A 4I3IA 1OTDA 1IOUA 3HJIA 3TRCA 5DKLA 2WKRA 4HP9A 5DJUA 4PAUA 2O9BA 4GHIB 1ZTUA 1TD5A 1P97A 5J4EA 2VA0A 2P04A 5HWVA 5DF9A 2V0UA 2K7SA 2EA9A 1OPXA 3G6OA 1S1ZA 3A0SA 1T18A 3H7WA 5HL6A 2B02A 2PR6A 2W3FA 3PBOA 4KUOA 2I9VA 4PKYA 1DP6A 2JKTI 3E98A 3OBFA 2B18A 4WL9A 4F3LA 4P6ZS 4PKYG 4CLCD 1H8MA 1YSQA 3O5YA 3NOPC 2YKFA 4Z1WA 3PBSA 2VV7A 1S4SA 1IFQA 3B33A 4M4XA 2QJ7A 3VE4A 1F9IA 3NOUC 2PD8A 3R4KA 4HHDA 4GS9A 5HDSA 4HQAA 2W3GA 3FPVA 4II7A 2PYPA 3K2NA 1STZA 2R78A 3HJKA 4NXFA 4R6LA 4Y3IA 5J3WA 3LI9A 4O0PA 4BMWA 4EUVA 3H82B 2PHYA 3EEHA 3RH8B 2OOLA 2DMWA 3V67A 3TJZC 3GECA 2V1AA 4MN5A 3FC7A 4MN6A 1VB6A 4H6JA 4EW7A 5HDDA 4EEUA 3H9WA 5AVFA 1YSPA 2FH5A 2Y8HA 3LR4A 3T4JA 3MQOA 5DKKA 1TS7A 3E0YA 4EETB 1MC0A 2WKQA 1OJ5A 3KSGA 3U2AA 5MC7A 2L0WA 2W3DA 2W27A 4K08A 3H7WB 2HGVA 2JKTM 4I5SA 4HIAA 3E4QA 2INWA 4KQDA 2CMNA 4F3LB 1D7EA 4BBVA 1Y28A 5F5YA 1LL8A 4GW9A 3T50A 2W1RA 4DN0A 3EEAA 4MCWA 4UQIM 1F98A 3TW8A 4HI4A 3EQUA 1N9NA 2GZAA 5HWWA 4GCZA 2G7UA 4Y2FA 3P01A 3ZYTA 4GS9B 3PBTA 5IT5A 2BASA 4CLCE 2HJ9C 2M7UA 3CWFA 3BWLA 4YWZA 2ZOHA 5F68A 4KQOA 2QJ5A 2Z6CA 2P7JA 3NOTC 2ZOIA 4UQIS 3ICYA 4IUHA 1P0ZA 2O99A 1UGUA 4WF0A 2J3TD 2JHEA 3BJNA 1LT0A 2QWSA 5HD5A 2HJEA 1XJ4A 2PD7A 2K2NA 2PT7A 1S67L 4R70A 1H3QA 5HPFA 4GJ4A 3PYPA 3S7QA 4EEPA 4JGQA 5IU1A 3A0RA 5G4ZA 4EESA 2YKHA 2J3WA 4H6JB 5HWTA 5TJJA 4I38A 1XFNA 4B9OA 2GJ3A 3EOIA 1T1CA 4L9FA 4NEED 2W1TA 2ZMFA 5HD3A 2EWVA 3MXQA 4HJ4A 4HH2A 5LBRA 3LYXA 4Q0HA 2LB5A 3EGXC 3KYZA 4B93A 5J7EA 2WKPA 1DP9A 1NLZA 4R3AA 2V9AA 1S1YA 3B42A 3EWKA 3F1NB 4DMZA 4G3KA 2PDRA 2V1BA 4ARZA 3K3DA 4OOMA 4LRYC 2Z6DA 4E04A 1NRJA 3T4OA 2ZBBA 3UB6A 3LI8A 3LICA 4MMNA 3LIDA 2M1CA 1ZHHB 3LIBA 4ETZA 5EFWA 3GDIA 4OOLA 1GSVA 1LSXA 2KLIA 4IUKA 3HCYA 1T19A 4LRXC 3UB9A 1TS6A 2OWJA 4R38A 3MQQA 2FZ0A 1XJ3A 3D3OA 1OTBA 3C8CA 3T4KA 1OJGA 2VJWA 5DJTA 4DJ2A 2M7VA 3MF0A 4AFIA 5A8BA 3D72A 2A2LA 2LB9A 4RQ9A 3TE8A 3UB8A 4IJGA 2XA7M 4YOFA 2XROA 2A24A 1TF1A 3F1NA 3F1PA 2JKRM 3FPWA 4NKPA 2KDKA 3OOVA 4NXBA 4O01A 3RFBA 3KSFA 2O9AA 4WELA 1V9ZA 3UMDA 2KOIA 4JGRA 1XJ2A 5HZHA 5I5LA 4G3WA 3PR6A 2QHKA 1OTEA 3R7WB 1N9OA 4EQ1A 3EGDC 3UB7A 5F6AA 4HH3A 4IHQA 4LLOB 2XA7S 2L4RA 4BJPA 5K5BA 4MN7A 3CLOA 2W1TB 2XRNA 3UMEA 2O0YA 4WLAA 4I3AA 1G6OA 1EW0A 2PR5A 3EQVA 1UWNX 5IS1A 4MDZA 2VV8A 3A0VA 3RTYA 3VOLA 3OC2A 2MJ6A 3KSHA 4QPRA 3LIFA 2VGLM 2NUPC 4Q0IA 3JVUA 1G28A 3LR5A 4HNBA 1BYWA 4I39A 4ARZB 4BWIA 1YAXA 2J3TC 1S4RA 3T4SA 3T4TA 3DBAA 2VV6A 3BQ8A 4NXGA 4Y5FA 3VV4A 1NWZA 1TS0A 3NJAA 4ZRRA 3SW1A 3E4OA 3CUEA 2PYRA 2W3EA 4CLCA 2JKRI 4JGOA 4WUJA 4YNRA 4EXOA 4HP4A 2QKPA 5L8MA 4ME4A 3CUEC 1OTAA 4I3JA 2K31A 4CLCC 4L0LA 2VGLS 3VE3A 4P6ZM 1DRMA 1N9LA 3BY9A 3UE6A 5DFXA 3R7WA 1OT9A 4BBUA 1DP8A 3PBNA 3LR0A 2O9CA 2XSSA 3PHYA 4Q0JA 5DFYA 2VX8A 5G4YA 1YKDA 3CI6A 4L9GA 3F1OA 1UWPX 1OTIA 5TBMB 1F5MA 3OLOA 2OAP1 2A24B 3JVVA 1P9RA 3F1PB 4XT2B 3CITA 4WEJA 1V9YA 2NUTC 5HSQA 4HOIA 5F69A 3IBRA 4UEYA 3LIEA 5AJGA 5AVEA 1LSVA 3KSIA 3LUQA 1WA9A 3P7NA 1GSWA 1TS8A 3IS2A 3S7NA 2P08A 4JGPA 3W2ZA 4CQHA 2OWHA 4NXEA 3KX0X 5CX7A 1KOUA 1LSWA 3C2WA 3KYQA 3UE3A 3MQ0A 3K3CA 4GHIA 1P9WA 4FOFA 4KUKA 3ZQ5A 2ZMVA 4PHTA 1X0OA 2KX6A 2V0WA 1JNUA 3OCLA 4LPZA 5TBMA 2L1MA 1ODVA 4G3VA 1NLYA 4XT2A 3NHQA 1MKMA 2GX5A 2IA2A 2VLGA 4CLCB 2Y79A 3S7OA 2D02A 3LR3A 3BY8A 3MFXA 2J80A 4DJ3A 1VHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JN7 A;  1GSX A;  4HJ3 A;  3FG8 A;  1XJ6 A;  4BBT A;  1MZU A;  2W0N A;  1OT6 A;  4HY8 A;  3LIA A;  3F1O B;  3MJQ A;  4HJ6 A;  4L9E A;  3ULF A;  3H82 A;  4LRZ E;  2D01 A;  1XFQ A;  2VEA A;  3CAX A;  4WN5 A;  1T1A A;  1S66 L;  3MR0 A;  5KIZ A;  1T1B A;  1D06 A;  3IS2 B;  5HDC A;  4EER A;  2H28 A;  3E4P A;  2HV1 A;  4I3I A;  1OTD A;  3HJI A;  5DKL A;  2WKR A;  4HP9 A;  5DJU A;  4GHI B;  5J4E A;  1P97 A;  5HWV A;  2V0U A;  2K7S A;  2EA9 A;  3G6O A;  1S1Z A;  3A0S A;  1T18 A;  3H7W A;  2B02 A;  2PR6 A;  4KUO A;  2I9V A;  4PKY A;  1DP6 A;  4WL9 A;  4F3L A;  4PKY G;  3NOP C;  2YKF A;  2VV7 A;  1S4S A;  3B33 A;  4M4X A;  2QJ7 A;  3VE4 A;  1F9I A;  3NOU C;  2PD8 A;  4HHD A;  4GS9 A;  5HDS A;  4HQA A;  2PYP A;  2R78 A;  3HJK A;  4NXF A;  4R6L A;  5J3W A;  3LI9 A;  3H82 B;  2PHY A;  3EEH A;  3RH8 B;  2OOL A;  3GEC A;  2V1A A;  4MN5 A;  3FC7 A;  4MN6 A;  1VB6 A;  4H6J A;  4EW7 A;  5HDD A;  4EEU A;  3H9W A;  5AVF A;  3MQO A;  5DKK A;  1TS7 A;  4EET B;  2WKQ A;  1OJ5 A;  2L0W A;  2W27 A;  4K08 A;  3H7W B;  4I5S A;  4HIA A;  3E4Q A;  2INW A;  4KQD A;  2CMN A;  4F3L B;  1D7E A;  4BBV A;  1Y28 A;  5F5Y A;  1LL8 A;  4GW9 A;  3T50 A;  1F98 A;  4HI4 A;  1N9N A;  5HWW A;  4GCZ A;  4GS9 B;  2BAS A;  3CWF A;  3BWL A;  4YWZ A;  2ZOH A;  5F68 A;  2QJ5 A;  2Z6C A;  2P7J A;  3NOT C;  2ZOI A;  3ICY A;  1P0Z A;  1UGU A;  4WF0 A;  2JHE A;  1LT0 A;  2QWS A;  5HD5 A;  1XJ4 A;  2PD7 A;  1S67 L;  4R70 A;  3PYP A;  4EEP A;  4JGQ A;  5IU1 A;  3A0R A;  5G4Z A;  4EES A;  2YKH A;  4H6J B;  5HWT A;  4I38 A;  1XFN A;  4B9O A;  2GJ3 A;  1T1C A;  4L9F A;  5HD3 A;  3MXQ A;  4HJ4 A;  4HH2 A;  3LYX A;  5J7E A;  2WKP A;  1DP9 A;  4R3A A;  2V9A A;  1S1Y A;  3EWK A;  3F1N B;  2PDR A;  2V1B A;  3K3D A;  4LRY C;  2Z6D A;  4E04 A;  2ZBB A;  3UB6 A;  3LI8 A;  3LIC A;  3LID A;  2M1C A;  3LIB A;  5EFW A;  3GDI A;  1GSV A;  1LSX A;  1T19 A;  4LRX C;  3UB9 A;  1TS6 A;  2OWJ A;  4R38 A;  3MQQ A;  1XJ3 A;  1OTB A;  3C8C A;  1OJG A;  5DJT A;  4DJ2 A;  5A8B A;  3D72 A;  4RQ9 A;  3UB8 A;  2A24 A;  3F1N A;  3F1P A;  2KDK A;  4NXB A;  1V9Z A;  3UMD A;  4JGR A;  1XJ2 A;  5HZH A;  5I5L A;  2QHK A;  1OTE A;  1N9O A;  4EQ1 A;  3UB7 A;  5F6A A;  4HH3 A;  4LLO B;  2L4R A;  3CLO A;  3UME A;  4WLA A;  4I3A A;  1EW0 A;  2PR5 A;  1UWN X;  5IS1 A;  2VV8 A;  3A0V A;  3RTY A;  3VOL A;  3LIF A;  1G28 A;  4HNB A;  4I39 A;  1BYW A;  1S4R A;  2VV6 A;  4NXG A;  1NWZ A;  1TS0 A;  3NJA A;  3SW1 A;  3E4O A;  2PYR A;  4JGO A;  4WUJ A;  4EXO A;  4HP4 A;  2QKP A;  1OTA A;  4I3J A;  3VE3 A;  1DRM A;  1N9L A;  3BY9 A;  3UE6 A;  1OT9 A;  4BBU A;  1DP8 A;  3PHY A;  5G4Y A;  4L9G A;  3F1O A;  1UWP X;  1OTI A;  5TBM B;  3OLO A;  2A24 B;  3F1P B;  4XT2 B;  1V9Y A;  5HSQ A;  4HOI A;  5F69 A;  3IBR A;  3LIE A;  5AVE A;  1LSV A;  3LUQ A;  1WA9 A;  3P7N A;  1GSW A;  1TS8 A;  3IS2 A;  4JGP A;  2OWH A;  4NXE A;  3KX0 X;  1KOU A;  1LSW A;  3C2W A;  3K3C A;  4GHI A;  4KUK A;  3ZQ5 A;  1X0O A;  2KX6 A;  2V0W A;  1JNU A;  4LPZ A;  5TBM A;  2L1M A;  1ODV A;  4XT2 A;  3NHQ A;  2VLG A;  2D02 A;  3BY8 A;  3MFX A;  2J80 A;  4DJ3 A; 
#chains in the Genus database with same CATH topology
 1LL9 A;  3IX8 A;  3C7U A;  4LV1 A;  4R0Q A;  4OPR A;  1QMF A;  5CHU A;  1NYY A;  1OT6 A;  5FAQ A;  2VKS A;  3PBQ A;  3MMH A;  1W63 M;  1FOF A;  4KZ8 A;  4WEK A;  5A90 A;  3H82 A;  3IX3 A;  4JXG A;  2D01 A;  2VEA A;  2Y2N A;  3BQA A;  2VGK A;  4WN5 A;  1T1A A;  3GR2 A;  5HPI A;  2Y2Q A;  1D06 A;  5EUA A;  3OZH A;  1PFL A;  3IX4 A;  3IT9 A;  4R1G A;  1KVM A;  3M6B A;  4C3Q A;  5DKL A;  2WKR A;  4X6T A;  1G68 A;  4PAU A;  3C7V A;  2O9B A;  1TD5 A;  4N1X A;  2P04 A;  3A3E A;  4EBL A;  2V0U A;  3A0S A;  5M1A A;  5FEF A;  4OPY A;  2W3F A;  4GD6 A;  4C6Y A;  3OBF A;  2QZ6 A;  3RJU A;  3S1Y A;  4F3L A;  4P6Z S;  4CLC D;  1H8M A;  1NZU A;  3NOP C;  3G35 A;  2VV7 A;  3B33 A;  2QJ7 A;  1GA0 A;  2H10 A;  2JCH A;  4II7 A;  2XD5 A;  2R78 A;  3G2Z A;  4NXF A;  3W4Q A;  4MBK A;  4BMW A;  5E2G A;  5JYO A;  3IXB A;  2PHY A;  4LCM A;  4QWO A;  1W7F A;  1XA1 A;  1IYS A;  3CMZ A;  3RH8 B;  1NXY A;  2DMW A;  3MKF A;  5A91 A;  3TJZ C;  2J8Y A;  3UDI A;  4Y0T A;  3T12 B;  1MBL A;  2EXB A;  3FC7 A;  4H6J A;  3CPT B;  3FV7 A;  3IXG A;  5HDD A;  4E3M A;  1KDS A;  3B3X A;  1XX2 A;  3LR4 A;  3HUO A;  3MQO A;  3TG9 A;  5EOO A;  2Q0O A;  4EET B;  1L0F A;  2Y4A A;  3VFH A;  1Y54 A;  5FI6 A;  2W3D A;  4K08 A;  4E3N A;  3FWL A;  1D7E A;  3AGD A;  3FZC A;  3SZT A;  4GW9 A;  3UDX A;  2HDQ A;  5KZH A;  1W8Y A;  3V39 A;  3EQU A;  4WYY A;  5HWW A;  1BLP A;  2G7U A;  4Y2F A;  3P01 A;  1TDG A;  2BTF P;  5IT5 A;  2M7U A;  2XFS A;  4OLD A;  4R3J A;  5F68 A;  1K4F A;  4K0X A;  3NI9 A;  3NOT C;  4D60 A;  4IUH A;  2O99 A;  2V8C A;  1L3L A;  3QP4 A;  2PD7 A;  3RXX A;  2PT7 A;  1S67 L;  4R70 A;  1H3Q A;  5HPF A;  2R9X A;  3S22 A;  1SKF A;  3UB5 P;  4EEP A;  3CJM A;  2YKH A;  4OQH A;  5HWT A;  5EVE A;  4I38 A;  1FQG A;  2GJ3 A;  2V2F F;  3PTE A;  2WYX A;  1KVL A;  2W1T A;  2ZMF A;  3QP6 A;  5HD3 A;  3IWI A;  3Q82 A;  3VOY A;  4Y0O A;  5GLB A;  5FA7 A;  3HVF A;  3EGX C;  3KYZ A;  2WKP A;  1DP9 A;  3LEZ A;  1NLZ A;  4M3K A;  3F1N B;  3Q7Z A;  4OP8 A;  2DNS A;  3RXW A;  4JPM A;  1H0M A;  4ARZ A;  3K3D A;  3T1R A;  2Z6D A;  3IH9 A;  1ALQ A;  3NDG A;  3FKW A;  4KZ9 A;  3UB6 A;  4MMN A;  2M1C A;  4QY6 A;  3UPN A;  2ZL1 B;  3LIB A;  4IVI A;  5EFW A;  3GDI A;  4DDY A;  3ZFZ A;  3BM6 A;  2JC7 A;  3HCY A;  3SOI A;  1TS6 A;  2A49 A;  2Y2O A;  4R38 A;  4KZ4 A;  5GHZ A;  3T1Q B;  4N92 A;  1XJ3 A;  2Y2H A;  4D2O A;  3Q7V B;  1OJG A;  2ZC5 B;  2VJW A;  3N7W A;  4X25 A;  2EX8 A;  1K0K A;  5A8B A;  3TE8 A;  4RVA A;  2XRO A;  2JKR M;  3FPW A;  4NKP A;  1NRF A;  3OOV A;  4GNU A;  3O87 A;  4NXB A;  4O01 A;  4OOY A;  3KSF A;  3ZG7 B;  4G3W A;  5E43 A;  2QHK A;  3DTI A;  1OTE A;  1VM1 A;  3EGD C;  5F6A A;  1IYP A;  2XFT A;  1FSW A;  1HVB A;  4MN7 A;  3CLO A;  4I3A A;  1G6O A;  2P9V B;  3UNW A;  4OQG A;  1PWD A;  2VV8 A;  2BLS A;  2AVX A;  1ERM A;  2XDM A;  3LIF A;  2NUP C;  4Q0I A;  1BYW A;  4BWI A;  2J3T C;  1S4R A;  3T4T A;  1TEM A;  1KDW A;  4Y5F A;  4KG2 A;  3M2J A;  2ZM0 A;  3NJA A;  1ACF A;  4WZ5 A;  3E4O A;  1RCJ A;  1BZA A;  2W3E A;  2JKR I;  2EFU A;  4WZ5 C;  1SDN A;  3VE3 A;  1N9L A;  3GTC A;  2XD1 A;  3R7W A;  1OT9 A;  1W5D A;  5DF8 A;  3PBN A;  1YLJ A;  2VX8 A;  4QY5 A;  5G4Y A;  1VEU A;  3F1O A;  4FTX A;  1IKI A;  2A24 B;  1P9R A;  4OON A;  4CJN A;  1GHI A;  3CIT A;  1GA9 A;  4WEJ A;  3SH8 A;  2NUT C;  5HSQ A;  5DTS A;  1XPB A;  4ZJ3 A;  1SCW A;  4FCF A;  3IH8 A;  3NEC A;  1GSW A;  2P08 A;  4NXE A;  1LSW A;  2IWD A;  2JBF A;  4GHI A;  5CGS A;  4GKU A;  3HUN A;  4RX3 A;  1LHY A;  4PHT A;  3T1X A;  1X0O A;  3IF6 A;  1JNU A;  5TBM A;  2OSU A;  4MLL A;  4S2K A;  1HTZ A;  3IF6 C;  2J7V A;  1MKM A;  2ZQA A;  1IYO A;  4CLC B;  4X69 A;  5AQ7 A;  3W8K A;  4JF6 A;  1ONH A;  2VZW A;  3OCN A;  1FCO A;  2V20 A;  4BBT A;  3D9Y A;  2FFY A;  3HRE A;  3LIA A;  3MJQ A;  4FH4 A;  3N8R A;  1PI5 A;  4QB8 A;  4PM8 A;  4HJ6 A;  3ITB A;  4LRZ E;  4IED A;  5FL3 A;  1XFQ A;  5HW3 A;  2QMI A;  3G34 A;  5KIZ A;  2HP6 A;  4EBN A;  2GNX A;  2RL3 A;  2PBD P;  3G2Y A;  1CEF A;  1YT4 A;  5G18 A;  2OAQ 1;  5CHM A;  3SS4 A;  3T4Q A;  4KZB A;  4EU0 A;  4GOG A;  2H28 A;  3E4P A;  4KQQ A;  3E2L A;  4I3I A;  1J9M A;  1IOU A;  2Y2J A;  1M40 A;  4DKI A;  4HP9 A;  3Q1F A;  1XXM A;  3HLW A;  1ZTU A;  4WM9 A;  1H8Z A;  1HZO A;  2VA0 A;  5DF9 A;  5DF7 A;  3GMW A;  2HPB A;  2CC1 A;  4KZ5 A;  2I9V A;  1ES2 A;  3QP5 A;  2WGW A;  3VP1 A;  3ZHH A;  2ZJ9 A;  4E3I A;  1FSY A;  2YKF A;  1DJB A;  1KGG A;  3C5A A;  4N1H A;  3PBS A;  4BD1 A;  3O3V A;  1F9I A;  4GS9 A;  4QJG A;  5FQI A;  1TDL A;  3FPV A;  2C5W B;  2Y2L A;  3MFD A;  3V50 A;  2PYP A;  1STZ A;  4R6L A;  3N8L A;  4Y3I A;  4BLM A;  4EUV A;  1KE0 A;  3JYI A;  1KGE A;  1K6S A;  1Z09 A;  3UO9 A;  2OOL A;  3W4P A;  2V1A A;  1DJC A;  4OVD A;  2Y8H A;  3QNC A;  3GVB A;  2OV5 A;  1BLS A;  2Y91 A;  2HDR A;  1I5Q A;  3MBZ A;  1TS7 A;  3OPR A;  5GLD A;  3U2A A;  5MC7 A;  2L0W A;  3H7W B;  1F2K A;  2HGV A;  5FI2 A;  2EFX A;  4KQD A;  4S2O A;  3ZNT A;  4B4Z A;  1FIL A;  2CMN A;  3QP1 A;  4JXV A;  1LL8 A;  2WKI A;  3TW8 A;  3PAE A;  3HL9 A;  1N9N A;  4C75 A;  2BAS A;  3IWO A;  5F1F A;  3BWL A;  4DXC A;  5CEC A;  4KQO A;  2P7J A;  3UPO A;  1FR6 A;  1P0Z A;  2QWS A;  1CF0 A;  1NJ4 A;  2K2N A;  5FI7 A;  5FAS A;  3WS2 A;  5GLC A;  1SKO B;  5FDH A;  4GJ4 A;  1EWZ A;  1L0D A;  3PYP A;  1H8Y A;  5IU1 A;  3A0R A;  3W4O A;  4PM9 A;  1XFN A;  2ZMA A;  2Y2M A;  4B9O A;  2H0T A;  3EOI A;  1DY6 A;  1T1C A;  2HZ5 A;  4L9F A;  1K4E A;  1WE4 A;  3MXQ A;  4HH2 A;  5LBR A;  4Q0H A;  5EM0 A;  3MZE A;  4Y0U A;  4ZTK A;  3SH7 A;  2IWB A;  1XKZ A;  3UN7 A;  3CHW P;  4GN2 A;  1K56 D;  5AQA A;  4LRY C;  3ZGA B;  1O7E A;  3LIC A;  3WWX A;  3BFD A;  3KYE A;  1LSX A;  4IUK A;  1ES3 A;  4FUW A;  3ZG5 A;  4KZ3 A;  5FSR A;  3UB9 A;  3MQQ A;  4OPZ A;  3GRJ A;  4KZ6 A;  3U4L P;  4Y17 A;  1OTB A;  3C8C A;  3WS4 A;  5KMW A;  4X56 A;  1GHM A;  4UA6 A;  5EM1 A;  4DRT A;  3MF0 A;  1GHP A;  1WYB A;  3P98 A;  4CPK A;  3UB8 A;  4WMC D;  4JLF A;  4IJG A;  2XA7 M;  1TF1 A;  2Y55 A;  3F1P A;  2Y2P A;  1NYM A;  2JKF A;  1E25 A;  1XA7 A;  3SH9 A;  3UMD A;  3MZF A;  3R7W B;  2G2U A;  1CQA A;  3LY3 A;  4EQ1 A;  4ZAM A;  4HH3 A;  4IHQ A;  2XA7 S;  2L4R A;  4DE0 A;  4WLA A;  2PR5 A;  3P09 A;  1UWN X;  2X02 A;  2WKH A;  3OC2 A;  3MSH A;  2ZQ9 A;  4KEN B;  1ZG6 A;  4QPR A;  2VGL M;  4HNB A;  4I39 A;  1YLW A;  5FAT A;  3T4S A;  4NK3 A;  3N6I A;  1NWZ A;  4GD8 A;  4A5R A;  1BSG A;  4HES A;  3MXS A;  4JGO A;  4WUJ A;  5L09 A;  4EXO A;  4BQM A;  2QKP A;  5L8M A;  4I3J A;  2K31 A;  2VGL S;  3HLB A;  2UWX A;  3MXR A;  1DRM A;  3UE6 A;  5DFX A;  4HBT A;  5L2F A;  4MEZ A;  4P87 A;  5EE8 A;  3GQZ A;  4RYE A;  4EWF A;  1L0G A;  1OTI A;  5EOE A;  2WGV A;  5TBM B;  1ZC2 A;  1F5M A;  1PNE A;  5FEG A;  3E2K A;  1V9Y A;  4WBG A;  5F69 A;  3IBR A;  4UEY A;  3LIE A;  2ZQD A;  5TGF A;  5AVE A;  5HX9 A;  1YLZ A;  3KSI A;  5CTN A;  3P7N A;  3OPP A;  3S7N A;  3W2Z A;  4CQH A;  3KX0 X;  2EX6 A;  5CX7 A;  4N9L A;  2XF3 A;  1G6A A;  4PMA A;  5GLA A;  5EV0 A;  2KX6 A;  4GDB A;  1K6R A;  4LPZ A;  1YMX A;  1MY8 A;  1ODV A;  1PWG A;  5CGX A;  5M19 A;  1LL5 A;  4UA9 A;  2GX5 A;  2IA2 A;  2OLV A;  2VLG A;  1VET B;  4E6X A;  1AWI A;  3BFG A;  3LR3 A;  3G4P A;  3BY8 A;  3I7J A;  4X68 A;  2JN7 A;  1FCN A;  1GSX A;  5KSH A;  3L7H A;  4HJ3 A;  1K57 A;  5EEC A;  3FG8 A;  1XJ6 A;  4LV0 A;  1MKI A;  1MZU A;  1K57 C;  3B47 A;  3LFV A;  3S7P A;  5TR7 A;  2EX2 A;  4L9E A;  3G32 A;  5EPH A;  1S66 L;  3PBR A;  3IBJ A;  3MR0 A;  3T4L A;  3DTE A;  3IHA A;  3UE0 A;  3PXP A;  3NIA A;  2HF6 A;  3CPT A;  4IVK A;  3KO6 A;  3SS3 A;  3VP3 A;  2W3H A;  3IS2 B;  2Y2I A;  2HV1 A;  3QP2 A;  3BEB A;  3HJI A;  2WZX A;  5DJU A;  1S0W A;  3HLC A;  4UHU A;  4IBR A;  5HWV A;  2K7S A;  2EA9 A;  4LV2 A;  2WAE A;  5HL6 A;  2B02 A;  4DDS A;  3BLS A;  4KUO A;  2XK1 A;  1PZO A;  1IEM A;  2PU2 A;  1DP6 A;  2JKT I;  4PKY G;  1PYY A;  2ZC4 B;  1YSQ A;  3O5Y A;  3UE1 A;  4Z1W A;  5HL1 A;  4OLG A;  3ZG0 A;  1DJA A;  5HAR A;  1MXO A;  4M4X A;  3VE4 A;  1BLH A;  3NOU C;  2ZC7 A;  4P85 A;  2ZM8 A;  4E3J A;  1YLP A;  4OH0 A;  3JPU A;  3LI9 A;  3V5M A;  4RX2 A;  1JTD A;  1J3W A;  3H82 B;  1JVJ A;  2DRW A;  3M2K A;  1I2S A;  1Z6F A;  5F82 A;  1YLY A;  3UDF A;  3EEH A;  3T1S A;  4DE1 A;  3V67 A;  3GEC A;  1K25 A;  1XP4 A;  3A3J A;  4KG5 A;  2V8F A;  4EEU A;  3H9W A;  1IEL A;  1YSP A;  4JF5 A;  4PM6 A;  3T4J A;  5CED A;  4LCL A;  2I72 A;  5DKK A;  3E0Y A;  1PWC A;  1MC0 A;  2WKQ A;  1KE3 A;  4KG6 A;  3FYZ A;  1OJ5 A;  4BL3 A;  5F1G A;  2H0Y A;  2HDS A;  2HDU A;  3ZG8 B;  3WS5 A;  5E2E A;  4NET A;  1PI4 A;  3VP0 A;  3E4Q A;  2INW A;  3NCK A;  2ZL1 A;  1RGZ A;  4QHC A;  4F3L B;  4WZ4 A;  1MWT A;  3WRZ A;  1Y28 A;  5DTT A;  5F5Y A;  3T50 A;  4MCW A;  4UQI M;  4XUX A;  1F98 A;  5GHX A;  4HI4 A;  1K55 A;  3IQA A;  3HUM A;  4JXS A;  1U60 A;  1K55 C;  4ZJ2 A;  3ZYT A;  3Q7V A;  3PBT A;  4CLC E;  2HJ9 C;  4X53 A;  3CWF A;  5FQK A;  2QJ5 A;  2Z6C A;  1BUE A;  3L9K A;  1FIK A;  2ZOI A;  4UQI S;  1Q2Q A;  3ICY A;  1UGU A;  1MWR A;  3BYD A;  1AXB A;  3BJN A;  1LT0 A;  2Z2M B;  3DAV A;  5HD5 A;  4FD8 A;  4YIN A;  4S2L A;  2RCX A;  1MWS A;  1QME A;  3G31 A;  4H8R A;  1YM1 A;  2JE5 A;  4JGQ A;  4EV4 A;  2A3U A;  4EES A;  5G4Z A;  4H6J B;  1CI9 A;  4X1M A;  2Z2L B;  5DTK A;  4LGW A;  1ES4 A;  2P9V A;  3LYX A;  2LB5 A;  5J7E A;  4R3A A;  2V9A A;  2C6W B;  3EWK A;  3VP4 A;  5CGW A;  4G3K A;  4DMZ A;  2V1B A;  4OOM A;  2ACG A;  5GL9 A;  4E04 A;  3LCE A;  1VQQ A;  5EVI A;  3LI8 A;  3LID A;  3LGO A;  3SS5 A;  1ESI A;  4OOL A;  5EVI C;  1E3U D;  3DTK A;  3TSG A;  3HBR A;  5D3O A;  4E3L A;  2FZ0 A;  3BFF A;  5FAP A;  2WGI A;  4U3T A;  3UY6 A;  4K0W A;  3ZVT A;  4OQI A;  1GCE A;  1SZV A;  4DJ2 A;  5A92 A;  3N8S A;  1S6R A;  3G30 A;  4KQR A;  1ERO A;  2M7V A;  4AFI A;  1ZKJ A;  2J9P A;  2LB9 A;  1CK3 A;  4PM5 A;  2A24 A;  2WZZ A;  3IWQ A;  1YMS A;  4HEF A;  2KDK A;  4F94 A;  5E2H A;  3RFB A;  2O9A A;  1V9Z A;  4JGR A;  1XJ2 A;  5HZH A;  5I5L A;  3PR6 A;  4BD0 A;  3LY4 A;  2W1T B;  3UME A;  3VMA A;  2O0Y A;  1HD8 A;  1EW0 A;  1NY0 A;  3EQV A;  5IS1 A;  2V1Z A;  3A0V A;  1O07 A;  4OPQ A;  3RTY A;  2MJ6 A;  3KSH A;  3M6H A;  1W79 A;  3LR5 A;  4ARZ B;  4Y15 A;  3DBA A;  2VV6 A;  4NXG A;  3CG5 A;  5JYP A;  1WYC A;  2ZM2 A;  3SW1 A;  1K38 A;  3BEC A;  2PYR A;  4CLC A;  3WRT A;  3BFC A;  4ME4 A;  1OTA A;  3C4O A;  4CLC C;  2ZC3 B;  4L0L A;  4P6Z M;  5I94 A;  3BY9 A;  4N9K A;  2BG1 A;  4ZJ1 A;  4S2J A;  3LR0 A;  3S4X A;  3PHY A;  1D1J A;  1K56 A;  1BUL A;  1YKD A;  4L9G A;  1E4D A;  4ID4 A;  1M6K A;  3ZCZ A;  3GV9 A;  3OLO A;  2OAP 1;  3N4I A;  4E6W A;  2E8J A;  5HFO A;  2E8I A;  4X55 A;  3DWZ A;  2IWC A;  5AJG A;  1LSV A;  1XGJ A;  3LUQ A;  4S2P A;  1TS8 A;  5HAP A;  4GDN A;  4JGP A;  3VSK A;  1ERQ A;  2WKE A;  2Q9N A;  3C2W A;  3KYQ A;  4Q8I A;  3BFE A;  4WMC A;  4EQI A;  5U47 A;  3ZQ5 A;  2ZC6 B;  4R23 A;  4U0X A;  4MNR A;  4BEN A;  1EI5 A;  3DW0 A;  2V0W A;  1PW1 A;  2L1M A;  1TVF A;  1K54 A;  1SHV A;  1NLY A;  4XT2 A;  4RA7 A;  1K54 C;  5CRF A;  4ZDX A;  3WS0 A;  4DXB A;  3PAG A;  2D02 A;  2DCF A;  3MFX A;  2J80 A;  2XQZ A;  1VHM A;  3MZD A;  4P6B A;  1RP5 A;  1W63 Q;  2QYB A;  2W0N A;  4LEN A;  4HY8 A;  1VEU B;  2OLU A;  3F1O B;  3Q07 A;  3HLF A;  2EWW A;  5TFQ A;  3NY4 A;  1PZP A;  2VGJ A;  5L10 A;  3C38 A;  1JWZ A;  3ULF A;  1CEG A;  4ETX A;  3CAX A;  4OQ0 A;  2HP5 A;  5AQ9 A;  4GLQ A;  1KGF A;  4B4X A;  5J8X A;  4P0M A;  5C5K A;  3BW6 A;  1T1B A;  4FSF A;  1W8Q A;  2ZLY A;  3C30 A;  4OKP A;  4O8G A;  5HDC A;  4EER A;  3HLE A;  4QU3 A;  1OTD A;  5FQQ A;  3TRC A;  4MBF A;  5CXW A;  4GHI B;  5J4E A;  1P97 A;  4S2I A;  4JKT A;  1ONG A;  1IYQ A;  1OPX A;  2ZQ7 A;  3G6O A;  1S1Z A;  1T18 A;  3LEQ A;  3H7W A;  2PR6 A;  2Y2K A;  3IF6 B;  3PBO A;  4GB7 A;  3NC8 A;  4K91 A;  1Q2P A;  2X01 A;  4PKY A;  4S2N A;  3E98 A;  4WL9 A;  2B18 A;  4ZBE A;  2PU4 A;  1JWP A;  3D4F A;  4LFU A;  4S2N C;  1SDE A;  1ES5 A;  4E3K A;  3ZG9 B;  1YQS A;  4KZ7 A;  1S4S A;  1IFQ A;  2PD8 A;  3AGE A;  4X1L A;  3R4K A;  2EXA A;  4HHD A;  2B5R A;  5HDS A;  4HQA A;  2W3G A;  4EBP A;  3K2N A;  3HJK A;  5F83 A;  5J3W A;  4O0P A;  3MKE A;  5GHY A;  3ISG A;  2R9W A;  1SKO A;  3OPH A;  3BRM A;  5EVL A;  1MPL A;  4MN5 A;  4MN6 A;  1VB6 A;  4Z9Q A;  2J9O A;  3A3D A;  4EW7 A;  5AVF A;  2FH5 A;  1JTG A;  4R4S A;  4PM7 A;  4Y13 A;  3VP2 A;  2WAD A;  3C4P A;  1YPR A;  2B95 A;  3KSG A;  5M18 A;  2W27 A;  2JKT M;  3QP8 A;  4I5S A;  4UAA A;  4HIA A;  1BLC A;  2WGW B;  4BBV A;  2XLN A;  4KZA A;  2W1R A;  4DN0 A;  3EEA A;  3Q81 A;  3VFF A;  3HLG A;  2GZA A;  3BLM A;  4GCZ A;  3O88 A;  1RGY A;  4GS9 B;  3A3F A;  5CHJ A;  2XR0 A;  4YWZ A;  2ZOH A;  4U0T A;  3ZNY A;  3OPL A;  1BTL A;  5EVI B;  4DE3 A;  4MBH A;  4WF0 A;  2J3T D;  1XGI A;  4R3B A;  2JHE A;  2HJE A;  1XJ4 A;  2X71 A;  4HBU A;  3S7Q A;  2QPN A;  5KSC A;  3VOZ A;  3O86 A;  5DVA A;  2J3W A;  2Y2G A;  5TJJ A;  1HLU P;  5HAI A;  3HLD A;  1NZO A;  4NEE D;  2H5S A;  2EWV A;  1C3B A;  4HJ4 A;  1LI0 A;  4B93 A;  2UV0 E;  1S1Y A;  3B42 A;  2VK3 A;  3ITA A;  2PDR A;  1I2W A;  4GZB A;  1NRJ A;  3T4O A;  2ZBB A;  5A93 A;  1ZHH B;  2PAV P;  4ETZ A;  1FR1 A;  3WS1 A;  1GSV A;  2KLI A;  3TOI A;  3V3S A;  3DTM A;  1T19 A;  2XH9 A;  1PIO A;  4LRX C;  4O7D A;  2G2W A;  5L07 A;  2OWJ A;  5CTM A;  3QHY A;  3D3O A;  1G5U A;  3T4K A;  1MWU A;  2HP9 A;  5DJT A;  2FFF B;  1N9B A;  3IXD A;  5IHV A;  1CJF A;  3D72 A;  2A2L A;  4RQ9 A;  3AGF A;  1L2S A;  4YOF A;  3F1N A;  5FQJ A;  5CER A;  3NBL A;  1CI8 A;  3NUL A;  4WEL A;  5HAQ A;  4YFM A;  2KOI A;  4LV3 A;  4QD4 A;  1ESU A;  2JKG A;  4XXR A;  4FH2 A;  1KE4 A;  5FDS A;  3VSL A;  1JWV A;  1N9O A;  3ZVW A;  3UB7 A;  4LLO B;  5K5B A;  4BJP A;  2XRN A;  4IBX A;  4BL2 A;  2WK0 A;  3ZDJ A;  5AQB A;  4EUZ A;  4MDZ A;  1LLB A;  5BOH A;  4E3O A;  1L0E A;  4PPR A;  3VOL A;  2PBY A;  1IKG A;  4ESP A;  3JVU A;  1G28 A;  1ZG4 A;  3IXH A;  1YAX A;  4R4R A;  3BQ8 A;  3VV4 A;  4DF6 A;  3A3I A;  1TS0 A;  4ZRR A;  2PRF A;  3UPP A;  5FQM A;  3CUE A;  4Y7P A;  4DE2 A;  1VET A;  2WAF A;  4YNR A;  4HP4 A;  3CUE C;  4JF4 A;  3GSG A;  4XUZ A;  3QNB A;  2GDN A;  4BBU A;  1DP8 A;  2O9C A;  2XSS A;  4Q0J A;  5DFY A;  5FQ9 A;  3MS6 A;  3IF5 A;  3CI6 A;  4B88 A;  1UWP X;  1N4O A;  2ZQC A;  4JBF A;  3JVV A;  3F1P B;  4XT2 B;  2ZQ8 A;  3LO7 A;  2Q9M A;  4HOI A;  1E3U A;  4JXW A;  4OP5 A;  1WA9 A;  1OME A;  2XGN A;  3FKV A;  3IS2 A;  4UA7 A;  2OWH A;  1A0K A;  2ZD8 A;  1FCM A;  4NG2 A;  1KOU A;  1PRQ A;  4S2M A;  5CEB A;  3UE3 A;  3MQ0 A;  3K3C A;  1P9W A;  4FOF A;  4KUK A;  1PW8 A;  2XEP A;  2ZMV A;  3V3R A;  1H5X A;  3OCL A;  5E2F A;  5EVI D;  2Y59 A;  4G3V A;  3DWK A;  1LI9 A;  3NHQ A;  5FAO A;  2WUQ A;  1BT5 A;  2Y79 A;  3IHB A;  3S7O A;  1YLT A;  2P74 A;  3NDE A;  4DJ3 A;  1Y4O A;  3CZD A;  2EX9 A; 
#chains in the Genus database with same CATH homology
 2JN7 A;  1GSX A;  5KSH A;  4HJ3 A;  2VZW A;  1W63 Q;  3OCN A;  3FG8 A;  1XJ6 A;  4BBT A;  1MZU A;  2QYB A;  2W0N A;  1OT6 A;  4HY8 A;  3LIA A;  2VKS A;  3PBQ A;  3F1O B;  3B47 A;  3MJQ A;  3LFV A;  3S7P A;  2EWW A;  3MMH A;  4HJ6 A;  1W63 M;  4L9E A;  4WEK A;  3C38 A;  3ULF A;  3H82 A;  4LRZ E;  2D01 A;  5FL3 A;  1XFQ A;  2VEA A;  3BQA A;  3CAX A;  4WN5 A;  4ETX A;  1T1A A;  1S66 L;  4GLQ A;  3PBR A;  3IBJ A;  3MR0 A;  5C5K A;  3T4L A;  5KIZ A;  5HPI A;  2GNX A;  3BW6 A;  1T1B A;  3PXP A;  1D06 A;  2HF6 A;  4FSF A;  3KO6 A;  3C30 A;  2OAQ 1;  4O8G A;  3T4Q A;  2W3H A;  3IS2 B;  5HDC A;  4EU0 A;  4EER A;  2H28 A;  3E4P A;  2HV1 A;  4I3I A;  1OTD A;  1IOU A;  3HJI A;  3TRC A;  5DKL A;  2WKR A;  4HP9 A;  5DJU A;  4PAU A;  2O9B A;  4GHI B;  1ZTU A;  1TD5 A;  1P97 A;  5J4E A;  2VA0 A;  2P04 A;  5HWV A;  5DF9 A;  2V0U A;  2K7S A;  2EA9 A;  1OPX A;  3G6O A;  1S1Z A;  3A0S A;  1T18 A;  3H7W A;  5HL6 A;  2B02 A;  2PR6 A;  2W3F A;  3PBO A;  4KUO A;  2I9V A;  4PKY A;  1DP6 A;  2JKT I;  3E98 A;  3OBF A;  2B18 A;  4WL9 A;  4F3L A;  4P6Z S;  4PKY G;  4CLC D;  1H8M A;  1YSQ A;  3O5Y A;  3NOP C;  2YKF A;  4Z1W A;  3PBS A;  2VV7 A;  1S4S A;  1IFQ A;  3B33 A;  4M4X A;  2QJ7 A;  3VE4 A;  1F9I A;  3NOU C;  2PD8 A;  3R4K A;  4HHD A;  4GS9 A;  5HDS A;  4HQA A;  2W3G A;  3FPV A;  4II7 A;  2PYP A;  3K2N A;  1STZ A;  2R78 A;  3HJK A;  4NXF A;  4R6L A;  4Y3I A;  5J3W A;  3LI9 A;  4O0P A;  4BMW A;  4EUV A;  3H82 B;  2PHY A;  3EEH A;  3RH8 B;  2OOL A;  2DMW A;  3V67 A;  3TJZ C;  3GEC A;  2V1A A;  4MN5 A;  3FC7 A;  4MN6 A;  1VB6 A;  4H6J A;  4EW7 A;  5HDD A;  4EEU A;  3H9W A;  5AVF A;  1YSP A;  2FH5 A;  2Y8H A;  3LR4 A;  3T4J A;  3MQO A;  5DKK A;  1TS7 A;  3E0Y A;  4EET B;  1MC0 A;  2WKQ A;  1OJ5 A;  3KSG A;  3U2A A;  5MC7 A;  2L0W A;  2W3D A;  2W27 A;  4K08 A;  3H7W B;  2HGV A;  2JKT M;  4I5S A;  4HIA A;  3E4Q A;  2INW A;  4KQD A;  2CMN A;  4F3L B;  1D7E A;  4BBV A;  1Y28 A;  5F5Y A;  1LL8 A;  4GW9 A;  3T50 A;  2W1R A;  4DN0 A;  3EEA A;  4MCW A;  4UQI M;  1F98 A;  3TW8 A;  4HI4 A;  3EQU A;  1N9N A;  2GZA A;  5HWW A;  4GCZ A;  2G7U A;  4Y2F A;  3P01 A;  3ZYT A;  4GS9 B;  3PBT A;  5IT5 A;  2BAS A;  4CLC E;  2HJ9 C;  2M7U A;  3CWF A;  3BWL A;  4YWZ A;  2ZOH A;  5F68 A;  4KQO A;  2QJ5 A;  2Z6C A;  2P7J A;  3NOT C;  2ZOI A;  4UQI S;  3ICY A;  4IUH A;  1P0Z A;  2O99 A;  1UGU A;  4WF0 A;  2J3T D;  2JHE A;  3BJN A;  1LT0 A;  2QWS A;  5HD5 A;  2HJE A;  1XJ4 A;  2PD7 A;  2K2N A;  2PT7 A;  1S67 L;  4R70 A;  1H3Q A;  5HPF A;  4GJ4 A;  3PYP A;  3S7Q A;  4EEP A;  4JGQ A;  5IU1 A;  3A0R A;  5G4Z A;  4EES A;  2YKH A;  2J3W A;  4H6J B;  5HWT A;  5TJJ A;  4I38 A;  1XFN A;  4B9O A;  2GJ3 A;  3EOI A;  1T1C A;  4L9F A;  4NEE D;  2W1T A;  2ZMF A;  5HD3 A;  2EWV A;  3MXQ A;  4HJ4 A;  4HH2 A;  5LBR A;  3LYX A;  4Q0H A;  2LB5 A;  3EGX C;  3KYZ A;  4B93 A;  5J7E A;  2WKP A;  1DP9 A;  1NLZ A;  4R3A A;  2V9A A;  1S1Y A;  3B42 A;  3EWK A;  3F1N B;  4DMZ A;  4G3K A;  2PDR A;  2V1B A;  4ARZ A;  3K3D A;  4OOM A;  4LRY C;  2Z6D A;  4E04 A;  1NRJ A;  3T4O A;  2ZBB A;  3UB6 A;  3LI8 A;  3LIC A;  4MMN A;  3LID A;  2M1C A;  1ZHH B;  3LIB A;  4ETZ A;  5EFW A;  3GDI A;  4OOL A;  1GSV A;  1LSX A;  2KLI A;  4IUK A;  3HCY A;  1T19 A;  4LRX C;  3UB9 A;  1TS6 A;  2OWJ A;  4R38 A;  3MQQ A;  2FZ0 A;  1XJ3 A;  3D3O A;  1OTB A;  3C8C A;  3T4K A;  1OJG A;  2VJW A;  5DJT A;  4DJ2 A;  2M7V A;  3MF0 A;  4AFI A;  5A8B A;  3D72 A;  2A2L A;  2LB9 A;  4RQ9 A;  3TE8 A;  3UB8 A;  4IJG A;  2XA7 M;  4YOF A;  2XRO A;  2A24 A;  1TF1 A;  3F1N A;  3F1P A;  2JKR M;  3FPW A;  4NKP A;  2KDK A;  3OOV A;  4NXB A;  4O01 A;  3RFB A;  3KSF A;  2O9A A;  4WEL A;  1V9Z A;  3UMD A;  2KOI A;  4JGR A;  1XJ2 A;  5HZH A;  5I5L A;  4G3W A;  3PR6 A;  2QHK A;  1OTE A;  3R7W B;  1N9O A;  4EQ1 A;  3EGD C;  3UB7 A;  5F6A A;  4HH3 A;  4IHQ A;  4LLO B;  2XA7 S;  2L4R A;  4BJP A;  5K5B A;  4MN7 A;  3CLO A;  2W1T B;  2XRN A;  3UME A;  2O0Y A;  4WLA A;  4I3A A;  1G6O A;  1EW0 A;  2PR5 A;  3EQV A;  1UWN X;  5IS1 A;  4MDZ A;  2VV8 A;  3A0V A;  3RTY A;  3VOL A;  3OC2 A;  2MJ6 A;  3KSH A;  4QPR A;  3LIF A;  2VGL M;  2NUP C;  4Q0I A;  3JVU A;  1G28 A;  3LR5 A;  4HNB A;  1BYW A;  4I39 A;  4ARZ B;  4BWI A;  1YAX A;  2J3T C;  1S4R A;  3T4S A;  3T4T A;  3DBA A;  2VV6 A;  3BQ8 A;  4NXG A;  4Y5F A;  3VV4 A;  1NWZ A;  1TS0 A;  3NJA A;  4ZRR A;  3SW1 A;  3E4O A;  3CUE A;  2PYR A;  2W3E A;  4CLC A;  2JKR I;  4JGO A;  4WUJ A;  4YNR A;  4EXO A;  4HP4 A;  2QKP A;  5L8M A;  4ME4 A;  3CUE C;  1OTA A;  4I3J A;  2K31 A;  4CLC C;  4L0L A;  2VGL S;  3VE3 A;  4P6Z M;  1DRM A;  1N9L A;  3BY9 A;  3UE6 A;  5DFX A;  3R7W A;  1OT9 A;  4BBU A;  1DP8 A;  3PBN A;  3LR0 A;  2O9C A;  2XSS A;  3PHY A;  4Q0J A;  5DFY A;  2VX8 A;  5G4Y A;  1YKD A;  3CI6 A;  4L9G A;  3F1O A;  1UWP X;  1OTI A;  5TBM B;  1F5M A;  3OLO A;  2OAP 1;  2A24 B;  3JVV A;  1P9R A;  3F1P B;  4XT2 B;  3CIT A;  4WEJ A;  1V9Y A;  2NUT C;  5HSQ A;  4HOI A;  5F69 A;  3IBR A;  4UEY A;  3LIE A;  5AJG A;  5AVE A;  1LSV A;  3KSI A;  3LUQ A;  1WA9 A;  3P7N A;  1GSW A;  1TS8 A;  3IS2 A;  3S7N A;  2P08 A;  4JGP A;  3W2Z A;  4CQH A;  2OWH A;  4NXE A;  3KX0 X;  5CX7 A;  1KOU A;  1LSW A;  3C2W A;  3KYQ A;  3UE3 A;  3MQ0 A;  3K3C A;  4GHI A;  1P9W A;  4FOF A;  4KUK A;  3ZQ5 A;  2ZMV A;  4PHT A;  1X0O A;  2KX6 A;  2V0W A;  1JNU A;  3OCL A;  4LPZ A;  5TBM A;  2L1M A;  1ODV A;  4G3V A;  1NLY A;  4XT2 A;  3NHQ A;  1MKM A;  2GX5 A;  2IA2 A;  2VLG A;  4CLC B;  2Y79 A;  3S7O A;  2D02 A;  3LR3 A;  3BY8 A;  3MFX A;  2J80 A;  4DJ3 A;  1VHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...