1OTDA

Strong hydrogen bonds in photoactive yellow protein and their role in its photocycle
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
b'SQLDNLAFGAIQLDGDGTILQYNAAEGDITGRNPKEVIGKNFFKDVAPCTDSPEFSGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Short hydrogen bonds in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 30
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1otdA00
1OJ5A 1GSXA 1N9LA 1XFQA 2PR6A 4GHIA 2QHKA 5HDDA 2ZBBA 3CWFA 3E4QA 3CAXA 4EERA 2QKPA 4BBUA 5TBMA 2PD7A 3A0SA 1UGUA 2D01A 3E4PA 4HQAA 3ICYA 4RQ9A 2JHEA 4XT2B 2L1MA 4L9GA 4YWZA 2QJ7A 1JNUA 4I3AA 1OTAA 3LI9A 1LT0A 3EEHA 4EXOA 1TS6A 5J7EA 3LIDA 4M4XA 1BYWA 4K08A 1D7EA 3LI8A 3MJQA 5DKLA 5AVFA 4JGRA 1S1ZA 4HP4A 4EESA 4BBTA 4HP9A 4NXEA 1GSWA 2J80A 3NJAA 1NWZA 4E04A 5HDSA 3F1NB 4HNBA 2A24A 3LYXA 4HJ4A 2VV6A 5HWWA 5J4EA 4I5SA 2OWJA 3GECA 3LIBA 3IS2B 1T1CA 4I38A 2PR5A 2CMNA 5HWVA 1ODVA 1OTIA 5HD3A 3MXQA 3NOPC 4JGPA 3VOLA 4MN6A 3A0VA 4GS9A 3HJKA 5I5LA 2WKRA 3SW1A 4L9FA 5F68A 3UMEA 3B33A 5F5YA 4HOIA 3H82B 1EW0A 3BY8A 3HJIA 2D02A 1XFNA 1F9IA 1DP6A 4F3LB 3H7WA 2P7JA 3FC7A 5F6AA 4EETB 1TS7A 5DJUA 1Y28A 3UE6A 3T50A 2VV8A 3UB7A 4GHIB 3UB9A 1DRMA 1KOUA 4WN5A 1OT6A 3NOTC 2W27A 2K7SA 4HY8A 5TBMB 3EWKA 3G6OA 3C8CA 5J3WA 2M1CA 2V9AA 1OTBA 2JN7A 2OOLA 4H6JA 2YKFA 3P7NA 3UB8A 2V0UA 2VEAA 3LIFA 2PD8A 4NXGA 2L0WA 4LLOB 5G4ZA 3FG8A 3F1NA 1OT9A 2ZOIA 2KX6A 5HD5A 3F1OA 1T18A 4HJ3A 1X0OA 3MQQA 2INWA 4PKYA 4WLAA 2ZOHA 5HWTA 4HIAA 2KDKA 1XJ6A 1N9OA 3MFXA 3IS2A 4WF0A 1T1AA 5G4YA 2R78A 5EFWA 3GDIA 3BY9A 3F1PB 4I39A 1LSWA 4I3IA 2B02A 3C2WA 4R3AA 4R6LA 2A24B 3CLOA 5HSQA 1UWNX 4HH2A 2PYRA 1DP9A 1XJ3A 3NHQA 5F69A 5DKKA 4NXFA 3LUQA 4HHDA 1LSVA 4PKYG 3LIEA 2HV1A 2H28A 4HH3A 2V1BA 3PHYA 4GS9B 3RTYA 5IU1A 4KUKA 1TS8A 3OLOA 1LL8A 2EA9A 4BBVA 2Z6CA 4I3JA 4XT2A 3K3DA 2V0WA 2QJ5A 4WUJA 4KUOA 4EEUA 4LRZE 4LRXC 3VE4A 5AVEA 2PDRA 3E4OA 4JGQA 3UMDA 4DJ3A 2WKPA 2L4RA 2WKQA 2PYPA 1S4SA 5DJTA 3H7WB 4DJ2A 1F98A 4HJ6A 1P0ZA 3PYPA 4EW7A 1T1BA 4GW9A 3NOUC 1TS0A 3H9WA 5IS1A 5A8BA 1MZUA 3BWLA 3K3CA 1N9NA 4JGOA 4B9OA 2VV7A 1XJ2A 2GJ3A 1T19A 4LPZA 2Z6DA 4L9EA 4R70A 3A0RA 3ZQ5A 4H6JB 1LSXA 5KIZA 3KX0X 3ULFA 4NXBA 1WA9A 1S66L 3F1PA 2PHYA 2V1AA 1P97A 2W0NA 1S4RA 4EQ1A 4KQDA 3F1OB 1G28A 2VLGA 4GCZA 4EEPA 1GSVA 1DP8A 1UWPX 2BASA 2OWHA 1VB6A 1OTEA 3MR0A 3IBRA 1S67L 1S1YA 1XJ4A 3LICA 3H82A 3VE3A 1D06A 1OTDA 4WL9A 3RH8B 1OJGA 3D72A 3UB6A 4F3LA 3LIAA 4R38A 4LRYC 3MQOA 1V9YA 4MN5A 1V9ZA 2I9VA 2YKHA 2QWSA 4HI4A 5HZHA 5HDCA
chains in the Genus database with same CATH superfamily
3FPWA 3QP4A 1XX2A 1XFQA 1GSXA 4JXWA 1LI0A 5E43A 1IEMA 3CHWP 4X55A 4FOFA 1G6OA 1SKFA 4RX3A 5FASA 2ZBBA 4WEKA 5FI6A 2AVXA 5HPIA 4CQHA 3OPLA 4LV1A 2X71A 3CAXA 1YLTA 4EERA 2W1RA 1FSWA 2WAFA 2Q0OA 4ETZA 1HTZA 2VK3A 1LHYA 2Y2HA 3E4PA 3ICYA 4RQ9A 4EUZA 3P09A 1TVFA 2Z2MB 3T4QA 1NXYA 4X1MA 3LO7A 1NZUA 3WS4A 3MSHA 2J3TC 3QP8A 2IWCA 3C38A 1I2WA 1BZAA 4Y17A 1K38A 4JXGA 2NUPC 4Y2FA 1XP4A 3LI9A 1KVLA 1BLHA 4PM9A 2ZQAA 3BW6A 4M4XA 1BYWA 5DVAA 2WGWA 1ZG4A 3B3XA 3V39A 2HP5A 3C7UA 1YAXA 3PXPA 4KQQA 4NXEA 3KSGA 4IVIA 1PWDA 4JXSA 1GSWA 1KE0A 1MY8A 3R7WA 5HAQA 3E98A 5HDSA 4HNBA 5FA7A 2XROA 2X01A 3CPTB 4I5SA 2P9VB 3B42A 3MMHA 1T1CA 2PR5A 4E3LA 5FQJA 1OTIA 3NIAA 3NOPC 2ZQCA 1YLZA 2VJWA 4G3VA 3BFFA 1NYMA 5C5KA 3TJZC 3JVUA 3S7OA 1W8YA 3HLCA 4S2PA 3BY8A 3QHYA 5M18A 2E8IA 5E2HA 4N92A 1DP6A 3GTCA 3T1SA 5CHJA 4PPRA 4WZ5C 2W3HA 2O9AA 3PBTA 2H5SA 3MZFA 3H7WA 5DTSA 5F6AA 3Q7VB 4FD8A 4DDSA 1ALQA 1ZG6A 1Y28A 3V50A 3T50A 3UB7A 4GHIB 3UB9A 3HUMA 4WN5A 1IYPA 1NLYA 4RYEA 2W27A 4HY8A 5EM1A 4HEFA 2V9AA 1NY0A 3MS6A 1IYOA 2JN7A 4ARZA 3KSIA 4GNUA 4Z9QA 5EVLA 4S2IA 1S6RA 5A93A 2EWWA 5DF9A 3P7NA 4FH4A 1E3UD 5KZHA 3LIFA 5EOOA 1F5MA 3OZHA 3PBNA 2OLUA 2L0WA 4LLOB 4Y0TA 4S2MA 2ZL1B 3IH8A 2XDMA 4OLGA 3ZGAB 1KE4A 3G31A 1XA1A 2O99A 5L07A 4GDBA 4E3MA 1X0OA 3MQ0A 5CEDA 2INWA 4P87A 1GA0A 3IF6C 2HZ5A 3NULA 1SZVA 4R1GA 2J8YA 3OPPA 4EV4A 3UDFA 4O8GA 5EVIA 3T1XA 5J8XA 2OSUA 3BY9A 3F1PB 4I39A 1LSWA 4GZBA 1IFQA 2W3GA 2BLSA 2PU2A 1PW1A 3GR2A 4HH2A 2PYRA 1ESIA 4ZTKA 5FL3A 1K4EA 3BFGA 3NHQA 5F69A 2W1TB 4NXFA 1Y4OA 3LUQA 4ETXA 1K25A 4BLMA 3QNBA 5FATA 4HHDA 3GRJA 4MEZA 1FILA 3S1YA 3IHBA 3LIEA 3PTEA 3HVFA 3G2YA 3PHYA 3E2KA 3KYQA 2WKEA 4KQRA 4KUKA 3OLOA 4JKTA 2FFFB 3MZEA 2ZQ9A 3LY4A 1W79A 3IF5A 2VGLS 5AQBA 3UPPA 3WWXA 3VV4A 1YT4A 4EEUA 2Q9MA 4KZ6A 1RGYA 4LRZE 5HFOA 4KZAA 2XA7S 3E2LA 1YPRA 4BWIA 4S2OA 3LEQA 4LENA 3WS0A 4EU0A 2PYPA 3V3SA 1S4SA 2LB5A 5HL6A 1WYBA 4DJ2A 4HJ6A 1P0ZA 4Y5FA 3W4OA 1PYYA 4N1XA 3GQZA 3UPOA 1TS0A 3TOIA 3H9WA 5IS1A 3M6HA 1MZUA 1XJ2A 1T19A 5GLAA 3MZDA 2Z6DA 4CLCC 3A0RA 4S2LA 2JKFA 1W63Q 2ZC3B 4H6JB 1I5QA 4U0XA 3CPTA 3KX0X 4ZJ3A 1ES2A 3ULFA 2P9VA 4E3NA 3LY3A 5KSHA 4NK3A 1K4FA 2FH5A 4FCFA 1S4RA 3KSHA 4KQDA 4KENB 1ES5A 1SCWA 2VKSA 3F1OB 3KYEA 1MKMA 2HP6A 5CGWA 1GSVA 3OC2A 4LV0A 4O7DA 3W2ZA 4EBLA 3MR0A 3ZG7B 1HZOA 1XJ4A 2X02A 1H8YA 1G5UA 4WM9A 1KVMA 1Q2PA 3VP0A 5AQ9A 3UB6A 4WEJA 2WGIA 1CEFA 3T12B 4CLCE 4XXRA 3LGOA 4D2OA 4R38A 5HAPA 1EROA 4GB7A 2HPBA 1TDLA 4R4RA 1ESUA 3T1QB 2YKHA 4HI4A 1PI4A 5HDCA 5FEGA 1OJ5A 3Q7VA 4GLQA 2P04A 4GHIA 2ZM0A 2HJ9C 2QHKA 5HDDA 3NDGA 4YINA 3N8RA 3ISGA 4Y0UA 3AGEA 4BL3A 4QJGA 2PD7A 1ZC2A 1UGUA 4OH0A 3CUEC 1VETB 1K54C 4E3JA 1JWVA 5EM0A 4HQAA 3OCLA 2XSSA 2JKGA 4MLLA 3Q07A 3UE3A 2FZ0A 3EGDC 2UWXA 4WMCA 1Q2QA 2EWVA 3PR6A 3G4PA 3BFDA 4BD1A 1FCNA 4GKUA 4P0MA 4I3AA 1OTAA 1LT0A 2ZL1A 1YSPA 3A3IA 1TS6A 5CHMA 4MBFA 4OPRA 2JKTM 3LIDA 3LR4A 3CITA 3G35A 3O86A 1TDGA 3ZVWA 1ZTUA 5AJGA 4K08A 2XQZA 5EOEA 1ZKJA 1ERMA 4Y7PA 2V20A 1CI8A 4KG5A 4EESA 3EEAA 3FKWA 2A49A 2J80A 2KOIA 1LL5A 3NJAA 1NWZA 3ZHHA 3B47A 2HDSA 4IUHA 3TW8A 5GLCA 3N4IA 3LYXA 2ZMFA 4K0XA 4HJ4A 2VV6A 5HWWA 1KGGA 1GA9A 2W1TA 4II7A 3LIBA 4EQIA 2WADA 4I38A 2DCFA 2HF6A 4FSFA 1W7FA 4JBFA 3V67A 3MXQA 2C6WB 1MWUA 1WYCA 2WGVA 1TEMA 4JGPA 5U47A 4OKPA 4MN6A 1E4DA 3T4JA 4QWOA 5CRFA 1XGJA 3CI6A 3HJKA 2EX2A 2PT7A 5KSCA 5L09A 2EXAA 1GHPA 5F68A 3EOIA 3UMEA 2Y2MA 1N9BA 5EV0A 3H82B 5MC7A 5FQQA 2IWDA 3Q7ZA 2UV0E 4FTXA 1XFNA 4QY6A 1F9IA 2ZC4B 1YMSA 4MBKA 1GHMA 3UO9A 3PBQA 5FDHA 1BLSA 1LLBA 5EVID 4GDNA 5DF7A 2EFUA 3BM6A 4EETB 2JCHA 5DJUA 2IWBA 1FIKA 1DRMA 5E2FA 4NETA 2XK1A 2DNSA 5FQKA 1L0GA 3VOZA 4ZRRA 5F83A 2J3WA 1BT5A 3BFEA 3EWKA 2Y8HA 5J3WA 3DWKA 3UDIA 3HLFA 2CC1A 1L0DA 2MJ6A 4GN2A 4Y13A 1OTBA 2JE5A 2V1ZA 1AXBA 4H6JA 3HLGA 1YSQA 3HLWA 1TF1A 4DE1A 2YKFA 4ZJ2A 4N9LA 1DJBA 3DTIA 5JYPA 2V0UA 4KZ4A 2PD8A 1QMEA 3BFCA 2XR0A 2FFYA 2BTFP 4IBXA 3F1NA 4H8RA 2ZOIA 2Y55A 3F1OA 3ZVTA 1OPXA 2PBYA 3S4XA 3MQQA 1JVJA 3CG5A 4Y15A 3SS5A 1NRJA 4CJNA 2ZOHA 1XJ6A 1N9OA 1K57C 1KDSA 1HLUP 3NECA 4P6BA 3NDEA 3EQVA 2H10A 1M6KA 4OLDA 5BOHA 1YM1A 4R6LA 2A24B 4S2NC 5FAOA 1IOUA 1N4OA 3AGDA 2G2UA 1XJ3A 4XUXA 2XFSA 1IYQA 1ERQA 4NG2A 3C4PA 5EVEA 1BUEA 4K91A 3A3EA 2H28A 3S7QA 4M3KA 2ZQ7A 2OV5A 4GS9B 4OQHA 4C3QA 1TS8A 1VETA 3DTKA 3L9KA 1VEUA 3ZG8B 4IBRA 2Z6CA 1H0MA 3K3DA 3VSKA 4P6ZM 2EXBA 4WUJA 3ZNTA 2VZWA 1I2SA 1BLCA 4QU3A 3N8LA 5AVEA 2PDRA 3S7PA 2WZXA 3P01A 2WKPA 4O0PA 4IJGA 3Q82A 3WS1A 1G6AA 3MKFA 1F98A 3EQUA 4JF6A 4DN0A 4EW7A 1T1BA 1KDWA 2GX5A 5A8BA 4YOFA 2HDQA 1DY6A 2DMWA 1N9NA 3K3CA 3TRCA 2VV7A 3JPUA 1CK3A 4PM8A 4QD4A 3ZNYA 1SHVA 4R70A 3ZQ5A 5CTNA 1WE4A 1PRQA 3VOYA 5KIZA 4NEED 1VQQA 4NXBA 3T4OA 4PM5A 2O9CA 1W63M 1FCOA 2PBDP 3IF6B 1A0KA 2PHYA 3HREA 1GHIA 3G2ZA 1P97A 5TJJA 5DF8A 5HX9A 2VA0A 3V5MA 3FKVA 2VGKA 2K31A 1UWPX 5F1GA 1VB6A 2W3EA 2DRWA 5AQAA 1OTEA 3IBRA 3ZG9B 5EPHA 3H82A 2Y2GA 5TGFA 4EWFA 1D06A 1P9RA 3BJNA 1KGFA 3P98A 3D72A 5HW3A 1YMXA 1K55C 3PAEA 3SH9A 3PBSA 3MQOA 1PWCA 5FI7A 2Y2QA 4LV2A 5F1FA 1V9YA 1KGEA 4MN5A 3EGXC 3IQAA 2QWSA 4LV3A 3U2AA 3DTMA 5DTKA 3RJUA 4MNRA 3VFFA 1YLPA 3CWFA 4E3OA 3L7HA 5GLDA 2O0YA 4BBUA 3PBOA 4QY5A 3BQ8A 3A0SA 3IT9A 1F2KA 2D01A 4OQIA 3UY6A 3HLDA 1YLWA 4UEYA 2JHEA 4DDYA 3UB5P 2L1MA 4L9GA 1JWZA 4PAUA 2QJ7A 4ZDXA 2JBFA 4EUVA 3N8SA 2M7UA 2ZD8A 3EEHA 1W5DA 2HP9A 1O07A 4GJ4A 2JKTI 4GD6A 3QP5A 3LI8A 4IEDA 4DE3A 5DKLA 1NRFA 1S1ZA 3N7WA 3RFBA 4ID4A 2RCXA 4CLCB 3QP6A 5FSRA 3D3OA 4DXCA 1ES3A 3OCNA 2Y79A 3T4TA 3F1NB 4OVDA 4B4XA 4JF5A 2A24A 3OPHA 3HUOA 4L0LA 2R9WA 5I94A 1EI5A 2ZMVA 1TD5A 5J4EA 5DTTA 3IBJA 2OWJA 4ZAMA 5M19A 2H0YA 2QMIA 2PAVP 3G34A 1SDEA 3VFHA 3CMZA 2V2FF 3TG9A 2CMNA 1RCJA 2O9BA 4LCMA 5HWVA 5HD3A 3LFVA 2WZZA 1VHMA 3QNCA 1MWTA 4GS9A 4X68A 5E2EA 5HPFA 1XGIA 5I5LA 1MBLA 2WKRA 3VP3A 3C7VA 3IX3A 3HL9A 4R0QA 3M2JA 3B33A 4DF6A 4HOIA 1EW0A 4KG6A 3VP2A 2GZAA 2ZLYA 3HJIA 4WZ5A 2D02A 4R4SA 2Y2NA 4ZBEA 3W4PA 5HAIA 1LI9A 2W3FA 1E3UA 3CZDA 1PZPA 4OP5A 4OPQA 3O88A 4Q0IA 3OPRA 5JYOA 2WUQA 3C30A 2P7JA 3W4QA 3FC7A 3SZTA 4EBPA 1VEUB 5CERA 3IXGA 3A3JA 5GL9A 2WYXA 4PM7A 2VV8A 3Q81A 4A5RA 3BLMA 1OT6A 1BSGA 3IXBA 3NBLA 5CTMA 5FAPA 1YLJA 4UA9A 4JF4A 2K7SA 4R3BA 2G7UA 3IWIA 5TBMB 3BYDA 3DWZA 3C8CA 3T4SA 4YFMA 3NI9A 2M1CA 4B88A 2J9OA 2QZ6A 1M40A 4RVAA 2XEPA 3GSGA 1J9MA 3GVBA 1FR6A 2VEAA 4NXGA 2XGNA 4O01A 4WELA 5AQ7A 5G4ZA 3FG8A 3IF6A 3IWOA 3KO6A 1JWPA 3HBRA 2Y2KA 1OT9A 5A90A 1MPLA 1S0WA 3C4OA 1G68A 1DJCA 4HESA 3PBRA 3W8KA 1T18A 4HJ3A 3IWQA 5EECA 5GHXA 4QB8A 2P08A 3QP2A 4WLAA 4LGWA 3DAVA 5HWTA 1L3LA 3BEBA 1PWGA 2M7VA 1P9WA 3MFXA 3IS2A 1NLZA 2HJEA 3O5YA 3G30A 1BULA 2R78A 1PI5A 3GDIA 3AGFA 3FV7A 4I3IA 4P85A 3ZG0A 2B02A 2VGJA 5G18A 3C2WA 4OPZA 1FR1A 3CLOA 5EVIC 5DFXA 1UWNX 2WKIA 4EBNA 2A3UA 1DP9A 3ITAA 1MKIA 2A2LA 2HGVA 2B18A 5DKKA 4E6WA 4WZ4A 3MKEA 3NC8A 3UNWA 4PKYG 3M6BA 1L0FA 1PNEA 2HV1A 4HH3A 3IHAA 4U3TA 2HDUA 4GD8A 4UA6A 1GCEA 3KSFA 3ZCZA 1ACFA 3UE0A 3RTYA 5KMWA 4X6TA 3SH8A 4X69A 5K5BA 4BBVA 4I3JA 2OAP1 1MC0A 2V0WA 2QJ5A 3VP4A 3HCYA 4KQOA 3UPNA 4OOLA 4BENA 3VE4A 4C75A 2VGLM 4OOMA 3C5AA 3MBZA 1FQGA 3UMDA 3T1RA 2L4RA 4PHTA 1XKZA 3WRZA 4IHQA 3ZFZA 3CJMA 2XA7M 3E0YA 3OBFA 1CEGA 1NZOA 3IXHA 3BLSA 3QP1A 4MBHA 4OOYA 5DFYA 3UDXA 3NOUC 3NCKA 5M1AA 3V3RA 5CX7A 1XXMA 4CLCA 4KZ5A 4HBUA 3HLBA 1AWIA 2JKRM 4BQMA 1CJFA 4JGOA 1FSYA 4B9OA 2XH9A 2GJ3A 4KZ8A 4D60A 1KE3A 4L9EA 4OONA 1CF0A 5F82A 3K2NA 4BD0A 4KZ7A 1Z6FA 4KZ3A 1SKOB 1JTDA 1LSXA 2ZM8A 5HL1A 1PZOA 5CECA 1STZA 2G2WA 4S2JA 1WA9A 3UE1A 1H8MA 4MCWA 2J3TD 3UN7A 4N9KA 4QHCA 4BL2A 5CGSA 1K56A 2W0NA 4EQ1A 5CHUA 1ZHHB 4ME4A 1DP8A 4Q0JA 3S22A 3A3FA 2OWHA 1C3BA 4B4ZA 4WYYA 2P74A 4OQGA 2V8CA 1OTDA 4WL9A 2ZC5B 1OJGA 5FQ9A 1PIOA 3LIAA 4HBTA 4X53A 4LCLA 3MF0A 2XD1A 2Z2LB 1V9ZA 2I9VA 3M2KA 1N9LA 2XLNA 4S2KA 2PR6A 4UHUA 4BJPA 1MWRA 2H0TA 3CUEA 1K54A 1VM1A 3E4QA 4GOGA 2QKPA 5TBMA 3LR3A 4RX2A 4K0WA 3ITBA 1ONHA 3Q1FA 2JC7A 4X56A 1YQSA 4XT2B 3VSLA 2C5WB 4MN7A 2ZQ8A 4DRTA 4YWZA 4DE2A 2ZMAA 4UQIS 3U4LP 1FOFA 3FZCA 1JNUA 5L8MA 1IELA 3GMWA 1LL9A 3A3DA 1IKIA 4Z1WA 3VMAA 4EXOA 5FI2A 4DKIA 5J7EA 3S7NA 2PU4A 2J9PA 3OOVA 4LFUA 2BG1A 1D7EA 3MJQA 2R9XA 1ONGA 3DTEA 4ZJ1A 5AVFA 4MMNA 4JGRA 4HP4A 4BBTA 2GNXA 4HP9A 1BLPA 3O87A 2Y2LA 4OQ0A 2EX6A 4E04A 1NJ4A 5D3OA 2ZC6B 4WMCD 2Y91A 3ZDJA 4Y3IA 3GECA 5IT5A 2QPNA 1QMFA 3ZG5A 5LBRA 3IS2B 3D4FA 4KZBA 1ODVA 3WS5A 1J3WA 3VOLA 3IXDA 3I7JA 3A0VA 2I72A 1MWSA 4Q8IA 2ZC7A 1YLYA 1CI9A 2Y2OA 2VX8A 3SW1A 4L9FA 4UAAA 4WBGA 2Y2IA 5F5YA 4BMWA 1PW8A 4QPRA 1JTGA 3FYZA 2PRFA 4F3LB 3LEZA 5A91A 3MXSA 4E6XA 1K0KA 2HDRA 4JPMA 4OPYA 4KG2A 2Q9NA 5L10A 3LCEA 3MXRA 1H3QA 1MXOA 3DW0A 4KZ9A 4B93A 1TS7A 1Z09A 3UE6A 3R4KA 2XD5A 4R3JA 1KOUA 3NOTC 1PFLA 3ZYTA 2K2NA 3RXWA 3G6OA 4OP8A 4G3KA 1H5XA 2OOLA 1SKOA 2ACGA 4IUKA 5IHVA 4G3WA 5FQIA 3UB8A 1L0EA 5L2FA 5A92A 1E25A 4JLFA 1OMEA 4N1HA 2EFXA 5TR7A 2QYBA 4IVKA 3SS4A 2B95A 4X25A 1K57A 2KX6A 5HD5A 3KYZA 2WGWB 4PKYA 1XPBA 3HUNA 1HD8A 1HVBA 1EWZA 4HIAA 2KDKA 2WK0A 5CXWA 4CPKA 4F94A 4WF0A 3SS3A 2Y2JA 1T1AA 4S2NA 1Y54A 5G4YA 3R7WB 4C6YA 5EFWA 2WAEA 4R3AA 5CGXA 1IYSA 2Y4AA 5HSQA 4CLCD 5FAQA 2EX8A 1CQAA 3HLEA 2ZQDA 1L2SA 2WKHA 2J7VA 3G32A 5FDSA 1BTLA 4XUZA 2E8JA 2ZJ9A 1D1JA 2KLIA 4DMZA 3LR0A 5FQMA 1LSVA 2XRNA 5EUAA 1H8ZA 3WS2A 2V1BA 4P6ZS 4DE0A 1ES4A 5IU1A 3NY4A 3IX4A 3DBAA 4R23A 5E2GA 1LL8A 2EA9A 3IH9A 4XT2A 5EE8A 4NKPA 4PM6A 3BECA 3T4KA 1K56D 4KUOA 5TFQA 4LRXC 3BRMA 3O3VA 1RP5A 1DJAA 3TE8A 3TSGA 3E4OA 4JGQA 2ZM2A 4DJ3A 2WKQA 4JXVA 5DJTA 3H7WB 3PAGA 2XF3A 1K6SA 3IX8A 3PYPA 3VP1A 4Q0HA 4AFIA 4DXBA 4GW9A 3FWLA 3GV9A 1RGZA 3BWLA 4E3KA 2JKRI 2IA2A 4FH2A 4UQIM 1W8QA 4LPZA 3JYIA 2NUTC 4ARZB 3D9YA 1SDNA 1IKGA 4ESPA 3BQAA 4PMAA 1K6RA 5GLBA 1S66L 1U60A 4FUWA 4E3IA 3SH7A 4YNRA 4U0TA 2Y2PA 3LR5A 2XFTA 2Y59A 3F1PA 2B5RA 5GHYA 4MDZA 2OLVA 2V1AA 2LB9A 2W3DA 4UA7A 1G28A 2GDNA 2VLGA 1O7EA 4GCZA 4EEPA 2BASA 5GHZA 2RL3A 1NYYA 1K55A 5HARA 1FCMA 1S67L 1S1YA 3T4LA 3LICA 3N6IA 3JVVA 4RA7A 3VE3A 5FEFA 5EVIB 3RH8B 2V8FA 2OAQ1 1YKDA 4F3LA 4X1LA 3WRTA 3RXXA 4LRYC 4Y0OA 2EX9A 3FPVA 3SOIA 3MFDA 5CEBA 5HZHA 1XA7A
chains in the Genus database with same CATH topology
3FPWA 1OJ5A 1GSXA 1N9LA 1XFQA 4GLQA 3U2AA 2P04A 2PR6A 4FOFA 1G6OA 4GHIA 4BJPA 2HJ9C 2QHKA 5HDDA 3CUEA 2ZBBA 4WEKA 3CWFA 5HPIA 4CQHA 3E4QA 3CAXA 4EERA 2QKPA 2W1RA 2O0YA 4BBUA 3PBOA 5TBMA 4ETZA 3LR3A 2PD7A 3BQ8A 3A0SA 1UGUA 2D01A 3CUEC 3E4PA 4UEYA 4HQAA 3ICYA 3OCLA 2XSSA 4RQ9A 2JHEA 4XT2B 3UE3A 2FZ0A 3EGDC 3T4QA 4MN7A 2L1MA 4L9GA 4PAUA 4YWZA 2QJ7A 2EWVA 3PR6A 4UQIS 2J3TC 4EUVA 1JNUA 3C38A 5L8MA 4I3AA 2M7UA 1OTAA 2NUPC 4Y2FA 3LI9A 1LT0A 4Z1WA 1YSPA 3EEHA 4EXOA 1TS6A 4GJ4A 2JKTM 5J7EA 2JKTI 3LIDA 3BW6A 3S7NA 3LR4A 3CITA 4M4XA 1ZTUA 5AJGA 3OOVA 1BYWA 4K08A 1D7EA 3LI8A 3MJQA 5DKLA 5AVFA 4MMNA 4JGRA 1S1ZA 4HP4A 4EESA 4BBTA 2GNXA 3EEAA 4HP9A 1YAXA 3RFBA 3PXPA 4CLCB 4NXEA 3KSGA 1GSWA 3D3OA 2J80A 2KOIA 3NJAA 3OCNA 2Y79A 3R7WA 1NWZA 4E04A 3T4TA 3E98A 3B47A 5HDSA 3F1NB 4IUHA 3TW8A 4HNBA 2A24A 2XROA 4Y3IA 4L0LA 3LYXA 2ZMFA 2ZMVA 4HJ4A 1TD5A 2VV6A 5HWWA 5J4EA 4I5SA 3IBJA 2OWJA 3GECA 5IT5A 3B42A 2W1TA 4II7A 3LIBA 3MMHA 5LBRA 3IS2B 1T1CA 4I38A 2HF6A 2PR5A 2CMNA 2O9BA 4FSFA 5HWVA 1ODVA 1OTIA 5HD3A 3LFVA 3MXQA 3NOPC 3V67A 2VJWA 4G3VA 4JGPA 3VOLA 4MN6A 1VHMA 3A0VA 3T4JA 5C5KA 4GS9A 3TJZC 5HPFA 3CI6A 3HJKA 5I5LA 2PT7A 3JVUA 2WKRA 2VX8A 3SW1A 4L9FA 3S7OA 5F68A 3EOIA 3UMEA 3B33A 5F5YA 4BMWA 4HOIA 4QPRA 3H82B 5MC7A 1EW0A 3BY8A 2GZAA 3HJIA 2D02A 1XFNA 1F9IA 1DP6A 4F3LB 2W3FA 4Q0IA 2W3HA 3PBQA 2O9AA 3PBTA 1H3QA 3C30A 3H7WA 2P7JA 3FC7A 5F6AA 4B93A 4EETB 1TS7A 5DJUA 1Y28A 3UE6A 3T50A 2VV8A 3R4KA 4GHIB 3UB7A 3UB9A 1DRMA 1KOUA 4WN5A 1OT6A 3NOTC 4ZRRA 1NLYA 2W27A 3ZYTA 2J3WA 2K7SA 2G7UA 4HY8A 2K2NA 5TBMB 3EWKA 3G6OA 2Y8HA 3C8CA 3T4SA 5J3WA 2M1CA 4G3KA 2V9AA 2MJ6A 1OTBA 2JN7A 4ARZA 2OOLA 4H6JA 1YSQA 3KSIA 1TF1A 2YKFA 4IUKA 4G3WA 2EWWA 5DF9A 3P7NA 2V0UA 2VEAA 3LIFA 3UB8A 1F5MA 2PD8A 3PBNA 4NXGA 4O01A 4WELA 2L0WA 4LLOB 5G4ZA 3FG8A 3F1NA 2QYBA 3KO6A 1OT9A 2ZOIA 2KX6A 5HD5A 3KYZA 3F1OA 2O99A 3PBRA 1T18A 4HJ3A 1OPXA 1X0OA 3MQ0A 3MQQA 2INWA 4PKYA 2P08A 4WLAA 1NRJA 2ZOHA 5HWTA 4HIAA 2KDKA 2M7VA 1P9WA 1N9OA 1XJ6A 3IS2A 3MFXA 4WF0A 1NLZA 2HJEA 3O5YA 1T1AA 4O8GA 5G4YA 2R78A 3EQVA 3R7WB 5EFWA 3GDIA 3BY9A 3F1PB 4I39A 1LSWA 4I3IA 2B02A 1IFQA 2W3GA 3C2WA 4R3AA 4R6LA 2A24B 3CLOA 5HSQA 4CLCD 5DFXA 1UWNX 4HH2A 1IOUA 2PYRA 1DP9A 1XJ3A 5FL3A 2A2LA 2HGVA 2B18A 3NHQA 5F69A 2W1TB 5DKKA 4NXFA 3LUQA 4ETXA 2KLIA 4DMZA 3LR0A 4HHDA 1LSVA 4PKYG 2XRNA 3LIEA 2HV1A 2H28A 3S7QA 4HH3A 2V1BA 3PHYA 4P6ZS 3KSFA 3KYQA 4GS9B 3RTYA 5IU1A 4KUKA 1TS8A 3OLOA 3DBAA 1LL8A 2EA9A 5K5BA 4BBVA 2Z6CA 4I3JA 2VGLS 2OAP1 4XT2A 3K3DA 1MC0A 2V0WA 4P6ZM 4NKPA 2QJ5A 3T4KA 3HCYA 4WUJA 3VV4A 2VZWA 4KUOA 4KQOA 4EEUA 4LRZE 4OOLA 4LRXC 3VE4A 2XA7S 2VGLM 4OOMA 5AVEA 2PDRA 3TE8A 3E4OA 4JGQA 4BWIA 3S7PA 3UMDA 3P01A 4DJ3A 2WKPA 2L4RA 4PHTA 4O0PA 4IJGA 2WKQA 4EU0A 2PYPA 1S4SA 4IHQA 5DJTA 3H7WB 2LB5A 5HL6A 2XA7M 4DJ2A 3E0YA 1F98A 3EQUA 1P0ZA 3OBFA 4HJ6A 4Y5FA 4DN0A 3PYPA 4Q0HA 4EW7A 5DFYA 4AFIA 1T1BA 4GW9A 3NOUC 2GX5A 5CX7A 1TS0A 4CLCA 3H9WA 5IS1A 5A8BA 4YOFA 1MZUA 3BWLA 2JKRM 2DMWA 3K3CA 1N9NA 2JKRI 2IA2A 4JGOA 3TRCA 4B9OA 2VV7A 1XJ2A 4UQIM 2GJ3A 1T19A 4LPZA 2Z6DA 2NUTC 4L9EA 4CLCC 4R70A 3A0RA 3ZQ5A 3K2NA 1W63Q 4ARZB 4H6JB 1LSXA 3BQAA 3KX0X 5KIZA 4NEED 3ULFA 1STZA 4NXBA 1WA9A 1S66L 3T4OA 1H8MA 2O9CA 4MCWA 4YNRA 1W63M 2J3TD 3LR5A 5KSHA 3F1PA 4MDZA 2PHYA 2V1AA 2LB9A 2W3DA 1P97A 2FH5A 5TJJA 2W0NA 1S4RA 3KSHA 4KQDA 1ZHHB 4EQ1A 4ME4A 2VKSA 3F1OB 1G28A 2VLGA 2VA0A 1MKMA 4GCZA 4EEPA 1GSVA 1DP8A 3OC2A 4Q0JA 2K31A 1UWPX 2BASA 2OWHA 1VB6A 2W3EA 3W2ZA 1OTEA 3MR0A 3IBRA 1S67L 1S1YA 3T4LA 1XJ4A 3LICA 3H82A 3JVVA 3VE3A 1D06A 1OTDA 1P9RA 4WL9A 3RH8B 3BJNA 1OJGA 2OAQ1 3D72A 3UB6A 4WEJA 1YKDA 4F3LA 3LIAA 4CLCE 4R38A 3MF0A 4LRYC 3PBSA 3MQOA 3FPVA 1V9YA 4MN5A 1V9ZA 2I9VA 2YKHA 3EGXC 2QWSA 4HI4A 5HZHA 5HDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OJ5 A;  1GSX A;  1N9L A;  1XFQ A;  2PR6 A;  4GHI A;  2QHK A;  5HDD A;  2ZBB A;  3CWF A;  3E4Q A;  3CAX A;  4EER A;  2QKP A;  4BBU A;  5TBM A;  2PD7 A;  3A0S A;  1UGU A;  2D01 A;  3E4P A;  4HQA A;  3ICY A;  4RQ9 A;  2JHE A;  4XT2 B;  2L1M A;  4L9G A;  4YWZ A;  2QJ7 A;  1JNU A;  4I3A A;  1OTA A;  3LI9 A;  1LT0 A;  3EEH A;  4EXO A;  1TS6 A;  5J7E A;  3LID A;  4M4X A;  1BYW A;  4K08 A;  1D7E A;  3LI8 A;  3MJQ A;  5DKL A;  5AVF A;  4JGR A;  1S1Z A;  4HP4 A;  4EES A;  4BBT A;  4HP9 A;  4NXE A;  1GSW A;  2J80 A;  3NJA A;  1NWZ A;  4E04 A;  5HDS A;  3F1N B;  4HNB A;  2A24 A;  3LYX A;  4HJ4 A;  2VV6 A;  5HWW A;  5J4E A;  4I5S A;  2OWJ A;  3GEC A;  3LIB A;  3IS2 B;  1T1C A;  4I38 A;  2PR5 A;  2CMN A;  5HWV A;  1ODV A;  1OTI A;  5HD3 A;  3MXQ A;  3NOP C;  4JGP A;  3VOL A;  4MN6 A;  3A0V A;  4GS9 A;  3HJK A;  5I5L A;  2WKR A;  3SW1 A;  4L9F A;  5F68 A;  3UME A;  3B33 A;  5F5Y A;  4HOI A;  3H82 B;  1EW0 A;  3BY8 A;  3HJI A;  2D02 A;  1XFN A;  1F9I A;  1DP6 A;  4F3L B;  3H7W A;  2P7J A;  3FC7 A;  5F6A A;  4EET B;  1TS7 A;  5DJU A;  1Y28 A;  3UE6 A;  3T50 A;  2VV8 A;  3UB7 A;  4GHI B;  3UB9 A;  1DRM A;  1KOU A;  4WN5 A;  1OT6 A;  3NOT C;  2W27 A;  2K7S A;  4HY8 A;  5TBM B;  3EWK A;  3G6O A;  3C8C A;  5J3W A;  2M1C A;  2V9A A;  1OTB A;  2JN7 A;  2OOL A;  4H6J A;  2YKF A;  3P7N A;  3UB8 A;  2V0U A;  2VEA A;  3LIF A;  2PD8 A;  4NXG A;  2L0W A;  4LLO B;  5G4Z A;  3FG8 A;  3F1N A;  1OT9 A;  2ZOI A;  2KX6 A;  5HD5 A;  3F1O A;  1T18 A;  4HJ3 A;  1X0O A;  3MQQ A;  2INW A;  4PKY A;  4WLA A;  2ZOH A;  5HWT A;  4HIA A;  2KDK A;  1XJ6 A;  1N9O A;  3MFX A;  3IS2 A;  4WF0 A;  1T1A A;  5G4Y A;  2R78 A;  5EFW A;  3GDI A;  3BY9 A;  3F1P B;  4I39 A;  1LSW A;  4I3I A;  2B02 A;  3C2W A;  4R3A A;  4R6L A;  2A24 B;  3CLO A;  5HSQ A;  1UWN X;  4HH2 A;  2PYR A;  1DP9 A;  1XJ3 A;  3NHQ A;  5F69 A;  5DKK A;  4NXF A;  3LUQ A;  4HHD A;  1LSV A;  4PKY G;  3LIE A;  2HV1 A;  2H28 A;  4HH3 A;  2V1B A;  3PHY A;  4GS9 B;  3RTY A;  5IU1 A;  4KUK A;  1TS8 A;  3OLO A;  1LL8 A;  2EA9 A;  4BBV A;  2Z6C A;  4I3J A;  4XT2 A;  3K3D A;  2V0W A;  2QJ5 A;  4WUJ A;  4KUO A;  4EEU A;  4LRZ E;  4LRX C;  3VE4 A;  5AVE A;  2PDR A;  3E4O A;  4JGQ A;  3UMD A;  4DJ3 A;  2WKP A;  2L4R A;  2WKQ A;  2PYP A;  1S4S A;  5DJT A;  3H7W B;  4DJ2 A;  1F98 A;  4HJ6 A;  1P0Z A;  3PYP A;  4EW7 A;  1T1B A;  4GW9 A;  3NOU C;  1TS0 A;  3H9W A;  5IS1 A;  5A8B A;  1MZU A;  3BWL A;  3K3C A;  1N9N A;  4JGO A;  4B9O A;  2VV7 A;  1XJ2 A;  2GJ3 A;  1T19 A;  4LPZ A;  2Z6D A;  4L9E A;  4R70 A;  3A0R A;  3ZQ5 A;  4H6J B;  1LSX A;  5KIZ A;  3KX0 X;  3ULF A;  4NXB A;  1WA9 A;  1S66 L;  3F1P A;  2PHY A;  2V1A A;  1P97 A;  2W0N A;  1S4R A;  4EQ1 A;  4KQD A;  3F1O B;  1G28 A;  2VLG A;  4GCZ A;  4EEP A;  1GSV A;  1DP8 A;  1UWP X;  2BAS A;  2OWH A;  1VB6 A;  1OTE A;  3MR0 A;  3IBR A;  1S67 L;  1S1Y A;  1XJ4 A;  3LIC A;  3H82 A;  3VE3 A;  1D06 A;  1OTD A;  4WL9 A;  3RH8 B;  1OJG A;  3D72 A;  3UB6 A;  4F3L A;  3LIA A;  4R38 A;  4LRY C;  3MQO A;  1V9Y A;  4MN5 A;  1V9Z A;  2I9V A;  2YKH A;  2QWS A;  4HI4 A;  5HZH A;  5HDC A; 
#chains in the Genus database with same CATH topology
 3FPW A;  3QP4 A;  1XX2 A;  1XFQ A;  1GSX A;  4JXW A;  1LI0 A;  5E43 A;  1IEM A;  3CHW P;  4X55 A;  4FOF A;  1G6O A;  1SKF A;  4RX3 A;  5FAS A;  2ZBB A;  4WEK A;  5FI6 A;  2AVX A;  5HPI A;  4CQH A;  3OPL A;  4LV1 A;  2X71 A;  3CAX A;  1YLT A;  4EER A;  2W1R A;  1FSW A;  2WAF A;  2Q0O A;  4ETZ A;  1HTZ A;  2VK3 A;  1LHY A;  2Y2H A;  3E4P A;  3ICY A;  4RQ9 A;  4EUZ A;  3P09 A;  1TVF A;  2Z2M B;  3T4Q A;  1NXY A;  4X1M A;  3LO7 A;  1NZU A;  3WS4 A;  3MSH A;  2J3T C;  3QP8 A;  2IWC A;  3C38 A;  1I2W A;  1BZA A;  4Y17 A;  1K38 A;  4JXG A;  2NUP C;  4Y2F A;  1XP4 A;  3LI9 A;  1KVL A;  1BLH A;  4PM9 A;  2ZQA A;  3BW6 A;  4M4X A;  1BYW A;  5DVA A;  2WGW A;  1ZG4 A;  3B3X A;  3V39 A;  2HP5 A;  3C7U A;  1YAX A;  3PXP A;  4KQQ A;  4NXE A;  3KSG A;  4IVI A;  1PWD A;  4JXS A;  1GSW A;  1KE0 A;  1MY8 A;  3R7W A;  5HAQ A;  3E98 A;  5HDS A;  4HNB A;  5FA7 A;  2XRO A;  2X01 A;  3CPT B;  4I5S A;  2P9V B;  3B42 A;  3MMH A;  1T1C A;  2PR5 A;  4E3L A;  5FQJ A;  1OTI A;  3NIA A;  3NOP C;  2ZQC A;  1YLZ A;  2VJW A;  4G3V A;  3BFF A;  1NYM A;  5C5K A;  3TJZ C;  3JVU A;  3S7O A;  1W8Y A;  3HLC A;  4S2P A;  3BY8 A;  3QHY A;  5M18 A;  2E8I A;  5E2H A;  4N92 A;  1DP6 A;  3GTC A;  3T1S A;  5CHJ A;  4PPR A;  4WZ5 C;  2W3H A;  2O9A A;  3PBT A;  2H5S A;  3MZF A;  3H7W A;  5DTS A;  5F6A A;  3Q7V B;  4FD8 A;  4DDS A;  1ALQ A;  1ZG6 A;  1Y28 A;  3V50 A;  3T50 A;  3UB7 A;  4GHI B;  3UB9 A;  3HUM A;  4WN5 A;  1IYP A;  1NLY A;  4RYE A;  2W27 A;  4HY8 A;  5EM1 A;  4HEF A;  2V9A A;  1NY0 A;  3MS6 A;  1IYO A;  2JN7 A;  4ARZ A;  3KSI A;  4GNU A;  4Z9Q A;  5EVL A;  4S2I A;  1S6R A;  5A93 A;  2EWW A;  5DF9 A;  3P7N A;  4FH4 A;  1E3U D;  5KZH A;  3LIF A;  5EOO A;  1F5M A;  3OZH A;  3PBN A;  2OLU A;  2L0W A;  4LLO B;  4Y0T A;  4S2M A;  2ZL1 B;  3IH8 A;  2XDM A;  4OLG A;  3ZGA B;  1KE4 A;  3G31 A;  1XA1 A;  2O99 A;  5L07 A;  4GDB A;  4E3M A;  1X0O A;  3MQ0 A;  5CED A;  2INW A;  4P87 A;  1GA0 A;  3IF6 C;  2HZ5 A;  3NUL A;  1SZV A;  4R1G A;  2J8Y A;  3OPP A;  4EV4 A;  3UDF A;  4O8G A;  5EVI A;  3T1X A;  5J8X A;  2OSU A;  3BY9 A;  3F1P B;  4I39 A;  1LSW A;  4GZB A;  1IFQ A;  2W3G A;  2BLS A;  2PU2 A;  1PW1 A;  3GR2 A;  4HH2 A;  2PYR A;  1ESI A;  4ZTK A;  5FL3 A;  1K4E A;  3BFG A;  3NHQ A;  5F69 A;  2W1T B;  4NXF A;  1Y4O A;  3LUQ A;  4ETX A;  1K25 A;  4BLM A;  3QNB A;  5FAT A;  4HHD A;  3GRJ A;  4MEZ A;  1FIL A;  3S1Y A;  3IHB A;  3LIE A;  3PTE A;  3HVF A;  3G2Y A;  3PHY A;  3E2K A;  3KYQ A;  2WKE A;  4KQR A;  4KUK A;  3OLO A;  4JKT A;  2FFF B;  3MZE A;  2ZQ9 A;  3LY4 A;  1W79 A;  3IF5 A;  2VGL S;  5AQB A;  3UPP A;  3WWX A;  3VV4 A;  1YT4 A;  4EEU A;  2Q9M A;  4KZ6 A;  1RGY A;  4LRZ E;  5HFO A;  4KZA A;  2XA7 S;  3E2L A;  1YPR A;  4BWI A;  4S2O A;  3LEQ A;  4LEN A;  3WS0 A;  4EU0 A;  2PYP A;  3V3S A;  1S4S A;  2LB5 A;  5HL6 A;  1WYB A;  4DJ2 A;  4HJ6 A;  1P0Z A;  4Y5F A;  3W4O A;  1PYY A;  4N1X A;  3GQZ A;  3UPO A;  1TS0 A;  3TOI A;  3H9W A;  5IS1 A;  3M6H A;  1MZU A;  1XJ2 A;  1T19 A;  5GLA A;  3MZD A;  2Z6D A;  4CLC C;  3A0R A;  4S2L A;  2JKF A;  1W63 Q;  2ZC3 B;  4H6J B;  1I5Q A;  4U0X A;  3CPT A;  3KX0 X;  4ZJ3 A;  1ES2 A;  3ULF A;  2P9V A;  4E3N A;  3LY3 A;  5KSH A;  4NK3 A;  1K4F A;  2FH5 A;  4FCF A;  1S4R A;  3KSH A;  4KQD A;  4KEN B;  1ES5 A;  1SCW A;  2VKS A;  3F1O B;  3KYE A;  1MKM A;  2HP6 A;  5CGW A;  1GSV A;  3OC2 A;  4LV0 A;  4O7D A;  3W2Z A;  4EBL A;  3MR0 A;  3ZG7 B;  1HZO A;  1XJ4 A;  2X02 A;  1H8Y A;  1G5U A;  4WM9 A;  1KVM A;  1Q2P A;  3VP0 A;  5AQ9 A;  3UB6 A;  4WEJ A;  2WGI A;  1CEF A;  3T12 B;  4CLC E;  4XXR A;  3LGO A;  4D2O A;  4R38 A;  5HAP A;  1ERO A;  4GB7 A;  2HPB A;  1TDL A;  4R4R A;  1ESU A;  3T1Q B;  2YKH A;  4HI4 A;  1PI4 A;  5HDC A;  5FEG A;  1OJ5 A;  3Q7V A;  4GLQ A;  2P04 A;  4GHI A;  2ZM0 A;  2HJ9 C;  2QHK A;  5HDD A;  3NDG A;  4YIN A;  3N8R A;  3ISG A;  4Y0U A;  3AGE A;  4BL3 A;  4QJG A;  2PD7 A;  1ZC2 A;  1UGU A;  4OH0 A;  3CUE C;  1VET B;  1K54 C;  4E3J A;  1JWV A;  5EM0 A;  4HQA A;  3OCL A;  2XSS A;  2JKG A;  4MLL A;  3Q07 A;  3UE3 A;  2FZ0 A;  3EGD C;  2UWX A;  4WMC A;  1Q2Q A;  2EWV A;  3PR6 A;  3G4P A;  3BFD A;  4BD1 A;  1FCN A;  4GKU A;  4P0M A;  4I3A A;  1OTA A;  1LT0 A;  2ZL1 A;  1YSP A;  3A3I A;  1TS6 A;  5CHM A;  4MBF A;  4OPR A;  2JKT M;  3LID A;  3LR4 A;  3CIT A;  3G35 A;  3O86 A;  1TDG A;  3ZVW A;  1ZTU A;  5AJG A;  4K08 A;  2XQZ A;  5EOE A;  1ZKJ A;  1ERM A;  4Y7P A;  2V20 A;  1CI8 A;  4KG5 A;  4EES A;  3EEA A;  3FKW A;  2A49 A;  2J80 A;  2KOI A;  1LL5 A;  3NJA A;  1NWZ A;  3ZHH A;  3B47 A;  2HDS A;  4IUH A;  3TW8 A;  5GLC A;  3N4I A;  3LYX A;  2ZMF A;  4K0X A;  4HJ4 A;  2VV6 A;  5HWW A;  1KGG A;  1GA9 A;  2W1T A;  4II7 A;  3LIB A;  4EQI A;  2WAD A;  4I38 A;  2DCF A;  2HF6 A;  4FSF A;  1W7F A;  4JBF A;  3V67 A;  3MXQ A;  2C6W B;  1MWU A;  1WYC A;  2WGV A;  1TEM A;  4JGP A;  5U47 A;  4OKP A;  4MN6 A;  1E4D A;  3T4J A;  4QWO A;  5CRF A;  1XGJ A;  3CI6 A;  3HJK A;  2EX2 A;  2PT7 A;  5KSC A;  5L09 A;  2EXA A;  1GHP A;  5F68 A;  3EOI A;  3UME A;  2Y2M A;  1N9B A;  5EV0 A;  3H82 B;  5MC7 A;  5FQQ A;  2IWD A;  3Q7Z A;  2UV0 E;  4FTX A;  1XFN A;  4QY6 A;  1F9I A;  2ZC4 B;  1YMS A;  4MBK A;  1GHM A;  3UO9 A;  3PBQ A;  5FDH A;  1BLS A;  1LLB A;  5EVI D;  4GDN A;  5DF7 A;  2EFU A;  3BM6 A;  4EET B;  2JCH A;  5DJU A;  2IWB A;  1FIK A;  1DRM A;  5E2F A;  4NET A;  2XK1 A;  2DNS A;  5FQK A;  1L0G A;  3VOZ A;  4ZRR A;  5F83 A;  2J3W A;  1BT5 A;  3BFE A;  3EWK A;  2Y8H A;  5J3W A;  3DWK A;  3UDI A;  3HLF A;  2CC1 A;  1L0D A;  2MJ6 A;  4GN2 A;  4Y13 A;  1OTB A;  2JE5 A;  2V1Z A;  1AXB A;  4H6J A;  3HLG A;  1YSQ A;  3HLW A;  1TF1 A;  4DE1 A;  2YKF A;  4ZJ2 A;  4N9L A;  1DJB A;  3DTI A;  5JYP A;  2V0U A;  4KZ4 A;  2PD8 A;  1QME A;  3BFC A;  2XR0 A;  2FFY A;  2BTF P;  4IBX A;  3F1N A;  4H8R A;  2ZOI A;  2Y55 A;  3F1O A;  3ZVT A;  1OPX A;  2PBY A;  3S4X A;  3MQQ A;  1JVJ A;  3CG5 A;  4Y15 A;  3SS5 A;  1NRJ A;  4CJN A;  2ZOH A;  1XJ6 A;  1N9O A;  1K57 C;  1KDS A;  1HLU P;  3NEC A;  4P6B A;  3NDE A;  3EQV A;  2H10 A;  1M6K A;  4OLD A;  5BOH A;  1YM1 A;  4R6L A;  2A24 B;  4S2N C;  5FAO A;  1IOU A;  1N4O A;  3AGD A;  2G2U A;  1XJ3 A;  4XUX A;  2XFS A;  1IYQ A;  1ERQ A;  4NG2 A;  3C4P A;  5EVE A;  1BUE A;  4K91 A;  3A3E A;  2H28 A;  3S7Q A;  4M3K A;  2ZQ7 A;  2OV5 A;  4GS9 B;  4OQH A;  4C3Q A;  1TS8 A;  1VET A;  3DTK A;  3L9K A;  1VEU A;  3ZG8 B;  4IBR A;  2Z6C A;  1H0M A;  3K3D A;  3VSK A;  4P6Z M;  2EXB A;  4WUJ A;  3ZNT A;  2VZW A;  1I2S A;  1BLC A;  4QU3 A;  3N8L A;  5AVE A;  2PDR A;  3S7P A;  2WZX A;  3P01 A;  2WKP A;  4O0P A;  4IJG A;  3Q82 A;  3WS1 A;  1G6A A;  3MKF A;  1F98 A;  3EQU A;  4JF6 A;  4DN0 A;  4EW7 A;  1T1B A;  1KDW A;  2GX5 A;  5A8B A;  4YOF A;  2HDQ A;  1DY6 A;  2DMW A;  1N9N A;  3K3C A;  3TRC A;  2VV7 A;  3JPU A;  1CK3 A;  4PM8 A;  4QD4 A;  3ZNY A;  1SHV A;  4R70 A;  3ZQ5 A;  5CTN A;  1WE4 A;  1PRQ A;  3VOY A;  5KIZ A;  4NEE D;  1VQQ A;  4NXB A;  3T4O A;  4PM5 A;  2O9C A;  1W63 M;  1FCO A;  2PBD P;  3IF6 B;  1A0K A;  2PHY A;  3HRE A;  1GHI A;  3G2Z A;  1P97 A;  5TJJ A;  5DF8 A;  5HX9 A;  2VA0 A;  3V5M A;  3FKV A;  2VGK A;  2K31 A;  1UWP X;  5F1G A;  1VB6 A;  2W3E A;  2DRW A;  5AQA A;  1OTE A;  3IBR A;  3ZG9 B;  5EPH A;  3H82 A;  2Y2G A;  5TGF A;  4EWF A;  1D06 A;  1P9R A;  3BJN A;  1KGF A;  3P98 A;  3D72 A;  5HW3 A;  1YMX A;  1K55 C;  3PAE A;  3SH9 A;  3PBS A;  3MQO A;  1PWC A;  5FI7 A;  2Y2Q A;  4LV2 A;  5F1F A;  1V9Y A;  1KGE A;  4MN5 A;  3EGX C;  3IQA A;  2QWS A;  4LV3 A;  3U2A A;  3DTM A;  5DTK A;  3RJU A;  4MNR A;  3VFF A;  1YLP A;  3CWF A;  4E3O A;  3L7H A;  5GLD A;  2O0Y A;  4BBU A;  3PBO A;  4QY5 A;  3BQ8 A;  3A0S A;  3IT9 A;  1F2K A;  2D01 A;  4OQI A;  3UY6 A;  3HLD A;  1YLW A;  4UEY A;  2JHE A;  4DDY A;  3UB5 P;  2L1M A;  4L9G A;  1JWZ A;  4PAU A;  2QJ7 A;  4ZDX A;  2JBF A;  4EUV A;  3N8S A;  2M7U A;  2ZD8 A;  3EEH A;  1W5D A;  2HP9 A;  1O07 A;  4GJ4 A;  2JKT I;  4GD6 A;  3QP5 A;  3LI8 A;  4IED A;  4DE3 A;  5DKL A;  1NRF A;  1S1Z A;  3N7W A;  3RFB A;  4ID4 A;  2RCX A;  4CLC B;  3QP6 A;  5FSR A;  3D3O A;  4DXC A;  1ES3 A;  3OCN A;  2Y79 A;  3T4T A;  3F1N B;  4OVD A;  4B4X A;  4JF5 A;  2A24 A;  3OPH A;  3HUO A;  4L0L A;  2R9W A;  5I94 A;  1EI5 A;  2ZMV A;  1TD5 A;  5J4E A;  5DTT A;  3IBJ A;  2OWJ A;  4ZAM A;  5M19 A;  2H0Y A;  2QMI A;  2PAV P;  3G34 A;  1SDE A;  3VFH A;  3CMZ A;  2V2F F;  3TG9 A;  2CMN A;  1RCJ A;  2O9B A;  4LCM A;  5HWV A;  5HD3 A;  3LFV A;  2WZZ A;  1VHM A;  3QNC A;  1MWT A;  4GS9 A;  4X68 A;  5E2E A;  5HPF A;  1XGI A;  5I5L A;  1MBL A;  2WKR A;  3VP3 A;  3C7V A;  3IX3 A;  3HL9 A;  4R0Q A;  3M2J A;  3B33 A;  4DF6 A;  4HOI A;  1EW0 A;  4KG6 A;  3VP2 A;  2GZA A;  2ZLY A;  3HJI A;  4WZ5 A;  2D02 A;  4R4S A;  2Y2N A;  4ZBE A;  3W4P A;  5HAI A;  1LI9 A;  2W3F A;  1E3U A;  3CZD A;  1PZP A;  4OP5 A;  4OPQ A;  3O88 A;  4Q0I A;  3OPR A;  5JYO A;  2WUQ A;  3C30 A;  2P7J A;  3W4Q A;  3FC7 A;  3SZT A;  4EBP A;  1VEU B;  5CER A;  3IXG A;  3A3J A;  5GL9 A;  2WYX A;  4PM7 A;  2VV8 A;  3Q81 A;  4A5R A;  3BLM A;  1OT6 A;  1BSG A;  3IXB A;  3NBL A;  5CTM A;  5FAP A;  1YLJ A;  4UA9 A;  4JF4 A;  2K7S A;  4R3B A;  2G7U A;  3IWI A;  5TBM B;  3BYD A;  3DWZ A;  3C8C A;  3T4S A;  4YFM A;  3NI9 A;  2M1C A;  4B88 A;  2J9O A;  2QZ6 A;  1M40 A;  4RVA A;  2XEP A;  3GSG A;  1J9M A;  3GVB A;  1FR6 A;  2VEA A;  4NXG A;  2XGN A;  4O01 A;  4WEL A;  5AQ7 A;  5G4Z A;  3FG8 A;  3IF6 A;  3IWO A;  3KO6 A;  1JWP A;  3HBR A;  2Y2K A;  1OT9 A;  5A90 A;  1MPL A;  1S0W A;  3C4O A;  1G68 A;  1DJC A;  4HES A;  3PBR A;  3W8K A;  1T18 A;  4HJ3 A;  3IWQ A;  5EEC A;  5GHX A;  4QB8 A;  2P08 A;  3QP2 A;  4WLA A;  4LGW A;  3DAV A;  5HWT A;  1L3L A;  3BEB A;  1PWG A;  2M7V A;  1P9W A;  3MFX A;  3IS2 A;  1NLZ A;  2HJE A;  3O5Y A;  3G30 A;  1BUL A;  2R78 A;  1PI5 A;  3GDI A;  3AGF A;  3FV7 A;  4I3I A;  4P85 A;  3ZG0 A;  2B02 A;  2VGJ A;  5G18 A;  3C2W A;  4OPZ A;  1FR1 A;  3CLO A;  5EVI C;  5DFX A;  1UWN X;  2WKI A;  4EBN A;  2A3U A;  1DP9 A;  3ITA A;  1MKI A;  2A2L A;  2HGV A;  2B18 A;  5DKK A;  4E6W A;  4WZ4 A;  3MKE A;  3NC8 A;  3UNW A;  4PKY G;  3M6B A;  1L0F A;  1PNE A;  2HV1 A;  4HH3 A;  3IHA A;  4U3T A;  2HDU A;  4GD8 A;  4UA6 A;  1GCE A;  3KSF A;  3ZCZ A;  1ACF A;  3UE0 A;  3RTY A;  5KMW A;  4X6T A;  3SH8 A;  4X69 A;  5K5B A;  4BBV A;  4I3J A;  2OAP 1;  1MC0 A;  2V0W A;  2QJ5 A;  3VP4 A;  3HCY A;  4KQO A;  3UPN A;  4OOL A;  4BEN A;  3VE4 A;  4C75 A;  2VGL M;  4OOM A;  3C5A A;  3MBZ A;  1FQG A;  3UMD A;  3T1R A;  2L4R A;  4PHT A;  1XKZ A;  3WRZ A;  4IHQ A;  3ZFZ A;  3CJM A;  2XA7 M;  3E0Y A;  3OBF A;  1CEG A;  1NZO A;  3IXH A;  3BLS A;  3QP1 A;  4MBH A;  4OOY A;  5DFY A;  3UDX A;  3NOU C;  3NCK A;  5M1A A;  3V3R A;  5CX7 A;  1XXM A;  4CLC A;  4KZ5 A;  4HBU A;  3HLB A;  1AWI A;  2JKR M;  4BQM A;  1CJF A;  4JGO A;  1FSY A;  4B9O A;  2XH9 A;  2GJ3 A;  4KZ8 A;  4D60 A;  1KE3 A;  4L9E A;  4OON A;  1CF0 A;  5F82 A;  3K2N A;  4BD0 A;  4KZ7 A;  1Z6F A;  4KZ3 A;  1SKO B;  1JTD A;  1LSX A;  2ZM8 A;  5HL1 A;  1PZO A;  5CEC A;  1STZ A;  2G2W A;  4S2J A;  1WA9 A;  3UE1 A;  1H8M A;  4MCW A;  2J3T D;  3UN7 A;  4N9K A;  4QHC A;  4BL2 A;  5CGS A;  1K56 A;  2W0N A;  4EQ1 A;  5CHU A;  1ZHH B;  4ME4 A;  1DP8 A;  4Q0J A;  3S22 A;  3A3F A;  2OWH A;  1C3B A;  4B4Z A;  4WYY A;  2P74 A;  4OQG A;  2V8C A;  1OTD A;  4WL9 A;  2ZC5 B;  1OJG A;  5FQ9 A;  1PIO A;  3LIA A;  4HBT A;  4X53 A;  4LCL A;  3MF0 A;  2XD1 A;  2Z2L B;  1V9Z A;  2I9V A;  3M2K A;  1N9L A;  2XLN A;  4S2K A;  2PR6 A;  4UHU A;  4BJP A;  1MWR A;  2H0T A;  3CUE A;  1K54 A;  1VM1 A;  3E4Q A;  4GOG A;  2QKP A;  5TBM A;  3LR3 A;  4RX2 A;  4K0W A;  3ITB A;  1ONH A;  3Q1F A;  2JC7 A;  4X56 A;  1YQS A;  4XT2 B;  3VSL A;  2C5W B;  4MN7 A;  2ZQ8 A;  4DRT A;  4YWZ A;  4DE2 A;  2ZMA A;  4UQI S;  3U4L P;  1FOF A;  3FZC A;  1JNU A;  5L8M A;  1IEL A;  3GMW A;  1LL9 A;  3A3D A;  1IKI A;  4Z1W A;  3VMA A;  4EXO A;  5FI2 A;  4DKI A;  5J7E A;  3S7N A;  2PU4 A;  2J9P A;  3OOV A;  4LFU A;  2BG1 A;  1D7E A;  3MJQ A;  2R9X A;  1ONG A;  3DTE A;  4ZJ1 A;  5AVF A;  4MMN A;  4JGR A;  4HP4 A;  4BBT A;  2GNX A;  4HP9 A;  1BLP A;  3O87 A;  2Y2L A;  4OQ0 A;  2EX6 A;  4E04 A;  1NJ4 A;  5D3O A;  2ZC6 B;  4WMC D;  2Y91 A;  3ZDJ A;  4Y3I A;  3GEC A;  5IT5 A;  2QPN A;  1QMF A;  3ZG5 A;  5LBR A;  3IS2 B;  3D4F A;  4KZB A;  1ODV A;  3WS5 A;  1J3W A;  3VOL A;  3IXD A;  3I7J A;  3A0V A;  2I72 A;  1MWS A;  4Q8I A;  2ZC7 A;  1YLY A;  1CI9 A;  2Y2O A;  2VX8 A;  3SW1 A;  4L9F A;  4UAA A;  4WBG A;  2Y2I A;  5F5Y A;  4BMW A;  1PW8 A;  4QPR A;  1JTG A;  3FYZ A;  2PRF A;  4F3L B;  3LEZ A;  5A91 A;  3MXS A;  4E6X A;  1K0K A;  2HDR A;  4JPM A;  4OPY A;  4KG2 A;  2Q9N A;  5L10 A;  3LCE A;  3MXR A;  1H3Q A;  1MXO A;  3DW0 A;  4KZ9 A;  4B93 A;  1TS7 A;  1Z09 A;  3UE6 A;  3R4K A;  2XD5 A;  4R3J A;  1KOU A;  3NOT C;  1PFL A;  3ZYT A;  2K2N A;  3RXW A;  3G6O A;  4OP8 A;  4G3K A;  1H5X A;  2OOL A;  1SKO A;  2ACG A;  4IUK A;  5IHV A;  4G3W A;  5FQI A;  3UB8 A;  1L0E A;  5L2F A;  5A92 A;  1E25 A;  4JLF A;  1OME A;  4N1H A;  2EFX A;  5TR7 A;  2QYB A;  4IVK A;  3SS4 A;  2B95 A;  4X25 A;  1K57 A;  2KX6 A;  5HD5 A;  3KYZ A;  2WGW B;  4PKY A;  1XPB A;  3HUN A;  1HD8 A;  1HVB A;  1EWZ A;  4HIA A;  2KDK A;  2WK0 A;  5CXW A;  4CPK A;  4F94 A;  4WF0 A;  3SS3 A;  2Y2J A;  1T1A A;  4S2N A;  1Y54 A;  5G4Y A;  3R7W B;  4C6Y A;  5EFW A;  2WAE A;  4R3A A;  5CGX A;  1IYS A;  2Y4A A;  5HSQ A;  4CLC D;  5FAQ A;  2EX8 A;  1CQA A;  3HLE A;  2ZQD A;  1L2S A;  2WKH A;  2J7V A;  3G32 A;  5FDS A;  1BTL A;  4XUZ A;  2E8J A;  2ZJ9 A;  1D1J A;  2KLI A;  4DMZ A;  3LR0 A;  5FQM A;  1LSV A;  2XRN A;  5EUA A;  1H8Z A;  3WS2 A;  2V1B A;  4P6Z S;  4DE0 A;  1ES4 A;  5IU1 A;  3NY4 A;  3IX4 A;  3DBA A;  4R23 A;  5E2G A;  1LL8 A;  2EA9 A;  3IH9 A;  4XT2 A;  5EE8 A;  4NKP A;  4PM6 A;  3BEC A;  3T4K A;  1K56 D;  4KUO A;  5TFQ A;  4LRX C;  3BRM A;  3O3V A;  1RP5 A;  1DJA A;  3TE8 A;  3TSG A;  3E4O A;  4JGQ A;  2ZM2 A;  4DJ3 A;  2WKQ A;  4JXV A;  5DJT A;  3H7W B;  3PAG A;  2XF3 A;  1K6S A;  3IX8 A;  3PYP A;  3VP1 A;  4Q0H A;  4AFI A;  4DXB A;  4GW9 A;  3FWL A;  3GV9 A;  1RGZ A;  3BWL A;  4E3K A;  2JKR I;  2IA2 A;  4FH2 A;  4UQI M;  1W8Q A;  4LPZ A;  3JYI A;  2NUT C;  4ARZ B;  3D9Y A;  1SDN A;  1IKG A;  4ESP A;  3BQA A;  4PMA A;  1K6R A;  5GLB A;  1S66 L;  1U60 A;  4FUW A;  4E3I A;  3SH7 A;  4YNR A;  4U0T A;  2Y2P A;  3LR5 A;  2XFT A;  2Y59 A;  3F1P A;  2B5R A;  5GHY A;  4MDZ A;  2OLV A;  2V1A A;  2LB9 A;  2W3D A;  4UA7 A;  1G28 A;  2GDN A;  2VLG A;  1O7E A;  4GCZ A;  4EEP A;  2BAS A;  5GHZ A;  2RL3 A;  1NYY A;  1K55 A;  5HAR A;  1FCM A;  1S67 L;  1S1Y A;  3T4L A;  3LIC A;  3N6I A;  3JVV A;  4RA7 A;  3VE3 A;  5FEF A;  5EVI B;  3RH8 B;  2V8F A;  2OAQ 1;  1YKD A;  4F3L A;  4X1L A;  3WRT A;  3RXX A;  4LRY C;  4Y0O A;  2EX9 A;  3FPV A;  3SOI A;  3MFD A;  5CEB A;  5HZH A;  1XA7 A; 
#chains in the Genus database with same CATH homology
 3FPW A;  1OJ5 A;  1GSX A;  1N9L A;  1XFQ A;  4GLQ A;  3U2A A;  2P04 A;  2PR6 A;  4FOF A;  1G6O A;  4GHI A;  4BJP A;  2HJ9 C;  2QHK A;  5HDD A;  3CUE A;  2ZBB A;  4WEK A;  3CWF A;  5HPI A;  4CQH A;  3E4Q A;  3CAX A;  4EER A;  2QKP A;  2W1R A;  2O0Y A;  4BBU A;  3PBO A;  5TBM A;  4ETZ A;  3LR3 A;  2PD7 A;  3BQ8 A;  3A0S A;  1UGU A;  2D01 A;  3CUE C;  3E4P A;  4UEY A;  4HQA A;  3ICY A;  3OCL A;  2XSS A;  4RQ9 A;  2JHE A;  4XT2 B;  3UE3 A;  2FZ0 A;  3EGD C;  3T4Q A;  4MN7 A;  2L1M A;  4L9G A;  4PAU A;  4YWZ A;  2QJ7 A;  2EWV A;  3PR6 A;  4UQI S;  2J3T C;  4EUV A;  1JNU A;  3C38 A;  5L8M A;  4I3A A;  2M7U A;  1OTA A;  2NUP C;  4Y2F A;  3LI9 A;  1LT0 A;  4Z1W A;  1YSP A;  3EEH A;  4EXO A;  1TS6 A;  4GJ4 A;  2JKT M;  5J7E A;  2JKT I;  3LID A;  3BW6 A;  3S7N A;  3LR4 A;  3CIT A;  4M4X A;  1ZTU A;  5AJG A;  3OOV A;  1BYW A;  4K08 A;  1D7E A;  3LI8 A;  3MJQ A;  5DKL A;  5AVF A;  4MMN A;  4JGR A;  1S1Z A;  4HP4 A;  4EES A;  4BBT A;  2GNX A;  3EEA A;  4HP9 A;  1YAX A;  3RFB A;  3PXP A;  4CLC B;  4NXE A;  3KSG A;  1GSW A;  3D3O A;  2J80 A;  2KOI A;  3NJA A;  3OCN A;  2Y79 A;  3R7W A;  1NWZ A;  4E04 A;  3T4T A;  3E98 A;  3B47 A;  5HDS A;  3F1N B;  4IUH A;  3TW8 A;  4HNB A;  2A24 A;  2XRO A;  4Y3I A;  4L0L A;  3LYX A;  2ZMF A;  2ZMV A;  4HJ4 A;  1TD5 A;  2VV6 A;  5HWW A;  5J4E A;  4I5S A;  3IBJ A;  2OWJ A;  3GEC A;  5IT5 A;  3B42 A;  2W1T A;  4II7 A;  3LIB A;  3MMH A;  5LBR A;  3IS2 B;  1T1C A;  4I38 A;  2HF6 A;  2PR5 A;  2CMN A;  2O9B A;  4FSF A;  5HWV A;  1ODV A;  1OTI A;  5HD3 A;  3LFV A;  3MXQ A;  3NOP C;  3V67 A;  2VJW A;  4G3V A;  4JGP A;  3VOL A;  4MN6 A;  1VHM A;  3A0V A;  3T4J A;  5C5K A;  4GS9 A;  3TJZ C;  5HPF A;  3CI6 A;  3HJK A;  5I5L A;  2PT7 A;  3JVU A;  2WKR A;  2VX8 A;  3SW1 A;  4L9F A;  3S7O A;  5F68 A;  3EOI A;  3UME A;  3B33 A;  5F5Y A;  4BMW A;  4HOI A;  4QPR A;  3H82 B;  5MC7 A;  1EW0 A;  3BY8 A;  2GZA A;  3HJI A;  2D02 A;  1XFN A;  1F9I A;  1DP6 A;  4F3L B;  2W3F A;  4Q0I A;  2W3H A;  3PBQ A;  2O9A A;  3PBT A;  1H3Q A;  3C30 A;  3H7W A;  2P7J A;  3FC7 A;  5F6A A;  4B93 A;  4EET B;  1TS7 A;  5DJU A;  1Y28 A;  3UE6 A;  3T50 A;  2VV8 A;  3R4K A;  4GHI B;  3UB7 A;  3UB9 A;  1DRM A;  1KOU A;  4WN5 A;  1OT6 A;  3NOT C;  4ZRR A;  1NLY A;  2W27 A;  3ZYT A;  2J3W A;  2K7S A;  2G7U A;  4HY8 A;  2K2N A;  5TBM B;  3EWK A;  3G6O A;  2Y8H A;  3C8C A;  3T4S A;  5J3W A;  2M1C A;  4G3K A;  2V9A A;  2MJ6 A;  1OTB A;  2JN7 A;  4ARZ A;  2OOL A;  4H6J A;  1YSQ A;  3KSI A;  1TF1 A;  2YKF A;  4IUK A;  4G3W A;  2EWW A;  5DF9 A;  3P7N A;  2V0U A;  2VEA A;  3LIF A;  3UB8 A;  1F5M A;  2PD8 A;  3PBN A;  4NXG A;  4O01 A;  4WEL A;  2L0W A;  4LLO B;  5G4Z A;  3FG8 A;  3F1N A;  2QYB A;  3KO6 A;  1OT9 A;  2ZOI A;  2KX6 A;  5HD5 A;  3KYZ A;  3F1O A;  2O99 A;  3PBR A;  1T18 A;  4HJ3 A;  1OPX A;  1X0O A;  3MQ0 A;  3MQQ A;  2INW A;  4PKY A;  2P08 A;  4WLA A;  1NRJ A;  2ZOH A;  5HWT A;  4HIA A;  2KDK A;  2M7V A;  1P9W A;  1N9O A;  1XJ6 A;  3IS2 A;  3MFX A;  4WF0 A;  1NLZ A;  2HJE A;  3O5Y A;  1T1A A;  4O8G A;  5G4Y A;  2R78 A;  3EQV A;  3R7W B;  5EFW A;  3GDI A;  3BY9 A;  3F1P B;  4I39 A;  1LSW A;  4I3I A;  2B02 A;  1IFQ A;  2W3G A;  3C2W A;  4R3A A;  4R6L A;  2A24 B;  3CLO A;  5HSQ A;  4CLC D;  5DFX A;  1UWN X;  4HH2 A;  1IOU A;  2PYR A;  1DP9 A;  1XJ3 A;  5FL3 A;  2A2L A;  2HGV A;  2B18 A;  3NHQ A;  5F69 A;  2W1T B;  5DKK A;  4NXF A;  3LUQ A;  4ETX A;  2KLI A;  4DMZ A;  3LR0 A;  4HHD A;  1LSV A;  4PKY G;  2XRN A;  3LIE A;  2HV1 A;  2H28 A;  3S7Q A;  4HH3 A;  2V1B A;  3PHY A;  4P6Z S;  3KSF A;  3KYQ A;  4GS9 B;  3RTY A;  5IU1 A;  4KUK A;  1TS8 A;  3OLO A;  3DBA A;  1LL8 A;  2EA9 A;  5K5B A;  4BBV A;  2Z6C A;  4I3J A;  2VGL S;  2OAP 1;  4XT2 A;  3K3D A;  1MC0 A;  2V0W A;  4P6Z M;  4NKP A;  2QJ5 A;  3T4K A;  3HCY A;  4WUJ A;  3VV4 A;  2VZW A;  4KUO A;  4KQO A;  4EEU A;  4LRZ E;  4OOL A;  4LRX C;  3VE4 A;  2XA7 S;  2VGL M;  4OOM A;  5AVE A;  2PDR A;  3TE8 A;  3E4O A;  4JGQ A;  4BWI A;  3S7P A;  3UMD A;  3P01 A;  4DJ3 A;  2WKP A;  2L4R A;  4PHT A;  4O0P A;  4IJG A;  2WKQ A;  4EU0 A;  2PYP A;  1S4S A;  4IHQ A;  5DJT A;  3H7W B;  2LB5 A;  5HL6 A;  2XA7 M;  4DJ2 A;  3E0Y A;  1F98 A;  3EQU A;  1P0Z A;  3OBF A;  4HJ6 A;  4Y5F A;  4DN0 A;  3PYP A;  4Q0H A;  4EW7 A;  5DFY A;  4AFI A;  1T1B A;  4GW9 A;  3NOU C;  2GX5 A;  5CX7 A;  1TS0 A;  4CLC A;  3H9W A;  5IS1 A;  5A8B A;  4YOF A;  1MZU A;  3BWL A;  2JKR M;  2DMW A;  3K3C A;  1N9N A;  2JKR I;  2IA2 A;  4JGO A;  3TRC A;  4B9O A;  2VV7 A;  1XJ2 A;  4UQI M;  2GJ3 A;  1T19 A;  4LPZ A;  2Z6D A;  2NUT C;  4L9E A;  4CLC C;  4R70 A;  3A0R A;  3ZQ5 A;  3K2N A;  1W63 Q;  4ARZ B;  4H6J B;  1LSX A;  3BQA A;  3KX0 X;  5KIZ A;  4NEE D;  3ULF A;  1STZ A;  4NXB A;  1WA9 A;  1S66 L;  3T4O A;  1H8M A;  2O9C A;  4MCW A;  4YNR A;  1W63 M;  2J3T D;  3LR5 A;  5KSH A;  3F1P A;  4MDZ A;  2PHY A;  2V1A A;  2LB9 A;  2W3D A;  1P97 A;  2FH5 A;  5TJJ A;  2W0N A;  1S4R A;  3KSH A;  4KQD A;  1ZHH B;  4EQ1 A;  4ME4 A;  2VKS A;  3F1O B;  1G28 A;  2VLG A;  2VA0 A;  1MKM A;  4GCZ A;  4EEP A;  1GSV A;  1DP8 A;  3OC2 A;  4Q0J A;  2K31 A;  1UWP X;  2BAS A;  2OWH A;  1VB6 A;  2W3E A;  3W2Z A;  1OTE A;  3MR0 A;  3IBR A;  1S67 L;  1S1Y A;  3T4L A;  1XJ4 A;  3LIC A;  3H82 A;  3JVV A;  3VE3 A;  1D06 A;  1OTD A;  1P9R A;  4WL9 A;  3RH8 B;  3BJN A;  1OJG A;  2OAQ 1;  3D72 A;  3UB6 A;  4WEJ A;  1YKD A;  4F3L A;  3LIA A;  4CLC E;  4R38 A;  3MF0 A;  4LRY C;  3PBS A;  3MQO A;  3FPV A;  1V9Y A;  4MN5 A;  1V9Z A;  2I9V A;  2YKH A;  3EGX C;  2QWS A;  4HI4 A;  5HZH A;  5HDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...