4OPZA

Crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying g238s mutation in complex with boron-based inhibitor ec25
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGGRVGYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPVAMATTLRKLLTGELLTAASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TEM-94 ES-beta-lactamase
publication title Negative Epistasis and Evolvability in TEM-1 beta-Lactamase--The Thin Line between an Enzyme's Conformational Freedom and Disorder.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 100
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4opzA00
4P85A 4NETA 1CK3A 1L0FA 4KZ4A 3IQAA 2WZZA 4Y0TA 4M3KA 1Y54A 1CI9A 1K57A 5E2EA 1MPLA 3UE3A 4DE1A 3VP1A 4WMCD 1KDWA 1WE4A 4DRTA 1YLWA 5DVAA 4JF6A 3IT9A 1SDNA 4DKIA 5EVLA 3VOZA 1XA1A 4UHUA 1KGFA 3OCNA 2OSUA 3BRMA 3VFFA 4ZJ2A 1PWGA 1PZOA 5TGFA 3S1YA 3MZFA 4RYEA 3ZCZA 4KQRA 4R23A 2XQZA 4HESA 5GL9A 1YMSA 1XA7A 2A49A 3C7UA 1YLPA 5EVIA 1PZPA 4BQMA 4LCLA 3G31A 3NDGA 3BFDA 4KG2A 4DXBA 1GCEA 5DTKA 4S2MA 3TOIA 5JYOA 5EOOA 1O7EA 1K54A 2X02A 3BLSA 4PM8A 4C75A 1PWCA 3SH8A 3BYDA 4JF5A 5CRFA 1E4DA 1MBLA 4P0MA 3E2LA 5A90A 5CEDA 1H8ZA 4JKTA 3MKFA 5CEBA 4IVIA 4HBUA 3WWXA 3RJUA 1FOFA 3W4PA 3I7JA 3Q82A 2A3UA 5FAPA 3Q7VB 3IXDA 4OOLA 4K91A 1NYYA 3CG5A 3ZG8B 1IKIA 4S2PA 4DE2A 3VP4A 1NRFA 1TVFA 3MXSA 4MLLA 2WUQA 4NK3A 4PM9A 1EI5A 4D2OA 3CJMA 4BL3A 4WELA 1L0EA 2V20A 2ZMAA 3PBTA 4KZBA 3G34A 4KQOA 3VFHA 2Z2LB 3HLWA 3VP2A 3G32A 4KG6A 1C3BA 1JWVA 2J8YA 3EQVA 3UNWA 2DRWA 4RX3A 4O7DA 4LV0A 5GHZA 5KZHA 1RGYA 1W8QA 2XR0A 2XD5A 3NC8A 1VM1A 1PWDA 4GD6A 4PPRA 4LV2A 2QMIA 4LV1A 2E8IA 2FFFB 2JC7A 5E2FA 4BD1A 3AGDA 1H8YA 1S0WA 5EUAA 1ES4A 3PBRA 5FDHA 3SH9A 2OLVA 1RP5A 1K25A 2H10A 4WM9A 1YLZA 2V1ZA 2Y2PA 1K6RA 2WYXA 4OOYA 1QMEA 2ZM2A 4QY5A 5U47A 3C4PA 1KE0A 1ERQA 1E3UA 1KGEA 3N8LA 3NIAA 4E3LA 1BLPA 2VGJA 4WYYA 3Q1FA 1YQSA 3UY6A 1JTGA 3PBNA 2PU4A 4N92A 4X68A 1ESIA 1FQGA 4N1XA 3W4QA 1W79A 4ZDXA 2JCHA 1CEFA 5KMWA 5HAQA 1NZOA 3OPPA 2Y4AA 2HPBA 4S2JA 3QNCA 4B4ZA 4JXWA 1IEMA 1L0GA 2V2FF 1BUEA 1FCMA 1SKFA 5CGWA 5KSHA 3N7WA 2RL3A 1K4FA 4JBFA 1BLSA 3M6BA 4MBKA 3P09A 3O87A 4JF4A 5EECA 5M1AA 1KVMA 3N8RA 4UA6A 4JPMA 4UA9A 3IWQA 2ZQAA 4OQ0A 4KZ9A 4RA7A 5E43A 3UDIA 3HLFA 3UDFA 3ZNYA 5BOHA 4XUZA 2EFXA 2EX8A 1LL9A 3LY4A 3GRJA 1JWPA 1GHIA 2HDQA 1K4EA 3GR2A 3IXHA 3UE1A 4WMCA 1XP4A 3VOYA 4GB7A 1MWTA 1Z6FA 3DWZA 3N8SA 1NY0A 5GLDA 3GV9A 1JTDA 2JE5A 3FKVA 3ZG9B 3FZCA 1NJ4A 1K38A 5F82A 2DNSA 4FD8A 1K57C 3BEBA 2EXAA 3IH9A 4KZ7A 1N4OA 4P6BA 5FQIA 5FQMA 1KDSA 1OMEA 1BSGA 1KVLA 4OQIA 2WKIA 3FWLA 2WKEA 4RVAA 1BLHA 3HLGA 3UN7A 4BLMA 5J8XA 5FQKA 3HREA 4N1HA 4R0QA 3VSLA 4PM5A 2P9VB 1GA9A 3N4IA 3ITBA 1IKGA 3UPOA 1FCNA 2Y91A 3TSGA 3OZHA 1KE4A 4BD0A 2Q9MA 2IWDA 5HAPA 1SHVA 3WS2A 1PW8A 1ZG4A 2H5SA 2R9WA 3B3XA 5EVIC 5L2FA 2QPNA 1SDEA 1VQQA 2C5WB 4E3JA 1O07A 5CXWA 3NY4A 2HP6A 3ZVWA 1GA0A 2Y2KA 4GDNA 5F83A 2Y2JA 3ZG0A 1ZG6A 2ZQCA 4S2OA 5GLCA 1K54C 5CHUA 5FSRA 3WS4A 5F1GA 4OONA 5FAOA 1DJBA 3ITAA 4B88A 1LI0A 2ZQ7A 1S6RA 4R1GA 2WGWB 3ZFZA 1BULA 3MZEA 4OPQA 3N6IA 3OPRA 1L2SA 5A91A 3CZDA 1YT4A 2XLNA 1BLCA 5FASA 4C6YA 1QMFA 1MXOA 3ZG7B 1IYOA 4Y0UA 2XF3A 2ZM8A 3A3EA 1PIOA 5EE8A 4OKPA 2WK0A 1IYPA 1I5QA 4KG5A 4OOMA 5G18A 5IHVA 4WZ4A 5FI2A 1FR6A 1FSYA 3BFFA 1AXBA 5F1FA 4QU3A 4OQHA 4WEJA 4Y7PA 2WAFA 3W4OA 1MKIA 1MWRA 4XUXA 3A3FA 3GVBA 4KZAA 4HEFA 4GKUA 3C5AA 4R3JA 5GHXA 1Q2QA 1U60A 1W7FA 2WGWA 5FI7A 3AGEA 4Y0OA 5DF9A 5KSCA 1MWUA 4OLDA 3V50A 5M18A 1J9MA 1ONGA 3G30A 3RXXA 4B4XA 3NCKA 3G2ZA 2XDMA 3Q7VA 2HP5A 3WS5A 1XGIA 3P98A 4BENA 1ZC2A 5GLAA 1IYQA 1JWZA 2Y2OA 2ZJ9A 4GDBA 4RX2A 5FI6A 2Y2GA 4MEZA 4DXCA 2IWCA 2Y59A 4QHCA 4LCMA 1YLTA 5HW3A 4U0TA 3JYIA 3O86A 3Q7ZA 3BFGA 3CMZA 5GHYA 1K55C 5DTSA 3RXWA 5DF7A 1ESUA 3HLDA 4Z9QA 1RGZA 3IHAA 1K55A 2R9XA 3HUOA 3Q81A 2Q9NA 5CTNA 3BFEA 3ISGA 3UPNA 3HL9A 4X55A 4OP8A 4UAAA 1HVBA 3LY3A 4QB8A 2JBFA 3IXGA 3HLBA 2GDNA 4KENB 5FQ9A 3DWKA 4DF6A 5DTTA 2ZC4B 3IH8A 1ALQA 3LEZA 4DE3A 1FCOA 5HX9A 5EOEA 3ZVTA 2XFTA 2XGNA 5JYPA 4OVDA 4UA7A 4JXSA 1K56D 3MKEA 5TR7A 1KE3A 2ZLYA 3S22A 1N9BA 1I2SA 1ES3A 5CERA 1DJCA 3V3RA 3A3IA 3HLEA 3NI9A 4JXGA 4ZBEA 4FCFA 4C3QA 2UWXA 1I2WA 1DJAA 1W5DA 3DTMA 5TFQA 4X53A 1L0DA 1NXYA 2ZC7A 3IF6B 3BLMA 3UDXA 4GNUA 3MBZA 3IHBA 1E3UD 4N9KA 4FH2A 3WRTA 4U0XA 5CECA 1W8YA 4FSFA 4A5RA 1WYBA 5CHMA 5D3OA 1JVJA 2WGVA 2Y2IA 4ID4A 2EXBA 2PU2A 3GTCA 1YM1A 1XKZA 3HLCA 4PM6A 2WKHA 4IBXA 1YMXA 1EWZA 1BT5A 1ONHA 3TG9A 1M6KA 2G2WA 4IEDA 2WAEA 4GD8A 1PI4A 1TDGA 3G4PA 3M6HA 4LV3A 4X56A 3IF5A 2PBYA 5FATA 4WZ5A 5GLBA 1GHPA 3HBRA 2ZC6B 3QNBA 5A93A 1Q2PA 3FV7A 4JXVA 4ZJ3A 3ZHHA 3SS4A 2ZM0A 5I94A 4JLFA 2J9OA 2ZQDA 4MBFA 5EVIB 3LCEA 3WS1A 2G2UA 3IWIA 3VSKA 4E6XA 2Y2LA 3G35A 2P74A 2HDUA 2ZD8A 2ZC3B 1ES2A 3GSGA 2ZC5B 5CHJA 4E3MA 4F94A 1LHYA 2J7VA 2J9PA 5FA7A 3AGFA 1GHMA 3MZDA 2ZQ9A 3PTEA 4E3NA 4S2NC 2ZQ8A 4LENA 1ERMA 4WBGA 4EWFA 1LLBA 5E2GA 4ZAMA 1IELA 3FKWA 3UPPA 4PM7A 1KGGA 2P9VA 4S2NA 3OC2A 3W8KA 1YLJA 2BLSA 3HUNA 2X01A 4L0LA 3M2JA 4WEKA 3UO9A 3VMAA 3C4OA 1PYYA 4R4SA 3A3JA 3ZGAB 1CEGA 2HDSA 3SS5A 2XK1A 4E3IA 1G6AA 1BZAA 1E25A 3QHYA 1CI8A 3EQUA 4KZ5A 1XGJA 3NDEA 1FSWA 4K0WA 1BTLA 2HDRA 2Y2MA 4HBTA 2WGIA 4KZ6A 1HZOA 3PBSA 1EROA 3WS0A 5HFOA 4S2LA 2DCFA 4Q8IA 3S4XA 2HP9A 3BM6A 2XFSA 5EVID 2Y55A 3GMWA 5M19A 3OCLA 1TDLA 4OLGA 3Q07A 3VP3A 3MXRA 5CGSA 4R3BA 3NBLA 4XXRA 5HL1A 4BJPA 2XD1A 2BG1A 3HUMA 4GN2A 4FH4A 1LL5A 2C6WB 5AQ9A 4DDSA 3IWOA 4EBLA 4EBPA 1NYMA 1PW1A 3PAGA 4QJGA 1YLYA 1IYSA 4GZBA 1PI5A 2RCXA 2I72A 1SCWA 1MWSA 3GQZA 4QD4A 4S2KA 5FQQA 5HAIA 4X6TA 1H5XA 4EBNA 4ZTKA 1ES5A 2FFYA 3O88A 1RCJA 3M2KA 1NZUA 2Z2MB 4KZ3A 1LI9A 4OPRA 3A3DA 3LO7A 5FQJA 1XPBA 4S2IA 2CC1A 2B5RA 5CGXA 3ZDJA 3ZNTA 3BFCA 4MBHA 3V5MA 5FAQA 3PBQA 2VGKA 4GOGA 5AQAA 1ZKJA 4E3OA 3D4FA 1K56A 3E2KA 5EPHA 4N9LA 1G68A 4YFMA 2EX6A 3ZG5A 4U3TA 3VP0A 1M40A 1XXMA 2EFUA 2X71A 4EUZA 4PMAA 2Y2QA 1DY6A 3HVFA 3SS3A 5DF8A 4KZ8A 3V39A 4OPZA 1WYCA 4H8RA 2Y2HA 4MNRA 4CJNA 3PBOA 1MY8A 4P87A 2IWBA 1HTZA 4DE0A 3OPHA 2WZXA 4OPYA 4OH0A 2XH9A 3WRZA 4OQGA 4EV4A 4CPKA 4DDYA 1XX2A 5CTMA 2EX9A 4IBRA 2QZ6A 4IVKA 1TEMA 3IXBA 5AQBA 4K0XA 4QY6A 2Y2NA 5AQ7A 3DW0A 3UE0A 4E6WA 2H0YA 4KQQA 4OP5A 4EQIA 4BL2A 5A92A 3FYZA 3MFDA 3G2YA 2WADA 3OPLA 2H0TA 3SH7A 1K6SA 3O3VA 3PAEA 3SOIA 4WZ5C 2OV5A 4X69A 4E3KA 4YINA 3V3SA 5E2HA 2OLUA 3BECA 2XEPA 3IF6C 4R4RA 5HARA 4ZJ1A 1HD8A 3IF6A 1FR1A 2EX2A 3C7VA
chains in the Genus database with same CATH superfamily
1KOUA 2AVXA 3IQAA 1KDWA 4UEYA 4MN5A 3CHWP 2J80A 2QJ5A 4DKIA 4UHUA 1CJFA 3S7NA 4R23A 1XA7A 2A49A 1YLPA 1PZPA 2W3DA 1GSVA 3C8CA 4LLOB 4S2MA 3TOIA 1O7EA 4PKYA 1K54A 2QHKA 2G7UA 4PM8A 3LUQA 1DRMA 4ETZA 4JKTA 3D3OA 1YAXA 4L9GA 3T4KA 3WWXA 3Q82A 5FAPA 1NRJA 3IXDA 3VP4A 3S7QA 1TVFA 4D2OA 3CJMA 2O0YA 5K5BA 2ZMAA 4YWZA 3O5YA 3VFHA 4FTXA 3HLWA 3G32A 3UNWA 2DRWA 4LV0A 5GHZA 1RGYA 1XFQA 3DTKA 2QMIA 2EWVA 3FC7A 2PYPA 4WLAA 1ES4A 3SH9A 2W1TA 1D1JA 1G28A 1K25A 3MMHA 2W27A 4QY5A 2PHYA 2VGJA 2KOIA 1OJ5A 3UY6A 1Y28A 5MC7A 5HAQA 3OPPA 2Y4AA 3E4OA 1SKFA 2VZWA 5CGWA 1K4FA 1BLSA 3MQ0A 1KVMA 3TRCA 4UA9A 3IWQA 2ZQAA 1P9WA 3HLFA 5BOHA 2CMNA 3LY4A 3GRJA 2HDQA 2D02A 3VOYA 1K4EA 3GV9A 3FKVA 5EM1A 3DTIA 3ZG9B 5F82A 2DNSA 5FQMA 1N4OA 1TS7A 3S7PA 3NHQA 4RVAA 3HLGA 3UN7A 2EWWA 4R0QA 4QPRA 4G3KA 3VE4A 5FEFA 1DP8A 3N4IA 3ITBA 5EVEA 4R38A 3UPOA 1V9YA 1FCNA 3HJIA 3LICA 2Y91A 5HAPA 1KE4A 4BD0A 2Q9MA 2IWDA 1SHVA 1PW8A 5FEGA 1VQQA 2JHEA 2C5WB 4E3JA 3NY4A 5F83A 3T1QB 4HJ3A 5CHUA 5F1GA 1DJBA 4B88A 4Q0HA 4OPQA 1OTIA 3EGDC 1YT4A 1F2KA 2XF3A 5EE8A 2P08A 1I5QA 4OOMA 5IHVA 1FR6A 3BFFA 4Y7PA 2WAFA 3W4OA 1MKIA 1MWRA 3MF0A 3GECA 3CUEA 3C5AA 5GHXA 1U60A 2KDKA 3KYQA 5DFYA 5KSCA 5M18A 1J9MA 3RXXA 3WS5A 1XGIA 1OTEA 5GLAA 1IYQA 1JWZA 3F1OA 2ZJ9A 1UWPX 4RX2A 4DXCA 2B02A 2A2LA 4QHCA 2PDRA 4LCMA 1YLTA 4U0TA 1STZA 3CMZA 5DF7A 1UGUA 3H7WB 3UMEA 3GDIA 1K55A 2M7UA 2Q9NA 3BFEA 3HL9A 4X55A 3K2NA 3LY3A 2JBFA 5DTTA 4LPZA 5AVEA 1K56D 1N9BA 1DJCA 3A3IA 1OPXA 3LIEA 4ZBEA 3H7WA 1I2WA 1W5DA 4DJ2A 1L0DA 2ZC7A 3UDXA 4GNUA 1IOUA 1E3UD 4N9KA 4FSFA 3MQQA 2WGVA 2XROA 1YM1A 5DFXA 4X25A 1JNUA 3E0YA 1ONHA 3LFVA 4IEDA 1PI4A 1TDGA 3M6HA 5FATA 3IX3A 4WZ5A 1TS0A 4JXVA 2ZM0A 4JLFA 4E6XA 3VSKA 2Y2LA 1OTAA 4NXEA 3G35A 2HDUA 2PD7A 3GSGA 1YKDA 4WBGA 2ZQ8A 1ERMA 3PYPA 1IELA 4PM7A 3W8KA 1YLJA 3B47A 4HJ6A 3VMAA 3A3JA 3T4OA 4E3IA 1G6AA 3JVUA 4NG2A 1PNEA 1CI8A 3K3DA 3TJZC 4E04A 3KSFA 1S4SA 4KZ6A 5HFOA 2HV1A 4Q8IA 3S4XA 2OWHA 2Y55A 3GMWA 5M19A 1TDLA 3VV4A 5HPFA 4L9EA 4GN2A 2C6WB 5AQ9A 4EBPA 1NYMA 1MWSA 3BQ8A 1RCJA 2JKFA 4WL9A 4KZ3A 3A3DA 3LO7A 4S2IA 3ZYTA 4NXFA 2JKTI 3ZDJA 3PR6A 3LI9A 2PRFA 2J3WA 3V5MA 2VGKA 4E3OA 1K56A 3E2KA 3UB9A 4MDZA 5EPHA 3H82A 1G68A 2EX6A 4MN7A 4KZ8A 2IWBA 3OPHA 4EESA 2QZ6A 4NXBA 3IXBA 3DW0A 2H0YA 1XJ6A 5A92A 3G2YA 3R4KA 3IBRA 4B9OA 2QJ7A 4X69A 2NUTC 4E3KA 4B93A 2VX8A 4YINA 1YPRA 4BWIA 3V3SA 5HARA 4X1LA 2EX2A 3C7VA 4KUKA 3KSIA 4JGPA 2WZZA 1K57A 4DE1A 1YLWA 4JF6A 4GHIA 1XA1A 3KYEA 3C38A 2OSUA 1PWGA 2PT7A 3LR3A 4RYEA 2XQZA 4BQMA 4LCLA 5DTKA 5JYOA 2IA2A 2X02A 1N9OA 5CRFA 1E4DA 3QP6A 4P0MA 4H6JA 4IVIA 2GNXA 4PAUA 3RJUA 5IS1A 1FOFA 3W4PA 4ARZA 4K91A 3CG5A 4LRYC 1IKIA 4PM9A 1EI5A 1P97A 1L0EA 4KZBA 4HQAA 5EM0A 3BY9A 1C3BA 1JWVA 5KZHA 1W8QA 1G6OA 5CX7A 4PPRA 4LV1A 5E2FA 2JC7A 3T1RA 3AGDA 3T4TA 1S0WA 4BBVA 5EUAA 1LSVA 5FDHA 2ZL1A 1RP5A 2H10A 4HIAA 1YLZA 5HPIA 2V1ZA 2Y2PA 4OOYA 1P9RA 1KE0A 1KGEA 3N8LA 3NIAA 5HDCA 4E3LA 1W63M 1JTGA 3PBNA 4X68A 4GCZA 1CEFA 1NZOA 4B4ZA 2HPBA 3QNCA 3HCYA 1IEMA 3NOUC 1FCMA 4CLCD 3N8RA 3UDIA 3E4QA 2PR5A 4XUZA 2EFXA 5HZHA 3UE1A 1GHIA 3GR2A 1XP4A 1Z6FA 1NY0A 2GX5A 1N9LA 3FZCA 1NJ4A 4FD8A 3BEBA 5FQIA 1KDSA 2XA7M 1OMEA 3ICYA 1YSPA 4DMZA 2WKEA 1BLHA 4BLMA 1GSWA 5EFWA 3E4PA 3OZHA 1ZG4A 1FIKA 1SKOA 3CWFA 5EVIC 4O8GA 5L2FA 2QPNA 2V8FA 1GA0A 3NOTC 4GDNA 4S2OA 2ZQCA 4RQ9A 5FSRA 1S66L 2ZBBA 3RH8B 1LI0A 4GS9B 2ZQ7A 2WGWB 2V1BA 2PYRA 3N6IA 5FASA 3A0VA 1MXOA 4PKYG 4Y0UA 1F98A 1XJ2A 1K0KA 4OKPA 2WK0A 3LI8A 4WZ4A 3NECA 4K08A 4OQHA 1D06A 4MCWA 1XFNA 4R3JA 5AVFA 5HDDA 1Q2QA 4GS9A 4CLCB 2WGWA 3AGEA 4Y0OA 1MWUA 4OLDA 2PBDP 1LSXA 3G30A 3IS2B 3NCKA 5TJJA 2O9CA 2Y2OA 4EW7A 4GDBA 4HY8A 2Y2GA 4MEZA 3U4LP 5HW3A 2EA9A 3JYIA 1T18A 1J3WA 5GHYA 1K55C 4HP4A 3JVVA 4Z9QA 2Y79A 1RGZA 4CLCA 2R9XA 3HUOA 3Q81A 4HNBA 3ISGA 4UAAA 3L9KA 4QB8A 2Y8HA 4KENB 4DF6A 3DWKA 2ZC4B 3ZVTA 2XFTA 2HZ5A 5TR7A 1ES3A 2JN7A 1DJAA 1S1YA 4LRXC 5TBMB 3IF6B 4ETXA 3BLMA 2OAQ1 2W1RA 4EERA 4U0XA 5CECA 3T4QA 5CHMA 3LEQA 4ID4A 2YKFA 1XKZA 4PM6A 1YSQA 4R3AA 2WKRA 2G2WA 2V9AA 1ZHHB 4X56A 1G5UA 1GHPA 2KX6A 2ZC6B 3HBRA 3MR0A 3FV7A 3A0SA 1GSXA 2J9OA 2ZQDA 5EVIB 3SW1A 2O9AA 3IWIA 4IHQA 1NLYA 2ZC5B 5F5YA 2O9BA 3AGFA 2ZQ9A 4CQHA 3W2ZA 3UPPA 1S67L 4S2NA 2X01A 4L0LA 3M2JA 2M1CA 3ZGAB 4BBUA 3SS5A 4XT2B 1BZAA 1E25A 4KZ5A 4K0WA 1BTLA 1HZOA 1EROA 2VLGA 3WS0A 3BM6A 2XFSA 4LRZE 4OLGA 3Q07A 4HP9A 4R70A 3K3CA 3NBLA 5HL1A 4BJPA 2XD1A 4FH4A 3IWOA 1PW1A 1PI5A 1T1BA 2I72A 4QD4A 5HAIA 5FDSA 4UQIM 4EBNA 1ES5A 3M2KA 1NZUA 1LI9A 2VJWA 4OPRA 2Z6CA 5FQJA 3EEAA 3BFCA 4QWOA 1NWZA 4P6ZM 4GOGA 3MFXA 3B42A 3BJNA 1ACFA 3KSGA 2L1MA 2O99A 4U3TA 1T19A 4EUZA 5DKLA 1MKMA 1DY6A 2V8CA 2XA7S 3V39A 4OPZA 4H8RA 3PBOA 4Q0JA 2DMWA 4EUVA 4OH0A 5L8MA 4CPKA 2GJ3A 1XX2A 5HL6A 5CTMA 5J3WA 2EX9A 1TEMA 4HOIA 4QY6A 4E6WA 3NULA 4BL2A 4Y17A 4MMNA 3SH7A 3O3VA 1F5MA 5HSQA 2OV5A 1DP9A 2OOLA 5E2HA 4R4RA 1AWIA 4M4XA 4ZJ1A 2WKPA 1FR1A 1CK3A 2PD8A 4M3KA 3KX0X 5E2EA 1MPLA 3VP1A 5DVAA 2HJ9C 1VEUB 3IT9A 2W3HA 5EVLA 3VOZA 1KGFA 3OCNA 3BRMA 4ESPA 3ZCZA 1PZOA 5TGFA 3MZFA 3R7WB 2JKGA 3NOPC 3BFDA 4KG2A 2KLIA 3UMDA 5EOOA 3BLSA 2D01A 1MBLA 3E2LA 2HF6A 2INWA 3MKFA 2V0WA 4HBUA 3I7JA 2A3UA 3Q7VB 4GLQA 4OOLA 3ZG8B 3R7WA 4HI4A 1ZTUA 4S2PA 2WUQA 4BMWA 2V20A 3VP2A 1TS6A 4KG6A 4RX3A 4O7DA 3LYXA 3CITA 2OWJA 4GD6A 1T1AA 4LV2A 2J3TC 3T1XA 2E8IA 2FFFB 4BD1A 4ZRRA 3ZQ5A 1H8YA 3LR4A 5EV0A 3BW6A 4DN0A 2VV7A 2A24B 3QP4A 4CLCE 1WA9A 1QMEA 2ZM2A 3C4PA 3BQAA 3TE8A 1E3UA 2VKSA 5HD3A 4WYYA 1YQSA 2BTFP 3MXQA 1FQGA 4N1XA 3W4QA 4ZDXA 1W79A 3FPWA 2JCHA 3DAVA 3IX4A 2V2FF 5KSHA 3N7WA 3D9YA 4JBFA 4MBKA 3P09A 3O87A 1VETB 1H0MA 5M1AA 4UA6A 3EGXC 3UB5P 2VA0A 1TS8A 2BASA 3P01A 3UDFA 3ZNYA 3LR5A 2EX8A 1LL9A 4GB7A 1MWTA 3DWZA 3N8SA 1JTDA 3D72A 5G4YA 1X0OA 1K38A 4KZ7A 4P6BA 1BSGA 1KVLA 3FWLA 3E98A 5J8XA 5FQKA 3HREA 5FL3A 3VSLA 4PM5A 2P9VB 1GA9A 3CPTB 3U2AA 3SZTA 1CQAA 3LIFA 3V67A 2YKHA 1F9IA 3TSGA 1S1ZA 2PAVP 3B3XA 3VE3A 3ZVWA 3QP5A 4UQIS 5GLCA 4EEUA 1K54C 1NLZA 2XSSA 3WS4A 4OONA 1S6RA 3CPTA 4JGOA 2H28A 1BULA 3MZEA 3OPRA 1L2SA 5A91A 4P6ZS 4I39A 3CZDA 2P04A 2LB5A 2XLNA 4C6YA 2ZM8A 3A3EA 1PIOA 3T4JA 3F1PB 4KG5A 5FI2A 1FSYA 1AXBA 4QU3A 4WEJA 4IUKA 1DP6A 4XUXA 3A3FA 3GVBA 4KZAA 1LSWA 3UB8A 5FI7A 5DF9A 4AFIA 1ONGA 4B4XA 3G2ZA 3LIBA 4Y5FA 4GW9A 4Y15A 4BENA 1ZC2A 4JGRA 2Y59A 3O86A 3Q7ZA 5HDSA 3BFGA 2JKRM 1ESUA 3HLDA 1OT6A 3IHAA 4EQ1A 3UPNA 2P7JA 1BYWA 4OP8A 3IXGA 5A8BA 5FQ9A 3IH8A 2MJ6A 1ALQA 3LEZA 4DE3A 1FCOA 5HX9A 2XGNA 2E8JA 3MKEA 2ZLYA 1I2SA 2ZOHA 5CERA 3HLEA 3NI9A 2ZMFA 2UWXA 3DTMA 5TFQA 4EEPA 3QP8A 1MZUA 4FH2A 3WRTA 3KSHA 1WYBA 1JVJA 2Y2IA 1V9ZA 2PU2A 3GTCA 2Z6DA 4Y3IA 3HLCA 2WKHA 4IBXA 1YMXA 4HHDA 2W3FA 3NJAA 3G4PA 4LV3A 3IF5A 5DJUA 3QNBA 5A93A 2OAP1 3ZHHA 4MBFA 3LCEA 3WS1A 4ME4A 2PR6A 3MSHA 2P74A 2ZD8A 1ES2A 4F94A 1LHYA 2J9PA 5FA7A 4MN6A 1OT9A 2K2NA 2L4RA 4S2NC 4LENA 5F69A 1LLBA 5E2GA 2VGLS 4ZAMA 1XJ3A 3OC2A 3HUNA 3LIDA 2UV0E 4WEKA 5I5LA 3UO9A 5DJTA 2FZ0A 1PYYA 1VHMA 1ODVA 3IBJA 2XK1A 4EETB 2B18A 3P7NA 1FSWA 3CUEC 2Y2MA 2WGIA 4WF0A 3PBSA 4NXGA 5L10A 5EVID 3VP3A 3HJKA 4I3AA 3MXRA 3VOLA 4DDSA 4EBLA 5C5KA 1CF0A 3GQZA 4S2KA 1HLUP 2W1TB 1H5XA 1FILA 2FFYA 1H3QA 2Z2MB 2ZMVA 3ULFA 3IX8A 1XPBA 3C2WA 4G3VA 2B5RA 5CGXA 5J4EA 2VV8A 3PBQA 5AQAA 1ZKJA 3D4FA 3IS2A 4N9LA 4YFMA 2ZOIA 1OTBA 3ZG5A 4FOFA 3VP0A 1M40A 1XXMA 2EFUA 3SS3A 3H9WA 1WYCA 3QP2A 1MY8A 4P87A 3RTYA 1HTZA 3OLOA 5KIZA 3LIAA 3WRZA 4EV4A 4KQDA 4DDYA 4YOFA 4IBRA 5AQBA 4K0XA 5AQ7A 2Y2NA 4KUOA 4KQQA 4OP5A 4EQIA 3FYZA 3OPLA 5L09A 2QWSA 3UE6A 2H0TA 4WZ5C 1D7EA 2OLUA 5TBMA 3IF6A 1XJ4A 4P85A 4NETA 1L0FA 4KZ4A 4Y0TA 1Y54A 1CI9A 3UE3A 4WMCD 1WE4A 4DRTA 4G3WA 1SDNA 2VV6A 3VFFA 4ZJ2A 3S1YA 3T12B 2VEAA 4KQRA 3A0RA 4HESA 5GL9A 1YMSA 3C7UA 5EVIA 1N9NA 3LGOA 3G31A 3NDGA 1Y4OA 2Q0OA 4DXBA 3LR0A 1GCEA 2GZAA 4C75A 1PWCA 3SH8A 3BYDA 5CEDA 5A90A 1VB6A 1H8ZA 2V0UA 5CEBA 4EU0A 3EOIA 5G4ZA 1NYYA 1Z09A 4DE2A 4EXOA 3F1OB 4XT2A 1NRFA 3MXSA 4MLLA 4NK3A 4Y2FA 4HH3A 3G6OA 4BL3A 4WELA 4WUJA 3PBTA 3G34A 4KQOA 2Z2LB 3EQVA 2J8YA 2XR0A 2XD5A 3NC8A 1VM1A 1PWDA 1SZVA 2QYBA 2W3GA 3PBRA 2OLVA 4WM9A 2HJEA 1K6RA 2WYXA 4DJ3A 3MJQA 5U47A 1ERQA 2W3EA 1BLPA 3Q1FA 1LL8A 2XRNA 5F68A 2PU4A 4N92A 1ESIA 5KMWA 4S2JA 3UB7A 2WKQA 4JXWA 1L0GA 5IT5A 1BUEA 2W0NA 2RL3A 5J7EA 3T4LA 3M6BA 4HH2A 4JF4A 5EECA 1H8MA 4JPMA 4OQ0A 4KZ9A 4RA7A 5E43A 4JF5A 3KYZA 3T4SA 3IXHA 1JWPA 4WMCA 2L0WA 5GLDA 3CI6A 4R6LA 2JE5A 1K57C 3IH9A 2EXAA 4EWFA 4OQIA 2WKIA 4PHTA 4N1HA 2ACGA 2I9VA 1T1CA 1IKGA 1LT0A 4Z1WA 3WS2A 2H5SA 2R9WA 1IFQA 4FUWA 1SDEA 1O07A 5CXWA 2HP6A 2Y2KA 1EW0A 2Y2JA 3ZG0A 4II7A 1ZG6A 4LGWA 5FAOA 1PRQA 3ITAA 1VEUA 3BY8A 4R1GA 3TW8A 3ZFZA 4O0PA 2K31A 1BLCA 1QMFA 3ZG7B 1IYOA 5IU1A 5G18A 1IYPA 1A0KA 5F6AA 3DBAA 5F1FA 1P0ZA 4YNRA 3C30A 3JPUA 4HEFA 4GKUA 2VGLM 1W7FA 3OOVA 2VK3A 3V50A 5HWVA 3H82B 2XDMA 3Q7VA 2HP5A 3P98A 3S7OA 4IUHA 5FI6A 2IWCA 2JKRI 5DTSA 3RXWA 5CTNA 1HVBA 3HLBA 2GDNA 3KO6A 4GJ4A 3BWLA 5EOEA 3FG8A 3T1SA 5JYPA 4OVDA 4UA7A 4JXSA 2A24A 1KE3A 3S22A 2J3TD 5AJGA 3V3RA 1S4RA 4JXGA 3MQOA 4FCFA 4C3QA 2K7SA 3F1NB 1L3LA 4X1MA 1NXYA 3MBZA 3IHBA 4F3LB 1W8YA 4A5RA 2R78A 5D3OA 3FPVA 4I3IA 3T50A 3B33A 2EXBA 1UWNX 3UB6A 1PFLA 1VETA 4I38A 1EWZA 1BT5A 3TG9A 1M6KA 4GHIB 2WAEA 1OJGA 1TF1A 4GD8A 4I5SA 5GLBA 2PBYA 1Q2PA 4ZJ3A 3SS4A 3F1NA 5I94A 4L9FA 2G2UA 4F3LA 4NKPA 2ZC3B 5CHJA 4E3MA 2J7VA 1GHMA 3MZDA 3PTEA 4E3NA 3FKWA 1KGGA 2P9VA 4H6JB 4IJGA 2BLSA 3C4OA 5L07A 3CAXA 4ARZB 4R4SA 4HJ4A 5DKKA 1CEGA 2HDSA 3L7HA 3QHYA 4Q0IA 3EQUA 1XGJA 3NDEA 2HDRA 4HBTA 4D60A 3PHYA 3DTEA 4S2LA 2DCFA 2HP9A 2NUPC 3OCLA 2V1AA 5CGSA 4R3BA 4XXRA 5LBRA 2BG1A 3HUMA 1LL5A 3PAGA 4QJGA 5HWWA 1YLYA 1IYSA 4GZBA 2RCXA 2ZL1B 1SCWA 5FQQA 3F1PA 4X6TA 2HGVA 3RFBA 4ZTKA 3O88A 1MC0A 4O01A 2CC1A 3ZNTA 2JKTM 4WN5A 4CLCC 4MBHA 1TD5A 4NEED 5FAQA 2M7VA 3PXPA 1OTDA 2X71A 4Y13A 4PMAA 2Y2QA 3HVFA 5DF8A 4CJNA 2Y2HA 4MNRA 4JGQA 4DE0A 2WZXA 4OPYA 1W63Q 2XH9A 3MS6A 4OQGA 4IVKA 3UE0A 3CLOA 2QKPA 3MFDA 2WADA 3QP1A 1K6SA 3OBFA 3PAEA 3SOIA 4LFUA 2B95A 2LB9A 2FH5A 5HD5A 4BBTA 3BECA 2XEPA 3EEHA 3IF6C 4I3JA 1SKOB 5HWTA 1HD8A 3EWKA 4X53A
chains in the Genus database with same CATH topology
4P85A 4NETA 1CK3A 1L0FA 4KZ4A 3IQAA 2WZZA 4Y0TA 4M3KA 1Y54A 1CI9A 1K57A 5E2EA 1MPLA 3UE3A 4DE1A 3VP1A 4WMCD 1KDWA 1WE4A 4DRTA 1YLWA 5DVAA 4JF6A 3IT9A 1SDNA 4DKIA 5EVLA 3VOZA 1XA1A 4UHUA 1KGFA 3OCNA 2OSUA 3BRMA 3VFFA 4ZJ2A 1PWGA 1PZOA 5TGFA 3S1YA 3MZFA 4RYEA 3ZCZA 4KQRA 4R23A 2XQZA 4HESA 5GL9A 1YMSA 1XA7A 2A49A 3C7UA 1YLPA 5EVIA 1PZPA 4BQMA 4LCLA 3G31A 3NDGA 3BFDA 4KG2A 4DXBA 1GCEA 5DTKA 4S2MA 3TOIA 5JYOA 5EOOA 1O7EA 1K54A 2X02A 3BLSA 4PM8A 4C75A 1PWCA 3SH8A 3BYDA 4JF5A 5CRFA 1E4DA 1MBLA 4P0MA 3E2LA 5A90A 5CEDA 1H8ZA 4JKTA 3MKFA 5CEBA 4IVIA 4HBUA 3WWXA 3RJUA 1FOFA 3W4PA 3I7JA 3Q82A 2A3UA 5FAPA 3Q7VB 3IXDA 4OOLA 4K91A 1NYYA 3CG5A 3ZG8B 1IKIA 4S2PA 4DE2A 3VP4A 1NRFA 1TVFA 3MXSA 4MLLA 2WUQA 4NK3A 4PM9A 1EI5A 4D2OA 3CJMA 4BL3A 4WELA 1L0EA 2V20A 2ZMAA 3PBTA 4KZBA 3G34A 4KQOA 3VFHA 2Z2LB 3HLWA 3VP2A 3G32A 4KG6A 1C3BA 1JWVA 2J8YA 3EQVA 3UNWA 2DRWA 4RX3A 4O7DA 4LV0A 5GHZA 5KZHA 1RGYA 1W8QA 2XR0A 2XD5A 3NC8A 1VM1A 1PWDA 4GD6A 4PPRA 4LV2A 2QMIA 4LV1A 2E8IA 2FFFB 2JC7A 5E2FA 4BD1A 3AGDA 1H8YA 1S0WA 5EUAA 1ES4A 3PBRA 5FDHA 3SH9A 2OLVA 1RP5A 1K25A 2H10A 4WM9A 1YLZA 2V1ZA 2Y2PA 1K6RA 2WYXA 4OOYA 1QMEA 2ZM2A 4QY5A 5U47A 3C4PA 1KE0A 1ERQA 1E3UA 1KGEA 3N8LA 3NIAA 4E3LA 1BLPA 2VGJA 4WYYA 3Q1FA 1YQSA 3UY6A 1JTGA 3PBNA 2PU4A 4N92A 4X68A 1ESIA 1FQGA 4N1XA 3W4QA 1W79A 4ZDXA 2JCHA 1CEFA 5KMWA 5HAQA 1NZOA 3OPPA 2Y4AA 2HPBA 4S2JA 3QNCA 4B4ZA 4JXWA 1IEMA 1L0GA 2V2FF 1BUEA 1FCMA 1SKFA 5CGWA 5KSHA 3N7WA 2RL3A 1K4FA 4JBFA 1BLSA 3M6BA 4MBKA 3P09A 3O87A 4JF4A 5EECA 5M1AA 1KVMA 3N8RA 4UA6A 4JPMA 4UA9A 3IWQA 2ZQAA 4OQ0A 4KZ9A 4RA7A 5E43A 3UDIA 3HLFA 3UDFA 3ZNYA 5BOHA 4XUZA 2EFXA 2EX8A 1LL9A 3LY4A 3GRJA 1JWPA 1GHIA 2HDQA 1K4EA 3GR2A 3IXHA 3UE1A 4WMCA 1XP4A 3VOYA 4GB7A 1MWTA 1Z6FA 3DWZA 3N8SA 1NY0A 5GLDA 3GV9A 1JTDA 2JE5A 3FKVA 3ZG9B 3FZCA 1NJ4A 1K38A 5F82A 2DNSA 4FD8A 1K57C 3BEBA 2EXAA 3IH9A 4KZ7A 1N4OA 4P6BA 5FQIA 5FQMA 1KDSA 1OMEA 1BSGA 1KVLA 4OQIA 2WKIA 3FWLA 2WKEA 4RVAA 1BLHA 3HLGA 3UN7A 4BLMA 5J8XA 5FQKA 3HREA 4N1HA 4R0QA 3VSLA 4PM5A 2P9VB 1GA9A 3N4IA 3ITBA 1IKGA 3UPOA 1FCNA 2Y91A 3TSGA 3OZHA 1KE4A 4BD0A 2Q9MA 2IWDA 5HAPA 1SHVA 3WS2A 1PW8A 1ZG4A 2H5SA 2R9WA 3B3XA 5EVIC 5L2FA 2QPNA 1SDEA 1VQQA 2C5WB 4E3JA 1O07A 5CXWA 3NY4A 2HP6A 3ZVWA 1GA0A 2Y2KA 4GDNA 5F83A 2Y2JA 3ZG0A 1ZG6A 2ZQCA 4S2OA 5GLCA 1K54C 5CHUA 5FSRA 3WS4A 5F1GA 4OONA 5FAOA 1DJBA 3ITAA 4B88A 1LI0A 2ZQ7A 1S6RA 4R1GA 2WGWB 3ZFZA 1BULA 3MZEA 4OPQA 3N6IA 3OPRA 1L2SA 5A91A 3CZDA 1YT4A 2XLNA 1BLCA 5FASA 4C6YA 1QMFA 1MXOA 3ZG7B 1IYOA 4Y0UA 2XF3A 2ZM8A 3A3EA 1PIOA 5EE8A 4OKPA 2WK0A 1IYPA 1I5QA 4KG5A 4OOMA 5G18A 5IHVA 4WZ4A 5FI2A 1FR6A 1FSYA 3BFFA 1AXBA 5F1FA 4QU3A 4OQHA 4WEJA 4Y7PA 2WAFA 3W4OA 1MKIA 1MWRA 4XUXA 3A3FA 3GVBA 4KZAA 4HEFA 4GKUA 3C5AA 4R3JA 5GHXA 1Q2QA 1U60A 1W7FA 2WGWA 5FI7A 3AGEA 4Y0OA 5DF9A 5KSCA 1MWUA 4OLDA 3V50A 5M18A 1J9MA 1ONGA 3G30A 3RXXA 4B4XA 3NCKA 3G2ZA 2XDMA 3Q7VA 2HP5A 3WS5A 1XGIA 3P98A 4BENA 1ZC2A 5GLAA 1IYQA 1JWZA 2Y2OA 2ZJ9A 4GDBA 4RX2A 5FI6A 2Y2GA 4MEZA 4DXCA 2IWCA 2Y59A 4QHCA 4LCMA 1YLTA 5HW3A 4U0TA 3JYIA 3O86A 3Q7ZA 3BFGA 3CMZA 5GHYA 1K55C 5DTSA 3RXWA 5DF7A 1ESUA 3HLDA 4Z9QA 1RGZA 3IHAA 1K55A 2R9XA 3HUOA 3Q81A 2Q9NA 5CTNA 3BFEA 3ISGA 3UPNA 3HL9A 4X55A 4OP8A 4UAAA 1HVBA 3LY3A 4QB8A 2JBFA 3IXGA 3HLBA 2GDNA 4KENB 5FQ9A 3DWKA 4DF6A 5DTTA 2ZC4B 3IH8A 1ALQA 3LEZA 4DE3A 1FCOA 5HX9A 5EOEA 3ZVTA 2XFTA 2XGNA 5JYPA 4OVDA 4UA7A 4JXSA 1K56D 3MKEA 5TR7A 1KE3A 2ZLYA 3S22A 1N9BA 1I2SA 1ES3A 5CERA 1DJCA 3V3RA 3A3IA 3HLEA 3NI9A 4JXGA 4ZBEA 4FCFA 4C3QA 2UWXA 1I2WA 1DJAA 1W5DA 3DTMA 5TFQA 4X53A 1L0DA 1NXYA 2ZC7A 3IF6B 3BLMA 3UDXA 4GNUA 3MBZA 3IHBA 1E3UD 4N9KA 4FH2A 3WRTA 4U0XA 5CECA 1W8YA 4FSFA 4A5RA 1WYBA 5CHMA 5D3OA 1JVJA 2WGVA 2Y2IA 4ID4A 2EXBA 2PU2A 3GTCA 1YM1A 1XKZA 3HLCA 4PM6A 2WKHA 4IBXA 1YMXA 1EWZA 1BT5A 1ONHA 3TG9A 1M6KA 2G2WA 4IEDA 2WAEA 4GD8A 1PI4A 1TDGA 3G4PA 3M6HA 4LV3A 4X56A 3IF5A 2PBYA 5FATA 4WZ5A 5GLBA 1GHPA 3HBRA 2ZC6B 3QNBA 5A93A 1Q2PA 3FV7A 4JXVA 4ZJ3A 3ZHHA 3SS4A 2ZM0A 5I94A 4JLFA 2J9OA 2ZQDA 4MBFA 5EVIB 3LCEA 3WS1A 2G2UA 3IWIA 3VSKA 4E6XA 2Y2LA 3G35A 2P74A 2HDUA 2ZD8A 2ZC3B 1ES2A 3GSGA 2ZC5B 5CHJA 4E3MA 4F94A 1LHYA 2J7VA 2J9PA 5FA7A 3AGFA 1GHMA 3MZDA 2ZQ9A 3PTEA 4E3NA 4S2NC 2ZQ8A 4LENA 1ERMA 4WBGA 4EWFA 1LLBA 5E2GA 4ZAMA 1IELA 3FKWA 3UPPA 4PM7A 1KGGA 2P9VA 4S2NA 3OC2A 3W8KA 1YLJA 2BLSA 3HUNA 2X01A 4L0LA 3M2JA 4WEKA 3UO9A 3VMAA 3C4OA 1PYYA 4R4SA 3A3JA 3ZGAB 1CEGA 2HDSA 3SS5A 2XK1A 4E3IA 1G6AA 1BZAA 1E25A 3QHYA 1CI8A 3EQUA 4KZ5A 1XGJA 3NDEA 1FSWA 4K0WA 1BTLA 2HDRA 2Y2MA 4HBTA 2WGIA 4KZ6A 1HZOA 3PBSA 1EROA 3WS0A 5HFOA 4S2LA 2DCFA 4Q8IA 3S4XA 2HP9A 3BM6A 2XFSA 5EVID 2Y55A 3GMWA 5M19A 3OCLA 1TDLA 4OLGA 3Q07A 3VP3A 3MXRA 5CGSA 4R3BA 3NBLA 4XXRA 5HL1A 4BJPA 2XD1A 2BG1A 3HUMA 4GN2A 4FH4A 1LL5A 2C6WB 5AQ9A 4DDSA 3IWOA 4EBLA 4EBPA 1NYMA 1PW1A 3PAGA 4QJGA 1YLYA 1IYSA 4GZBA 1PI5A 2RCXA 2I72A 1SCWA 1MWSA 3GQZA 4QD4A 4S2KA 5FQQA 5HAIA 4X6TA 1H5XA 4EBNA 4ZTKA 1ES5A 2FFYA 3O88A 1RCJA 3M2KA 1NZUA 2Z2MB 4KZ3A 1LI9A 4OPRA 3A3DA 3LO7A 5FQJA 1XPBA 4S2IA 2CC1A 2B5RA 5CGXA 3ZDJA 3ZNTA 3BFCA 4MBHA 3V5MA 5FAQA 3PBQA 2VGKA 4GOGA 5AQAA 1ZKJA 4E3OA 3D4FA 1K56A 3E2KA 5EPHA 4N9LA 1G68A 4YFMA 2EX6A 3ZG5A 4U3TA 3VP0A 1M40A 1XXMA 2EFUA 2X71A 4EUZA 4PMAA 2Y2QA 1DY6A 3HVFA 3SS3A 5DF8A 4KZ8A 3V39A 4OPZA 1WYCA 4H8RA 2Y2HA 4MNRA 4CJNA 3PBOA 1MY8A 4P87A 2IWBA 1HTZA 4DE0A 3OPHA 2WZXA 4OPYA 4OH0A 2XH9A 3WRZA 4OQGA 4EV4A 4CPKA 4DDYA 1XX2A 5CTMA 2EX9A 4IBRA 2QZ6A 4IVKA 1TEMA 3IXBA 5AQBA 4K0XA 4QY6A 2Y2NA 5AQ7A 3DW0A 3UE0A 4E6WA 2H0YA 4KQQA 4OP5A 4EQIA 4BL2A 5A92A 3FYZA 3MFDA 3G2YA 2WADA 3OPLA 2H0TA 3SH7A 1K6SA 3O3VA 3PAEA 3SOIA 4WZ5C 2OV5A 4X69A 4E3KA 4YINA 3V3SA 5E2HA 2OLUA 3BECA 2XEPA 3IF6C 4R4RA 5HARA 4ZJ1A 1HD8A 3IF6A 1FR1A 2EX2A 3C7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P85 A;  4NET A;  1CK3 A;  1L0F A;  4KZ4 A;  3IQA A;  2WZZ A;  4Y0T A;  4M3K A;  1Y54 A;  1CI9 A;  1K57 A;  5E2E A;  1MPL A;  3UE3 A;  4DE1 A;  3VP1 A;  4WMC D;  1KDW A;  1WE4 A;  4DRT A;  1YLW A;  5DVA A;  4JF6 A;  3IT9 A;  1SDN A;  4DKI A;  5EVL A;  3VOZ A;  1XA1 A;  4UHU A;  1KGF A;  3OCN A;  2OSU A;  3BRM A;  3VFF A;  4ZJ2 A;  1PWG A;  1PZO A;  5TGF A;  3S1Y A;  3MZF A;  4RYE A;  3ZCZ A;  4KQR A;  4R23 A;  2XQZ A;  4HES A;  5GL9 A;  1YMS A;  1XA7 A;  2A49 A;  3C7U A;  1YLP A;  5EVI A;  1PZP A;  4BQM A;  4LCL A;  3G31 A;  3NDG A;  3BFD A;  4KG2 A;  4DXB A;  1GCE A;  5DTK A;  4S2M A;  3TOI A;  5JYO A;  5EOO A;  1O7E A;  1K54 A;  2X02 A;  3BLS A;  4PM8 A;  4C75 A;  1PWC A;  3SH8 A;  3BYD A;  4JF5 A;  5CRF A;  1E4D A;  1MBL A;  4P0M A;  3E2L A;  5A90 A;  5CED A;  1H8Z A;  4JKT A;  3MKF A;  5CEB A;  4IVI A;  4HBU A;  3WWX A;  3RJU A;  1FOF A;  3W4P A;  3I7J A;  3Q82 A;  2A3U A;  5FAP A;  3Q7V B;  3IXD A;  4OOL A;  4K91 A;  1NYY A;  3CG5 A;  3ZG8 B;  1IKI A;  4S2P A;  4DE2 A;  3VP4 A;  1NRF A;  1TVF A;  3MXS A;  4MLL A;  2WUQ A;  4NK3 A;  4PM9 A;  1EI5 A;  4D2O A;  3CJM A;  4BL3 A;  4WEL A;  1L0E A;  2V20 A;  2ZMA A;  3PBT A;  4KZB A;  3G34 A;  4KQO A;  3VFH A;  2Z2L B;  3HLW A;  3VP2 A;  3G32 A;  4KG6 A;  1C3B A;  1JWV A;  2J8Y A;  3EQV A;  3UNW A;  2DRW A;  4RX3 A;  4O7D A;  4LV0 A;  5GHZ A;  5KZH A;  1RGY A;  1W8Q A;  2XR0 A;  2XD5 A;  3NC8 A;  1VM1 A;  1PWD A;  4GD6 A;  4PPR A;  4LV2 A;  2QMI A;  4LV1 A;  2E8I A;  2FFF B;  2JC7 A;  5E2F A;  4BD1 A;  3AGD A;  1H8Y A;  1S0W A;  5EUA A;  1ES4 A;  3PBR A;  5FDH A;  3SH9 A;  2OLV A;  1RP5 A;  1K25 A;  2H10 A;  4WM9 A;  1YLZ A;  2V1Z A;  2Y2P A;  1K6R A;  2WYX A;  4OOY A;  1QME A;  2ZM2 A;  4QY5 A;  5U47 A;  3C4P A;  1KE0 A;  1ERQ A;  1E3U A;  1KGE A;  3N8L A;  3NIA A;  4E3L A;  1BLP A;  2VGJ A;  4WYY A;  3Q1F A;  1YQS A;  3UY6 A;  1JTG A;  3PBN A;  2PU4 A;  4N92 A;  4X68 A;  1ESI A;  1FQG A;  4N1X A;  3W4Q A;  1W79 A;  4ZDX A;  2JCH A;  1CEF A;  5KMW A;  5HAQ A;  1NZO A;  3OPP A;  2Y4A A;  2HPB A;  4S2J A;  3QNC A;  4B4Z A;  4JXW A;  1IEM A;  1L0G A;  2V2F F;  1BUE A;  1FCM A;  1SKF A;  5CGW A;  5KSH A;  3N7W A;  2RL3 A;  1K4F A;  4JBF A;  1BLS A;  3M6B A;  4MBK A;  3P09 A;  3O87 A;  4JF4 A;  5EEC A;  5M1A A;  1KVM A;  3N8R A;  4UA6 A;  4JPM A;  4UA9 A;  3IWQ A;  2ZQA A;  4OQ0 A;  4KZ9 A;  4RA7 A;  5E43 A;  3UDI A;  3HLF A;  3UDF A;  3ZNY A;  5BOH A;  4XUZ A;  2EFX A;  2EX8 A;  1LL9 A;  3LY4 A;  3GRJ A;  1JWP A;  1GHI A;  2HDQ A;  1K4E A;  3GR2 A;  3IXH A;  3UE1 A;  4WMC A;  1XP4 A;  3VOY A;  4GB7 A;  1MWT A;  1Z6F A;  3DWZ A;  3N8S A;  1NY0 A;  5GLD A;  3GV9 A;  1JTD A;  2JE5 A;  3FKV A;  3ZG9 B;  3FZC A;  1NJ4 A;  1K38 A;  5F82 A;  2DNS A;  4FD8 A;  1K57 C;  3BEB A;  2EXA A;  3IH9 A;  4KZ7 A;  1N4O A;  4P6B A;  5FQI A;  5FQM A;  1KDS A;  1OME A;  1BSG A;  1KVL A;  4OQI A;  2WKI A;  3FWL A;  2WKE A;  4RVA A;  1BLH A;  3HLG A;  3UN7 A;  4BLM A;  5J8X A;  5FQK A;  3HRE A;  4N1H A;  4R0Q A;  3VSL A;  4PM5 A;  2P9V B;  1GA9 A;  3N4I A;  3ITB A;  1IKG A;  3UPO A;  1FCN A;  2Y91 A;  3TSG A;  3OZH A;  1KE4 A;  4BD0 A;  2Q9M A;  2IWD A;  5HAP A;  1SHV A;  3WS2 A;  1PW8 A;  1ZG4 A;  2H5S A;  2R9W A;  3B3X A;  5EVI C;  5L2F A;  2QPN A;  1SDE A;  1VQQ A;  2C5W B;  4E3J A;  1O07 A;  5CXW A;  3NY4 A;  2HP6 A;  3ZVW A;  1GA0 A;  2Y2K A;  4GDN A;  5F83 A;  2Y2J A;  3ZG0 A;  1ZG6 A;  2ZQC A;  4S2O A;  5GLC A;  1K54 C;  5CHU A;  5FSR A;  3WS4 A;  5F1G A;  4OON A;  5FAO A;  1DJB A;  3ITA A;  4B88 A;  1LI0 A;  2ZQ7 A;  1S6R A;  4R1G A;  2WGW B;  3ZFZ A;  1BUL A;  3MZE A;  4OPQ A;  3N6I A;  3OPR A;  1L2S A;  5A91 A;  3CZD A;  1YT4 A;  2XLN A;  1BLC A;  5FAS A;  4C6Y A;  1QMF A;  1MXO A;  3ZG7 B;  1IYO A;  4Y0U A;  2XF3 A;  2ZM8 A;  3A3E A;  1PIO A;  5EE8 A;  4OKP A;  2WK0 A;  1IYP A;  1I5Q A;  4KG5 A;  4OOM A;  5G18 A;  5IHV A;  4WZ4 A;  5FI2 A;  1FR6 A;  1FSY A;  3BFF A;  1AXB A;  5F1F A;  4QU3 A;  4OQH A;  4WEJ A;  4Y7P A;  2WAF A;  3W4O A;  1MKI A;  1MWR A;  4XUX A;  3A3F A;  3GVB A;  4KZA A;  4HEF A;  4GKU A;  3C5A A;  4R3J A;  5GHX A;  1Q2Q A;  1U60 A;  1W7F A;  2WGW A;  5FI7 A;  3AGE A;  4Y0O A;  5DF9 A;  5KSC A;  1MWU A;  4OLD A;  3V50 A;  5M18 A;  1J9M A;  1ONG A;  3G30 A;  3RXX A;  4B4X A;  3NCK A;  3G2Z A;  2XDM A;  3Q7V A;  2HP5 A;  3WS5 A;  1XGI A;  3P98 A;  4BEN A;  1ZC2 A;  5GLA A;  1IYQ A;  1JWZ A;  2Y2O A;  2ZJ9 A;  4GDB A;  4RX2 A;  5FI6 A;  2Y2G A;  4MEZ A;  4DXC A;  2IWC A;  2Y59 A;  4QHC A;  4LCM A;  1YLT A;  5HW3 A;  4U0T A;  3JYI A;  3O86 A;  3Q7Z A;  3BFG A;  3CMZ A;  5GHY A;  1K55 C;  5DTS A;  3RXW A;  5DF7 A;  1ESU A;  3HLD A;  4Z9Q A;  1RGZ A;  3IHA A;  1K55 A;  2R9X A;  3HUO A;  3Q81 A;  2Q9N A;  5CTN A;  3BFE A;  3ISG A;  3UPN A;  3HL9 A;  4X55 A;  4OP8 A;  4UAA A;  1HVB A;  3LY3 A;  4QB8 A;  2JBF A;  3IXG A;  3HLB A;  2GDN A;  4KEN B;  5FQ9 A;  3DWK A;  4DF6 A;  5DTT A;  2ZC4 B;  3IH8 A;  1ALQ A;  3LEZ A;  4DE3 A;  1FCO A;  5HX9 A;  5EOE A;  3ZVT A;  2XFT A;  2XGN A;  5JYP A;  4OVD A;  4UA7 A;  4JXS A;  1K56 D;  3MKE A;  5TR7 A;  1KE3 A;  2ZLY A;  3S22 A;  1N9B A;  1I2S A;  1ES3 A;  5CER A;  1DJC A;  3V3R A;  3A3I A;  3HLE A;  3NI9 A;  4JXG A;  4ZBE A;  4FCF A;  4C3Q A;  2UWX A;  1I2W A;  1DJA A;  1W5D A;  3DTM A;  5TFQ A;  4X53 A;  1L0D A;  1NXY A;  2ZC7 A;  3IF6 B;  3BLM A;  3UDX A;  4GNU A;  3MBZ A;  3IHB A;  1E3U D;  4N9K A;  4FH2 A;  3WRT A;  4U0X A;  5CEC A;  1W8Y A;  4FSF A;  4A5R A;  1WYB A;  5CHM A;  5D3O A;  1JVJ A;  2WGV A;  2Y2I A;  4ID4 A;  2EXB A;  2PU2 A;  3GTC A;  1YM1 A;  1XKZ A;  3HLC A;  4PM6 A;  2WKH A;  4IBX A;  1YMX A;  1EWZ A;  1BT5 A;  1ONH A;  3TG9 A;  1M6K A;  2G2W A;  4IED A;  2WAE A;  4GD8 A;  1PI4 A;  1TDG A;  3G4P A;  3M6H A;  4LV3 A;  4X56 A;  3IF5 A;  2PBY A;  5FAT A;  4WZ5 A;  5GLB A;  1GHP A;  3HBR A;  2ZC6 B;  3QNB A;  5A93 A;  1Q2P A;  3FV7 A;  4JXV A;  4ZJ3 A;  3ZHH A;  3SS4 A;  2ZM0 A;  5I94 A;  4JLF A;  2J9O A;  2ZQD A;  4MBF A;  5EVI B;  3LCE A;  3WS1 A;  2G2U A;  3IWI A;  3VSK A;  4E6X A;  2Y2L A;  3G35 A;  2P74 A;  2HDU A;  2ZD8 A;  2ZC3 B;  1ES2 A;  3GSG A;  2ZC5 B;  5CHJ A;  4E3M A;  4F94 A;  1LHY A;  2J7V A;  2J9P A;  5FA7 A;  3AGF A;  1GHM A;  3MZD A;  2ZQ9 A;  3PTE A;  4E3N A;  4S2N C;  2ZQ8 A;  4LEN A;  1ERM A;  4WBG A;  4EWF A;  1LLB A;  5E2G A;  4ZAM A;  1IEL A;  3FKW A;  3UPP A;  4PM7 A;  1KGG A;  2P9V A;  4S2N A;  3OC2 A;  3W8K A;  1YLJ A;  2BLS A;  3HUN A;  2X01 A;  4L0L A;  3M2J A;  4WEK A;  3UO9 A;  3VMA A;  3C4O A;  1PYY A;  4R4S A;  3A3J A;  3ZGA B;  1CEG A;  2HDS A;  3SS5 A;  2XK1 A;  4E3I A;  1G6A A;  1BZA A;  1E25 A;  3QHY A;  1CI8 A;  3EQU A;  4KZ5 A;  1XGJ A;  3NDE A;  1FSW A;  4K0W A;  1BTL A;  2HDR A;  2Y2M A;  4HBT A;  2WGI A;  4KZ6 A;  1HZO A;  3PBS A;  1ERO A;  3WS0 A;  5HFO A;  4S2L A;  2DCF A;  4Q8I A;  3S4X A;  2HP9 A;  3BM6 A;  2XFS A;  5EVI D;  2Y55 A;  3GMW A;  5M19 A;  3OCL A;  1TDL A;  4OLG A;  3Q07 A;  3VP3 A;  3MXR A;  5CGS A;  4R3B A;  3NBL A;  4XXR A;  5HL1 A;  4BJP A;  2XD1 A;  2BG1 A;  3HUM A;  4GN2 A;  4FH4 A;  1LL5 A;  2C6W B;  5AQ9 A;  4DDS A;  3IWO A;  4EBL A;  4EBP A;  1NYM A;  1PW1 A;  3PAG A;  4QJG A;  1YLY A;  1IYS A;  4GZB A;  1PI5 A;  2RCX A;  2I72 A;  1SCW A;  1MWS A;  3GQZ A;  4QD4 A;  4S2K A;  5FQQ A;  5HAI A;  4X6T A;  1H5X A;  4EBN A;  4ZTK A;  1ES5 A;  2FFY A;  3O88 A;  1RCJ A;  3M2K A;  1NZU A;  2Z2M B;  4KZ3 A;  1LI9 A;  4OPR A;  3A3D A;  3LO7 A;  5FQJ A;  1XPB A;  4S2I A;  2CC1 A;  2B5R A;  5CGX A;  3ZDJ A;  3ZNT A;  3BFC A;  4MBH A;  3V5M A;  5FAQ A;  3PBQ A;  2VGK A;  4GOG A;  5AQA A;  1ZKJ A;  4E3O A;  3D4F A;  1K56 A;  3E2K A;  5EPH A;  4N9L A;  1G68 A;  4YFM A;  2EX6 A;  3ZG5 A;  4U3T A;  3VP0 A;  1M40 A;  1XXM A;  2EFU A;  2X71 A;  4EUZ A;  4PMA A;  2Y2Q A;  1DY6 A;  3HVF A;  3SS3 A;  5DF8 A;  4KZ8 A;  3V39 A;  4OPZ A;  1WYC A;  4H8R A;  2Y2H A;  4MNR A;  4CJN A;  3PBO A;  1MY8 A;  4P87 A;  2IWB A;  1HTZ A;  4DE0 A;  3OPH A;  2WZX A;  4OPY A;  4OH0 A;  2XH9 A;  3WRZ A;  4OQG A;  4EV4 A;  4CPK A;  4DDY A;  1XX2 A;  5CTM A;  2EX9 A;  4IBR A;  2QZ6 A;  4IVK A;  1TEM A;  3IXB A;  5AQB A;  4K0X A;  4QY6 A;  2Y2N A;  5AQ7 A;  3DW0 A;  3UE0 A;  4E6W A;  2H0Y A;  4KQQ A;  4OP5 A;  4EQI A;  4BL2 A;  5A92 A;  3FYZ A;  3MFD A;  3G2Y A;  2WAD A;  3OPL A;  2H0T A;  3SH7 A;  1K6S A;  3O3V A;  3PAE A;  3SOI A;  4WZ5 C;  2OV5 A;  4X69 A;  4E3K A;  4YIN A;  3V3S A;  5E2H A;  2OLU A;  3BEC A;  2XEP A;  3IF6 C;  4R4R A;  5HAR A;  4ZJ1 A;  1HD8 A;  3IF6 A;  1FR1 A;  2EX2 A;  3C7V A; 
#chains in the Genus database with same CATH topology
 1KOU A;  2AVX A;  3IQA A;  1KDW A;  4UEY A;  4MN5 A;  3CHW P;  2J80 A;  2QJ5 A;  4DKI A;  4UHU A;  1CJF A;  3S7N A;  4R23 A;  1XA7 A;  2A49 A;  1YLP A;  1PZP A;  2W3D A;  1GSV A;  3C8C A;  4LLO B;  4S2M A;  3TOI A;  1O7E A;  4PKY A;  1K54 A;  2QHK A;  2G7U A;  4PM8 A;  3LUQ A;  1DRM A;  4ETZ A;  4JKT A;  3D3O A;  1YAX A;  4L9G A;  3T4K A;  3WWX A;  3Q82 A;  5FAP A;  1NRJ A;  3IXD A;  3VP4 A;  3S7Q A;  1TVF A;  4D2O A;  3CJM A;  2O0Y A;  5K5B A;  2ZMA A;  4YWZ A;  3O5Y A;  3VFH A;  4FTX A;  3HLW A;  3G32 A;  3UNW A;  2DRW A;  4LV0 A;  5GHZ A;  1RGY A;  1XFQ A;  3DTK A;  2QMI A;  2EWV A;  3FC7 A;  2PYP A;  4WLA A;  1ES4 A;  3SH9 A;  2W1T A;  1D1J A;  1G28 A;  1K25 A;  3MMH A;  2W27 A;  4QY5 A;  2PHY A;  2VGJ A;  2KOI A;  1OJ5 A;  3UY6 A;  1Y28 A;  5MC7 A;  5HAQ A;  3OPP A;  2Y4A A;  3E4O A;  1SKF A;  2VZW A;  5CGW A;  1K4F A;  1BLS A;  3MQ0 A;  1KVM A;  3TRC A;  4UA9 A;  3IWQ A;  2ZQA A;  1P9W A;  3HLF A;  5BOH A;  2CMN A;  3LY4 A;  3GRJ A;  2HDQ A;  2D02 A;  3VOY A;  1K4E A;  3GV9 A;  3FKV A;  5EM1 A;  3DTI A;  3ZG9 B;  5F82 A;  2DNS A;  5FQM A;  1N4O A;  1TS7 A;  3S7P A;  3NHQ A;  4RVA A;  3HLG A;  3UN7 A;  2EWW A;  4R0Q A;  4QPR A;  4G3K A;  3VE4 A;  5FEF A;  1DP8 A;  3N4I A;  3ITB A;  5EVE A;  4R38 A;  3UPO A;  1V9Y A;  1FCN A;  3HJI A;  3LIC A;  2Y91 A;  5HAP A;  1KE4 A;  4BD0 A;  2Q9M A;  2IWD A;  1SHV A;  1PW8 A;  5FEG A;  1VQQ A;  2JHE A;  2C5W B;  4E3J A;  3NY4 A;  5F83 A;  3T1Q B;  4HJ3 A;  5CHU A;  5F1G A;  1DJB A;  4B88 A;  4Q0H A;  4OPQ A;  1OTI A;  3EGD C;  1YT4 A;  1F2K A;  2XF3 A;  5EE8 A;  2P08 A;  1I5Q A;  4OOM A;  5IHV A;  1FR6 A;  3BFF A;  4Y7P A;  2WAF A;  3W4O A;  1MKI A;  1MWR A;  3MF0 A;  3GEC A;  3CUE A;  3C5A A;  5GHX A;  1U60 A;  2KDK A;  3KYQ A;  5DFY A;  5KSC A;  5M18 A;  1J9M A;  3RXX A;  3WS5 A;  1XGI A;  1OTE A;  5GLA A;  1IYQ A;  1JWZ A;  3F1O A;  2ZJ9 A;  1UWP X;  4RX2 A;  4DXC A;  2B02 A;  2A2L A;  4QHC A;  2PDR A;  4LCM A;  1YLT A;  4U0T A;  1STZ A;  3CMZ A;  5DF7 A;  1UGU A;  3H7W B;  3UME A;  3GDI A;  1K55 A;  2M7U A;  2Q9N A;  3BFE A;  3HL9 A;  4X55 A;  3K2N A;  3LY3 A;  2JBF A;  5DTT A;  4LPZ A;  5AVE A;  1K56 D;  1N9B A;  1DJC A;  3A3I A;  1OPX A;  3LIE A;  4ZBE A;  3H7W A;  1I2W A;  1W5D A;  4DJ2 A;  1L0D A;  2ZC7 A;  3UDX A;  4GNU A;  1IOU A;  1E3U D;  4N9K A;  4FSF A;  3MQQ A;  2WGV A;  2XRO A;  1YM1 A;  5DFX A;  4X25 A;  1JNU A;  3E0Y A;  1ONH A;  3LFV A;  4IED A;  1PI4 A;  1TDG A;  3M6H A;  5FAT A;  3IX3 A;  4WZ5 A;  1TS0 A;  4JXV A;  2ZM0 A;  4JLF A;  4E6X A;  3VSK A;  2Y2L A;  1OTA A;  4NXE A;  3G35 A;  2HDU A;  2PD7 A;  3GSG A;  1YKD A;  4WBG A;  2ZQ8 A;  1ERM A;  3PYP A;  1IEL A;  4PM7 A;  3W8K A;  1YLJ A;  3B47 A;  4HJ6 A;  3VMA A;  3A3J A;  3T4O A;  4E3I A;  1G6A A;  3JVU A;  4NG2 A;  1PNE A;  1CI8 A;  3K3D A;  3TJZ C;  4E04 A;  3KSF A;  1S4S A;  4KZ6 A;  5HFO A;  2HV1 A;  4Q8I A;  3S4X A;  2OWH A;  2Y55 A;  3GMW A;  5M19 A;  1TDL A;  3VV4 A;  5HPF A;  4L9E A;  4GN2 A;  2C6W B;  5AQ9 A;  4EBP A;  1NYM A;  1MWS A;  3BQ8 A;  1RCJ A;  2JKF A;  4WL9 A;  4KZ3 A;  3A3D A;  3LO7 A;  4S2I A;  3ZYT A;  4NXF A;  2JKT I;  3ZDJ A;  3PR6 A;  3LI9 A;  2PRF A;  2J3W A;  3V5M A;  2VGK A;  4E3O A;  1K56 A;  3E2K A;  3UB9 A;  4MDZ A;  5EPH A;  3H82 A;  1G68 A;  2EX6 A;  4MN7 A;  4KZ8 A;  2IWB A;  3OPH A;  4EES A;  2QZ6 A;  4NXB A;  3IXB A;  3DW0 A;  2H0Y A;  1XJ6 A;  5A92 A;  3G2Y A;  3R4K A;  3IBR A;  4B9O A;  2QJ7 A;  4X69 A;  2NUT C;  4E3K A;  4B93 A;  2VX8 A;  4YIN A;  1YPR A;  4BWI A;  3V3S A;  5HAR A;  4X1L A;  2EX2 A;  3C7V A;  4KUK A;  3KSI A;  4JGP A;  2WZZ A;  1K57 A;  4DE1 A;  1YLW A;  4JF6 A;  4GHI A;  1XA1 A;  3KYE A;  3C38 A;  2OSU A;  1PWG A;  2PT7 A;  3LR3 A;  4RYE A;  2XQZ A;  4BQM A;  4LCL A;  5DTK A;  5JYO A;  2IA2 A;  2X02 A;  1N9O A;  5CRF A;  1E4D A;  3QP6 A;  4P0M A;  4H6J A;  4IVI A;  2GNX A;  4PAU A;  3RJU A;  5IS1 A;  1FOF A;  3W4P A;  4ARZ A;  4K91 A;  3CG5 A;  4LRY C;  1IKI A;  4PM9 A;  1EI5 A;  1P97 A;  1L0E A;  4KZB A;  4HQA A;  5EM0 A;  3BY9 A;  1C3B A;  1JWV A;  5KZH A;  1W8Q A;  1G6O A;  5CX7 A;  4PPR A;  4LV1 A;  5E2F A;  2JC7 A;  3T1R A;  3AGD A;  3T4T A;  1S0W A;  4BBV A;  5EUA A;  1LSV A;  5FDH A;  2ZL1 A;  1RP5 A;  2H10 A;  4HIA A;  1YLZ A;  5HPI A;  2V1Z A;  2Y2P A;  4OOY A;  1P9R A;  1KE0 A;  1KGE A;  3N8L A;  3NIA A;  5HDC A;  4E3L A;  1W63 M;  1JTG A;  3PBN A;  4X68 A;  4GCZ A;  1CEF A;  1NZO A;  4B4Z A;  2HPB A;  3QNC A;  3HCY A;  1IEM A;  3NOU C;  1FCM A;  4CLC D;  3N8R A;  3UDI A;  3E4Q A;  2PR5 A;  4XUZ A;  2EFX A;  5HZH A;  3UE1 A;  1GHI A;  3GR2 A;  1XP4 A;  1Z6F A;  1NY0 A;  2GX5 A;  1N9L A;  3FZC A;  1NJ4 A;  4FD8 A;  3BEB A;  5FQI A;  1KDS A;  2XA7 M;  1OME A;  3ICY A;  1YSP A;  4DMZ A;  2WKE A;  1BLH A;  4BLM A;  1GSW A;  5EFW A;  3E4P A;  3OZH A;  1ZG4 A;  1FIK A;  1SKO A;  3CWF A;  5EVI C;  4O8G A;  5L2F A;  2QPN A;  2V8F A;  1GA0 A;  3NOT C;  4GDN A;  4S2O A;  2ZQC A;  4RQ9 A;  5FSR A;  1S66 L;  2ZBB A;  3RH8 B;  1LI0 A;  4GS9 B;  2ZQ7 A;  2WGW B;  2V1B A;  2PYR A;  3N6I A;  5FAS A;  3A0V A;  1MXO A;  4PKY G;  4Y0U A;  1F98 A;  1XJ2 A;  1K0K A;  4OKP A;  2WK0 A;  3LI8 A;  4WZ4 A;  3NEC A;  4K08 A;  4OQH A;  1D06 A;  4MCW A;  1XFN A;  4R3J A;  5AVF A;  5HDD A;  1Q2Q A;  4GS9 A;  4CLC B;  2WGW A;  3AGE A;  4Y0O A;  1MWU A;  4OLD A;  2PBD P;  1LSX A;  3G30 A;  3IS2 B;  3NCK A;  5TJJ A;  2O9C A;  2Y2O A;  4EW7 A;  4GDB A;  4HY8 A;  2Y2G A;  4MEZ A;  3U4L P;  5HW3 A;  2EA9 A;  3JYI A;  1T18 A;  1J3W A;  5GHY A;  1K55 C;  4HP4 A;  3JVV A;  4Z9Q A;  2Y79 A;  1RGZ A;  4CLC A;  2R9X A;  3HUO A;  3Q81 A;  4HNB A;  3ISG A;  4UAA A;  3L9K A;  4QB8 A;  2Y8H A;  4KEN B;  4DF6 A;  3DWK A;  2ZC4 B;  3ZVT A;  2XFT A;  2HZ5 A;  5TR7 A;  1ES3 A;  2JN7 A;  1DJA A;  1S1Y A;  4LRX C;  5TBM B;  3IF6 B;  4ETX A;  3BLM A;  2OAQ 1;  2W1R A;  4EER A;  4U0X A;  5CEC A;  3T4Q A;  5CHM A;  3LEQ A;  4ID4 A;  2YKF A;  1XKZ A;  4PM6 A;  1YSQ A;  4R3A A;  2WKR A;  2G2W A;  2V9A A;  1ZHH B;  4X56 A;  1G5U A;  1GHP A;  2KX6 A;  2ZC6 B;  3HBR A;  3MR0 A;  3FV7 A;  3A0S A;  1GSX A;  2J9O A;  2ZQD A;  5EVI B;  3SW1 A;  2O9A A;  3IWI A;  4IHQ A;  1NLY A;  2ZC5 B;  5F5Y A;  2O9B A;  3AGF A;  2ZQ9 A;  4CQH A;  3W2Z A;  3UPP A;  1S67 L;  4S2N A;  2X01 A;  4L0L A;  3M2J A;  2M1C A;  3ZGA B;  4BBU A;  3SS5 A;  4XT2 B;  1BZA A;  1E25 A;  4KZ5 A;  4K0W A;  1BTL A;  1HZO A;  1ERO A;  2VLG A;  3WS0 A;  3BM6 A;  2XFS A;  4LRZ E;  4OLG A;  3Q07 A;  4HP9 A;  4R70 A;  3K3C A;  3NBL A;  5HL1 A;  4BJP A;  2XD1 A;  4FH4 A;  3IWO A;  1PW1 A;  1PI5 A;  1T1B A;  2I72 A;  4QD4 A;  5HAI A;  5FDS A;  4UQI M;  4EBN A;  1ES5 A;  3M2K A;  1NZU A;  1LI9 A;  2VJW A;  4OPR A;  2Z6C A;  5FQJ A;  3EEA A;  3BFC A;  4QWO A;  1NWZ A;  4P6Z M;  4GOG A;  3MFX A;  3B42 A;  3BJN A;  1ACF A;  3KSG A;  2L1M A;  2O99 A;  4U3T A;  1T19 A;  4EUZ A;  5DKL A;  1MKM A;  1DY6 A;  2V8C A;  2XA7 S;  3V39 A;  4OPZ A;  4H8R A;  3PBO A;  4Q0J A;  2DMW A;  4EUV A;  4OH0 A;  5L8M A;  4CPK A;  2GJ3 A;  1XX2 A;  5HL6 A;  5CTM A;  5J3W A;  2EX9 A;  1TEM A;  4HOI A;  4QY6 A;  4E6W A;  3NUL A;  4BL2 A;  4Y17 A;  4MMN A;  3SH7 A;  3O3V A;  1F5M A;  5HSQ A;  2OV5 A;  1DP9 A;  2OOL A;  5E2H A;  4R4R A;  1AWI A;  4M4X A;  4ZJ1 A;  2WKP A;  1FR1 A;  1CK3 A;  2PD8 A;  4M3K A;  3KX0 X;  5E2E A;  1MPL A;  3VP1 A;  5DVA A;  2HJ9 C;  1VEU B;  3IT9 A;  2W3H A;  5EVL A;  3VOZ A;  1KGF A;  3OCN A;  3BRM A;  4ESP A;  3ZCZ A;  1PZO A;  5TGF A;  3MZF A;  3R7W B;  2JKG A;  3NOP C;  3BFD A;  4KG2 A;  2KLI A;  3UMD A;  5EOO A;  3BLS A;  2D01 A;  1MBL A;  3E2L A;  2HF6 A;  2INW A;  3MKF A;  2V0W A;  4HBU A;  3I7J A;  2A3U A;  3Q7V B;  4GLQ A;  4OOL A;  3ZG8 B;  3R7W A;  4HI4 A;  1ZTU A;  4S2P A;  2WUQ A;  4BMW A;  2V20 A;  3VP2 A;  1TS6 A;  4KG6 A;  4RX3 A;  4O7D A;  3LYX A;  3CIT A;  2OWJ A;  4GD6 A;  1T1A A;  4LV2 A;  2J3T C;  3T1X A;  2E8I A;  2FFF B;  4BD1 A;  4ZRR A;  3ZQ5 A;  1H8Y A;  3LR4 A;  5EV0 A;  3BW6 A;  4DN0 A;  2VV7 A;  2A24 B;  3QP4 A;  4CLC E;  1WA9 A;  1QME A;  2ZM2 A;  3C4P A;  3BQA A;  3TE8 A;  1E3U A;  2VKS A;  5HD3 A;  4WYY A;  1YQS A;  2BTF P;  3MXQ A;  1FQG A;  4N1X A;  3W4Q A;  4ZDX A;  1W79 A;  3FPW A;  2JCH A;  3DAV A;  3IX4 A;  2V2F F;  5KSH A;  3N7W A;  3D9Y A;  4JBF A;  4MBK A;  3P09 A;  3O87 A;  1VET B;  1H0M A;  5M1A A;  4UA6 A;  3EGX C;  3UB5 P;  2VA0 A;  1TS8 A;  2BAS A;  3P01 A;  3UDF A;  3ZNY A;  3LR5 A;  2EX8 A;  1LL9 A;  4GB7 A;  1MWT A;  3DWZ A;  3N8S A;  1JTD A;  3D72 A;  5G4Y A;  1X0O A;  1K38 A;  4KZ7 A;  4P6B A;  1BSG A;  1KVL A;  3FWL A;  3E98 A;  5J8X A;  5FQK A;  3HRE A;  5FL3 A;  3VSL A;  4PM5 A;  2P9V B;  1GA9 A;  3CPT B;  3U2A A;  3SZT A;  1CQA A;  3LIF A;  3V67 A;  2YKH A;  1F9I A;  3TSG A;  1S1Z A;  2PAV P;  3B3X A;  3VE3 A;  3ZVW A;  3QP5 A;  4UQI S;  5GLC A;  4EEU A;  1K54 C;  1NLZ A;  2XSS A;  3WS4 A;  4OON A;  1S6R A;  3CPT A;  4JGO A;  2H28 A;  1BUL A;  3MZE A;  3OPR A;  1L2S A;  5A91 A;  4P6Z S;  4I39 A;  3CZD A;  2P04 A;  2LB5 A;  2XLN A;  4C6Y A;  2ZM8 A;  3A3E A;  1PIO A;  3T4J A;  3F1P B;  4KG5 A;  5FI2 A;  1FSY A;  1AXB A;  4QU3 A;  4WEJ A;  4IUK A;  1DP6 A;  4XUX A;  3A3F A;  3GVB A;  4KZA A;  1LSW A;  3UB8 A;  5FI7 A;  5DF9 A;  4AFI A;  1ONG A;  4B4X A;  3G2Z A;  3LIB A;  4Y5F A;  4GW9 A;  4Y15 A;  4BEN A;  1ZC2 A;  4JGR A;  2Y59 A;  3O86 A;  3Q7Z A;  5HDS A;  3BFG A;  2JKR M;  1ESU A;  3HLD A;  1OT6 A;  3IHA A;  4EQ1 A;  3UPN A;  2P7J A;  1BYW A;  4OP8 A;  3IXG A;  5A8B A;  5FQ9 A;  3IH8 A;  2MJ6 A;  1ALQ A;  3LEZ A;  4DE3 A;  1FCO A;  5HX9 A;  2XGN A;  2E8J A;  3MKE A;  2ZLY A;  1I2S A;  2ZOH A;  5CER A;  3HLE A;  3NI9 A;  2ZMF A;  2UWX A;  3DTM A;  5TFQ A;  4EEP A;  3QP8 A;  1MZU A;  4FH2 A;  3WRT A;  3KSH A;  1WYB A;  1JVJ A;  2Y2I A;  1V9Z A;  2PU2 A;  3GTC A;  2Z6D A;  4Y3I A;  3HLC A;  2WKH A;  4IBX A;  1YMX A;  4HHD A;  2W3F A;  3NJA A;  3G4P A;  4LV3 A;  3IF5 A;  5DJU A;  3QNB A;  5A93 A;  2OAP 1;  3ZHH A;  4MBF A;  3LCE A;  3WS1 A;  4ME4 A;  2PR6 A;  3MSH A;  2P74 A;  2ZD8 A;  1ES2 A;  4F94 A;  1LHY A;  2J9P A;  5FA7 A;  4MN6 A;  1OT9 A;  2K2N A;  2L4R A;  4S2N C;  4LEN A;  5F69 A;  1LLB A;  5E2G A;  2VGL S;  4ZAM A;  1XJ3 A;  3OC2 A;  3HUN A;  3LID A;  2UV0 E;  4WEK A;  5I5L A;  3UO9 A;  5DJT A;  2FZ0 A;  1PYY A;  1VHM A;  1ODV A;  3IBJ A;  2XK1 A;  4EET B;  2B18 A;  3P7N A;  1FSW A;  3CUE C;  2Y2M A;  2WGI A;  4WF0 A;  3PBS A;  4NXG A;  5L10 A;  5EVI D;  3VP3 A;  3HJK A;  4I3A A;  3MXR A;  3VOL A;  4DDS A;  4EBL A;  5C5K A;  1CF0 A;  3GQZ A;  4S2K A;  1HLU P;  2W1T B;  1H5X A;  1FIL A;  2FFY A;  1H3Q A;  2Z2M B;  2ZMV A;  3ULF A;  3IX8 A;  1XPB A;  3C2W A;  4G3V A;  2B5R A;  5CGX A;  5J4E A;  2VV8 A;  3PBQ A;  5AQA A;  1ZKJ A;  3D4F A;  3IS2 A;  4N9L A;  4YFM A;  2ZOI A;  1OTB A;  3ZG5 A;  4FOF A;  3VP0 A;  1M40 A;  1XXM A;  2EFU A;  3SS3 A;  3H9W A;  1WYC A;  3QP2 A;  1MY8 A;  4P87 A;  3RTY A;  1HTZ A;  3OLO A;  5KIZ A;  3LIA A;  3WRZ A;  4EV4 A;  4KQD A;  4DDY A;  4YOF A;  4IBR A;  5AQB A;  4K0X A;  5AQ7 A;  2Y2N A;  4KUO A;  4KQQ A;  4OP5 A;  4EQI A;  3FYZ A;  3OPL A;  5L09 A;  2QWS A;  3UE6 A;  2H0T A;  4WZ5 C;  1D7E A;  2OLU A;  5TBM A;  3IF6 A;  1XJ4 A;  4P85 A;  4NET A;  1L0F A;  4KZ4 A;  4Y0T A;  1Y54 A;  1CI9 A;  3UE3 A;  4WMC D;  1WE4 A;  4DRT A;  4G3W A;  1SDN A;  2VV6 A;  3VFF A;  4ZJ2 A;  3S1Y A;  3T12 B;  2VEA A;  4KQR A;  3A0R A;  4HES A;  5GL9 A;  1YMS A;  3C7U A;  5EVI A;  1N9N A;  3LGO A;  3G31 A;  3NDG A;  1Y4O A;  2Q0O A;  4DXB A;  3LR0 A;  1GCE A;  2GZA A;  4C75 A;  1PWC A;  3SH8 A;  3BYD A;  5CED A;  5A90 A;  1VB6 A;  1H8Z A;  2V0U A;  5CEB A;  4EU0 A;  3EOI A;  5G4Z A;  1NYY A;  1Z09 A;  4DE2 A;  4EXO A;  3F1O B;  4XT2 A;  1NRF A;  3MXS A;  4MLL A;  4NK3 A;  4Y2F A;  4HH3 A;  3G6O A;  4BL3 A;  4WEL A;  4WUJ A;  3PBT A;  3G34 A;  4KQO A;  2Z2L B;  3EQV A;  2J8Y A;  2XR0 A;  2XD5 A;  3NC8 A;  1VM1 A;  1PWD A;  1SZV A;  2QYB A;  2W3G A;  3PBR A;  2OLV A;  4WM9 A;  2HJE A;  1K6R A;  2WYX A;  4DJ3 A;  3MJQ A;  5U47 A;  1ERQ A;  2W3E A;  1BLP A;  3Q1F A;  1LL8 A;  2XRN A;  5F68 A;  2PU4 A;  4N92 A;  1ESI A;  5KMW A;  4S2J A;  3UB7 A;  2WKQ A;  4JXW A;  1L0G A;  5IT5 A;  1BUE A;  2W0N A;  2RL3 A;  5J7E A;  3T4L A;  3M6B A;  4HH2 A;  4JF4 A;  5EEC A;  1H8M A;  4JPM A;  4OQ0 A;  4KZ9 A;  4RA7 A;  5E43 A;  4JF5 A;  3KYZ A;  3T4S A;  3IXH A;  1JWP A;  4WMC A;  2L0W A;  5GLD A;  3CI6 A;  4R6L A;  2JE5 A;  1K57 C;  3IH9 A;  2EXA A;  4EWF A;  4OQI A;  2WKI A;  4PHT A;  4N1H A;  2ACG A;  2I9V A;  1T1C A;  1IKG A;  1LT0 A;  4Z1W A;  3WS2 A;  2H5S A;  2R9W A;  1IFQ A;  4FUW A;  1SDE A;  1O07 A;  5CXW A;  2HP6 A;  2Y2K A;  1EW0 A;  2Y2J A;  3ZG0 A;  4II7 A;  1ZG6 A;  4LGW A;  5FAO A;  1PRQ A;  3ITA A;  1VEU A;  3BY8 A;  4R1G A;  3TW8 A;  3ZFZ A;  4O0P A;  2K31 A;  1BLC A;  1QMF A;  3ZG7 B;  1IYO A;  5IU1 A;  5G18 A;  1IYP A;  1A0K A;  5F6A A;  3DBA A;  5F1F A;  1P0Z A;  4YNR A;  3C30 A;  3JPU A;  4HEF A;  4GKU A;  2VGL M;  1W7F A;  3OOV A;  2VK3 A;  3V50 A;  5HWV A;  3H82 B;  2XDM A;  3Q7V A;  2HP5 A;  3P98 A;  3S7O A;  4IUH A;  5FI6 A;  2IWC A;  2JKR I;  5DTS A;  3RXW A;  5CTN A;  1HVB A;  3HLB A;  2GDN A;  3KO6 A;  4GJ4 A;  3BWL A;  5EOE A;  3FG8 A;  3T1S A;  5JYP A;  4OVD A;  4UA7 A;  4JXS A;  2A24 A;  1KE3 A;  3S22 A;  2J3T D;  5AJG A;  3V3R A;  1S4R A;  4JXG A;  3MQO A;  4FCF A;  4C3Q A;  2K7S A;  3F1N B;  1L3L A;  4X1M A;  1NXY A;  3MBZ A;  3IHB A;  4F3L B;  1W8Y A;  4A5R A;  2R78 A;  5D3O A;  3FPV A;  4I3I A;  3T50 A;  3B33 A;  2EXB A;  1UWN X;  3UB6 A;  1PFL A;  1VET A;  4I38 A;  1EWZ A;  1BT5 A;  3TG9 A;  1M6K A;  4GHI B;  2WAE A;  1OJG A;  1TF1 A;  4GD8 A;  4I5S A;  5GLB A;  2PBY A;  1Q2P A;  4ZJ3 A;  3SS4 A;  3F1N A;  5I94 A;  4L9F A;  2G2U A;  4F3L A;  4NKP A;  2ZC3 B;  5CHJ A;  4E3M A;  2J7V A;  1GHM A;  3MZD A;  3PTE A;  4E3N A;  3FKW A;  1KGG A;  2P9V A;  4H6J B;  4IJG A;  2BLS A;  3C4O A;  5L07 A;  3CAX A;  4ARZ B;  4R4S A;  4HJ4 A;  5DKK A;  1CEG A;  2HDS A;  3L7H A;  3QHY A;  4Q0I A;  3EQU A;  1XGJ A;  3NDE A;  2HDR A;  4HBT A;  4D60 A;  3PHY A;  3DTE A;  4S2L A;  2DCF A;  2HP9 A;  2NUP C;  3OCL A;  2V1A A;  5CGS A;  4R3B A;  4XXR A;  5LBR A;  2BG1 A;  3HUM A;  1LL5 A;  3PAG A;  4QJG A;  5HWW A;  1YLY A;  1IYS A;  4GZB A;  2RCX A;  2ZL1 B;  1SCW A;  5FQQ A;  3F1P A;  4X6T A;  2HGV A;  3RFB A;  4ZTK A;  3O88 A;  1MC0 A;  4O01 A;  2CC1 A;  3ZNT A;  2JKT M;  4WN5 A;  4CLC C;  4MBH A;  1TD5 A;  4NEE D;  5FAQ A;  2M7V A;  3PXP A;  1OTD A;  2X71 A;  4Y13 A;  4PMA A;  2Y2Q A;  3HVF A;  5DF8 A;  4CJN A;  2Y2H A;  4MNR A;  4JGQ A;  4DE0 A;  2WZX A;  4OPY A;  1W63 Q;  2XH9 A;  3MS6 A;  4OQG A;  4IVK A;  3UE0 A;  3CLO A;  2QKP A;  3MFD A;  2WAD A;  3QP1 A;  1K6S A;  3OBF A;  3PAE A;  3SOI A;  4LFU A;  2B95 A;  2LB9 A;  2FH5 A;  5HD5 A;  4BBT A;  3BEC A;  2XEP A;  3EEH A;  3IF6 C;  4I3J A;  1SKO B;  5HWT A;  1HD8 A;  3EWK A;  4X53 A; 
#chains in the Genus database with same CATH homology
 4P85 A;  4NET A;  1CK3 A;  1L0F A;  4KZ4 A;  3IQA A;  2WZZ A;  4Y0T A;  4M3K A;  1Y54 A;  1CI9 A;  1K57 A;  5E2E A;  1MPL A;  3UE3 A;  4DE1 A;  3VP1 A;  4WMC D;  1KDW A;  1WE4 A;  4DRT A;  1YLW A;  5DVA A;  4JF6 A;  3IT9 A;  1SDN A;  4DKI A;  5EVL A;  3VOZ A;  1XA1 A;  4UHU A;  1KGF A;  3OCN A;  2OSU A;  3BRM A;  3VFF A;  4ZJ2 A;  1PWG A;  1PZO A;  5TGF A;  3S1Y A;  3MZF A;  4RYE A;  3ZCZ A;  4KQR A;  4R23 A;  2XQZ A;  4HES A;  5GL9 A;  1YMS A;  1XA7 A;  2A49 A;  3C7U A;  1YLP A;  5EVI A;  1PZP A;  4BQM A;  4LCL A;  3G31 A;  3NDG A;  3BFD A;  4KG2 A;  4DXB A;  1GCE A;  5DTK A;  4S2M A;  3TOI A;  5JYO A;  5EOO A;  1O7E A;  1K54 A;  2X02 A;  3BLS A;  4PM8 A;  4C75 A;  1PWC A;  3SH8 A;  3BYD A;  4JF5 A;  5CRF A;  1E4D A;  1MBL A;  4P0M A;  3E2L A;  5A90 A;  5CED A;  1H8Z A;  4JKT A;  3MKF A;  5CEB A;  4IVI A;  4HBU A;  3WWX A;  3RJU A;  1FOF A;  3W4P A;  3I7J A;  3Q82 A;  2A3U A;  5FAP A;  3Q7V B;  3IXD A;  4OOL A;  4K91 A;  1NYY A;  3CG5 A;  3ZG8 B;  1IKI A;  4S2P A;  4DE2 A;  3VP4 A;  1NRF A;  1TVF A;  3MXS A;  4MLL A;  2WUQ A;  4NK3 A;  4PM9 A;  1EI5 A;  4D2O A;  3CJM A;  4BL3 A;  4WEL A;  1L0E A;  2V20 A;  2ZMA A;  3PBT A;  4KZB A;  3G34 A;  4KQO A;  3VFH A;  2Z2L B;  3HLW A;  3VP2 A;  3G32 A;  4KG6 A;  1C3B A;  1JWV A;  2J8Y A;  3EQV A;  3UNW A;  2DRW A;  4RX3 A;  4O7D A;  4LV0 A;  5GHZ A;  5KZH A;  1RGY A;  1W8Q A;  2XR0 A;  2XD5 A;  3NC8 A;  1VM1 A;  1PWD A;  4GD6 A;  4PPR A;  4LV2 A;  2QMI A;  4LV1 A;  2E8I A;  2FFF B;  2JC7 A;  5E2F A;  4BD1 A;  3AGD A;  1H8Y A;  1S0W A;  5EUA A;  1ES4 A;  3PBR A;  5FDH A;  3SH9 A;  2OLV A;  1RP5 A;  1K25 A;  2H10 A;  4WM9 A;  1YLZ A;  2V1Z A;  2Y2P A;  1K6R A;  2WYX A;  4OOY A;  1QME A;  2ZM2 A;  4QY5 A;  5U47 A;  3C4P A;  1KE0 A;  1ERQ A;  1E3U A;  1KGE A;  3N8L A;  3NIA A;  4E3L A;  1BLP A;  2VGJ A;  4WYY A;  3Q1F A;  1YQS A;  3UY6 A;  1JTG A;  3PBN A;  2PU4 A;  4N92 A;  4X68 A;  1ESI A;  1FQG A;  4N1X A;  3W4Q A;  1W79 A;  4ZDX A;  2JCH A;  1CEF A;  5KMW A;  5HAQ A;  1NZO A;  3OPP A;  2Y4A A;  2HPB A;  4S2J A;  3QNC A;  4B4Z A;  4JXW A;  1IEM A;  1L0G A;  2V2F F;  1BUE A;  1FCM A;  1SKF A;  5CGW A;  5KSH A;  3N7W A;  2RL3 A;  1K4F A;  4JBF A;  1BLS A;  3M6B A;  4MBK A;  3P09 A;  3O87 A;  4JF4 A;  5EEC A;  5M1A A;  1KVM A;  3N8R A;  4UA6 A;  4JPM A;  4UA9 A;  3IWQ A;  2ZQA A;  4OQ0 A;  4KZ9 A;  4RA7 A;  5E43 A;  3UDI A;  3HLF A;  3UDF A;  3ZNY A;  5BOH A;  4XUZ A;  2EFX A;  2EX8 A;  1LL9 A;  3LY4 A;  3GRJ A;  1JWP A;  1GHI A;  2HDQ A;  1K4E A;  3GR2 A;  3IXH A;  3UE1 A;  4WMC A;  1XP4 A;  3VOY A;  4GB7 A;  1MWT A;  1Z6F A;  3DWZ A;  3N8S A;  1NY0 A;  5GLD A;  3GV9 A;  1JTD A;  2JE5 A;  3FKV A;  3ZG9 B;  3FZC A;  1NJ4 A;  1K38 A;  5F82 A;  2DNS A;  4FD8 A;  1K57 C;  3BEB A;  2EXA A;  3IH9 A;  4KZ7 A;  1N4O A;  4P6B A;  5FQI A;  5FQM A;  1KDS A;  1OME A;  1BSG A;  1KVL A;  4OQI A;  2WKI A;  3FWL A;  2WKE A;  4RVA A;  1BLH A;  3HLG A;  3UN7 A;  4BLM A;  5J8X A;  5FQK A;  3HRE A;  4N1H A;  4R0Q A;  3VSL A;  4PM5 A;  2P9V B;  1GA9 A;  3N4I A;  3ITB A;  1IKG A;  3UPO A;  1FCN A;  2Y91 A;  3TSG A;  3OZH A;  1KE4 A;  4BD0 A;  2Q9M A;  2IWD A;  5HAP A;  1SHV A;  3WS2 A;  1PW8 A;  1ZG4 A;  2H5S A;  2R9W A;  3B3X A;  5EVI C;  5L2F A;  2QPN A;  1SDE A;  1VQQ A;  2C5W B;  4E3J A;  1O07 A;  5CXW A;  3NY4 A;  2HP6 A;  3ZVW A;  1GA0 A;  2Y2K A;  4GDN A;  5F83 A;  2Y2J A;  3ZG0 A;  1ZG6 A;  2ZQC A;  4S2O A;  5GLC A;  1K54 C;  5CHU A;  5FSR A;  3WS4 A;  5F1G A;  4OON A;  5FAO A;  1DJB A;  3ITA A;  4B88 A;  1LI0 A;  2ZQ7 A;  1S6R A;  4R1G A;  2WGW B;  3ZFZ A;  1BUL A;  3MZE A;  4OPQ A;  3N6I A;  3OPR A;  1L2S A;  5A91 A;  3CZD A;  1YT4 A;  2XLN A;  1BLC A;  5FAS A;  4C6Y A;  1QMF A;  1MXO A;  3ZG7 B;  1IYO A;  4Y0U A;  2XF3 A;  2ZM8 A;  3A3E A;  1PIO A;  5EE8 A;  4OKP A;  2WK0 A;  1IYP A;  1I5Q A;  4KG5 A;  4OOM A;  5G18 A;  5IHV A;  4WZ4 A;  5FI2 A;  1FR6 A;  1FSY A;  3BFF A;  1AXB A;  5F1F A;  4QU3 A;  4OQH A;  4WEJ A;  4Y7P A;  2WAF A;  3W4O A;  1MKI A;  1MWR A;  4XUX A;  3A3F A;  3GVB A;  4KZA A;  4HEF A;  4GKU A;  3C5A A;  4R3J A;  5GHX A;  1Q2Q A;  1U60 A;  1W7F A;  2WGW A;  5FI7 A;  3AGE A;  4Y0O A;  5DF9 A;  5KSC A;  1MWU A;  4OLD A;  3V50 A;  5M18 A;  1J9M A;  1ONG A;  3G30 A;  3RXX A;  4B4X A;  3NCK A;  3G2Z A;  2XDM A;  3Q7V A;  2HP5 A;  3WS5 A;  1XGI A;  3P98 A;  4BEN A;  1ZC2 A;  5GLA A;  1IYQ A;  1JWZ A;  2Y2O A;  2ZJ9 A;  4GDB A;  4RX2 A;  5FI6 A;  2Y2G A;  4MEZ A;  4DXC A;  2IWC A;  2Y59 A;  4QHC A;  4LCM A;  1YLT A;  5HW3 A;  4U0T A;  3JYI A;  3O86 A;  3Q7Z A;  3BFG A;  3CMZ A;  5GHY A;  1K55 C;  5DTS A;  3RXW A;  5DF7 A;  1ESU A;  3HLD A;  4Z9Q A;  1RGZ A;  3IHA A;  1K55 A;  2R9X A;  3HUO A;  3Q81 A;  2Q9N A;  5CTN A;  3BFE A;  3ISG A;  3UPN A;  3HL9 A;  4X55 A;  4OP8 A;  4UAA A;  1HVB A;  3LY3 A;  4QB8 A;  2JBF A;  3IXG A;  3HLB A;  2GDN A;  4KEN B;  5FQ9 A;  3DWK A;  4DF6 A;  5DTT A;  2ZC4 B;  3IH8 A;  1ALQ A;  3LEZ A;  4DE3 A;  1FCO A;  5HX9 A;  5EOE A;  3ZVT A;  2XFT A;  2XGN A;  5JYP A;  4OVD A;  4UA7 A;  4JXS A;  1K56 D;  3MKE A;  5TR7 A;  1KE3 A;  2ZLY A;  3S22 A;  1N9B A;  1I2S A;  1ES3 A;  5CER A;  1DJC A;  3V3R A;  3A3I A;  3HLE A;  3NI9 A;  4JXG A;  4ZBE A;  4FCF A;  4C3Q A;  2UWX A;  1I2W A;  1DJA A;  1W5D A;  3DTM A;  5TFQ A;  4X53 A;  1L0D A;  1NXY A;  2ZC7 A;  3IF6 B;  3BLM A;  3UDX A;  4GNU A;  3MBZ A;  3IHB A;  1E3U D;  4N9K A;  4FH2 A;  3WRT A;  4U0X A;  5CEC A;  1W8Y A;  4FSF A;  4A5R A;  1WYB A;  5CHM A;  5D3O A;  1JVJ A;  2WGV A;  2Y2I A;  4ID4 A;  2EXB A;  2PU2 A;  3GTC A;  1YM1 A;  1XKZ A;  3HLC A;  4PM6 A;  2WKH A;  4IBX A;  1YMX A;  1EWZ A;  1BT5 A;  1ONH A;  3TG9 A;  1M6K A;  2G2W A;  4IED A;  2WAE A;  4GD8 A;  1PI4 A;  1TDG A;  3G4P A;  3M6H A;  4LV3 A;  4X56 A;  3IF5 A;  2PBY A;  5FAT A;  4WZ5 A;  5GLB A;  1GHP A;  3HBR A;  2ZC6 B;  3QNB A;  5A93 A;  1Q2P A;  3FV7 A;  4JXV A;  4ZJ3 A;  3ZHH A;  3SS4 A;  2ZM0 A;  5I94 A;  4JLF A;  2J9O A;  2ZQD A;  4MBF A;  5EVI B;  3LCE A;  3WS1 A;  2G2U A;  3IWI A;  3VSK A;  4E6X A;  2Y2L A;  3G35 A;  2P74 A;  2HDU A;  2ZD8 A;  2ZC3 B;  1ES2 A;  3GSG A;  2ZC5 B;  5CHJ A;  4E3M A;  4F94 A;  1LHY A;  2J7V A;  2J9P A;  5FA7 A;  3AGF A;  1GHM A;  3MZD A;  2ZQ9 A;  3PTE A;  4E3N A;  4S2N C;  2ZQ8 A;  4LEN A;  1ERM A;  4WBG A;  4EWF A;  1LLB A;  5E2G A;  4ZAM A;  1IEL A;  3FKW A;  3UPP A;  4PM7 A;  1KGG A;  2P9V A;  4S2N A;  3OC2 A;  3W8K A;  1YLJ A;  2BLS A;  3HUN A;  2X01 A;  4L0L A;  3M2J A;  4WEK A;  3UO9 A;  3VMA A;  3C4O A;  1PYY A;  4R4S A;  3A3J A;  3ZGA B;  1CEG A;  2HDS A;  3SS5 A;  2XK1 A;  4E3I A;  1G6A A;  1BZA A;  1E25 A;  3QHY A;  1CI8 A;  3EQU A;  4KZ5 A;  1XGJ A;  3NDE A;  1FSW A;  4K0W A;  1BTL A;  2HDR A;  2Y2M A;  4HBT A;  2WGI A;  4KZ6 A;  1HZO A;  3PBS A;  1ERO A;  3WS0 A;  5HFO A;  4S2L A;  2DCF A;  4Q8I A;  3S4X A;  2HP9 A;  3BM6 A;  2XFS A;  5EVI D;  2Y55 A;  3GMW A;  5M19 A;  3OCL A;  1TDL A;  4OLG A;  3Q07 A;  3VP3 A;  3MXR A;  5CGS A;  4R3B A;  3NBL A;  4XXR A;  5HL1 A;  4BJP A;  2XD1 A;  2BG1 A;  3HUM A;  4GN2 A;  4FH4 A;  1LL5 A;  2C6W B;  5AQ9 A;  4DDS A;  3IWO A;  4EBL A;  4EBP A;  1NYM A;  1PW1 A;  3PAG A;  4QJG A;  1YLY A;  1IYS A;  4GZB A;  1PI5 A;  2RCX A;  2I72 A;  1SCW A;  1MWS A;  3GQZ A;  4QD4 A;  4S2K A;  5FQQ A;  5HAI A;  4X6T A;  1H5X A;  4EBN A;  4ZTK A;  1ES5 A;  2FFY A;  3O88 A;  1RCJ A;  3M2K A;  1NZU A;  2Z2M B;  4KZ3 A;  1LI9 A;  4OPR A;  3A3D A;  3LO7 A;  5FQJ A;  1XPB A;  4S2I A;  2CC1 A;  2B5R A;  5CGX A;  3ZDJ A;  3ZNT A;  3BFC A;  4MBH A;  3V5M A;  5FAQ A;  3PBQ A;  2VGK A;  4GOG A;  5AQA A;  1ZKJ A;  4E3O A;  3D4F A;  1K56 A;  3E2K A;  5EPH A;  4N9L A;  1G68 A;  4YFM A;  2EX6 A;  3ZG5 A;  4U3T A;  3VP0 A;  1M40 A;  1XXM A;  2EFU A;  2X71 A;  4EUZ A;  4PMA A;  2Y2Q A;  1DY6 A;  3HVF A;  3SS3 A;  5DF8 A;  4KZ8 A;  3V39 A;  4OPZ A;  1WYC A;  4H8R A;  2Y2H A;  4MNR A;  4CJN A;  3PBO A;  1MY8 A;  4P87 A;  2IWB A;  1HTZ A;  4DE0 A;  3OPH A;  2WZX A;  4OPY A;  4OH0 A;  2XH9 A;  3WRZ A;  4OQG A;  4EV4 A;  4CPK A;  4DDY A;  1XX2 A;  5CTM A;  2EX9 A;  4IBR A;  2QZ6 A;  4IVK A;  1TEM A;  3IXB A;  5AQB A;  4K0X A;  4QY6 A;  2Y2N A;  5AQ7 A;  3DW0 A;  3UE0 A;  4E6W A;  2H0Y A;  4KQQ A;  4OP5 A;  4EQI A;  4BL2 A;  5A92 A;  3FYZ A;  3MFD A;  3G2Y A;  2WAD A;  3OPL A;  2H0T A;  3SH7 A;  1K6S A;  3O3V A;  3PAE A;  3SOI A;  4WZ5 C;  2OV5 A;  4X69 A;  4E3K A;  4YIN A;  3V3S A;  5E2H A;  2OLU A;  3BEC A;  2XEP A;  3IF6 C;  4R4R A;  5HAR A;  4ZJ1 A;  1HD8 A;  3IF6 A;  1FR1 A;  2EX2 A;  3C7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...