4OPZA

Crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying g238s mutation in complex with boron-based inhibitor ec25
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGGRVGYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPVAMATTLRKLLTGELLTAASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TEM-94 ES-beta-lactamase
publication title Negative Epistasis and Evolvability in TEM-1 beta-Lactamase--The Thin Line between an Enzyme's Conformational Freedom and Disorder.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 100
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4opzA00
5HX9A 5M1AA 3ISGA 3UPNA 2XGNA 3ZG5A 4HEFA 3UPPA 1PWGA 4MLLA 4DDYA 1IYOA 4ID4A 5HARA 3W8KA 5GLDA 4E3LA 4EBNA 2JE5A 4N9LA 5FSRA 1YMXA 2PU4A 2WGWB 1WE4A 2P9VA 1MWTA 2ZC3B 5AQAA 5FQIA 4DXBA 1YMSA 2HDQA 5DTTA 1ERMA 3VFHA 3CZDA 4IBRA 3HL9A 3UY6A 4PMAA 1ALQA 1Z6FA 3DWKA 1XX2A 3VMAA 5CGXA 3RXXA 2XLNA 5HL1A 3LY3A 1MWUA 2EX9A 4KZ6A 4U3TA 3IXHA 4X53A 5IHVA 4DDSA 1YQSA 3D4FA 1L0GA 1XXMA 2ZQDA 3M6HA 5CTNA 1NYYA 1HTZA 3S4XA 5GHYA 5HW3A 5U47A 1PZPA 5DF8A 3FV7A 5FASA 2XDMA 1KE3A 4MBFA 5TR7A 1BUEA 3FWLA 3G35A 1Y54A 3A3IA 5FAPA 2ZQ9A 3VFFA 3WS0A 1DY6A 3E2LA 2Y2NA 3HLBA 5F82A 4U0TA 3FYZA 4BL3A 1ESUA 1YLZA 3HLEA 4OKPA 2PBYA 4B4XA 2E8IA 5FDHA 3O86A 4ZJ2A 1NY0A 3BFFA 3UNWA 3OPRA 3PBRA 3GTCA 4LCMA 1YLTA 1LI0A 1KE4A 2UWXA 3LEZA 5F1GA 1SDEA 1JWPA 1MWRA 1PI4A 2IWDA 3VP1A 2IWBA 3BLMA 1M6KA 3C7UA 1TDGA 3HLGA 4WYYA 3CJMA 4C6YA 5GLAA 4RA7A 4UA9A 3VP2A 4A5RA 3A3EA 3UE3A 3PBNA 3ZG0A 5EPHA 2WADA 3ZDJA 4CPKA 3N8RA 2X02A 2WAEA 1Q2QA 2BG1A 4KZ8A 1FR1A 4P85A 4E6XA 1XGIA 1H8YA 5GLBA 5KZHA 3C4PA 4S2NC 3BRMA 1IEMA 3QNCA 5EVIB 1GHPA 4WBGA 2FFFB 4E3OA 2WKHA 1VM1A 2EX8A 2JBFA 5CERA 1EROA 3AGDA 4QD4A 3UDFA 4PPRA 4KZ7A 1HD8A 4BLMA 1EI5A 1IYSA 1ES3A 1TEMA 2HP9A 4LENA 4LV2A 3O87A 1GA0A 4DE2A 4DKIA 5TFQA 1WYCA 1K4FA 3M2JA 2Y2KA 2ZQAA 2XH9A 3C4OA 1U60A 2DCFA 4ZJ3A 3HBRA 4JXVA 4P0MA 1BZAA 2WGVA 3SS3A 1PZOA 5FAQA 4S2LA 3AGEA 1LLBA 3HLFA 4X6TA 5CHUA 2Y2QA 2XQZA 5JYOA 3RXWA 3O88A 3B3XA 2WKIA 4JXWA 4OQHA 2JCHA 1QMEA 1MPLA 3EQUA 4YFMA 5HAIA 3W4OA 1JVJA 1JWZA 4KZ4A 3V39A 4WEKA 1BTLA 4JBFA 4OPRA 4K0WA 3SH8A 4PM7A 4HESA 1ES2A 3PAGA 3PBSA 1MXOA 4RX2A 5E2HA 5L2FA 4BQMA 1W79A 5J8XA 1CEGA 4WM9A 4GN2A 5EOEA 2B5RA 4PM5A 2OLVA 3OC2A 3P98A 2V20A 2XFTA 5TGFA 4IBXA 5HAQA 5EOOA 4PM9A 3UE0A 1XP4A 5HAPA 4P87A 1BULA 5GHZA 3OCNA 1YLWA 1FCNA 4X68A 3UDIA 5KSCA 2H0TA 1GCEA 2H0YA 3C5AA 2XD1A 2R9WA 4OLDA 4FH4A 1SKFA 5HFOA 3HVFA 3Q1FA 3P09A 3QHYA 1JTDA 4S2NA 4OPYA 2XFSA 3BEBA 3GV9A 3V50A 1E3UA 2J7VA 2WZXA 3ZFZA 4CJNA 3OCLA 4ZAMA 4R23A 1GA9A 4Z9QA 3OPPA 4OP8A 3WS1A 5EVIA 4S2MA 3ZHHA 2C5WB 1SDNA 4R0QA 3ZNYA 3ZCZA 3N6IA 1KGFA 1G6AA 3DWZA 4JLFA 1NZUA 4QY6A 5G18A 1N9BA 4QJGA 1O07A 5KMWA 1K4EA 1MKIA 3NI9A 3OZHA 4OOMA 1FR6A 2WGIA 5CXWA 4Y0TA 3IXDA 4WZ4A 4S2IA 3HLDA 3VP4A 2ZC4B 3IF6B 3VOZA 3PBTA 3V3RA 4R3JA 1W5DA 4ZTKA 5FATA 4MNRA 4E3KA 2EFUA 3UDXA 4EWFA 2VGJA 5EUAA 4B4ZA 2J8YA 3OPHA 1IELA 3TG9A 2ZJ9A 4UA7A 3UO9A 3IWOA 1K54A 3G34A 1I2SA 4IVIA 4E3JA 3ZNTA 1PIOA 2QZ6A 3NC8A 2Y59A 1I2WA 3V5MA 2Y2GA 3BFCA 3FKVA 1MY8A 4WZ5C 4OOLA 2WUQA 4OPZA 5FQ9A 3IF5A 3SS4A 2ZC5B 4DE1A 2HPBA 5E2FA 1TVFA 5FI2A 1DJCA 1L0FA 3AGFA 2WZZA 4LCLA 4NK3A 4DXCA 3Q07A 1VQQA 1K57C 1I5QA 2ZC6B 5BOHA 5FQQA 3ZGAB 3JYIA 4JXGA 2EXBA 3HUOA 5CEBA 4LV0A 4OPQA 1YLYA 1FCOA 2EX2A 5AQ7A 1QMFA 4Q8IA 3FZCA 3G30A 1FQGA 2G2WA 3FKWA 5A92A 3BFDA 3IXBA 3Q7VB 2FFYA 1C3BA 2X71A 1KGGA 4KZBA 1KGEA 4OP5A 4OQGA 1NXYA 5FI7A 4FH2A 1BLPA 2HDSA 1H5XA 2IWCA 4Y0OA 3VSLA 3NIAA 1E25A 4DE0A 2V2FF 5FI6A 4L0LA 5A91A 2RL3A 3HUMA 3NDEA 3I7JA 5FAOA 4GD6A 4FD8A 1RP5A 4X55A 1NRFA 3DW0A 2WGWA 1YLJA 3MKEA 2X01A 2Z2MB 4S2PA 5EVIC 3N7WA 4KQOA 5GLCA 4R4RA 4E3IA 5DTKA 2HDUA 1E3UD 3M2KA 3ITAA 3PAEA 4O7DA 1Q2PA 3HLWA 4C3QA 3C7VA 1CK3A 4Y0UA 4BD0A 3OPLA 4OH0A 3MXSA 4WELA 3WS5A 1XPBA 4OQIA 3HLCA 4ZJ1A 4DE3A 5EVID 1HZOA 1KDSA 3GQZA 5CHMA 2Y4AA 1K56A 1FOFA 2HDRA 4K0XA 3BYDA 2WKEA 2V1ZA 5GHXA 1AXBA 1XGJA 4JF4A 1G68A 4S2KA 2P74A 1GHMA 2QPNA 4BD1A 1RCJA 4C75A 1BLHA 1S0WA 1NYMA 4X69A 4BL2A 3UPOA 2C6WB 1ZG4A 4JPMA 1ZKJA 3N8SA 4K91A 1FSWA 3N8LA 1GHIA 3NCKA 4WZ5A 1K54C 2CC1A 3GRJA 1PI5A 4HBUA 1LL5A 2XF3A 3MBZA 1PW1A 2Q9NA 1K6RA 3GMWA 2A49A 4GB7A 1XA7A 4JF6A 3S22A 4X56A 1OMEA 1K57A 3SH9A 4N1XA 4R3BA 1MBLA 5EE8A 2Y2JA 2ZMAA 3LY4A 4BJPA 1KE0A 4XXRA 4EBLA 5CRFA 1RGYA 5E2GA 1IYPA 1DJAA 4N9KA 5A93A 2WYXA 1WYBA 4PM6A 1W8YA 1BLSA 2QMIA 3SH7A 2PU2A 4KQRA 3LCEA 3WWXA 5I94A 3GVBA 2HP6A 5M18A 3ITBA 2G2UA 1K55C 3IHBA 3Q7ZA 3IWQA 1RGZA 1MWSA 3Q7VA 2ZQCA 4N92A 4WMCA 4XUXA 4R4SA 5FA7A 3BFEA 1FCMA 1CI8A 1YT4A 3WS2A 4KG6A 1XA1A 4FCFA 4E3NA 2ZM0A 4N1HA 1FSYA 3UE1A 4QHCA 3RJUA 5EECA 1KDWA 5CEDA 2DRWA 3E2KA 3A3FA 4EBPA 1XKZA 1IKGA 1TDLA 3MZEA 5AQBA 2OSUA 4EUZA 1K38A 4OVDA 1LHYA 4JKTA 2ZLYA 4QY5A 2ZM8A 3VSKA 3O3VA 3LO7A 1W8QA 2XK1A 4KZ5A 2GDNA 1J9MA 1L0EA 4RX3A 3IF6C 3HREA 3IH8A 2Y91A 4KG2A 4M3KA 1K56D 4YINA 2OLUA 1KVMA 2BLSA 3M6BA 2Y2OA 5CECA 1K25A 1ES5A 5E43A 4R1GA 5D3OA 3BM6A 4KZAA 1S6RA 5F1FA 4Y7PA 3TOIA 5JYPA 2OV5A 5CHJA 1BSGA 1PW8A 3IWIA 5AQ9A 4IEDA 3W4PA 5FQMA 2XEPA 4MEZA 2Q9MA 3PBOA 3G4PA 4H8RA 3QNBA 3VP3A 1H8ZA 3GSGA 5CGWA 3NDGA 4XUZA 3SOIA 1SCWA 3TSGA 4OONA 3G2YA 4QU3A 4S2JA 3HUNA 1SHVA 4UAAA 4E3MA 3A3JA 1K55A 3G32A 4HBTA 5CGSA 3NY4A 5FQKA 4KZ9A 1W7FA 4P6BA 1O7EA 2HP5A 4DF6A 3ZG8B 4S2OA 1PYYA 1LI9A 3G31A 3IXGA 4KG5A 4GNUA 3PTEA 3CG5A 2RCXA 1M40A 4EQIA 4LV3A 3CMZA 4F94A 2DNSA 1N4OA 2ZD8A 4FSFA 4DRTA 2Y2IA 1PWDA 3ZG7B 3IQAA 1HVBA 3BECA 4BENA 3ZG9B 3Q81A 3SS5A 1ESIA 3VP0A 3IH9A 4UHUA 4WMCD 5E2EA 2R9XA 5EVLA 2P9VB 4RVAA 5FQJA 2A3UA 4WEJA 2Y55A 1ONGA 2EFXA 2ZQ8A 2JC7A 1YM1A 3MXRA 1E4DA 3A3DA 2ZC7A 5KSHA 4NETA 1JTGA 4MBKA 4GDBA 3GR2A 4OOYA 4GOGA 4B88A 2ZQ7A 3DTMA 3IF6A 4KZ3A 2Z2LB 4QB8A 3MKFA 4UA6A 1JWVA 2Y2MA 1YLPA 4KENB 1L0DA 1IYQA 1PWCA 1ZC2A 3BFGA 3G2ZA 3VOYA 1BT5A 2EX6A 3BLSA 3EQVA 2Y2HA 3MZDA 4OLGA 3WS4A 4OQ0A 2H10A 3N4IA 4RYEA 4ZDXA 2Y2PA 3NBLA 1CI9A 4GZBA 2Y2LA 1L2SA 1ZG6A 3ZVWA 3Q82A 4KQQA 2WAFA 2ZM2A 4GDNA 4IVKA 5DVAA 4U0XA 4EV4A 5F83A 2J9OA 3WRZA 3UN7A 3ZVTA 2VGKA 4E6WA 4MBHA 4JXSA 2WK0A 3MFDA 5CTMA 2H5SA 5DF9A 1ERQA 1BLCA 1ONHA 1NJ4A 1LL9A 1KVLA 4LV1A 3S1YA 3V3SA 3PBQA 1CEFA 5A90A 2I72A 4JF5A 5M19A 1K6SA 2XD5A 4GKUA 3WRTA 1IKIA 3IHAA 5DTSA 5GL9A 2EXAA 4D2OA 1ES4A 1DJBA 1NZOA 4GD8A 2J9PA 4PM8A 3IT9A 3W4QA 1EWZA 5DF7A 4ZBEA 2XR0A 3MZFA
chains in the Genus database with same CATH superfamily
1MKMA 1EW0A 3UPNA 2ZL1B 1S4SA 1PWGA 4DDYA 4ID4A 2JE5A 1YMXA 5AQAA 5FQIA 2HDQA 4GS9A 3CZDA 3LI9A 4PMAA 1XX2A 1SKOB 1MWUA 2EX9A 5IHVA 2V8CA 2LB5A 4HJ6A 4JGOA 1XXMA 2E8JA 5U47A 4EU0A 3MQQA 5DF8A 4RQ9A 1KE3A 1Y54A 3VFFA 3IS2A 3H7WA 5F82A 4CLCC 1YLZA 2PBYA 1XJ2A 4ZJ2A 4HHDA 3UNWA 1UWNX 4LCMA 4CLCD 2KX6A 5F1GA 3QP1A 1TDGA 4WYYA 2OAQ1 3T4JA 4LFUA 4UA9A 4A5RA 3VE4A 2D01A 4KZ8A 3EEHA 4E6XA 5GLBA 2ZL1A 3MSHA 4QD4A 2JKTM 4PPRA 1IYSA 2G7UA 4LV2A 4LRYC 3O87A 4DKIA 2VA0A 4I3AA 4HI4A 1U60A 3A0SA 3HBRA 4ZJ3A 4JXVA 3SS3A 1PZOA 4ETZA 1LLBA 2Y2QA 2XQZA 2WKIA 3T4LA 3EQUA 3T4OA 3W4OA 1JVJA 4KZ4A 4WEKA 4OPRA 2VX8A 4JBFA 3SH8A 1ES2A 5L2FA 4Z1WA 3S7PA 4GN2A 1CJFA 2V20A 4PM9A 1XP4A 1BULA 5GHZA 2PR5A 1A0KA 1YAXA 3UDIA 2H0TA 2R9WA 4FH4A 2HJEA 1JTDA 2W1TB 2BASA 3V50A 1E3UA 3ZFZA 4CJNA 4R23A 1GA9A 3OPPA 4OP8A 3SW1A 5DKKA 3ZHHA 2C5WB 3CPTA 2YKFA 3LR5A 1KGFA 4YOFA 1NZUA 4BMWA 1O07A 1K4EA 2FH5A 3NI9A 2ZOIA 3LGOA 2ZC4B 3VOZA 2PBDP 3PBTA 5FATA 3ULFA 3UDXA 2VGJA 4B4ZA 2QJ7A 3IWOA 2NUTC 3KYQA 3W2ZA 4IVIA 2QZ6A 3NC8A 4MN6A 2Y2GA 3BFCA 4WZ5C 3PXPA 5EM0A 5FQ9A 3SS4A 1HLUP 4DE1A 2J3TD 1TVFA 3MJQA 1TS7A 3Q07A 5FQQA 4LPZA 2EXBA 2EX2A 3TJZC 1TS0A 2KOIA 2G2WA 3FKWA 3BFDA 2LB9A 4KZBA 1DP6A 4Y3IA 4Y0OA 2IWCA 3VSLA 5FI6A 2W1TA 4L0LA 3LR3A 1RP5A 2WKPA 2WGWA 5EVIC 4E3IA 5DTKA 3M2KA 3PAEA 4O7DA 3HLWA 1P9RA 1CF0A 3C7VA 1CK3A 1W63M 4OH0A 5LBRA 2M7UA 5EVID 2QHKA 1KDSA 3GQZA 2Y4AA 4MMNA 2HDRA 4K0XA 1AXBA 3PHYA 2XA7M 1XGJA 1N9LA 4JF4A 2P74A 4BD1A 1RCJA 1S0WA 1GSWA 3N8SA 4K91A 4WZ5A 2CC1A 2P08A 4GCZA 4HBUA 1LL5A 3MBZA 2Q9NA 3S22A 1NWZA 3SH9A 4R3BA 3GDIA 2Y2JA 3E0YA 4F3LA 4EBLA 3LIEA 3LIAA 1DJAA 2V0WA 4N9KA 5AVEA 1G28A 4LLOB 1BLSA 3SH7A 3GVBA 3BQ8A 3ITBA 4UQIM 3Q7ZA 1MWSA 2ZQCA 4N92A 4R4SA 2JN7A 3BFEA 4KG6A 4E3NA 2ZM0A 4N1HA 1FSYA 3KX0X 4G3KA 4X1LA 1XKZA 1IKGA 3QP8A 3VV4A 3BQAA 2GZAA 1OTEA 2ZLYA 3LO7A 4KZ5A 4CLCE 1J9MA 1L0EA 4L9FA 2Y91A 3KSGA 1K56D 4YINA 2Y2OA 5CECA 1ES5A 5D3OA 2OOLA 4KZAA 4B93A 2JKTI 4Y7PA 1BSGA 1XFQA 5AQ9A 5FQMA 4FTXA 1XJ4A 5L07A 3QNBA 3VP3A 3GSGA 2HF6A 4OONA 1GSVA 3A3JA 5IS1A 3NY4A 2HP5A 4DF6A 3ZG8B 4S2OA 3G31A 3CMZA 4DRTA 3ZG7B 3ZG9B 4WMCD 5EVLA 4RVAA 5FQJA 2A3UA 4WEJA 3T1RA 1N9OA 4ZRRA 2JC7A 1YM1A 2L1MA 3RFBA 3GR2A 4BWIA 4KZ3A 2VZWA 5HSQA 3MKFA 1Z09A 3G2ZA 3KSFA 2H28A 2Y2HA 3MZDA 1H8MA 2H10A 3N4IA 1CI9A 2Y2LA 3KO6A 1L2SA 4KQQA 1FILA 4H6JA 3GECA 4IVKA 4U0XA 2J9OA 3H82B 3ZVTA 4MBHA 1P97A 5CTMA 2H5SA 1NJ4A 1LL9A 4LV1A 4E04A 2JHEA 2O0YA 2XD5A 3F1PB 4NXBA 5L8MA 1T18A 2QYBA 3E4QA 4GD8A 2J9PA 3IT9A 4IUKA 3W4QA 3OBFA 2FZ0A 2XR0A 3MZFA 5M1AA 3ISGA 3DBAA 4HEFA 2VJWA 3UPPA 3JPUA 5HARA 4Y15A 5DFYA 5GLDA 3W8KA 4EBNA 4E3LA 4N9LA 1WE4A 1MWTA 3EGDC 4Y2FA 3HL9A 3UY6A 3DWKA 3VMAA 5CGXA 2XLNA 4KZ6A 3IXHA 3KSHA 4UEYA 3K2NA 2PYRA 5J7EA 1HTZA 4I5SA 1DP9A 2Q0OA 2XDMA 1BUEA 3A3IA 3WS0A 1DRMA 3FYZA 4QWOA 5I5LA 5F68A 4B4XA 2YKHA 3BFFA 3UMDA 1YLTA 1KE4A 3VP1A 2IWDA 3BLMA 2GX5A 3F1PA 1OPXA 4RA7A 3VP2A 2O9AA 3PBNA 1STZA 4CPKA 3ZDJA 2X02A 1FR1A 2Y8HA 3C4PA 4S2NC 1GHPA 2FFFB 1VM1A 3TRCA 4KZ7A 1EI5A 5EVEA 1ES3A 1TEMA 1P9WA 4DE2A 5TFQA 2V0UA 1K4FA 3M2JA 5HL6A 2B95A 2DCFA 4R70A 4P0MA 1BZAA 2WGVA 5FAQA 2DMWA 3AGEA 4X6TA 5JYOA 3RXWA 1H3QA 4EW7A 3O88A 3UB7A 4WF0A 4ARZB 4JXWA 2JCHA 4YFMA 2W3GA 4K0WA 1CQAA 4HESA 1V9ZA 2V1BA 1W79A 3F1NA 5J8XA 2B5RA 5DKLA 3OC2A 3LYXA 3L9KA 2XFTA 5TGFA 3CWFA 4DJ2A 1D7EA 3UE0A 4P87A 1YLWA 5HFOA 3Q1FA 1OTIA 4S2NA 2XFSA 3BEBA 4B9OA 2A24A 2J7VA 2WZXA 3TW8A 3WS1A 3ZCZA 3E98A 1LSWA 4QY6A 1N9BA 5CXWA 2B02A 4OOMA 5HWTA 4WZ4A 2VLGA 2V8FA 1W5DA 1BYWA 1S66L 1UWPX 2J8YA 2ZJ9A 4UA7A 3UO9A 1PIOA 2GNXA 5E2FA 1DJCA 5HDCA 4ESPA 4DXCA 5BOHA 2JKRM 2XROA 3JYIA 4LV0A 3MF0A 4OPQA 1FCOA 4Q8IA 3A0VA 5A92A 3Q7VB 3RH8B 4OQGA 1KGEA 4OP5A 5FI7A 1NXYA 1BLPA 1H5XA 1K0KA 1E25A 2RL3A 3D9YA 4GD6A 3K3DA 4X55A 1NRFA 3UB6A 1YLJA 2EA9A 4R4RA 3UE6A 1E3UD 1IFQA 4WELA 4ZJ1A 1JNUA 1SKOA 1HZOA 5CHMA 4GJ4A 1FOFA 3RTYA 3EGXC 3CHWP 1GHMA 4R3AA 3UPOA 3EOIA 1ZG4A 4BBTA 1D1JA 1T1AA 1PW1A 1K6RA 1XA7A 4HH3A 3QP4A 5FDSA 3T4TA 1MBLA 1LL8A 3DTKA 3LY4A 4HNBA 4XXRA 2WYXA 4PM6A 2PU2A 4KQRA 3LCEA 5I94A 2HP6A 4M4XA 2G2UA 3IHBA 2VV6A 3Q7VA 3C38A 1FCMA 1YT4A 4Y5FA 3BJNA 1X0OA 5HD3A 3RJUA 1KDWA 3U2AA 2DRWA 3S7OA 4NG2A 2WKQA 5AQBA 3BY8A 4OVDA 4JKTA 4FOFA 4QY5A 2O9BA 2ZM8A 2PD8A 2XK1A 4KUOA 4KG2A 4NKPA 5C5KA 4HP4A 2OLUA 2BLSA 3LIFA 5A8BA 3C30A 4R1GA 3IBRA 5F1FA 5JYPA 2OV5A 3IWIA 1PW8A 3KYZA 2W27A 1S1ZA 1OJGA 1ZHHB 5CGWA 3SOIA 3G2YA 1KOUA 4E3MA 5MC7A 4IHQA 2PRFA 4P6BA 2WKRA 1PYYA 3MQOA 3IXGA 4GNUA 3PTEA 2HV1A 2VV7A 3CG5A 2RCXA 1M40A 4LV3A 3LEQA 2ACGA 3BECA 4WL9A 4UHUA 1FIKA 2IA2A 2EFXA 3MXRA 4BBVA 4BBUA 4OOYA 2ZQ7A 1DP8A 2Z2LB 4UA6A 4Y17A 1JWVA 4KUKA 2Y2MA 1YLPA 2K2NA 1IYQA 3BFGA 4GW9A 2EX6A 4OLGA 2W3EA 3BY9A 4EXOA 4RYEA 2Y2PA 5HWWA 3ZVWA 1ACFA 2WAFA 1TS6A 3WRZA 2WK0A 3A0RA 5DF9A 4I3IA 3FG8A 5L10A 3PBQA 1CEFA 5A90A 1K6SA 3V67A 4P6ZM 3WRTA 5DTSA 5GL9A 2EXAA 2VEAA 4D2OA 1ES4A 4PM8A 5G4ZA 3NOTC 3DTIA 2XGNA 3HJIA 2O99A 2JKGA 4MLLA 4MN5A 3IX3A 2JKRI 3CUEC 5FSRA 5IT5A 2PU4A 4Y13A 1VHMA 5DTTA 4IBRA 3CITA 1ALQA 1Z6FA 3LY3A 4X53A 1YQSA 4LRXC 1L0GA 2ZQDA 3M6HA 3FPVA 3S4XA 5GHYA 5HWVA 5HW3A 1PZPA 3FV7A 3OOVA 5TR7A 3MR0A 3FWLA 5FAPA 2ZQ9A 4BL3A 1DY6A 2KDKA 2Y2NA 3P01A 1LT0A 3IBJA 2E8IA 3PBRA 1LI0A 4HJ4A 3LEZA 1JWPA 1MWRA 3O5YA 1PI4A 3C7UA 3FPWA 3HLGA 4LRZE 3CJMA 2PHYA 5GLAA 4MCWA 2CMNA 4II7A 2I9VA 5EFWA 2WADA 5HZHA 3N8RA 2WAEA 5HDSA 2BG1A 3CUEA 1ZTUA 5KZHA 1S67L 4E3OA 4WLAA 2JBFA 4LGWA 1EROA 1F98A 3AGDA 4BLMA 3DTEA 2HP9A 1YKDA 3HCYA 1V9YA 1GA0A 3NECA 2XH9A 3C4OA 2NUPC 3MS6A 4R6LA 1IOUA 1WA9A 2VKSA 2MJ6A 3B3XA 4OQHA 1G5UA 1AWIA 1QMEA 5HAIA 3S7NA 5TBMB 4XT2B 1BTLA 4PM7A 3PBSA 1MXOA 4WN5A 4BQMA 1NLZA 4WM9A 5EOEA 5FL3A 4PM5A 1OJ5A 4IBXA 5HAQA 3OCNA 2XRNA 4X68A 2KLIA 2J3WA 1GCEA 2H0YA 2OAP1 3D3OA 1Y4OA 2XD1A 4PAUA 1SKFA 3HVFA 3QHYA 4OPYA 4I3JA 4ZAMA 2BTFP 4Z9QA 1MC0A 3UB9A 3ZNYA 3N6IA 1G6AA 3R7WB 4QJGA 3UB8A 1VEUB 1MKIA 3OZHA 1FR6A 4Y0TA 3IXDA 4S2IA 3HLDA 3IF6B 3V3RA 4R3JA 3SZTA 4HIAA 3NJAA 2EFUA 2K31A 1IELA 3TG9A 1K54A 3G34A 4MDZA 1F2KA 3H82A 2Y59A 1I2WA 3CLOA 3FKVA 3IX8A 4XT2A 3T12B 3AGFA 3IX4A 2WZZA 4LCLA 4NK3A 3D72A 1VQQA 5HDDA 3ZGAB 4JXGA 3HUOA 5CEBA 3FZCA 4O8GA 1VETB 2VK3A 3IXBA 4NXGA 2X71A 1KGGA 3L7HA 2W3HA 3LI8A 4PKYG 3NIAA 2PYPA 3HUMA 3P7NA 3MKEA 2Z2MB 4S2PA 3N7WA 3T4QA 4GHIB 5GLCA 2ZOHA 4C3QA 4BD0A 4Y0UA 3MXSA 2VGLS 3WS5A 4OQIA 2HGVA 4NEED 4YWZA 2PAVP 4EETB 4HOIA 3BYDA 2WKEA 2V1AA 4ME4A 4QPRA 5KIZA 3C8CA 4C75A 4O0PA 4X25A 1NYMA 1XJ3A 1TD5A 2C6WB 3MXQA 4JPMA 4P6ZS 1GHIA 3JVVA 3B33A 5J4EA 4WUJA 2XF3A 1OTBA 4GB7A 4L9EA 3QP6A 3E4PA 4X56A 1OMEA 3IS2B 3H7WB 4N1XA 5EE8A 4PHTA 2ZMAA 3F1OB 1IYPA 1PNEA 3WWXA 3PYPA 1K55C 1T1BA 2W1RA 5FA7A 3T1SA 1CI8A 3WS2A 5HD5A 4G3VA 3UE1A 1NLYA 4QHCA 2B18A 3E2KA 3A3FA 4GHIA 2OSUA 4EUZA 2EWWA 2PT7A 3QP2A 3T1XA 3VSKA 3O3VA 1W63Q 4RX3A 4PKYA 4M3KA 3T4SA 3C2WA 3BM6A 4ARZA 1S6RA 2QKPA 5CHJA 4Q0HA 4CLCB 3W4PA 5FEGA 4Q0JA 2Q9MA 3PBOA 3G4PA 4H8RA 1H8ZA 3FC7A 3NDGA 3QP5A 3E4OA 4XUZA 1SCWA 3TSGA 3LICA 4S2JA 3HUNA 3F1OA 5L09A 1K55A 3G32A 4HBTA 5CGSA 4KZ9A 1W7FA 1O7EA 1LI9A 4EUVA 4KG5A 3TE8A 2DNSA 4FSFA 2Y2IA 1PWDA 4BENA 4NXFA 3VP0A 2Z6DA 2R9XA 2P9VB 4HY8A 2V9AA 1UGUA 3CPTB 2ZQ8A 5TJJA 1E4DA 2ZC7A 5KSHA 4GDBA 3DTMA 4KENB 3LR0A 1L0DA 3MFXA 4NXEA 3VOYA 1OTDA 2PDRA 3KSIA 4OQ0A 5K5BA 3NBLA 1T19A 1YSPA 1ZG6A 3K3CA 2ZM2A 4GDNA 5DVAA 4CLCA 3UN7A 2VGKA 4JXSA 1ERQA 2UV0E 5DJTA 1KVLA 3S1YA 2I72A 1YSQA 4GKUA 1IKIA 3B47A 1OT9A 1DJBA 1NRJA 2A2LA 3VOLA 1EWZA 4K08A 3GV9A 2PD7A 5HX9A 2QWSA 3ZG5A 2W3DA 1IYOA 4DXBA 2WGWB 2P9VA 2ZC3B 1YMSA 1ERMA 3VFHA 2Z6CA 1PFLA 3RXXA 3R4KA 5HL1A 1OT6A 2Y79A 4U3TA 4DDSA 3D4FA 2QJ5A 5CTNA 1NYYA 3NULA 3LUQA 5FASA 4G3WA 3NHQA 4MBFA 3G35A 3E2LA 3HLBA 4U0TA 1ESUA 3HLEA 4OKPA 2J3TC 5FDHA 3O86A 1NY0A 3OPRA 2EWVA 3GTCA 2UWXA 2JKFA 1SDEA 4F3LB 2IWBA 1M6KA 4C6YA 2K7SA 3A3EA 3UE3A 2HJ9C 3ZG0A 5EPHA 2O9CA 1Q2QA 4P85A 1XFNA 1XGIA 1H8YA 3PR6A 5EVIB 3BRMA 1IEMA 3QNCA 1OTAA 4WBGA 2R78A 2WKHA 2EX8A 5G4YA 5CERA 4EERA 3UDFA 1HD8A 3LR4A 4LENA 4L9GA 2ZMFA 4FUWA 1WYCA 3G6OA 2Y2KA 2ZQAA 3JVUA 3BW6A 2VGLM 3CAXA 5AJGA 4S2LA 1N9NA 3HLFA 5CHUA 3OLOA 5CEDA 1MPLA 1JWZA 3V39A 4JGPA 3PAGA 4RX2A 5E2HA 4D60A 2ZMVA 4AFIA 1CEGA 5CX7A 1LSXA 2OLVA 3P98A 4IUHA 5EOOA 5HAPA 1FCNA 5KSCA 3C5AA 4OLDA 3LFVA 3P09A 3HJKA 2XSSA 4YNRA 3OCLA 4EEPA 4O01A 1YPRA 3MMHA 5EVIA 4S2MA 1SDNA 4R0QA 4MN7A 4EEUA 3DWZA 4JLFA 5G18A 5KMWA 2VV8A 2WGIA 1F5MA 4Q0IA 3VP4A 1J3WA 3LIBA 4ZTKA 4MNRA 2M1CA 4E3KA 4EWFA 5EUAA 3OPHA 3S7QA 1I2SA 4E3JA 3ZNTA 1GSXA 2AVXA 1H0MA 3V5MA 2P04A 1MY8A 4OOLA 1VB6A 4H6JB 2WUQA 4OPZA 3UMEA 3IF5A 2ZC5B 2HPBA 3T4KA 5DJUA 5FI2A 1L0FA 2ZC6B 1K57C 1I5QA 2P7JA 1YLYA 5AQ7A 1QMFA 3G30A 1FQGA 2FFYA 4EESA 1C3BA 4FH2A 4DE0A 2HDSA 2V2FF 5A91A 3NDEA 3I7JA 5FAOA 4FD8A 3DW0A 5AVFA 2X01A 4KQOA 2HDUA 3ITAA 1Q2PA 3OPLA 1XPBA 4EQ1A 3HLCA 4DE3A 4DMZA 5J3WA 1K56A 4HH2A 2V1ZA 5GHXA 4S2KA 1G68A 2QPNA 2PR6A 1BLHA 2ZBBA 4X69A 4BL2A 2GJ3A 1ZKJA 1FSWA 3N8LA 3BWLA 5EV0A 3NCKA 1K54C 4HJ3A 3GRJA 1PI5A 4DN0A 3KYEA 3GMWA 2A49A 4JF6A 1K57A 3H9WA 4BJPA 1KE0A 5CRFA 1RGYA 5E2GA 3U4LP 3T50A 4I38A 5A93A 1G6OA 1WYBA 1W8YA 2QMIA 5M18A 2L4RA 1TF1A 4JGQA 3IWQA 1RGZA 4XUXA 4WMCA 5HPIA 1L3LA 3DAVA 1XA1A 4FCFA 2OWJA 3UB5P 1F9IA 5EECA 4EBPA 2M7VA 1LSVA 1TDLA 5F5YA 3MZEA 1K38A 1LHYA 3ICYA 4GLQA 4KQDA 3ZQ5A 5F69A 1TS8A 1W8QA 2GDNA 3IF6C 3HREA 3IH8A 4IJGA 4R38A 1KVMA 3M6BA 1K25A 5E43A 1T1CA 2W0NA 3MQ0A 4JGRA 3TOIA 5TBMA 4IEDA 3VE3A 2XEPA 4MEZA 1P0ZA 4QU3A 1ODVA 1SHVA 3F1NB 4UAAA 5EM1A 5FQKA 1PRQA 1S4RA 3CI6A 2W3FA 2OWHA 1SZVA 2L0WA 4EQIA 4F94A 1N4OA 1XJ6A 2ZD8A 3IQAA 1HVBA 3Q81A 3SS5A 1ESIA 2A24B 3IH9A 5E2EA 3R7WA 2D02A 2XA7S 3ZYTA 2Y55A 1VEUA 4GS9B 3LIDA 4X1MA 1ONGA 4ETXA 1Y28A 3A3DA 4NETA 1JTGA 4MBKA 4GOGA 4B88A 3IF6A 4I39A 3EWKA 4QB8A 5FEFA 4DJ3A 5F6AA 3EEAA 1PWCA 1ZC2A 1BT5A 3EQVA 3BLSA 1D06A 3WS4A 3T1QB 4ZDXA 4GZBA 5HPFA 2HZ5A 3Q82A 5IU1A 4EV4A 5F83A 4E6WA 2J80A 3MFDA 3NOPC 3NOUC 1BLCA 4HQAA 1ONHA 4UQIS 3B42A 3V3SA 1MZUA 5DFXA 4JF5A 5M19A 1VETA 3IHAA 4HP9A 1NZOA 2INWA 5DF7A 4ZBEA 1S1YA 4CQHA
chains in the Genus database with same CATH topology
5HX9A 5M1AA 3ISGA 3UPNA 2XGNA 3ZG5A 4HEFA 3UPPA 1PWGA 4MLLA 4DDYA 1IYOA 4ID4A 5HARA 3W8KA 5GLDA 4E3LA 4EBNA 2JE5A 4N9LA 5FSRA 1YMXA 2PU4A 2WGWB 1WE4A 2P9VA 1MWTA 2ZC3B 5AQAA 5FQIA 4DXBA 1YMSA 2HDQA 5DTTA 1ERMA 3VFHA 3CZDA 4IBRA 3HL9A 3UY6A 4PMAA 1ALQA 1Z6FA 3DWKA 1XX2A 3VMAA 5CGXA 3RXXA 2XLNA 5HL1A 3LY3A 1MWUA 2EX9A 4KZ6A 4U3TA 3IXHA 4X53A 5IHVA 4DDSA 1YQSA 3D4FA 1L0GA 1XXMA 2ZQDA 3M6HA 5CTNA 1NYYA 1HTZA 3S4XA 5GHYA 5HW3A 5U47A 1PZPA 5DF8A 3FV7A 5FASA 2XDMA 1KE3A 4MBFA 5TR7A 1BUEA 3FWLA 3G35A 1Y54A 3A3IA 5FAPA 2ZQ9A 3VFFA 3WS0A 1DY6A 3E2LA 2Y2NA 3HLBA 5F82A 4U0TA 3FYZA 4BL3A 1ESUA 1YLZA 3HLEA 4OKPA 2PBYA 4B4XA 2E8IA 5FDHA 3O86A 4ZJ2A 1NY0A 3BFFA 3UNWA 3OPRA 3PBRA 3GTCA 4LCMA 1YLTA 1LI0A 1KE4A 2UWXA 3LEZA 5F1GA 1SDEA 1JWPA 1MWRA 1PI4A 2IWDA 3VP1A 2IWBA 3BLMA 1M6KA 3C7UA 1TDGA 3HLGA 4WYYA 3CJMA 4C6YA 5GLAA 4RA7A 4UA9A 3VP2A 4A5RA 3A3EA 3UE3A 3PBNA 3ZG0A 5EPHA 2WADA 3ZDJA 4CPKA 3N8RA 2X02A 2WAEA 1Q2QA 2BG1A 4KZ8A 1FR1A 4P85A 4E6XA 1XGIA 1H8YA 5GLBA 5KZHA 3C4PA 4S2NC 3BRMA 1IEMA 3QNCA 5EVIB 1GHPA 4WBGA 2FFFB 4E3OA 2WKHA 1VM1A 2EX8A 2JBFA 5CERA 1EROA 3AGDA 4QD4A 3UDFA 4PPRA 4KZ7A 1HD8A 4BLMA 1EI5A 1IYSA 1ES3A 1TEMA 2HP9A 4LENA 4LV2A 3O87A 1GA0A 4DE2A 4DKIA 5TFQA 1WYCA 1K4FA 3M2JA 2Y2KA 2ZQAA 2XH9A 3C4OA 1U60A 2DCFA 4ZJ3A 3HBRA 4JXVA 4P0MA 1BZAA 2WGVA 3SS3A 1PZOA 5FAQA 4S2LA 3AGEA 1LLBA 3HLFA 4X6TA 5CHUA 2Y2QA 2XQZA 5JYOA 3RXWA 3O88A 3B3XA 2WKIA 4JXWA 4OQHA 2JCHA 1QMEA 1MPLA 3EQUA 4YFMA 5HAIA 3W4OA 1JVJA 1JWZA 4KZ4A 3V39A 4WEKA 1BTLA 4JBFA 4OPRA 4K0WA 3SH8A 4PM7A 4HESA 1ES2A 3PAGA 3PBSA 1MXOA 4RX2A 5E2HA 5L2FA 4BQMA 1W79A 5J8XA 1CEGA 4WM9A 4GN2A 5EOEA 2B5RA 4PM5A 2OLVA 3OC2A 3P98A 2V20A 2XFTA 5TGFA 4IBXA 5HAQA 5EOOA 4PM9A 3UE0A 1XP4A 5HAPA 4P87A 1BULA 5GHZA 3OCNA 1YLWA 1FCNA 4X68A 3UDIA 5KSCA 2H0TA 1GCEA 2H0YA 3C5AA 2XD1A 2R9WA 4OLDA 4FH4A 1SKFA 5HFOA 3HVFA 3Q1FA 3P09A 3QHYA 1JTDA 4S2NA 4OPYA 2XFSA 3BEBA 3GV9A 3V50A 1E3UA 2J7VA 2WZXA 3ZFZA 4CJNA 3OCLA 4ZAMA 4R23A 1GA9A 4Z9QA 3OPPA 4OP8A 3WS1A 5EVIA 4S2MA 3ZHHA 2C5WB 1SDNA 4R0QA 3ZNYA 3ZCZA 3N6IA 1KGFA 1G6AA 3DWZA 4JLFA 1NZUA 4QY6A 5G18A 1N9BA 4QJGA 1O07A 5KMWA 1K4EA 1MKIA 3NI9A 3OZHA 4OOMA 1FR6A 2WGIA 5CXWA 4Y0TA 3IXDA 4WZ4A 4S2IA 3HLDA 3VP4A 2ZC4B 3IF6B 3VOZA 3PBTA 3V3RA 4R3JA 1W5DA 4ZTKA 5FATA 4MNRA 4E3KA 2EFUA 3UDXA 4EWFA 2VGJA 5EUAA 4B4ZA 2J8YA 3OPHA 1IELA 3TG9A 2ZJ9A 4UA7A 3UO9A 3IWOA 1K54A 3G34A 1I2SA 4IVIA 4E3JA 3ZNTA 1PIOA 2QZ6A 3NC8A 2Y59A 1I2WA 3V5MA 2Y2GA 3BFCA 3FKVA 1MY8A 4WZ5C 4OOLA 2WUQA 4OPZA 5FQ9A 3IF5A 3SS4A 2ZC5B 4DE1A 2HPBA 5E2FA 1TVFA 5FI2A 1DJCA 1L0FA 3AGFA 2WZZA 4LCLA 4NK3A 4DXCA 3Q07A 1VQQA 1K57C 1I5QA 2ZC6B 5BOHA 5FQQA 3ZGAB 3JYIA 4JXGA 2EXBA 3HUOA 5CEBA 4LV0A 4OPQA 1YLYA 1FCOA 2EX2A 5AQ7A 1QMFA 4Q8IA 3FZCA 3G30A 1FQGA 2G2WA 3FKWA 5A92A 3BFDA 3IXBA 3Q7VB 2FFYA 1C3BA 2X71A 1KGGA 4KZBA 1KGEA 4OP5A 4OQGA 1NXYA 5FI7A 4FH2A 1BLPA 2HDSA 1H5XA 2IWCA 4Y0OA 3VSLA 3NIAA 1E25A 4DE0A 2V2FF 5FI6A 4L0LA 5A91A 2RL3A 3HUMA 3NDEA 3I7JA 5FAOA 4GD6A 4FD8A 1RP5A 4X55A 1NRFA 3DW0A 2WGWA 1YLJA 3MKEA 2X01A 2Z2MB 4S2PA 5EVIC 3N7WA 4KQOA 5GLCA 4R4RA 4E3IA 5DTKA 2HDUA 1E3UD 3M2KA 3ITAA 3PAEA 4O7DA 1Q2PA 3HLWA 4C3QA 3C7VA 1CK3A 4Y0UA 4BD0A 3OPLA 4OH0A 3MXSA 4WELA 3WS5A 1XPBA 4OQIA 3HLCA 4ZJ1A 4DE3A 5EVID 1HZOA 1KDSA 3GQZA 5CHMA 2Y4AA 1K56A 1FOFA 2HDRA 4K0XA 3BYDA 2WKEA 2V1ZA 5GHXA 1AXBA 1XGJA 4JF4A 1G68A 4S2KA 2P74A 1GHMA 2QPNA 4BD1A 1RCJA 4C75A 1BLHA 1S0WA 1NYMA 4X69A 4BL2A 3UPOA 2C6WB 1ZG4A 4JPMA 1ZKJA 3N8SA 4K91A 1FSWA 3N8LA 1GHIA 3NCKA 4WZ5A 1K54C 2CC1A 3GRJA 1PI5A 4HBUA 1LL5A 2XF3A 3MBZA 1PW1A 2Q9NA 1K6RA 3GMWA 2A49A 4GB7A 1XA7A 4JF6A 3S22A 4X56A 1OMEA 1K57A 3SH9A 4N1XA 4R3BA 1MBLA 5EE8A 2Y2JA 2ZMAA 3LY4A 4BJPA 1KE0A 4XXRA 4EBLA 5CRFA 1RGYA 5E2GA 1IYPA 1DJAA 4N9KA 5A93A 2WYXA 1WYBA 4PM6A 1W8YA 1BLSA 2QMIA 3SH7A 2PU2A 4KQRA 3LCEA 3WWXA 5I94A 3GVBA 2HP6A 5M18A 3ITBA 2G2UA 1K55C 3IHBA 3Q7ZA 3IWQA 1RGZA 1MWSA 3Q7VA 2ZQCA 4N92A 4WMCA 4XUXA 4R4SA 5FA7A 3BFEA 1FCMA 1CI8A 1YT4A 3WS2A 4KG6A 1XA1A 4FCFA 4E3NA 2ZM0A 4N1HA 1FSYA 3UE1A 4QHCA 3RJUA 5EECA 1KDWA 5CEDA 2DRWA 3E2KA 3A3FA 4EBPA 1XKZA 1IKGA 1TDLA 3MZEA 5AQBA 2OSUA 4EUZA 1K38A 4OVDA 1LHYA 4JKTA 2ZLYA 4QY5A 2ZM8A 3VSKA 3O3VA 3LO7A 1W8QA 2XK1A 4KZ5A 2GDNA 1J9MA 1L0EA 4RX3A 3IF6C 3HREA 3IH8A 2Y91A 4KG2A 4M3KA 1K56D 4YINA 2OLUA 1KVMA 2BLSA 3M6BA 2Y2OA 5CECA 1K25A 1ES5A 5E43A 4R1GA 5D3OA 3BM6A 4KZAA 1S6RA 5F1FA 4Y7PA 3TOIA 5JYPA 2OV5A 5CHJA 1BSGA 1PW8A 3IWIA 5AQ9A 4IEDA 3W4PA 5FQMA 2XEPA 4MEZA 2Q9MA 3PBOA 3G4PA 4H8RA 3QNBA 3VP3A 1H8ZA 3GSGA 5CGWA 3NDGA 4XUZA 3SOIA 1SCWA 3TSGA 4OONA 3G2YA 4QU3A 4S2JA 3HUNA 1SHVA 4UAAA 4E3MA 3A3JA 1K55A 3G32A 4HBTA 5CGSA 3NY4A 5FQKA 4KZ9A 1W7FA 4P6BA 1O7EA 2HP5A 4DF6A 3ZG8B 4S2OA 1PYYA 1LI9A 3G31A 3IXGA 4KG5A 4GNUA 3PTEA 3CG5A 2RCXA 1M40A 4EQIA 4LV3A 3CMZA 4F94A 2DNSA 1N4OA 2ZD8A 4FSFA 4DRTA 2Y2IA 1PWDA 3ZG7B 3IQAA 1HVBA 3BECA 4BENA 3ZG9B 3Q81A 3SS5A 1ESIA 3VP0A 3IH9A 4UHUA 4WMCD 5E2EA 2R9XA 5EVLA 2P9VB 4RVAA 5FQJA 2A3UA 4WEJA 2Y55A 1ONGA 2EFXA 2ZQ8A 2JC7A 1YM1A 3MXRA 1E4DA 3A3DA 2ZC7A 5KSHA 4NETA 1JTGA 4MBKA 4GDBA 3GR2A 4OOYA 4GOGA 4B88A 2ZQ7A 3DTMA 3IF6A 4KZ3A 2Z2LB 4QB8A 3MKFA 4UA6A 1JWVA 2Y2MA 1YLPA 4KENB 1L0DA 1IYQA 1PWCA 1ZC2A 3BFGA 3G2ZA 3VOYA 1BT5A 2EX6A 3BLSA 3EQVA 2Y2HA 3MZDA 4OLGA 3WS4A 4OQ0A 2H10A 3N4IA 4RYEA 4ZDXA 2Y2PA 3NBLA 1CI9A 4GZBA 2Y2LA 1L2SA 1ZG6A 3ZVWA 3Q82A 4KQQA 2WAFA 2ZM2A 4GDNA 4IVKA 5DVAA 4U0XA 4EV4A 5F83A 2J9OA 3WRZA 3UN7A 3ZVTA 2VGKA 4E6WA 4MBHA 4JXSA 2WK0A 3MFDA 5CTMA 2H5SA 5DF9A 1ERQA 1BLCA 1ONHA 1NJ4A 1LL9A 1KVLA 4LV1A 3S1YA 3V3SA 3PBQA 1CEFA 5A90A 2I72A 4JF5A 5M19A 1K6SA 2XD5A 4GKUA 3WRTA 1IKIA 3IHAA 5DTSA 5GL9A 2EXAA 4D2OA 1ES4A 1DJBA 1NZOA 4GD8A 2J9PA 4PM8A 3IT9A 3W4QA 1EWZA 5DF7A 4ZBEA 2XR0A 3MZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HX9 A;  5M1A A;  3ISG A;  3UPN A;  2XGN A;  3ZG5 A;  4HEF A;  3UPP A;  1PWG A;  4MLL A;  4DDY A;  1IYO A;  4ID4 A;  5HAR A;  3W8K A;  5GLD A;  4E3L A;  4EBN A;  2JE5 A;  4N9L A;  5FSR A;  1YMX A;  2PU4 A;  2WGW B;  1WE4 A;  2P9V A;  1MWT A;  2ZC3 B;  5AQA A;  5FQI A;  4DXB A;  1YMS A;  2HDQ A;  5DTT A;  1ERM A;  3VFH A;  3CZD A;  4IBR A;  3HL9 A;  3UY6 A;  4PMA A;  1ALQ A;  1Z6F A;  3DWK A;  1XX2 A;  3VMA A;  5CGX A;  3RXX A;  2XLN A;  5HL1 A;  3LY3 A;  1MWU A;  2EX9 A;  4KZ6 A;  4U3T A;  3IXH A;  4X53 A;  5IHV A;  4DDS A;  1YQS A;  3D4F A;  1L0G A;  1XXM A;  2ZQD A;  3M6H A;  5CTN A;  1NYY A;  1HTZ A;  3S4X A;  5GHY A;  5HW3 A;  5U47 A;  1PZP A;  5DF8 A;  3FV7 A;  5FAS A;  2XDM A;  1KE3 A;  4MBF A;  5TR7 A;  1BUE A;  3FWL A;  3G35 A;  1Y54 A;  3A3I A;  5FAP A;  2ZQ9 A;  3VFF A;  3WS0 A;  1DY6 A;  3E2L A;  2Y2N A;  3HLB A;  5F82 A;  4U0T A;  3FYZ A;  4BL3 A;  1ESU A;  1YLZ A;  3HLE A;  4OKP A;  2PBY A;  4B4X A;  2E8I A;  5FDH A;  3O86 A;  4ZJ2 A;  1NY0 A;  3BFF A;  3UNW A;  3OPR A;  3PBR A;  3GTC A;  4LCM A;  1YLT A;  1LI0 A;  1KE4 A;  2UWX A;  3LEZ A;  5F1G A;  1SDE A;  1JWP A;  1MWR A;  1PI4 A;  2IWD A;  3VP1 A;  2IWB A;  3BLM A;  1M6K A;  3C7U A;  1TDG A;  3HLG A;  4WYY A;  3CJM A;  4C6Y A;  5GLA A;  4RA7 A;  4UA9 A;  3VP2 A;  4A5R A;  3A3E A;  3UE3 A;  3PBN A;  3ZG0 A;  5EPH A;  2WAD A;  3ZDJ A;  4CPK A;  3N8R A;  2X02 A;  2WAE A;  1Q2Q A;  2BG1 A;  4KZ8 A;  1FR1 A;  4P85 A;  4E6X A;  1XGI A;  1H8Y A;  5GLB A;  5KZH A;  3C4P A;  4S2N C;  3BRM A;  1IEM A;  3QNC A;  5EVI B;  1GHP A;  4WBG A;  2FFF B;  4E3O A;  2WKH A;  1VM1 A;  2EX8 A;  2JBF A;  5CER A;  1ERO A;  3AGD A;  4QD4 A;  3UDF A;  4PPR A;  4KZ7 A;  1HD8 A;  4BLM A;  1EI5 A;  1IYS A;  1ES3 A;  1TEM A;  2HP9 A;  4LEN A;  4LV2 A;  3O87 A;  1GA0 A;  4DE2 A;  4DKI A;  5TFQ A;  1WYC A;  1K4F A;  3M2J A;  2Y2K A;  2ZQA A;  2XH9 A;  3C4O A;  1U60 A;  2DCF A;  4ZJ3 A;  3HBR A;  4JXV A;  4P0M A;  1BZA A;  2WGV A;  3SS3 A;  1PZO A;  5FAQ A;  4S2L A;  3AGE A;  1LLB A;  3HLF A;  4X6T A;  5CHU A;  2Y2Q A;  2XQZ A;  5JYO A;  3RXW A;  3O88 A;  3B3X A;  2WKI A;  4JXW A;  4OQH A;  2JCH A;  1QME A;  1MPL A;  3EQU A;  4YFM A;  5HAI A;  3W4O A;  1JVJ A;  1JWZ A;  4KZ4 A;  3V39 A;  4WEK A;  1BTL A;  4JBF A;  4OPR A;  4K0W A;  3SH8 A;  4PM7 A;  4HES A;  1ES2 A;  3PAG A;  3PBS A;  1MXO A;  4RX2 A;  5E2H A;  5L2F A;  4BQM A;  1W79 A;  5J8X A;  1CEG A;  4WM9 A;  4GN2 A;  5EOE A;  2B5R A;  4PM5 A;  2OLV A;  3OC2 A;  3P98 A;  2V20 A;  2XFT A;  5TGF A;  4IBX A;  5HAQ A;  5EOO A;  4PM9 A;  3UE0 A;  1XP4 A;  5HAP A;  4P87 A;  1BUL A;  5GHZ A;  3OCN A;  1YLW A;  1FCN A;  4X68 A;  3UDI A;  5KSC A;  2H0T A;  1GCE A;  2H0Y A;  3C5A A;  2XD1 A;  2R9W A;  4OLD A;  4FH4 A;  1SKF A;  5HFO A;  3HVF A;  3Q1F A;  3P09 A;  3QHY A;  1JTD A;  4S2N A;  4OPY A;  2XFS A;  3BEB A;  3GV9 A;  3V50 A;  1E3U A;  2J7V A;  2WZX A;  3ZFZ A;  4CJN A;  3OCL A;  4ZAM A;  4R23 A;  1GA9 A;  4Z9Q A;  3OPP A;  4OP8 A;  3WS1 A;  5EVI A;  4S2M A;  3ZHH A;  2C5W B;  1SDN A;  4R0Q A;  3ZNY A;  3ZCZ A;  3N6I A;  1KGF A;  1G6A A;  3DWZ A;  4JLF A;  1NZU A;  4QY6 A;  5G18 A;  1N9B A;  4QJG A;  1O07 A;  5KMW A;  1K4E A;  1MKI A;  3NI9 A;  3OZH A;  4OOM A;  1FR6 A;  2WGI A;  5CXW A;  4Y0T A;  3IXD A;  4WZ4 A;  4S2I A;  3HLD A;  3VP4 A;  2ZC4 B;  3IF6 B;  3VOZ A;  3PBT A;  3V3R A;  4R3J A;  1W5D A;  4ZTK A;  5FAT A;  4MNR A;  4E3K A;  2EFU A;  3UDX A;  4EWF A;  2VGJ A;  5EUA A;  4B4Z A;  2J8Y A;  3OPH A;  1IEL A;  3TG9 A;  2ZJ9 A;  4UA7 A;  3UO9 A;  3IWO A;  1K54 A;  3G34 A;  1I2S A;  4IVI A;  4E3J A;  3ZNT A;  1PIO A;  2QZ6 A;  3NC8 A;  2Y59 A;  1I2W A;  3V5M A;  2Y2G A;  3BFC A;  3FKV A;  1MY8 A;  4WZ5 C;  4OOL A;  2WUQ A;  4OPZ A;  5FQ9 A;  3IF5 A;  3SS4 A;  2ZC5 B;  4DE1 A;  2HPB A;  5E2F A;  1TVF A;  5FI2 A;  1DJC A;  1L0F A;  3AGF A;  2WZZ A;  4LCL A;  4NK3 A;  4DXC A;  3Q07 A;  1VQQ A;  1K57 C;  1I5Q A;  2ZC6 B;  5BOH A;  5FQQ A;  3ZGA B;  3JYI A;  4JXG A;  2EXB A;  3HUO A;  5CEB A;  4LV0 A;  4OPQ A;  1YLY A;  1FCO A;  2EX2 A;  5AQ7 A;  1QMF A;  4Q8I A;  3FZC A;  3G30 A;  1FQG A;  2G2W A;  3FKW A;  5A92 A;  3BFD A;  3IXB A;  3Q7V B;  2FFY A;  1C3B A;  2X71 A;  1KGG A;  4KZB A;  1KGE A;  4OP5 A;  4OQG A;  1NXY A;  5FI7 A;  4FH2 A;  1BLP A;  2HDS A;  1H5X A;  2IWC A;  4Y0O A;  3VSL A;  3NIA A;  1E25 A;  4DE0 A;  2V2F F;  5FI6 A;  4L0L A;  5A91 A;  2RL3 A;  3HUM A;  3NDE A;  3I7J A;  5FAO A;  4GD6 A;  4FD8 A;  1RP5 A;  4X55 A;  1NRF A;  3DW0 A;  2WGW A;  1YLJ A;  3MKE A;  2X01 A;  2Z2M B;  4S2P A;  5EVI C;  3N7W A;  4KQO A;  5GLC A;  4R4R A;  4E3I A;  5DTK A;  2HDU A;  1E3U D;  3M2K A;  3ITA A;  3PAE A;  4O7D A;  1Q2P A;  3HLW A;  4C3Q A;  3C7V A;  1CK3 A;  4Y0U A;  4BD0 A;  3OPL A;  4OH0 A;  3MXS A;  4WEL A;  3WS5 A;  1XPB A;  4OQI A;  3HLC A;  4ZJ1 A;  4DE3 A;  5EVI D;  1HZO A;  1KDS A;  3GQZ A;  5CHM A;  2Y4A A;  1K56 A;  1FOF A;  2HDR A;  4K0X A;  3BYD A;  2WKE A;  2V1Z A;  5GHX A;  1AXB A;  1XGJ A;  4JF4 A;  1G68 A;  4S2K A;  2P74 A;  1GHM A;  2QPN A;  4BD1 A;  1RCJ A;  4C75 A;  1BLH A;  1S0W A;  1NYM A;  4X69 A;  4BL2 A;  3UPO A;  2C6W B;  1ZG4 A;  4JPM A;  1ZKJ A;  3N8S A;  4K91 A;  1FSW A;  3N8L A;  1GHI A;  3NCK A;  4WZ5 A;  1K54 C;  2CC1 A;  3GRJ A;  1PI5 A;  4HBU A;  1LL5 A;  2XF3 A;  3MBZ A;  1PW1 A;  2Q9N A;  1K6R A;  3GMW A;  2A49 A;  4GB7 A;  1XA7 A;  4JF6 A;  3S22 A;  4X56 A;  1OME A;  1K57 A;  3SH9 A;  4N1X A;  4R3B A;  1MBL A;  5EE8 A;  2Y2J A;  2ZMA A;  3LY4 A;  4BJP A;  1KE0 A;  4XXR A;  4EBL A;  5CRF A;  1RGY A;  5E2G A;  1IYP A;  1DJA A;  4N9K A;  5A93 A;  2WYX A;  1WYB A;  4PM6 A;  1W8Y A;  1BLS A;  2QMI A;  3SH7 A;  2PU2 A;  4KQR A;  3LCE A;  3WWX A;  5I94 A;  3GVB A;  2HP6 A;  5M18 A;  3ITB A;  2G2U A;  1K55 C;  3IHB A;  3Q7Z A;  3IWQ A;  1RGZ A;  1MWS A;  3Q7V A;  2ZQC A;  4N92 A;  4WMC A;  4XUX A;  4R4S A;  5FA7 A;  3BFE A;  1FCM A;  1CI8 A;  1YT4 A;  3WS2 A;  4KG6 A;  1XA1 A;  4FCF A;  4E3N A;  2ZM0 A;  4N1H A;  1FSY A;  3UE1 A;  4QHC A;  3RJU A;  5EEC A;  1KDW A;  5CED A;  2DRW A;  3E2K A;  3A3F A;  4EBP A;  1XKZ A;  1IKG A;  1TDL A;  3MZE A;  5AQB A;  2OSU A;  4EUZ A;  1K38 A;  4OVD A;  1LHY A;  4JKT A;  2ZLY A;  4QY5 A;  2ZM8 A;  3VSK A;  3O3V A;  3LO7 A;  1W8Q A;  2XK1 A;  4KZ5 A;  2GDN A;  1J9M A;  1L0E A;  4RX3 A;  3IF6 C;  3HRE A;  3IH8 A;  2Y91 A;  4KG2 A;  4M3K A;  1K56 D;  4YIN A;  2OLU A;  1KVM A;  2BLS A;  3M6B A;  2Y2O A;  5CEC A;  1K25 A;  1ES5 A;  5E43 A;  4R1G A;  5D3O A;  3BM6 A;  4KZA A;  1S6R A;  5F1F A;  4Y7P A;  3TOI A;  5JYP A;  2OV5 A;  5CHJ A;  1BSG A;  1PW8 A;  3IWI A;  5AQ9 A;  4IED A;  3W4P A;  5FQM A;  2XEP A;  4MEZ A;  2Q9M A;  3PBO A;  3G4P A;  4H8R A;  3QNB A;  3VP3 A;  1H8Z A;  3GSG A;  5CGW A;  3NDG A;  4XUZ A;  3SOI A;  1SCW A;  3TSG A;  4OON A;  3G2Y A;  4QU3 A;  4S2J A;  3HUN A;  1SHV A;  4UAA A;  4E3M A;  3A3J A;  1K55 A;  3G32 A;  4HBT A;  5CGS A;  3NY4 A;  5FQK A;  4KZ9 A;  1W7F A;  4P6B A;  1O7E A;  2HP5 A;  4DF6 A;  3ZG8 B;  4S2O A;  1PYY A;  1LI9 A;  3G31 A;  3IXG A;  4KG5 A;  4GNU A;  3PTE A;  3CG5 A;  2RCX A;  1M40 A;  4EQI A;  4LV3 A;  3CMZ A;  4F94 A;  2DNS A;  1N4O A;  2ZD8 A;  4FSF A;  4DRT A;  2Y2I A;  1PWD A;  3ZG7 B;  3IQA A;  1HVB A;  3BEC A;  4BEN A;  3ZG9 B;  3Q81 A;  3SS5 A;  1ESI A;  3VP0 A;  3IH9 A;  4UHU A;  4WMC D;  5E2E A;  2R9X A;  5EVL A;  2P9V B;  4RVA A;  5FQJ A;  2A3U A;  4WEJ A;  2Y55 A;  1ONG A;  2EFX A;  2ZQ8 A;  2JC7 A;  1YM1 A;  3MXR A;  1E4D A;  3A3D A;  2ZC7 A;  5KSH A;  4NET A;  1JTG A;  4MBK A;  4GDB A;  3GR2 A;  4OOY A;  4GOG A;  4B88 A;  2ZQ7 A;  3DTM A;  3IF6 A;  4KZ3 A;  2Z2L B;  4QB8 A;  3MKF A;  4UA6 A;  1JWV A;  2Y2M A;  1YLP A;  4KEN B;  1L0D A;  1IYQ A;  1PWC A;  1ZC2 A;  3BFG A;  3G2Z A;  3VOY A;  1BT5 A;  2EX6 A;  3BLS A;  3EQV A;  2Y2H A;  3MZD A;  4OLG A;  3WS4 A;  4OQ0 A;  2H10 A;  3N4I A;  4RYE A;  4ZDX A;  2Y2P A;  3NBL A;  1CI9 A;  4GZB A;  2Y2L A;  1L2S A;  1ZG6 A;  3ZVW A;  3Q82 A;  4KQQ A;  2WAF A;  2ZM2 A;  4GDN A;  4IVK A;  5DVA A;  4U0X A;  4EV4 A;  5F83 A;  2J9O A;  3WRZ A;  3UN7 A;  3ZVT A;  2VGK A;  4E6W A;  4MBH A;  4JXS A;  2WK0 A;  3MFD A;  5CTM A;  2H5S A;  5DF9 A;  1ERQ A;  1BLC A;  1ONH A;  1NJ4 A;  1LL9 A;  1KVL A;  4LV1 A;  3S1Y A;  3V3S A;  3PBQ A;  1CEF A;  5A90 A;  2I72 A;  4JF5 A;  5M19 A;  1K6S A;  2XD5 A;  4GKU A;  3WRT A;  1IKI A;  3IHA A;  5DTS A;  5GL9 A;  2EXA A;  4D2O A;  1ES4 A;  1DJB A;  1NZO A;  4GD8 A;  2J9P A;  4PM8 A;  3IT9 A;  3W4Q A;  1EWZ A;  5DF7 A;  4ZBE A;  2XR0 A;  3MZF A; 
#chains in the Genus database with same CATH topology
 1MKM A;  1EW0 A;  3UPN A;  2ZL1 B;  1S4S A;  1PWG A;  4DDY A;  4ID4 A;  2JE5 A;  1YMX A;  5AQA A;  5FQI A;  2HDQ A;  4GS9 A;  3CZD A;  3LI9 A;  4PMA A;  1XX2 A;  1SKO B;  1MWU A;  2EX9 A;  5IHV A;  2V8C A;  2LB5 A;  4HJ6 A;  4JGO A;  1XXM A;  2E8J A;  5U47 A;  4EU0 A;  3MQQ A;  5DF8 A;  4RQ9 A;  1KE3 A;  1Y54 A;  3VFF A;  3IS2 A;  3H7W A;  5F82 A;  4CLC C;  1YLZ A;  2PBY A;  1XJ2 A;  4ZJ2 A;  4HHD A;  3UNW A;  1UWN X;  4LCM A;  4CLC D;  2KX6 A;  5F1G A;  3QP1 A;  1TDG A;  4WYY A;  2OAQ 1;  3T4J A;  4LFU A;  4UA9 A;  4A5R A;  3VE4 A;  2D01 A;  4KZ8 A;  3EEH A;  4E6X A;  5GLB A;  2ZL1 A;  3MSH A;  4QD4 A;  2JKT M;  4PPR A;  1IYS A;  2G7U A;  4LV2 A;  4LRY C;  3O87 A;  4DKI A;  2VA0 A;  4I3A A;  4HI4 A;  1U60 A;  3A0S A;  3HBR A;  4ZJ3 A;  4JXV A;  3SS3 A;  1PZO A;  4ETZ A;  1LLB A;  2Y2Q A;  2XQZ A;  2WKI A;  3T4L A;  3EQU A;  3T4O A;  3W4O A;  1JVJ A;  4KZ4 A;  4WEK A;  4OPR A;  2VX8 A;  4JBF A;  3SH8 A;  1ES2 A;  5L2F A;  4Z1W A;  3S7P A;  4GN2 A;  1CJF A;  2V20 A;  4PM9 A;  1XP4 A;  1BUL A;  5GHZ A;  2PR5 A;  1A0K A;  1YAX A;  3UDI A;  2H0T A;  2R9W A;  4FH4 A;  2HJE A;  1JTD A;  2W1T B;  2BAS A;  3V50 A;  1E3U A;  3ZFZ A;  4CJN A;  4R23 A;  1GA9 A;  3OPP A;  4OP8 A;  3SW1 A;  5DKK A;  3ZHH A;  2C5W B;  3CPT A;  2YKF A;  3LR5 A;  1KGF A;  4YOF A;  1NZU A;  4BMW A;  1O07 A;  1K4E A;  2FH5 A;  3NI9 A;  2ZOI A;  3LGO A;  2ZC4 B;  3VOZ A;  2PBD P;  3PBT A;  5FAT A;  3ULF A;  3UDX A;  2VGJ A;  4B4Z A;  2QJ7 A;  3IWO A;  2NUT C;  3KYQ A;  3W2Z A;  4IVI A;  2QZ6 A;  3NC8 A;  4MN6 A;  2Y2G A;  3BFC A;  4WZ5 C;  3PXP A;  5EM0 A;  5FQ9 A;  3SS4 A;  1HLU P;  4DE1 A;  2J3T D;  1TVF A;  3MJQ A;  1TS7 A;  3Q07 A;  5FQQ A;  4LPZ A;  2EXB A;  2EX2 A;  3TJZ C;  1TS0 A;  2KOI A;  2G2W A;  3FKW A;  3BFD A;  2LB9 A;  4KZB A;  1DP6 A;  4Y3I A;  4Y0O A;  2IWC A;  3VSL A;  5FI6 A;  2W1T A;  4L0L A;  3LR3 A;  1RP5 A;  2WKP A;  2WGW A;  5EVI C;  4E3I A;  5DTK A;  3M2K A;  3PAE A;  4O7D A;  3HLW A;  1P9R A;  1CF0 A;  3C7V A;  1CK3 A;  1W63 M;  4OH0 A;  5LBR A;  2M7U A;  5EVI D;  2QHK A;  1KDS A;  3GQZ A;  2Y4A A;  4MMN A;  2HDR A;  4K0X A;  1AXB A;  3PHY A;  2XA7 M;  1XGJ A;  1N9L A;  4JF4 A;  2P74 A;  4BD1 A;  1RCJ A;  1S0W A;  1GSW A;  3N8S A;  4K91 A;  4WZ5 A;  2CC1 A;  2P08 A;  4GCZ A;  4HBU A;  1LL5 A;  3MBZ A;  2Q9N A;  3S22 A;  1NWZ A;  3SH9 A;  4R3B A;  3GDI A;  2Y2J A;  3E0Y A;  4F3L A;  4EBL A;  3LIE A;  3LIA A;  1DJA A;  2V0W A;  4N9K A;  5AVE A;  1G28 A;  4LLO B;  1BLS A;  3SH7 A;  3GVB A;  3BQ8 A;  3ITB A;  4UQI M;  3Q7Z A;  1MWS A;  2ZQC A;  4N92 A;  4R4S A;  2JN7 A;  3BFE A;  4KG6 A;  4E3N A;  2ZM0 A;  4N1H A;  1FSY A;  3KX0 X;  4G3K A;  4X1L A;  1XKZ A;  1IKG A;  3QP8 A;  3VV4 A;  3BQA A;  2GZA A;  1OTE A;  2ZLY A;  3LO7 A;  4KZ5 A;  4CLC E;  1J9M A;  1L0E A;  4L9F A;  2Y91 A;  3KSG A;  1K56 D;  4YIN A;  2Y2O A;  5CEC A;  1ES5 A;  5D3O A;  2OOL A;  4KZA A;  4B93 A;  2JKT I;  4Y7P A;  1BSG A;  1XFQ A;  5AQ9 A;  5FQM A;  4FTX A;  1XJ4 A;  5L07 A;  3QNB A;  3VP3 A;  3GSG A;  2HF6 A;  4OON A;  1GSV A;  3A3J A;  5IS1 A;  3NY4 A;  2HP5 A;  4DF6 A;  3ZG8 B;  4S2O A;  3G31 A;  3CMZ A;  4DRT A;  3ZG7 B;  3ZG9 B;  4WMC D;  5EVL A;  4RVA A;  5FQJ A;  2A3U A;  4WEJ A;  3T1R A;  1N9O A;  4ZRR A;  2JC7 A;  1YM1 A;  2L1M A;  3RFB A;  3GR2 A;  4BWI A;  4KZ3 A;  2VZW A;  5HSQ A;  3MKF A;  1Z09 A;  3G2Z A;  3KSF A;  2H28 A;  2Y2H A;  3MZD A;  1H8M A;  2H10 A;  3N4I A;  1CI9 A;  2Y2L A;  3KO6 A;  1L2S A;  4KQQ A;  1FIL A;  4H6J A;  3GEC A;  4IVK A;  4U0X A;  2J9O A;  3H82 B;  3ZVT A;  4MBH A;  1P97 A;  5CTM A;  2H5S A;  1NJ4 A;  1LL9 A;  4LV1 A;  4E04 A;  2JHE A;  2O0Y A;  2XD5 A;  3F1P B;  4NXB A;  5L8M A;  1T18 A;  2QYB A;  3E4Q A;  4GD8 A;  2J9P A;  3IT9 A;  4IUK A;  3W4Q A;  3OBF A;  2FZ0 A;  2XR0 A;  3MZF A;  5M1A A;  3ISG A;  3DBA A;  4HEF A;  2VJW A;  3UPP A;  3JPU A;  5HAR A;  4Y15 A;  5DFY A;  5GLD A;  3W8K A;  4EBN A;  4E3L A;  4N9L A;  1WE4 A;  1MWT A;  3EGD C;  4Y2F A;  3HL9 A;  3UY6 A;  3DWK A;  3VMA A;  5CGX A;  2XLN A;  4KZ6 A;  3IXH A;  3KSH A;  4UEY A;  3K2N A;  2PYR A;  5J7E A;  1HTZ A;  4I5S A;  1DP9 A;  2Q0O A;  2XDM A;  1BUE A;  3A3I A;  3WS0 A;  1DRM A;  3FYZ A;  4QWO A;  5I5L A;  5F68 A;  4B4X A;  2YKH A;  3BFF A;  3UMD A;  1YLT A;  1KE4 A;  3VP1 A;  2IWD A;  3BLM A;  2GX5 A;  3F1P A;  1OPX A;  4RA7 A;  3VP2 A;  2O9A A;  3PBN A;  1STZ A;  4CPK A;  3ZDJ A;  2X02 A;  1FR1 A;  2Y8H A;  3C4P A;  4S2N C;  1GHP A;  2FFF B;  1VM1 A;  3TRC A;  4KZ7 A;  1EI5 A;  5EVE A;  1ES3 A;  1TEM A;  1P9W A;  4DE2 A;  5TFQ A;  2V0U A;  1K4F A;  3M2J A;  5HL6 A;  2B95 A;  2DCF A;  4R70 A;  4P0M A;  1BZA A;  2WGV A;  5FAQ A;  2DMW A;  3AGE A;  4X6T A;  5JYO A;  3RXW A;  1H3Q A;  4EW7 A;  3O88 A;  3UB7 A;  4WF0 A;  4ARZ B;  4JXW A;  2JCH A;  4YFM A;  2W3G A;  4K0W A;  1CQA A;  4HES A;  1V9Z A;  2V1B A;  1W79 A;  3F1N A;  5J8X A;  2B5R A;  5DKL A;  3OC2 A;  3LYX A;  3L9K A;  2XFT A;  5TGF A;  3CWF A;  4DJ2 A;  1D7E A;  3UE0 A;  4P87 A;  1YLW A;  5HFO A;  3Q1F A;  1OTI A;  4S2N A;  2XFS A;  3BEB A;  4B9O A;  2A24 A;  2J7V A;  2WZX A;  3TW8 A;  3WS1 A;  3ZCZ A;  3E98 A;  1LSW A;  4QY6 A;  1N9B A;  5CXW A;  2B02 A;  4OOM A;  5HWT A;  4WZ4 A;  2VLG A;  2V8F A;  1W5D A;  1BYW A;  1S66 L;  1UWP X;  2J8Y A;  2ZJ9 A;  4UA7 A;  3UO9 A;  1PIO A;  2GNX A;  5E2F A;  1DJC A;  5HDC A;  4ESP A;  4DXC A;  5BOH A;  2JKR M;  2XRO A;  3JYI A;  4LV0 A;  3MF0 A;  4OPQ A;  1FCO A;  4Q8I A;  3A0V A;  5A92 A;  3Q7V B;  3RH8 B;  4OQG A;  1KGE A;  4OP5 A;  5FI7 A;  1NXY A;  1BLP A;  1H5X A;  1K0K A;  1E25 A;  2RL3 A;  3D9Y A;  4GD6 A;  3K3D A;  4X55 A;  1NRF A;  3UB6 A;  1YLJ A;  2EA9 A;  4R4R A;  3UE6 A;  1E3U D;  1IFQ A;  4WEL A;  4ZJ1 A;  1JNU A;  1SKO A;  1HZO A;  5CHM A;  4GJ4 A;  1FOF A;  3RTY A;  3EGX C;  3CHW P;  1GHM A;  4R3A A;  3UPO A;  3EOI A;  1ZG4 A;  4BBT A;  1D1J A;  1T1A A;  1PW1 A;  1K6R A;  1XA7 A;  4HH3 A;  3QP4 A;  5FDS A;  3T4T A;  1MBL A;  1LL8 A;  3DTK A;  3LY4 A;  4HNB A;  4XXR A;  2WYX A;  4PM6 A;  2PU2 A;  4KQR A;  3LCE A;  5I94 A;  2HP6 A;  4M4X A;  2G2U A;  3IHB A;  2VV6 A;  3Q7V A;  3C38 A;  1FCM A;  1YT4 A;  4Y5F A;  3BJN A;  1X0O A;  5HD3 A;  3RJU A;  1KDW A;  3U2A A;  2DRW A;  3S7O A;  4NG2 A;  2WKQ A;  5AQB A;  3BY8 A;  4OVD A;  4JKT A;  4FOF A;  4QY5 A;  2O9B A;  2ZM8 A;  2PD8 A;  2XK1 A;  4KUO A;  4KG2 A;  4NKP A;  5C5K A;  4HP4 A;  2OLU A;  2BLS A;  3LIF A;  5A8B A;  3C30 A;  4R1G A;  3IBR A;  5F1F A;  5JYP A;  2OV5 A;  3IWI A;  1PW8 A;  3KYZ A;  2W27 A;  1S1Z A;  1OJG A;  1ZHH B;  5CGW A;  3SOI A;  3G2Y A;  1KOU A;  4E3M A;  5MC7 A;  4IHQ A;  2PRF A;  4P6B A;  2WKR A;  1PYY A;  3MQO A;  3IXG A;  4GNU A;  3PTE A;  2HV1 A;  2VV7 A;  3CG5 A;  2RCX A;  1M40 A;  4LV3 A;  3LEQ A;  2ACG A;  3BEC A;  4WL9 A;  4UHU A;  1FIK A;  2IA2 A;  2EFX A;  3MXR A;  4BBV A;  4BBU A;  4OOY A;  2ZQ7 A;  1DP8 A;  2Z2L B;  4UA6 A;  4Y17 A;  1JWV A;  4KUK A;  2Y2M A;  1YLP A;  2K2N A;  1IYQ A;  3BFG A;  4GW9 A;  2EX6 A;  4OLG A;  2W3E A;  3BY9 A;  4EXO A;  4RYE A;  2Y2P A;  5HWW A;  3ZVW A;  1ACF A;  2WAF A;  1TS6 A;  3WRZ A;  2WK0 A;  3A0R A;  5DF9 A;  4I3I A;  3FG8 A;  5L10 A;  3PBQ A;  1CEF A;  5A90 A;  1K6S A;  3V67 A;  4P6Z M;  3WRT A;  5DTS A;  5GL9 A;  2EXA A;  2VEA A;  4D2O A;  1ES4 A;  4PM8 A;  5G4Z A;  3NOT C;  3DTI A;  2XGN A;  3HJI A;  2O99 A;  2JKG A;  4MLL A;  4MN5 A;  3IX3 A;  2JKR I;  3CUE C;  5FSR A;  5IT5 A;  2PU4 A;  4Y13 A;  1VHM A;  5DTT A;  4IBR A;  3CIT A;  1ALQ A;  1Z6F A;  3LY3 A;  4X53 A;  1YQS A;  4LRX C;  1L0G A;  2ZQD A;  3M6H A;  3FPV A;  3S4X A;  5GHY A;  5HWV A;  5HW3 A;  1PZP A;  3FV7 A;  3OOV A;  5TR7 A;  3MR0 A;  3FWL A;  5FAP A;  2ZQ9 A;  4BL3 A;  1DY6 A;  2KDK A;  2Y2N A;  3P01 A;  1LT0 A;  3IBJ A;  2E8I A;  3PBR A;  1LI0 A;  4HJ4 A;  3LEZ A;  1JWP A;  1MWR A;  3O5Y A;  1PI4 A;  3C7U A;  3FPW A;  3HLG A;  4LRZ E;  3CJM A;  2PHY A;  5GLA A;  4MCW A;  2CMN A;  4II7 A;  2I9V A;  5EFW A;  2WAD A;  5HZH A;  3N8R A;  2WAE A;  5HDS A;  2BG1 A;  3CUE A;  1ZTU A;  5KZH A;  1S67 L;  4E3O A;  4WLA A;  2JBF A;  4LGW A;  1ERO A;  1F98 A;  3AGD A;  4BLM A;  3DTE A;  2HP9 A;  1YKD A;  3HCY A;  1V9Y A;  1GA0 A;  3NEC A;  2XH9 A;  3C4O A;  2NUP C;  3MS6 A;  4R6L A;  1IOU A;  1WA9 A;  2VKS A;  2MJ6 A;  3B3X A;  4OQH A;  1G5U A;  1AWI A;  1QME A;  5HAI A;  3S7N A;  5TBM B;  4XT2 B;  1BTL A;  4PM7 A;  3PBS A;  1MXO A;  4WN5 A;  4BQM A;  1NLZ A;  4WM9 A;  5EOE A;  5FL3 A;  4PM5 A;  1OJ5 A;  4IBX A;  5HAQ A;  3OCN A;  2XRN A;  4X68 A;  2KLI A;  2J3W A;  1GCE A;  2H0Y A;  2OAP 1;  3D3O A;  1Y4O A;  2XD1 A;  4PAU A;  1SKF A;  3HVF A;  3QHY A;  4OPY A;  4I3J A;  4ZAM A;  2BTF P;  4Z9Q A;  1MC0 A;  3UB9 A;  3ZNY A;  3N6I A;  1G6A A;  3R7W B;  4QJG A;  3UB8 A;  1VEU B;  1MKI A;  3OZH A;  1FR6 A;  4Y0T A;  3IXD A;  4S2I A;  3HLD A;  3IF6 B;  3V3R A;  4R3J A;  3SZT A;  4HIA A;  3NJA A;  2EFU A;  2K31 A;  1IEL A;  3TG9 A;  1K54 A;  3G34 A;  4MDZ A;  1F2K A;  3H82 A;  2Y59 A;  1I2W A;  3CLO A;  3FKV A;  3IX8 A;  4XT2 A;  3T12 B;  3AGF A;  3IX4 A;  2WZZ A;  4LCL A;  4NK3 A;  3D72 A;  1VQQ A;  5HDD A;  3ZGA B;  4JXG A;  3HUO A;  5CEB A;  3FZC A;  4O8G A;  1VET B;  2VK3 A;  3IXB A;  4NXG A;  2X71 A;  1KGG A;  3L7H A;  2W3H A;  3LI8 A;  4PKY G;  3NIA A;  2PYP A;  3HUM A;  3P7N A;  3MKE A;  2Z2M B;  4S2P A;  3N7W A;  3T4Q A;  4GHI B;  5GLC A;  2ZOH A;  4C3Q A;  4BD0 A;  4Y0U A;  3MXS A;  2VGL S;  3WS5 A;  4OQI A;  2HGV A;  4NEE D;  4YWZ A;  2PAV P;  4EET B;  4HOI A;  3BYD A;  2WKE A;  2V1A A;  4ME4 A;  4QPR A;  5KIZ A;  3C8C A;  4C75 A;  4O0P A;  4X25 A;  1NYM A;  1XJ3 A;  1TD5 A;  2C6W B;  3MXQ A;  4JPM A;  4P6Z S;  1GHI A;  3JVV A;  3B33 A;  5J4E A;  4WUJ A;  2XF3 A;  1OTB A;  4GB7 A;  4L9E A;  3QP6 A;  3E4P A;  4X56 A;  1OME A;  3IS2 B;  3H7W B;  4N1X A;  5EE8 A;  4PHT A;  2ZMA A;  3F1O B;  1IYP A;  1PNE A;  3WWX A;  3PYP A;  1K55 C;  1T1B A;  2W1R A;  5FA7 A;  3T1S A;  1CI8 A;  3WS2 A;  5HD5 A;  4G3V A;  3UE1 A;  1NLY A;  4QHC A;  2B18 A;  3E2K A;  3A3F A;  4GHI A;  2OSU A;  4EUZ A;  2EWW A;  2PT7 A;  3QP2 A;  3T1X A;  3VSK A;  3O3V A;  1W63 Q;  4RX3 A;  4PKY A;  4M3K A;  3T4S A;  3C2W A;  3BM6 A;  4ARZ A;  1S6R A;  2QKP A;  5CHJ A;  4Q0H A;  4CLC B;  3W4P A;  5FEG A;  4Q0J A;  2Q9M A;  3PBO A;  3G4P A;  4H8R A;  1H8Z A;  3FC7 A;  3NDG A;  3QP5 A;  3E4O A;  4XUZ A;  1SCW A;  3TSG A;  3LIC A;  4S2J A;  3HUN A;  3F1O A;  5L09 A;  1K55 A;  3G32 A;  4HBT A;  5CGS A;  4KZ9 A;  1W7F A;  1O7E A;  1LI9 A;  4EUV A;  4KG5 A;  3TE8 A;  2DNS A;  4FSF A;  2Y2I A;  1PWD A;  4BEN A;  4NXF A;  3VP0 A;  2Z6D A;  2R9X A;  2P9V B;  4HY8 A;  2V9A A;  1UGU A;  3CPT B;  2ZQ8 A;  5TJJ A;  1E4D A;  2ZC7 A;  5KSH A;  4GDB A;  3DTM A;  4KEN B;  3LR0 A;  1L0D A;  3MFX A;  4NXE A;  3VOY A;  1OTD A;  2PDR A;  3KSI A;  4OQ0 A;  5K5B A;  3NBL A;  1T19 A;  1YSP A;  1ZG6 A;  3K3C A;  2ZM2 A;  4GDN A;  5DVA A;  4CLC A;  3UN7 A;  2VGK A;  4JXS A;  1ERQ A;  2UV0 E;  5DJT A;  1KVL A;  3S1Y A;  2I72 A;  1YSQ A;  4GKU A;  1IKI A;  3B47 A;  1OT9 A;  1DJB A;  1NRJ A;  2A2L A;  3VOL A;  1EWZ A;  4K08 A;  3GV9 A;  2PD7 A;  5HX9 A;  2QWS A;  3ZG5 A;  2W3D A;  1IYO A;  4DXB A;  2WGW B;  2P9V A;  2ZC3 B;  1YMS A;  1ERM A;  3VFH A;  2Z6C A;  1PFL A;  3RXX A;  3R4K A;  5HL1 A;  1OT6 A;  2Y79 A;  4U3T A;  4DDS A;  3D4F A;  2QJ5 A;  5CTN A;  1NYY A;  3NUL A;  3LUQ A;  5FAS A;  4G3W A;  3NHQ A;  4MBF A;  3G35 A;  3E2L A;  3HLB A;  4U0T A;  1ESU A;  3HLE A;  4OKP A;  2J3T C;  5FDH A;  3O86 A;  1NY0 A;  3OPR A;  2EWV A;  3GTC A;  2UWX A;  2JKF A;  1SDE A;  4F3L B;  2IWB A;  1M6K A;  4C6Y A;  2K7S A;  3A3E A;  3UE3 A;  2HJ9 C;  3ZG0 A;  5EPH A;  2O9C A;  1Q2Q A;  4P85 A;  1XFN A;  1XGI A;  1H8Y A;  3PR6 A;  5EVI B;  3BRM A;  1IEM A;  3QNC A;  1OTA A;  4WBG A;  2R78 A;  2WKH A;  2EX8 A;  5G4Y A;  5CER A;  4EER A;  3UDF A;  1HD8 A;  3LR4 A;  4LEN A;  4L9G A;  2ZMF A;  4FUW A;  1WYC A;  3G6O A;  2Y2K A;  2ZQA A;  3JVU A;  3BW6 A;  2VGL M;  3CAX A;  5AJG A;  4S2L A;  1N9N A;  3HLF A;  5CHU A;  3OLO A;  5CED A;  1MPL A;  1JWZ A;  3V39 A;  4JGP A;  3PAG A;  4RX2 A;  5E2H A;  4D60 A;  2ZMV A;  4AFI A;  1CEG A;  5CX7 A;  1LSX A;  2OLV A;  3P98 A;  4IUH A;  5EOO A;  5HAP A;  1FCN A;  5KSC A;  3C5A A;  4OLD A;  3LFV A;  3P09 A;  3HJK A;  2XSS A;  4YNR A;  3OCL A;  4EEP A;  4O01 A;  1YPR A;  3MMH A;  5EVI A;  4S2M A;  1SDN A;  4R0Q A;  4MN7 A;  4EEU A;  3DWZ A;  4JLF A;  5G18 A;  5KMW A;  2VV8 A;  2WGI A;  1F5M A;  4Q0I A;  3VP4 A;  1J3W A;  3LIB A;  4ZTK A;  4MNR A;  2M1C A;  4E3K A;  4EWF A;  5EUA A;  3OPH A;  3S7Q A;  1I2S A;  4E3J A;  3ZNT A;  1GSX A;  2AVX A;  1H0M A;  3V5M A;  2P04 A;  1MY8 A;  4OOL A;  1VB6 A;  4H6J B;  2WUQ A;  4OPZ A;  3UME A;  3IF5 A;  2ZC5 B;  2HPB A;  3T4K A;  5DJU A;  5FI2 A;  1L0F A;  2ZC6 B;  1K57 C;  1I5Q A;  2P7J A;  1YLY A;  5AQ7 A;  1QMF A;  3G30 A;  1FQG A;  2FFY A;  4EES A;  1C3B A;  4FH2 A;  4DE0 A;  2HDS A;  2V2F F;  5A91 A;  3NDE A;  3I7J A;  5FAO A;  4FD8 A;  3DW0 A;  5AVF A;  2X01 A;  4KQO A;  2HDU A;  3ITA A;  1Q2P A;  3OPL A;  1XPB A;  4EQ1 A;  3HLC A;  4DE3 A;  4DMZ A;  5J3W A;  1K56 A;  4HH2 A;  2V1Z A;  5GHX A;  4S2K A;  1G68 A;  2QPN A;  2PR6 A;  1BLH A;  2ZBB A;  4X69 A;  4BL2 A;  2GJ3 A;  1ZKJ A;  1FSW A;  3N8L A;  3BWL A;  5EV0 A;  3NCK A;  1K54 C;  4HJ3 A;  3GRJ A;  1PI5 A;  4DN0 A;  3KYE A;  3GMW A;  2A49 A;  4JF6 A;  1K57 A;  3H9W A;  4BJP A;  1KE0 A;  5CRF A;  1RGY A;  5E2G A;  3U4L P;  3T50 A;  4I38 A;  5A93 A;  1G6O A;  1WYB A;  1W8Y A;  2QMI A;  5M18 A;  2L4R A;  1TF1 A;  4JGQ A;  3IWQ A;  1RGZ A;  4XUX A;  4WMC A;  5HPI A;  1L3L A;  3DAV A;  1XA1 A;  4FCF A;  2OWJ A;  3UB5 P;  1F9I A;  5EEC A;  4EBP A;  2M7V A;  1LSV A;  1TDL A;  5F5Y A;  3MZE A;  1K38 A;  1LHY A;  3ICY A;  4GLQ A;  4KQD A;  3ZQ5 A;  5F69 A;  1TS8 A;  1W8Q A;  2GDN A;  3IF6 C;  3HRE A;  3IH8 A;  4IJG A;  4R38 A;  1KVM A;  3M6B A;  1K25 A;  5E43 A;  1T1C A;  2W0N A;  3MQ0 A;  4JGR A;  3TOI A;  5TBM A;  4IED A;  3VE3 A;  2XEP A;  4MEZ A;  1P0Z A;  4QU3 A;  1ODV A;  1SHV A;  3F1N B;  4UAA A;  5EM1 A;  5FQK A;  1PRQ A;  1S4R A;  3CI6 A;  2W3F A;  2OWH A;  1SZV A;  2L0W A;  4EQI A;  4F94 A;  1N4O A;  1XJ6 A;  2ZD8 A;  3IQA A;  1HVB A;  3Q81 A;  3SS5 A;  1ESI A;  2A24 B;  3IH9 A;  5E2E A;  3R7W A;  2D02 A;  2XA7 S;  3ZYT A;  2Y55 A;  1VEU A;  4GS9 B;  3LID A;  4X1M A;  1ONG A;  4ETX A;  1Y28 A;  3A3D A;  4NET A;  1JTG A;  4MBK A;  4GOG A;  4B88 A;  3IF6 A;  4I39 A;  3EWK A;  4QB8 A;  5FEF A;  4DJ3 A;  5F6A A;  3EEA A;  1PWC A;  1ZC2 A;  1BT5 A;  3EQV A;  3BLS A;  1D06 A;  3WS4 A;  3T1Q B;  4ZDX A;  4GZB A;  5HPF A;  2HZ5 A;  3Q82 A;  5IU1 A;  4EV4 A;  5F83 A;  4E6W A;  2J80 A;  3MFD A;  3NOP C;  3NOU C;  1BLC A;  4HQA A;  1ONH A;  4UQI S;  3B42 A;  3V3S A;  1MZU A;  5DFX A;  4JF5 A;  5M19 A;  1VET A;  3IHA A;  4HP9 A;  1NZO A;  2INW A;  5DF7 A;  4ZBE A;  1S1Y A;  4CQH A; 
#chains in the Genus database with same CATH homology
 5HX9 A;  5M1A A;  3ISG A;  3UPN A;  2XGN A;  3ZG5 A;  4HEF A;  3UPP A;  1PWG A;  4MLL A;  4DDY A;  1IYO A;  4ID4 A;  5HAR A;  3W8K A;  5GLD A;  4E3L A;  4EBN A;  2JE5 A;  4N9L A;  5FSR A;  1YMX A;  2PU4 A;  2WGW B;  1WE4 A;  2P9V A;  1MWT A;  2ZC3 B;  5AQA A;  5FQI A;  4DXB A;  1YMS A;  2HDQ A;  5DTT A;  1ERM A;  3VFH A;  3CZD A;  4IBR A;  3HL9 A;  3UY6 A;  4PMA A;  1ALQ A;  1Z6F A;  3DWK A;  1XX2 A;  3VMA A;  5CGX A;  3RXX A;  2XLN A;  5HL1 A;  3LY3 A;  1MWU A;  2EX9 A;  4KZ6 A;  4U3T A;  3IXH A;  4X53 A;  5IHV A;  4DDS A;  1YQS A;  3D4F A;  1L0G A;  1XXM A;  2ZQD A;  3M6H A;  5CTN A;  1NYY A;  1HTZ A;  3S4X A;  5GHY A;  5HW3 A;  5U47 A;  1PZP A;  5DF8 A;  3FV7 A;  5FAS A;  2XDM A;  1KE3 A;  4MBF A;  5TR7 A;  1BUE A;  3FWL A;  3G35 A;  1Y54 A;  3A3I A;  5FAP A;  2ZQ9 A;  3VFF A;  3WS0 A;  1DY6 A;  3E2L A;  2Y2N A;  3HLB A;  5F82 A;  4U0T A;  3FYZ A;  4BL3 A;  1ESU A;  1YLZ A;  3HLE A;  4OKP A;  2PBY A;  4B4X A;  2E8I A;  5FDH A;  3O86 A;  4ZJ2 A;  1NY0 A;  3BFF A;  3UNW A;  3OPR A;  3PBR A;  3GTC A;  4LCM A;  1YLT A;  1LI0 A;  1KE4 A;  2UWX A;  3LEZ A;  5F1G A;  1SDE A;  1JWP A;  1MWR A;  1PI4 A;  2IWD A;  3VP1 A;  2IWB A;  3BLM A;  1M6K A;  3C7U A;  1TDG A;  3HLG A;  4WYY A;  3CJM A;  4C6Y A;  5GLA A;  4RA7 A;  4UA9 A;  3VP2 A;  4A5R A;  3A3E A;  3UE3 A;  3PBN A;  3ZG0 A;  5EPH A;  2WAD A;  3ZDJ A;  4CPK A;  3N8R A;  2X02 A;  2WAE A;  1Q2Q A;  2BG1 A;  4KZ8 A;  1FR1 A;  4P85 A;  4E6X A;  1XGI A;  1H8Y A;  5GLB A;  5KZH A;  3C4P A;  4S2N C;  3BRM A;  1IEM A;  3QNC A;  5EVI B;  1GHP A;  4WBG A;  2FFF B;  4E3O A;  2WKH A;  1VM1 A;  2EX8 A;  2JBF A;  5CER A;  1ERO A;  3AGD A;  4QD4 A;  3UDF A;  4PPR A;  4KZ7 A;  1HD8 A;  4BLM A;  1EI5 A;  1IYS A;  1ES3 A;  1TEM A;  2HP9 A;  4LEN A;  4LV2 A;  3O87 A;  1GA0 A;  4DE2 A;  4DKI A;  5TFQ A;  1WYC A;  1K4F A;  3M2J A;  2Y2K A;  2ZQA A;  2XH9 A;  3C4O A;  1U60 A;  2DCF A;  4ZJ3 A;  3HBR A;  4JXV A;  4P0M A;  1BZA A;  2WGV A;  3SS3 A;  1PZO A;  5FAQ A;  4S2L A;  3AGE A;  1LLB A;  3HLF A;  4X6T A;  5CHU A;  2Y2Q A;  2XQZ A;  5JYO A;  3RXW A;  3O88 A;  3B3X A;  2WKI A;  4JXW A;  4OQH A;  2JCH A;  1QME A;  1MPL A;  3EQU A;  4YFM A;  5HAI A;  3W4O A;  1JVJ A;  1JWZ A;  4KZ4 A;  3V39 A;  4WEK A;  1BTL A;  4JBF A;  4OPR A;  4K0W A;  3SH8 A;  4PM7 A;  4HES A;  1ES2 A;  3PAG A;  3PBS A;  1MXO A;  4RX2 A;  5E2H A;  5L2F A;  4BQM A;  1W79 A;  5J8X A;  1CEG A;  4WM9 A;  4GN2 A;  5EOE A;  2B5R A;  4PM5 A;  2OLV A;  3OC2 A;  3P98 A;  2V20 A;  2XFT A;  5TGF A;  4IBX A;  5HAQ A;  5EOO A;  4PM9 A;  3UE0 A;  1XP4 A;  5HAP A;  4P87 A;  1BUL A;  5GHZ A;  3OCN A;  1YLW A;  1FCN A;  4X68 A;  3UDI A;  5KSC A;  2H0T A;  1GCE A;  2H0Y A;  3C5A A;  2XD1 A;  2R9W A;  4OLD A;  4FH4 A;  1SKF A;  5HFO A;  3HVF A;  3Q1F A;  3P09 A;  3QHY A;  1JTD A;  4S2N A;  4OPY A;  2XFS A;  3BEB A;  3GV9 A;  3V50 A;  1E3U A;  2J7V A;  2WZX A;  3ZFZ A;  4CJN A;  3OCL A;  4ZAM A;  4R23 A;  1GA9 A;  4Z9Q A;  3OPP A;  4OP8 A;  3WS1 A;  5EVI A;  4S2M A;  3ZHH A;  2C5W B;  1SDN A;  4R0Q A;  3ZNY A;  3ZCZ A;  3N6I A;  1KGF A;  1G6A A;  3DWZ A;  4JLF A;  1NZU A;  4QY6 A;  5G18 A;  1N9B A;  4QJG A;  1O07 A;  5KMW A;  1K4E A;  1MKI A;  3NI9 A;  3OZH A;  4OOM A;  1FR6 A;  2WGI A;  5CXW A;  4Y0T A;  3IXD A;  4WZ4 A;  4S2I A;  3HLD A;  3VP4 A;  2ZC4 B;  3IF6 B;  3VOZ A;  3PBT A;  3V3R A;  4R3J A;  1W5D A;  4ZTK A;  5FAT A;  4MNR A;  4E3K A;  2EFU A;  3UDX A;  4EWF A;  2VGJ A;  5EUA A;  4B4Z A;  2J8Y A;  3OPH A;  1IEL A;  3TG9 A;  2ZJ9 A;  4UA7 A;  3UO9 A;  3IWO A;  1K54 A;  3G34 A;  1I2S A;  4IVI A;  4E3J A;  3ZNT A;  1PIO A;  2QZ6 A;  3NC8 A;  2Y59 A;  1I2W A;  3V5M A;  2Y2G A;  3BFC A;  3FKV A;  1MY8 A;  4WZ5 C;  4OOL A;  2WUQ A;  4OPZ A;  5FQ9 A;  3IF5 A;  3SS4 A;  2ZC5 B;  4DE1 A;  2HPB A;  5E2F A;  1TVF A;  5FI2 A;  1DJC A;  1L0F A;  3AGF A;  2WZZ A;  4LCL A;  4NK3 A;  4DXC A;  3Q07 A;  1VQQ A;  1K57 C;  1I5Q A;  2ZC6 B;  5BOH A;  5FQQ A;  3ZGA B;  3JYI A;  4JXG A;  2EXB A;  3HUO A;  5CEB A;  4LV0 A;  4OPQ A;  1YLY A;  1FCO A;  2EX2 A;  5AQ7 A;  1QMF A;  4Q8I A;  3FZC A;  3G30 A;  1FQG A;  2G2W A;  3FKW A;  5A92 A;  3BFD A;  3IXB A;  3Q7V B;  2FFY A;  1C3B A;  2X71 A;  1KGG A;  4KZB A;  1KGE A;  4OP5 A;  4OQG A;  1NXY A;  5FI7 A;  4FH2 A;  1BLP A;  2HDS A;  1H5X A;  2IWC A;  4Y0O A;  3VSL A;  3NIA A;  1E25 A;  4DE0 A;  2V2F F;  5FI6 A;  4L0L A;  5A91 A;  2RL3 A;  3HUM A;  3NDE A;  3I7J A;  5FAO A;  4GD6 A;  4FD8 A;  1RP5 A;  4X55 A;  1NRF A;  3DW0 A;  2WGW A;  1YLJ A;  3MKE A;  2X01 A;  2Z2M B;  4S2P A;  5EVI C;  3N7W A;  4KQO A;  5GLC A;  4R4R A;  4E3I A;  5DTK A;  2HDU A;  1E3U D;  3M2K A;  3ITA A;  3PAE A;  4O7D A;  1Q2P A;  3HLW A;  4C3Q A;  3C7V A;  1CK3 A;  4Y0U A;  4BD0 A;  3OPL A;  4OH0 A;  3MXS A;  4WEL A;  3WS5 A;  1XPB A;  4OQI A;  3HLC A;  4ZJ1 A;  4DE3 A;  5EVI D;  1HZO A;  1KDS A;  3GQZ A;  5CHM A;  2Y4A A;  1K56 A;  1FOF A;  2HDR A;  4K0X A;  3BYD A;  2WKE A;  2V1Z A;  5GHX A;  1AXB A;  1XGJ A;  4JF4 A;  1G68 A;  4S2K A;  2P74 A;  1GHM A;  2QPN A;  4BD1 A;  1RCJ A;  4C75 A;  1BLH A;  1S0W A;  1NYM A;  4X69 A;  4BL2 A;  3UPO A;  2C6W B;  1ZG4 A;  4JPM A;  1ZKJ A;  3N8S A;  4K91 A;  1FSW A;  3N8L A;  1GHI A;  3NCK A;  4WZ5 A;  1K54 C;  2CC1 A;  3GRJ A;  1PI5 A;  4HBU A;  1LL5 A;  2XF3 A;  3MBZ A;  1PW1 A;  2Q9N A;  1K6R A;  3GMW A;  2A49 A;  4GB7 A;  1XA7 A;  4JF6 A;  3S22 A;  4X56 A;  1OME A;  1K57 A;  3SH9 A;  4N1X A;  4R3B A;  1MBL A;  5EE8 A;  2Y2J A;  2ZMA A;  3LY4 A;  4BJP A;  1KE0 A;  4XXR A;  4EBL A;  5CRF A;  1RGY A;  5E2G A;  1IYP A;  1DJA A;  4N9K A;  5A93 A;  2WYX A;  1WYB A;  4PM6 A;  1W8Y A;  1BLS A;  2QMI A;  3SH7 A;  2PU2 A;  4KQR A;  3LCE A;  3WWX A;  5I94 A;  3GVB A;  2HP6 A;  5M18 A;  3ITB A;  2G2U A;  1K55 C;  3IHB A;  3Q7Z A;  3IWQ A;  1RGZ A;  1MWS A;  3Q7V A;  2ZQC A;  4N92 A;  4WMC A;  4XUX A;  4R4S A;  5FA7 A;  3BFE A;  1FCM A;  1CI8 A;  1YT4 A;  3WS2 A;  4KG6 A;  1XA1 A;  4FCF A;  4E3N A;  2ZM0 A;  4N1H A;  1FSY A;  3UE1 A;  4QHC A;  3RJU A;  5EEC A;  1KDW A;  5CED A;  2DRW A;  3E2K A;  3A3F A;  4EBP A;  1XKZ A;  1IKG A;  1TDL A;  3MZE A;  5AQB A;  2OSU A;  4EUZ A;  1K38 A;  4OVD A;  1LHY A;  4JKT A;  2ZLY A;  4QY5 A;  2ZM8 A;  3VSK A;  3O3V A;  3LO7 A;  1W8Q A;  2XK1 A;  4KZ5 A;  2GDN A;  1J9M A;  1L0E A;  4RX3 A;  3IF6 C;  3HRE A;  3IH8 A;  2Y91 A;  4KG2 A;  4M3K A;  1K56 D;  4YIN A;  2OLU A;  1KVM A;  2BLS A;  3M6B A;  2Y2O A;  5CEC A;  1K25 A;  1ES5 A;  5E43 A;  4R1G A;  5D3O A;  3BM6 A;  4KZA A;  1S6R A;  5F1F A;  4Y7P A;  3TOI A;  5JYP A;  2OV5 A;  5CHJ A;  1BSG A;  1PW8 A;  3IWI A;  5AQ9 A;  4IED A;  3W4P A;  5FQM A;  2XEP A;  4MEZ A;  2Q9M A;  3PBO A;  3G4P A;  4H8R A;  3QNB A;  3VP3 A;  1H8Z A;  3GSG A;  5CGW A;  3NDG A;  4XUZ A;  3SOI A;  1SCW A;  3TSG A;  4OON A;  3G2Y A;  4QU3 A;  4S2J A;  3HUN A;  1SHV A;  4UAA A;  4E3M A;  3A3J A;  1K55 A;  3G32 A;  4HBT A;  5CGS A;  3NY4 A;  5FQK A;  4KZ9 A;  1W7F A;  4P6B A;  1O7E A;  2HP5 A;  4DF6 A;  3ZG8 B;  4S2O A;  1PYY A;  1LI9 A;  3G31 A;  3IXG A;  4KG5 A;  4GNU A;  3PTE A;  3CG5 A;  2RCX A;  1M40 A;  4EQI A;  4LV3 A;  3CMZ A;  4F94 A;  2DNS A;  1N4O A;  2ZD8 A;  4FSF A;  4DRT A;  2Y2I A;  1PWD A;  3ZG7 B;  3IQA A;  1HVB A;  3BEC A;  4BEN A;  3ZG9 B;  3Q81 A;  3SS5 A;  1ESI A;  3VP0 A;  3IH9 A;  4UHU A;  4WMC D;  5E2E A;  2R9X A;  5EVL A;  2P9V B;  4RVA A;  5FQJ A;  2A3U A;  4WEJ A;  2Y55 A;  1ONG A;  2EFX A;  2ZQ8 A;  2JC7 A;  1YM1 A;  3MXR A;  1E4D A;  3A3D A;  2ZC7 A;  5KSH A;  4NET A;  1JTG A;  4MBK A;  4GDB A;  3GR2 A;  4OOY A;  4GOG A;  4B88 A;  2ZQ7 A;  3DTM A;  3IF6 A;  4KZ3 A;  2Z2L B;  4QB8 A;  3MKF A;  4UA6 A;  1JWV A;  2Y2M A;  1YLP A;  4KEN B;  1L0D A;  1IYQ A;  1PWC A;  1ZC2 A;  3BFG A;  3G2Z A;  3VOY A;  1BT5 A;  2EX6 A;  3BLS A;  3EQV A;  2Y2H A;  3MZD A;  4OLG A;  3WS4 A;  4OQ0 A;  2H10 A;  3N4I A;  4RYE A;  4ZDX A;  2Y2P A;  3NBL A;  1CI9 A;  4GZB A;  2Y2L A;  1L2S A;  1ZG6 A;  3ZVW A;  3Q82 A;  4KQQ A;  2WAF A;  2ZM2 A;  4GDN A;  4IVK A;  5DVA A;  4U0X A;  4EV4 A;  5F83 A;  2J9O A;  3WRZ A;  3UN7 A;  3ZVT A;  2VGK A;  4E6W A;  4MBH A;  4JXS A;  2WK0 A;  3MFD A;  5CTM A;  2H5S A;  5DF9 A;  1ERQ A;  1BLC A;  1ONH A;  1NJ4 A;  1LL9 A;  1KVL A;  4LV1 A;  3S1Y A;  3V3S A;  3PBQ A;  1CEF A;  5A90 A;  2I72 A;  4JF5 A;  5M19 A;  1K6S A;  2XD5 A;  4GKU A;  3WRT A;  1IKI A;  3IHA A;  5DTS A;  5GL9 A;  2EXA A;  4D2O A;  1ES4 A;  1DJB A;  1NZO A;  4GD8 A;  2J9P A;  4PM8 A;  3IT9 A;  3W4Q A;  1EWZ A;  5DF7 A;  4ZBE A;  2XR0 A;  3MZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...