4OPZA

Crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying g238s mutation in complex with boron-based inhibitor ec25
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
263
structure length
263
Chain Sequence
b'HPETLVKVKDAEDQLGGRVGYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPVAMATTLRKLLTGELLTAASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TEM-94 ES-beta-lactamase
molecule tags Hydrolase/hydrolase inhibitor
source organism Escherichia coli
publication title Negative Epistasis and Evolvability in TEM-1 beta-Lactamase--The Thin Line between an Enzyme's Conformational Freedom and Disorder.
pubmed doi rcsb
total genus 100
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4opzA00
2EX6A 3O86A 1Y54A 2XD5A 2WZXA 2H0TA 2ZM0A 3A3JA 4K0WA 5CRFA 3ZGAB 2XGNA 4LCMA 4OQ0A 3TOIA 1ESIA 4OONA 4UAAA 4WMCD 4P85A 3S4XA 3A3DA 4EBLA 5EE8A 2OLUA 3WRZA 3IQAA 3WWXA 3BLSA 2EX8A 4QY5A 3A3EA 4OLGA 1TVFA 1IYSA 1W7FA 2RL3A 4X68A 1FCNA 1NJ4A 1CI8A 3GV9A 5A90A 5FDHA 2HDRA 3TSGA 2ZQAA 5F83A 4E3KA 5EVID 5HFOA 5FQMA 3UNWA 1KGGA 4ZJ3A 3C7VA 3NI9A 4WYYA 5CGWA 1L0GA 5BOHA 1NZOA 1HZOA 2EXBA 4O7DA 4R1GA 4S2IA 1XKZA 3BECA 2GDNA 2OLVA 4CPKA 4IVIA 4X69A 5CGSA 1L2SA 4B88A 1W79A 4OQGA 2Y2LA 4JF6A 3DWZA 3HUOA 4R3BA 4JXGA 1BTLA 1ESUA 3Q7VB 3MKEA 5FI7A 1SDEA 4EQIA 3G4PA 3EQVA 2WKEA 2P9VA 4QY6A 5FATA 2V1ZA 3O87A 4JKTA 2P9VB 5FI2A 4JXVA 1ZC2A 3IH8A 3UPOA 1LI0A 5FA7A 1W8YA 4DDYA 3ZDJA 1EI5A 1NRFA 4RX3A 4R0QA 3G31A 3N8RA 3ZVWA 1BLSA 2Y55A 3VSLA 1IYPA 3UE1A 4R4SA 1ERQA 1K56A 2J7VA 1ES5A 4MEZA 1K54A 1LI9A 1LLBA 1MWUA 3O3VA 4FH4A 3VOZA 2G2UA 3IHAA 1YMSA 3HUNA 1ONHA 5HX9A 1ES3A 3NIAA 4LENA 1L0EA 5L2FA 3G34A 4FSFA 3VFFA 1YMXA 1KDWA 1CI9A 3P09A 4H8RA 3WS5A 3C4PA 3A3FA 3Q1FA 4S2OA 1E3UD 2BG1A 2ZJ9A 2HDQA 2WGVA 4YINA 1FCOA 1BSGA 4RA7A 3S22A 2Y2PA 5AQBA 1FCMA 3UE0A 1BT5A 2V20A 4IBRA 2XFTA 4GB7A 1N9BA 4KZ5A 1XPBA 1PW1A 2FFFB 3Q7VA 5GLDA 4BENA 1YT4A 3FZCA 3M2KA 2Z2MB 2ZD8A 1BUEA 3Q07A 5JYOA 1K56D 3HLWA 4Y7PA 3GR2A 3VP2A 1SDNA 3PAEA 5DTKA 2QZ6A 4PPRA 4KZ9A 4JLFA 5E2EA 4K91A 3PBNA 3ZFZA 4PM6A 4OP5A 1FSYA 1HVBA 4LCLA 1BLPA 1PWDA 2H10A 2OSUA 3NBLA 5CTMA 2EX9A 3TG9A 2B5RA 3UDFA 2JE5A 4S2NC 1G68A 3Q7ZA 1KE3A 3HLDA 4R23A 4Z9QA 3OPPA 1DJBA 3ISGA 3HUMA 4C75A 3G32A 1EROA 1OMEA 2PU4A 4GOGA 1JVJA 2WGIA 1JWVA 4P6BA 2Q9NA 3CMZA 4BJPA 4WM9A 1S6RA 1GCEA 1XX2A 3FKVA 1JWPA 3HLBA 2PBYA 2WAFA 2X71A 3NDGA 4KG2A 5E43A 1MWSA 4HEFA 3PBOA 3PBRA 4OKPA 1MBLA 4N1HA 5HAIA 5FASA 3UO9A 3FV7A 3IXGA 1ALQA 2EXAA 4BD1A 1WE4A 1K57C 2HP6A 1TEMA 3W4PA 2ZQ7A 2WAEA 1PIOA 1IYQA 5CXWA 3IF6B 3ZNTA 5EPHA 4DRTA 1GHMA 2ZM2A 1YLTA 4GD8A 3IHBA 1E4DA 3GVBA 3IXHA 5CECA 3BFFA 1LHYA 3M6HA 2H0YA 5M19A 1RP5A 1BLCA 2RCXA 4ZBEA 5TGFA 4WZ5A 4OLDA 4WBGA 1QMFA 2HPBA 4JXSA 1GA9A 5FQ9A 5EOEA 3NY4A 4DXCA 2A49A 2Y59A 4Y0OA 3LEZA 5DF8A 4B4ZA 3GMWA 2BLSA 1K4FA 2XFSA 5M18A 1Z6FA 4LV3A 4DE0A 1ZG6A 3VMAA 1MKIA 3GSGA 4WEKA 5D3OA 3ZG0A 1CEGA 3PBSA 1YLPA 1PYYA 2XH9A 1XA1A 1G6AA 3BEBA 1FSWA 3PAGA 3Q82A 4PMAA 2H5SA 4NK3A 4WZ5C 1ES4A 3M6BA 1IELA 1S0WA 4L0LA 5DVAA 2WUQA 3ITAA 3ZCZA 3ZG9B 1ZG4A 1JTDA 2HP9A 1E25A 3HLGA 2EFUA 4OQIA 3V39A 2XLNA 4P87A 1KVLA 4OPYA 4K0XA 4LV1A 2HDSA 4OPZA 3RJUA 3UPNA 4IBXA 2WADA 3OPRA 2Y2KA 4NETA 5KSHA 4OP8A 4WELA 4BD0A 4JPMA 4PM9A 4KZ4A 3C5AA 3HREA 4XUZA 1W8QA 2FFYA 5HW3A 1CEFA 3EQUA 3HLFA 3P98A 3FKWA 1M6KA 2X02A 4EWFA 3BFEA 5DTSA 5DF9A 4IVKA 4C3QA 3G30A 1ERMA 4ZAMA 1YLJA 4DDSA 4GDNA 4MBHA 4DE2A 2C6WB 2DRWA 5CHJA 3SH7A 2XEPA 5M1AA 3SH9A 4E3MA 1ONGA 3IF5A 3BFGA 3MFDA 4FD8A 1E3UA 1JWZA 2P74A 1DY6A 3GRJA 5HARA 4X56A 3OPHA 5G18A 2J9OA 2R9WA 4KQQA 2A3UA 3WS0A 4XUXA 2Y2MA 4IEDA 2Y2NA 4Y0UA 4OQHA 2Y4AA 2JC7A 4KG6A 4UA6A 4ZJ1A 3A3IA 3PBQA 2IWCA 1J9MA 5FQJA 3VP3A 1MY8A 3QNBA 1IYOA 3WRTA 3N8LA 2XD1A 1K38A 3DW0A 3SOIA 2ZC3B 3V3SA 4KG5A 1HTZA 3UN7A 5CHUA 5GHZA 2Y91A 4X6TA 3RXXA 4E6XA 2JBFA 1Q2PA 1IEMA 1WYCA 4ZJ2A 1VQQA 1XXMA 3ZG5A 5HAQA 5KSCA 4U3TA 5FQIA 1GHPA 5EVIB 5CTNA 5FSRA 4BL2A 3OCLA 3DWKA 4EV4A 1AXBA 1JTGA 3ZHHA 3UDIA 2QMIA 4C6YA 5AQ7A 3VP4A 1C3BA 2I72A 3OC2A 1IKGA 5TR7A 3RXWA 3MZEA 1PI5A 2J8YA 4EBNA 3HL9A 1K54C 4OPRA 4UA7A 5FI6A 3LCEA 1N4OA 1MPLA 2DNSA 3MBZA 1PZOA 4M3KA 3PTEA 5JYPA 1CK3A 3IWIA 2WYXA 2HDUA 3WS1A 1WYBA 3G2YA 1YQSA 1NYMA 2Y2OA 5HL1A 2ZLYA 2R9XA 2E8IA 4WEJA 2HP5A 4P0MA 1YLZA 4RYEA 4QHCA 2Y2QA 3V3RA 5AQAA 3ZG7B 4R4RA 4S2MA 5F1FA 5F82A 1NZUA 3HVFA 1L0DA 3SS5A 3SS3A 3I7JA 2UWXA 3ZNYA 2Y2JA 1SHVA 2V2FF 1QMEA 3NDEA 1MWRA 4RVAA 1XGIA 3E2KA 1K57A 1H5XA 5EUAA 3VP0A 5EVIA 1FOFA 2DCFA 3DTMA 4S2LA 5DF7A 4U0TA 4E3OA 1GA0A 4QJGA 2ZC5B 5CGXA 1SKFA 5FAQA 3QHYA 1NY0A 1RGZA 2WKIA 5HAPA 5EECA 4N9KA 4GN2A 3MZDA 1K25A 2ZC4B 1K55C 5E2HA 1XA7A 1K4EA 4WMCA 3IWQA 1O07A 1XGJA 2XQZA 5GLAA 1PW8A 5E2FA 4E6WA 4S2KA 5F1GA 2OV5A 2WGWB 1BLHA 4UA9A 4OH0A 2WKHA 4S2NA 4E3NA 3MXSA 3MZFA 4OOLA 1VM1A 3E2LA 4X53A 2ZQDA 2XDMA 2WK0A 4KQOA 5GL9A 5GLBA 4RX2A 4PM7A 4MNRA 1BZAA 2VGJA 5GHXA 2QPNA 5CEBA 4QU3A 1K6SA 5J8XA 4EBPA 3MKFA 3BFCA 5KZHA 4Y0TA 3IT9A 5FAPA 3UPPA 2ZQ9A 5CERA 4MBFA 5EVIC 3WS2A 3BLMA 4KQRA 1PI4A 4YFMA 1KVMA 2XR0A 3BFDA 1PWGA 3NC8A 3VSKA 4BLMA 2PU2A 3G2ZA 3Q81A 2CC1A 4FH2A 3BRMA 1W5DA 3IXDA 4U0XA 2Q9MA 3WS4A 1H8YA 4LV2A 1KDSA 4KZ3A 4GZBA 4B4XA 2ZC6B 3IXBA 3QNCA 2ZC7A 4ID4A 3CG5A 4BQMA 5AQ9A 3MXRA 5TFQA 1DJCA 1KE4A 4GNUA 3IWOA 3PBTA 1FR1A 3C4OA 1ZKJA 4KENB 4KZ6A 5FAOA 2XF3A 3IH9A 4FCFA 3V50A 1IKIA 1NYYA 4PM5A 3SS4A 3VP1A 1TDGA 4JBFA 3W8KA 1RGYA 3LY3A 2J9PA 1I2SA 1O7EA 2Y2IA 4HBTA 5CEDA 3M2JA 4PM8A 3FYZA 4KZ8A 3N7WA 4MLLA 3IF6A 5FQKA 3N4IA 4GKUA 4JF4A 4QD4A 4GDBA 4KZAA 3W4OA 1LL9A 4CJNA 4DKIA 2C5WB 4GD6A 3N6IA 3OCNA 4LV0A 1FR6A 3LO7A 4R3JA 4JXWA 1H8ZA 3VOYA 2EX2A 4OOYA 5EVLA 5A93A 1NXYA 1TDLA 1KE0A 4X55A 1LL5A 1YM1A 1MWTA 3NCKA 1FQGA 4S2JA 4XXRA 4D2OA 2Z2LB 3IF6C 1U60A 5I94A 2VGKA 4MBKA 5DTTA 2WGWA 5IHVA 4OVDA 5E2GA 5GHYA 2Y2HA 4N92A 1PZPA 4OOMA 4A5RA 2X01A 3HLCA 4BL3A 1EWZA 3UY6A 5U47A 3CJMA 1YLWA 4ZTKA 3D4FA 2ZQCA 4UHUA 2IWDA 3O88A 5FQQA 5A91A 3FWLA 4DF6A 3GQZA 3S1YA 3ZG8B 4ZDXA 3GTCA 3ITBA 3UE3A 1YLYA 3AGDA 1RCJA 3C7UA 5EOOA 3G35A 4JF5A 4S2PA 4F94A 2WZZA 4DE3A 3VFHA 2ZQ8A 2Y2GA 1I5QA 5KMWA 2EFXA 1ES2A 1K55A 3N8SA 4WZ4A 1PWCA 5CHMA 4E3IA 4N9LA 3BM6A 1GHIA 4QB8A 2G2WA 2XK1A 4KZ7A 3HBRA 4HESA 3JYIA 3W4QA 4E3JA 1I2WA 3LY4A 4DXBA 4EUZA 2IWBA 1KGEA 4OPQA 4E3LA 3B3XA 5GLCA 3OPLA 3V5MA 1DJAA 3SH8A 3CZDA 5A92A 1L0FA 3BYDA 1BULA 4KZBA 3AGFA 1M40A 4DE1A 1SCWA 3UDXA 1KGFA 4Q8IA 1HD8A 1MXOA 1Q2QA 4N1XA 1XP4A 2JCHA 3OZHA 3ZVTA 3HLEA 4HBUA 1K6RA 3AGEA 2ZMAA 2ZM8A
chains in the Genus database with same CATH superfamily
2EX6A 4M4XA 1Y54A 4K0WA 5DKLA 3A3DA 5EE8A 2OLUA 3A3EA 4OLGA 2WKPA 2I9VA 1BYWA 3LIBA 1NRJA 2RL3A 2VX8A 5FDHA 4Y13A 3NI9A 1L0GA 2EWWA 3BECA 3DAVA 2KX6A 2OLVA 4IVIA 4X69A 1L2SA 1LSXA 3CLOA 4OQGA 2VA0A 2JKTI 4JF6A 5DJUA 3Q7VB 4QY6A 3EQVA 2WKEA 2P9VA 2P9VB 5FI2A 4F3LA 1ZC2A 1LI0A 1W8YA 1NRFA 1PNEA 2QJ7A 4RX3A 3FG8A 3G31A 1S4RA 2J7VA 4IUHA 4FH4A 1DP9A 2G2UA 2Z6CA 3HUNA 1L0EA 2NUPC 3G34A 2FH5A 5G4YA 3WS5A 4DMZA 3A3FA 3Q1FA 4S2OA 2WGVA 4YINA 1FCOA 1BSGA 1XFQA 1D1JA 2Y2PA 3UB9A 3IS2A 4BENA 2FFFB 5GLDA 2OWHA 3MQQA 2ZD8A 3CITA 4NXEA 3CUEA 3E4QA 1K56D 3HLWA 3D72A 1SDNA 2ZOIA 2QZ6A 4Y3IA 5E2EA 4Y15A 3BQAA 3ZFZA 4OP5A 2H10A 1SKOA 3UDFA 5HZHA 3NOUC 3UMEA 1DJBA 3T12B 4EU0A 3DBAA 1OMEA 3PYPA 3PXPA 5HDDA 2WGIA 4P6BA 4BJPA 2J80A 1XX2A 2NUTC 3FKVA 3HLBA 2A24B 1MWSA 4HEFA 3PBOA 4OKPA 4N1HA 3FV7A 2EXAA 4BD1A 2ACGA 5EFWA 3LI9A 3ZNTA 4MN6A 1GHMA 2ZM2A 1G5UA 3EWKA 2W3DA 3IHBA 1BLCA 1XJ2A 1D7EA 2GNXA 2HPBA 4JXSA 5FQ9A 3KX0X 2A49A 1XJ4A 2INWA 3F1PB 3GMWA 3OOVA 1Z6FA 3TW8A 4PMAA 1T1AA 2H5SA 4NK3A 4WZ5C 1S0WA 3ZG9B 1ZG4A 3V39A 4K0XA 1OTIA 2HDSA 3RJUA 3KO6A 4BD0A 5EM0A 3E4PA 3HREA 2FZ0A 1CEFA 3F1OA 3P98A 2X02A 5DTSA 4BBUA 5HDCA 4DDSA 4GDNA 4NXFA 2DRWA 4X1MA 5M1AA 1ONGA 3IF5A 3OPHA 2JKGA 4KQQA 2O0YA 4IEDA 2Y2NA 4KG6A 3VP3A 1MY8A 1IYOA 1S4SA 3WRTA 3CUEC 3CPTA 5L07A 5GHZA 2JBFA 3E4OA 1MC0A 5FQIA 1YSQA 3OCLA 1AXBA 1T1BA 1C3BA 5TR7A 4ETXA 2AVXA 2VJWA 4E04A 4ARZA 1CK3A 2R78A 3LGOA 2HDUA 3NECA 3WS1A 1YQSA 1NYMA 2E8IA 4RYEA 4QHCA 2Y2QA 3H7WB 5AQAA 4S2MA 4I3IA 4Q0IA 4G3WA 2WKQA 5F82A 4RVAA 5HPFA 2A2LA 3UB6A 1H5XA 3LR3A 2BASA 4U0TA 3IBJA 4E3OA 4WL9A 5MC7A 5CGXA 1SKFA 1NY0A 4GN2A 3MZDA 1K55C 1K4EA 2XQZA 1PW8A 2OV5A 2WGWB 2OAP1 4IUKA 4UA9A 3LIEA 1VM1A 4X53A 3R4KA 2WK0A 5GL9A 5GLBA 4PM7A 3A0RA 5AVEA 3T4LA 5CEBA 1P9RA 5AVFA 2VV7A 1LL8A 4EBPA 3BFCA 3MFXA 5KZHA 4Y0TA 5FAPA 2ZQ9A 2HF6A 1KVMA 3NC8A 2JKTM 4KUOA 3OBFA 4U0XA 1H8YA 4O01A 3S7PA 5IT5A 3IXBA 2JHEA 3CG5A 4KENB 1ZKJA 3IH9A 3SS4A 3LY3A 1I2SA 2Y2IA 4HBTA 3T4QA 2D01A 3KSFA 4G3VA 4DJ3A 3MQOA 4GKUA 3MSHA 4JF4A 4QD4A 4GDBA 4KZAA 1LL9A 4CJNA 3OCNA 1FR6A 3UB7A 3BWLA 2WKRA 4WN5A 4X55A 1VEUA 1OJ5A 4D2OA 4S2JA 2Z2LB 1VEUB 2XRNA 4B93A 1NLYA 3KSGA 4N92A 2QHKA 5DFXA 4MCWA 3GQZA 3ZG8B 2PAVP 4F94A 1MKMA 4DE3A 2ZQ8A 1I5QA 1K55A 4WZ4A 1PWCA 5CHMA 3W2ZA 2CMNA 4N9LA 1GHIA 2G2WA 4KZ7A 4EUZA 2V0WA 4OPQA 4MN5A 1J3WA 4CQHA 5GLCA 4CLCC 4CLCA 3OPLA 3V5MA 3SH8A 2P04A 3CZDA 1L0FA 2O9CA 4DE1A 3QP5A 1KGFA 1MXOA 3OZHA 3ZVTA 3HLEA 1K6RA 3UB5P 3A3JA 2WZXA 2H0TA 5CRFA 4LCMA 4OQ0A 1ESIA 4EBLA 4WMCD 1H3QA 3WRZA 3WWXA 3BLSA 2EX8A 4QY5A 1GSXA 4GW9A 5AJGA 3ICYA 1FCNA 2HZ5A 4CLCD 2ZQAA 5EVID 2DMWA 3UNWA 2KDKA 4R1GA 1OTAA 5K5BA 2GDNA 4B88A 1W79A 3P01A 3HUOA 4R3BA 2QJ5A 4R70A 3MKEA 3G4PA 5FATA 2V1ZA 3O87A 3RFBA 3G6OA 5HDSA 4JXVA 3UPOA 2Y55A 3VSLA 4R4SA 5EVEA 5F5YA 1K54A 1LI9A 1LLBA 3O3VA 3IHAA 1ONHA 1ES3A 3NIAA 3TRCA 1YMXA 5L10A 4HNBA 5CX7A 3LIFA 4NXGA 2BG1A 3T4KA 3U4LP 1BT5A 4IBRA 1N9BA 4KZ5A 1PW1A 1VHMA 4PKYG 3M2KA 3GR2A 3PAEA 4KZ9A 3EEAA 3PBNA 4R38A 1HVBA 4LCLA 1PWDA 3DTIA 2OSUA 4PHTA 5CTMA 2EX9A 2JE5A 1G68A 1YAXA 1KE3A 3HLDA 4R23A 4Z9QA 3KSIA 1CJFA 3OPPA 4P6ZS 4BBVA 4D60A 1JVJA 3T4OA 1S6RA 2WAFA 5J4EA 1TS0A 2VV8A 3PBRA 2QKPA 1ALQA 1WE4A 2K7SA 1PIOA 1F98A 3IF6B 3QP2A 4HH3A 3QP4A 1S1ZA 3OLOA 4GD8A 2V8FA 1LHYA 4HJ3A 1NLZA 1RP5A 2RCXA 5L09A 4WZ5A 4OLDA 2Y59A 4Y0OA 4B4ZA 3T4JA 2HGVA 3MXQA 4HQAA 5M18A 4DE0A 2JKRI 1MKIA 4WEKA 4EUVA 1CEGA 3PBSA 1PYYA 3BEBA 3LFVA 1FSWA 3M6BA 4L0LA 2WUQA 3ZCZA 2L0WA 1JTDA 3HLGA 4OQIA 2XLNA 5EM1A 2JN7A 4P87A 4OPYA 4LV1A 2KLIA 1IFQA 2WADA 3OPRA 2VEAA 5KSHA 4NETA 3C5AA 4ESPA 3EGDC 1IOUA 3FKWA 4EWFA 2ZOHA 1ERMA 4DE2A 2C6WB 5HWTA 3HJIA 3HCYA 5G18A 3LR5A 3RH8B 3FPWA 2J3WA 3IBRA 2VGLM 3WS0A 2Y2MA 2XA7S 4ZRRA 5IU1A 2Y4AA 1XFNA 3QNBA 4RQ9A 3N8LA 4YNRA 3V3SA 1HTZA 3UN7A 4E6XA 3RXXA 3NOTC 1Q2PA 3CI6A 5G4ZA 4EQ1A 5L8MA 1V9YA 3S7NA 3IX4A 1XXMA 3EEHA 5KSCA 4I5SA 4BL2A 3BW6A 3DTEA 4Y5FA 5AQ7A 2MJ6A 3MZEA 4EERA 5FI6A 1MPLA 5FL3A 5IS1A 3IWIA 5HL1A 2PYRA 3LI8A 5DKKA 1NWZA 4DN0A 1XJ6A 3JVUA 3IS2B 1YKDA 1AWIA 3I7JA 1SZVA 2Y2JA 2XROA 1SHVA 2V2FF 1MWRA 2GX5A 5HWWA 3DTMA 4S2LA 3F1NA 4LRZE 3C8CA 5FDSA 4I3JA 1F2KA 4ETZA 1P97A 1LSWA 2M7UA 2B95A 2WKHA 4S2NA 4E3NA 3MXSA 1UWNX 4G3KA 2VGJA 4QU3A 1K6SA 3A0SA 1DP6A 3IT9A 4L9GA 5EVIC 2J3TD 3VSKA 4O0PA 4HHDA 4KUKA 4FH2A 1W5DA 3IXDA 4CLCB 2Q9MA 2K31A 4KZ3A 4GZBA 1UGUA 5TFQA 3MXRA 1DJCA 1KE4A 4GNUA 1N9LA 3PBTA 5FAOA 3V50A 2M1CA 2BTFP 3VP1A 1X0OA 3W8KA 2J9PA 2OAQ1 4WLAA 4L9EA 1SKOB 3N7WA 4GS9B 5FQKA 3GDIA 3N4IA 4GLQA 3KYQA 1YPRA 2C5WB 2YKHA 4LV0A 1H8ZA 3VOYA 2EX2A 5A93A 1KE0A 4HP9A 4XXRA 2UV0E 2PDRA 4HIAA 5DTTA 4GJ4A 5GHYA 2X01A 4BL3A 1EWZA 1YLWA 4UHUA 3V67A 3FWLA 3GTCA 3ITBA 3UE3A 3F1OB 2W3EA 4EW7A 5EOOA 3G35A 3D3OA 3HJKA 2EFXA 4GCZA 1MZUA 2XK1A 3HBRA 4E3JA 1I2WA 4DXBA 4DJ2A 2L1MA 2PYPA 3AGFA 4EEUA 1STZA 1SCWA 4Q8IA 2PRFA 1XP4A 2JCHA 4HBUA 1P0ZA 2ZM8A 1LSVA 3O86A 2XD5A 4R6LA 2W27A 2VKSA 2Q0OA 1ZHHB 4UAAA 4P85A 4Q0HA 3IX3A 3IQAA 5HL6A 1IYSA 1LT0A 2JKRM 3GV9A 2HDRA 3TSGA 4E3KA 5HFOA 2PR6A 3EGXC 3TE8A 1KGGA 5CGWA 4WYYA 2EXBA 1HZOA 2ZL1B 4O7DA 4S2IA 3ZYTA 1OTEA 4HP4A 2VZWA 4CPKA 1GSVA 2O9BA 3DWZA 4NG2A 1VETB 5EV0A 1SDEA 4EQIA 1F5MA 4B9OA 3C30A 3BJNA 3LEQA 3IH8A 4DDYA 4R0QA 3N8RA 1BLSA 4UQIS 1IYPA 3UE1A 4ME4A 1ES5A 1YMSA 5HX9A 4LENA 1TF1A 4FSFA 2O99A 4X1LA 1KDWA 3F1PA 3JVVA 5HSQA 1G6OA 3CAXA 1E3UD 4P6ZM 1F9IA 2HDQA 4RA7A 1T19A 3UE0A 3T4SA 1YT4A 3FZCA 2Z2MB 2VV6A 5JYOA 3VP2A 4K91A 3NULA 2QYBA 1FSYA 1OTDA 2B5RA 4S2NC 3Q7ZA 4EETB 5HD5A 1EROA 1JWVA 2Q9NA 4WM9A 1ZTUA 3NDGA 1JWPA 4KG2A 2PBYA 4I38A 5E43A 5FASA 4II7A 4MN7A 1K57C 2WAEA 1IYQA 5CXWA 2GJ3A 4UQIM 1W63M 3S7OA 1E4DA 3U2AA 3GVBA 3IXHA 3BFFA 3M6HA 4H6JB 4WBGA 1TS6A 5EOEA 3NY4A 3LEZA 5DF8A 1GSWA 2OOLA 1TS7A 2E8JA 5HD3A 2BLSA 2XFSA 4I3AA 3VMAA 3ZG0A 3GSGA 5FSRA 2XH9A 1G6AA 1ES4A 3LIDA 1IELA 2HP9A 1OT9A 2EFUA 4HJ4A 2O9AA 4QPRA 4OPZA 3UPNA 1H8MA 2Y2KA 4EXOA 4H6JA 4WELA 4JPMA 4GHIA 4PM9A 4KZ4A 1W8QA 1S66L 3EQUA 3HLFA 2W3GA 4JGOA 4IVKA 4C3QA 4ZAMA 1YLJA 2J3TC 3MF0A 1Y4OA 5CHJA 3SH7A 3SH9A 4E3MA 2A24A 3BY8A 3MFDA 4FD8A 2LB9A 3RTYA 1DY6A 1CF0A 3GRJA 4X56A 5HARA 4BMWA 2J9OA 1D06A 4Y0UA 2JC7A 3LR4A 4UA6A 5FQJA 1N9NA 1J9MA 2IWCA 4I39A 3MMHA 2XD1A 2Y8HA 4WF0A 3DW0A 3SOIA 5CHUA 2Y91A 4X6TA 3BY9A 4CLCE 1IEMA 2W1TA 1FILA 1VQQA 5HAQA 4U3TA 1PRQA 1GHPA 5EVIB 3DWKA 4Y2FA 3UDIA 2QMIA 5I5LA 3OC2A 1IKGA 3RXWA 3B33A 1K54C 4UA7A 3LCEA 1N4OA 4Y17A 1VETA 2W1RA 2DNSA 3MBZA 3PTEA 3C2WA 5FEFA 2W3FA 2Y2OA 4WEJA 1YLZA 3V3RA 1K0KA 5TJJA 4R4RA 1NZUA 3HVFA 3SS5A 2UWXA 3ZNYA 1QMEA 3K3DA 2D02A 3E2KA 3MR0A 3VP0A 5EVIA 1FOFA 2DCFA 1GA0A 4BBTA 5A8BA 3QHYA 1RGZA 2WKIA 5HAPA 5EECA 1XA7A 4WMCA 1O07A 5F69A 5E2FA 4E6WA 1PFLA 4S2KA 5F1GA 1BLHA 3MZFA 2B02A 4OOLA 3E2LA 2ZQDA 4KQOA 4RX2A 3LIAA 1OPXA 5GHXA 2W0NA 4IHQA 5J8XA 2EA9A 2W1TB 5CERA 3BLMA 1PI4A 4YFMA 2XR0A 2PU2A 1T18A 3BRMA 3WS4A 2XSSA 4L9FA 1KDSA 3T4TA 4B4XA 3KYZA 3QNCA 4BQMA 5AQ9A 3QP1A 4MMNA 3T1QB 4KZ6A 4PAUA 1NYYA 4PM5A 1TDGA 3EOIA 5CEDA 3M2JA 4PM8A 5HPIA 3FYZA 1DRMA 4KZ8A 3IF6A 2P08A 3W4OA 3N6IA 4R3JA 3VOLA 5TBMA 4OOYA 1NXYA 1TDLA 1YM1A 3NCKA 1FQGA 1U60A 2PHYA 2WGWA 2Y2HA 1XJ3A 3HLCA 4XT2A 5U47A 3CJMA 4ZTKA 2GZAA 2ZQCA 1JNUA 5FQQA 3O88A 5A91A 4DF6A 4JGQA 3S1YA 3L7HA 4ZDXA 3AGDA 1RCJA 3C7UA 4JF5A 4S2PA 2PD7A 3T1RA 2Y2GA 1ES2A 1P9WA 3N8SA 4NKPA 3H82A 1WA9A 3JYIA 4HESA 3W4QA 3LY4A 2IWBA 1KGEA 4E3LA 2KOIA 1DJAA 3BYDA 1M40A 2ZBBA 3UDXA 1HD8A 4N1XA 2ZM0A 3ZGAB 5DFYA 2XGNA 3TOIA 4OONA 3S4XA 1TVFA 1W7FA 3UMDA 2W3HA 4X68A 1NJ4A 1CI8A 4R3AA 5A90A 5F83A 5FQMA 4ZJ3A 3C7VA 5BOHA 1NZOA 3NOPC 4EESA 2HV1A 1XKZA 3S7QA 3CPTB 4WUJA 3R7WA 5CGSA 2PR5A 3PR6A 2Y2LA 4JXGA 3IX8A 1BTLA 1ESUA 5FI7A 4FOFA 3DTKA 4JKTA 1W63Q 3T50A 1N9OA 3H82B 4O8GA 3VV4A 5FA7A 2IA2A 2V8CA 1EI5A 3ZDJA 3ZVWA 4Z1WA 1ERQA 1K56A 3FPVA 3R7WB 3NHQA 4MEZA 1MWUA 3VOZA 3JPUA 5L2FA 3VFFA 4LPZA 1CI9A 5J3WA 3P09A 4H8RA 3MJQA 3C4PA 3GECA 2ZJ9A 3CHWP 3VE3A 3KYEA 1OT6A 3S22A 5AQBA 1FCMA 2V20A 2XFTA 4GB7A 1XPBA 1HLUP 3Q7VA 2G7UA 3LR0A 3FC7A 1BUEA 3Q07A 4HH2A 4Y7PA 5DTKA 4PPRA 4JLFA 4PM6A 2PT7A 1BLPA 1VB6A 3NBLA 3TG9A 2HJEA 3E0YA 3ISGA 3HUMA 4C75A 3G32A 2PBDP 2PU4A 5J7EA 4GOGA 3CMZA 1T1CA 1GCEA 2X71A 5HAIA 1MBLA 5C5KA 3UO9A 3IXGA 1CQAA 2HP6A 1TEMA 3W4PA 2ZQ7A 3LICA 5F68A 1Z09A 5EPHA 4DRTA 4ARZB 3T1SA 1YLTA 4EEPA 3A0VA 5CECA 2H0YA 5M19A 3P7NA 4ZBEA 5TGFA 1QMFA 1GA9A 1TD5A 4DXCA 3H9WA 4IJGA 4X25A 4AFIA 1K4FA 3SZTA 4LV3A 1ZG6A 5D3OA 4FUWA 1YLPA 1XA1A 3Q82A 3PAGA 4GS9A 5DVAA 4MDZA 3ITAA 3T1XA 1OTBA 3D9YA 1E25A 1Y28A 1KVLA 4IBXA 4F3LB 2V1BA 2V9AA 3QP6A 4OP8A 4KQDA 4Q0JA 3QP8A 4XUZA 2K2NA 2FFYA 5HW3A 3L9KA 2VGLS 1M6KA 3BFEA 5DF9A 1S67L 3G30A 1TS8A 4MBHA 4PKYA 5F6AA 2XEPA 4FTXA 3BFGA 1E3UA 1JWZA 2P74A 5LBRA 2R9WA 1ODVA 2A3UA 4XUXA 2Y79A 1FIKA 2QWSA 3B42A 4OQHA 5A92A 4ZJ1A 3A3IA 3PBQA 3K3CA 2ZMVA 1K38A 2ZC3B 4KG5A 2OWJA 4YWZA 3LUQA 1WYCA 4ZJ2A 4QWOA 3ZG5A 3VE4A 2H28A 3K2NA 5CTNA 4LRXC 4EV4A 1JTGA 3ZHHA 4C6YA 3VP4A 2I72A 1PI5A 2M7VA 2J8YA 4BWIA 3HL9A 2HJ9C 4EBNA 4OPRA 1PZOA 3SW1A 4M3KA 1KOUA 5JYPA 4XT2B 2B18A 2WYXA 1WYBA 3G2YA 5DJTA 3ZQ5A 2ZLYA 2R9XA 2HP5A 4P0MA 3PHYA 3UE6A 1V9ZA 3ZG7B 5F1FA 1L0DA 3SS3A 3NDEA 5TBMB 1XGIA 1K57A 1S1YA 4HOIA 5EUAA 1UWPX 5DF7A 4HI4A 4HJ6A 4QJGA 2ZC5B 5FAQA 4N9KA 1H0MA 1K25A 2ZC4B 5E2HA 2XA7M 3IWQA 1L3LA 1XGJA 5GLAA 4OH0A 1EW0A 2XDMA 4NEED 4MNRA 5KIZA 1BZAA 3UB8A 3NJAA 4LGWA 2QPNA 2ZMFA 3MKFA 4JGPA 3UPPA 4MBFA 4UEYA 3WS2A 4KQRA 3BFDA 2ZL1A 1PWGA 2EWVA 3G2ZA 4BLMA 3MS6A 2CC1A 3Q81A 3B47A 3ULFA 4HY8A 4LV2A 2VK3A 2ZC6B 2JKFA 2ZC7A 4ID4A 3LYXA 3IWOA 1FR1A 3C4OA 2XF3A 4FCFA 1IKIA 4JBFA 3O5YA 1RGYA 1O7EA 2L4RA 5FEGA 3BQ8A 4MLLA 1DP8A 3MQ0A 1G28A 4DKIA 4GD6A 5HWVA 3LO7A 4JXWA 3F1NB 4NXBA 5EVLA 3CWFA 2VLGA 4YOFA 4GHIB 1LL5A 1ACFA 1MWTA 3IF6C 1OJGA 2P7JA 5I94A 3H7WA 2VGKA 1YSPA 4LFUA 4MBKA 5IHVA 4OVDA 5E2GA 1PZPA 4OOMA 4A5RA 4JGRA 1A0KA 2V0UA 4LRYC 3UY6A 3D4FA 2IWDA 2YKFA 1YLYA 3C38A 2LB5A 2WZZA 3VFHA 3E98A 5KMWA 2PD8A 4E3IA 3BM6A 4QB8A 2Z6DA 3B3XA 4K08A 1BULA 4KZBA 4LLOB 3KSHA 2V1AA 3TJZC 1Q2QA 3AGEA 2ZMAA
chains in the Genus database with same CATH topology
2EX6A 3O86A 1Y54A 2XD5A 2WZXA 2H0TA 2ZM0A 3A3JA 4K0WA 5CRFA 3ZGAB 2XGNA 4LCMA 4OQ0A 3TOIA 1ESIA 4OONA 4UAAA 4WMCD 4P85A 3S4XA 3A3DA 4EBLA 5EE8A 2OLUA 3WRZA 3IQAA 3WWXA 3BLSA 2EX8A 4QY5A 3A3EA 4OLGA 1TVFA 1IYSA 1W7FA 2RL3A 4X68A 1FCNA 1NJ4A 1CI8A 3GV9A 5A90A 5FDHA 2HDRA 3TSGA 2ZQAA 5F83A 4E3KA 5EVID 5HFOA 5FQMA 3UNWA 1KGGA 4ZJ3A 3C7VA 3NI9A 4WYYA 5CGWA 1L0GA 5BOHA 1NZOA 1HZOA 2EXBA 4O7DA 4R1GA 4S2IA 1XKZA 3BECA 2GDNA 2OLVA 4CPKA 4IVIA 4X69A 5CGSA 1L2SA 4B88A 1W79A 4OQGA 2Y2LA 4JF6A 3DWZA 3HUOA 4R3BA 4JXGA 1BTLA 1ESUA 3Q7VB 3MKEA 5FI7A 1SDEA 4EQIA 3G4PA 3EQVA 2WKEA 2P9VA 4QY6A 5FATA 2V1ZA 3O87A 4JKTA 2P9VB 5FI2A 4JXVA 1ZC2A 3IH8A 3UPOA 1LI0A 5FA7A 1W8YA 4DDYA 3ZDJA 1EI5A 1NRFA 4RX3A 4R0QA 3G31A 3N8RA 3ZVWA 1BLSA 2Y55A 3VSLA 1IYPA 3UE1A 4R4SA 1ERQA 1K56A 2J7VA 1ES5A 4MEZA 1K54A 1LI9A 1LLBA 1MWUA 3O3VA 4FH4A 3VOZA 2G2UA 3IHAA 1YMSA 3HUNA 1ONHA 5HX9A 1ES3A 3NIAA 4LENA 1L0EA 5L2FA 3G34A 4FSFA 3VFFA 1YMXA 1KDWA 1CI9A 3P09A 4H8RA 3WS5A 3C4PA 3A3FA 3Q1FA 4S2OA 1E3UD 2BG1A 2ZJ9A 2HDQA 2WGVA 4YINA 1FCOA 1BSGA 4RA7A 3S22A 2Y2PA 5AQBA 1FCMA 3UE0A 1BT5A 2V20A 4IBRA 2XFTA 4GB7A 1N9BA 4KZ5A 1XPBA 1PW1A 2FFFB 3Q7VA 5GLDA 4BENA 1YT4A 3FZCA 3M2KA 2Z2MB 2ZD8A 1BUEA 3Q07A 5JYOA 1K56D 3HLWA 4Y7PA 3GR2A 3VP2A 1SDNA 3PAEA 5DTKA 2QZ6A 4PPRA 4KZ9A 4JLFA 5E2EA 4K91A 3PBNA 3ZFZA 4PM6A 4OP5A 1FSYA 1HVBA 4LCLA 1BLPA 1PWDA 2H10A 2OSUA 3NBLA 5CTMA 2EX9A 3TG9A 2B5RA 3UDFA 2JE5A 4S2NC 1G68A 3Q7ZA 1KE3A 3HLDA 4R23A 4Z9QA 3OPPA 1DJBA 3ISGA 3HUMA 4C75A 3G32A 1EROA 1OMEA 2PU4A 4GOGA 1JVJA 2WGIA 1JWVA 4P6BA 2Q9NA 3CMZA 4BJPA 4WM9A 1S6RA 1GCEA 1XX2A 3FKVA 1JWPA 3HLBA 2PBYA 2WAFA 2X71A 3NDGA 4KG2A 5E43A 1MWSA 4HEFA 3PBOA 3PBRA 4OKPA 1MBLA 4N1HA 5HAIA 5FASA 3UO9A 3FV7A 3IXGA 1ALQA 2EXAA 4BD1A 1WE4A 1K57C 2HP6A 1TEMA 3W4PA 2ZQ7A 2WAEA 1PIOA 1IYQA 5CXWA 3IF6B 3ZNTA 5EPHA 4DRTA 1GHMA 2ZM2A 1YLTA 4GD8A 3IHBA 1E4DA 3GVBA 3IXHA 5CECA 3BFFA 1LHYA 3M6HA 2H0YA 5M19A 1RP5A 1BLCA 2RCXA 4ZBEA 5TGFA 4WZ5A 4OLDA 4WBGA 1QMFA 2HPBA 4JXSA 1GA9A 5FQ9A 5EOEA 3NY4A 4DXCA 2A49A 2Y59A 4Y0OA 3LEZA 5DF8A 4B4ZA 3GMWA 2BLSA 1K4FA 2XFSA 5M18A 1Z6FA 4LV3A 4DE0A 1ZG6A 3VMAA 1MKIA 3GSGA 4WEKA 5D3OA 3ZG0A 1CEGA 3PBSA 1YLPA 1PYYA 2XH9A 1XA1A 1G6AA 3BEBA 1FSWA 3PAGA 3Q82A 4PMAA 2H5SA 4NK3A 4WZ5C 1ES4A 3M6BA 1IELA 1S0WA 4L0LA 5DVAA 2WUQA 3ITAA 3ZCZA 3ZG9B 1ZG4A 1JTDA 2HP9A 1E25A 3HLGA 2EFUA 4OQIA 3V39A 2XLNA 4P87A 1KVLA 4OPYA 4K0XA 4LV1A 2HDSA 4OPZA 3RJUA 3UPNA 4IBXA 2WADA 3OPRA 2Y2KA 4NETA 5KSHA 4OP8A 4WELA 4BD0A 4JPMA 4PM9A 4KZ4A 3C5AA 3HREA 4XUZA 1W8QA 2FFYA 5HW3A 1CEFA 3EQUA 3HLFA 3P98A 3FKWA 1M6KA 2X02A 4EWFA 3BFEA 5DTSA 5DF9A 4IVKA 4C3QA 3G30A 1ERMA 4ZAMA 1YLJA 4DDSA 4GDNA 4MBHA 4DE2A 2C6WB 2DRWA 5CHJA 3SH7A 2XEPA 5M1AA 3SH9A 4E3MA 1ONGA 3IF5A 3BFGA 3MFDA 4FD8A 1E3UA 1JWZA 2P74A 1DY6A 3GRJA 5HARA 4X56A 3OPHA 5G18A 2J9OA 2R9WA 4KQQA 2A3UA 3WS0A 4XUXA 2Y2MA 4IEDA 2Y2NA 4Y0UA 4OQHA 2Y4AA 2JC7A 4KG6A 4UA6A 4ZJ1A 3A3IA 3PBQA 2IWCA 1J9MA 5FQJA 3VP3A 1MY8A 3QNBA 1IYOA 3WRTA 3N8LA 2XD1A 1K38A 3DW0A 3SOIA 2ZC3B 3V3SA 4KG5A 1HTZA 3UN7A 5CHUA 5GHZA 2Y91A 4X6TA 3RXXA 4E6XA 2JBFA 1Q2PA 1IEMA 1WYCA 4ZJ2A 1VQQA 1XXMA 3ZG5A 5HAQA 5KSCA 4U3TA 5FQIA 1GHPA 5EVIB 5CTNA 5FSRA 4BL2A 3OCLA 3DWKA 4EV4A 1AXBA 1JTGA 3ZHHA 3UDIA 2QMIA 4C6YA 5AQ7A 3VP4A 1C3BA 2I72A 3OC2A 1IKGA 5TR7A 3RXWA 3MZEA 1PI5A 2J8YA 4EBNA 3HL9A 1K54C 4OPRA 4UA7A 5FI6A 3LCEA 1N4OA 1MPLA 2DNSA 3MBZA 1PZOA 4M3KA 3PTEA 5JYPA 1CK3A 3IWIA 2WYXA 2HDUA 3WS1A 1WYBA 3G2YA 1YQSA 1NYMA 2Y2OA 5HL1A 2ZLYA 2R9XA 2E8IA 4WEJA 2HP5A 4P0MA 1YLZA 4RYEA 4QHCA 2Y2QA 3V3RA 5AQAA 3ZG7B 4R4RA 4S2MA 5F1FA 5F82A 1NZUA 3HVFA 1L0DA 3SS5A 3SS3A 3I7JA 2UWXA 3ZNYA 2Y2JA 1SHVA 2V2FF 1QMEA 3NDEA 1MWRA 4RVAA 1XGIA 3E2KA 1K57A 1H5XA 5EUAA 3VP0A 5EVIA 1FOFA 2DCFA 3DTMA 4S2LA 5DF7A 4U0TA 4E3OA 1GA0A 4QJGA 2ZC5B 5CGXA 1SKFA 5FAQA 3QHYA 1NY0A 1RGZA 2WKIA 5HAPA 5EECA 4N9KA 4GN2A 3MZDA 1K25A 2ZC4B 1K55C 5E2HA 1XA7A 1K4EA 4WMCA 3IWQA 1O07A 1XGJA 2XQZA 5GLAA 1PW8A 5E2FA 4E6WA 4S2KA 5F1GA 2OV5A 2WGWB 1BLHA 4UA9A 4OH0A 2WKHA 4S2NA 4E3NA 3MXSA 3MZFA 4OOLA 1VM1A 3E2LA 4X53A 2ZQDA 2XDMA 2WK0A 4KQOA 5GL9A 5GLBA 4RX2A 4PM7A 4MNRA 1BZAA 2VGJA 5GHXA 2QPNA 5CEBA 4QU3A 1K6SA 5J8XA 4EBPA 3MKFA 3BFCA 5KZHA 4Y0TA 3IT9A 5FAPA 3UPPA 2ZQ9A 5CERA 4MBFA 5EVIC 3WS2A 3BLMA 4KQRA 1PI4A 4YFMA 1KVMA 2XR0A 3BFDA 1PWGA 3NC8A 3VSKA 4BLMA 2PU2A 3G2ZA 3Q81A 2CC1A 4FH2A 3BRMA 1W5DA 3IXDA 4U0XA 2Q9MA 3WS4A 1H8YA 4LV2A 1KDSA 4KZ3A 4GZBA 4B4XA 2ZC6B 3IXBA 3QNCA 2ZC7A 4ID4A 3CG5A 4BQMA 5AQ9A 3MXRA 5TFQA 1DJCA 1KE4A 4GNUA 3IWOA 3PBTA 1FR1A 3C4OA 1ZKJA 4KENB 4KZ6A 5FAOA 2XF3A 3IH9A 4FCFA 3V50A 1IKIA 1NYYA 4PM5A 3SS4A 3VP1A 1TDGA 4JBFA 3W8KA 1RGYA 3LY3A 2J9PA 1I2SA 1O7EA 2Y2IA 4HBTA 5CEDA 3M2JA 4PM8A 3FYZA 4KZ8A 3N7WA 4MLLA 3IF6A 5FQKA 3N4IA 4GKUA 4JF4A 4QD4A 4GDBA 4KZAA 3W4OA 1LL9A 4CJNA 4DKIA 2C5WB 4GD6A 3N6IA 3OCNA 4LV0A 1FR6A 3LO7A 4R3JA 4JXWA 1H8ZA 3VOYA 2EX2A 4OOYA 5EVLA 5A93A 1NXYA 1TDLA 1KE0A 4X55A 1LL5A 1YM1A 1MWTA 3NCKA 1FQGA 4S2JA 4XXRA 4D2OA 2Z2LB 3IF6C 1U60A 5I94A 2VGKA 4MBKA 5DTTA 2WGWA 5IHVA 4OVDA 5E2GA 5GHYA 2Y2HA 4N92A 1PZPA 4OOMA 4A5RA 2X01A 3HLCA 4BL3A 1EWZA 3UY6A 5U47A 3CJMA 1YLWA 4ZTKA 3D4FA 2ZQCA 4UHUA 2IWDA 3O88A 5FQQA 5A91A 3FWLA 4DF6A 3GQZA 3S1YA 3ZG8B 4ZDXA 3GTCA 3ITBA 3UE3A 1YLYA 3AGDA 1RCJA 3C7UA 5EOOA 3G35A 4JF5A 4S2PA 4F94A 2WZZA 4DE3A 3VFHA 2ZQ8A 2Y2GA 1I5QA 5KMWA 2EFXA 1ES2A 1K55A 3N8SA 4WZ4A 1PWCA 5CHMA 4E3IA 4N9LA 3BM6A 1GHIA 4QB8A 2G2WA 2XK1A 4KZ7A 3HBRA 4HESA 3JYIA 3W4QA 4E3JA 1I2WA 3LY4A 4DXBA 4EUZA 2IWBA 1KGEA 4OPQA 4E3LA 3B3XA 5GLCA 3OPLA 3V5MA 1DJAA 3SH8A 3CZDA 5A92A 1L0FA 3BYDA 1BULA 4KZBA 3AGFA 1M40A 4DE1A 1SCWA 3UDXA 1KGFA 4Q8IA 1HD8A 1MXOA 1Q2QA 4N1XA 1XP4A 2JCHA 3OZHA 3ZVTA 3HLEA 4HBUA 1K6RA 3AGEA 2ZMAA 2ZM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EX6 A;  3O86 A;  1Y54 A;  2XD5 A;  2WZX A;  2H0T A;  2ZM0 A;  3A3J A;  4K0W A;  5CRF A;  3ZGA B;  2XGN A;  4LCM A;  4OQ0 A;  3TOI A;  1ESI A;  4OON A;  4UAA A;  4WMC D;  4P85 A;  3S4X A;  3A3D A;  4EBL A;  5EE8 A;  2OLU A;  3WRZ A;  3IQA A;  3WWX A;  3BLS A;  2EX8 A;  4QY5 A;  3A3E A;  4OLG A;  1TVF A;  1IYS A;  1W7F A;  2RL3 A;  4X68 A;  1FCN A;  1NJ4 A;  1CI8 A;  3GV9 A;  5A90 A;  5FDH A;  2HDR A;  3TSG A;  2ZQA A;  5F83 A;  4E3K A;  5EVI D;  5HFO A;  5FQM A;  3UNW A;  1KGG A;  4ZJ3 A;  3C7V A;  3NI9 A;  4WYY A;  5CGW A;  1L0G A;  5BOH A;  1NZO A;  1HZO A;  2EXB A;  4O7D A;  4R1G A;  4S2I A;  1XKZ A;  3BEC A;  2GDN A;  2OLV A;  4CPK A;  4IVI A;  4X69 A;  5CGS A;  1L2S A;  4B88 A;  1W79 A;  4OQG A;  2Y2L A;  4JF6 A;  3DWZ A;  3HUO A;  4R3B A;  4JXG A;  1BTL A;  1ESU A;  3Q7V B;  3MKE A;  5FI7 A;  1SDE A;  4EQI A;  3G4P A;  3EQV A;  2WKE A;  2P9V A;  4QY6 A;  5FAT A;  2V1Z A;  3O87 A;  4JKT A;  2P9V B;  5FI2 A;  4JXV A;  1ZC2 A;  3IH8 A;  3UPO A;  1LI0 A;  5FA7 A;  1W8Y A;  4DDY A;  3ZDJ A;  1EI5 A;  1NRF A;  4RX3 A;  4R0Q A;  3G31 A;  3N8R A;  3ZVW A;  1BLS A;  2Y55 A;  3VSL A;  1IYP A;  3UE1 A;  4R4S A;  1ERQ A;  1K56 A;  2J7V A;  1ES5 A;  4MEZ A;  1K54 A;  1LI9 A;  1LLB A;  1MWU A;  3O3V A;  4FH4 A;  3VOZ A;  2G2U A;  3IHA A;  1YMS A;  3HUN A;  1ONH A;  5HX9 A;  1ES3 A;  3NIA A;  4LEN A;  1L0E A;  5L2F A;  3G34 A;  4FSF A;  3VFF A;  1YMX A;  1KDW A;  1CI9 A;  3P09 A;  4H8R A;  3WS5 A;  3C4P A;  3A3F A;  3Q1F A;  4S2O A;  1E3U D;  2BG1 A;  2ZJ9 A;  2HDQ A;  2WGV A;  4YIN A;  1FCO A;  1BSG A;  4RA7 A;  3S22 A;  2Y2P A;  5AQB A;  1FCM A;  3UE0 A;  1BT5 A;  2V20 A;  4IBR A;  2XFT A;  4GB7 A;  1N9B A;  4KZ5 A;  1XPB A;  1PW1 A;  2FFF B;  3Q7V A;  5GLD A;  4BEN A;  1YT4 A;  3FZC A;  3M2K A;  2Z2M B;  2ZD8 A;  1BUE A;  3Q07 A;  5JYO A;  1K56 D;  3HLW A;  4Y7P A;  3GR2 A;  3VP2 A;  1SDN A;  3PAE A;  5DTK A;  2QZ6 A;  4PPR A;  4KZ9 A;  4JLF A;  5E2E A;  4K91 A;  3PBN A;  3ZFZ A;  4PM6 A;  4OP5 A;  1FSY A;  1HVB A;  4LCL A;  1BLP A;  1PWD A;  2H10 A;  2OSU A;  3NBL A;  5CTM A;  2EX9 A;  3TG9 A;  2B5R A;  3UDF A;  2JE5 A;  4S2N C;  1G68 A;  3Q7Z A;  1KE3 A;  3HLD A;  4R23 A;  4Z9Q A;  3OPP A;  1DJB A;  3ISG A;  3HUM A;  4C75 A;  3G32 A;  1ERO A;  1OME A;  2PU4 A;  4GOG A;  1JVJ A;  2WGI A;  1JWV A;  4P6B A;  2Q9N A;  3CMZ A;  4BJP A;  4WM9 A;  1S6R A;  1GCE A;  1XX2 A;  3FKV A;  1JWP A;  3HLB A;  2PBY A;  2WAF A;  2X71 A;  3NDG A;  4KG2 A;  5E43 A;  1MWS A;  4HEF A;  3PBO A;  3PBR A;  4OKP A;  1MBL A;  4N1H A;  5HAI A;  5FAS A;  3UO9 A;  3FV7 A;  3IXG A;  1ALQ A;  2EXA A;  4BD1 A;  1WE4 A;  1K57 C;  2HP6 A;  1TEM A;  3W4P A;  2ZQ7 A;  2WAE A;  1PIO A;  1IYQ A;  5CXW A;  3IF6 B;  3ZNT A;  5EPH A;  4DRT A;  1GHM A;  2ZM2 A;  1YLT A;  4GD8 A;  3IHB A;  1E4D A;  3GVB A;  3IXH A;  5CEC A;  3BFF A;  1LHY A;  3M6H A;  2H0Y A;  5M19 A;  1RP5 A;  1BLC A;  2RCX A;  4ZBE A;  5TGF A;  4WZ5 A;  4OLD A;  4WBG A;  1QMF A;  2HPB A;  4JXS A;  1GA9 A;  5FQ9 A;  5EOE A;  3NY4 A;  4DXC A;  2A49 A;  2Y59 A;  4Y0O A;  3LEZ A;  5DF8 A;  4B4Z A;  3GMW A;  2BLS A;  1K4F A;  2XFS A;  5M18 A;  1Z6F A;  4LV3 A;  4DE0 A;  1ZG6 A;  3VMA A;  1MKI A;  3GSG A;  4WEK A;  5D3O A;  3ZG0 A;  1CEG A;  3PBS A;  1YLP A;  1PYY A;  2XH9 A;  1XA1 A;  1G6A A;  3BEB A;  1FSW A;  3PAG A;  3Q82 A;  4PMA A;  2H5S A;  4NK3 A;  4WZ5 C;  1ES4 A;  3M6B A;  1IEL A;  1S0W A;  4L0L A;  5DVA A;  2WUQ A;  3ITA A;  3ZCZ A;  3ZG9 B;  1ZG4 A;  1JTD A;  2HP9 A;  1E25 A;  3HLG A;  2EFU A;  4OQI A;  3V39 A;  2XLN A;  4P87 A;  1KVL A;  4OPY A;  4K0X A;  4LV1 A;  2HDS A;  4OPZ A;  3RJU A;  3UPN A;  4IBX A;  2WAD A;  3OPR A;  2Y2K A;  4NET A;  5KSH A;  4OP8 A;  4WEL A;  4BD0 A;  4JPM A;  4PM9 A;  4KZ4 A;  3C5A A;  3HRE A;  4XUZ A;  1W8Q A;  2FFY A;  5HW3 A;  1CEF A;  3EQU A;  3HLF A;  3P98 A;  3FKW A;  1M6K A;  2X02 A;  4EWF A;  3BFE A;  5DTS A;  5DF9 A;  4IVK A;  4C3Q A;  3G30 A;  1ERM A;  4ZAM A;  1YLJ A;  4DDS A;  4GDN A;  4MBH A;  4DE2 A;  2C6W B;  2DRW A;  5CHJ A;  3SH7 A;  2XEP A;  5M1A A;  3SH9 A;  4E3M A;  1ONG A;  3IF5 A;  3BFG A;  3MFD A;  4FD8 A;  1E3U A;  1JWZ A;  2P74 A;  1DY6 A;  3GRJ A;  5HAR A;  4X56 A;  3OPH A;  5G18 A;  2J9O A;  2R9W A;  4KQQ A;  2A3U A;  3WS0 A;  4XUX A;  2Y2M A;  4IED A;  2Y2N A;  4Y0U A;  4OQH A;  2Y4A A;  2JC7 A;  4KG6 A;  4UA6 A;  4ZJ1 A;  3A3I A;  3PBQ A;  2IWC A;  1J9M A;  5FQJ A;  3VP3 A;  1MY8 A;  3QNB A;  1IYO A;  3WRT A;  3N8L A;  2XD1 A;  1K38 A;  3DW0 A;  3SOI A;  2ZC3 B;  3V3S A;  4KG5 A;  1HTZ A;  3UN7 A;  5CHU A;  5GHZ A;  2Y91 A;  4X6T A;  3RXX A;  4E6X A;  2JBF A;  1Q2P A;  1IEM A;  1WYC A;  4ZJ2 A;  1VQQ A;  1XXM A;  3ZG5 A;  5HAQ A;  5KSC A;  4U3T A;  5FQI A;  1GHP A;  5EVI B;  5CTN A;  5FSR A;  4BL2 A;  3OCL A;  3DWK A;  4EV4 A;  1AXB A;  1JTG A;  3ZHH A;  3UDI A;  2QMI A;  4C6Y A;  5AQ7 A;  3VP4 A;  1C3B A;  2I72 A;  3OC2 A;  1IKG A;  5TR7 A;  3RXW A;  3MZE A;  1PI5 A;  2J8Y A;  4EBN A;  3HL9 A;  1K54 C;  4OPR A;  4UA7 A;  5FI6 A;  3LCE A;  1N4O A;  1MPL A;  2DNS A;  3MBZ A;  1PZO A;  4M3K A;  3PTE A;  5JYP A;  1CK3 A;  3IWI A;  2WYX A;  2HDU A;  3WS1 A;  1WYB A;  3G2Y A;  1YQS A;  1NYM A;  2Y2O A;  5HL1 A;  2ZLY A;  2R9X A;  2E8I A;  4WEJ A;  2HP5 A;  4P0M A;  1YLZ A;  4RYE A;  4QHC A;  2Y2Q A;  3V3R A;  5AQA A;  3ZG7 B;  4R4R A;  4S2M A;  5F1F A;  5F82 A;  1NZU A;  3HVF A;  1L0D A;  3SS5 A;  3SS3 A;  3I7J A;  2UWX A;  3ZNY A;  2Y2J A;  1SHV A;  2V2F F;  1QME A;  3NDE A;  1MWR A;  4RVA A;  1XGI A;  3E2K A;  1K57 A;  1H5X A;  5EUA A;  3VP0 A;  5EVI A;  1FOF A;  2DCF A;  3DTM A;  4S2L A;  5DF7 A;  4U0T A;  4E3O A;  1GA0 A;  4QJG A;  2ZC5 B;  5CGX A;  1SKF A;  5FAQ A;  3QHY A;  1NY0 A;  1RGZ A;  2WKI A;  5HAP A;  5EEC A;  4N9K A;  4GN2 A;  3MZD A;  1K25 A;  2ZC4 B;  1K55 C;  5E2H A;  1XA7 A;  1K4E A;  4WMC A;  3IWQ A;  1O07 A;  1XGJ A;  2XQZ A;  5GLA A;  1PW8 A;  5E2F A;  4E6W A;  4S2K A;  5F1G A;  2OV5 A;  2WGW B;  1BLH A;  4UA9 A;  4OH0 A;  2WKH A;  4S2N A;  4E3N A;  3MXS A;  3MZF A;  4OOL A;  1VM1 A;  3E2L A;  4X53 A;  2ZQD A;  2XDM A;  2WK0 A;  4KQO A;  5GL9 A;  5GLB A;  4RX2 A;  4PM7 A;  4MNR A;  1BZA A;  2VGJ A;  5GHX A;  2QPN A;  5CEB A;  4QU3 A;  1K6S A;  5J8X A;  4EBP A;  3MKF A;  3BFC A;  5KZH A;  4Y0T A;  3IT9 A;  5FAP A;  3UPP A;  2ZQ9 A;  5CER A;  4MBF A;  5EVI C;  3WS2 A;  3BLM A;  4KQR A;  1PI4 A;  4YFM A;  1KVM A;  2XR0 A;  3BFD A;  1PWG A;  3NC8 A;  3VSK A;  4BLM A;  2PU2 A;  3G2Z A;  3Q81 A;  2CC1 A;  4FH2 A;  3BRM A;  1W5D A;  3IXD A;  4U0X A;  2Q9M A;  3WS4 A;  1H8Y A;  4LV2 A;  1KDS A;  4KZ3 A;  4GZB A;  4B4X A;  2ZC6 B;  3IXB A;  3QNC A;  2ZC7 A;  4ID4 A;  3CG5 A;  4BQM A;  5AQ9 A;  3MXR A;  5TFQ A;  1DJC A;  1KE4 A;  4GNU A;  3IWO A;  3PBT A;  1FR1 A;  3C4O A;  1ZKJ A;  4KEN B;  4KZ6 A;  5FAO A;  2XF3 A;  3IH9 A;  4FCF A;  3V50 A;  1IKI A;  1NYY A;  4PM5 A;  3SS4 A;  3VP1 A;  1TDG A;  4JBF A;  3W8K A;  1RGY A;  3LY3 A;  2J9P A;  1I2S A;  1O7E A;  2Y2I A;  4HBT A;  5CED A;  3M2J A;  4PM8 A;  3FYZ A;  4KZ8 A;  3N7W A;  4MLL A;  3IF6 A;  5FQK A;  3N4I A;  4GKU A;  4JF4 A;  4QD4 A;  4GDB A;  4KZA A;  3W4O A;  1LL9 A;  4CJN A;  4DKI A;  2C5W B;  4GD6 A;  3N6I A;  3OCN A;  4LV0 A;  1FR6 A;  3LO7 A;  4R3J A;  4JXW A;  1H8Z A;  3VOY A;  2EX2 A;  4OOY A;  5EVL A;  5A93 A;  1NXY A;  1TDL A;  1KE0 A;  4X55 A;  1LL5 A;  1YM1 A;  1MWT A;  3NCK A;  1FQG A;  4S2J A;  4XXR A;  4D2O A;  2Z2L B;  3IF6 C;  1U60 A;  5I94 A;  2VGK A;  4MBK A;  5DTT A;  2WGW A;  5IHV A;  4OVD A;  5E2G A;  5GHY A;  2Y2H A;  4N92 A;  1PZP A;  4OOM A;  4A5R A;  2X01 A;  3HLC A;  4BL3 A;  1EWZ A;  3UY6 A;  5U47 A;  3CJM A;  1YLW A;  4ZTK A;  3D4F A;  2ZQC A;  4UHU A;  2IWD A;  3O88 A;  5FQQ A;  5A91 A;  3FWL A;  4DF6 A;  3GQZ A;  3S1Y A;  3ZG8 B;  4ZDX A;  3GTC A;  3ITB A;  3UE3 A;  1YLY A;  3AGD A;  1RCJ A;  3C7U A;  5EOO A;  3G35 A;  4JF5 A;  4S2P A;  4F94 A;  2WZZ A;  4DE3 A;  3VFH A;  2ZQ8 A;  2Y2G A;  1I5Q A;  5KMW A;  2EFX A;  1ES2 A;  1K55 A;  3N8S A;  4WZ4 A;  1PWC A;  5CHM A;  4E3I A;  4N9L A;  3BM6 A;  1GHI A;  4QB8 A;  2G2W A;  2XK1 A;  4KZ7 A;  3HBR A;  4HES A;  3JYI A;  3W4Q A;  4E3J A;  1I2W A;  3LY4 A;  4DXB A;  4EUZ A;  2IWB A;  1KGE A;  4OPQ A;  4E3L A;  3B3X A;  5GLC A;  3OPL A;  3V5M A;  1DJA A;  3SH8 A;  3CZD A;  5A92 A;  1L0F A;  3BYD A;  1BUL A;  4KZB A;  3AGF A;  1M40 A;  4DE1 A;  1SCW A;  3UDX A;  1KGF A;  4Q8I A;  1HD8 A;  1MXO A;  1Q2Q A;  4N1X A;  1XP4 A;  2JCH A;  3OZH A;  3ZVT A;  3HLE A;  4HBU A;  1K6R A;  3AGE A;  2ZMA A;  2ZM8 A; 
#chains in the Genus database with same CATH topology
 2EX6 A;  4M4X A;  1Y54 A;  4K0W A;  5DKL A;  3A3D A;  5EE8 A;  2OLU A;  3A3E A;  4OLG A;  2WKP A;  2I9V A;  1BYW A;  3LIB A;  1NRJ A;  2RL3 A;  2VX8 A;  5FDH A;  4Y13 A;  3NI9 A;  1L0G A;  2EWW A;  3BEC A;  3DAV A;  2KX6 A;  2OLV A;  4IVI A;  4X69 A;  1L2S A;  1LSX A;  3CLO A;  4OQG A;  2VA0 A;  2JKT I;  4JF6 A;  5DJU A;  3Q7V B;  4QY6 A;  3EQV A;  2WKE A;  2P9V A;  2P9V B;  5FI2 A;  4F3L A;  1ZC2 A;  1LI0 A;  1W8Y A;  1NRF A;  1PNE A;  2QJ7 A;  4RX3 A;  3FG8 A;  3G31 A;  1S4R A;  2J7V A;  4IUH A;  4FH4 A;  1DP9 A;  2G2U A;  2Z6C A;  3HUN A;  1L0E A;  2NUP C;  3G34 A;  2FH5 A;  5G4Y A;  3WS5 A;  4DMZ A;  3A3F A;  3Q1F A;  4S2O A;  2WGV A;  4YIN A;  1FCO A;  1BSG A;  1XFQ A;  1D1J A;  2Y2P A;  3UB9 A;  3IS2 A;  4BEN A;  2FFF B;  5GLD A;  2OWH A;  3MQQ A;  2ZD8 A;  3CIT A;  4NXE A;  3CUE A;  3E4Q A;  1K56 D;  3HLW A;  3D72 A;  1SDN A;  2ZOI A;  2QZ6 A;  4Y3I A;  5E2E A;  4Y15 A;  3BQA A;  3ZFZ A;  4OP5 A;  2H10 A;  1SKO A;  3UDF A;  5HZH A;  3NOU C;  3UME A;  1DJB A;  3T12 B;  4EU0 A;  3DBA A;  1OME A;  3PYP A;  3PXP A;  5HDD A;  2WGI A;  4P6B A;  4BJP A;  2J80 A;  1XX2 A;  2NUT C;  3FKV A;  3HLB A;  2A24 B;  1MWS A;  4HEF A;  3PBO A;  4OKP A;  4N1H A;  3FV7 A;  2EXA A;  4BD1 A;  2ACG A;  5EFW A;  3LI9 A;  3ZNT A;  4MN6 A;  1GHM A;  2ZM2 A;  1G5U A;  3EWK A;  2W3D A;  3IHB A;  1BLC A;  1XJ2 A;  1D7E A;  2GNX A;  2HPB A;  4JXS A;  5FQ9 A;  3KX0 X;  2A49 A;  1XJ4 A;  2INW A;  3F1P B;  3GMW A;  3OOV A;  1Z6F A;  3TW8 A;  4PMA A;  1T1A A;  2H5S A;  4NK3 A;  4WZ5 C;  1S0W A;  3ZG9 B;  1ZG4 A;  3V39 A;  4K0X A;  1OTI A;  2HDS A;  3RJU A;  3KO6 A;  4BD0 A;  5EM0 A;  3E4P A;  3HRE A;  2FZ0 A;  1CEF A;  3F1O A;  3P98 A;  2X02 A;  5DTS A;  4BBU A;  5HDC A;  4DDS A;  4GDN A;  4NXF A;  2DRW A;  4X1M A;  5M1A A;  1ONG A;  3IF5 A;  3OPH A;  2JKG A;  4KQQ A;  2O0Y A;  4IED A;  2Y2N A;  4KG6 A;  3VP3 A;  1MY8 A;  1IYO A;  1S4S A;  3WRT A;  3CUE C;  3CPT A;  5L07 A;  5GHZ A;  2JBF A;  3E4O A;  1MC0 A;  5FQI A;  1YSQ A;  3OCL A;  1AXB A;  1T1B A;  1C3B A;  5TR7 A;  4ETX A;  2AVX A;  2VJW A;  4E04 A;  4ARZ A;  1CK3 A;  2R78 A;  3LGO A;  2HDU A;  3NEC A;  3WS1 A;  1YQS A;  1NYM A;  2E8I A;  4RYE A;  4QHC A;  2Y2Q A;  3H7W B;  5AQA A;  4S2M A;  4I3I A;  4Q0I A;  4G3W A;  2WKQ A;  5F82 A;  4RVA A;  5HPF A;  2A2L A;  3UB6 A;  1H5X A;  3LR3 A;  2BAS A;  4U0T A;  3IBJ A;  4E3O A;  4WL9 A;  5MC7 A;  5CGX A;  1SKF A;  1NY0 A;  4GN2 A;  3MZD A;  1K55 C;  1K4E A;  2XQZ A;  1PW8 A;  2OV5 A;  2WGW B;  2OAP 1;  4IUK A;  4UA9 A;  3LIE A;  1VM1 A;  4X53 A;  3R4K A;  2WK0 A;  5GL9 A;  5GLB A;  4PM7 A;  3A0R A;  5AVE A;  3T4L A;  5CEB A;  1P9R A;  5AVF A;  2VV7 A;  1LL8 A;  4EBP A;  3BFC A;  3MFX A;  5KZH A;  4Y0T A;  5FAP A;  2ZQ9 A;  2HF6 A;  1KVM A;  3NC8 A;  2JKT M;  4KUO A;  3OBF A;  4U0X A;  1H8Y A;  4O01 A;  3S7P A;  5IT5 A;  3IXB A;  2JHE A;  3CG5 A;  4KEN B;  1ZKJ A;  3IH9 A;  3SS4 A;  3LY3 A;  1I2S A;  2Y2I A;  4HBT A;  3T4Q A;  2D01 A;  3KSF A;  4G3V A;  4DJ3 A;  3MQO A;  4GKU A;  3MSH A;  4JF4 A;  4QD4 A;  4GDB A;  4KZA A;  1LL9 A;  4CJN A;  3OCN A;  1FR6 A;  3UB7 A;  3BWL A;  2WKR A;  4WN5 A;  4X55 A;  1VEU A;  1OJ5 A;  4D2O A;  4S2J A;  2Z2L B;  1VEU B;  2XRN A;  4B93 A;  1NLY A;  3KSG A;  4N92 A;  2QHK A;  5DFX A;  4MCW A;  3GQZ A;  3ZG8 B;  2PAV P;  4F94 A;  1MKM A;  4DE3 A;  2ZQ8 A;  1I5Q A;  1K55 A;  4WZ4 A;  1PWC A;  5CHM A;  3W2Z A;  2CMN A;  4N9L A;  1GHI A;  2G2W A;  4KZ7 A;  4EUZ A;  2V0W A;  4OPQ A;  4MN5 A;  1J3W A;  4CQH A;  5GLC A;  4CLC C;  4CLC A;  3OPL A;  3V5M A;  3SH8 A;  2P04 A;  3CZD A;  1L0F A;  2O9C A;  4DE1 A;  3QP5 A;  1KGF A;  1MXO A;  3OZH A;  3ZVT A;  3HLE A;  1K6R A;  3UB5 P;  3A3J A;  2WZX A;  2H0T A;  5CRF A;  4LCM A;  4OQ0 A;  1ESI A;  4EBL A;  4WMC D;  1H3Q A;  3WRZ A;  3WWX A;  3BLS A;  2EX8 A;  4QY5 A;  1GSX A;  4GW9 A;  5AJG A;  3ICY A;  1FCN A;  2HZ5 A;  4CLC D;  2ZQA A;  5EVI D;  2DMW A;  3UNW A;  2KDK A;  4R1G A;  1OTA A;  5K5B A;  2GDN A;  4B88 A;  1W79 A;  3P01 A;  3HUO A;  4R3B A;  2QJ5 A;  4R70 A;  3MKE A;  3G4P A;  5FAT A;  2V1Z A;  3O87 A;  3RFB A;  3G6O A;  5HDS A;  4JXV A;  3UPO A;  2Y55 A;  3VSL A;  4R4S A;  5EVE A;  5F5Y A;  1K54 A;  1LI9 A;  1LLB A;  3O3V A;  3IHA A;  1ONH A;  1ES3 A;  3NIA A;  3TRC A;  1YMX A;  5L10 A;  4HNB A;  5CX7 A;  3LIF A;  4NXG A;  2BG1 A;  3T4K A;  3U4L P;  1BT5 A;  4IBR A;  1N9B A;  4KZ5 A;  1PW1 A;  1VHM A;  4PKY G;  3M2K A;  3GR2 A;  3PAE A;  4KZ9 A;  3EEA A;  3PBN A;  4R38 A;  1HVB A;  4LCL A;  1PWD A;  3DTI A;  2OSU A;  4PHT A;  5CTM A;  2EX9 A;  2JE5 A;  1G68 A;  1YAX A;  1KE3 A;  3HLD A;  4R23 A;  4Z9Q A;  3KSI A;  1CJF A;  3OPP A;  4P6Z S;  4BBV A;  4D60 A;  1JVJ A;  3T4O A;  1S6R A;  2WAF A;  5J4E A;  1TS0 A;  2VV8 A;  3PBR A;  2QKP A;  1ALQ A;  1WE4 A;  2K7S A;  1PIO A;  1F98 A;  3IF6 B;  3QP2 A;  4HH3 A;  3QP4 A;  1S1Z A;  3OLO A;  4GD8 A;  2V8F A;  1LHY A;  4HJ3 A;  1NLZ A;  1RP5 A;  2RCX A;  5L09 A;  4WZ5 A;  4OLD A;  2Y59 A;  4Y0O A;  4B4Z A;  3T4J A;  2HGV A;  3MXQ A;  4HQA A;  5M18 A;  4DE0 A;  2JKR I;  1MKI A;  4WEK A;  4EUV A;  1CEG A;  3PBS A;  1PYY A;  3BEB A;  3LFV A;  1FSW A;  3M6B A;  4L0L A;  2WUQ A;  3ZCZ A;  2L0W A;  1JTD A;  3HLG A;  4OQI A;  2XLN A;  5EM1 A;  2JN7 A;  4P87 A;  4OPY A;  4LV1 A;  2KLI A;  1IFQ A;  2WAD A;  3OPR A;  2VEA A;  5KSH A;  4NET A;  3C5A A;  4ESP A;  3EGD C;  1IOU A;  3FKW A;  4EWF A;  2ZOH A;  1ERM A;  4DE2 A;  2C6W B;  5HWT A;  3HJI A;  3HCY A;  5G18 A;  3LR5 A;  3RH8 B;  3FPW A;  2J3W A;  3IBR A;  2VGL M;  3WS0 A;  2Y2M A;  2XA7 S;  4ZRR A;  5IU1 A;  2Y4A A;  1XFN A;  3QNB A;  4RQ9 A;  3N8L A;  4YNR A;  3V3S A;  1HTZ A;  3UN7 A;  4E6X A;  3RXX A;  3NOT C;  1Q2P A;  3CI6 A;  5G4Z A;  4EQ1 A;  5L8M A;  1V9Y A;  3S7N A;  3IX4 A;  1XXM A;  3EEH A;  5KSC A;  4I5S A;  4BL2 A;  3BW6 A;  3DTE A;  4Y5F A;  5AQ7 A;  2MJ6 A;  3MZE A;  4EER A;  5FI6 A;  1MPL A;  5FL3 A;  5IS1 A;  3IWI A;  5HL1 A;  2PYR A;  3LI8 A;  5DKK A;  1NWZ A;  4DN0 A;  1XJ6 A;  3JVU A;  3IS2 B;  1YKD A;  1AWI A;  3I7J A;  1SZV A;  2Y2J A;  2XRO A;  1SHV A;  2V2F F;  1MWR A;  2GX5 A;  5HWW A;  3DTM A;  4S2L A;  3F1N A;  4LRZ E;  3C8C A;  5FDS A;  4I3J A;  1F2K A;  4ETZ A;  1P97 A;  1LSW A;  2M7U A;  2B95 A;  2WKH A;  4S2N A;  4E3N A;  3MXS A;  1UWN X;  4G3K A;  2VGJ A;  4QU3 A;  1K6S A;  3A0S A;  1DP6 A;  3IT9 A;  4L9G A;  5EVI C;  2J3T D;  3VSK A;  4O0P A;  4HHD A;  4KUK A;  4FH2 A;  1W5D A;  3IXD A;  4CLC B;  2Q9M A;  2K31 A;  4KZ3 A;  4GZB A;  1UGU A;  5TFQ A;  3MXR A;  1DJC A;  1KE4 A;  4GNU A;  1N9L A;  3PBT A;  5FAO A;  3V50 A;  2M1C A;  2BTF P;  3VP1 A;  1X0O A;  3W8K A;  2J9P A;  2OAQ 1;  4WLA A;  4L9E A;  1SKO B;  3N7W A;  4GS9 B;  5FQK A;  3GDI A;  3N4I A;  4GLQ A;  3KYQ A;  1YPR A;  2C5W B;  2YKH A;  4LV0 A;  1H8Z A;  3VOY A;  2EX2 A;  5A93 A;  1KE0 A;  4HP9 A;  4XXR A;  2UV0 E;  2PDR A;  4HIA A;  5DTT A;  4GJ4 A;  5GHY A;  2X01 A;  4BL3 A;  1EWZ A;  1YLW A;  4UHU A;  3V67 A;  3FWL A;  3GTC A;  3ITB A;  3UE3 A;  3F1O B;  2W3E A;  4EW7 A;  5EOO A;  3G35 A;  3D3O A;  3HJK A;  2EFX A;  4GCZ A;  1MZU A;  2XK1 A;  3HBR A;  4E3J A;  1I2W A;  4DXB A;  4DJ2 A;  2L1M A;  2PYP A;  3AGF A;  4EEU A;  1STZ A;  1SCW A;  4Q8I A;  2PRF A;  1XP4 A;  2JCH A;  4HBU A;  1P0Z A;  2ZM8 A;  1LSV A;  3O86 A;  2XD5 A;  4R6L A;  2W27 A;  2VKS A;  2Q0O A;  1ZHH B;  4UAA A;  4P85 A;  4Q0H A;  3IX3 A;  3IQA A;  5HL6 A;  1IYS A;  1LT0 A;  2JKR M;  3GV9 A;  2HDR A;  3TSG A;  4E3K A;  5HFO A;  2PR6 A;  3EGX C;  3TE8 A;  1KGG A;  5CGW A;  4WYY A;  2EXB A;  1HZO A;  2ZL1 B;  4O7D A;  4S2I A;  3ZYT A;  1OTE A;  4HP4 A;  2VZW A;  4CPK A;  1GSV A;  2O9B A;  3DWZ A;  4NG2 A;  1VET B;  5EV0 A;  1SDE A;  4EQI A;  1F5M A;  4B9O A;  3C30 A;  3BJN A;  3LEQ A;  3IH8 A;  4DDY A;  4R0Q A;  3N8R A;  1BLS A;  4UQI S;  1IYP A;  3UE1 A;  4ME4 A;  1ES5 A;  1YMS A;  5HX9 A;  4LEN A;  1TF1 A;  4FSF A;  2O99 A;  4X1L A;  1KDW A;  3F1P A;  3JVV A;  5HSQ A;  1G6O A;  3CAX A;  1E3U D;  4P6Z M;  1F9I A;  2HDQ A;  4RA7 A;  1T19 A;  3UE0 A;  3T4S A;  1YT4 A;  3FZC A;  2Z2M B;  2VV6 A;  5JYO A;  3VP2 A;  4K91 A;  3NUL A;  2QYB A;  1FSY A;  1OTD A;  2B5R A;  4S2N C;  3Q7Z A;  4EET B;  5HD5 A;  1ERO A;  1JWV A;  2Q9N A;  4WM9 A;  1ZTU A;  3NDG A;  1JWP A;  4KG2 A;  2PBY A;  4I38 A;  5E43 A;  5FAS A;  4II7 A;  4MN7 A;  1K57 C;  2WAE A;  1IYQ A;  5CXW A;  2GJ3 A;  4UQI M;  1W63 M;  3S7O A;  1E4D A;  3U2A A;  3GVB A;  3IXH A;  3BFF A;  3M6H A;  4H6J B;  4WBG A;  1TS6 A;  5EOE A;  3NY4 A;  3LEZ A;  5DF8 A;  1GSW A;  2OOL A;  1TS7 A;  2E8J A;  5HD3 A;  2BLS A;  2XFS A;  4I3A A;  3VMA A;  3ZG0 A;  3GSG A;  5FSR A;  2XH9 A;  1G6A A;  1ES4 A;  3LID A;  1IEL A;  2HP9 A;  1OT9 A;  2EFU A;  4HJ4 A;  2O9A A;  4QPR A;  4OPZ A;  3UPN A;  1H8M A;  2Y2K A;  4EXO A;  4H6J A;  4WEL A;  4JPM A;  4GHI A;  4PM9 A;  4KZ4 A;  1W8Q A;  1S66 L;  3EQU A;  3HLF A;  2W3G A;  4JGO A;  4IVK A;  4C3Q A;  4ZAM A;  1YLJ A;  2J3T C;  3MF0 A;  1Y4O A;  5CHJ A;  3SH7 A;  3SH9 A;  4E3M A;  2A24 A;  3BY8 A;  3MFD A;  4FD8 A;  2LB9 A;  3RTY A;  1DY6 A;  1CF0 A;  3GRJ A;  4X56 A;  5HAR A;  4BMW A;  2J9O A;  1D06 A;  4Y0U A;  2JC7 A;  3LR4 A;  4UA6 A;  5FQJ A;  1N9N A;  1J9M A;  2IWC A;  4I39 A;  3MMH A;  2XD1 A;  2Y8H A;  4WF0 A;  3DW0 A;  3SOI A;  5CHU A;  2Y91 A;  4X6T A;  3BY9 A;  4CLC E;  1IEM A;  2W1T A;  1FIL A;  1VQQ A;  5HAQ A;  4U3T A;  1PRQ A;  1GHP A;  5EVI B;  3DWK A;  4Y2F A;  3UDI A;  2QMI A;  5I5L A;  3OC2 A;  1IKG A;  3RXW A;  3B33 A;  1K54 C;  4UA7 A;  3LCE A;  1N4O A;  4Y17 A;  1VET A;  2W1R A;  2DNS A;  3MBZ A;  3PTE A;  3C2W A;  5FEF A;  2W3F A;  2Y2O A;  4WEJ A;  1YLZ A;  3V3R A;  1K0K A;  5TJJ A;  4R4R A;  1NZU A;  3HVF A;  3SS5 A;  2UWX A;  3ZNY A;  1QME A;  3K3D A;  2D02 A;  3E2K A;  3MR0 A;  3VP0 A;  5EVI A;  1FOF A;  2DCF A;  1GA0 A;  4BBT A;  5A8B A;  3QHY A;  1RGZ A;  2WKI A;  5HAP A;  5EEC A;  1XA7 A;  4WMC A;  1O07 A;  5F69 A;  5E2F A;  4E6W A;  1PFL A;  4S2K A;  5F1G A;  1BLH A;  3MZF A;  2B02 A;  4OOL A;  3E2L A;  2ZQD A;  4KQO A;  4RX2 A;  3LIA A;  1OPX A;  5GHX A;  2W0N A;  4IHQ A;  5J8X A;  2EA9 A;  2W1T B;  5CER A;  3BLM A;  1PI4 A;  4YFM A;  2XR0 A;  2PU2 A;  1T18 A;  3BRM A;  3WS4 A;  2XSS A;  4L9F A;  1KDS A;  3T4T A;  4B4X A;  3KYZ A;  3QNC A;  4BQM A;  5AQ9 A;  3QP1 A;  4MMN A;  3T1Q B;  4KZ6 A;  4PAU A;  1NYY A;  4PM5 A;  1TDG A;  3EOI A;  5CED A;  3M2J A;  4PM8 A;  5HPI A;  3FYZ A;  1DRM A;  4KZ8 A;  3IF6 A;  2P08 A;  3W4O A;  3N6I A;  4R3J A;  3VOL A;  5TBM A;  4OOY A;  1NXY A;  1TDL A;  1YM1 A;  3NCK A;  1FQG A;  1U60 A;  2PHY A;  2WGW A;  2Y2H A;  1XJ3 A;  3HLC A;  4XT2 A;  5U47 A;  3CJM A;  4ZTK A;  2GZA A;  2ZQC A;  1JNU A;  5FQQ A;  3O88 A;  5A91 A;  4DF6 A;  4JGQ A;  3S1Y A;  3L7H A;  4ZDX A;  3AGD A;  1RCJ A;  3C7U A;  4JF5 A;  4S2P A;  2PD7 A;  3T1R A;  2Y2G A;  1ES2 A;  1P9W A;  3N8S A;  4NKP A;  3H82 A;  1WA9 A;  3JYI A;  4HES A;  3W4Q A;  3LY4 A;  2IWB A;  1KGE A;  4E3L A;  2KOI A;  1DJA A;  3BYD A;  1M40 A;  2ZBB A;  3UDX A;  1HD8 A;  4N1X A;  2ZM0 A;  3ZGA B;  5DFY A;  2XGN A;  3TOI A;  4OON A;  3S4X A;  1TVF A;  1W7F A;  3UMD A;  2W3H A;  4X68 A;  1NJ4 A;  1CI8 A;  4R3A A;  5A90 A;  5F83 A;  5FQM A;  4ZJ3 A;  3C7V A;  5BOH A;  1NZO A;  3NOP C;  4EES A;  2HV1 A;  1XKZ A;  3S7Q A;  3CPT B;  4WUJ A;  3R7W A;  5CGS A;  2PR5 A;  3PR6 A;  2Y2L A;  4JXG A;  3IX8 A;  1BTL A;  1ESU A;  5FI7 A;  4FOF A;  3DTK A;  4JKT A;  1W63 Q;  3T50 A;  1N9O A;  3H82 B;  4O8G A;  3VV4 A;  5FA7 A;  2IA2 A;  2V8C A;  1EI5 A;  3ZDJ A;  3ZVW A;  4Z1W A;  1ERQ A;  1K56 A;  3FPV A;  3R7W B;  3NHQ A;  4MEZ A;  1MWU A;  3VOZ A;  3JPU A;  5L2F A;  3VFF A;  4LPZ A;  1CI9 A;  5J3W A;  3P09 A;  4H8R A;  3MJQ A;  3C4P A;  3GEC A;  2ZJ9 A;  3CHW P;  3VE3 A;  3KYE A;  1OT6 A;  3S22 A;  5AQB A;  1FCM A;  2V20 A;  2XFT A;  4GB7 A;  1XPB A;  1HLU P;  3Q7V A;  2G7U A;  3LR0 A;  3FC7 A;  1BUE A;  3Q07 A;  4HH2 A;  4Y7P A;  5DTK A;  4PPR A;  4JLF A;  4PM6 A;  2PT7 A;  1BLP A;  1VB6 A;  3NBL A;  3TG9 A;  2HJE A;  3E0Y A;  3ISG A;  3HUM A;  4C75 A;  3G32 A;  2PBD P;  2PU4 A;  5J7E A;  4GOG A;  3CMZ A;  1T1C A;  1GCE A;  2X71 A;  5HAI A;  1MBL A;  5C5K A;  3UO9 A;  3IXG A;  1CQA A;  2HP6 A;  1TEM A;  3W4P A;  2ZQ7 A;  3LIC A;  5F68 A;  1Z09 A;  5EPH A;  4DRT A;  4ARZ B;  3T1S A;  1YLT A;  4EEP A;  3A0V A;  5CEC A;  2H0Y A;  5M19 A;  3P7N A;  4ZBE A;  5TGF A;  1QMF A;  1GA9 A;  1TD5 A;  4DXC A;  3H9W A;  4IJG A;  4X25 A;  4AFI A;  1K4F A;  3SZT A;  4LV3 A;  1ZG6 A;  5D3O A;  4FUW A;  1YLP A;  1XA1 A;  3Q82 A;  3PAG A;  4GS9 A;  5DVA A;  4MDZ A;  3ITA A;  3T1X A;  1OTB A;  3D9Y A;  1E25 A;  1Y28 A;  1KVL A;  4IBX A;  4F3L B;  2V1B A;  2V9A A;  3QP6 A;  4OP8 A;  4KQD A;  4Q0J A;  3QP8 A;  4XUZ A;  2K2N A;  2FFY A;  5HW3 A;  3L9K A;  2VGL S;  1M6K A;  3BFE A;  5DF9 A;  1S67 L;  3G30 A;  1TS8 A;  4MBH A;  4PKY A;  5F6A A;  2XEP A;  4FTX A;  3BFG A;  1E3U A;  1JWZ A;  2P74 A;  5LBR A;  2R9W A;  1ODV A;  2A3U A;  4XUX A;  2Y79 A;  1FIK A;  2QWS A;  3B42 A;  4OQH A;  5A92 A;  4ZJ1 A;  3A3I A;  3PBQ A;  3K3C A;  2ZMV A;  1K38 A;  2ZC3 B;  4KG5 A;  2OWJ A;  4YWZ A;  3LUQ A;  1WYC A;  4ZJ2 A;  4QWO A;  3ZG5 A;  3VE4 A;  2H28 A;  3K2N A;  5CTN A;  4LRX C;  4EV4 A;  1JTG A;  3ZHH A;  4C6Y A;  3VP4 A;  2I72 A;  1PI5 A;  2M7V A;  2J8Y A;  4BWI A;  3HL9 A;  2HJ9 C;  4EBN A;  4OPR A;  1PZO A;  3SW1 A;  4M3K A;  1KOU A;  5JYP A;  4XT2 B;  2B18 A;  2WYX A;  1WYB A;  3G2Y A;  5DJT A;  3ZQ5 A;  2ZLY A;  2R9X A;  2HP5 A;  4P0M A;  3PHY A;  3UE6 A;  1V9Z A;  3ZG7 B;  5F1F A;  1L0D A;  3SS3 A;  3NDE A;  5TBM B;  1XGI A;  1K57 A;  1S1Y A;  4HOI A;  5EUA A;  1UWP X;  5DF7 A;  4HI4 A;  4HJ6 A;  4QJG A;  2ZC5 B;  5FAQ A;  4N9K A;  1H0M A;  1K25 A;  2ZC4 B;  5E2H A;  2XA7 M;  3IWQ A;  1L3L A;  1XGJ A;  5GLA A;  4OH0 A;  1EW0 A;  2XDM A;  4NEE D;  4MNR A;  5KIZ A;  1BZA A;  3UB8 A;  3NJA A;  4LGW A;  2QPN A;  2ZMF A;  3MKF A;  4JGP A;  3UPP A;  4MBF A;  4UEY A;  3WS2 A;  4KQR A;  3BFD A;  2ZL1 A;  1PWG A;  2EWV A;  3G2Z A;  4BLM A;  3MS6 A;  2CC1 A;  3Q81 A;  3B47 A;  3ULF A;  4HY8 A;  4LV2 A;  2VK3 A;  2ZC6 B;  2JKF A;  2ZC7 A;  4ID4 A;  3LYX A;  3IWO A;  1FR1 A;  3C4O A;  2XF3 A;  4FCF A;  1IKI A;  4JBF A;  3O5Y A;  1RGY A;  1O7E A;  2L4R A;  5FEG A;  3BQ8 A;  4MLL A;  1DP8 A;  3MQ0 A;  1G28 A;  4DKI A;  4GD6 A;  5HWV A;  3LO7 A;  4JXW A;  3F1N B;  4NXB A;  5EVL A;  3CWF A;  2VLG A;  4YOF A;  4GHI B;  1LL5 A;  1ACF A;  1MWT A;  3IF6 C;  1OJG A;  2P7J A;  5I94 A;  3H7W A;  2VGK A;  1YSP A;  4LFU A;  4MBK A;  5IHV A;  4OVD A;  5E2G A;  1PZP A;  4OOM A;  4A5R A;  4JGR A;  1A0K A;  2V0U A;  4LRY C;  3UY6 A;  3D4F A;  2IWD A;  2YKF A;  1YLY A;  3C38 A;  2LB5 A;  2WZZ A;  3VFH A;  3E98 A;  5KMW A;  2PD8 A;  4E3I A;  3BM6 A;  4QB8 A;  2Z6D A;  3B3X A;  4K08 A;  1BUL A;  4KZB A;  4LLO B;  3KSH A;  2V1A A;  3TJZ C;  1Q2Q A;  3AGE A;  2ZMA A; 
#chains in the Genus database with same CATH homology
 2EX6 A;  3O86 A;  1Y54 A;  2XD5 A;  2WZX A;  2H0T A;  2ZM0 A;  3A3J A;  4K0W A;  5CRF A;  3ZGA B;  2XGN A;  4LCM A;  4OQ0 A;  3TOI A;  1ESI A;  4OON A;  4UAA A;  4WMC D;  4P85 A;  3S4X A;  3A3D A;  4EBL A;  5EE8 A;  2OLU A;  3WRZ A;  3IQA A;  3WWX A;  3BLS A;  2EX8 A;  4QY5 A;  3A3E A;  4OLG A;  1TVF A;  1IYS A;  1W7F A;  2RL3 A;  4X68 A;  1FCN A;  1NJ4 A;  1CI8 A;  3GV9 A;  5A90 A;  5FDH A;  2HDR A;  3TSG A;  2ZQA A;  5F83 A;  4E3K A;  5EVI D;  5HFO A;  5FQM A;  3UNW A;  1KGG A;  4ZJ3 A;  3C7V A;  3NI9 A;  4WYY A;  5CGW A;  1L0G A;  5BOH A;  1NZO A;  1HZO A;  2EXB A;  4O7D A;  4R1G A;  4S2I A;  1XKZ A;  3BEC A;  2GDN A;  2OLV A;  4CPK A;  4IVI A;  4X69 A;  5CGS A;  1L2S A;  4B88 A;  1W79 A;  4OQG A;  2Y2L A;  4JF6 A;  3DWZ A;  3HUO A;  4R3B A;  4JXG A;  1BTL A;  1ESU A;  3Q7V B;  3MKE A;  5FI7 A;  1SDE A;  4EQI A;  3G4P A;  3EQV A;  2WKE A;  2P9V A;  4QY6 A;  5FAT A;  2V1Z A;  3O87 A;  4JKT A;  2P9V B;  5FI2 A;  4JXV A;  1ZC2 A;  3IH8 A;  3UPO A;  1LI0 A;  5FA7 A;  1W8Y A;  4DDY A;  3ZDJ A;  1EI5 A;  1NRF A;  4RX3 A;  4R0Q A;  3G31 A;  3N8R A;  3ZVW A;  1BLS A;  2Y55 A;  3VSL A;  1IYP A;  3UE1 A;  4R4S A;  1ERQ A;  1K56 A;  2J7V A;  1ES5 A;  4MEZ A;  1K54 A;  1LI9 A;  1LLB A;  1MWU A;  3O3V A;  4FH4 A;  3VOZ A;  2G2U A;  3IHA A;  1YMS A;  3HUN A;  1ONH A;  5HX9 A;  1ES3 A;  3NIA A;  4LEN A;  1L0E A;  5L2F A;  3G34 A;  4FSF A;  3VFF A;  1YMX A;  1KDW A;  1CI9 A;  3P09 A;  4H8R A;  3WS5 A;  3C4P A;  3A3F A;  3Q1F A;  4S2O A;  1E3U D;  2BG1 A;  2ZJ9 A;  2HDQ A;  2WGV A;  4YIN A;  1FCO A;  1BSG A;  4RA7 A;  3S22 A;  2Y2P A;  5AQB A;  1FCM A;  3UE0 A;  1BT5 A;  2V20 A;  4IBR A;  2XFT A;  4GB7 A;  1N9B A;  4KZ5 A;  1XPB A;  1PW1 A;  2FFF B;  3Q7V A;  5GLD A;  4BEN A;  1YT4 A;  3FZC A;  3M2K A;  2Z2M B;  2ZD8 A;  1BUE A;  3Q07 A;  5JYO A;  1K56 D;  3HLW A;  4Y7P A;  3GR2 A;  3VP2 A;  1SDN A;  3PAE A;  5DTK A;  2QZ6 A;  4PPR A;  4KZ9 A;  4JLF A;  5E2E A;  4K91 A;  3PBN A;  3ZFZ A;  4PM6 A;  4OP5 A;  1FSY A;  1HVB A;  4LCL A;  1BLP A;  1PWD A;  2H10 A;  2OSU A;  3NBL A;  5CTM A;  2EX9 A;  3TG9 A;  2B5R A;  3UDF A;  2JE5 A;  4S2N C;  1G68 A;  3Q7Z A;  1KE3 A;  3HLD A;  4R23 A;  4Z9Q A;  3OPP A;  1DJB A;  3ISG A;  3HUM A;  4C75 A;  3G32 A;  1ERO A;  1OME A;  2PU4 A;  4GOG A;  1JVJ A;  2WGI A;  1JWV A;  4P6B A;  2Q9N A;  3CMZ A;  4BJP A;  4WM9 A;  1S6R A;  1GCE A;  1XX2 A;  3FKV A;  1JWP A;  3HLB A;  2PBY A;  2WAF A;  2X71 A;  3NDG A;  4KG2 A;  5E43 A;  1MWS A;  4HEF A;  3PBO A;  3PBR A;  4OKP A;  1MBL A;  4N1H A;  5HAI A;  5FAS A;  3UO9 A;  3FV7 A;  3IXG A;  1ALQ A;  2EXA A;  4BD1 A;  1WE4 A;  1K57 C;  2HP6 A;  1TEM A;  3W4P A;  2ZQ7 A;  2WAE A;  1PIO A;  1IYQ A;  5CXW A;  3IF6 B;  3ZNT A;  5EPH A;  4DRT A;  1GHM A;  2ZM2 A;  1YLT A;  4GD8 A;  3IHB A;  1E4D A;  3GVB A;  3IXH A;  5CEC A;  3BFF A;  1LHY A;  3M6H A;  2H0Y A;  5M19 A;  1RP5 A;  1BLC A;  2RCX A;  4ZBE A;  5TGF A;  4WZ5 A;  4OLD A;  4WBG A;  1QMF A;  2HPB A;  4JXS A;  1GA9 A;  5FQ9 A;  5EOE A;  3NY4 A;  4DXC A;  2A49 A;  2Y59 A;  4Y0O A;  3LEZ A;  5DF8 A;  4B4Z A;  3GMW A;  2BLS A;  1K4F A;  2XFS A;  5M18 A;  1Z6F A;  4LV3 A;  4DE0 A;  1ZG6 A;  3VMA A;  1MKI A;  3GSG A;  4WEK A;  5D3O A;  3ZG0 A;  1CEG A;  3PBS A;  1YLP A;  1PYY A;  2XH9 A;  1XA1 A;  1G6A A;  3BEB A;  1FSW A;  3PAG A;  3Q82 A;  4PMA A;  2H5S A;  4NK3 A;  4WZ5 C;  1ES4 A;  3M6B A;  1IEL A;  1S0W A;  4L0L A;  5DVA A;  2WUQ A;  3ITA A;  3ZCZ A;  3ZG9 B;  1ZG4 A;  1JTD A;  2HP9 A;  1E25 A;  3HLG A;  2EFU A;  4OQI A;  3V39 A;  2XLN A;  4P87 A;  1KVL A;  4OPY A;  4K0X A;  4LV1 A;  2HDS A;  4OPZ A;  3RJU A;  3UPN A;  4IBX A;  2WAD A;  3OPR A;  2Y2K A;  4NET A;  5KSH A;  4OP8 A;  4WEL A;  4BD0 A;  4JPM A;  4PM9 A;  4KZ4 A;  3C5A A;  3HRE A;  4XUZ A;  1W8Q A;  2FFY A;  5HW3 A;  1CEF A;  3EQU A;  3HLF A;  3P98 A;  3FKW A;  1M6K A;  2X02 A;  4EWF A;  3BFE A;  5DTS A;  5DF9 A;  4IVK A;  4C3Q A;  3G30 A;  1ERM A;  4ZAM A;  1YLJ A;  4DDS A;  4GDN A;  4MBH A;  4DE2 A;  2C6W B;  2DRW A;  5CHJ A;  3SH7 A;  2XEP A;  5M1A A;  3SH9 A;  4E3M A;  1ONG A;  3IF5 A;  3BFG A;  3MFD A;  4FD8 A;  1E3U A;  1JWZ A;  2P74 A;  1DY6 A;  3GRJ A;  5HAR A;  4X56 A;  3OPH A;  5G18 A;  2J9O A;  2R9W A;  4KQQ A;  2A3U A;  3WS0 A;  4XUX A;  2Y2M A;  4IED A;  2Y2N A;  4Y0U A;  4OQH A;  2Y4A A;  2JC7 A;  4KG6 A;  4UA6 A;  4ZJ1 A;  3A3I A;  3PBQ A;  2IWC A;  1J9M A;  5FQJ A;  3VP3 A;  1MY8 A;  3QNB A;  1IYO A;  3WRT A;  3N8L A;  2XD1 A;  1K38 A;  3DW0 A;  3SOI A;  2ZC3 B;  3V3S A;  4KG5 A;  1HTZ A;  3UN7 A;  5CHU A;  5GHZ A;  2Y91 A;  4X6T A;  3RXX A;  4E6X A;  2JBF A;  1Q2P A;  1IEM A;  1WYC A;  4ZJ2 A;  1VQQ A;  1XXM A;  3ZG5 A;  5HAQ A;  5KSC A;  4U3T A;  5FQI A;  1GHP A;  5EVI B;  5CTN A;  5FSR A;  4BL2 A;  3OCL A;  3DWK A;  4EV4 A;  1AXB A;  1JTG A;  3ZHH A;  3UDI A;  2QMI A;  4C6Y A;  5AQ7 A;  3VP4 A;  1C3B A;  2I72 A;  3OC2 A;  1IKG A;  5TR7 A;  3RXW A;  3MZE A;  1PI5 A;  2J8Y A;  4EBN A;  3HL9 A;  1K54 C;  4OPR A;  4UA7 A;  5FI6 A;  3LCE A;  1N4O A;  1MPL A;  2DNS A;  3MBZ A;  1PZO A;  4M3K A;  3PTE A;  5JYP A;  1CK3 A;  3IWI A;  2WYX A;  2HDU A;  3WS1 A;  1WYB A;  3G2Y A;  1YQS A;  1NYM A;  2Y2O A;  5HL1 A;  2ZLY A;  2R9X A;  2E8I A;  4WEJ A;  2HP5 A;  4P0M A;  1YLZ A;  4RYE A;  4QHC A;  2Y2Q A;  3V3R A;  5AQA A;  3ZG7 B;  4R4R A;  4S2M A;  5F1F A;  5F82 A;  1NZU A;  3HVF A;  1L0D A;  3SS5 A;  3SS3 A;  3I7J A;  2UWX A;  3ZNY A;  2Y2J A;  1SHV A;  2V2F F;  1QME A;  3NDE A;  1MWR A;  4RVA A;  1XGI A;  3E2K A;  1K57 A;  1H5X A;  5EUA A;  3VP0 A;  5EVI A;  1FOF A;  2DCF A;  3DTM A;  4S2L A;  5DF7 A;  4U0T A;  4E3O A;  1GA0 A;  4QJG A;  2ZC5 B;  5CGX A;  1SKF A;  5FAQ A;  3QHY A;  1NY0 A;  1RGZ A;  2WKI A;  5HAP A;  5EEC A;  4N9K A;  4GN2 A;  3MZD A;  1K25 A;  2ZC4 B;  1K55 C;  5E2H A;  1XA7 A;  1K4E A;  4WMC A;  3IWQ A;  1O07 A;  1XGJ A;  2XQZ A;  5GLA A;  1PW8 A;  5E2F A;  4E6W A;  4S2K A;  5F1G A;  2OV5 A;  2WGW B;  1BLH A;  4UA9 A;  4OH0 A;  2WKH A;  4S2N A;  4E3N A;  3MXS A;  3MZF A;  4OOL A;  1VM1 A;  3E2L A;  4X53 A;  2ZQD A;  2XDM A;  2WK0 A;  4KQO A;  5GL9 A;  5GLB A;  4RX2 A;  4PM7 A;  4MNR A;  1BZA A;  2VGJ A;  5GHX A;  2QPN A;  5CEB A;  4QU3 A;  1K6S A;  5J8X A;  4EBP A;  3MKF A;  3BFC A;  5KZH A;  4Y0T A;  3IT9 A;  5FAP A;  3UPP A;  2ZQ9 A;  5CER A;  4MBF A;  5EVI C;  3WS2 A;  3BLM A;  4KQR A;  1PI4 A;  4YFM A;  1KVM A;  2XR0 A;  3BFD A;  1PWG A;  3NC8 A;  3VSK A;  4BLM A;  2PU2 A;  3G2Z A;  3Q81 A;  2CC1 A;  4FH2 A;  3BRM A;  1W5D A;  3IXD A;  4U0X A;  2Q9M A;  3WS4 A;  1H8Y A;  4LV2 A;  1KDS A;  4KZ3 A;  4GZB A;  4B4X A;  2ZC6 B;  3IXB A;  3QNC A;  2ZC7 A;  4ID4 A;  3CG5 A;  4BQM A;  5AQ9 A;  3MXR A;  5TFQ A;  1DJC A;  1KE4 A;  4GNU A;  3IWO A;  3PBT A;  1FR1 A;  3C4O A;  1ZKJ A;  4KEN B;  4KZ6 A;  5FAO A;  2XF3 A;  3IH9 A;  4FCF A;  3V50 A;  1IKI A;  1NYY A;  4PM5 A;  3SS4 A;  3VP1 A;  1TDG A;  4JBF A;  3W8K A;  1RGY A;  3LY3 A;  2J9P A;  1I2S A;  1O7E A;  2Y2I A;  4HBT A;  5CED A;  3M2J A;  4PM8 A;  3FYZ A;  4KZ8 A;  3N7W A;  4MLL A;  3IF6 A;  5FQK A;  3N4I A;  4GKU A;  4JF4 A;  4QD4 A;  4GDB A;  4KZA A;  3W4O A;  1LL9 A;  4CJN A;  4DKI A;  2C5W B;  4GD6 A;  3N6I A;  3OCN A;  4LV0 A;  1FR6 A;  3LO7 A;  4R3J A;  4JXW A;  1H8Z A;  3VOY A;  2EX2 A;  4OOY A;  5EVL A;  5A93 A;  1NXY A;  1TDL A;  1KE0 A;  4X55 A;  1LL5 A;  1YM1 A;  1MWT A;  3NCK A;  1FQG A;  4S2J A;  4XXR A;  4D2O A;  2Z2L B;  3IF6 C;  1U60 A;  5I94 A;  2VGK A;  4MBK A;  5DTT A;  2WGW A;  5IHV A;  4OVD A;  5E2G A;  5GHY A;  2Y2H A;  4N92 A;  1PZP A;  4OOM A;  4A5R A;  2X01 A;  3HLC A;  4BL3 A;  1EWZ A;  3UY6 A;  5U47 A;  3CJM A;  1YLW A;  4ZTK A;  3D4F A;  2ZQC A;  4UHU A;  2IWD A;  3O88 A;  5FQQ A;  5A91 A;  3FWL A;  4DF6 A;  3GQZ A;  3S1Y A;  3ZG8 B;  4ZDX A;  3GTC A;  3ITB A;  3UE3 A;  1YLY A;  3AGD A;  1RCJ A;  3C7U A;  5EOO A;  3G35 A;  4JF5 A;  4S2P A;  4F94 A;  2WZZ A;  4DE3 A;  3VFH A;  2ZQ8 A;  2Y2G A;  1I5Q A;  5KMW A;  2EFX A;  1ES2 A;  1K55 A;  3N8S A;  4WZ4 A;  1PWC A;  5CHM A;  4E3I A;  4N9L A;  3BM6 A;  1GHI A;  4QB8 A;  2G2W A;  2XK1 A;  4KZ7 A;  3HBR A;  4HES A;  3JYI A;  3W4Q A;  4E3J A;  1I2W A;  3LY4 A;  4DXB A;  4EUZ A;  2IWB A;  1KGE A;  4OPQ A;  4E3L A;  3B3X A;  5GLC A;  3OPL A;  3V5M A;  1DJA A;  3SH8 A;  3CZD A;  5A92 A;  1L0F A;  3BYD A;  1BUL A;  4KZB A;  3AGF A;  1M40 A;  4DE1 A;  1SCW A;  3UDX A;  1KGF A;  4Q8I A;  1HD8 A;  1MXO A;  1Q2Q A;  4N1X A;  1XP4 A;  2JCH A;  3OZH A;  3ZVT A;  3HLE A;  4HBU A;  1K6R A;  3AGE A;  2ZMA A;  2ZM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...