1LSVA

Crystal structure of the co-bound bjfixl heme domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
117
structure length
117
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQELQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Sensor protein FixL
publication title Structure-based mechanism of O2 sensing and ligand discrimination by the FixL heme domain of Bradyrhizobium japonicum
pubmed doi rcsb
source organism Bradyrhizobium japonicum
total genus 31
structure length 117
sequence length 117
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2002-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1lsvA00
3GDIA 4EQ1A 5TBMA 2Z6DA 3VE3A 2I9VA 5A8BA 3H7WB 4WLAA 4LRXC 1GSVA 4F3LB 2PR5A 3P7NA 4HI4A 4LPZA 3PYPA 2BASA 2PDRA 3MQOA 4F3LA 3UMDA 4MN5A 3E4QA 4KUOA 4PKYG 5IU1A 5I5LA 4KQDA 2PHYA 2OWJA 1OTIA 3MFXA 4MN6A 5F5YA 3UB6A 1UGUA 3UB9A 3UB7A 3IS2B 1X0OA 1LSWA 2HV1A 2V0UA 3ULFA 3FC7A 5HDSA 3IS2A 1T1AA 1VB6A 2INWA 2KDKA 3D72A 3CWFA 2P7JA 1KOUA 4LLOB 3A0RA 4LRZE 5G4ZA 5HZHA 2VV7A 2J80A 2ZOHA 4EESA 4R38A 2W27A 5HWVA 2V1AA 2KX6A 1D06A 3UMEA 3BY9A 1WA9A 4R6LA 3EEHA 1OTBA 2WKRA 2QHKA 4H6JB 4I5SA 1OTDA 3PHYA 4H6JA 5J4EA 4LRYC 3SW1A 1XJ2A 1S1ZA 5DJUA 5J7EA 4I3IA 1TS7A 4GHIB 2WKPA 1NWZA 1G28A 2VLGA 3LIBA 3T50A 1DP8A 3LIDA 2PR6A 4GHIA 1T18A 5EFWA 2V0WA 1S67L 4HJ6A 4YWZA 3IBRA 3VE4A 1DP6A 3NJAA 1F9IA 3H7WA 3F1OB 2V1BA 1XFNA 2QJ5A 3C8CA 3LIFA 4HY8A 3H82B 1Y28A 3F1OA 1BYWA 3NOTC 2JN7A 1S66L 2YKFA 4RQ9A 3MQQA 4K08A 3GECA 3HJKA 3MR0A 1MZUA 1S4SA 3CAXA 2H28A 1JNUA 4GCZA 1XJ6A 5HD3A 1GSWA 4HJ4A 2VV8A 2QWSA 4I3JA 2CMNA 3LIEA 1LL8A 1S1YA 5DKKA 1OTAA 4HH3A 4B9OA 4GW9A 3FG8A 1UWPX 1TS0A 1GSXA 1XJ4A 1T1BA 5AVFA 3ICYA 5DKLA 2L4RA 2R78A 4HP9A 5IS1A 4HHDA 1TS6A 4HJ3A 3B33A 3LUQA 3NHQA 4I38A 3E4PA 2B02A 4JGPA 5HWTA 3F1NB 3HJIA 1EW0A 1OJ5A 1DRMA 3UE6A 4DJ2A 4E04A 4HOIA 4NXEA 3F1NA 1LSVA 1V9ZA 4BBVA 3MXQA 1N9LA 2M1CA 2Z6CA 4HQAA 2VV6A 2OWHA 3BY8A 1OTEA 5G4YA 5HDCA 2PYRA 4GS9B 2A24B 2D01A 2JHEA 5HWWA 4EEUA 5AVEA 3LIAA 1UWNX 4EETB 4GS9A 1N9NA 2A24A 3F1PB 4HNBA 4EXOA 4JGQA 4I39A 4M4XA 2WKQA 5F6AA 2W0NA 4WUJA 3F1PA 5F68A 1OT9A 4HIAA 1V9YA 1F98A 4BBUA 4KUKA 2QJ7A 4EW7A 1N9OA 3H82A 1T19A 3VOLA 4L9GA 5DJTA 3LI8A 5F69A 1OJGA 2YKHA 4NXFA 3EWKA 3KX0X 1S4RA 3UB8A 5J3WA 2V9AA 4DJ3A 3RTYA 4JGOA 2GJ3A 1OT6A 4L9FA 4NXGA 3LICA 1XFQA 1XJ3A 3NOPC 2PD8A 2D02A 1TS8A 3MJQA 5HSQA 2ZOIA 4WF0A 3C2WA 3LYXA 4EERA 2PYPA 4XT2B 3LI9A 4I3AA 4HH2A 3E4OA 4HP4A 3NOUC 4WN5A 3OLOA 1ODVA 2L0WA 4PKYA 1T1CA 4L9EA 3G6OA 4JGRA 4XT2A 2QKPA 1DP9A 1P97A 4EEPA 1LT0A 3CLOA 2K7SA 2PD7A 3RH8B 5HDDA 2L1MA 3H9WA 3A0SA 1LSXA 2ZBBA 4R3AA 3K3DA 3A0VA 4BBTA 2EA9A 5HD5A 4R70A 3K3CA 2VEAA 1D7EA 5TBMB 3ZQ5A 1P0ZA 3BWLA 5KIZA 2OOLA 4WL9A 4NXBA
chains in the Genus database with same CATH superfamily
1LHYA 2PU4A 3BQAA 3WS0A 2Z6DA 3G2YA 3VE3A 5KSCA 2WUQA 1YLYA 1PZOA 2RL3A 4K0XA 4LRXC 2P04A 3OPRA 2PR5A 1FR6A 4S2PA 3T12B 4BL2A 1FQGA 1IYPA 2M7VA 4JXWA 3S7PA 1C3BA 4Y5FA 2XFTA 3MQOA 4F3LA 4E6XA 4RVAA 5C5KA 3LR3A 2Y2KA 3MFXA 4UA7A 5F5YA 1EI5A 4JF6A 1YLWA 3S7OA 3WRTA 1MY8A 4O8GA 3TOIA 5HDSA 1T1AA 5L07A 3G34A 2KDKA 3C7UA 5CHUA 3D72A 3CWFA 5EE8A 3NC8A 1KOUA 3VSKA 4LLOB 4EUZA 4OQHA 1SDNA 1VM1A 1Z09A 2XFSA 1P9WA 5DF7A 2J80A 4NKPA 1ZG4A 2EX8A 1L0EA 2X02A 3AGEA 1IYSA 2B95A 3T4LA 1Q2PA 2V2FF 1FOFA 1XA7A 1FCNA 1D1JA 2QHKA 4H6JB 2DRWA 4UQIS 4WZ5C 3D3OA 4I5SA 5GLBA 1IKGA 1OTDA 3PHYA 3S22A 1K57A 3ZG7B 2WGIA 1EROA 3OPLA 1S1ZA 5DJUA 2Y2QA 2VGLM 4CQHA 3IX4A 1MPLA 4S2NC 3I7JA 2O99A 2VLGA 2FFYA 5DF9A 2XRNA 4LFUA 2Z2LB 2NUTC 3BRMA 4GHIA 5L8MA 1T18A 3W2ZA 2QPNA 3E2KA 1ZG6A 3KO6A 2VKSA 4E6WA 2V0WA 2PRFA 3PBTA 5GL9A 2WGVA 3ZDJA 4UA6A 1XFNA 4UQIM 1PWCA 4UHUA 3BJNA 1K56A 3LY4A 3F1OA 3MKFA 1ONGA 4DDSA 1S66L 4KZBA 4KG2A 2WAEA 3M6HA 4K08A 5I94A 2WGWB 1FSWA 3ZGAB 4NG2A 3UE3A 1MZUA 3NCKA 4N1XA 1G5UA 3P98A 1CQAA 2I72A 3VP4A 1K4EA 4GZBA 4DMZA 1DY6A 1FCOA 3BEBA 3VMAA 2CMNA 2Y79A 3EGXC 3B42A 3QNCA 2EX6A 1WYCA 4OKPA 1UWPX 2WKHA 4GDNA 2WKIA 4PM9A 1GSXA 3IQAA 2XD5A 4B4XA 4PMAA 3ZCZA 2R78A 4HESA 4OQIA 4E3KA 3IBJA 3T1SA 3TSGA 2G7UA 2EXAA 3QP5A 3B33A 1H5XA 2B02A 2BTFP 5HWTA 2Q9MA 1EW0A 2XF3A 5HW3A 4DJ2A 3O87A 4IBRA 5HAIA 3BFGA 3G4PA 3F1NA 3OCLA 4U0XA 3IHAA 2J8YA 2JKFA 2HDUA 1N9LA 3CUEC 4G3WA 1J9MA 2Y2NA 4WM9A 2ACGA 4BENA 3LR4A 1U60A 5G4YA 4BD1A 4DXBA 3VV4A 4EU0A 4X25A 4EETB 1YM1A 1FSYA 2W1TA 2A24A 4EXOA 4KZ9A 3SZTA 3DWKA 3ZG8B 2ZQDA 3V3RA 2WKQA 2W0NA 1YMSA 5DF8A 4E3JA 2EFXA 4M3KA 1F98A 3FV7A 3UY6A 3T4SA 3UPOA 5FDHA 3WRZA 4DDYA 4ID4A 1SKFA 4Y7PA 3BFFA 1ONHA 1OMEA 3HUNA 3MMHA 4NXFA 3EWKA 2J3TC 3C30A 4JF5A 4JF4A 1S4RA 3GMWA 4S2NA 4BWIA 4N1HA 1OT6A 3N7WA 5HL6A 5IHVA 1PW8A 4L9FA 1IEMA 3ZHHA 1GA0A 1XJ3A 2VGKA 3TE8A 1BT5A 5EVIA 2PD8A 2D02A 3P01A 5FQQA 4Y15A 4UAAA 4K0WA 2Y2HA 4P87A 5F1FA 3C4PA 2HZ5A 1JTGA 3E4OA 4X55A 3EQUA 3M6BA 1TVFA 3NOUC 4WN5A 3MZFA 2H0YA 2XK1A 3C7VA 3G6OA 3KSIA 4BD0A 2XA7M 1E4DA 4OLGA 2Y55A 2E8JA 5CGWA 1IELA 4DE2A 4IVKA 4Q0HA 3PAEA 5CHJA 5CRFA 1AWIA 3W4QA 1HLUP 4BMWA 1L0GA 5KSHA 2K7SA 3PBRA 2L1MA 1XGJA 2KLIA 3G35A 3A0VA 4ARZB 3DTKA 1JWPA 2VEAA 3N8RA 2JE5A 1P0ZA 4CJNA 1SCWA 4Y2FA 3W4PA 4WL9A 3GDIA 5K5BA 4EQ1A 3QNBA 5TBMA 1XX2A 2H5SA 5A90A 2I9VA 5L09A 2GNXA 5FL3A 4F3LB 5L10A 3P7NA 1K54A 4BJPA 1EWZA 3PYPA 4GN2A 2W3EA 2JC7A 3EGDC 4P6BA 4EWFA 1OPXA 2V8FA 4KG5A 4KUOA 2QYBA 3ITBA 1CEGA 3IH8A 2PHYA 2OWJA 5EPHA 1OTIA 3CUEA 1GCEA 4WMCD 4KENB 3WS2A 2Z2MB 1UGUA 3M2JA 1X0OA 1LSWA 2HV1A 1CJFA 2P08A 4OOLA 2W3FA 1ACFA 3HUOA 3IS2A 3QHYA 4CLCC 1SKOA 4U3TA 1I5QA 2HGVA 5JYPA 2HP6A 2MJ6A 2XGNA 5DTSA 4YINA 5G4ZA 5HARA 5HZHA 3DWZA 4MNRA 2J7VA 4IHQA 2XR0A 2ZOHA 4GDBA 4QHCA 1YKDA 2ZC3B 4EESA 2W27A 5FQJA 5FSRA 2V1AA 3UB5P 2LB9A 4GJ4A 3RXXA 2KX6A 4A5RA 1XA1A 4CLCE 2EFUA 4R6LA 2IWCA 3EEHA 2WKRA 2ZQAA 4NEED 2ZM0A 3O3VA 4JKTA 3V5MA 2PBDP 5FQKA 5CGSA 1G6OA 3UNWA 3NI9A 5IT5A 1KVMA 5DFXA 2ZQ7A 3SW1A 1XJ2A 3UPNA 3IF5A 3MS6A 4S2KA 3S4XA 3T1XA 2BLSA 3UDFA 4GHIB 4R4RA 2WKPA 4AFIA 1NWZA 4E3OA 5EVLA 1DP8A 1F2KA 4HBTA 2PR6A 4RX2A 1GHIA 1YSQA 5E2GA 1DJCA 3PBNA 4BL3A 3IXBA 4XUZA 1S67L 5GHYA 4YWZA 1VETA 4DXCA 3OCNA 3WWXA 1FIKA 3T4TA 3NJAA 1F9IA 2ZQ9A 3F1OB 1L3LA 3DAVA 5M1AA 4E3IA 1WE4A 3LIFA 2WAFA 4HBUA 3FPVA 4ZJ3A 4PPRA 1E3UA 1NLYA 3V50A 4L0LA 3CPTA 1P9RA 3NOTC 2JN7A 3T4OA 2YKFA 5G18A 3HLDA 5AQ9A 3MBZA 2H28A 1JNUA 4GCZA 3SOIA 4ME4A 4ZAMA 1I2WA 1PZPA 4WZ4A 1GSWA 5EECA 2WYXA 4R3BA 4B4ZA 3ZNYA 1IFQA 3R7WA 3NDGA 3FYZA 2JCHA 4I3JA 1KDWA 1OTAA 1BUEA 1DJAA 1H8ZA 2EXBA 4R3JA 3SS3A 4B88A 4Q0JA 2UV0E 2WADA 1XJ4A 5DKLA 3GQZA 4CLCD 1ZKJA 4O7DA 5KZHA 4S2JA 2Y8HA 2K31A 3C4OA 3LFVA 5HAQA 4EV4A 4U0TA 2Y2OA 4GNUA 4JGPA 1NRJA 3F1NB 4C75A 2AVXA 1DRMA 3QP6A 5DVAA 1I2SA 1H0MA 5FQ9A 3IX3A 3DBAA 3S7NA 3T1QB 1LSVA 1V9ZA 1L0DA 5EV0A 1HZOA 5LBRA 3C38A 4MEZA 1G68A 2M1CA 2ZLYA 2OWHA 1Y54A 1XGIA 3IXDA 2EX2A 2W1TB 3A3DA 2A24B 2D01A 5HWWA 4EEUA 2Y2GA 5AVEA 3LIAA 5CX7A 2VJWA 1ESIA 1N9NA 2KOIA 3RXWA 1KE3A 4FD8A 2HDSA 2G2UA 4MCWA 5F83A 2J9PA 4Z9QA 1YQSA 3UE1A 2JKRI 2PT7A 2ZQCA 5HAPA 4OPYA 2HDRA 4WUJA 3F1PA 5F68A 4X1LA 4WYYA 4HIAA 1H8MA 1V9YA 1BSGA 4BBUA 4KUKA 2QJ7A 4MLLA 3E98A 3VOZA 1BULA 2K2NA 2ZC5B 2ZQ8A 4QPRA 3BECA 5FI2A 5F69A 1Y4OA 1NYMA 2YKHA 3UB8A 1M6KA 1VEUA 3V3SA 3UO9A 2Y2PA 3HL9A 1TDLA 1G6AA 5EVIB 4XUXA 3MKEA 4NXGA 1MC0A 3SS4A 2XD1A 5AQBA 4OP5A 3MJQA 1H3QA 4PHTA 3C2WA 3OOVA 1NZUA 3LYXA 3GV9A 4EERA 3DTEA 5J8XA 4HH2A 1ODVA 2L0WA 4NETA 1ERQA 2QZ6A 4GB7A 3MQ0A 3OPHA 1MXOA 4LGWA 1JVJA 5GHXA 1RP5A 2ZM2A 2B5RA 3G30A 1Q2QA 2E8IA 3UN7A 4EEPA 1LT0A 3CLOA 3RH8B 2R9XA 5HDDA 5FA7A 4WELA 4ZBEA 4QJGA 3N6IA 2HJ9C 5HPFA 3H9WA 1KGEA 4ETXA 5HL1A 4R3AA 4LV1A 5FEFA 1YLPA 5HD5A 1AXBA 4S2IA 4BQMA 1BZAA 1YT4A 4FH4A 5CEDA 1ES2A 1NYYA 1RCJA 3HLBA 4D2OA 1D7EA 5TBMB 3ZQ5A 3UPPA 2PU2A 5KIZA 1STZA 2OOLA 3N8LA 2JKTI 4NXBA 4S2OA 4H8RA 1RGYA 2ZJ9A 4WLAA 4WZ5A 1GSVA 4JXVA 1CEFA 3PBSA 1GA9A 1N9BA 4KZ5A 4XXRA 2PDRA 2VA0A 2XQZA 1PWGA 1O7EA 4MN5A 3PTEA 4DE0A 5IU1A 2HF6A 3T4QA 4K91A 5GLDA 3VP1A 3HBRA 1PWDA 2Y2MA 2J3WA 3LEZA 4ZTKA 1IYOA 1W8QA 3CJMA 3JPUA 1PFLA 3IS2B 2XDMA 1SKOB 4BLMA 4RA7A 2V0UA 1VHMA 3SS5A 2GDNA 4IBXA 4GOGA 3ULFA 2CC1A 1KE0A 2A49A 2A3UA 1VQQA 2Y2IA 5GLCA 3IT9A 1VB6A 2DNSA 2INWA 1YLJA 4QY6A 5BOHA 1PI4A 3ZFZA 4N92A 5EUAA 3A0RA 5FATA 4QD4A 5DFYA 2GZAA 2ZMFA 2QMIA 4GD6A 3OBFA 3PBQA 4R0QA 2ZC6B 1LL5A 1JWVA 5HWVA 4R4SA 1K6SA 4KZ8A 1D06A 3UMEA 3V67A 3BY9A 2P9VA 1WA9A 1H8YA 1OTBA 3QP2A 2X71A 1XKZA 2V20A 3E2LA 2FZ0A 3VSLA 4O01A 2W3HA 1YAXA 5FAQA 3JVUA 5J4EA 5A92A 3PAGA 3ZG0A 4GLQA 3HREA 5J7EA 4IVIA 1YPRA 1TS7A 2WKEA 3IF6C 1FR1A 2HPBA 3PXPA 1G28A 4JPMA 5JYOA 2Y2JA 3A3EA 4C3QA 4JXGA 3BLSA 3T50A 3U2AA 3LIDA 4EBLA 5DTKA 1VETB 5EFWA 5M19A 4YFMA 1PIOA 4PM8A 3T1RA 3Q7VA 1DP6A 5CEBA 1PYYA 3CPTB 1XPBA 2V1BA 2ZM8A 4LENA 2X01A 4MBFA 3JYIA 2QJ5A 3C8CA 1BLSA 1PRQA 5FAOA 1Y28A 1BYWA 2J9OA 5FQMA 1K55C 4GKUA 1L0FA 3B3XA 4E3NA 3GECA 3MR0A 1S4SA 2WK0A 3MZDA 3OC2A 2WZZA 4X56A 3VFHA 3R7WB 4KZ3A 3VOYA 3N8SA 2XEPA 1J3WA 3D9YA 3SH7A 4HJ4A 2Q0OA 3LEQA 1LI0A 2VV8A 2QWSA 4G3KA 4OPRA 1ES3A 5EVEA 5AQAA 1K57C 2FFFB 3LIEA 1LL8A 3MXSA 1S1YA 4KZAA 2EWVA 5DKKA 4E3LA 4OH0A 4Y3IA 4HH3A 1FCMA 3EOIA 4QU3A 4KQOA 5DTTA 1DJBA 4GW9A 1K4FA 4WMCA 3ZYTA 1GHPA 3FG8A 3KYZA 4EQIA 1W79A 2VK3A 5AVFA 3ICYA 3WS5A 4HP9A 5U47A 5IS1A 4ZJ2A 5F1GA 1QMFA 3IWIA 1TS6A 1TF1A 3OZHA 4HJ3A 4I38A 3HJIA 1YLTA 2C6WB 4E04A 4F94A 3EQVA 4HOIA 5M18A 3TRCA 4BBVA 1ES5A 4FCFA 3WS4A 3HLEA 3LR0A 1HVBA 4P85A 4RYEA 4HQAA 3MSHA 5EOOA 4JXSA 4QY5A 3BY8A 4OOMA 4FUWA 2NUPC 2O0YA 2PYRA 4R23A 4ZDXA 2VZWA 4RX3A 4ETZA 2IWDA 2JHEA 4DE1A 4OQGA 4II7A 1UWNX 5FDSA 4GS9A 4X53A 3F1PB 4KQRA 3A3IA 1YMXA 4M4XA 5F6AA 4R1GA 3GRJA 1LL9A 3KSHA 1OT9A 2C5WB 2IA2A 3M2KA 3FKVA 4EBPA 4D60A 4EW7A 4OOYA 4FSFA 1N9OA 5A91A 4L9GA 2Y4AA 3G32A 1VEUB 3BFEA 1OJGA 4MBKA 2Y2LA 4O0PA 3TG9A 3LY3A 4UEYA 3KX0X 3IF6A 4JBFA 4Y0UA 4DF6A 2V9AA 3HLCA 3Q82A 3IH9A 4OVDA 4PM7A 3FWLA 2JKGA 3BLMA 3CHWP 4JGOA 2GJ3A 1IOUA 5EOEA 3W4OA 5AJGA 5MC7A 1XFQA 1ALQA 3LR5A 3IXGA 3ITAA 1PW1A 2VX8A 4X1MA 2ZL1A 2VGLS 4YOFA 1BLCA 2O9CA 5HSQA 4WF0A 4FH2A 4Y0TA 3KYEA 5CGXA 4N9KA 2PYPA 2BG1A 4I3AA 4HP4A 3MXRA 3O5YA 4PKYA 4YNRA 4L9EA 4NK3A 2M7UA 2W3DA 4JGRA 4XT2A 5HPIA 3OPPA 1K55A 1ERMA 2QKPA 1P97A 4Y0OA 3LCEA 1CF0A 1K0KA 1MWRA 4CLCA 5E2FA 3SH8A 5GLAA 2PD7A 3CI6A 3QP8A 4OP8A 1LSXA 1TEMA 3K3DA 4BBTA 2EA9A 2XLNA 1YLZA 4X68A 3O86A 1HTZA 5GHZA 4P6ZS 1K6RA 2Y59A 1TDGA 3FKWA 3K3CA 1K56D 1Z6FA 4IJGA 3LGOA 3BWLA 5TFQA 1W63Q 3CZDA 3VP2A 3A3FA 4Y13A 3NBLA 5A8BA 3H7WB 4DE3A 3MZEA 3JVVA 5EVIC 2FH5A 3MF0A 4HI4A 4LPZA 3ZG5A 3NULA 3VP3A 4Q0IA 4EBNA 3ZNTA 1W5DA 2BASA 4LV3A 1W7FA 3FPWA 3UMDA 3E4QA 4PKYG 3ZVTA 5I5LA 5TGFA 4KQDA 3IWQA 1MKMA 2V8CA 4Z1WA 1CK3A 2H0TA 4MN6A 3UB6A 3UB9A 1WYBA 3UB7A 3EEAA 2ZMAA 3G2ZA 3IX8A 4P6ZM 1W63M 5FI7A 3FC7A 2OAP1 3NIAA 3Q07A 1NJ4A 2P7JA 3HLFA 1K38A 3FZCA 4DN0A 3BW6A 5L2FA 4LV0A 5EM0A 4LRZE 1E25A 4QB8A 4S2MA 3HCYA 2JBFA 3AGFA 3KSFA 2IWBA 2XH9A 2VV7A 2P9VB 4R38A 1XP4A 1CI9A 4B93A 1NY0A 3UDIA 3NDEA 5CTMA 3D4FA 2DMWA 2W1RA 2ZD8A 2DCFA 2RCXA 1S0WA 1K54C 4JLFA 1PI5A 3Q1FA 4H6JA 3T4JA 1MWTA 2ZC4B 4LRYC 4PM6A 1ZHHB 1RGZA 2OLVA 4G3VA 1BLPA 2R9WA 3KYQA 4I3IA 4LV2A 4S2LA 3CG5A 3LIBA 4DKIA 2O9AA 5TR7A 3Q7VB 3HVFA 1QMEA 5CERA 2UWXA 1TD5A 4HJ6A 1SDEA 3HLGA 3IBRA 2HP9A 3VE4A 1MWSA 3H7WA 3ZVWA 2VGJA 3GTCA 3MFDA 3ZG9B 1ZTUA 4KZ7A 5FQIA 1KGGA 1IYQA 4HY8A 3H82B 3HLWA 2OSUA 3N4IA 4LCMA 4PAUA 3L9KA 1BTLA 4RQ9A 3MQQA 3QP4A 5EVID 1JWZA 3HJKA 1NLZA 2XA7S 1MWUA 3WS1A 3CAXA 4N9LA 3IHBA 4KG6A 1XJ6A 1KE4A 4WEJA 1L2SA 1SHVA 2WGWA 5HD3A 4KQQA 1SZVA 4WEKA 1A0KA 3CITA 5FASA 1JTDA 1MBLA 5AQ7A 3Q81A 1TS0A 3DTMA 2OLUA 5EM1A 4CPKA 1T1BA 2L4RA 3CMZA 1NZOA 4WBGA 5E2HA 3TW8A 2Q9NA 5F82A 3SH9A 3P09A 2JKRM 4HHDA 5TJJA 4PM5A 1IKIA 3G31A 5CTNA 3BFDA 3A3JA 2HP5A 3IXHA 3LUQA 3NHQA 3E4PA 1YSPA 4OLDA 4MDZA 4MMNA 5HX9A 2P74A 3GSGA 1OJ5A 3UE6A 3DTIA 3L7HA 4OPZA 1LI9A 3Q7ZA 4DRTA 1N4OA 3NY4A 4NXEA 3S1YA 2O9BA 1NXYA 3MXQA 2W3GA 2HDQA 1BLHA 3B47A 4GD8A 3RJUA 1XXMA 2Z6CA 4FOFA 2VV6A 2B18A 3E0YA 4ZRRA 1OTEA 4OQ0A 5HDCA 2LB5A 4Y17A 4GS9B 5D3OA 4IUHA 4UA9A 4C6YA 3GVBA 1KVLA 2OAQ1 4Q8IA 1K25A 1ESUA 5KMWA 4MBHA 1ZC2A 4HNBA 4JGQA 2GX5A 3K2NA 4I39A 4EUVA 4X6TA 3S7QA 1F5MA 1O07A 3TJZC 3UDXA 3AGDA 1W8YA 3H82A 3ISGA 3V39A 1T19A 4ESPA 3VOLA 4LCLA 3IF6B 3BYDA 3T4KA 5DJTA 3LI8A 5E43A 5FEGA 2PAVP 5CECA 2XROA 2HJEA 2EWWA 3RFBA 5J3WA 4OONA 4DJ3A 3C5AA 3RTYA 1ES4A 4X69A 4MN7A 5A93A 4E3MA 1M40A 5CHMA 5HFOA 2Y91A 2ZL1B 3HUMA 2G2WA 3LICA 4FTXA 3BFCA 3NOPC 4P0MA 5E2EA 3PR6A 3VP0A 1TS8A 4HEFA 1PNEA 1S6RA 2J3TD 2ZOIA 3PBOA 3KSGA 1LLBA 2EX9A 4XT2B 2OV5A 2JKTM 2V1ZA 3BQ8A 3LI9A 5FI6A 3O88A 2H10A 3IWOA 2XSSA 3OLOA 1HD8A 1T1CA 4IEDA 1KDSA 3QP1A 4IUKA 1GHMA 3R4KA 1DP9A 3DW0A 4CLCB 3VFFA 3NECA 3BM6A 1MKIA 2ZC7A 3LO7A 2A2LA 5FAPA 4KZ4A 3U4LP 4ZJ1A 2PBYA 1FILA 1CI8A 4KZ6A 1KGFA 3A0SA 2ZBBA 3W8KA 3UE0A 4R70A 4QWOA 5CXWA 2WZXA 2ZMVA 1E3UD 1NRFA 4OPQA 3GR2A 4ARZA 4B9OA
chains in the Genus database with same CATH topology
3GDIA 5K5BA 4EQ1A 3BQAA 5TBMA 2Z6DA 3VE3A 2I9VA 5A8BA 3H7WB 3JVVA 4WLAA 2GNXA 4LRXC 1GSVA 2FH5A 2P04A 3MF0A 5FL3A 4F3LB 3PBSA 2PR5A 3P7NA 4HI4A 4LPZA 4BJPA 4Q0IA 2M7VA 3PYPA 2W3EA 2BASA 3S7PA 4Y5FA 2PDRA 3EGDC 2VA0A 3MQOA 3FPWA 1OPXA 4F3LA 3UMDA 4MN5A 3E4QA 4KUOA 4PKYG 5IU1A 2QYBA 5I5LA 2HF6A 3T4QA 4KQDA 2PHYA 2OWJA 1MKMA 1OTIA 5C5KA 3CUEA 4Z1WA 2J3WA 3LR3A 3MFXA 4MN6A 5F5YA 3UB6A 1UGUA 3UB9A 3UB7A 3EEAA 3IS2B 1X0OA 1LSWA 2HV1A 3S7OA 2P08A 2V0UA 1VHMA 4OOLA 4P6ZM 2W3FA 4O8GA 1W63M 3ULFA 3FC7A 2OAP1 5HDSA 3IS2A 1T1AA 4CLCC 1VB6A 2HGVA 2INWA 2KDKA 3D72A 4WL9A 3CWFA 2P7JA 2MJ6A 4DN0A 3BW6A 1KOUA 4LLOB 3A0RA 4LRZE 3HCYA 5G4ZA 5DFYA 2GZAA 2ZMFA 5HZHA 3KSFA 4IHQA 1P9WA 3OBFA 2VV7A 2J80A 4NKPA 3PBQA 2ZOHA 1YKDA 4EESA 4R38A 2W27A 5HWVA 2V1AA 3T4LA 2LB9A 4GJ4A 2KX6A 1D06A 4B93A 3UMEA 3V67A 4CLCE 3BY9A 1WA9A 4R6LA 2DMWA 3EEHA 1OTBA 2W1RA 2WKRA 4NEED 2QHKA 4H6JB 4UQIS 1G6OA 3D3OA 4I5SA 1OTDA 3PHYA 2FZ0A 4O01A 4H6JA 2W3HA 1YAXA 5IT5A 3JVUA 5J4EA 5DFXA 3T4JA 4LRYC 1ZHHB 3SW1A 1XJ2A 1S1ZA 5DJUA 4G3VA 2VGLM 4GLQA 3KYQA 4CQHA 4I3IA 5J7EA 1TS7A 3PXPA 2WKPA 4GHIB 4AFIA 1NWZA 1G28A 2O99A 2VLGA 5DF9A 2XRNA 3LIBA 3T50A 3U2AA 1DP8A 2NUTC 2O9AA 3LIDA 2PR6A 4GHIA 5L8MA 1T18A 3W2ZA 1YSQA 3PBNA 3KO6A 2VKSA 5EFWA 2V0WA 1TD5A 1S67L 4HJ6A 3PBTA 4YWZA 3IBRA 3OCNA 3VE4A 1DP6A 3T4TA 3NJAA 1F9IA 3H7WA 3F1OB 1ZTUA 2V1BA 1XFNA 4UQIM 2QJ5A 3C8CA 3LIFA 4HY8A 3BJNA 3FPVA 3H82B 1NLYA 4L0LA 4PAUA 1Y28A 1P9RA 3F1OA 1BYWA 3NOTC 2JN7A 1S66L 3T4OA 2YKFA 4RQ9A 3MQQA 4K08A 3GECA 3HJKA 3MR0A 1NLZA 2XA7S 3UE3A 1MZUA 1S4SA 3CAXA 3OC2A 2H28A 1JNUA 4GCZA 3R7WB 4ME4A 1XJ6A 4WEJA 5HD3A 1GSWA 4DMZA 4HJ4A 4WEKA 2VV8A 1IFQA 2QWSA 3R7WA 4G3KA 4I3JA 3LIEA 2CMNA 1LL8A 2Y79A 1S1YA 3CITA 3EGXC 2EWVA 5DKKA 1OTAA 3B42A 4Y3IA 4HH3A 3EOIA 4B9OA 4KQOA 4GW9A 3ZYTA 3FG8A 1UWPX 4Q0JA 3KYZA 1TS0A 1GSXA 1XJ4A 1T1BA 5AVFA 3ICYA 5DKLA 2L4RA 2R78A 4CLCD 3TW8A 2Y8HA 4HP9A 3IBJA 5IS1A 2K31A 2JKRM 4HHDA 5TJJA 3LFVA 1TS6A 1TF1A 2G7UA 4HJ3A 3B33A 3LUQA 3NHQA 4I38A 3E4PA 1YSPA 2B02A 4JGPA 1NRJA 5HWTA 4MDZA 4MMNA 3F1NB 3HJIA 1EW0A 1OJ5A 1DRMA 3UE6A 4DJ2A 4E04A 3EQVA 4HOIA 3TRCA 3DBAA 4NXEA 3S7NA 3F1NA 1LSVA 3OCLA 1V9ZA 4BBVA 2O9BA 3MXQA 2W3GA 3LR0A 3B47A 5LBRA 1N9LA 3C38A 3CUEC 4G3WA 2M1CA 2Z6CA 4FOFA 4HQAA 2VV6A 2B18A 3E0YA 2OWHA 3BY8A 4ZRRA 3LR4A 4OOMA 1OTEA 5G4YA 5HDCA 2NUPC 2O0YA 2LB5A 2PYRA 4GS9B 2W1TB 2A24B 3VV4A 2D01A 2VZWA 4ETZA 4IUHA 2JHEA 5HWWA 4EEUA 5AVEA 4EU0A 3LIAA 4II7A 5CX7A 1UWNX 2OAQ1 4EETB 2VJWA 4GS9A 2W1TA 1N9NA 2KOIA 2A24A 3F1PB 4HNBA 4EXOA 4JGQA 4MCWA 2GX5A 3K2NA 2JKRI 2PT7A 4I39A 4EUVA 4M4XA 2WKQA 5F6AA 2W0NA 4WUJA 3S7QA 3F1PA 3KSHA 5F68A 1OT9A 1F5MA 4HIAA 1H8MA 2IA2A 1V9YA 1F98A 3TJZC 4BBUA 4KUKA 2QJ7A 4EW7A 3E98A 3T4SA 4FSFA 1N9OA 3H82A 1T19A 2K2NA 3VOLA 4L9GA 4QPRA 3T4KA 5DJTA 3LI8A 5F69A 1OJGA 3MMHA 4O0PA 2XROA 2HJEA 2YKHA 4NXFA 3EWKA 2EWWA 2J3TC 3C30A 3KX0X 4UEYA 1S4RA 3UB8A 3RFBA 5J3WA 2V9AA 4BWIA 4DJ3A 3RTYA 4MN7A 4JGOA 2GJ3A 1IOUA 1OT6A 5HL6A 5AJGA 4L9FA 4NXGA 1MC0A 5MC7A 3LICA 1XFQA 3LR5A 1XJ3A 3NOPC 3TE8A 2PD8A 2D02A 2VX8A 3P01A 3PR6A 2VGLS 4YOFA 1TS8A 3MJQA 1H3QA 4PHTA 2J3TD 2O9CA 5HSQA 2ZOIA 4WF0A 3C2WA 3KSGA 3OOVA 3PBOA 3LYXA 4EERA 2PYPA 4XT2B 2JKTM 3BQ8A 3LI9A 4I3AA 4HH2A 3E4OA 4HP4A 3EQUA 3NOUC 4WN5A 3O5YA 2XSSA 3OLOA 1ODVA 2L0WA 4PKYA 1T1CA 4YNRA 4L9EA 2M7UA 2W3DA 3G6OA 3KSIA 4JGRA 4XT2A 2XA7M 3MQ0A 5HPIA 2QKPA 4IUKA 3R4KA 1DP9A 1P97A 4CLCB 4Q0HA 4BMWA 4CLCA 4EEPA 5KSHA 1LT0A 2A2LA 3CLOA 2K7SA 2PD7A 3PBRA 3RH8B 5HDDA 4WELA 5HPFA 2HJ9C 2L1MA 3CI6A 3H9WA 2KLIA 3A0SA 4ETXA 1LSXA 2ZBBA 4R3AA 3K3DA 3A0VA 4BBTA 2EA9A 5HD5A 4P6ZS 4ARZB 4R70A 3K3CA 2VEAA 2ZMVA 1D7EA 5TBMB 3ZQ5A 4IJGA 1P0ZA 3BWLA 5KIZA 1W63Q 4Y2FA 1STZA 2OOLA 2JKTI 4NXBA 4ARZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GDI A;  4EQ1 A;  5TBM A;  2Z6D A;  3VE3 A;  2I9V A;  5A8B A;  3H7W B;  4WLA A;  4LRX C;  1GSV A;  4F3L B;  2PR5 A;  3P7N A;  4HI4 A;  4LPZ A;  3PYP A;  2BAS A;  2PDR A;  3MQO A;  4F3L A;  3UMD A;  4MN5 A;  3E4Q A;  4KUO A;  4PKY G;  5IU1 A;  5I5L A;  4KQD A;  2PHY A;  2OWJ A;  1OTI A;  3MFX A;  4MN6 A;  5F5Y A;  3UB6 A;  1UGU A;  3UB9 A;  3UB7 A;  3IS2 B;  1X0O A;  1LSW A;  2HV1 A;  2V0U A;  3ULF A;  3FC7 A;  5HDS A;  3IS2 A;  1T1A A;  1VB6 A;  2INW A;  2KDK A;  3D72 A;  3CWF A;  2P7J A;  1KOU A;  4LLO B;  3A0R A;  4LRZ E;  5G4Z A;  5HZH A;  2VV7 A;  2J80 A;  2ZOH A;  4EES A;  4R38 A;  2W27 A;  5HWV A;  2V1A A;  2KX6 A;  1D06 A;  3UME A;  3BY9 A;  1WA9 A;  4R6L A;  3EEH A;  1OTB A;  2WKR A;  2QHK A;  4H6J B;  4I5S A;  1OTD A;  3PHY A;  4H6J A;  5J4E A;  4LRY C;  3SW1 A;  1XJ2 A;  1S1Z A;  5DJU A;  5J7E A;  4I3I A;  1TS7 A;  4GHI B;  2WKP A;  1NWZ A;  1G28 A;  2VLG A;  3LIB A;  3T50 A;  1DP8 A;  3LID A;  2PR6 A;  4GHI A;  1T18 A;  5EFW A;  2V0W A;  1S67 L;  4HJ6 A;  4YWZ A;  3IBR A;  3VE4 A;  1DP6 A;  3NJA A;  1F9I A;  3H7W A;  3F1O B;  2V1B A;  1XFN A;  2QJ5 A;  3C8C A;  3LIF A;  4HY8 A;  3H82 B;  1Y28 A;  3F1O A;  1BYW A;  3NOT C;  2JN7 A;  1S66 L;  2YKF A;  4RQ9 A;  3MQQ A;  4K08 A;  3GEC A;  3HJK A;  3MR0 A;  1MZU A;  1S4S A;  3CAX A;  2H28 A;  1JNU A;  4GCZ A;  1XJ6 A;  5HD3 A;  1GSW A;  4HJ4 A;  2VV8 A;  2QWS A;  4I3J A;  2CMN A;  3LIE A;  1LL8 A;  1S1Y A;  5DKK A;  1OTA A;  4HH3 A;  4B9O A;  4GW9 A;  3FG8 A;  1UWP X;  1TS0 A;  1GSX A;  1XJ4 A;  1T1B A;  5AVF A;  3ICY A;  5DKL A;  2L4R A;  2R78 A;  4HP9 A;  5IS1 A;  4HHD A;  1TS6 A;  4HJ3 A;  3B33 A;  3LUQ A;  3NHQ A;  4I38 A;  3E4P A;  2B02 A;  4JGP A;  5HWT A;  3F1N B;  3HJI A;  1EW0 A;  1OJ5 A;  1DRM A;  3UE6 A;  4DJ2 A;  4E04 A;  4HOI A;  4NXE A;  3F1N A;  1LSV A;  1V9Z A;  4BBV A;  3MXQ A;  1N9L A;  2M1C A;  2Z6C A;  4HQA A;  2VV6 A;  2OWH A;  3BY8 A;  1OTE A;  5G4Y A;  5HDC A;  2PYR A;  4GS9 B;  2A24 B;  2D01 A;  2JHE A;  5HWW A;  4EEU A;  5AVE A;  3LIA A;  1UWN X;  4EET B;  4GS9 A;  1N9N A;  2A24 A;  3F1P B;  4HNB A;  4EXO A;  4JGQ A;  4I39 A;  4M4X A;  2WKQ A;  5F6A A;  2W0N A;  4WUJ A;  3F1P A;  5F68 A;  1OT9 A;  4HIA A;  1V9Y A;  1F98 A;  4BBU A;  4KUK A;  2QJ7 A;  4EW7 A;  1N9O A;  3H82 A;  1T19 A;  3VOL A;  4L9G A;  5DJT A;  3LI8 A;  5F69 A;  1OJG A;  2YKH A;  4NXF A;  3EWK A;  3KX0 X;  1S4R A;  3UB8 A;  5J3W A;  2V9A A;  4DJ3 A;  3RTY A;  4JGO A;  2GJ3 A;  1OT6 A;  4L9F A;  4NXG A;  3LIC A;  1XFQ A;  1XJ3 A;  3NOP C;  2PD8 A;  2D02 A;  1TS8 A;  3MJQ A;  5HSQ A;  2ZOI A;  4WF0 A;  3C2W A;  3LYX A;  4EER A;  2PYP A;  4XT2 B;  3LI9 A;  4I3A A;  4HH2 A;  3E4O A;  4HP4 A;  3NOU C;  4WN5 A;  3OLO A;  1ODV A;  2L0W A;  4PKY A;  1T1C A;  4L9E A;  3G6O A;  4JGR A;  4XT2 A;  2QKP A;  1DP9 A;  1P97 A;  4EEP A;  1LT0 A;  3CLO A;  2K7S A;  2PD7 A;  3RH8 B;  5HDD A;  2L1M A;  3H9W A;  3A0S A;  1LSX A;  2ZBB A;  4R3A A;  3K3D A;  3A0V A;  4BBT A;  2EA9 A;  5HD5 A;  4R70 A;  3K3C A;  2VEA A;  1D7E A;  5TBM B;  3ZQ5 A;  1P0Z A;  3BWL A;  5KIZ A;  2OOL A;  4WL9 A;  4NXB A; 
#chains in the Genus database with same CATH topology
 1LHY A;  2PU4 A;  3BQA A;  3WS0 A;  2Z6D A;  3G2Y A;  3VE3 A;  5KSC A;  2WUQ A;  1YLY A;  1PZO A;  2RL3 A;  4K0X A;  4LRX C;  2P04 A;  3OPR A;  2PR5 A;  1FR6 A;  4S2P A;  3T12 B;  4BL2 A;  1FQG A;  1IYP A;  2M7V A;  4JXW A;  3S7P A;  1C3B A;  4Y5F A;  2XFT A;  3MQO A;  4F3L A;  4E6X A;  4RVA A;  5C5K A;  3LR3 A;  2Y2K A;  3MFX A;  4UA7 A;  5F5Y A;  1EI5 A;  4JF6 A;  1YLW A;  3S7O A;  3WRT A;  1MY8 A;  4O8G A;  3TOI A;  5HDS A;  1T1A A;  5L07 A;  3G34 A;  2KDK A;  3C7U A;  5CHU A;  3D72 A;  3CWF A;  5EE8 A;  3NC8 A;  1KOU A;  3VSK A;  4LLO B;  4EUZ A;  4OQH A;  1SDN A;  1VM1 A;  1Z09 A;  2XFS A;  1P9W A;  5DF7 A;  2J80 A;  4NKP A;  1ZG4 A;  2EX8 A;  1L0E A;  2X02 A;  3AGE A;  1IYS A;  2B95 A;  3T4L A;  1Q2P A;  2V2F F;  1FOF A;  1XA7 A;  1FCN A;  1D1J A;  2QHK A;  4H6J B;  2DRW A;  4UQI S;  4WZ5 C;  3D3O A;  4I5S A;  5GLB A;  1IKG A;  1OTD A;  3PHY A;  3S22 A;  1K57 A;  3ZG7 B;  2WGI A;  1ERO A;  3OPL A;  1S1Z A;  5DJU A;  2Y2Q A;  2VGL M;  4CQH A;  3IX4 A;  1MPL A;  4S2N C;  3I7J A;  2O99 A;  2VLG A;  2FFY A;  5DF9 A;  2XRN A;  4LFU A;  2Z2L B;  2NUT C;  3BRM A;  4GHI A;  5L8M A;  1T18 A;  3W2Z A;  2QPN A;  3E2K A;  1ZG6 A;  3KO6 A;  2VKS A;  4E6W A;  2V0W A;  2PRF A;  3PBT A;  5GL9 A;  2WGV A;  3ZDJ A;  4UA6 A;  1XFN A;  4UQI M;  1PWC A;  4UHU A;  3BJN A;  1K56 A;  3LY4 A;  3F1O A;  3MKF A;  1ONG A;  4DDS A;  1S66 L;  4KZB A;  4KG2 A;  2WAE A;  3M6H A;  4K08 A;  5I94 A;  2WGW B;  1FSW A;  3ZGA B;  4NG2 A;  3UE3 A;  1MZU A;  3NCK A;  4N1X A;  1G5U A;  3P98 A;  1CQA A;  2I72 A;  3VP4 A;  1K4E A;  4GZB A;  4DMZ A;  1DY6 A;  1FCO A;  3BEB A;  3VMA A;  2CMN A;  2Y79 A;  3EGX C;  3B42 A;  3QNC A;  2EX6 A;  1WYC A;  4OKP A;  1UWP X;  2WKH A;  4GDN A;  2WKI A;  4PM9 A;  1GSX A;  3IQA A;  2XD5 A;  4B4X A;  4PMA A;  3ZCZ A;  2R78 A;  4HES A;  4OQI A;  4E3K A;  3IBJ A;  3T1S A;  3TSG A;  2G7U A;  2EXA A;  3QP5 A;  3B33 A;  1H5X A;  2B02 A;  2BTF P;  5HWT A;  2Q9M A;  1EW0 A;  2XF3 A;  5HW3 A;  4DJ2 A;  3O87 A;  4IBR A;  5HAI A;  3BFG A;  3G4P A;  3F1N A;  3OCL A;  4U0X A;  3IHA A;  2J8Y A;  2JKF A;  2HDU A;  1N9L A;  3CUE C;  4G3W A;  1J9M A;  2Y2N A;  4WM9 A;  2ACG A;  4BEN A;  3LR4 A;  1U60 A;  5G4Y A;  4BD1 A;  4DXB A;  3VV4 A;  4EU0 A;  4X25 A;  4EET B;  1YM1 A;  1FSY A;  2W1T A;  2A24 A;  4EXO A;  4KZ9 A;  3SZT A;  3DWK A;  3ZG8 B;  2ZQD A;  3V3R A;  2WKQ A;  2W0N A;  1YMS A;  5DF8 A;  4E3J A;  2EFX A;  4M3K A;  1F98 A;  3FV7 A;  3UY6 A;  3T4S A;  3UPO A;  5FDH A;  3WRZ A;  4DDY A;  4ID4 A;  1SKF A;  4Y7P A;  3BFF A;  1ONH A;  1OME A;  3HUN A;  3MMH A;  4NXF A;  3EWK A;  2J3T C;  3C30 A;  4JF5 A;  4JF4 A;  1S4R A;  3GMW A;  4S2N A;  4BWI A;  4N1H A;  1OT6 A;  3N7W A;  5HL6 A;  5IHV A;  1PW8 A;  4L9F A;  1IEM A;  3ZHH A;  1GA0 A;  1XJ3 A;  2VGK A;  3TE8 A;  1BT5 A;  5EVI A;  2PD8 A;  2D02 A;  3P01 A;  5FQQ A;  4Y15 A;  4UAA A;  4K0W A;  2Y2H A;  4P87 A;  5F1F A;  3C4P A;  2HZ5 A;  1JTG A;  3E4O A;  4X55 A;  3EQU A;  3M6B A;  1TVF A;  3NOU C;  4WN5 A;  3MZF A;  2H0Y A;  2XK1 A;  3C7V A;  3G6O A;  3KSI A;  4BD0 A;  2XA7 M;  1E4D A;  4OLG A;  2Y55 A;  2E8J A;  5CGW A;  1IEL A;  4DE2 A;  4IVK A;  4Q0H A;  3PAE A;  5CHJ A;  5CRF A;  1AWI A;  3W4Q A;  1HLU P;  4BMW A;  1L0G A;  5KSH A;  2K7S A;  3PBR A;  2L1M A;  1XGJ A;  2KLI A;  3G35 A;  3A0V A;  4ARZ B;  3DTK A;  1JWP A;  2VEA A;  3N8R A;  2JE5 A;  1P0Z A;  4CJN A;  1SCW A;  4Y2F A;  3W4P A;  4WL9 A;  3GDI A;  5K5B A;  4EQ1 A;  3QNB A;  5TBM A;  1XX2 A;  2H5S A;  5A90 A;  2I9V A;  5L09 A;  2GNX A;  5FL3 A;  4F3L B;  5L10 A;  3P7N A;  1K54 A;  4BJP A;  1EWZ A;  3PYP A;  4GN2 A;  2W3E A;  2JC7 A;  3EGD C;  4P6B A;  4EWF A;  1OPX A;  2V8F A;  4KG5 A;  4KUO A;  2QYB A;  3ITB A;  1CEG A;  3IH8 A;  2PHY A;  2OWJ A;  5EPH A;  1OTI A;  3CUE A;  1GCE A;  4WMC D;  4KEN B;  3WS2 A;  2Z2M B;  1UGU A;  3M2J A;  1X0O A;  1LSW A;  2HV1 A;  1CJF A;  2P08 A;  4OOL A;  2W3F A;  1ACF A;  3HUO A;  3IS2 A;  3QHY A;  4CLC C;  1SKO A;  4U3T A;  1I5Q A;  2HGV A;  5JYP A;  2HP6 A;  2MJ6 A;  2XGN A;  5DTS A;  4YIN A;  5G4Z A;  5HAR A;  5HZH A;  3DWZ A;  4MNR A;  2J7V A;  4IHQ A;  2XR0 A;  2ZOH A;  4GDB A;  4QHC A;  1YKD A;  2ZC3 B;  4EES A;  2W27 A;  5FQJ A;  5FSR A;  2V1A A;  3UB5 P;  2LB9 A;  4GJ4 A;  3RXX A;  2KX6 A;  4A5R A;  1XA1 A;  4CLC E;  2EFU A;  4R6L A;  2IWC A;  3EEH A;  2WKR A;  2ZQA A;  4NEE D;  2ZM0 A;  3O3V A;  4JKT A;  3V5M A;  2PBD P;  5FQK A;  5CGS A;  1G6O A;  3UNW A;  3NI9 A;  5IT5 A;  1KVM A;  5DFX A;  2ZQ7 A;  3SW1 A;  1XJ2 A;  3UPN A;  3IF5 A;  3MS6 A;  4S2K A;  3S4X A;  3T1X A;  2BLS A;  3UDF A;  4GHI B;  4R4R A;  2WKP A;  4AFI A;  1NWZ A;  4E3O A;  5EVL A;  1DP8 A;  1F2K A;  4HBT A;  2PR6 A;  4RX2 A;  1GHI A;  1YSQ A;  5E2G A;  1DJC A;  3PBN A;  4BL3 A;  3IXB A;  4XUZ A;  1S67 L;  5GHY A;  4YWZ A;  1VET A;  4DXC A;  3OCN A;  3WWX A;  1FIK A;  3T4T A;  3NJA A;  1F9I A;  2ZQ9 A;  3F1O B;  1L3L A;  3DAV A;  5M1A A;  4E3I A;  1WE4 A;  3LIF A;  2WAF A;  4HBU A;  3FPV A;  4ZJ3 A;  4PPR A;  1E3U A;  1NLY A;  3V50 A;  4L0L A;  3CPT A;  1P9R A;  3NOT C;  2JN7 A;  3T4O A;  2YKF A;  5G18 A;  3HLD A;  5AQ9 A;  3MBZ A;  2H28 A;  1JNU A;  4GCZ A;  3SOI A;  4ME4 A;  4ZAM A;  1I2W A;  1PZP A;  4WZ4 A;  1GSW A;  5EEC A;  2WYX A;  4R3B A;  4B4Z A;  3ZNY A;  1IFQ A;  3R7W A;  3NDG A;  3FYZ A;  2JCH A;  4I3J A;  1KDW A;  1OTA A;  1BUE A;  1DJA A;  1H8Z A;  2EXB A;  4R3J A;  3SS3 A;  4B88 A;  4Q0J A;  2UV0 E;  2WAD A;  1XJ4 A;  5DKL A;  3GQZ A;  4CLC D;  1ZKJ A;  4O7D A;  5KZH A;  4S2J A;  2Y8H A;  2K31 A;  3C4O A;  3LFV A;  5HAQ A;  4EV4 A;  4U0T A;  2Y2O A;  4GNU A;  4JGP A;  1NRJ A;  3F1N B;  4C75 A;  2AVX A;  1DRM A;  3QP6 A;  5DVA A;  1I2S A;  1H0M A;  5FQ9 A;  3IX3 A;  3DBA A;  3S7N A;  3T1Q B;  1LSV A;  1V9Z A;  1L0D A;  5EV0 A;  1HZO A;  5LBR A;  3C38 A;  4MEZ A;  1G68 A;  2M1C A;  2ZLY A;  2OWH A;  1Y54 A;  1XGI A;  3IXD A;  2EX2 A;  2W1T B;  3A3D A;  2A24 B;  2D01 A;  5HWW A;  4EEU A;  2Y2G A;  5AVE A;  3LIA A;  5CX7 A;  2VJW A;  1ESI A;  1N9N A;  2KOI A;  3RXW A;  1KE3 A;  4FD8 A;  2HDS A;  2G2U A;  4MCW A;  5F83 A;  2J9P A;  4Z9Q A;  1YQS A;  3UE1 A;  2JKR I;  2PT7 A;  2ZQC A;  5HAP A;  4OPY A;  2HDR A;  4WUJ A;  3F1P A;  5F68 A;  4X1L A;  4WYY A;  4HIA A;  1H8M A;  1V9Y A;  1BSG A;  4BBU A;  4KUK A;  2QJ7 A;  4MLL A;  3E98 A;  3VOZ A;  1BUL A;  2K2N A;  2ZC5 B;  2ZQ8 A;  4QPR A;  3BEC A;  5FI2 A;  5F69 A;  1Y4O A;  1NYM A;  2YKH A;  3UB8 A;  1M6K A;  1VEU A;  3V3S A;  3UO9 A;  2Y2P A;  3HL9 A;  1TDL A;  1G6A A;  5EVI B;  4XUX A;  3MKE A;  4NXG A;  1MC0 A;  3SS4 A;  2XD1 A;  5AQB A;  4OP5 A;  3MJQ A;  1H3Q A;  4PHT A;  3C2W A;  3OOV A;  1NZU A;  3LYX A;  3GV9 A;  4EER A;  3DTE A;  5J8X A;  4HH2 A;  1ODV A;  2L0W A;  4NET A;  1ERQ A;  2QZ6 A;  4GB7 A;  3MQ0 A;  3OPH A;  1MXO A;  4LGW A;  1JVJ A;  5GHX A;  1RP5 A;  2ZM2 A;  2B5R A;  3G30 A;  1Q2Q A;  2E8I A;  3UN7 A;  4EEP A;  1LT0 A;  3CLO A;  3RH8 B;  2R9X A;  5HDD A;  5FA7 A;  4WEL A;  4ZBE A;  4QJG A;  3N6I A;  2HJ9 C;  5HPF A;  3H9W A;  1KGE A;  4ETX A;  5HL1 A;  4R3A A;  4LV1 A;  5FEF A;  1YLP A;  5HD5 A;  1AXB A;  4S2I A;  4BQM A;  1BZA A;  1YT4 A;  4FH4 A;  5CED A;  1ES2 A;  1NYY A;  1RCJ A;  3HLB A;  4D2O A;  1D7E A;  5TBM B;  3ZQ5 A;  3UPP A;  2PU2 A;  5KIZ A;  1STZ A;  2OOL A;  3N8L A;  2JKT I;  4NXB A;  4S2O A;  4H8R A;  1RGY A;  2ZJ9 A;  4WLA A;  4WZ5 A;  1GSV A;  4JXV A;  1CEF A;  3PBS A;  1GA9 A;  1N9B A;  4KZ5 A;  4XXR A;  2PDR A;  2VA0 A;  2XQZ A;  1PWG A;  1O7E A;  4MN5 A;  3PTE A;  4DE0 A;  5IU1 A;  2HF6 A;  3T4Q A;  4K91 A;  5GLD A;  3VP1 A;  3HBR A;  1PWD A;  2Y2M A;  2J3W A;  3LEZ A;  4ZTK A;  1IYO A;  1W8Q A;  3CJM A;  3JPU A;  1PFL A;  3IS2 B;  2XDM A;  1SKO B;  4BLM A;  4RA7 A;  2V0U A;  1VHM A;  3SS5 A;  2GDN A;  4IBX A;  4GOG A;  3ULF A;  2CC1 A;  1KE0 A;  2A49 A;  2A3U A;  1VQQ A;  2Y2I A;  5GLC A;  3IT9 A;  1VB6 A;  2DNS A;  2INW A;  1YLJ A;  4QY6 A;  5BOH A;  1PI4 A;  3ZFZ A;  4N92 A;  5EUA A;  3A0R A;  5FAT A;  4QD4 A;  5DFY A;  2GZA A;  2ZMF A;  2QMI A;  4GD6 A;  3OBF A;  3PBQ A;  4R0Q A;  2ZC6 B;  1LL5 A;  1JWV A;  5HWV A;  4R4S A;  1K6S A;  4KZ8 A;  1D06 A;  3UME A;  3V67 A;  3BY9 A;  2P9V A;  1WA9 A;  1H8Y A;  1OTB A;  3QP2 A;  2X71 A;  1XKZ A;  2V20 A;  3E2L A;  2FZ0 A;  3VSL A;  4O01 A;  2W3H A;  1YAX A;  5FAQ A;  3JVU A;  5J4E A;  5A92 A;  3PAG A;  3ZG0 A;  4GLQ A;  3HRE A;  5J7E A;  4IVI A;  1YPR A;  1TS7 A;  2WKE A;  3IF6 C;  1FR1 A;  2HPB A;  3PXP A;  1G28 A;  4JPM A;  5JYO A;  2Y2J A;  3A3E A;  4C3Q A;  4JXG A;  3BLS A;  3T50 A;  3U2A A;  3LID A;  4EBL A;  5DTK A;  1VET B;  5EFW A;  5M19 A;  4YFM A;  1PIO A;  4PM8 A;  3T1R A;  3Q7V A;  1DP6 A;  5CEB A;  1PYY A;  3CPT B;  1XPB A;  2V1B A;  2ZM8 A;  4LEN A;  2X01 A;  4MBF A;  3JYI A;  2QJ5 A;  3C8C A;  1BLS A;  1PRQ A;  5FAO A;  1Y28 A;  1BYW A;  2J9O A;  5FQM A;  1K55 C;  4GKU A;  1L0F A;  3B3X A;  4E3N A;  3GEC A;  3MR0 A;  1S4S A;  2WK0 A;  3MZD A;  3OC2 A;  2WZZ A;  4X56 A;  3VFH A;  3R7W B;  4KZ3 A;  3VOY A;  3N8S A;  2XEP A;  1J3W A;  3D9Y A;  3SH7 A;  4HJ4 A;  2Q0O A;  3LEQ A;  1LI0 A;  2VV8 A;  2QWS A;  4G3K A;  4OPR A;  1ES3 A;  5EVE A;  5AQA A;  1K57 C;  2FFF B;  3LIE A;  1LL8 A;  3MXS A;  1S1Y A;  4KZA A;  2EWV A;  5DKK A;  4E3L A;  4OH0 A;  4Y3I A;  4HH3 A;  1FCM A;  3EOI A;  4QU3 A;  4KQO A;  5DTT A;  1DJB A;  4GW9 A;  1K4F A;  4WMC A;  3ZYT A;  1GHP A;  3FG8 A;  3KYZ A;  4EQI A;  1W79 A;  2VK3 A;  5AVF A;  3ICY A;  3WS5 A;  4HP9 A;  5U47 A;  5IS1 A;  4ZJ2 A;  5F1G A;  1QMF A;  3IWI A;  1TS6 A;  1TF1 A;  3OZH A;  4HJ3 A;  4I38 A;  3HJI A;  1YLT A;  2C6W B;  4E04 A;  4F94 A;  3EQV A;  4HOI A;  5M18 A;  3TRC A;  4BBV A;  1ES5 A;  4FCF A;  3WS4 A;  3HLE A;  3LR0 A;  1HVB A;  4P85 A;  4RYE A;  4HQA A;  3MSH A;  5EOO A;  4JXS A;  4QY5 A;  3BY8 A;  4OOM A;  4FUW A;  2NUP C;  2O0Y A;  2PYR A;  4R23 A;  4ZDX A;  2VZW A;  4RX3 A;  4ETZ A;  2IWD A;  2JHE A;  4DE1 A;  4OQG A;  4II7 A;  1UWN X;  5FDS A;  4GS9 A;  4X53 A;  3F1P B;  4KQR A;  3A3I A;  1YMX A;  4M4X A;  5F6A A;  4R1G A;  3GRJ A;  1LL9 A;  3KSH A;  1OT9 A;  2C5W B;  2IA2 A;  3M2K A;  3FKV A;  4EBP A;  4D60 A;  4EW7 A;  4OOY A;  4FSF A;  1N9O A;  5A91 A;  4L9G A;  2Y4A A;  3G32 A;  1VEU B;  3BFE A;  1OJG A;  4MBK A;  2Y2L A;  4O0P A;  3TG9 A;  3LY3 A;  4UEY A;  3KX0 X;  3IF6 A;  4JBF A;  4Y0U A;  4DF6 A;  2V9A A;  3HLC A;  3Q82 A;  3IH9 A;  4OVD A;  4PM7 A;  3FWL A;  2JKG A;  3BLM A;  3CHW P;  4JGO A;  2GJ3 A;  1IOU A;  5EOE A;  3W4O A;  5AJG A;  5MC7 A;  1XFQ A;  1ALQ A;  3LR5 A;  3IXG A;  3ITA A;  1PW1 A;  2VX8 A;  4X1M A;  2ZL1 A;  2VGL S;  4YOF A;  1BLC A;  2O9C A;  5HSQ A;  4WF0 A;  4FH2 A;  4Y0T A;  3KYE A;  5CGX A;  4N9K A;  2PYP A;  2BG1 A;  4I3A A;  4HP4 A;  3MXR A;  3O5Y A;  4PKY A;  4YNR A;  4L9E A;  4NK3 A;  2M7U A;  2W3D A;  4JGR A;  4XT2 A;  5HPI A;  3OPP A;  1K55 A;  1ERM A;  2QKP A;  1P97 A;  4Y0O A;  3LCE A;  1CF0 A;  1K0K A;  1MWR A;  4CLC A;  5E2F A;  3SH8 A;  5GLA A;  2PD7 A;  3CI6 A;  3QP8 A;  4OP8 A;  1LSX A;  1TEM A;  3K3D A;  4BBT A;  2EA9 A;  2XLN A;  1YLZ A;  4X68 A;  3O86 A;  1HTZ A;  5GHZ A;  4P6Z S;  1K6R A;  2Y59 A;  1TDG A;  3FKW A;  3K3C A;  1K56 D;  1Z6F A;  4IJG A;  3LGO A;  3BWL A;  5TFQ A;  1W63 Q;  3CZD A;  3VP2 A;  3A3F A;  4Y13 A;  3NBL A;  5A8B A;  3H7W B;  4DE3 A;  3MZE A;  3JVV A;  5EVI C;  2FH5 A;  3MF0 A;  4HI4 A;  4LPZ A;  3ZG5 A;  3NUL A;  3VP3 A;  4Q0I A;  4EBN A;  3ZNT A;  1W5D A;  2BAS A;  4LV3 A;  1W7F A;  3FPW A;  3UMD A;  3E4Q A;  4PKY G;  3ZVT A;  5I5L A;  5TGF A;  4KQD A;  3IWQ A;  1MKM A;  2V8C A;  4Z1W A;  1CK3 A;  2H0T A;  4MN6 A;  3UB6 A;  3UB9 A;  1WYB A;  3UB7 A;  3EEA A;  2ZMA A;  3G2Z A;  3IX8 A;  4P6Z M;  1W63 M;  5FI7 A;  3FC7 A;  2OAP 1;  3NIA A;  3Q07 A;  1NJ4 A;  2P7J A;  3HLF A;  1K38 A;  3FZC A;  4DN0 A;  3BW6 A;  5L2F A;  4LV0 A;  5EM0 A;  4LRZ E;  1E25 A;  4QB8 A;  4S2M A;  3HCY A;  2JBF A;  3AGF A;  3KSF A;  2IWB A;  2XH9 A;  2VV7 A;  2P9V B;  4R38 A;  1XP4 A;  1CI9 A;  4B93 A;  1NY0 A;  3UDI A;  3NDE A;  5CTM A;  3D4F A;  2DMW A;  2W1R A;  2ZD8 A;  2DCF A;  2RCX A;  1S0W A;  1K54 C;  4JLF A;  1PI5 A;  3Q1F A;  4H6J A;  3T4J A;  1MWT A;  2ZC4 B;  4LRY C;  4PM6 A;  1ZHH B;  1RGZ A;  2OLV A;  4G3V A;  1BLP A;  2R9W A;  3KYQ A;  4I3I A;  4LV2 A;  4S2L A;  3CG5 A;  3LIB A;  4DKI A;  2O9A A;  5TR7 A;  3Q7V B;  3HVF A;  1QME A;  5CER A;  2UWX A;  1TD5 A;  4HJ6 A;  1SDE A;  3HLG A;  3IBR A;  2HP9 A;  3VE4 A;  1MWS A;  3H7W A;  3ZVW A;  2VGJ A;  3GTC A;  3MFD A;  3ZG9 B;  1ZTU A;  4KZ7 A;  5FQI A;  1KGG A;  1IYQ A;  4HY8 A;  3H82 B;  3HLW A;  2OSU A;  3N4I A;  4LCM A;  4PAU A;  3L9K A;  1BTL A;  4RQ9 A;  3MQQ A;  3QP4 A;  5EVI D;  1JWZ A;  3HJK A;  1NLZ A;  2XA7 S;  1MWU A;  3WS1 A;  3CAX A;  4N9L A;  3IHB A;  4KG6 A;  1XJ6 A;  1KE4 A;  4WEJ A;  1L2S A;  1SHV A;  2WGW A;  5HD3 A;  4KQQ A;  1SZV A;  4WEK A;  1A0K A;  3CIT A;  5FAS A;  1JTD A;  1MBL A;  5AQ7 A;  3Q81 A;  1TS0 A;  3DTM A;  2OLU A;  5EM1 A;  4CPK A;  1T1B A;  2L4R A;  3CMZ A;  1NZO A;  4WBG A;  5E2H A;  3TW8 A;  2Q9N A;  5F82 A;  3SH9 A;  3P09 A;  2JKR M;  4HHD A;  5TJJ A;  4PM5 A;  1IKI A;  3G31 A;  5CTN A;  3BFD A;  3A3J A;  2HP5 A;  3IXH A;  3LUQ A;  3NHQ A;  3E4P A;  1YSP A;  4OLD A;  4MDZ A;  4MMN A;  5HX9 A;  2P74 A;  3GSG A;  1OJ5 A;  3UE6 A;  3DTI A;  3L7H A;  4OPZ A;  1LI9 A;  3Q7Z A;  4DRT A;  1N4O A;  3NY4 A;  4NXE A;  3S1Y A;  2O9B A;  1NXY A;  3MXQ A;  2W3G A;  2HDQ A;  1BLH A;  3B47 A;  4GD8 A;  3RJU A;  1XXM A;  2Z6C A;  4FOF A;  2VV6 A;  2B18 A;  3E0Y A;  4ZRR A;  1OTE A;  4OQ0 A;  5HDC A;  2LB5 A;  4Y17 A;  4GS9 B;  5D3O A;  4IUH A;  4UA9 A;  4C6Y A;  3GVB A;  1KVL A;  2OAQ 1;  4Q8I A;  1K25 A;  1ESU A;  5KMW A;  4MBH A;  1ZC2 A;  4HNB A;  4JGQ A;  2GX5 A;  3K2N A;  4I39 A;  4EUV A;  4X6T A;  3S7Q A;  1F5M A;  1O07 A;  3TJZ C;  3UDX A;  3AGD A;  1W8Y A;  3H82 A;  3ISG A;  3V39 A;  1T19 A;  4ESP A;  3VOL A;  4LCL A;  3IF6 B;  3BYD A;  3T4K A;  5DJT A;  3LI8 A;  5E43 A;  5FEG A;  2PAV P;  5CEC A;  2XRO A;  2HJE A;  2EWW A;  3RFB A;  5J3W A;  4OON A;  4DJ3 A;  3C5A A;  3RTY A;  1ES4 A;  4X69 A;  4MN7 A;  5A93 A;  4E3M A;  1M40 A;  5CHM A;  5HFO A;  2Y91 A;  2ZL1 B;  3HUM A;  2G2W A;  3LIC A;  4FTX A;  3BFC A;  3NOP C;  4P0M A;  5E2E A;  3PR6 A;  3VP0 A;  1TS8 A;  4HEF A;  1PNE A;  1S6R A;  2J3T D;  2ZOI A;  3PBO A;  3KSG A;  1LLB A;  2EX9 A;  4XT2 B;  2OV5 A;  2JKT M;  2V1Z A;  3BQ8 A;  3LI9 A;  5FI6 A;  3O88 A;  2H10 A;  3IWO A;  2XSS A;  3OLO A;  1HD8 A;  1T1C A;  4IED A;  1KDS A;  3QP1 A;  4IUK A;  1GHM A;  3R4K A;  1DP9 A;  3DW0 A;  4CLC B;  3VFF A;  3NEC A;  3BM6 A;  1MKI A;  2ZC7 A;  3LO7 A;  2A2L A;  5FAP A;  4KZ4 A;  3U4L P;  4ZJ1 A;  2PBY A;  1FIL A;  1CI8 A;  4KZ6 A;  1KGF A;  3A0S A;  2ZBB A;  3W8K A;  3UE0 A;  4R70 A;  4QWO A;  5CXW A;  2WZX A;  2ZMV A;  1E3U D;  1NRF A;  4OPQ A;  3GR2 A;  4ARZ A;  4B9O A; 
#chains in the Genus database with same CATH homology
 3GDI A;  5K5B A;  4EQ1 A;  3BQA A;  5TBM A;  2Z6D A;  3VE3 A;  2I9V A;  5A8B A;  3H7W B;  3JVV A;  4WLA A;  2GNX A;  4LRX C;  1GSV A;  2FH5 A;  2P04 A;  3MF0 A;  5FL3 A;  4F3L B;  3PBS A;  2PR5 A;  3P7N A;  4HI4 A;  4LPZ A;  4BJP A;  4Q0I A;  2M7V A;  3PYP A;  2W3E A;  2BAS A;  3S7P A;  4Y5F A;  2PDR A;  3EGD C;  2VA0 A;  3MQO A;  3FPW A;  1OPX A;  4F3L A;  3UMD A;  4MN5 A;  3E4Q A;  4KUO A;  4PKY G;  5IU1 A;  2QYB A;  5I5L A;  2HF6 A;  3T4Q A;  4KQD A;  2PHY A;  2OWJ A;  1MKM A;  1OTI A;  5C5K A;  3CUE A;  4Z1W A;  2J3W A;  3LR3 A;  3MFX A;  4MN6 A;  5F5Y A;  3UB6 A;  1UGU A;  3UB9 A;  3UB7 A;  3EEA A;  3IS2 B;  1X0O A;  1LSW A;  2HV1 A;  3S7O A;  2P08 A;  2V0U A;  1VHM A;  4OOL A;  4P6Z M;  2W3F A;  4O8G A;  1W63 M;  3ULF A;  3FC7 A;  2OAP 1;  5HDS A;  3IS2 A;  1T1A A;  4CLC C;  1VB6 A;  2HGV A;  2INW A;  2KDK A;  3D72 A;  4WL9 A;  3CWF A;  2P7J A;  2MJ6 A;  4DN0 A;  3BW6 A;  1KOU A;  4LLO B;  3A0R A;  4LRZ E;  3HCY A;  5G4Z A;  5DFY A;  2GZA A;  2ZMF A;  5HZH A;  3KSF A;  4IHQ A;  1P9W A;  3OBF A;  2VV7 A;  2J80 A;  4NKP A;  3PBQ A;  2ZOH A;  1YKD A;  4EES A;  4R38 A;  2W27 A;  5HWV A;  2V1A A;  3T4L A;  2LB9 A;  4GJ4 A;  2KX6 A;  1D06 A;  4B93 A;  3UME A;  3V67 A;  4CLC E;  3BY9 A;  1WA9 A;  4R6L A;  2DMW A;  3EEH A;  1OTB A;  2W1R A;  2WKR A;  4NEE D;  2QHK A;  4H6J B;  4UQI S;  1G6O A;  3D3O A;  4I5S A;  1OTD A;  3PHY A;  2FZ0 A;  4O01 A;  4H6J A;  2W3H A;  1YAX A;  5IT5 A;  3JVU A;  5J4E A;  5DFX A;  3T4J A;  4LRY C;  1ZHH B;  3SW1 A;  1XJ2 A;  1S1Z A;  5DJU A;  4G3V A;  2VGL M;  4GLQ A;  3KYQ A;  4CQH A;  4I3I A;  5J7E A;  1TS7 A;  3PXP A;  2WKP A;  4GHI B;  4AFI A;  1NWZ A;  1G28 A;  2O99 A;  2VLG A;  5DF9 A;  2XRN A;  3LIB A;  3T50 A;  3U2A A;  1DP8 A;  2NUT C;  2O9A A;  3LID A;  2PR6 A;  4GHI A;  5L8M A;  1T18 A;  3W2Z A;  1YSQ A;  3PBN A;  3KO6 A;  2VKS A;  5EFW A;  2V0W A;  1TD5 A;  1S67 L;  4HJ6 A;  3PBT A;  4YWZ A;  3IBR A;  3OCN A;  3VE4 A;  1DP6 A;  3T4T A;  3NJA A;  1F9I A;  3H7W A;  3F1O B;  1ZTU A;  2V1B A;  1XFN A;  4UQI M;  2QJ5 A;  3C8C A;  3LIF A;  4HY8 A;  3BJN A;  3FPV A;  3H82 B;  1NLY A;  4L0L A;  4PAU A;  1Y28 A;  1P9R A;  3F1O A;  1BYW A;  3NOT C;  2JN7 A;  1S66 L;  3T4O A;  2YKF A;  4RQ9 A;  3MQQ A;  4K08 A;  3GEC A;  3HJK A;  3MR0 A;  1NLZ A;  2XA7 S;  3UE3 A;  1MZU A;  1S4S A;  3CAX A;  3OC2 A;  2H28 A;  1JNU A;  4GCZ A;  3R7W B;  4ME4 A;  1XJ6 A;  4WEJ A;  5HD3 A;  1GSW A;  4DMZ A;  4HJ4 A;  4WEK A;  2VV8 A;  1IFQ A;  2QWS A;  3R7W A;  4G3K A;  4I3J A;  3LIE A;  2CMN A;  1LL8 A;  2Y79 A;  1S1Y A;  3CIT A;  3EGX C;  2EWV A;  5DKK A;  1OTA A;  3B42 A;  4Y3I A;  4HH3 A;  3EOI A;  4B9O A;  4KQO A;  4GW9 A;  3ZYT A;  3FG8 A;  1UWP X;  4Q0J A;  3KYZ A;  1TS0 A;  1GSX A;  1XJ4 A;  1T1B A;  5AVF A;  3ICY A;  5DKL A;  2L4R A;  2R78 A;  4CLC D;  3TW8 A;  2Y8H A;  4HP9 A;  3IBJ A;  5IS1 A;  2K31 A;  2JKR M;  4HHD A;  5TJJ A;  3LFV A;  1TS6 A;  1TF1 A;  2G7U A;  4HJ3 A;  3B33 A;  3LUQ A;  3NHQ A;  4I38 A;  3E4P A;  1YSP A;  2B02 A;  4JGP A;  1NRJ A;  5HWT A;  4MDZ A;  4MMN A;  3F1N B;  3HJI A;  1EW0 A;  1OJ5 A;  1DRM A;  3UE6 A;  4DJ2 A;  4E04 A;  3EQV A;  4HOI A;  3TRC A;  3DBA A;  4NXE A;  3S7N A;  3F1N A;  1LSV A;  3OCL A;  1V9Z A;  4BBV A;  2O9B A;  3MXQ A;  2W3G A;  3LR0 A;  3B47 A;  5LBR A;  1N9L A;  3C38 A;  3CUE C;  4G3W A;  2M1C A;  2Z6C A;  4FOF A;  4HQA A;  2VV6 A;  2B18 A;  3E0Y A;  2OWH A;  3BY8 A;  4ZRR A;  3LR4 A;  4OOM A;  1OTE A;  5G4Y A;  5HDC A;  2NUP C;  2O0Y A;  2LB5 A;  2PYR A;  4GS9 B;  2W1T B;  2A24 B;  3VV4 A;  2D01 A;  2VZW A;  4ETZ A;  4IUH A;  2JHE A;  5HWW A;  4EEU A;  5AVE A;  4EU0 A;  3LIA A;  4II7 A;  5CX7 A;  1UWN X;  2OAQ 1;  4EET B;  2VJW A;  4GS9 A;  2W1T A;  1N9N A;  2KOI A;  2A24 A;  3F1P B;  4HNB A;  4EXO A;  4JGQ A;  4MCW A;  2GX5 A;  3K2N A;  2JKR I;  2PT7 A;  4I39 A;  4EUV A;  4M4X A;  2WKQ A;  5F6A A;  2W0N A;  4WUJ A;  3S7Q A;  3F1P A;  3KSH A;  5F68 A;  1OT9 A;  1F5M A;  4HIA A;  1H8M A;  2IA2 A;  1V9Y A;  1F98 A;  3TJZ C;  4BBU A;  4KUK A;  2QJ7 A;  4EW7 A;  3E98 A;  3T4S A;  4FSF A;  1N9O A;  3H82 A;  1T19 A;  2K2N A;  3VOL A;  4L9G A;  4QPR A;  3T4K A;  5DJT A;  3LI8 A;  5F69 A;  1OJG A;  3MMH A;  4O0P A;  2XRO A;  2HJE A;  2YKH A;  4NXF A;  3EWK A;  2EWW A;  2J3T C;  3C30 A;  3KX0 X;  4UEY A;  1S4R A;  3UB8 A;  3RFB A;  5J3W A;  2V9A A;  4BWI A;  4DJ3 A;  3RTY A;  4MN7 A;  4JGO A;  2GJ3 A;  1IOU A;  1OT6 A;  5HL6 A;  5AJG A;  4L9F A;  4NXG A;  1MC0 A;  5MC7 A;  3LIC A;  1XFQ A;  3LR5 A;  1XJ3 A;  3NOP C;  3TE8 A;  2PD8 A;  2D02 A;  2VX8 A;  3P01 A;  3PR6 A;  2VGL S;  4YOF A;  1TS8 A;  3MJQ A;  1H3Q A;  4PHT A;  2J3T D;  2O9C A;  5HSQ A;  2ZOI A;  4WF0 A;  3C2W A;  3KSG A;  3OOV A;  3PBO A;  3LYX A;  4EER A;  2PYP A;  4XT2 B;  2JKT M;  3BQ8 A;  3LI9 A;  4I3A A;  4HH2 A;  3E4O A;  4HP4 A;  3EQU A;  3NOU C;  4WN5 A;  3O5Y A;  2XSS A;  3OLO A;  1ODV A;  2L0W A;  4PKY A;  1T1C A;  4YNR A;  4L9E A;  2M7U A;  2W3D A;  3G6O A;  3KSI A;  4JGR A;  4XT2 A;  2XA7 M;  3MQ0 A;  5HPI A;  2QKP A;  4IUK A;  3R4K A;  1DP9 A;  1P97 A;  4CLC B;  4Q0H A;  4BMW A;  4CLC A;  4EEP A;  5KSH A;  1LT0 A;  2A2L A;  3CLO A;  2K7S A;  2PD7 A;  3PBR A;  3RH8 B;  5HDD A;  4WEL A;  5HPF A;  2HJ9 C;  2L1M A;  3CI6 A;  3H9W A;  2KLI A;  3A0S A;  4ETX A;  1LSX A;  2ZBB A;  4R3A A;  3K3D A;  3A0V A;  4BBT A;  2EA9 A;  5HD5 A;  4P6Z S;  4ARZ B;  4R70 A;  3K3C A;  2VEA A;  2ZMV A;  1D7E A;  5TBM B;  3ZQ5 A;  4IJG A;  1P0Z A;  3BWL A;  5KIZ A;  1W63 Q;  4Y2F A;  1STZ A;  2OOL A;  2JKT I;  4NXB A;  4ARZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...