1LSVA

Crystal structure of the co-bound bjfixl heme domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
117
structure length
117
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQELQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein FixL
publication title Structure-based mechanism of O2 sensing and ligand discrimination by the FixL heme domain of Bradyrhizobium japonicum
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Transferase
total genus 31
structure length 117
sequence length 117
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2002-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1lsvA00
5HD5A 2INWA 5F5YA 2P7JA 4HJ3A 3BY8A 3UB9A 4WL9A 4HHDA 4EERA 3UMEA 1UGUA 3IBRA 3VOLA 3UE6A 4EESA 5HDDA 1ODVA 4F3LA 4EQ1A 2L0WA 3OLOA 1DP8A 4NXFA 2OOLA 2WKQA 3A0SA 2BASA 4XT2B 3K3CA 3D72A 1S4RA 4BBVA 3MJQA 2V1BA 2EA9A 1KOUA 5KIZA 4H6JB 4K08A 3BWLA 1NWZA 5TBMA 1XJ6A 3K3DA 4BBUA 3PYPA 5AVEA 2PD8A 4HNBA 1F98A 4DJ3A 3E4OA 4PKYG 2A24A 4RQ9A 4R70A 4R3AA 4EETB 3F1NA 1XJ4A 2H28A 1P0ZA 4JGQA 4HH3A 2PYPA 3FC7A 4HY8A 2PR6A 5G4YA 1T1AA 2ZOIA 3LIFA 4GS9B 2PHYA 3G6OA 3HJIA 1S4SA 3KX0X 1GSXA 4WN5A 3H7WA 3F1OA 2PYRA 1N9OA 4H6JA 2CMNA 4HI4A 4JGOA 3T50A 3ICYA 2JN7A 2VV6A 1LT0A 4GHIA 5HWTA 2B02A 5A8BA 3GECA 4M4XA 5HD3A 4I3IA 3A0VA 2VV7A 1VB6A 4MN6A 4LRXC 2V1AA 4I39A 4YWZA 4R38A 4DJ2A 4EEUA 4R6LA 1UWPX 4L9EA 4HOIA 4NXBA 5DJTA 1BYWA 1OJGA 1F9IA 1OJ5A 3BY9A 5IS1A 3SW1A 5HSQA 2KX6A 4KUOA 1XJ3A 2J80A 2QJ5A 1LSXA 4B9OA 2YKHA 2KDKA 1UWNX 1GSWA 5HZHA 1S1YA 3E4PA 1Y28A 3H9WA 3F1PA 1OT9A 2L1MA 3P7NA 5G4ZA 3UB7A 2JHEA 3NOPC 4HJ4A 3CLOA 3MR0A 3A0RA 1EW0A 2GJ3A 4WF0A 3H82B 3UB8A 4HP9A 5J4EA 1OT6A 4EEPA 3UMDA 5HWWA 1DRMA 2QJ7A 1DP6A 3CAXA 1LL8A 2OWHA 1WA9A 2VEAA 1D06A 1GSVA 1MZUA 4NXEA 2QWSA 2WKPA 2W27A 4EW7A 4KUKA 3IS2B 3LI9A 3MXQA 4MN5A 1XFQA 2PD7A 4XT2A 5HDCA 2ZOHA 3NOTC 3LIDA 4E04A 1TS6A 4JGRA 1OTBA 1V9ZA 4I3AA 1TS7A 3H82A 2D01A 3LI8A 1OTAA 2VV8A 2QKPA 4HP4A 1OTIA 1T19A 2YKFA 4F3LB 3C8CA 1P97A 1D7EA 3MFXA 1N9NA 1XJ2A 4PKYA 3NJAA 4LLOB 3MQOA 3LYXA 5F68A 1X0OA 4HH2A 4I5SA 4L9GA 3VE3A 2PDRA 3IS2A 5TBMB 3UB6A 4GS9A 3MQQA 4NXGA 5EFWA 1S67L 3LIBA 3CWFA 2ZBBA 4GW9A 3LUQA 2A24B 1XFNA 1OTEA 2V9AA 3C2WA 5DKKA 3F1NB 2VLGA 1T1CA 2PR5A 3E4QA 3PHYA 1TS0A 5J7EA 3HJKA 2V0WA 4HQAA 5F69A 2HV1A 3H7WB 3F1OB 5HWVA 4WLAA 4I3JA 4I38A 2V0UA 2WKRA 3GDIA 1TS8A 2Z6DA 4KQDA 4GHIB 5DKLA 5F6AA 2I9VA 1S66L 3EEHA 4JGPA 1OTDA 5I5LA 2D02A 4L9FA 4HIAA 3FG8A 1T18A 3LICA 5HDSA 4EXOA 2OWJA 1LSWA 3ZQ5A 3RH8B 5DJUA 4LRZE 4LPZA 5AVFA 3VE4A 1N9LA 4HJ6A 5J3WA 3NHQA 4LRYC 2QHKA 1LSVA 3LIAA 2R78A 2L4RA 1S1ZA 2Z6CA 1T1BA 3EWKA 3F1PB 1G28A 4WUJA 2M1CA 3RTYA 2K7SA 3LIEA 4GCZA 2W0NA 1V9YA 3NOUC 4BBTA 1JNUA 3B33A 5IU1A 1DP9A 3ULFA
chains in the Genus database with same CATH superfamily
5HD5A 4X69A 1YLPA 2O0YA 3UB9A 4OOMA 4WL9A 4HHDA 3CUEC 4QY6A 1ONHA 3UMEA 1KGEA 3IBRA 1TD5A 4LCLA 3L7HA 3IHAA 2ZJ9A 1ODVA 3ZFZA 2CC1A 4NXFA 1DP8A 1YSPA 3A0SA 4ARZB 1N9BA 1K55A 5FQJA 1RCJA 1MWTA 4UA7A 3NC8A 4JXSA 3SS3A 5CXWA 5KSCA 5TJJA 3MZEA 4H6JB 2NUTC 2XA7S 2ZM8A 1O07A 3U2AA 3UO9A 4K08A 2VKSA 1IELA 3Q07A 1XXMA 5GHZA 4ZJ2A 1KDSA 4JKTA 5AVEA 3WS5A 4ZTKA 4GN2A 3BQAA 3T4KA 4ZDXA 5FQKA 4JF6A 4HNBA 1F98A 2ZC3B 4RQ9A 4OQIA 4R3AA 2HJEA 1ES4A 3CG5A 3IF6C 1IKIA 5MC7A 3C7VA 4HH3A 3NDEA 1NZOA 5A90A 2PR6A 2J9PA 4G3WA 4GS9B 3V3SA 1BULA 3HVFA 3UN7A 1J3WA 2ZD8A 2WGWA 2WYXA 1S4SA 3KX0X 4JPMA 3RFBA 1PFLA 3F1OA 2G2WA 3DTMA 4H6JA 1IYSA 2ZC7A 1YLTA 4JGOA 1CK3A 4R1GA 3T50A 3T1XA 4Y15A 3ICYA 3ISGA 1LT0A 5EVEA 2HP6A 2Y2KA 2P9VA 5HWTA 3IF5A 2BG1A 5HD3A 1K57C 3V50A 4X55A 1VB6A 3GR2A 4R38A 3D4FA 1UWPX 4L9EA 1K6RA 1VEUB 3PBTA 1F9IA 4FH2A 3T4SA 4GB7A 2QZ6A 4LGWA 4DF6A 5FA7A 4JXVA 4DMZA 4ZRRA 4E6WA 3IWQA 5FQMA 1UWNX 1S1YA 3UNWA 1SKFA 2HJ9C 3F1PA 3V39A 1GA9A 2ZQCA 1E3UD 2HDUA 1E4DA 4UA6A 3T1RA 4B93A 3MR0A 3A0RA 4WMCD 3S7QA 2EFXA 2GJ3A 3B42A 5EUAA 2OLUA 2X71A 4MLLA 3IX3A 3NIAA 2Y2MA 3H82B 5FDHA 3UB8A 3T4JA 5AQBA 2WUQA 1OT6A 1NJ4A 3MXRA 3UMDA 3BFGA 4CPKA 5HWWA 3IWOA 3HLBA 2V1ZA 3CAXA 4N1XA 5HW3A 1W79A 4OQGA 1LL8A 1WA9A 1PWGA 5FEFA 1D06A 1MZUA 4NXEA 2EX6A 1IOUA 5F82A 2W27A 2PT7A 1BZAA 5CRFA 5C5KA 2Y4AA 2Y59A 3O5YA 3BFFA 4XT2A 5HDCA 3NOTC 2ZM2A 1Z09A 3W2ZA 1OTBA 3V67A 3ZG0A 4Y2FA 1V9ZA 4N9KA 2GDNA 1TS7A 1JTGA 3H82A 2D01A 3TG9A 3Q7VA 2QKPA 4EBLA 1ZG6A 4O7DA 3VP4A 4F3LB 2A3UA 2G2UA 2XFSA 3VP3A 2MJ6A 3MFXA 4KZ4A 1XJ2A 3LR0A 1JWVA 4BWIA 2JCHA 1A0KA 4BL2A 1TVFA 2VK3A 4AFIA 2VGKA 4PM8A 3OCLA 1BT5A 4O0PA 3UB6A 1GCEA 4S2KA 1OPXA 1K54A 2GNXA 5K5BA 1YSQA 5EPHA 1K55C 1NRJA 5EVIB 3MQQA 1S67L 5HX9A 1L0DA 3LIBA 4KG6A 4S2LA 3AGDA 5EE8A 5EM0A 3T4OA 3LEQA 2NUPC 5IT5A 4LFUA 4ETZA 1YLYA 1KE3A 2JKTI 3E4QA 3CJMA 3OCNA 1YLWA 2PU4A 4GNUA 1QMFA 5F69A 3IH9A 3QNCA 2XD5A 5DTTA 3PXPA 3S7PA 5EV0A 3VFHA 2W3FA 3DAVA 2V0UA 4GD8A 1KVLA 4BD1A 2ZLYA 2JC7A 4P6ZM 4KZ9A 2Z6DA 4GHIB 5DKLA 3EEHA 4JGPA 4EUZA 2VGLS 2WZXA 4PM9A 2XLNA 5FQQA 5FEGA 4WEJA 1SCWA 1T18A 1SDEA 4XUXA 3LICA 5HDSA 4GDBA 3OPHA 3CPTA 3DW0A 3RH8B 2WAEA 1TDGA 2Y2IA 3PBRA 4ZAMA 3E98A 4OQHA 1VETA 3RXWA 4LRZE 1O7EA 5AVFA 3VE4A 2FZ0A 1N9LA 4KZ5A 3Q81A 4Q0IA 4HJ6A 4ID4A 3W4OA 4LRYC 3KYQA 2JBFA 4WM9A 3LIAA 1Y54A 2L4RA 3BFDA 2WK0A 2Z6CA 3EWKA 3WRTA 5M1AA 1G28A 1W63Q 2V20A 3QP1A 2WADA 2J9OA 5L2FA 5E2FA 2XD1A 5E2EA 3NBLA 2VJWA 2W0NA 4B4ZA 3C7UA 1JNUA 4CLCE 5GHXA 1W5DA 3B47A 3ULFA 1KE0A 2INWA 3P98A 2Y2PA 1ES2A 4IVKA 3VV4A 4B4XA 2Y2NA 3BW6A 5HAIA 1XX2A 2Y2HA 3G2YA 5CX7A 4Y5FA 5L07A 2H5SA 4HEFA 3IX4A 3LO7A 4OPQA 4S2NA 4K91A 2Z2LB 2L0WA 2RL3A 1OMEA 3JYIA 2M7VA 1AXBA 4A5RA 4E3LA 3K3CA 3SH9A 4BJPA 5CGWA 1XA7A 3MJQA 2V1BA 2EA9A 1MBLA 1D1JA 3KO6A 2XH9A 3E2KA 4BL3A 3HL9A 2FH5A 4EBNA 2Q0OA 5TBMA 4BBUA 5HAQA 3V3RA 1FQGA 3PYPA 3R7WA 3PTEA 5A91A 3CI6A 1PZPA 4R3BA 3K2NA 3HLDA 2Y2GA 2PD8A 3UDFA 3D9YA 5FAQA 3JVUA 5F1GA 4E3KA 2ZMFA 3E4OA 5FI6A 2A49A 2XDMA 4PKYG 4PAUA 2ZL1B 1PWCA 4PM5A 1NLZA 1DJBA 1CF0A 4CQHA 2H28A 3TJZC 3CHWP 4OP5A 4JGQA 3GMWA 2PYPA 1K4EA 2QPNA 4FTXA 5I94A 3WS0A 5M18A 3DWZA 3KSFA 4II7A 3A3EA 3G6OA 3HJIA 4JF5A 1GSXA 4WN5A 3H7WA 4MDZA 1NRFA 1N9OA 3JVVA 4KZ7A 3SH7A 3WS2A 1L0FA 3NECA 1CJFA 4HI4A 3T4LA 5EOOA 2WGIA 2HGVA 2VV6A 1SKOA 1K54C 2B02A 3VSKA 5A8BA 1HVBA 5FDSA 4OP8A 3E2LA 4FH4A 4X25A 4HBUA 3MS6A 4GD6A 4E3NA 4I39A 4NXBA 1BYWA 3ITAA 4FCFA 3S4XA 5EVLA 3N4IA 2J8YA 5IS1A 5HSQA 1IFQA 4KUOA 1ZHHB 2J80A 2QJ5A 1Q2QA 3LGOA 1ERMA 4KZ6A 2PAVP 1GSWA 5HZHA 4KENB 4OH0A 3E4PA 5DF7A 3WRZA 1PZOA 2L1MA 1F2KA 2HP9A 4R4SA 2HF6A 3T1SA 3UE3A 4PMAA 4ETXA 2P04A 4DE0A 3HREA 1YMXA 4WF0A 5EVIC 5KMWA 1MY8A 3G30A 2P08A 4HP9A 1PW8A 2XR0A 4X53A 4Z9QA 1GA0A 2JKRI 5IHVA 3G4PA 1YPRA 2ZC5B 4K0XA 4QHCA 3M6BA 4Y3IA 2OAQ1 3FPWA 2VEAA 4UAAA 5LBRA 2I72A 1GSVA 2X01A 2QWSA 4FSFA 4KUKA 3IS2B 3C4OA 3LI9A 4Q0HA 4ARZA 3B3XA 4MN5A 1XFQA 1CQAA 2XK1A 2W1RA 4E04A 5FI2A 3S1YA 3BYDA 1MKMA 3FV7A 4LV3A 4BLMA 3QP6A 5HPFA 2KOIA 3BFCA 4RA7A 3C8CA 1YLJA 2JKTM 4UQIS 3HLCA 4S2IA 5EOEA 1N9NA 3BQ8A 2OAP1 4PKYA 4KG5A 2Q9NA 2Y91A 3MQOA 4S2NC 4PPRA 1C3BA 5AQAA 1FR6A 2ZQ9A 1DJCA 4HH2A 5L8MA 4D60A 1ZKJA 3IS2A 5DTKA 3I7JA 4GS9A 5HFOA 1YKDA 4NXGA 1J9MA 3MMHA 1MKIA 4L0LA 4P0MA 4OVDA 4OOYA 3O87A 4GW9A 3EQVA 1ALQA 3LUQA 2A24B 2V9AA 4K0WA 3UE0A 3F1NB 2PR5A 3CZDA 3PHYA 3BLMA 1GHPA 2V0WA 1K38A 1VHMA 4WZ5A 5AQ9A 4OKPA 4FUWA 1VEUA 4QU3A 5HWVA 1MC0A 2ZM0A 3ZYTA 5DFXA 4I38A 4C3QA 4MN7A 3U4LP 2VZWA 3FZCA 4EQIA 4EU0A 2OV5A 3GDIA 4KQDA 5L09A 5DF8A 3VOYA 2EXBA 2I9VA 5F6AA 1S66L 1OTDA 2D02A 2GX5A 4HIAA 5D3OA 3FG8A 4R4RA 4EXOA 3Q7ZA 1LSWA 3ZCZA 4Y0UA 3GVBA 2XQZA 3L9KA 4Y7PA 5DJUA 4IUKA 2HPBA 1XPBA 4EUVA 3HLEA 3Q82A 4S2PA 3T12B 3N8RA 1HLUP 3BJNA 4S2OA 1ZTUA 1T1BA 3LY3A 1SHVA 3IWIA 3BM6A 1LL9A 2M1CA 4LENA 3OOVA 1CI8A 3RTYA 2J3WA 1V9YA 1FOFA 1I5QA 3O88A 1NY0A 3NCKA 4IBXA 4R0QA 2W1TB 4BQMA 5F1FA 4QB8A 3NOUC 4GLQA 3IH8A 4BBTA 4JXWA 4CLCB 4JBFA 2O9BA 2P7JA 2FFFB 4MMNA 4NK3A 4D2OA 4QD4A 3EOIA 3BY8A 2XA7M 3LFVA 3HBRA 1XKZA 4WYYA 2BLSA 4O01A 3TRCA 3ITBA 3VOLA 2H10A 2K31A 3UE6A 3UDXA 4KQQA 4EESA 5HARA 3G34A 4JLFA 3OPPA 1FSWA 4F3LA 4WZ4A 4EQ1A 3N6IA 2Y2JA 3OLOA 2OOLA 2WKQA 2IWDA 2DMWA 2UV0E 4OOLA 2J3TC 4EWFA 2VA0A 4RX2A 2BASA 3EGDC 3NULA 1FIKA 3D72A 2Y2LA 3PBSA 4DN0A 4BBVA 4NKPA 5KIZA 4E3OA 2QYBA 3V5MA 5CHJA 4MEZA 2EXAA 1NWZA 1XJ6A 1MPLA 4CLCA 1G5UA 3IF6B 4Y0TA 3UB5P 4RVAA 4BMWA 5EVIA 1S6RA 3MF0A 3IXHA 2R9WA 2UWXA 2G7UA 2E8JA 5E2HA 3G35A 4DJ3A 4R70A 3MKFA 2JKGA 2P74A 3FC7A 1IKGA 4HY8A 1MWRA 1YAXA 3KSHA 4DKIA 1T1AA 2ZOIA 3LIFA 1AWIA 2PHYA 2LB9A 3IHBA 4JF4A 4BD0A 4U3TA 4IHQA 3ZNYA 3C4PA 2O99A 1XA1A 2V8CA 5HL6A 2CMNA 4EV4A 3OPLA 3IXGA 2K2NA 1IEMA 2JN7A 1ES3A 3NI9A 3N8SA 4GHIA 5AQ7A 1TDLA 2PU2A 4PM7A 3GECA 5CEDA 4M4XA 3RXXA 3EQUA 3A0VA 3QP8A 2VV7A 4E3IA 2XSSA 4MN6A 3CITA 4LRXC 3SOIA 2V1AA 1K4FA 2WKIA 1I2WA 4CJNA 4DJ2A 3C5AA 3M2JA 5DVAA 5HL1A 3WWXA 1OJGA 3EEAA 2JKRM 2WGVA 1RGZA 1OJ5A 3BY9A 2A2LA 3SW1A 1L3LA 2KX6A 2V2FF 3IXBA 1XJ3A 2ZC4B 3UPNA 4WZ5C 3ZHHA 1EI5A 4B9OA 4DDYA 2YKHA 4RX3A 1SDNA 3IXDA 3BECA 1ZG4A 5A93A 1OT9A 1BTLA 3P7NA 3UB7A 1H5XA 4Z1WA 2B18A 2JHEA 1HZOA 5KZHA 1H8MA 4E6XA 1H8ZA 2IA2A 3VP0A 3C30A 3QP2A 1PW1A 2Y8HA 1N4OA 4DE1A 4QWOA 5FL3A 3HUNA 2GZAA 5J4EA 1P9WA 3DBAA 4NEED 1Q2PA 2QJ7A 1BLSA 3TOIA 2ZQ8A 3G32A 3T4TA 1JWPA 2OWHA 4X68A 1P9RA 2HP5A 5JYPA 2WZZA 4IUHA 3ZDJA 3KYEA 5FSRA 4N1HA 4EBPA 3CMZA 3GQZA 2VX8A 4DRTA 2HDRA 4EW7A 4F94A 1NYMA 5FI7A 5CEBA 5CGXA 2C6WB 1IYPA 2ZMVA 1FR1A 3AGFA 5GHYA 2ZOHA 2EX9A 5U47A 1TS6A 4JGRA 5A92A 2DRWA 2VGJA 1STZA 2W3HA 4ZJ1A 3LI8A 1OTAA 2VV8A 4R23A 1IYOA 4HP4A 4NETA 4OPYA 2YKFA 4KZ8A 1EROA 1P97A 1D7EA 3OC2A 4CLCD 2OSUA 3A3IA 1XGJA 5EVID 4LLOB 4O8GA 1W8QA 4PHTA 3ZNTA 2ZL1A 2ACGA 3ZG9B 2WKHA 2V8FA 4H8RA 2H0TA 1X0OA 3FWLA 4I5SA 3TW8A 1Z6FA 4L9GA 1CEGA 3SS4A 4OONA 4QY5A 1GHIA 3EGXC 1FCMA 5G18A 4U0TA 5EFWA 2C5WB 2WAFA 3CWFA 2ZQAA 3PBNA 3BRMA 5AJGA 3BEBA 5HPIA 1OTEA 4CLCC 4Y13A 5DKKA 3MSHA 1T1CA 2VGLM 5GLAA 4X1LA 4BENA 2XFTA 1FCNA 1TS0A 4XUZA 3P09A 3BLSA 1KGGA 4JXGA 2WGWB 4OPRA 2HV1A 4IBRA 4OPZA 3Q1FA 1LI9A 3F1OB 3LCEA 4WLAA 4I3JA 3GRJA 5HAPA 1L2SA 4YINA 3S7OA 5DF9A 3UPOA 2P9VB 3VP2A 1K56A 4MBHA 4N9LA 5FATA 1PI5A 1MWSA 3IX8A 4R3JA 1E25A 3S7NA 4FOFA 3QP4A 4LCMA 1FCOA 4DDSA 2ZMAA 2OWJA 1S0WA 4YFMA 3OZHA 4YOFA 2QMIA 4P85A 5EM1A 5EECA 3MZFA 5CHMA 4P6ZS 3FKWA 5L10A 3T1QB 3PBOA 3SZTA 1GHMA 3PR6A 4ESPA 4Q8IA 2Q9MA 4G3VA 4YNRA 3F1PB 4WUJA 3T4QA 3ZG7B 1H8YA 4KZBA 1H3QA 4Q0JA 2K7SA 2PRFA 1YM1A 3NDGA 4LV1A 1IYQA 1F5MA 1BLCA 1DJAA 1QMEA 3B33A 2FFYA 2H0YA 4KQOA 1ERQA 5F5YA 4GDNA 2XF3A 3GSGA 1BLHA 4HJ3A 1KVMA 5M19A 4DXCA 4X56A 3VFFA 4LV0A 3ZG8B 3DTEA 1YQSA 2Y2QA 1G6OA 2O9CA 4EERA 1G6AA 1K0KA 1DY6A 3UE1A 1UGUA 3TSGA 3HLGA 1BUEA 5HDDA 4Y17A 1W8YA 3A3DA 3HUOA 5TGFA 4DE3A 1LHYA 4UA9A 2Y2OA 4XT2B 1LI0A 4P6BA 1S4RA 1K6SA 1KE4A 1KOUA 3HCYA 4M3KA 2XGNA 1TF1A 3BWLA 3Q7VB 3PBQA 3K3DA 2EWVA 2HDSA 5E2GA 1RP5A 1NLYA 3KSIA 4S2JA 2W3DA 1NXYA 1U60A 3ZGAB 1MWUA 2A24A 3ZVTA 3C38A 4WELA 4EETB 2E8IA 3F1NA 1XJ4A 3QP5A 1HD8A 1P0ZA 4XXRA 5KSHA 5F83A 2B95A 1ESUA 1RGYA 5TFQA 5GL9A 5G4YA 3LEZA 3A3FA 4GOGA 4KQRA 1CI9A 3MBZA 2PYRA 4ZJ3A 1BSGA 3LR5A 4QJGA 4MCWA 2J3TD 1VQQA 4MBKA 2EX8A 1WE4A 3ZVWA 1Y4OA 3LR4A 4GKUA 4I3IA 2IWCA 3QNBA 1K56D 4KZAA 2M7UA 4YWZA 4QPRA 1JVJA 4U0XA 4EEUA 4R6LA 3KYZA 2DNSA 4OQ0A 4HOIA 5DJTA 3VP1A 4ME4A 1I2SA 4N92A 3UPPA 1ESIA 5DFYA 3MKEA 1NYYA 2J7VA 5GLBA 1LSXA 2W3GA 2KDKA 3AGEA 3R4KA 4E3MA 1Y28A 3H9WA 3CPTB 5G4ZA 3LY4A 3NOPC 4HJ4A 3CLOA 3DTIA 2Z2MB 3PAGA 5CTNA 1EW0A 1VETB 1M6KA 3IQAA 1JWZA 3DWKA 2W1TA 3CUEA 1L0GA 2XRNA 2EFUA 2AVXA 3HLWA 1EWZA 3BFEA 2HZ5A 4PM6A 3FYZA 4EEPA 3IT9A 1DRMA 3QHYA 1DP6A 5FQ9A 1W7FA 4UEYA 3W4QA 5JYOA 5TR7A 2BTFP 3VSLA 1PRQA 2WKPA 4UQIM 2Y79A 2HDQA 2JE5A 3E0YA 4C75A 2PBYA 5DTSA 1KGFA 4KZ3A 2EX2A 3MXQA 4WBGA 1WYBA 3N7WA 1K25A 2PD7A 3G2ZA 3P01A 2EWWA 3LIDA 2RCXA 2XEPA 3PAEA 1YLZA 3OPRA 2R9XA 4I3AA 2O9AA 3MZDA 3UDIA 4HESA 4MBFA 5CHUA 1OTIA 3IF6A 1T19A 3HUMA 1VM1A 2DCFA 3SH8A 3ZG5A 1ACFA 4RYEA 4DE2A 3NJAA 3SS5A 3W8KA 3LYXA 4OLDA 5CERA 5F68A 1ONGA 2XROA 1ZC2A 1LL5A 1KDWA 5CTMA 3VE3A 1NZUA 2PDRA 5TBMB 1M40A 2OLVA 3M6HA 4WEKA 3VOZA 3R7WB 3GTCA 4B88A 3GV9A 3UY6A 5BOHA 1K57A 1LLBA 2ZQ7A 1XGIA 1CEFA 1PYYA 5FASA 4ZBEA 3WS1A 2ZBBA 5E43A 4C6YA 5CECA 1XFNA 2ZC6B 2Y55A 3C2WA 3WS4A 1PNEA 2VLGA 3M2KA 1PWDA 3W4PA 1H0MA 4GZBA 5J7EA 3HJKA 3MFDA 4HQAA 3NY4A 5GLCA 1W63M 4NG2A 4IJGA 4LV2A 5J8XA 4E3JA 4MNRA 3H7WB 1G68A 3O86A 1L0EA 1PIOA 5FQIA 1FILA 3VMAA 1TEMA 2B5RA 2WKRA 3D3OA 1TS8A 5CGSA 1SKOB 1MXOA 2PBDP 4X1MA 1YT4A 5I5LA 1FSYA 1WYCA 4L9FA 3DTKA 2KLIA 1PI4A 5GLDA 1XP4A 2ZQDA 3ZQ5A 3MQ0A 3FPVA 4G3KA 4FD8A 2W3EA 3IBJA 5FAOA 3LR3A 3JPUA 4LPZA 4Y0OA 5FAPA 1JTDA 4IEDA 3S22A 3MXSA 3RJUA 2JKFA 5J3WA 2IWBA 3NHQA 4S2MA 2QHKA 3FKVA 1E3UA 1ES5A 4X6TA 2LB5A 1LSVA 3KSGA 1BLPA 2R78A 3TE8A 1YMSA 1S1ZA 3G31A 4OLGA 3HLFA 1SZVA 4WMCA 2WKEA 4P87A 4HBTA 2X02A 3OBFA 3LIEA 4GCZA 1HTZA 4GJ4A 4KG2A 3O3VA 3N8LA 4DXBA 5IU1A 3A3JA 4IVIA 4UHUA 1DP9A
chains in the Genus database with same CATH topology
5HD5A 2INWA 2O9BA 5F5YA 2P7JA 4MMNA 3VV4A 4HJ3A 3BW6A 2O0YA 3EOIA 3BY8A 2XA7M 5CX7A 3UB9A 3LFVA 4OOMA 4Y5FA 4WL9A 4HHDA 3CUEC 1G6OA 2O9CA 4EERA 3UMEA 4O01A 3TRCA 1UGUA 3IBRA 3VOLA 2K31A 1TD5A 3UE6A 4EESA 5HDDA 1ODVA 4F3LA 4EQ1A 2L0WA 3OLOA 1DP8A 4NXFA 2OOLA 2WKQA 1YSPA 2DMWA 4OOLA 2J3TC 3A0SA 4ARZB 2M7VA 2VA0A 2BASA 4XT2B 3K3CA 3EGDC 4BJPA 3D72A 3PBSA 1S4RA 4DN0A 4BBVA 4NKPA 3MJQA 2V1BA 2EA9A 1KOUA 5TJJA 4H6JB 5KIZA 2NUTC 2XA7S 3HCYA 2QYBA 3KO6A 3U2AA 4K08A 1TF1A 3BWLA 2FH5A 1NWZA 2VKSA 3PBQA 1XJ6A 5TBMA 3K3DA 4CLCA 4BBUA 2EWVA 3PYPA 3R7WA 4BMWA 1NLYA 3KSIA 3MF0A 5AVEA 3CI6A 2W3DA 3BQAA 3T4KA 3K2NA 2G7UA 2PD8A 3JVUA 4HNBA 1F98A 2ZMFA 3E4OA 4DJ3A 4PKYG 2A24A 4RQ9A 4R70A 4R3AA 2HJEA 4PAUA 3C38A 4WELA 4EETB 1NLZA 4CQHA 3F1NA 1XJ4A 2H28A 3TJZC 5MC7A 1P0ZA 4JGQA 4HH3A 5KSHA 2PYPA 3FC7A 4HY8A 2PR6A 4G3WA 1YAXA 3KSFA 5G4YA 4II7A 3KSHA 1T1AA 2ZOIA 3LIFA 4GS9B 2PHYA 3G6OA 3HJIA 1S4SA 3KX0X 1GSXA 2LB9A 4WN5A 3RFBA 3H7WA 4MDZA 3F1OA 2PYRA 1N9OA 3JVVA 4IHQA 4H6JA 2O99A 5HL6A 2CMNA 4HI4A 3T4LA 3LR5A 2K2NA 4JGOA 3T50A 3ICYA 4MCWA 2HGVA 2JN7A 2VV6A 1LT0A 2J3TD 3ULFA 4GHIA 5HWTA 2B02A 5A8BA 3GECA 4M4XA 3LR4A 3EQUA 5HD3A 4I3IA 3A0VA 2VV7A 2XSSA 1VB6A 4MN6A 3CITA 4LRXC 2V1AA 4I39A 2M7UA 4YWZA 4R38A 4DJ2A 4QPRA 4EEUA 4R6LA 3KYZA 1UWPX 4L9EA 4HOIA 4NXBA 3PBTA 5DJTA 1BYWA 1OJGA 3EEAA 1F9IA 3T4SA 2JKRM 4ME4A 1OJ5A 3BY9A 5IS1A 2A2LA 3SW1A 5HSQA 2KX6A 5DFYA 1IFQA 4KUOA 1XJ3A 1ZHHB 2J80A 2QJ5A 4DMZA 1LSXA 4ZRRA 4B9OA 2YKHA 2W3GA 2KDKA 1UWNX 1GSWA 5HZHA 1S1YA 3E4PA 3R4KA 1Y28A 2HJ9C 3H9WA 3F1PA 1OT9A 2L1MA 3P7NA 5G4ZA 3UB7A 2HF6A 4Z1WA 2B18A 2JHEA 3NOPC 3UE3A 4B93A 4HJ4A 3CLOA 4ETXA 2P04A 3MR0A 3A0RA 1EW0A 3S7QA 2GJ3A 1H8MA 3B42A 4WF0A 2W1TA 3CUEA 2IA2A 3C30A 3H82B 3UB8A 2XRNA 2Y8HA 2P08A 3T4JA 4HP9A 5FL3A 2GZAA 5J4EA 1P9WA 1OT6A 2JKRI 3DBAA 4EEPA 3UMDA 4NEED 5HWWA 1DRMA 2QJ7A 1DP6A 3CAXA 3T4TA 4Y3IA 4UEYA 2OAQ1 1LL8A 2OWHA 1P9RA 3FPWA 1WA9A 2VEAA 4IUHA 5LBRA 1D06A 1GSVA 1MZUA 4NXEA 2QWSA 2WKPA 1IOUA 4UQIM 4FSFA 2W27A 2PT7A 2Y79A 2VX8A 3E0YA 4EW7A 5C5KA 4KUKA 3IS2B 3LI9A 4Q0HA 3O5YA 4ARZA 3MXQA 4MN5A 1XFQA 2ZMVA 2PD7A 4XT2A 5HDCA 2ZOHA 3P01A 3NOTC 2W1RA 2EWWA 3LIDA 4E04A 1TS6A 4JGRA 3W2ZA 1OTBA 3V67A 4Y2FA 1V9ZA 4I3AA 1STZA 1TS7A 2O9AA 1MKMA 2W3HA 3H82A 2D01A 3LI8A 1OTAA 2VV8A 2QKPA 4HP4A 1OTIA 5HPFA 2KOIA 1T19A 2YKFA 4F3LB 3C8CA 2JKTM 4UQIS 1P97A 1D7EA 3OC2A 4CLCD 2MJ6A 3MFXA 1N9NA 3BQ8A 2OAP1 1XJ2A 4PKYA 3LR0A 3NJAA 4BWIA 4LLOB 4O8GA 3MQOA 4PHTA 3LYXA 5F68A 4AFIA 2XROA 1X0OA 4HH2A 4I5SA 5L8MA 3TW8A 3OCLA 4L9GA 3VE3A 2PDRA 3IS2A 5TBMB 4O0PA 3UB6A 3EGXC 1OPXA 4WEKA 2GNXA 5K5BA 4GS9A 1YSQA 3R7WB 1NRJA 1YKDA 3MQQA 4NXGA 5EFWA 3MMHA 1S67L 4L0LA 3LIBA 3CWFA 3PBNA 2ZBBA 4GW9A 5AJGA 3EQVA 3LUQA 3T4OA 2A24B 1XFNA 5HPIA 2NUPC 1OTEA 2V9AA 5IT5A 4CLCC 3C2WA 5DKKA 3F1NB 4ETZA 2VLGA 1T1CA 2PR5A 2VGLM 3E4QA 2JKTI 3PHYA 1TS0A 3OCNA 5J7EA 3HJKA 2V0WA 1VHMA 4HQAA 5F69A 1W63M 4IJGA 2HV1A 3PXPA 3H7WB 3S7PA 3F1OB 5HWVA 1MC0A 4WLAA 2W3FA 4I3JA 3ZYTA 5DFXA 4I38A 2V0UA 4MN7A 2VZWA 4EU0A 4P6ZM 2WKRA 3D3OA 1TS8A 2Z6DA 3GDIA 4KQDA 3S7OA 5DF9A 4GHIB 5DKLA 2I9VA 5F6AA 1S66L 3EEHA 4JGPA 1OTDA 5I5LA 2VGLS 2D02A 2GX5A 4L9FA 4HIAA 4WEJA 2KLIA 3FG8A 3S7NA 4FOFA 1T18A 3LICA 5HDSA 4EXOA 2OWJA 1LSWA 3ZQ5A 3RH8B 4YOFA 3PBRA 3MQ0A 3FPVA 4G3KA 5DJUA 3E98A 4IUKA 2W3EA 3IBJA 3LR3A 4EUVA 4LRZE 4LPZA 5AVFA 3VE4A 2FZ0A 1N9LA 4P6ZS 4Q0IA 4HJ6A 5J3WA 3PBOA 3NHQA 4LRYC 3KYQA 3PR6A 2QHKA 2LB5A 1LSVA 3BJNA 3LIAA 3KSGA 2R78A 2L4RA 3TE8A 1S1ZA 1ZTUA 2Z6CA 1T1BA 4G3VA 4YNRA 3EWKA 3F1PB 1G28A 1W63Q 4WUJA 3T4QA 2M1CA 3OOVA 1H3QA 4Q0JA 3RTYA 2J3WA 2K7SA 3OBFA 2VJWA 3LIEA 4GCZA 2W0NA 1V9YA 4GJ4A 2W1TB 1F5MA 3NOUC 4GLQA 4BBTA 1JNUA 3B33A 5IU1A 4CLCE 3B47A 4KQOA 4CLCB 1DP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HD5 A;  2INW A;  5F5Y A;  2P7J A;  4HJ3 A;  3BY8 A;  3UB9 A;  4WL9 A;  4HHD A;  4EER A;  3UME A;  1UGU A;  3IBR A;  3VOL A;  3UE6 A;  4EES A;  5HDD A;  1ODV A;  4F3L A;  4EQ1 A;  2L0W A;  3OLO A;  1DP8 A;  4NXF A;  2OOL A;  2WKQ A;  3A0S A;  2BAS A;  4XT2 B;  3K3C A;  3D72 A;  1S4R A;  4BBV A;  3MJQ A;  2V1B A;  2EA9 A;  1KOU A;  5KIZ A;  4H6J B;  4K08 A;  3BWL A;  1NWZ A;  5TBM A;  1XJ6 A;  3K3D A;  4BBU A;  3PYP A;  5AVE A;  2PD8 A;  4HNB A;  1F98 A;  4DJ3 A;  3E4O A;  4PKY G;  2A24 A;  4RQ9 A;  4R70 A;  4R3A A;  4EET B;  3F1N A;  1XJ4 A;  2H28 A;  1P0Z A;  4JGQ A;  4HH3 A;  2PYP A;  3FC7 A;  4HY8 A;  2PR6 A;  5G4Y A;  1T1A A;  2ZOI A;  3LIF A;  4GS9 B;  2PHY A;  3G6O A;  3HJI A;  1S4S A;  3KX0 X;  1GSX A;  4WN5 A;  3H7W A;  3F1O A;  2PYR A;  1N9O A;  4H6J A;  2CMN A;  4HI4 A;  4JGO A;  3T50 A;  3ICY A;  2JN7 A;  2VV6 A;  1LT0 A;  4GHI A;  5HWT A;  2B02 A;  5A8B A;  3GEC A;  4M4X A;  5HD3 A;  4I3I A;  3A0V A;  2VV7 A;  1VB6 A;  4MN6 A;  4LRX C;  2V1A A;  4I39 A;  4YWZ A;  4R38 A;  4DJ2 A;  4EEU A;  4R6L A;  1UWP X;  4L9E A;  4HOI A;  4NXB A;  5DJT A;  1BYW A;  1OJG A;  1F9I A;  1OJ5 A;  3BY9 A;  5IS1 A;  3SW1 A;  5HSQ A;  2KX6 A;  4KUO A;  1XJ3 A;  2J80 A;  2QJ5 A;  1LSX A;  4B9O A;  2YKH A;  2KDK A;  1UWN X;  1GSW A;  5HZH A;  1S1Y A;  3E4P A;  1Y28 A;  3H9W A;  3F1P A;  1OT9 A;  2L1M A;  3P7N A;  5G4Z A;  3UB7 A;  2JHE A;  3NOP C;  4HJ4 A;  3CLO A;  3MR0 A;  3A0R A;  1EW0 A;  2GJ3 A;  4WF0 A;  3H82 B;  3UB8 A;  4HP9 A;  5J4E A;  1OT6 A;  4EEP A;  3UMD A;  5HWW A;  1DRM A;  2QJ7 A;  1DP6 A;  3CAX A;  1LL8 A;  2OWH A;  1WA9 A;  2VEA A;  1D06 A;  1GSV A;  1MZU A;  4NXE A;  2QWS A;  2WKP A;  2W27 A;  4EW7 A;  4KUK A;  3IS2 B;  3LI9 A;  3MXQ A;  4MN5 A;  1XFQ A;  2PD7 A;  4XT2 A;  5HDC A;  2ZOH A;  3NOT C;  3LID A;  4E04 A;  1TS6 A;  4JGR A;  1OTB A;  1V9Z A;  4I3A A;  1TS7 A;  3H82 A;  2D01 A;  3LI8 A;  1OTA A;  2VV8 A;  2QKP A;  4HP4 A;  1OTI A;  1T19 A;  2YKF A;  4F3L B;  3C8C A;  1P97 A;  1D7E A;  3MFX A;  1N9N A;  1XJ2 A;  4PKY A;  3NJA A;  4LLO B;  3MQO A;  3LYX A;  5F68 A;  1X0O A;  4HH2 A;  4I5S A;  4L9G A;  3VE3 A;  2PDR A;  3IS2 A;  5TBM B;  3UB6 A;  4GS9 A;  3MQQ A;  4NXG A;  5EFW A;  1S67 L;  3LIB A;  3CWF A;  2ZBB A;  4GW9 A;  3LUQ A;  2A24 B;  1XFN A;  1OTE A;  2V9A A;  3C2W A;  5DKK A;  3F1N B;  2VLG A;  1T1C A;  2PR5 A;  3E4Q A;  3PHY A;  1TS0 A;  5J7E A;  3HJK A;  2V0W A;  4HQA A;  5F69 A;  2HV1 A;  3H7W B;  3F1O B;  5HWV A;  4WLA A;  4I3J A;  4I38 A;  2V0U A;  2WKR A;  3GDI A;  1TS8 A;  2Z6D A;  4KQD A;  4GHI B;  5DKL A;  5F6A A;  2I9V A;  1S66 L;  3EEH A;  4JGP A;  1OTD A;  5I5L A;  2D02 A;  4L9F A;  4HIA A;  3FG8 A;  1T18 A;  3LIC A;  5HDS A;  4EXO A;  2OWJ A;  1LSW A;  3ZQ5 A;  3RH8 B;  5DJU A;  4LRZ E;  4LPZ A;  5AVF A;  3VE4 A;  1N9L A;  4HJ6 A;  5J3W A;  3NHQ A;  4LRY C;  2QHK A;  1LSV A;  3LIA A;  2R78 A;  2L4R A;  1S1Z A;  2Z6C A;  1T1B A;  3EWK A;  3F1P B;  1G28 A;  4WUJ A;  2M1C A;  3RTY A;  2K7S A;  3LIE A;  4GCZ A;  2W0N A;  1V9Y A;  3NOU C;  4BBT A;  1JNU A;  3B33 A;  5IU1 A;  1DP9 A;  3ULF A; 
#chains in the Genus database with same CATH topology
 5HD5 A;  4X69 A;  1YLP A;  2O0Y A;  3UB9 A;  4OOM A;  4WL9 A;  4HHD A;  3CUE C;  4QY6 A;  1ONH A;  3UME A;  1KGE A;  3IBR A;  1TD5 A;  4LCL A;  3L7H A;  3IHA A;  2ZJ9 A;  1ODV A;  3ZFZ A;  2CC1 A;  4NXF A;  1DP8 A;  1YSP A;  3A0S A;  4ARZ B;  1N9B A;  1K55 A;  5FQJ A;  1RCJ A;  1MWT A;  4UA7 A;  3NC8 A;  4JXS A;  3SS3 A;  5CXW A;  5KSC A;  5TJJ A;  3MZE A;  4H6J B;  2NUT C;  2XA7 S;  2ZM8 A;  1O07 A;  3U2A A;  3UO9 A;  4K08 A;  2VKS A;  1IEL A;  3Q07 A;  1XXM A;  5GHZ A;  4ZJ2 A;  1KDS A;  4JKT A;  5AVE A;  3WS5 A;  4ZTK A;  4GN2 A;  3BQA A;  3T4K A;  4ZDX A;  5FQK A;  4JF6 A;  4HNB A;  1F98 A;  2ZC3 B;  4RQ9 A;  4OQI A;  4R3A A;  2HJE A;  1ES4 A;  3CG5 A;  3IF6 C;  1IKI A;  5MC7 A;  3C7V A;  4HH3 A;  3NDE A;  1NZO A;  5A90 A;  2PR6 A;  2J9P A;  4G3W A;  4GS9 B;  3V3S A;  1BUL A;  3HVF A;  3UN7 A;  1J3W A;  2ZD8 A;  2WGW A;  2WYX A;  1S4S A;  3KX0 X;  4JPM A;  3RFB A;  1PFL A;  3F1O A;  2G2W A;  3DTM A;  4H6J A;  1IYS A;  2ZC7 A;  1YLT A;  4JGO A;  1CK3 A;  4R1G A;  3T50 A;  3T1X A;  4Y15 A;  3ICY A;  3ISG A;  1LT0 A;  5EVE A;  2HP6 A;  2Y2K A;  2P9V A;  5HWT A;  3IF5 A;  2BG1 A;  5HD3 A;  1K57 C;  3V50 A;  4X55 A;  1VB6 A;  3GR2 A;  4R38 A;  3D4F A;  1UWP X;  4L9E A;  1K6R A;  1VEU B;  3PBT A;  1F9I A;  4FH2 A;  3T4S A;  4GB7 A;  2QZ6 A;  4LGW A;  4DF6 A;  5FA7 A;  4JXV A;  4DMZ A;  4ZRR A;  4E6W A;  3IWQ A;  5FQM A;  1UWN X;  1S1Y A;  3UNW A;  1SKF A;  2HJ9 C;  3F1P A;  3V39 A;  1GA9 A;  2ZQC A;  1E3U D;  2HDU A;  1E4D A;  4UA6 A;  3T1R A;  4B93 A;  3MR0 A;  3A0R A;  4WMC D;  3S7Q A;  2EFX A;  2GJ3 A;  3B42 A;  5EUA A;  2OLU A;  2X71 A;  4MLL A;  3IX3 A;  3NIA A;  2Y2M A;  3H82 B;  5FDH A;  3UB8 A;  3T4J A;  5AQB A;  2WUQ A;  1OT6 A;  1NJ4 A;  3MXR A;  3UMD A;  3BFG A;  4CPK A;  5HWW A;  3IWO A;  3HLB A;  2V1Z A;  3CAX A;  4N1X A;  5HW3 A;  1W79 A;  4OQG A;  1LL8 A;  1WA9 A;  1PWG A;  5FEF A;  1D06 A;  1MZU A;  4NXE A;  2EX6 A;  1IOU A;  5F82 A;  2W27 A;  2PT7 A;  1BZA A;  5CRF A;  5C5K A;  2Y4A A;  2Y59 A;  3O5Y A;  3BFF A;  4XT2 A;  5HDC A;  3NOT C;  2ZM2 A;  1Z09 A;  3W2Z A;  1OTB A;  3V67 A;  3ZG0 A;  4Y2F A;  1V9Z A;  4N9K A;  2GDN A;  1TS7 A;  1JTG A;  3H82 A;  2D01 A;  3TG9 A;  3Q7V A;  2QKP A;  4EBL A;  1ZG6 A;  4O7D A;  3VP4 A;  4F3L B;  2A3U A;  2G2U A;  2XFS A;  3VP3 A;  2MJ6 A;  3MFX A;  4KZ4 A;  1XJ2 A;  3LR0 A;  1JWV A;  4BWI A;  2JCH A;  1A0K A;  4BL2 A;  1TVF A;  2VK3 A;  4AFI A;  2VGK A;  4PM8 A;  3OCL A;  1BT5 A;  4O0P A;  3UB6 A;  1GCE A;  4S2K A;  1OPX A;  1K54 A;  2GNX A;  5K5B A;  1YSQ A;  5EPH A;  1K55 C;  1NRJ A;  5EVI B;  3MQQ A;  1S67 L;  5HX9 A;  1L0D A;  3LIB A;  4KG6 A;  4S2L A;  3AGD A;  5EE8 A;  5EM0 A;  3T4O A;  3LEQ A;  2NUP C;  5IT5 A;  4LFU A;  4ETZ A;  1YLY A;  1KE3 A;  2JKT I;  3E4Q A;  3CJM A;  3OCN A;  1YLW A;  2PU4 A;  4GNU A;  1QMF A;  5F69 A;  3IH9 A;  3QNC A;  2XD5 A;  5DTT A;  3PXP A;  3S7P A;  5EV0 A;  3VFH A;  2W3F A;  3DAV A;  2V0U A;  4GD8 A;  1KVL A;  4BD1 A;  2ZLY A;  2JC7 A;  4P6Z M;  4KZ9 A;  2Z6D A;  4GHI B;  5DKL A;  3EEH A;  4JGP A;  4EUZ A;  2VGL S;  2WZX A;  4PM9 A;  2XLN A;  5FQQ A;  5FEG A;  4WEJ A;  1SCW A;  1T18 A;  1SDE A;  4XUX A;  3LIC A;  5HDS A;  4GDB A;  3OPH A;  3CPT A;  3DW0 A;  3RH8 B;  2WAE A;  1TDG A;  2Y2I A;  3PBR A;  4ZAM A;  3E98 A;  4OQH A;  1VET A;  3RXW A;  4LRZ E;  1O7E A;  5AVF A;  3VE4 A;  2FZ0 A;  1N9L A;  4KZ5 A;  3Q81 A;  4Q0I A;  4HJ6 A;  4ID4 A;  3W4O A;  4LRY C;  3KYQ A;  2JBF A;  4WM9 A;  3LIA A;  1Y54 A;  2L4R A;  3BFD A;  2WK0 A;  2Z6C A;  3EWK A;  3WRT A;  5M1A A;  1G28 A;  1W63 Q;  2V20 A;  3QP1 A;  2WAD A;  2J9O A;  5L2F A;  5E2F A;  2XD1 A;  5E2E A;  3NBL A;  2VJW A;  2W0N A;  4B4Z A;  3C7U A;  1JNU A;  4CLC E;  5GHX A;  1W5D A;  3B47 A;  3ULF A;  1KE0 A;  2INW A;  3P98 A;  2Y2P A;  1ES2 A;  4IVK A;  3VV4 A;  4B4X A;  2Y2N A;  3BW6 A;  5HAI A;  1XX2 A;  2Y2H A;  3G2Y A;  5CX7 A;  4Y5F A;  5L07 A;  2H5S A;  4HEF A;  3IX4 A;  3LO7 A;  4OPQ A;  4S2N A;  4K91 A;  2Z2L B;  2L0W A;  2RL3 A;  1OME A;  3JYI A;  2M7V A;  1AXB A;  4A5R A;  4E3L A;  3K3C A;  3SH9 A;  4BJP A;  5CGW A;  1XA7 A;  3MJQ A;  2V1B A;  2EA9 A;  1MBL A;  1D1J A;  3KO6 A;  2XH9 A;  3E2K A;  4BL3 A;  3HL9 A;  2FH5 A;  4EBN A;  2Q0O A;  5TBM A;  4BBU A;  5HAQ A;  3V3R A;  1FQG A;  3PYP A;  3R7W A;  3PTE A;  5A91 A;  3CI6 A;  1PZP A;  4R3B A;  3K2N A;  3HLD A;  2Y2G A;  2PD8 A;  3UDF A;  3D9Y A;  5FAQ A;  3JVU A;  5F1G A;  4E3K A;  2ZMF A;  3E4O A;  5FI6 A;  2A49 A;  2XDM A;  4PKY G;  4PAU A;  2ZL1 B;  1PWC A;  4PM5 A;  1NLZ A;  1DJB A;  1CF0 A;  4CQH A;  2H28 A;  3TJZ C;  3CHW P;  4OP5 A;  4JGQ A;  3GMW A;  2PYP A;  1K4E A;  2QPN A;  4FTX A;  5I94 A;  3WS0 A;  5M18 A;  3DWZ A;  3KSF A;  4II7 A;  3A3E A;  3G6O A;  3HJI A;  4JF5 A;  1GSX A;  4WN5 A;  3H7W A;  4MDZ A;  1NRF A;  1N9O A;  3JVV A;  4KZ7 A;  3SH7 A;  3WS2 A;  1L0F A;  3NEC A;  1CJF A;  4HI4 A;  3T4L A;  5EOO A;  2WGI A;  2HGV A;  2VV6 A;  1SKO A;  1K54 C;  2B02 A;  3VSK A;  5A8B A;  1HVB A;  5FDS A;  4OP8 A;  3E2L A;  4FH4 A;  4X25 A;  4HBU A;  3MS6 A;  4GD6 A;  4E3N A;  4I39 A;  4NXB A;  1BYW A;  3ITA A;  4FCF A;  3S4X A;  5EVL A;  3N4I A;  2J8Y A;  5IS1 A;  5HSQ A;  1IFQ A;  4KUO A;  1ZHH B;  2J80 A;  2QJ5 A;  1Q2Q A;  3LGO A;  1ERM A;  4KZ6 A;  2PAV P;  1GSW A;  5HZH A;  4KEN B;  4OH0 A;  3E4P A;  5DF7 A;  3WRZ A;  1PZO A;  2L1M A;  1F2K A;  2HP9 A;  4R4S A;  2HF6 A;  3T1S A;  3UE3 A;  4PMA A;  4ETX A;  2P04 A;  4DE0 A;  3HRE A;  1YMX A;  4WF0 A;  5EVI C;  5KMW A;  1MY8 A;  3G30 A;  2P08 A;  4HP9 A;  1PW8 A;  2XR0 A;  4X53 A;  4Z9Q A;  1GA0 A;  2JKR I;  5IHV A;  3G4P A;  1YPR A;  2ZC5 B;  4K0X A;  4QHC A;  3M6B A;  4Y3I A;  2OAQ 1;  3FPW A;  2VEA A;  4UAA A;  5LBR A;  2I72 A;  1GSV A;  2X01 A;  2QWS A;  4FSF A;  4KUK A;  3IS2 B;  3C4O A;  3LI9 A;  4Q0H A;  4ARZ A;  3B3X A;  4MN5 A;  1XFQ A;  1CQA A;  2XK1 A;  2W1R A;  4E04 A;  5FI2 A;  3S1Y A;  3BYD A;  1MKM A;  3FV7 A;  4LV3 A;  4BLM A;  3QP6 A;  5HPF A;  2KOI A;  3BFC A;  4RA7 A;  3C8C A;  1YLJ A;  2JKT M;  4UQI S;  3HLC A;  4S2I A;  5EOE A;  1N9N A;  3BQ8 A;  2OAP 1;  4PKY A;  4KG5 A;  2Q9N A;  2Y91 A;  3MQO A;  4S2N C;  4PPR A;  1C3B A;  5AQA A;  1FR6 A;  2ZQ9 A;  1DJC A;  4HH2 A;  5L8M A;  4D60 A;  1ZKJ A;  3IS2 A;  5DTK A;  3I7J A;  4GS9 A;  5HFO A;  1YKD A;  4NXG A;  1J9M A;  3MMH A;  1MKI A;  4L0L A;  4P0M A;  4OVD A;  4OOY A;  3O87 A;  4GW9 A;  3EQV A;  1ALQ A;  3LUQ A;  2A24 B;  2V9A A;  4K0W A;  3UE0 A;  3F1N B;  2PR5 A;  3CZD A;  3PHY A;  3BLM A;  1GHP A;  2V0W A;  1K38 A;  1VHM A;  4WZ5 A;  5AQ9 A;  4OKP A;  4FUW A;  1VEU A;  4QU3 A;  5HWV A;  1MC0 A;  2ZM0 A;  3ZYT A;  5DFX A;  4I38 A;  4C3Q A;  4MN7 A;  3U4L P;  2VZW A;  3FZC A;  4EQI A;  4EU0 A;  2OV5 A;  3GDI A;  4KQD A;  5L09 A;  5DF8 A;  3VOY A;  2EXB A;  2I9V A;  5F6A A;  1S66 L;  1OTD A;  2D02 A;  2GX5 A;  4HIA A;  5D3O A;  3FG8 A;  4R4R A;  4EXO A;  3Q7Z A;  1LSW A;  3ZCZ A;  4Y0U A;  3GVB A;  2XQZ A;  3L9K A;  4Y7P A;  5DJU A;  4IUK A;  2HPB A;  1XPB A;  4EUV A;  3HLE A;  3Q82 A;  4S2P A;  3T12 B;  3N8R A;  1HLU P;  3BJN A;  4S2O A;  1ZTU A;  1T1B A;  3LY3 A;  1SHV A;  3IWI A;  3BM6 A;  1LL9 A;  2M1C A;  4LEN A;  3OOV A;  1CI8 A;  3RTY A;  2J3W A;  1V9Y A;  1FOF A;  1I5Q A;  3O88 A;  1NY0 A;  3NCK A;  4IBX A;  4R0Q A;  2W1T B;  4BQM A;  5F1F A;  4QB8 A;  3NOU C;  4GLQ A;  3IH8 A;  4BBT A;  4JXW A;  4CLC B;  4JBF A;  2O9B A;  2P7J A;  2FFF B;  4MMN A;  4NK3 A;  4D2O A;  4QD4 A;  3EOI A;  3BY8 A;  2XA7 M;  3LFV A;  3HBR A;  1XKZ A;  4WYY A;  2BLS A;  4O01 A;  3TRC A;  3ITB A;  3VOL A;  2H10 A;  2K31 A;  3UE6 A;  3UDX A;  4KQQ A;  4EES A;  5HAR A;  3G34 A;  4JLF A;  3OPP A;  1FSW A;  4F3L A;  4WZ4 A;  4EQ1 A;  3N6I A;  2Y2J A;  3OLO A;  2OOL A;  2WKQ A;  2IWD A;  2DMW A;  2UV0 E;  4OOL A;  2J3T C;  4EWF A;  2VA0 A;  4RX2 A;  2BAS A;  3EGD C;  3NUL A;  1FIK A;  3D72 A;  2Y2L A;  3PBS A;  4DN0 A;  4BBV A;  4NKP A;  5KIZ A;  4E3O A;  2QYB A;  3V5M A;  5CHJ A;  4MEZ A;  2EXA A;  1NWZ A;  1XJ6 A;  1MPL A;  4CLC A;  1G5U A;  3IF6 B;  4Y0T A;  3UB5 P;  4RVA A;  4BMW A;  5EVI A;  1S6R A;  3MF0 A;  3IXH A;  2R9W A;  2UWX A;  2G7U A;  2E8J A;  5E2H A;  3G35 A;  4DJ3 A;  4R70 A;  3MKF A;  2JKG A;  2P74 A;  3FC7 A;  1IKG A;  4HY8 A;  1MWR A;  1YAX A;  3KSH A;  4DKI A;  1T1A A;  2ZOI A;  3LIF A;  1AWI A;  2PHY A;  2LB9 A;  3IHB A;  4JF4 A;  4BD0 A;  4U3T A;  4IHQ A;  3ZNY A;  3C4P A;  2O99 A;  1XA1 A;  2V8C A;  5HL6 A;  2CMN A;  4EV4 A;  3OPL A;  3IXG A;  2K2N A;  1IEM A;  2JN7 A;  1ES3 A;  3NI9 A;  3N8S A;  4GHI A;  5AQ7 A;  1TDL A;  2PU2 A;  4PM7 A;  3GEC A;  5CED A;  4M4X A;  3RXX A;  3EQU A;  3A0V A;  3QP8 A;  2VV7 A;  4E3I A;  2XSS A;  4MN6 A;  3CIT A;  4LRX C;  3SOI A;  2V1A A;  1K4F A;  2WKI A;  1I2W A;  4CJN A;  4DJ2 A;  3C5A A;  3M2J A;  5DVA A;  5HL1 A;  3WWX A;  1OJG A;  3EEA A;  2JKR M;  2WGV A;  1RGZ A;  1OJ5 A;  3BY9 A;  2A2L A;  3SW1 A;  1L3L A;  2KX6 A;  2V2F F;  3IXB A;  1XJ3 A;  2ZC4 B;  3UPN A;  4WZ5 C;  3ZHH A;  1EI5 A;  4B9O A;  4DDY A;  2YKH A;  4RX3 A;  1SDN A;  3IXD A;  3BEC A;  1ZG4 A;  5A93 A;  1OT9 A;  1BTL A;  3P7N A;  3UB7 A;  1H5X A;  4Z1W A;  2B18 A;  2JHE A;  1HZO A;  5KZH A;  1H8M A;  4E6X A;  1H8Z A;  2IA2 A;  3VP0 A;  3C30 A;  3QP2 A;  1PW1 A;  2Y8H A;  1N4O A;  4DE1 A;  4QWO A;  5FL3 A;  3HUN A;  2GZA A;  5J4E A;  1P9W A;  3DBA A;  4NEE D;  1Q2P A;  2QJ7 A;  1BLS A;  3TOI A;  2ZQ8 A;  3G32 A;  3T4T A;  1JWP A;  2OWH A;  4X68 A;  1P9R A;  2HP5 A;  5JYP A;  2WZZ A;  4IUH A;  3ZDJ A;  3KYE A;  5FSR A;  4N1H A;  4EBP A;  3CMZ A;  3GQZ A;  2VX8 A;  4DRT A;  2HDR A;  4EW7 A;  4F94 A;  1NYM A;  5FI7 A;  5CEB A;  5CGX A;  2C6W B;  1IYP A;  2ZMV A;  1FR1 A;  3AGF A;  5GHY A;  2ZOH A;  2EX9 A;  5U47 A;  1TS6 A;  4JGR A;  5A92 A;  2DRW A;  2VGJ A;  1STZ A;  2W3H A;  4ZJ1 A;  3LI8 A;  1OTA A;  2VV8 A;  4R23 A;  1IYO A;  4HP4 A;  4NET A;  4OPY A;  2YKF A;  4KZ8 A;  1ERO A;  1P97 A;  1D7E A;  3OC2 A;  4CLC D;  2OSU A;  3A3I A;  1XGJ A;  5EVI D;  4LLO B;  4O8G A;  1W8Q A;  4PHT A;  3ZNT A;  2ZL1 A;  2ACG A;  3ZG9 B;  2WKH A;  2V8F A;  4H8R A;  2H0T A;  1X0O A;  3FWL A;  4I5S A;  3TW8 A;  1Z6F A;  4L9G A;  1CEG A;  3SS4 A;  4OON A;  4QY5 A;  1GHI A;  3EGX C;  1FCM A;  5G18 A;  4U0T A;  5EFW A;  2C5W B;  2WAF A;  3CWF A;  2ZQA A;  3PBN A;  3BRM A;  5AJG A;  3BEB A;  5HPI A;  1OTE A;  4CLC C;  4Y13 A;  5DKK A;  3MSH A;  1T1C A;  2VGL M;  5GLA A;  4X1L A;  4BEN A;  2XFT A;  1FCN A;  1TS0 A;  4XUZ A;  3P09 A;  3BLS A;  1KGG A;  4JXG A;  2WGW B;  4OPR A;  2HV1 A;  4IBR A;  4OPZ A;  3Q1F A;  1LI9 A;  3F1O B;  3LCE A;  4WLA A;  4I3J A;  3GRJ A;  5HAP A;  1L2S A;  4YIN A;  3S7O A;  5DF9 A;  3UPO A;  2P9V B;  3VP2 A;  1K56 A;  4MBH A;  4N9L A;  5FAT A;  1PI5 A;  1MWS A;  3IX8 A;  4R3J A;  1E25 A;  3S7N A;  4FOF A;  3QP4 A;  4LCM A;  1FCO A;  4DDS A;  2ZMA A;  2OWJ A;  1S0W A;  4YFM A;  3OZH A;  4YOF A;  2QMI A;  4P85 A;  5EM1 A;  5EEC A;  3MZF A;  5CHM A;  4P6Z S;  3FKW A;  5L10 A;  3T1Q B;  3PBO A;  3SZT A;  1GHM A;  3PR6 A;  4ESP A;  4Q8I A;  2Q9M A;  4G3V A;  4YNR A;  3F1P B;  4WUJ A;  3T4Q A;  3ZG7 B;  1H8Y A;  4KZB A;  1H3Q A;  4Q0J A;  2K7S A;  2PRF A;  1YM1 A;  3NDG A;  4LV1 A;  1IYQ A;  1F5M A;  1BLC A;  1DJA A;  1QME A;  3B33 A;  2FFY A;  2H0Y A;  4KQO A;  1ERQ A;  5F5Y A;  4GDN A;  2XF3 A;  3GSG A;  1BLH A;  4HJ3 A;  1KVM A;  5M19 A;  4DXC A;  4X56 A;  3VFF A;  4LV0 A;  3ZG8 B;  3DTE A;  1YQS A;  2Y2Q A;  1G6O A;  2O9C A;  4EER A;  1G6A A;  1K0K A;  1DY6 A;  3UE1 A;  1UGU A;  3TSG A;  3HLG A;  1BUE A;  5HDD A;  4Y17 A;  1W8Y A;  3A3D A;  3HUO A;  5TGF A;  4DE3 A;  1LHY A;  4UA9 A;  2Y2O A;  4XT2 B;  1LI0 A;  4P6B A;  1S4R A;  1K6S A;  1KE4 A;  1KOU A;  3HCY A;  4M3K A;  2XGN A;  1TF1 A;  3BWL A;  3Q7V B;  3PBQ A;  3K3D A;  2EWV A;  2HDS A;  5E2G A;  1RP5 A;  1NLY A;  3KSI A;  4S2J A;  2W3D A;  1NXY A;  1U60 A;  3ZGA B;  1MWU A;  2A24 A;  3ZVT A;  3C38 A;  4WEL A;  4EET B;  2E8I A;  3F1N A;  1XJ4 A;  3QP5 A;  1HD8 A;  1P0Z A;  4XXR A;  5KSH A;  5F83 A;  2B95 A;  1ESU A;  1RGY A;  5TFQ A;  5GL9 A;  5G4Y A;  3LEZ A;  3A3F A;  4GOG A;  4KQR A;  1CI9 A;  3MBZ A;  2PYR A;  4ZJ3 A;  1BSG A;  3LR5 A;  4QJG A;  4MCW A;  2J3T D;  1VQQ A;  4MBK A;  2EX8 A;  1WE4 A;  3ZVW A;  1Y4O A;  3LR4 A;  4GKU A;  4I3I A;  2IWC A;  3QNB A;  1K56 D;  4KZA A;  2M7U A;  4YWZ A;  4QPR A;  1JVJ A;  4U0X A;  4EEU A;  4R6L A;  3KYZ A;  2DNS A;  4OQ0 A;  4HOI A;  5DJT A;  3VP1 A;  4ME4 A;  1I2S A;  4N92 A;  3UPP A;  1ESI A;  5DFY A;  3MKE A;  1NYY A;  2J7V A;  5GLB A;  1LSX A;  2W3G A;  2KDK A;  3AGE A;  3R4K A;  4E3M A;  1Y28 A;  3H9W A;  3CPT B;  5G4Z A;  3LY4 A;  3NOP C;  4HJ4 A;  3CLO A;  3DTI A;  2Z2M B;  3PAG A;  5CTN A;  1EW0 A;  1VET B;  1M6K A;  3IQA A;  1JWZ A;  3DWK A;  2W1T A;  3CUE A;  1L0G A;  2XRN A;  2EFU A;  2AVX A;  3HLW A;  1EWZ A;  3BFE A;  2HZ5 A;  4PM6 A;  3FYZ A;  4EEP A;  3IT9 A;  1DRM A;  3QHY A;  1DP6 A;  5FQ9 A;  1W7F A;  4UEY A;  3W4Q A;  5JYO A;  5TR7 A;  2BTF P;  3VSL A;  1PRQ A;  2WKP A;  4UQI M;  2Y79 A;  2HDQ A;  2JE5 A;  3E0Y A;  4C75 A;  2PBY A;  5DTS A;  1KGF A;  4KZ3 A;  2EX2 A;  3MXQ A;  4WBG A;  1WYB A;  3N7W A;  1K25 A;  2PD7 A;  3G2Z A;  3P01 A;  2EWW A;  3LID A;  2RCX A;  2XEP A;  3PAE A;  1YLZ A;  3OPR A;  2R9X A;  4I3A A;  2O9A A;  3MZD A;  3UDI A;  4HES A;  4MBF A;  5CHU A;  1OTI A;  3IF6 A;  1T19 A;  3HUM A;  1VM1 A;  2DCF A;  3SH8 A;  3ZG5 A;  1ACF A;  4RYE A;  4DE2 A;  3NJA A;  3SS5 A;  3W8K A;  3LYX A;  4OLD A;  5CER A;  5F68 A;  1ONG A;  2XRO A;  1ZC2 A;  1LL5 A;  1KDW A;  5CTM A;  3VE3 A;  1NZU A;  2PDR A;  5TBM B;  1M40 A;  2OLV A;  3M6H A;  4WEK A;  3VOZ A;  3R7W B;  3GTC A;  4B88 A;  3GV9 A;  3UY6 A;  5BOH A;  1K57 A;  1LLB A;  2ZQ7 A;  1XGI A;  1CEF A;  1PYY A;  5FAS A;  4ZBE A;  3WS1 A;  2ZBB A;  5E43 A;  4C6Y A;  5CEC A;  1XFN A;  2ZC6 B;  2Y55 A;  3C2W A;  3WS4 A;  1PNE A;  2VLG A;  3M2K A;  1PWD A;  3W4P A;  1H0M A;  4GZB A;  5J7E A;  3HJK A;  3MFD A;  4HQA A;  3NY4 A;  5GLC A;  1W63 M;  4NG2 A;  4IJG A;  4LV2 A;  5J8X A;  4E3J A;  4MNR A;  3H7W B;  1G68 A;  3O86 A;  1L0E A;  1PIO A;  5FQI A;  1FIL A;  3VMA A;  1TEM A;  2B5R A;  2WKR A;  3D3O A;  1TS8 A;  5CGS A;  1SKO B;  1MXO A;  2PBD P;  4X1M A;  1YT4 A;  5I5L A;  1FSY A;  1WYC A;  4L9F A;  3DTK A;  2KLI A;  1PI4 A;  5GLD A;  1XP4 A;  2ZQD A;  3ZQ5 A;  3MQ0 A;  3FPV A;  4G3K A;  4FD8 A;  2W3E A;  3IBJ A;  5FAO A;  3LR3 A;  3JPU A;  4LPZ A;  4Y0O A;  5FAP A;  1JTD A;  4IED A;  3S22 A;  3MXS A;  3RJU A;  2JKF A;  5J3W A;  2IWB A;  3NHQ A;  4S2M A;  2QHK A;  3FKV A;  1E3U A;  1ES5 A;  4X6T A;  2LB5 A;  1LSV A;  3KSG A;  1BLP A;  2R78 A;  3TE8 A;  1YMS A;  1S1Z A;  3G31 A;  4OLG A;  3HLF A;  1SZV A;  4WMC A;  2WKE A;  4P87 A;  4HBT A;  2X02 A;  3OBF A;  3LIE A;  4GCZ A;  1HTZ A;  4GJ4 A;  4KG2 A;  3O3V A;  3N8L A;  4DXB A;  5IU1 A;  3A3J A;  4IVI A;  4UHU A;  1DP9 A; 
#chains in the Genus database with same CATH homology
 5HD5 A;  2INW A;  2O9B A;  5F5Y A;  2P7J A;  4MMN A;  3VV4 A;  4HJ3 A;  3BW6 A;  2O0Y A;  3EOI A;  3BY8 A;  2XA7 M;  5CX7 A;  3UB9 A;  3LFV A;  4OOM A;  4Y5F A;  4WL9 A;  4HHD A;  3CUE C;  1G6O A;  2O9C A;  4EER A;  3UME A;  4O01 A;  3TRC A;  1UGU A;  3IBR A;  3VOL A;  2K31 A;  1TD5 A;  3UE6 A;  4EES A;  5HDD A;  1ODV A;  4F3L A;  4EQ1 A;  2L0W A;  3OLO A;  1DP8 A;  4NXF A;  2OOL A;  2WKQ A;  1YSP A;  2DMW A;  4OOL A;  2J3T C;  3A0S A;  4ARZ B;  2M7V A;  2VA0 A;  2BAS A;  4XT2 B;  3K3C A;  3EGD C;  4BJP A;  3D72 A;  3PBS A;  1S4R A;  4DN0 A;  4BBV A;  4NKP A;  3MJQ A;  2V1B A;  2EA9 A;  1KOU A;  5TJJ A;  4H6J B;  5KIZ A;  2NUT C;  2XA7 S;  3HCY A;  2QYB A;  3KO6 A;  3U2A A;  4K08 A;  1TF1 A;  3BWL A;  2FH5 A;  1NWZ A;  2VKS A;  3PBQ A;  1XJ6 A;  5TBM A;  3K3D A;  4CLC A;  4BBU A;  2EWV A;  3PYP A;  3R7W A;  4BMW A;  1NLY A;  3KSI A;  3MF0 A;  5AVE A;  3CI6 A;  2W3D A;  3BQA A;  3T4K A;  3K2N A;  2G7U A;  2PD8 A;  3JVU A;  4HNB A;  1F98 A;  2ZMF A;  3E4O A;  4DJ3 A;  4PKY G;  2A24 A;  4RQ9 A;  4R70 A;  4R3A A;  2HJE A;  4PAU A;  3C38 A;  4WEL A;  4EET B;  1NLZ A;  4CQH A;  3F1N A;  1XJ4 A;  2H28 A;  3TJZ C;  5MC7 A;  1P0Z A;  4JGQ A;  4HH3 A;  5KSH A;  2PYP A;  3FC7 A;  4HY8 A;  2PR6 A;  4G3W A;  1YAX A;  3KSF A;  5G4Y A;  4II7 A;  3KSH A;  1T1A A;  2ZOI A;  3LIF A;  4GS9 B;  2PHY A;  3G6O A;  3HJI A;  1S4S A;  3KX0 X;  1GSX A;  2LB9 A;  4WN5 A;  3RFB A;  3H7W A;  4MDZ A;  3F1O A;  2PYR A;  1N9O A;  3JVV A;  4IHQ A;  4H6J A;  2O99 A;  5HL6 A;  2CMN A;  4HI4 A;  3T4L A;  3LR5 A;  2K2N A;  4JGO A;  3T50 A;  3ICY A;  4MCW A;  2HGV A;  2JN7 A;  2VV6 A;  1LT0 A;  2J3T D;  3ULF A;  4GHI A;  5HWT A;  2B02 A;  5A8B A;  3GEC A;  4M4X A;  3LR4 A;  3EQU A;  5HD3 A;  4I3I A;  3A0V A;  2VV7 A;  2XSS A;  1VB6 A;  4MN6 A;  3CIT A;  4LRX C;  2V1A A;  4I39 A;  2M7U A;  4YWZ A;  4R38 A;  4DJ2 A;  4QPR A;  4EEU A;  4R6L A;  3KYZ A;  1UWP X;  4L9E A;  4HOI A;  4NXB A;  3PBT A;  5DJT A;  1BYW A;  1OJG A;  3EEA A;  1F9I A;  3T4S A;  2JKR M;  4ME4 A;  1OJ5 A;  3BY9 A;  5IS1 A;  2A2L A;  3SW1 A;  5HSQ A;  2KX6 A;  5DFY A;  1IFQ A;  4KUO A;  1XJ3 A;  1ZHH B;  2J80 A;  2QJ5 A;  4DMZ A;  1LSX A;  4ZRR A;  4B9O A;  2YKH A;  2W3G A;  2KDK A;  1UWN X;  1GSW A;  5HZH A;  1S1Y A;  3E4P A;  3R4K A;  1Y28 A;  2HJ9 C;  3H9W A;  3F1P A;  1OT9 A;  2L1M A;  3P7N A;  5G4Z A;  3UB7 A;  2HF6 A;  4Z1W A;  2B18 A;  2JHE A;  3NOP C;  3UE3 A;  4B93 A;  4HJ4 A;  3CLO A;  4ETX A;  2P04 A;  3MR0 A;  3A0R A;  1EW0 A;  3S7Q A;  2GJ3 A;  1H8M A;  3B42 A;  4WF0 A;  2W1T A;  3CUE A;  2IA2 A;  3C30 A;  3H82 B;  3UB8 A;  2XRN A;  2Y8H A;  2P08 A;  3T4J A;  4HP9 A;  5FL3 A;  2GZA A;  5J4E A;  1P9W A;  1OT6 A;  2JKR I;  3DBA A;  4EEP A;  3UMD A;  4NEE D;  5HWW A;  1DRM A;  2QJ7 A;  1DP6 A;  3CAX A;  3T4T A;  4Y3I A;  4UEY A;  2OAQ 1;  1LL8 A;  2OWH A;  1P9R A;  3FPW A;  1WA9 A;  2VEA A;  4IUH A;  5LBR A;  1D06 A;  1GSV A;  1MZU A;  4NXE A;  2QWS A;  2WKP A;  1IOU A;  4UQI M;  4FSF A;  2W27 A;  2PT7 A;  2Y79 A;  2VX8 A;  3E0Y A;  4EW7 A;  5C5K A;  4KUK A;  3IS2 B;  3LI9 A;  4Q0H A;  3O5Y A;  4ARZ A;  3MXQ A;  4MN5 A;  1XFQ A;  2ZMV A;  2PD7 A;  4XT2 A;  5HDC A;  2ZOH A;  3P01 A;  3NOT C;  2W1R A;  2EWW A;  3LID A;  4E04 A;  1TS6 A;  4JGR A;  3W2Z A;  1OTB A;  3V67 A;  4Y2F A;  1V9Z A;  4I3A A;  1STZ A;  1TS7 A;  2O9A A;  1MKM A;  2W3H A;  3H82 A;  2D01 A;  3LI8 A;  1OTA A;  2VV8 A;  2QKP A;  4HP4 A;  1OTI A;  5HPF A;  2KOI A;  1T19 A;  2YKF A;  4F3L B;  3C8C A;  2JKT M;  4UQI S;  1P97 A;  1D7E A;  3OC2 A;  4CLC D;  2MJ6 A;  3MFX A;  1N9N A;  3BQ8 A;  2OAP 1;  1XJ2 A;  4PKY A;  3LR0 A;  3NJA A;  4BWI A;  4LLO B;  4O8G A;  3MQO A;  4PHT A;  3LYX A;  5F68 A;  4AFI A;  2XRO A;  1X0O A;  4HH2 A;  4I5S A;  5L8M A;  3TW8 A;  3OCL A;  4L9G A;  3VE3 A;  2PDR A;  3IS2 A;  5TBM B;  4O0P A;  3UB6 A;  3EGX C;  1OPX A;  4WEK A;  2GNX A;  5K5B A;  4GS9 A;  1YSQ A;  3R7W B;  1NRJ A;  1YKD A;  3MQQ A;  4NXG A;  5EFW A;  3MMH A;  1S67 L;  4L0L A;  3LIB A;  3CWF A;  3PBN A;  2ZBB A;  4GW9 A;  5AJG A;  3EQV A;  3LUQ A;  3T4O A;  2A24 B;  1XFN A;  5HPI A;  2NUP C;  1OTE A;  2V9A A;  5IT5 A;  4CLC C;  3C2W A;  5DKK A;  3F1N B;  4ETZ A;  2VLG A;  1T1C A;  2PR5 A;  2VGL M;  3E4Q A;  2JKT I;  3PHY A;  1TS0 A;  3OCN A;  5J7E A;  3HJK A;  2V0W A;  1VHM A;  4HQA A;  5F69 A;  1W63 M;  4IJG A;  2HV1 A;  3PXP A;  3H7W B;  3S7P A;  3F1O B;  5HWV A;  1MC0 A;  4WLA A;  2W3F A;  4I3J A;  3ZYT A;  5DFX A;  4I38 A;  2V0U A;  4MN7 A;  2VZW A;  4EU0 A;  4P6Z M;  2WKR A;  3D3O A;  1TS8 A;  2Z6D A;  3GDI A;  4KQD A;  3S7O A;  5DF9 A;  4GHI B;  5DKL A;  2I9V A;  5F6A A;  1S66 L;  3EEH A;  4JGP A;  1OTD A;  5I5L A;  2VGL S;  2D02 A;  2GX5 A;  4L9F A;  4HIA A;  4WEJ A;  2KLI A;  3FG8 A;  3S7N A;  4FOF A;  1T18 A;  3LIC A;  5HDS A;  4EXO A;  2OWJ A;  1LSW A;  3ZQ5 A;  3RH8 B;  4YOF A;  3PBR A;  3MQ0 A;  3FPV A;  4G3K A;  5DJU A;  3E98 A;  4IUK A;  2W3E A;  3IBJ A;  3LR3 A;  4EUV A;  4LRZ E;  4LPZ A;  5AVF A;  3VE4 A;  2FZ0 A;  1N9L A;  4P6Z S;  4Q0I A;  4HJ6 A;  5J3W A;  3PBO A;  3NHQ A;  4LRY C;  3KYQ A;  3PR6 A;  2QHK A;  2LB5 A;  1LSV A;  3BJN A;  3LIA A;  3KSG A;  2R78 A;  2L4R A;  3TE8 A;  1S1Z A;  1ZTU A;  2Z6C A;  1T1B A;  4G3V A;  4YNR A;  3EWK A;  3F1P B;  1G28 A;  1W63 Q;  4WUJ A;  3T4Q A;  2M1C A;  3OOV A;  1H3Q A;  4Q0J A;  3RTY A;  2J3W A;  2K7S A;  3OBF A;  2VJW A;  3LIE A;  4GCZ A;  2W0N A;  1V9Y A;  4GJ4 A;  2W1T B;  1F5M A;  3NOU C;  4GLQ A;  4BBT A;  1JNU A;  3B33 A;  5IU1 A;  4CLC E;  3B47 A;  4KQO A;  4CLC B;  1DP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...