1LSVA

Crystal structure of the co-bound bjfixl heme domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
117
structure length
117
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQELQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-based mechanism of O2 sensing and ligand discrimination by the FixL heme domain of Bradyrhizobium japonicum
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Transferase
molecule keywords Sensor protein FixL
total genus 31
structure length 117
sequence length 117
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2002-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1lsvA00
2VV7A 2H28A 3A0SA 3BWLA 2YKFA 3MFXA 2PR6A 1TS7A 3K3CA 5G4YA 3MJQA 3H82A 3UMDA 4EEPA 1D06A 1DRMA 3H7WA 3BY8A 3VE4A 4BBVA 3C8CA 4EEUA 2KX6A 2PYRA 2ZOIA 3H7WB 3MR0A 1V9YA 1XJ3A 3A0RA 4XT2A 1S67L 2WKRA 4YWZA 5HZHA 5J4EA 5J3WA 5HDDA 1F9IA 4I3AA 2D02A 5HWVA 3D72A 3UB7A 4HH2A 2K7SA 3K3DA 2OOLA 3FC7A 4KUOA 3PHYA 4F3LB 4I5SA 2EA9A 4HJ3A 3LYXA 1F98A 4KUKA 3H82B 2M1CA 3FG8A 3GECA 1LL8A 4HH3A 3NOUC 2PHYA 2W0NA 4B9OA 1UWNX 4GCZA 1N9LA 4GS9A 3RTYA 4R3AA 4EERA 1JNUA 2ZBBA 4MN6A 1TS8A 1DP9A 3MQOA 4HIAA 5DKLA 4HP9A 4WLAA 4R6LA 1OTBA 2D01A 1D7EA 3HJKA 4EETB 2V1AA 5AVEA 5A8BA 2L4RA 2HV1A 3IBRA 4I3JA 4JGOA 3E4OA 4HJ6A 5DKKA 2R78A 1S1ZA 2VV6A 3G6OA 2PD8A 3GDIA 1MZUA 3LIBA 3NHQA 5DJUA 1T19A 5EFWA 2L1MA 1KOUA 3EEHA 3LIDA 1V9ZA 4HP4A 4LRXC 3B33A 4WN5A 2PYPA 3UMEA 4EW7A 3BY9A 3UE6A 2V1BA 3ULFA 4GS9B 3ZQ5A 3F1PA 1DP6A 4WF0A 1T1CA 2Z6CA 3VOLA 4R38A 1X0OA 2GJ3A 4HOIA 1BYWA 2A24B 2JN7A 5HDSA 1UGUA 2V0WA 4L9GA 5KIZA 4LRZE 2QWSA 1TS0A 4HI4A 4MN5A 1N9OA 3NOTC 3LIEA 3IS2B 3NJAA 1XJ6A 4I3IA 2WKQA 1XJ4A 5G4ZA 4I39A 3VE3A 2VEAA 5HSQA 5AVFA 2P7JA 3H9WA 3UB8A 5J7EA 2OWJA 5HD3A 1S66L 2BASA 1P0ZA 4GHIB 4JGRA 2PD7A 3T50A 2QKPA 4NXFA 3MQQA 1S4RA 1T18A 4GHIA 3F1NB 1GSXA 3HJIA 4WL9A 2PR5A 5TBMB 4EQ1A 3E4QA 1OT6A 3F1NA 2V0UA 4DJ2A 3CAXA 4H6JA 4JGQA 2OWHA 1OJGA 5F68A 5TBMA 4BBTA 4GW9A 3UB9A 1XJ2A 1NWZA 4M4XA 2B02A 4XT2B 3UB6A 3SW1A 5F5YA 4NXBA 3LIFA 1VB6A 4PKYG 4BBUA 1TS6A 3E4PA 4F3LA 1XFQA 1Y28A 1P97A 1OTAA 2ZOHA 3LI8A 3LI9A 4NXGA 4WUJA 2A24A 3IS2A 2L0WA 1LSVA 2V9AA 4LRYC 4I38A 3ICYA 2WKPA 3RH8B 4HJ4A 2VV8A 3C2WA 2QJ5A 1OT9A 1GSWA 2Z6DA 3CLOA 4RQ9A 2INWA 2QJ7A 1LSWA 1UWPX 4R70A 3CWFA 1GSVA 1ODVA 5F6AA 1S1YA 1XFNA 4HY8A 5DJTA 4EXOA 2W27A 1OTIA 3F1PB 1T1BA 1DP8A 3OLOA 4HHDA 1S4SA 2KDKA 4L9EA 4L9FA 5HWTA 4HQAA 1G28A 3F1OA 5F69A 3NOPC 5HWWA 2CMNA 5IS1A 2YKHA 1OTDA 3EWKA 4HNBA 3MXQA 3P7NA 1LT0A 4JGPA 4K08A 2I9VA 4EESA 1WA9A 5HDCA 5I5LA 1LSXA 4PKYA 3A0VA 5IU1A 4DJ3A 3LIAA 3PYPA 3F1OB 3KX0X 2J80A 1OTEA 3LICA 1T1AA 4H6JB 4NXEA 4E04A 5HD5A 1OJ5A 2JHEA 2QHKA 3LUQA 4LLOB 1EW0A 2VLGA 2PDRA 4LPZA 1N9NA 4KQDA
chains in the Genus database with same CATH superfamily
2VA0A 3WS2A 1PW8A 3ZG9B 4D60A 3D3OA 3IHBA 4YWZA 3MR0A 2E8JA 5HWVA 2G2UA 2Y8HA 3IXDA 2GZAA 3FG8A 2PHYA 2W0NA 5CHJA 1UWNX 3SS3A 4E6WA 2HPBA 3VMAA 4OP5A 1LL9A 3BQ8A 5HAPA 2HP6A 3WRTA 1IYQA 5EOEA 2JKRM 2DCFA 3UMEA 3ULFA 2ZQDA 4ZAMA 3F1PA 1G68A 5FQKA 3PBQA 1GHPA 4X53A 1UGUA 4HI4A 5DF9A 4KZ9A 3W4PA 5AVFA 2W3EA 3SH8A 4ETZA 1T18A 3HJIA 3OOVA 4M3KA 4PM7A 2FFFB 2GX5A 1M40A 3BYDA 4DDSA 1VB6A 1TS6A 2NUPC 5JYPA 1XFQA 1P97A 3NY4A 4R1GA 1YLTA 3V3SA 1PRQA 4AFIA 4E3IA 1S0WA 2Y2OA 2ZM8A 1GSWA 3DWKA 2HF6A 2PAVP 1XFNA 3CPTA 1YSQA 5JYOA 4PM9A 1FSWA 3FKWA 1XGIA 3F1OA 5EECA 5HAIA 5F69A 2B5RA 3GRJA 4LV0A 3CMZA 4EU0A 1OTEA 4E04A 1XA7A 4WZ5C 4MLLA 4LFUA 5CGSA 1NYMA 3UY6A 2Q9MA 3C8CA 2M7UA 2EX9A 3N4IA 3UB5P 1FSYA 4RYEA 5FEFA 1XPBA 4O01A 2OOLA 3P98A 5HAQA 3E2KA 1N9LA 4BD0A 1JWPA 4ID4A 3GV9A 4PHTA 4PM5A 4N1HA 4MNRA 4LRXC 4WZ5A 4HBUA 3T4JA 5GL9A 4JXSA 2HP5A 5L2FA 4E3JA 2WKIA 1HLUP 1Y4OA 4CQHA 2BG1A 5HDSA 3DW0A 3OCLA 4MN5A 4BENA 4BWIA 2WAFA 5HSQA 1GHIA 3NDEA 4G3KA 4WBGA 2PD7A 2V20A 3LR4A 3UDFA 3Q1FA 4GW9A 1XJ2A 3DTEA 1ZC2A 4NXBA 4Q0JA 3UPOA 5EV0A 3LI9A 5HARA 2WGIA 2WGWA 5MC7A 3RH8B 4K0XA 1OT9A 1CEFA 4WMCD 1IYPA 3SH7A 2O0YA 5TR7A 1S4SA 2WGWB 3A3IA 3VP3A 4JGPA 1TEMA 1W7FA 5IU1A 1XX2A 4D2OA 1ES3A 1G5UA 3V67A 1RGZA 2J3TD 1ES5A 3K3CA 3M6HA 3EGXC 2W3GA 4KQQA 1F5MA 3MZFA 2EFUA 4LGWA 3AGEA 4I5SA 4HJ3A 4KUKA 3WS5A 4MN6A 4HEFA 4WLAA 1NXYA 4DDYA 2Q0OA 4KG2A 1OMEA 3G6OA 5DJUA 5EFWA 4KZ4A 2ZM0A 3UO9A 3R4KA 2MJ6A 3PBNA 4OP8A 3B47A 4R38A 3HUOA 4EUZA 1XP4A 2A24B 5AQAA 1XKZA 4JXGA 2H5SA 3TW8A 5EVIC 1FR6A 3KSGA 1BZAA 1TF1A 1Z6FA 4UAAA 1MKMA 2IWCA 3WS0A 3MF0A 3T4TA 4BQMA 3Q07A 2Y79A 5F1GA 3IS2A 1LSVA 1K6RA 2JKTI 2QYBA 4S2LA 3HUMA 3IT9A 5L10A 4MDZA 3TOIA 3CLOA 4RQ9A 1XA1A 3HLEA 3ZG8B 3U2AA 4C75A 4P6BA 3OZHA 4L9EA 1G28A 2A3UA 5FATA 3EEAA 1STZA 4K08A 5I5LA 3BW6A 4CLCA 2V2FF 2J80A 1E25A 2O9BA 2H28A 1KGGA 3VE4A 1KGEA 3A0RA 1S67L 3T1SA 2EXBA 4PMAA 1K57A 5FDHA 4Z1WA 2Y2NA 5EE8A 5CEBA 2Y2JA 3HUNA 3LYXA 3GECA 3NOUC 1ES4A 5I94A 4Y3IA 4Q0IA 3T4SA 3E4OA 3UB8A 1V9ZA 3IXHA 2PYPA 1LL5A 2Z6CA 2Y59A 4BL3A 3Q82A 1YPRA 1H3QA 1SZVA 3UN7A 5CGWA 4MEZA 4Q0HA 3IQAA 3BQAA 3CJMA 2GNXA 4NXFA 3MQQA 4MBHA 3C30A 3E2LA 3E4QA 2PU4A 1NYYA 5FQIA 4M4XA 3WWXA 4XUZA 4C6YA 3OC2A 4YINA 2BTFP 5DTKA 1J9MA 4U3TA 4HJ4A 4DF6A 1CI8A 4QHCA 2EXAA 5G18A 1ERMA 1ODVA 4KZ5A 3A3DA 3HLDA 4JXWA 1VQQA 2KDKA 1FILA 3VOYA 2P04A 2VJWA 2W1TA 5HDCA 2HDQA 4NG2A 5A93A 5CXWA 4LCLA 4X1LA 2WKRA 5CGXA 3ZGAB 3V50A 2ZC6B 1YAXA 3H7WB 5J3WA 1HVBA 4I3AA 3T4LA 2ZC5B 4E3OA 3OPRA 2K7SA 2ZL1A 3EOIA 1ALQA 1I2SA 1LL8A 1FCMA 1JNUA 1TS8A 4FOFA 3IX8A 3BFDA 1ZHHB 3HJKA 5AVEA 5KSCA 4B4XA 5FL3A 3IX4A 5DKKA 3GSGA 2XROA 4PPRA 2P9VB 3A3JA 4JKTA 1KGFA 3CG5A 4X55A 3R7WA 2Y4AA 3QP6A 3KYQA 3B3XA 4FSFA 1RCJA 5BOHA 4FD8A 5A92A 1K0KA 4B93A 4I3IA 1DJCA 4OLGA 3T4QA 1ZKJA 1NLYA 4L0LA 2UWXA 2XD1A 3F1NA 1IYSA 5CTNA 4UQIS 5FAQA 1MWUA 4NEED 1YQSA 2W1TB 1OTAA 2EX6A 3FPVA 4WM9A 2A2LA 2EFXA 1BLHA 1HD8A 1LLBA 4MBKA 2NUTC 3HLWA 4YNRA 3PBRA 1SDEA 3IH8A 4DE1A 1WYBA 4L9FA 4P0MA 3LEQA 3CZDA 1LHYA 3KYEA 5IS1A 4S2NA 1H8MA 1LSXA 3ZG7B 1JVJA 3PYPA 4YOFA 3KX0X 1YT4A 4IBRA 5FA7A 5CTMA 5HD5A 2J3TC 3VSLA 2PR6A 1PIOA 5CEDA 3IWOA 5M1AA 2ZL1B 2XK1A 2WZXA 3T12B 1XJ3A 2VGLS 2D02A 3O86A 5EVEA 1BLCA 3PHYA 2XQZA 1RP5A 3ZFZA 3Q7ZA 4QY6A 4R3BA 1K56D 3NDGA 1K4FA 2ZQCA 5E2EA 4OPRA 2V1AA 5A8BA 4DE2A 2VKSA 3O5YA 3LCEA 3GDIA 3LIBA 2L1MA 5IHVA 4EV4A 2Y55A 5GHZA 2ZC3B 4BL2A 2FFYA 4OKPA 2VGJA 3LGOA 2Y2IA 1H5XA 3EQVA 2GDNA 1EI5A 3E0YA 3BLSA 3A3FA 3KSFA 2C6WB 5TBMB 4IJGA 2HJEA 2X02A 4RVAA 4KENB 4CLCB 1IKGA 5F5YA 3LI8A 3K2NA 5DFYA 2V8FA 3CI6A 3IH9A 4QB8A 5M18A 2EX8A 2Y2GA 3R7WB 1KVMA 3M2KA 2J9PA 4OPZA 4X68A 1OTIA 1DP8A 4HHDA 3RJUA 3MSHA 3WRZA 4YFMA 4B4ZA 1FCOA 3ZVWA 1S6RA 3Q7VA 1C3BA 3TSGA 5AQ7A 1I2WA 3BWLA 4C3QA 1D06A 2JKRI 3H7WA 3BY8A 4RA7A 4ZRRA 2ZOIA 3NI9A 3T4KA 4DE0A 4E3KA 4S2NC 2ZMAA 3FC7A 2EA9A 5M19A 3M2JA 4B9OA 2A49A 4DE3A 1W8QA 1KE0A 4RX2A 1PYYA 3Q7VB 1ES2A 4FCFA 2R78A 3NHQA 2H0YA 4WN5A 4CPKA 1SKFA 1W63Q 3UE6A 3IF6A 3VFHA 3ZQ5A 1T1CA 2ZQ9A 3LY3A 1NZOA 2GJ3A 1BYWA 3LFVA 1N9OA 3IS2B 4MCWA 5F82A 1XJ4A 3VE3A 4BJPA 3NBLA 3H9WA 5A91A 4ESPA 2XH9A 5DTSA 3MMHA 4E3LA 4UA9A 4CLCC 4H6JA 4OOYA 3LR0A 4XT2B 4PKYG 3MQ0A 2ZLYA 3P09A 4LV2A 2I72A 1IYOA 2VX8A 1JTGA 1N9BA 3WS4A 1PWCA 1CJFA 1T1BA 3OLOA 4PAUA 4S2MA 3ZCZA 4ZJ1A 2CMNA 2K31A 2VK3A 2I9VA 4R3JA 3JVVA 2HDRA 3C7UA 3NECA 2ZQAA 1PI4A 3BRMA 3MBZA 4EEPA 5J7EA 5GLCA 4CLCE 1QMFA 1YLJA 4HBTA 5FQJA 3IWQA 3S7NA 3JVUA 1E3UD 2EWWA 1PZPA 2UV0E 5EM1A 3U4LP 3RTYA 2H10A 3DWZA 1VM1A 1D7EA 3OCNA 5FAPA 4EETB 2PRFA 1G6OA 2B95A 4JF6A 3S7OA 1DP6A 3T1RA 3MZDA 1DJAA 5AJGA 2JCHA 1P0ZA 4EBNA 1W8YA 4JBFA 3CHWP 4RX3A 2HP9A 4P6ZS 1P9WA 3UE1A 2JC7A 4EWFA 1VETA 2J8YA 4Y7PA 2XA7S 4IUKA 1L0FA 3L7HA 2WUQA 4U0TA 3W4QA 4NK3A 4R70A 2C5WB 3NIAA 5DJTA 2Z2LB 3HLBA 4X1MA 1NY0A 3RFBA 5GHXA 4FH2A 3LO7A 2J9OA 3A0VA 5L8MA 4LCMA 3NC8A 2VLGA 3MFXA 3PR6A 2YKFA 1LI9A 2JE5A 1CI9A 4OONA 2ZD8A 1YSPA 1Y54A 3VP0A 3FPWA 5HZHA 1SKOA 5HDDA 2ZC7A 1F9IA 3BM6A 5FEGA 4IBXA 5DF8A 4KUOA 3IX3A 1FOFA 2G7UA 5DF7A 1WE4A 2W3FA 4UA6A 2Y2QA 3VSKA 4HIAA 4GDBA 5FAOA 5HPIA 5EVID 5D3OA 2O99A 1K25A 1MZUA 3UDXA 4Y15A 2IWBA 5EVIB 3PTEA 2J3WA 5CERA 2V1BA 3HL9A 2DMWA 2V0WA 2W3DA 2WADA 5KIZA 3ZG5A 2QWSA 4MMNA 1OPXA 1ERQA 3QNBA 4OLDA 4P6ZM 4IVIA 2V1ZA 2OWJA 3E98A 2BASA 4JGRA 1SHVA 1L2SA 5DVAA 5A90A 2OAQ1 4GHIA 1L0DA 3G30A 2HGVA 3ZG0A 1F2KA 1XXMA 3C5AA 1NJ4A 2XSSA 4GB7A 2WK0A 3ICYA 3FZCA 5HW3A 2INWA 1LSWA 3MKFA 5TJJA 4OQHA 3D4FA 1K55A 5HWTA 3S4XA 3G2YA 3NOPC 2XFSA 1OTDA 1H0MA 4UHUA 1WA9A 2KLIA 4PKYA 4Y2FA 3MFDA 4PM8A 4BBTA 2JHEA 4LV3A 1N9NA 4KQDA 3PBOA 5CX7A 4EEUA 4FTXA 2KX6A 3S1YA 2ZM2A 4N92A 3ZHHA 4UQIM 2X01A 2WKHA 1L0EA 1YLPA 5HL1A 3M6BA 1MWTA 1IELA 3HREA 2ZBBA 4Z9QA 1VHMA 2D01A 5EPHA 4E3MA 4JGOA 2HV1A 3IBRA 4HJ6A 2PD8A 3WS1A 2CC1A 4EW7A 4ETXA 1RGYA 3L9KA 1TS0A 1K55C 1XGJA 3S7QA 4Y5FA 4K0WA 1SCWA 1SDNA 4S2IA 3DBAA 5HD3A 2OV5A 4Y13A 1OT6A 1TD5A 4NXGA 2ZOHA 1AWIA 2P74A 2QPNA 4WUJA 3V5MA 2FH5A 3EGDC 1ZTUA 4LENA 4OPYA 4GJ4A 3IF6B 3VOZA 4E3NA 3AGDA 4KZBA 2YKHA 2VGKA 1LT0A 2PBDP 2W1RA 1MKIA 4DJ3A 1WYCA 5DTTA 4WZ4A 4LV1A 2QMIA 4F3LB 2ZQ7A 3BEBA 3IBJA 4WMCA 2Z6DA 2EX2A 1YLZA 3IHAA 4K91A 3G34A 1FCNA 3TG9A 3FV7A 4R23A 3PBSA 4GLQA 2Y2LA 3SOIA 4F94A 1VETB 3UDIA 3QHYA 4UA7A 4GOGA 3PAEA 3A3EA 1O07A 2ACGA 3IXGA 2XFTA 1YLWA 2PBYA 1S1ZA 2IA2A 2VGLM 3LIDA 5EVIA 4HP4A 4KG5A 3BY9A 2WKEA 3DTMA 3T1QB 4WF0A 1TDGA 4KG6A 5CHUA 4XXRA 4O0PA 2LB5A 2WGVA 1ZG4A 4JXVA 3KSHA 1S66L 4Q8IA 3T50A 4KZ8A 4N9KA 2QKPA 1K4EA 4WL9A 4FUWA 3SH9A 5GLDA 4G3WA 3W4OA 3QP8A 1MWRA 2IWDA 1IFQA 2V9AA 1U60A 5FDSA 3QP2A 3C2WA 1KE3A 1MXOA 1AXBA 4U0XA 1H8ZA 2ZC4B 1MWSA 5CECA 3C4PA 5EOOA 4KZ7A 3KYZA 4HNBA 3BJNA 4EESA 5L07A 1NRFA 4ARZA 4LPZA 2ZMVA 2OLUA 3MJQA 1FQGA 4OQ0A 4NETA 1H8YA 1ESIA 3ISGA 3QNCA 4X6TA 3N8LA 3CITA 4R3AA 2LB9A 3OBFA 3BFFA 2XR0A 5KSHA 5DKLA 1IKIA 4N1XA 1QMEA 1Z09A 3CUEA 5KZHA 1G6AA 3Q81A 2K2NA 3ZNTA 2ZQ8A 2Y2KA 1O7EA 4HOIA 4IVKA 1BUEA 5GLBA 1BSGA 1MBLA 3NULA 4DRTA 3KSIA 3N7WA 1EROA 2WKQA 1KDSA 5G4ZA 3V3RA 2OSUA 2P7JA 4A5RA 2E8IA 3EQUA 4P85A 4JF4A 3I7JA 5TBMA 3ITBA 2XDMA 3N8SA 2B02A 5CRFA 3UB6A 3BLMA 4KQOA 2DRWA 3BFCA 2L0WA 2OAP1 3JYIA 1BLSA 3HBRA 1BULA 1UWPX 3GR2A 3CWFA 3F1PB 2HDSA 5HWWA 2P9VA 3PXPA 1IOUA 1HTZA 2P08A 4LLOB 1EW0A 2OLVA 5AQ9A 1N4OA 5G4YA 1TVFA 1YKDA 4ME4A 1TS7A 1GHMA 5KMWA 1GA9A 4B88A 3FWLA 3SZTA 5HPFA 4HH2A 2V8CA 4DXCA 1NRJA 4OQIA 3S7PA 4HH3A 1NLZA 3T1XA 4Y0UA 3MQOA 3SS4A 4HP9A 4KZ6A 1PZOA 3QP1A 2L4RA 3CPTB 4JLFA 5EVLA 3DTIA 1K54C 4CJNA 5GHYA 3TRCA 4GDNA 2EWVA 3HLCA 3OPLA 1YMSA 3VP4A 4L9GA 2RL3A 3G35A 4OVDA 4QY5A 2HDUA 3ZNYA 4GHIB 2XRNA 3F1NB 4EQ1A 5DFXA 1YM1A 5CHMA 4X25A 1L0GA 2JKGA 4F3LA 5L09A 1BTLA 3HVFA 1M6KA 2XLNA 4WEJA 3IF6C 2WKPA 3UE0A 2Z2MB 3TJZC 4WELA 5F6AA 4MBFA 2AVXA 1PI5A 2Y2HA 2H0TA 4HESA 1MY8A 4QU3A 4QD4A 1FIKA 1E3UA 4Y17A 3EWKA 4OH0A 1CEGA 2Y2MA 4BD1A 4NKPA 1PFLA 4H8RA 3ZDJA 4H6JB 3BFGA 3LICA 1MC0A 4O7DA 3MXSA 3MZEA 1A0KA 4GD8A 4Y0OA 3IXBA 3OPPA 4QWOA 4ZJ3A 2X71A 3UMDA 4R4RA 4BBVA 1PW1A 4ZJ2A 3BFEA 1IEMA 2HZ5A 4KQRA 4DMZA 5FI7A 3C7VA 3HLGA 4BMWA 1TDLA 2WZZA 1F98A 3C38A 4KZ3A 3PAGA 4EXOA 4UEYA 1HZOA 1DP9A 4ARZB 5EUAA 1OTBA 4QPRA 2Q9NA 1VEUB 4I3JA 1DY6A 2VV6A 2VZWA 3CUEC 2B18A 5FQQA 2M7VA 4II7A 5HL6A 3QP4A 4GS9B 4BLMA 3DAVA 5AQBA 5GLAA 1CF0A 2JBFA 2R9XA 2ZMFA 2Y2PA 3NCKA 5E2HA 3NJAA 4I39A 2VEAA 1K38A 3ITAA 3TE8A 1J3WA 4N9LA 4S2PA 4JGQA 1MPLA 1OJGA 3UB9A 3DTKA 4EUVA 1BLPA 3LEZA 2XA7M 3BECA 3E4PA 3C4OA 1K57C 1KVLA 3HLFA 1CK3A 4X56A 3FKVA 3UPNA 2QJ5A 2FZ0A 3LR5A 2QJ7A 2XD5A 3VP2A 1PNEA 5U47A 5E2GA 3W8KA 3LR3A 5FASA 5C5KA 2HJ9C 1T1AA 4DN0A 4EBPA 2JKTM 1W5DA 2PDRA 3UPPA 5J4EA 2KOIA 3H82A 3G31A 4ZTKA 1DRMA 5IT5A 2PYRA 2JKFA 3VP1A 1PWGA 4KZAA 4QJGA 4PM6A 3UB7A 3MKEA 4GZBA 4OOLA 3H82B 4XUXA 1JTDA 4JPMA 4EERA 3IWIA 4O8GA 4EQIA 3ZVTA 4R6LA 2O9CA 3MS6A 5FQ9A 1YMXA 3G32A 3EEHA 3AGFA 3GVBA 3B33A 3RXWA 5FI2A 1BT5A 4EBLA 3N8RA 1KE4A 1X0OA 2JN7A 1JWVA 2Y91A 3B42A 2R9WA 3NOTC 1ZG6A 1XJ6A 2W3HA 3IF5A 1L3LA 5K5BA 3ZYTA 1CQAA 3MXRA 3VV4A 2BLSA 3S22A 1GCEA 1GSXA 5E43A 1Q2PA 4DJ2A 3VFFA 2OWHA 1PWDA 4IHQA 4OPQA 4BBUA 4OOMA 4E6XA 4S2JA 1Y28A 1K54A 3O3VA 3QP5A 1K6SA 4JF5A 3V39A 3GMWA 2J7VA 3D9YA 1GSVA 2WYXA 1S1YA 1NZUA 5HFOA 2ZJ9A 1K56A 5EM0A 4ZBEA 1E4DA 5TFQA 1VEUA 3P7NA 5J8XA 1D1JA 3LIAA 1YLYA 1I5QA 3LUQA 4GNUA 2RCXA 2VV7A 3A0SA 4MN7A 5E2FA 4S2KA 4R4SA 5LBRA 1LI0A 4XT2A 1V9YA 5F1FA 3LY4A 4WYYA 4OQGA 3D72A 2O9AA 3N6IA 5HX9A 4Y0TA 3K3DA 3G2ZA 4IEDA 2M1CA 5TGFA 1KDWA 4GCZA 4GS9A 1Q2QA 1ACFA 1GA0A 3GQZA 3O88A 3OPHA 3JPUA 4GD6A 3P01A 5FI6A 1T19A 1KOUA 3UNWA 3UE3A 4R0QA 2WAEA 1ESUA 1FR1A 4DXBA 3VOLA 4ZDXA 1JWZA 3HCYA 3PBTA 3KO6A 4LRZE 3LIEA 4X69A 1SKOB 3T4OA 2G2WA 1ONHA 4GKUA 1EWZA 2DNSA 4G3VA 1S4RA 2XEPA 2PR5A 2V0UA 3CAXA 5F68A 3W2ZA 4CLCD 1NWZA 5F83A 3SW1A 2XGNA 3LIFA 4IUHA 3GTCA 2PU2A 3FYZA 2A24A 4WEKA 3RXXA 4LRYC 4I38A 4DKIA 3O87A 1W63M 2VV8A 1W79A 1P9RA 4HY8A 2W27A 3SS5A 4HQAA 4S2OA 5FQMA 3G4PA 1DJBA 2XF3A 3MXQA 5FSRA 2QZ6A 3F1OB 4NXEA 1OJ5A 2QHKA 4P87A 4GN2A 1ONGA 2PT7A 4FH4A
chains in the Genus database with same CATH topology
5G4YA 3MFXA 1YKDA 2VA0A 2YKFA 3PR6A 4ME4A 1TS7A 1YSPA 1YAXA 3D3OA 3FPWA 3H7WB 4YWZA 3MR0A 5HZHA 5J3WA 5HDDA 1F9IA 4I3AA 3T4LA 5HWVA 5HPFA 4HH2A 2K7SA 2Y8HA 4KUOA 1NRJA 3EOIA 3S7PA 2GZAA 2G7UA 3FG8A 1LL8A 4HH3A 2PHYA 2W0NA 1UWNX 2W3FA 1NLZA 1JNUA 1TS8A 3MQOA 4FOFA 4HIAA 5HPIA 4HP9A 1ZHHB 3BQ8A 3HJKA 5AVEA 2L4RA 5FL3A 5DKKA 2O99A 2XROA 1MZUA 2JKRM 3UMEA 2J3WA 3R7WA 2V1BA 3ULFA 3F1PA 3TRCA 3KYQA 2EWVA 4FSFA 3PBQA 2DMWA 1UGUA 2V0WA 2W3DA 4L9GA 5KIZA 2QWSA 4HI4A 4MMNA 4B93A 4I3IA 5DF9A 1OPXA 4P6ZM 3T4QA 5AVFA 2OWJA 2W3EA 3E98A 2BASA 4GHIB 4JGRA 1NLYA 4L0LA 4ETZA 2XRNA 1T18A 2OAQ1 3F1NB 3HJIA 4GHIA 3OOVA 4EQ1A 5DFXA 3F1NA 2HGVA 4UQIS 2GX5A 4NEED 2W1TB 1VB6A 1TS6A 2NUPC 4F3LA 1XFQA 1P97A 1OTAA 3FPVA 2XSSA 4WEJA 2A2LA 3ICYA 2WKPA 4AFIA 2NUTC 1GSWA 4YNRA 3PBRA 2INWA 1LSWA 3TJZC 2HF6A 4WELA 5F6AA 5TJJA 1XFNA 1YSQA 4L9FA 5HWTA 3F1OA 5F69A 3NOPC 5IS1A 1OTDA 3EWKA 1H8MA 4NKPA 1WA9A 2KLIA 4EU0A 1LSXA 4PKYA 4Y2FA 3PYPA 4H6JB 3KX0X 3LICA 1OTEA 4YOFA 1MC0A 4E04A 5HD5A 4BBTA 2JHEA 2J3TC 1N9NA 4KQDA 3PBOA 2PR6A 5CX7A 3UMDA 4BBVA 4EEUA 3C8CA 2M7UA 2KX6A 1XJ3A 2VGLS 2D02A 4UQIM 4DMZA 4O01A 2OOLA 4BMWA 3PHYA 1F98A 3C38A 4EXOA 4UEYA 1N9LA 2ZBBA 1DP9A 1VHMA 4ARZB 1OTBA 2D01A 2V1AA 5A8BA 4QPRA 4I3JA 2HV1A 3IBRA 2VKSA 3O5YA 4JGOA 4HJ6A 2VV6A 2PD8A 3GDIA 3LIBA 4PHTA 2VZWA 3CUEC 2B18A 2L1MA 2M7VA 4LRXC 4II7A 5HL6A 4EW7A 4ETXA 3T4JA 4GS9B 4CQHA 2ZMFA 5HDSA 3EQVA 3OCLA 1TS0A 4MN5A 3S7QA 4Y5FA 3NJAA 4BWIA 3E0YA 4I39A 2VEAA 5HSQA 3DBAA 5HD3A 3TE8A 4G3KA 2PD7A 3KSFA 5TBMB 4IJGA 2HJEA 1OT6A 1TD5A 3LR4A 4JGQA 1OJGA 4GW9A 3UB9A 4CLCB 1XJ2A 5F5YA 4NXBA 4EUVA 4Q0JA 2XA7M 3E4PA 3LI8A 3LI9A 2ZOHA 4NXGA 3K2NA 4WUJA 5DFYA 3CI6A 5MC7A 2FH5A 3EGDC 3RH8B 3R7WB 1ZTUA 2QJ5A 1OT9A 2FZ0A 3LR5A 2QJ7A 4GJ4A 1OTIA 2O0YA 1DP8A 4HHDA 1S4SA 3LR3A 2YKHA 1LT0A 4JGPA 2W1RA 4DJ3A 5IU1A 5C5KA 2HJ9C 1T1AA 4DN0A 4F3LB 2JKTM 3V67A 3IBJA 2PDRA 2J3TD 2Z6DA 5J4EA 2KOIA 3BWLA 3K3CA 3H82A 1D06A 1DRMA 2JKRI 3BY8A 3H7WA 5IT5A 2PYRA 2ZOIA 4ZRRA 3T4KA 3EGXC 3PBSA 2W3GA 1F5MA 4GLQA 3UB7A 3FC7A 4I5SA 2EA9A 4HJ3A 4KUKA 4OOLA 3H82B 4B9OA 4EERA 4O8GA 4MN6A 4WLAA 4R6LA 2O9CA 2R78A 1S1ZA 3G6OA 2IA2A 3NHQA 5DJUA 2VGLM 5EFWA 3EEHA 3LIDA 4HP4A 3B33A 4WN5A 3BY9A 1W63Q 3UE6A 3ZQ5A 3R4KA 2MJ6A 4WF0A 1T1CA 3PBNA 3B47A 4R38A 1X0OA 2GJ3A 1BYWA 2A24B 2JN7A 4O0PA 3LFVA 3B42A 3TW8A 1N9OA 3NOTC 3IS2B 4MCWA 1XJ6A 2W3HA 1XJ4A 2LB5A 3VE3A 4BJPA 3KSGA 5K5BA 3H9WA 3KSHA 3ZYTA 1S66L 3T50A 3VV4A 2QKPA 3MMHA 1TF1A 4WL9A 1GSXA 1MKMA 4G3WA 4DJ2A 4CLCC 4H6JA 2OWHA 3MF0A 3LR0A 4IHQA 3T4TA 4XT2B 4BBUA 4OOMA 4PKYG 3MQ0A 1Y28A 1IFQA 2Y79A 3IS2A 2V9AA 1LSVA 2VX8A 2JKTI 2QYBA 3C2WA 4MDZA 3CLOA 4RQ9A 1GSVA 1S1YA 3U2AA 1T1BA 3OLOA 4PAUA 4L9EA 1G28A 2CMNA 3EEAA 3KYZA 2K31A 4HNBA 3BJNA 3P7NA 1STZA 4K08A 2I9VA 4EESA 5I5LA 3BW6A 3JVVA 4CLCA 3LIAA 2J80A 3LUQA 4ARZA 4LPZA 2O9BA 2VV7A 2H28A 3A0SA 4MN7A 4EEPA 2ZMVA 3MJQA 3VE4A 5LBRA 5J7EA 4XT2A 1V9YA 3A0RA 1S67L 4CLCE 4Z1WA 3D72A 2O9AA 3K3DA 3S7NA 3JVUA 2EWWA 3LYXA 2M1CA 3GECA 3NOUC 4GCZA 4GS9A 3RTYA 3CITA 4R3AA 2LB9A 3OBFA 4Y3IA 4Q0IA 5KSHA 5DKLA 3T4SA 1D7EA 3OCNA 4EETB 3P01A 3E4OA 3CUEA 3UB8A 1G6OA 1T19A 1KOUA 2K2NA 1V9ZA 3UE3A 2PYPA 3S7OA 1DP6A 2Z6CA 3VOLA 4HOIA 3HCYA 3PBTA 3KO6A 4LRZE 5AJGA 3KSIA 3LIEA 1H3QA 2WKQA 3T4OA 5G4ZA 2P7JA 4Q0HA 3BQAA 1P0ZA 3EQUA 2GNXA 4NXFA 4G3VA 3MQQA 1S4RA 2PR5A 3C30A 3E4QA 2V0UA 3CAXA 5F68A 5TBMA 3W2ZA 4CLCD 4M4XA 1NWZA 2B02A 3UB6A 3SW1A 4P6ZS 3LIFA 4IUHA 4KQOA 1P9WA 3OC2A 2A24A 4WEKA 2L0WA 2OAP1 4LRYC 4I38A 2XA7S 4IUKA 4HJ4A 1W63M 2VV8A 1UWPX 4R70A 3CWFA 1ODVA 1P9RA 4HY8A 5DJTA 2W27A 3F1PB 2KDKA 4HQAA 5HWWA 3RFBA 3PXPA 2P04A 2VJWA 3MXQA 2W1TA 1IOUA 5HDCA 3A0VA 3F1OB 2P08A 4NXEA 5L8MA 1OJ5A 2QHKA 4LLOB 1EW0A 2VLGA 2WKRA 2PT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VV7 A;  2H28 A;  3A0S A;  3BWL A;  2YKF A;  3MFX A;  2PR6 A;  1TS7 A;  3K3C A;  5G4Y A;  3MJQ A;  3H82 A;  3UMD A;  4EEP A;  1D06 A;  1DRM A;  3H7W A;  3BY8 A;  3VE4 A;  4BBV A;  3C8C A;  4EEU A;  2KX6 A;  2PYR A;  2ZOI A;  3H7W B;  3MR0 A;  1V9Y A;  1XJ3 A;  3A0R A;  4XT2 A;  1S67 L;  2WKR A;  4YWZ A;  5HZH A;  5J4E A;  5J3W A;  5HDD A;  1F9I A;  4I3A A;  2D02 A;  5HWV A;  3D72 A;  3UB7 A;  4HH2 A;  2K7S A;  3K3D A;  2OOL A;  3FC7 A;  4KUO A;  3PHY A;  4F3L B;  4I5S A;  2EA9 A;  4HJ3 A;  3LYX A;  1F98 A;  4KUK A;  3H82 B;  2M1C A;  3FG8 A;  3GEC A;  1LL8 A;  4HH3 A;  3NOU C;  2PHY A;  2W0N A;  4B9O A;  1UWN X;  4GCZ A;  1N9L A;  4GS9 A;  3RTY A;  4R3A A;  4EER A;  1JNU A;  2ZBB A;  4MN6 A;  1TS8 A;  1DP9 A;  3MQO A;  4HIA A;  5DKL A;  4HP9 A;  4WLA A;  4R6L A;  1OTB A;  2D01 A;  1D7E A;  3HJK A;  4EET B;  2V1A A;  5AVE A;  5A8B A;  2L4R A;  2HV1 A;  3IBR A;  4I3J A;  4JGO A;  3E4O A;  4HJ6 A;  5DKK A;  2R78 A;  1S1Z A;  2VV6 A;  3G6O A;  2PD8 A;  3GDI A;  1MZU A;  3LIB A;  3NHQ A;  5DJU A;  1T19 A;  5EFW A;  2L1M A;  1KOU A;  3EEH A;  3LID A;  1V9Z A;  4HP4 A;  4LRX C;  3B33 A;  4WN5 A;  2PYP A;  3UME A;  4EW7 A;  3BY9 A;  3UE6 A;  2V1B A;  3ULF A;  4GS9 B;  3ZQ5 A;  3F1P A;  1DP6 A;  4WF0 A;  1T1C A;  2Z6C A;  3VOL A;  4R38 A;  1X0O A;  2GJ3 A;  4HOI A;  1BYW A;  2A24 B;  2JN7 A;  5HDS A;  1UGU A;  2V0W A;  4L9G A;  5KIZ A;  4LRZ E;  2QWS A;  1TS0 A;  4HI4 A;  4MN5 A;  1N9O A;  3NOT C;  3LIE A;  3IS2 B;  3NJA A;  1XJ6 A;  4I3I A;  2WKQ A;  1XJ4 A;  5G4Z A;  4I39 A;  3VE3 A;  2VEA A;  5HSQ A;  5AVF A;  2P7J A;  3H9W A;  3UB8 A;  5J7E A;  2OWJ A;  5HD3 A;  1S66 L;  2BAS A;  1P0Z A;  4GHI B;  4JGR A;  2PD7 A;  3T50 A;  2QKP A;  4NXF A;  3MQQ A;  1S4R A;  1T18 A;  4GHI A;  3F1N B;  1GSX A;  3HJI A;  4WL9 A;  2PR5 A;  5TBM B;  4EQ1 A;  3E4Q A;  1OT6 A;  3F1N A;  2V0U A;  4DJ2 A;  3CAX A;  4H6J A;  4JGQ A;  2OWH A;  1OJG A;  5F68 A;  5TBM A;  4BBT A;  4GW9 A;  3UB9 A;  1XJ2 A;  1NWZ A;  4M4X A;  2B02 A;  4XT2 B;  3UB6 A;  3SW1 A;  5F5Y A;  4NXB A;  3LIF A;  1VB6 A;  4PKY G;  4BBU A;  1TS6 A;  3E4P A;  4F3L A;  1XFQ A;  1Y28 A;  1P97 A;  1OTA A;  2ZOH A;  3LI8 A;  3LI9 A;  4NXG A;  4WUJ A;  2A24 A;  3IS2 A;  2L0W A;  1LSV A;  2V9A A;  4LRY C;  4I38 A;  3ICY A;  2WKP A;  3RH8 B;  4HJ4 A;  2VV8 A;  3C2W A;  2QJ5 A;  1OT9 A;  1GSW A;  2Z6D A;  3CLO A;  4RQ9 A;  2INW A;  2QJ7 A;  1LSW A;  1UWP X;  4R70 A;  3CWF A;  1GSV A;  1ODV A;  5F6A A;  1S1Y A;  1XFN A;  4HY8 A;  5DJT A;  4EXO A;  2W27 A;  1OTI A;  3F1P B;  1T1B A;  1DP8 A;  3OLO A;  4HHD A;  1S4S A;  2KDK A;  4L9E A;  4L9F A;  5HWT A;  4HQA A;  1G28 A;  3F1O A;  5F69 A;  3NOP C;  5HWW A;  2CMN A;  5IS1 A;  2YKH A;  1OTD A;  3EWK A;  4HNB A;  3MXQ A;  3P7N A;  1LT0 A;  4JGP A;  4K08 A;  2I9V A;  4EES A;  1WA9 A;  5HDC A;  5I5L A;  1LSX A;  4PKY A;  3A0V A;  5IU1 A;  4DJ3 A;  3LIA A;  3PYP A;  3F1O B;  3KX0 X;  2J80 A;  1OTE A;  3LIC A;  1T1A A;  4H6J B;  4NXE A;  4E04 A;  5HD5 A;  1OJ5 A;  2JHE A;  2QHK A;  3LUQ A;  4LLO B;  1EW0 A;  2VLG A;  2PDR A;  4LPZ A;  1N9N A;  4KQD A; 
#chains in the Genus database with same CATH topology
 2VA0 A;  3WS2 A;  1PW8 A;  3ZG9 B;  4D60 A;  3D3O A;  3IHB A;  4YWZ A;  3MR0 A;  2E8J A;  5HWV A;  2G2U A;  2Y8H A;  3IXD A;  2GZA A;  3FG8 A;  2PHY A;  2W0N A;  5CHJ A;  1UWN X;  3SS3 A;  4E6W A;  2HPB A;  3VMA A;  4OP5 A;  1LL9 A;  3BQ8 A;  5HAP A;  2HP6 A;  3WRT A;  1IYQ A;  5EOE A;  2JKR M;  2DCF A;  3UME A;  3ULF A;  2ZQD A;  4ZAM A;  3F1P A;  1G68 A;  5FQK A;  3PBQ A;  1GHP A;  4X53 A;  1UGU A;  4HI4 A;  5DF9 A;  4KZ9 A;  3W4P A;  5AVF A;  2W3E A;  3SH8 A;  4ETZ A;  1T18 A;  3HJI A;  3OOV A;  4M3K A;  4PM7 A;  2FFF B;  2GX5 A;  1M40 A;  3BYD A;  4DDS A;  1VB6 A;  1TS6 A;  2NUP C;  5JYP A;  1XFQ A;  1P97 A;  3NY4 A;  4R1G A;  1YLT A;  3V3S A;  1PRQ A;  4AFI A;  4E3I A;  1S0W A;  2Y2O A;  2ZM8 A;  1GSW A;  3DWK A;  2HF6 A;  2PAV P;  1XFN A;  3CPT A;  1YSQ A;  5JYO A;  4PM9 A;  1FSW A;  3FKW A;  1XGI A;  3F1O A;  5EEC A;  5HAI A;  5F69 A;  2B5R A;  3GRJ A;  4LV0 A;  3CMZ A;  4EU0 A;  1OTE A;  4E04 A;  1XA7 A;  4WZ5 C;  4MLL A;  4LFU A;  5CGS A;  1NYM A;  3UY6 A;  2Q9M A;  3C8C A;  2M7U A;  2EX9 A;  3N4I A;  3UB5 P;  1FSY A;  4RYE A;  5FEF A;  1XPB A;  4O01 A;  2OOL A;  3P98 A;  5HAQ A;  3E2K A;  1N9L A;  4BD0 A;  1JWP A;  4ID4 A;  3GV9 A;  4PHT A;  4PM5 A;  4N1H A;  4MNR A;  4LRX C;  4WZ5 A;  4HBU A;  3T4J A;  5GL9 A;  4JXS A;  2HP5 A;  5L2F A;  4E3J A;  2WKI A;  1HLU P;  1Y4O A;  4CQH A;  2BG1 A;  5HDS A;  3DW0 A;  3OCL A;  4MN5 A;  4BEN A;  4BWI A;  2WAF A;  5HSQ A;  1GHI A;  3NDE A;  4G3K A;  4WBG A;  2PD7 A;  2V20 A;  3LR4 A;  3UDF A;  3Q1F A;  4GW9 A;  1XJ2 A;  3DTE A;  1ZC2 A;  4NXB A;  4Q0J A;  3UPO A;  5EV0 A;  3LI9 A;  5HAR A;  2WGI A;  2WGW A;  5MC7 A;  3RH8 B;  4K0X A;  1OT9 A;  1CEF A;  4WMC D;  1IYP A;  3SH7 A;  2O0Y A;  5TR7 A;  1S4S A;  2WGW B;  3A3I A;  3VP3 A;  4JGP A;  1TEM A;  1W7F A;  5IU1 A;  1XX2 A;  4D2O A;  1ES3 A;  1G5U A;  3V67 A;  1RGZ A;  2J3T D;  1ES5 A;  3K3C A;  3M6H A;  3EGX C;  2W3G A;  4KQQ A;  1F5M A;  3MZF A;  2EFU A;  4LGW A;  3AGE A;  4I5S A;  4HJ3 A;  4KUK A;  3WS5 A;  4MN6 A;  4HEF A;  4WLA A;  1NXY A;  4DDY A;  2Q0O A;  4KG2 A;  1OME A;  3G6O A;  5DJU A;  5EFW A;  4KZ4 A;  2ZM0 A;  3UO9 A;  3R4K A;  2MJ6 A;  3PBN A;  4OP8 A;  3B47 A;  4R38 A;  3HUO A;  4EUZ A;  1XP4 A;  2A24 B;  5AQA A;  1XKZ A;  4JXG A;  2H5S A;  3TW8 A;  5EVI C;  1FR6 A;  3KSG A;  1BZA A;  1TF1 A;  1Z6F A;  4UAA A;  1MKM A;  2IWC A;  3WS0 A;  3MF0 A;  3T4T A;  4BQM A;  3Q07 A;  2Y79 A;  5F1G A;  3IS2 A;  1LSV A;  1K6R A;  2JKT I;  2QYB A;  4S2L A;  3HUM A;  3IT9 A;  5L10 A;  4MDZ A;  3TOI A;  3CLO A;  4RQ9 A;  1XA1 A;  3HLE A;  3ZG8 B;  3U2A A;  4C75 A;  4P6B A;  3OZH A;  4L9E A;  1G28 A;  2A3U A;  5FAT A;  3EEA A;  1STZ A;  4K08 A;  5I5L A;  3BW6 A;  4CLC A;  2V2F F;  2J80 A;  1E25 A;  2O9B A;  2H28 A;  1KGG A;  3VE4 A;  1KGE A;  3A0R A;  1S67 L;  3T1S A;  2EXB A;  4PMA A;  1K57 A;  5FDH A;  4Z1W A;  2Y2N A;  5EE8 A;  5CEB A;  2Y2J A;  3HUN A;  3LYX A;  3GEC A;  3NOU C;  1ES4 A;  5I94 A;  4Y3I A;  4Q0I A;  3T4S A;  3E4O A;  3UB8 A;  1V9Z A;  3IXH A;  2PYP A;  1LL5 A;  2Z6C A;  2Y59 A;  4BL3 A;  3Q82 A;  1YPR A;  1H3Q A;  1SZV A;  3UN7 A;  5CGW A;  4MEZ A;  4Q0H A;  3IQA A;  3BQA A;  3CJM A;  2GNX A;  4NXF A;  3MQQ A;  4MBH A;  3C30 A;  3E2L A;  3E4Q A;  2PU4 A;  1NYY A;  5FQI A;  4M4X A;  3WWX A;  4XUZ A;  4C6Y A;  3OC2 A;  4YIN A;  2BTF P;  5DTK A;  1J9M A;  4U3T A;  4HJ4 A;  4DF6 A;  1CI8 A;  4QHC A;  2EXA A;  5G18 A;  1ERM A;  1ODV A;  4KZ5 A;  3A3D A;  3HLD A;  4JXW A;  1VQQ A;  2KDK A;  1FIL A;  3VOY A;  2P04 A;  2VJW A;  2W1T A;  5HDC A;  2HDQ A;  4NG2 A;  5A93 A;  5CXW A;  4LCL A;  4X1L A;  2WKR A;  5CGX A;  3ZGA B;  3V50 A;  2ZC6 B;  1YAX A;  3H7W B;  5J3W A;  1HVB A;  4I3A A;  3T4L A;  2ZC5 B;  4E3O A;  3OPR A;  2K7S A;  2ZL1 A;  3EOI A;  1ALQ A;  1I2S A;  1LL8 A;  1FCM A;  1JNU A;  1TS8 A;  4FOF A;  3IX8 A;  3BFD A;  1ZHH B;  3HJK A;  5AVE A;  5KSC A;  4B4X A;  5FL3 A;  3IX4 A;  5DKK A;  3GSG A;  2XRO A;  4PPR A;  2P9V B;  3A3J A;  4JKT A;  1KGF A;  3CG5 A;  4X55 A;  3R7W A;  2Y4A A;  3QP6 A;  3KYQ A;  3B3X A;  4FSF A;  1RCJ A;  5BOH A;  4FD8 A;  5A92 A;  1K0K A;  4B93 A;  4I3I A;  1DJC A;  4OLG A;  3T4Q A;  1ZKJ A;  1NLY A;  4L0L A;  2UWX A;  2XD1 A;  3F1N A;  1IYS A;  5CTN A;  4UQI S;  5FAQ A;  1MWU A;  4NEE D;  1YQS A;  2W1T B;  1OTA A;  2EX6 A;  3FPV A;  4WM9 A;  2A2L A;  2EFX A;  1BLH A;  1HD8 A;  1LLB A;  4MBK A;  2NUT C;  3HLW A;  4YNR A;  3PBR A;  1SDE A;  3IH8 A;  4DE1 A;  1WYB A;  4L9F A;  4P0M A;  3LEQ A;  3CZD A;  1LHY A;  3KYE A;  5IS1 A;  4S2N A;  1H8M A;  1LSX A;  3ZG7 B;  1JVJ A;  3PYP A;  4YOF A;  3KX0 X;  1YT4 A;  4IBR A;  5FA7 A;  5CTM A;  5HD5 A;  2J3T C;  3VSL A;  2PR6 A;  1PIO A;  5CED A;  3IWO A;  5M1A A;  2ZL1 B;  2XK1 A;  2WZX A;  3T12 B;  1XJ3 A;  2VGL S;  2D02 A;  3O86 A;  5EVE A;  1BLC A;  3PHY A;  2XQZ A;  1RP5 A;  3ZFZ A;  3Q7Z A;  4QY6 A;  4R3B A;  1K56 D;  3NDG A;  1K4F A;  2ZQC A;  5E2E A;  4OPR A;  2V1A A;  5A8B A;  4DE2 A;  2VKS A;  3O5Y A;  3LCE A;  3GDI A;  3LIB A;  2L1M A;  5IHV A;  4EV4 A;  2Y55 A;  5GHZ A;  2ZC3 B;  4BL2 A;  2FFY A;  4OKP A;  2VGJ A;  3LGO A;  2Y2I A;  1H5X A;  3EQV A;  2GDN A;  1EI5 A;  3E0Y A;  3BLS A;  3A3F A;  3KSF A;  2C6W B;  5TBM B;  4IJG A;  2HJE A;  2X02 A;  4RVA A;  4KEN B;  4CLC B;  1IKG A;  5F5Y A;  3LI8 A;  3K2N A;  5DFY A;  2V8F A;  3CI6 A;  3IH9 A;  4QB8 A;  5M18 A;  2EX8 A;  2Y2G A;  3R7W B;  1KVM A;  3M2K A;  2J9P A;  4OPZ A;  4X68 A;  1OTI A;  1DP8 A;  4HHD A;  3RJU A;  3MSH A;  3WRZ A;  4YFM A;  4B4Z A;  1FCO A;  3ZVW A;  1S6R A;  3Q7V A;  1C3B A;  3TSG A;  5AQ7 A;  1I2W A;  3BWL A;  4C3Q A;  1D06 A;  2JKR I;  3H7W A;  3BY8 A;  4RA7 A;  4ZRR A;  2ZOI A;  3NI9 A;  3T4K A;  4DE0 A;  4E3K A;  4S2N C;  2ZMA A;  3FC7 A;  2EA9 A;  5M19 A;  3M2J A;  4B9O A;  2A49 A;  4DE3 A;  1W8Q A;  1KE0 A;  4RX2 A;  1PYY A;  3Q7V B;  1ES2 A;  4FCF A;  2R78 A;  3NHQ A;  2H0Y A;  4WN5 A;  4CPK A;  1SKF A;  1W63 Q;  3UE6 A;  3IF6 A;  3VFH A;  3ZQ5 A;  1T1C A;  2ZQ9 A;  3LY3 A;  1NZO A;  2GJ3 A;  1BYW A;  3LFV A;  1N9O A;  3IS2 B;  4MCW A;  5F82 A;  1XJ4 A;  3VE3 A;  4BJP A;  3NBL A;  3H9W A;  5A91 A;  4ESP A;  2XH9 A;  5DTS A;  3MMH A;  4E3L A;  4UA9 A;  4CLC C;  4H6J A;  4OOY A;  3LR0 A;  4XT2 B;  4PKY G;  3MQ0 A;  2ZLY A;  3P09 A;  4LV2 A;  2I72 A;  1IYO A;  2VX8 A;  1JTG A;  1N9B A;  3WS4 A;  1PWC A;  1CJF A;  1T1B A;  3OLO A;  4PAU A;  4S2M A;  3ZCZ A;  4ZJ1 A;  2CMN A;  2K31 A;  2VK3 A;  2I9V A;  4R3J A;  3JVV A;  2HDR A;  3C7U A;  3NEC A;  2ZQA A;  1PI4 A;  3BRM A;  3MBZ A;  4EEP A;  5J7E A;  5GLC A;  4CLC E;  1QMF A;  1YLJ A;  4HBT A;  5FQJ A;  3IWQ A;  3S7N A;  3JVU A;  1E3U D;  2EWW A;  1PZP A;  2UV0 E;  5EM1 A;  3U4L P;  3RTY A;  2H10 A;  3DWZ A;  1VM1 A;  1D7E A;  3OCN A;  5FAP A;  4EET B;  2PRF A;  1G6O A;  2B95 A;  4JF6 A;  3S7O A;  1DP6 A;  3T1R A;  3MZD A;  1DJA A;  5AJG A;  2JCH A;  1P0Z A;  4EBN A;  1W8Y A;  4JBF A;  3CHW P;  4RX3 A;  2HP9 A;  4P6Z S;  1P9W A;  3UE1 A;  2JC7 A;  4EWF A;  1VET A;  2J8Y A;  4Y7P A;  2XA7 S;  4IUK A;  1L0F A;  3L7H A;  2WUQ A;  4U0T A;  3W4Q A;  4NK3 A;  4R70 A;  2C5W B;  3NIA A;  5DJT A;  2Z2L B;  3HLB A;  4X1M A;  1NY0 A;  3RFB A;  5GHX A;  4FH2 A;  3LO7 A;  2J9O A;  3A0V A;  5L8M A;  4LCM A;  3NC8 A;  2VLG A;  3MFX A;  3PR6 A;  2YKF A;  1LI9 A;  2JE5 A;  1CI9 A;  4OON A;  2ZD8 A;  1YSP A;  1Y54 A;  3VP0 A;  3FPW A;  5HZH A;  1SKO A;  5HDD A;  2ZC7 A;  1F9I A;  3BM6 A;  5FEG A;  4IBX A;  5DF8 A;  4KUO A;  3IX3 A;  1FOF A;  2G7U A;  5DF7 A;  1WE4 A;  2W3F A;  4UA6 A;  2Y2Q A;  3VSK A;  4HIA A;  4GDB A;  5FAO A;  5HPI A;  5EVI D;  5D3O A;  2O99 A;  1K25 A;  1MZU A;  3UDX A;  4Y15 A;  2IWB A;  5EVI B;  3PTE A;  2J3W A;  5CER A;  2V1B A;  3HL9 A;  2DMW A;  2V0W A;  2W3D A;  2WAD A;  5KIZ A;  3ZG5 A;  2QWS A;  4MMN A;  1OPX A;  1ERQ A;  3QNB A;  4OLD A;  4P6Z M;  4IVI A;  2V1Z A;  2OWJ A;  3E98 A;  2BAS A;  4JGR A;  1SHV A;  1L2S A;  5DVA A;  5A90 A;  2OAQ 1;  4GHI A;  1L0D A;  3G30 A;  2HGV A;  3ZG0 A;  1F2K A;  1XXM A;  3C5A A;  1NJ4 A;  2XSS A;  4GB7 A;  2WK0 A;  3ICY A;  3FZC A;  5HW3 A;  2INW A;  1LSW A;  3MKF A;  5TJJ A;  4OQH A;  3D4F A;  1K55 A;  5HWT A;  3S4X A;  3G2Y A;  3NOP C;  2XFS A;  1OTD A;  1H0M A;  4UHU A;  1WA9 A;  2KLI A;  4PKY A;  4Y2F A;  3MFD A;  4PM8 A;  4BBT A;  2JHE A;  4LV3 A;  1N9N A;  4KQD A;  3PBO A;  5CX7 A;  4EEU A;  4FTX A;  2KX6 A;  3S1Y A;  2ZM2 A;  4N92 A;  3ZHH A;  4UQI M;  2X01 A;  2WKH A;  1L0E A;  1YLP A;  5HL1 A;  3M6B A;  1MWT A;  1IEL A;  3HRE A;  2ZBB A;  4Z9Q A;  1VHM A;  2D01 A;  5EPH A;  4E3M A;  4JGO A;  2HV1 A;  3IBR A;  4HJ6 A;  2PD8 A;  3WS1 A;  2CC1 A;  4EW7 A;  4ETX A;  1RGY A;  3L9K A;  1TS0 A;  1K55 C;  1XGJ A;  3S7Q A;  4Y5F A;  4K0W A;  1SCW A;  1SDN A;  4S2I A;  3DBA A;  5HD3 A;  2OV5 A;  4Y13 A;  1OT6 A;  1TD5 A;  4NXG A;  2ZOH A;  1AWI A;  2P74 A;  2QPN A;  4WUJ A;  3V5M A;  2FH5 A;  3EGD C;  1ZTU A;  4LEN A;  4OPY A;  4GJ4 A;  3IF6 B;  3VOZ A;  4E3N A;  3AGD A;  4KZB A;  2YKH A;  2VGK A;  1LT0 A;  2PBD P;  2W1R A;  1MKI A;  4DJ3 A;  1WYC A;  5DTT A;  4WZ4 A;  4LV1 A;  2QMI A;  4F3L B;  2ZQ7 A;  3BEB A;  3IBJ A;  4WMC A;  2Z6D A;  2EX2 A;  1YLZ A;  3IHA A;  4K91 A;  3G34 A;  1FCN A;  3TG9 A;  3FV7 A;  4R23 A;  3PBS A;  4GLQ A;  2Y2L A;  3SOI A;  4F94 A;  1VET B;  3UDI A;  3QHY A;  4UA7 A;  4GOG A;  3PAE A;  3A3E A;  1O07 A;  2ACG A;  3IXG A;  2XFT A;  1YLW A;  2PBY A;  1S1Z A;  2IA2 A;  2VGL M;  3LID A;  5EVI A;  4HP4 A;  4KG5 A;  3BY9 A;  2WKE A;  3DTM A;  3T1Q B;  4WF0 A;  1TDG A;  4KG6 A;  5CHU A;  4XXR A;  4O0P A;  2LB5 A;  2WGV A;  1ZG4 A;  4JXV A;  3KSH A;  1S66 L;  4Q8I A;  3T50 A;  4KZ8 A;  4N9K A;  2QKP A;  1K4E A;  4WL9 A;  4FUW A;  3SH9 A;  5GLD A;  4G3W A;  3W4O A;  3QP8 A;  1MWR A;  2IWD A;  1IFQ A;  2V9A A;  1U60 A;  5FDS A;  3QP2 A;  3C2W A;  1KE3 A;  1MXO A;  1AXB A;  4U0X A;  1H8Z A;  2ZC4 B;  1MWS A;  5CEC A;  3C4P A;  5EOO A;  4KZ7 A;  3KYZ A;  4HNB A;  3BJN A;  4EES A;  5L07 A;  1NRF A;  4ARZ A;  4LPZ A;  2ZMV A;  2OLU A;  3MJQ A;  1FQG A;  4OQ0 A;  4NET A;  1H8Y A;  1ESI A;  3ISG A;  3QNC A;  4X6T A;  3N8L A;  3CIT A;  4R3A A;  2LB9 A;  3OBF A;  3BFF A;  2XR0 A;  5KSH A;  5DKL A;  1IKI A;  4N1X A;  1QME A;  1Z09 A;  3CUE A;  5KZH A;  1G6A A;  3Q81 A;  2K2N A;  3ZNT A;  2ZQ8 A;  2Y2K A;  1O7E A;  4HOI A;  4IVK A;  1BUE A;  5GLB A;  1BSG A;  1MBL A;  3NUL A;  4DRT A;  3KSI A;  3N7W A;  1ERO A;  2WKQ A;  1KDS A;  5G4Z A;  3V3R A;  2OSU A;  2P7J A;  4A5R A;  2E8I A;  3EQU A;  4P85 A;  4JF4 A;  3I7J A;  5TBM A;  3ITB A;  2XDM A;  3N8S A;  2B02 A;  5CRF A;  3UB6 A;  3BLM A;  4KQO A;  2DRW A;  3BFC A;  2L0W A;  2OAP 1;  3JYI A;  1BLS A;  3HBR A;  1BUL A;  1UWP X;  3GR2 A;  3CWF A;  3F1P B;  2HDS A;  5HWW A;  2P9V A;  3PXP A;  1IOU A;  1HTZ A;  2P08 A;  4LLO B;  1EW0 A;  2OLV A;  5AQ9 A;  1N4O A;  5G4Y A;  1TVF A;  1YKD A;  4ME4 A;  1TS7 A;  1GHM A;  5KMW A;  1GA9 A;  4B88 A;  3FWL A;  3SZT A;  5HPF A;  4HH2 A;  2V8C A;  4DXC A;  1NRJ A;  4OQI A;  3S7P A;  4HH3 A;  1NLZ A;  3T1X A;  4Y0U A;  3MQO A;  3SS4 A;  4HP9 A;  4KZ6 A;  1PZO A;  3QP1 A;  2L4R A;  3CPT B;  4JLF A;  5EVL A;  3DTI A;  1K54 C;  4CJN A;  5GHY A;  3TRC A;  4GDN A;  2EWV A;  3HLC A;  3OPL A;  1YMS A;  3VP4 A;  4L9G A;  2RL3 A;  3G35 A;  4OVD A;  4QY5 A;  2HDU A;  3ZNY A;  4GHI B;  2XRN A;  3F1N B;  4EQ1 A;  5DFX A;  1YM1 A;  5CHM A;  4X25 A;  1L0G A;  2JKG A;  4F3L A;  5L09 A;  1BTL A;  3HVF A;  1M6K A;  2XLN A;  4WEJ A;  3IF6 C;  2WKP A;  3UE0 A;  2Z2M B;  3TJZ C;  4WEL A;  5F6A A;  4MBF A;  2AVX A;  1PI5 A;  2Y2H A;  2H0T A;  4HES A;  1MY8 A;  4QU3 A;  4QD4 A;  1FIK A;  1E3U A;  4Y17 A;  3EWK A;  4OH0 A;  1CEG A;  2Y2M A;  4BD1 A;  4NKP A;  1PFL A;  4H8R A;  3ZDJ A;  4H6J B;  3BFG A;  3LIC A;  1MC0 A;  4O7D A;  3MXS A;  3MZE A;  1A0K A;  4GD8 A;  4Y0O A;  3IXB A;  3OPP A;  4QWO A;  4ZJ3 A;  2X71 A;  3UMD A;  4R4R A;  4BBV A;  1PW1 A;  4ZJ2 A;  3BFE A;  1IEM A;  2HZ5 A;  4KQR A;  4DMZ A;  5FI7 A;  3C7V A;  3HLG A;  4BMW A;  1TDL A;  2WZZ A;  1F98 A;  3C38 A;  4KZ3 A;  3PAG A;  4EXO A;  4UEY A;  1HZO A;  1DP9 A;  4ARZ B;  5EUA A;  1OTB A;  4QPR A;  2Q9N A;  1VEU B;  4I3J A;  1DY6 A;  2VV6 A;  2VZW A;  3CUE C;  2B18 A;  5FQQ A;  2M7V A;  4II7 A;  5HL6 A;  3QP4 A;  4GS9 B;  4BLM A;  3DAV A;  5AQB A;  5GLA A;  1CF0 A;  2JBF A;  2R9X A;  2ZMF A;  2Y2P A;  3NCK A;  5E2H A;  3NJA A;  4I39 A;  2VEA A;  1K38 A;  3ITA A;  3TE8 A;  1J3W A;  4N9L A;  4S2P A;  4JGQ A;  1MPL A;  1OJG A;  3UB9 A;  3DTK A;  4EUV A;  1BLP A;  3LEZ A;  2XA7 M;  3BEC A;  3E4P A;  3C4O A;  1K57 C;  1KVL A;  3HLF A;  1CK3 A;  4X56 A;  3FKV A;  3UPN A;  2QJ5 A;  2FZ0 A;  3LR5 A;  2QJ7 A;  2XD5 A;  3VP2 A;  1PNE A;  5U47 A;  5E2G A;  3W8K A;  3LR3 A;  5FAS A;  5C5K A;  2HJ9 C;  1T1A A;  4DN0 A;  4EBP A;  2JKT M;  1W5D A;  2PDR A;  3UPP A;  5J4E A;  2KOI A;  3H82 A;  3G31 A;  4ZTK A;  1DRM A;  5IT5 A;  2PYR A;  2JKF A;  3VP1 A;  1PWG A;  4KZA A;  4QJG A;  4PM6 A;  3UB7 A;  3MKE A;  4GZB A;  4OOL A;  3H82 B;  4XUX A;  1JTD A;  4JPM A;  4EER A;  3IWI A;  4O8G A;  4EQI A;  3ZVT A;  4R6L A;  2O9C A;  3MS6 A;  5FQ9 A;  1YMX A;  3G32 A;  3EEH A;  3AGF A;  3GVB A;  3B33 A;  3RXW A;  5FI2 A;  1BT5 A;  4EBL A;  3N8R A;  1KE4 A;  1X0O A;  2JN7 A;  1JWV A;  2Y91 A;  3B42 A;  2R9W A;  3NOT C;  1ZG6 A;  1XJ6 A;  2W3H A;  3IF5 A;  1L3L A;  5K5B A;  3ZYT A;  1CQA A;  3MXR A;  3VV4 A;  2BLS A;  3S22 A;  1GCE A;  1GSX A;  5E43 A;  1Q2P A;  4DJ2 A;  3VFF A;  2OWH A;  1PWD A;  4IHQ A;  4OPQ A;  4BBU A;  4OOM A;  4E6X A;  4S2J A;  1Y28 A;  1K54 A;  3O3V A;  3QP5 A;  1K6S A;  4JF5 A;  3V39 A;  3GMW A;  2J7V A;  3D9Y A;  1GSV A;  2WYX A;  1S1Y A;  1NZU A;  5HFO A;  2ZJ9 A;  1K56 A;  5EM0 A;  4ZBE A;  1E4D A;  5TFQ A;  1VEU A;  3P7N A;  5J8X A;  1D1J A;  3LIA A;  1YLY A;  1I5Q A;  3LUQ A;  4GNU A;  2RCX A;  2VV7 A;  3A0S A;  4MN7 A;  5E2F A;  4S2K A;  4R4S A;  5LBR A;  1LI0 A;  4XT2 A;  1V9Y A;  5F1F A;  3LY4 A;  4WYY A;  4OQG A;  3D72 A;  2O9A A;  3N6I A;  5HX9 A;  4Y0T A;  3K3D A;  3G2Z A;  4IED A;  2M1C A;  5TGF A;  1KDW A;  4GCZ A;  4GS9 A;  1Q2Q A;  1ACF A;  1GA0 A;  3GQZ A;  3O88 A;  3OPH A;  3JPU A;  4GD6 A;  3P01 A;  5FI6 A;  1T19 A;  1KOU A;  3UNW A;  3UE3 A;  4R0Q A;  2WAE A;  1ESU A;  1FR1 A;  4DXB A;  3VOL A;  4ZDX A;  1JWZ A;  3HCY A;  3PBT A;  3KO6 A;  4LRZ E;  3LIE A;  4X69 A;  1SKO B;  3T4O A;  2G2W A;  1ONH A;  4GKU A;  1EWZ A;  2DNS A;  4G3V A;  1S4R A;  2XEP A;  2PR5 A;  2V0U A;  3CAX A;  5F68 A;  3W2Z A;  4CLC D;  1NWZ A;  5F83 A;  3SW1 A;  2XGN A;  3LIF A;  4IUH A;  3GTC A;  2PU2 A;  3FYZ A;  2A24 A;  4WEK A;  3RXX A;  4LRY C;  4I38 A;  4DKI A;  3O87 A;  1W63 M;  2VV8 A;  1W79 A;  1P9R A;  4HY8 A;  2W27 A;  3SS5 A;  4HQA A;  4S2O A;  5FQM A;  3G4P A;  1DJB A;  2XF3 A;  3MXQ A;  5FSR A;  2QZ6 A;  3F1O B;  4NXE A;  1OJ5 A;  2QHK A;  4P87 A;  4GN2 A;  1ONG A;  2PT7 A;  4FH4 A; 
#chains in the Genus database with same CATH homology
 5G4Y A;  3MFX A;  1YKD A;  2VA0 A;  2YKF A;  3PR6 A;  4ME4 A;  1TS7 A;  1YSP A;  1YAX A;  3D3O A;  3FPW A;  3H7W B;  4YWZ A;  3MR0 A;  5HZH A;  5J3W A;  5HDD A;  1F9I A;  4I3A A;  3T4L A;  5HWV A;  5HPF A;  4HH2 A;  2K7S A;  2Y8H A;  4KUO A;  1NRJ A;  3EOI A;  3S7P A;  2GZA A;  2G7U A;  3FG8 A;  1LL8 A;  4HH3 A;  2PHY A;  2W0N A;  1UWN X;  2W3F A;  1NLZ A;  1JNU A;  1TS8 A;  3MQO A;  4FOF A;  4HIA A;  5HPI A;  4HP9 A;  1ZHH B;  3BQ8 A;  3HJK A;  5AVE A;  2L4R A;  5FL3 A;  5DKK A;  2O99 A;  2XRO A;  1MZU A;  2JKR M;  3UME A;  2J3W A;  3R7W A;  2V1B A;  3ULF A;  3F1P A;  3TRC A;  3KYQ A;  2EWV A;  4FSF A;  3PBQ A;  2DMW A;  1UGU A;  2V0W A;  2W3D A;  4L9G A;  5KIZ A;  2QWS A;  4HI4 A;  4MMN A;  4B93 A;  4I3I A;  5DF9 A;  1OPX A;  4P6Z M;  3T4Q A;  5AVF A;  2OWJ A;  2W3E A;  3E98 A;  2BAS A;  4GHI B;  4JGR A;  1NLY A;  4L0L A;  4ETZ A;  2XRN A;  1T18 A;  2OAQ 1;  3F1N B;  3HJI A;  4GHI A;  3OOV A;  4EQ1 A;  5DFX A;  3F1N A;  2HGV A;  4UQI S;  2GX5 A;  4NEE D;  2W1T B;  1VB6 A;  1TS6 A;  2NUP C;  4F3L A;  1XFQ A;  1P97 A;  1OTA A;  3FPV A;  2XSS A;  4WEJ A;  2A2L A;  3ICY A;  2WKP A;  4AFI A;  2NUT C;  1GSW A;  4YNR A;  3PBR A;  2INW A;  1LSW A;  3TJZ C;  2HF6 A;  4WEL A;  5F6A A;  5TJJ A;  1XFN A;  1YSQ A;  4L9F A;  5HWT A;  3F1O A;  5F69 A;  3NOP C;  5IS1 A;  1OTD A;  3EWK A;  1H8M A;  4NKP A;  1WA9 A;  2KLI A;  4EU0 A;  1LSX A;  4PKY A;  4Y2F A;  3PYP A;  4H6J B;  3KX0 X;  3LIC A;  1OTE A;  4YOF A;  1MC0 A;  4E04 A;  5HD5 A;  4BBT A;  2JHE A;  2J3T C;  1N9N A;  4KQD A;  3PBO A;  2PR6 A;  5CX7 A;  3UMD A;  4BBV A;  4EEU A;  3C8C A;  2M7U A;  2KX6 A;  1XJ3 A;  2VGL S;  2D02 A;  4UQI M;  4DMZ A;  4O01 A;  2OOL A;  4BMW A;  3PHY A;  1F98 A;  3C38 A;  4EXO A;  4UEY A;  1N9L A;  2ZBB A;  1DP9 A;  1VHM A;  4ARZ B;  1OTB A;  2D01 A;  2V1A A;  5A8B A;  4QPR A;  4I3J A;  2HV1 A;  3IBR A;  2VKS A;  3O5Y A;  4JGO A;  4HJ6 A;  2VV6 A;  2PD8 A;  3GDI A;  3LIB A;  4PHT A;  2VZW A;  3CUE C;  2B18 A;  2L1M A;  2M7V A;  4LRX C;  4II7 A;  5HL6 A;  4EW7 A;  4ETX A;  3T4J A;  4GS9 B;  4CQH A;  2ZMF A;  5HDS A;  3EQV A;  3OCL A;  1TS0 A;  4MN5 A;  3S7Q A;  4Y5F A;  3NJA A;  4BWI A;  3E0Y A;  4I39 A;  2VEA A;  5HSQ A;  3DBA A;  5HD3 A;  3TE8 A;  4G3K A;  2PD7 A;  3KSF A;  5TBM B;  4IJG A;  2HJE A;  1OT6 A;  1TD5 A;  3LR4 A;  4JGQ A;  1OJG A;  4GW9 A;  3UB9 A;  4CLC B;  1XJ2 A;  5F5Y A;  4NXB A;  4EUV A;  4Q0J A;  2XA7 M;  3E4P A;  3LI8 A;  3LI9 A;  2ZOH A;  4NXG A;  3K2N A;  4WUJ A;  5DFY A;  3CI6 A;  5MC7 A;  2FH5 A;  3EGD C;  3RH8 B;  3R7W B;  1ZTU A;  2QJ5 A;  1OT9 A;  2FZ0 A;  3LR5 A;  2QJ7 A;  4GJ4 A;  1OTI A;  2O0Y A;  1DP8 A;  4HHD A;  1S4S A;  3LR3 A;  2YKH A;  1LT0 A;  4JGP A;  2W1R A;  4DJ3 A;  5IU1 A;  5C5K A;  2HJ9 C;  1T1A A;  4DN0 A;  4F3L B;  2JKT M;  3V67 A;  3IBJ A;  2PDR A;  2J3T D;  2Z6D A;  5J4E A;  2KOI A;  3BWL A;  3K3C A;  3H82 A;  1D06 A;  1DRM A;  2JKR I;  3BY8 A;  3H7W A;  5IT5 A;  2PYR A;  2ZOI A;  4ZRR A;  3T4K A;  3EGX C;  3PBS A;  2W3G A;  1F5M A;  4GLQ A;  3UB7 A;  3FC7 A;  4I5S A;  2EA9 A;  4HJ3 A;  4KUK A;  4OOL A;  3H82 B;  4B9O A;  4EER A;  4O8G A;  4MN6 A;  4WLA A;  4R6L A;  2O9C A;  2R78 A;  1S1Z A;  3G6O A;  2IA2 A;  3NHQ A;  5DJU A;  2VGL M;  5EFW A;  3EEH A;  3LID A;  4HP4 A;  3B33 A;  4WN5 A;  3BY9 A;  1W63 Q;  3UE6 A;  3ZQ5 A;  3R4K A;  2MJ6 A;  4WF0 A;  1T1C A;  3PBN A;  3B47 A;  4R38 A;  1X0O A;  2GJ3 A;  1BYW A;  2A24 B;  2JN7 A;  4O0P A;  3LFV A;  3B42 A;  3TW8 A;  1N9O A;  3NOT C;  3IS2 B;  4MCW A;  1XJ6 A;  2W3H A;  1XJ4 A;  2LB5 A;  3VE3 A;  4BJP A;  3KSG A;  5K5B A;  3H9W A;  3KSH A;  3ZYT A;  1S66 L;  3T50 A;  3VV4 A;  2QKP A;  3MMH A;  1TF1 A;  4WL9 A;  1GSX A;  1MKM A;  4G3W A;  4DJ2 A;  4CLC C;  4H6J A;  2OWH A;  3MF0 A;  3LR0 A;  4IHQ A;  3T4T A;  4XT2 B;  4BBU A;  4OOM A;  4PKY G;  3MQ0 A;  1Y28 A;  1IFQ A;  2Y79 A;  3IS2 A;  2V9A A;  1LSV A;  2VX8 A;  2JKT I;  2QYB A;  3C2W A;  4MDZ A;  3CLO A;  4RQ9 A;  1GSV A;  1S1Y A;  3U2A A;  1T1B A;  3OLO A;  4PAU A;  4L9E A;  1G28 A;  2CMN A;  3EEA A;  3KYZ A;  2K31 A;  4HNB A;  3BJN A;  3P7N A;  1STZ A;  4K08 A;  2I9V A;  4EES A;  5I5L A;  3BW6 A;  3JVV A;  4CLC A;  3LIA A;  2J80 A;  3LUQ A;  4ARZ A;  4LPZ A;  2O9B A;  2VV7 A;  2H28 A;  3A0S A;  4MN7 A;  4EEP A;  2ZMV A;  3MJQ A;  3VE4 A;  5LBR A;  5J7E A;  4XT2 A;  1V9Y A;  3A0R A;  1S67 L;  4CLC E;  4Z1W A;  3D72 A;  2O9A A;  3K3D A;  3S7N A;  3JVU A;  2EWW A;  3LYX A;  2M1C A;  3GEC A;  3NOU C;  4GCZ A;  4GS9 A;  3RTY A;  3CIT A;  4R3A A;  2LB9 A;  3OBF A;  4Y3I A;  4Q0I A;  5KSH A;  5DKL A;  3T4S A;  1D7E A;  3OCN A;  4EET B;  3P01 A;  3E4O A;  3CUE A;  3UB8 A;  1G6O A;  1T19 A;  1KOU A;  2K2N A;  1V9Z A;  3UE3 A;  2PYP A;  3S7O A;  1DP6 A;  2Z6C A;  3VOL A;  4HOI A;  3HCY A;  3PBT A;  3KO6 A;  4LRZ E;  5AJG A;  3KSI A;  3LIE A;  1H3Q A;  2WKQ A;  3T4O A;  5G4Z A;  2P7J A;  4Q0H A;  3BQA A;  1P0Z A;  3EQU A;  2GNX A;  4NXF A;  4G3V A;  3MQQ A;  1S4R A;  2PR5 A;  3C30 A;  3E4Q A;  2V0U A;  3CAX A;  5F68 A;  5TBM A;  3W2Z A;  4CLC D;  4M4X A;  1NWZ A;  2B02 A;  3UB6 A;  3SW1 A;  4P6Z S;  3LIF A;  4IUH A;  4KQO A;  1P9W A;  3OC2 A;  2A24 A;  4WEK A;  2L0W A;  2OAP 1;  4LRY C;  4I38 A;  2XA7 S;  4IUK A;  4HJ4 A;  1W63 M;  2VV8 A;  1UWP X;  4R70 A;  3CWF A;  1ODV A;  1P9R A;  4HY8 A;  5DJT A;  2W27 A;  3F1P B;  2KDK A;  4HQA A;  5HWW A;  3RFB A;  3PXP A;  2P04 A;  2VJW A;  3MXQ A;  2W1T A;  1IOU A;  5HDC A;  3A0V A;  3F1O B;  2P08 A;  4NXE A;  5L8M A;  1OJ5 A;  2QHK A;  4LLO B;  1EW0 A;  2VLG A;  2WKR A;  2PT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...