1LSVA

Crystal structure of the co-bound bjfixl heme domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
117
structure length
117
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQELQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-based mechanism of O2 sensing and ligand discrimination by the FixL heme domain of Bradyrhizobium japonicum
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Transferase
molecule keywords Sensor protein FixL
total genus 31
structure length 117
sequence length 117
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2002-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1lsvA00
4DJ3A 4WF0A 2KX6A 1WA9A 4R3AA 1UWNX 3E4OA 4PKYG 4HP9A 2PYRA 2INWA 2OOLA 2PR6A 1G28A 1T1AA 2JHEA 3H7WA 3LIEA 3PHYA 4HP4A 4LRYC 2D01A 4F3LA 1TS0A 5HD3A 4R6LA 3D72A 2L1MA 5EFWA 4MN6A 2WKPA 5HDSA 3A0VA 5A8BA 2EA9A 2YKHA 3H82B 1LSXA 1XJ2A 2W27A 4RQ9A 1P0ZA 1GSXA 4GS9A 3OLOA 3A0RA 4GW9A 2VLGA 4HIAA 4HJ6A 2OWHA 5DJUA 2YKFA 5J4EA 2ZBBA 4L9FA 3SW1A 2VV6A 1DP8A 1OTBA 1TS6A 2D02A 3LIAA 3CLOA 5IU1A 3PYPA 1D7EA 4L9EA 1OTIA 3H82A 2J80A 4I5SA 3IS2B 3MXQA 2P7JA 3UB7A 5HSQA 1JNUA 4HH2A 2V1BA 1ODVA 4GS9B 1T1BA 2V9AA 3F1PA 5IS1A 2KDKA 1S67L 3LIDA 3LIFA 1T19A 4I3AA 1BYWA 2B02A 4LRZE 4WUJA 4K08A 4BBTA 4HJ3A 1LSWA 1Y28A 2VV7A 3HJKA 4EERA 4HHDA 1XJ4A 1DP6A 2QJ5A 5DKKA 5HD5A 4L9GA 3UE6A 3K3DA 5HWVA 3LI8A 3ZQ5A 4EQ1A 1OJ5A 1OTDA 1T1CA 4GCZA 3F1PB 4KUOA 5HDDA 5TBMA 1LT0A 4HJ4A 4HI4A 5HDCA 1OJGA 2QWSA 4EEUA 3MQQA 3RTYA 1OT9A 3LYXA 3UMEA 4GHIA 3LIBA 4F3LB 1N9OA 4XT2B 1UWPX 4JGOA 5F5YA 4JGPA 1S66L 3F1OA 3IBRA 5I5LA 3NJAA 4M4XA 1LSVA 3VOLA 1N9LA 3NHQA 3A0SA 2A24B 2QKPA 5TBMB 1P97A 3GECA 3LICA 4HQAA 1TS7A 3BY9A 1S1ZA 2HV1A 3UB9A 1S1YA 3MQOA 1F9IA 4H6JA 4KQDA 5F68A 2K7SA 3LUQA 1KOUA 2V0WA 2VEAA 3F1NA 3CAXA 4HY8A 4XT2A 5HWTA 1S4RA 2V0UA 1OTAA 4I3IA 4EW7A 2CMNA 4NXBA 2Z6DA 1DP9A 2QJ7A 4EESA 4YWZA 5AVFA 2H28A 3P7NA 4I39A 4NXEA 3IS2A 1XFQA 3CWFA 3UB6A 5HZHA 1TS8A 2A24A 4HNBA 5F69A 5F6AA 4DJ2A 2L4RA 1N9NA 3HJIA 3NOPC 4R38A 1XJ3A 4KUKA 1DRMA 4HOIA 1S4SA 1VB6A 2Z6CA 4NXGA 3VE3A 2PR5A 2QHKA 3BWLA 4H6JB 3LI9A 2M1CA 4MN5A 4WN5A 2W0NA 1EW0A 2VV8A 4I3JA 5G4ZA 4EEPA 2PD7A 3EWKA 2OWJA 1X0OA 3C8CA 1D06A 4E04A 3MFXA 1XJ6A 3FG8A 2R78A 3EEHA 1OTEA 3ICYA 4R70A 4WLAA 4BBVA 3NOTC 2L0WA 3F1OB 4B9OA 3H9WA 1MZUA 3G6OA 4GHIB 1GSVA 4WL9A 3UB8A 2BASA 5DJTA 4I38A 4LRXC 1F98A 2WKRA 4JGQA 2PDRA 4EXOA 5J3WA 1V9YA 3GDIA 1GSWA 2PYPA 3FC7A 3BY8A 3C2WA 3E4PA 1LL8A 3K3CA 3KX0X 2V1AA 5HWWA 5J7EA 4LLOB 2I9VA 2PHYA 5KIZA 5G4YA 5DKLA 1XFNA 3E4QA 3MJQA 3UMDA 3VE4A 1NWZA 2GJ3A 4PKYA 3T50A 2PD8A 2JN7A 2ZOIA 4LPZA 5AVEA 3H7WB 4BBUA 1OT6A 1UGUA 4NXFA 3ULFA 4HH3A 1V9ZA 3B33A 1T18A 2WKQA 3F1NB 3MR0A 4JGRA 4EETB 2ZOHA 3NOUC 3RH8B
chains in the Genus database with same CATH superfamily
2LB9A 2VJWA 3EGDC 2HP9A 4CLCD 4Y17A 1YKDA 5HD3A 5EFWA 5DFXA 3UE1A 2PRFA 5HPFA 2WGWB 2VV6A 1WYBA 3CLOA 5I94A 2JKRI 4I5SA 3PBSA 1CEFA 1TD5A 2XH9A 1XGJA 2HDRA 4GS9B 3AGFA 4I3AA 4S2KA 4LRZE 4BBTA 1SDNA 5FI6A 1LI0A 1MWRA 3D9YA 3LR5A 3CG5A 4BLMA 3FPVA 1XA7A 4JGOA 1E3UA 5L10A 3NJAA 3SS4A 4Z1WA 1VETB 1K57A 5AQ7A 1LI9A 4MBHA 3S4XA 4HQAA 3IX4A 5CRFA 5FASA 4Q0IA 2B5RA 3CAXA 4X68A 4XT2A 3VV4A 1S4RA 2Y59A 2E8IA 2ZLYA 3WRTA 5AVFA 2H28A 2HP5A 2BTFP 2GNXA 5HZHA 1Q2PA 5F69A 3GV9A 3WRZA 3LI9A 4ZDXA 4N1XA 4EEPA 2Y8HA 1K4FA 3FG8A 1MPLA 3T4TA 5HAQA 1L0DA 1W8QA 5CTNA 3T1SA 1MY8A 4OP5A 4PM6A 5G4YA 2XQZA 1XFNA 2EXBA 2EX6A 1NWZA 4E3LA 2W1TA 2HDQA 4QY6A 3B47A 4GD6A 4EETB 3PBTA 2Y2LA 2WAFA 5L8MA 2FZ0A 2ZD8A 1BLCA 4DDSA 2YKHA 3VOZA 5CXWA 1GSXA 3OLOA 3MKFA 3N8LA 4Y7PA 4OH0A 1TS6A 2D02A 1BT5A 4PMAA 1D7EA 2GZAA 5KMWA 4BENA 3G2ZA 1SCWA 4HH2A 1ES2A 1ACFA 3TG9A 4HJ3A 2PBDP 2VV7A 4Y0OA 1XJ4A 2ZMVA 3IF5A 2A49A 4KENB 4S2NC 1NZUA 3ZFZA 4OQIA 4X6TA 3DTMA 1HZOA 2M7VA 3MSHA 3JVVA 1LSVA 1ERMA 4BD1A 1HD8A 4UHUA 5EE8A 5FEFA 3A3IA 3M2JA 3O86A 3MS6A 4CLCB 2JCHA 5DTKA 4EW7A 4S2PA 4S2OA 1K25A 3WWXA 3JYIA 3QP5A 3HJIA 1N9NA 4HOIA 5IHVA 2PR5A 1BUEA 1ZG4A 3OPPA 2VKSA 1L0GA 3IXGA 5F1GA 5GHYA 4X55A 1CJFA 3GVBA 4EUZA 2QYBA 3VP1A 2G7UA 1KE3A 3GDIA 3LR3A 3KX0X 3S7OA 1VEUB 3LGOA 3A3JA 2OAQ1 3HUOA 4EWFA 4MN7A 2Y2NA 5FQMA 5EOEA 1WA9A 4PKYG 3TSGA 4D2OA 4O01A 3OPHA 3PHYA 4HP4A 4R6LA 3D72A 4FH2A 5K5BA 3LO7A 1L0FA 4RQ9A 5C5KA 1VHMA 1IOUA 1IELA 2YKFA 4XUZA 3OCLA 1OTBA 2WKIA 1MWTA 2GDNA 1W63M 1MKIA 3LIFA 1YAXA 1G6AA 1ONHA 4E3IA 4KUOA 4CLCC 3BM6A 5CEBA 5CEDA 2Q9NA 2ACGA 2JKFA 3KYZA 4UA6A 2Y4AA 2Y2PA 3IWIA 4KZ3A 4O0PA 1K6RA 3MQ0A 4LCLA 1KE0A 4PM8A 4EUVA 1N9LA 3SH8A 4Q8IA 4MNRA 5GLDA 2K7SA 5A92A 4NKPA 2UWXA 3Q81A 4E3OA 4S2MA 1U60A 2XSSA 3HLDA 3NOPC 4UAAA 3DTEA 2W3FA 3IQAA 4P85A 2ZQAA 1CQAA 5FSRA 3VOYA 4WN5A 3C7UA 5BOHA 3QHYA 1RCJA 1X0OA 3O87A 4OPZA 2BASA 2XA7S 4WMCD 5HX9A 3FC7A 4KZAA 2XDMA 3Q07A 5MC7A 3N8RA 2HJ9C 3VE4A 2GJ3A 4Y0TA 3BQ8A 1BLSA 3H7WB 2HF6A 5EVIA 3MF0A 1G5UA 1ES5A 2X01A 4PM7A 2Y79A 1HVBA 1PZOA 2Z2MB 4ZJ1A 4GS9A 5E2GA 3IBJA 5HL1A 4DN0A 2HDUA 3BFFA 1OTIA 1Z09A 2FH5A 2X71A 1ZHHB 2IA2A 1W7FA 1PW1A 3MKEA 4BBUA 1NYYA 4B4XA 4LV0A 3BECA 4WEKA 3NDGA 2XRNA 4AFIA 2QZ6A 4NEED 5DTSA 1L0EA 1OT9A 4WZ4A 3LIBA 1BULA 2ZC7A 3BFGA 3IF6C 3F1OA 4N9KA 3IT9A 3VOLA 1PIOA 2A24B 4OOMA 1N9BA 1OMEA 2B95A 3NY4A 3BFCA 5CECA 3OPLA 3UN7A 5FEGA 2WUQA 3ZG7B 4R38A 4KUKA 4K0XA 1S0WA 1Z6FA 2VGKA 1D06A 1NZOA 1YM1A 4DE3A 1MXOA 2EXAA 4OLDA 4R4SA 1QMFA 1LLBA 2PYPA 3IF6B 3E98A 3LY4A 3HREA 3ZNTA 2J8YA 3WS1A 4D60A 4U0XA 4F3LB 1V9ZA 4QWOA 1MKMA 2W1RA 3NECA 1KDSA 2INWA 2Y2GA 3EEAA 3CZDA 3W4OA 2D01A 3VP3A 1NY0A 5GLBA 3HCYA 4GB7A 3ZG0A 1LSXA 3PXPA 2OV5A 2WKEA 4R1GA 2PU2A 4G3WA 1YPRA 4L9EA 1E4DA 2DNSA 1XXMA 3OBFA 1K6SA 1T1BA 2V20A 3ZG8B 2KDKA 5FQKA 4KG2A 2UV0E 4ESPA 3HUNA 3MMHA 4G3KA 5G18A 2V8FA 5FL3A 1LL5A 5HAIA 4WZ5A 4IJGA 3RTYA 3RJUA 2KLIA 4MDZA 3FWLA 1N9OA 5FDSA 1W5DA 5CGSA 3IBRA 4H8RA 1GHIA 3A0SA 3AGEA 5AQAA 2HP6A 1H8YA 3NBLA 3V3RA 4MLLA 4H6JA 3KO6A 1YMSA 2VEAA 1CI8A 4I3IA 3CMZA 4X69A 2Z6DA 3PBNA 3T1RA 4FSFA 3CWFA 2ZQ8A 1WE4A 5F6AA 4IEDA 2WADA 1DRMA 3ZVTA 2WZZA 2PU4A 3CI6A 4I3JA 2XGNA 3VP4A 4E04A 3BFDA 4BBVA 3F1OB 4GKUA 3H9WA 2J3TC 2WKRA 3P09A 5L07A 3SOIA 2A2LA 1JWPA 2P04A 2PD8A 4Y3IA 2OAP1 5U47A 3FKWA 2XLNA 3ZG5A 1T1AA 4F3LA 2ZMAA 1H8ZA 1NXYA 2OSUA 1LHYA 3N8SA 1ZKJA 2P9VB 3LIAA 1EWZA 2H0TA 3H82A 1STZA 3LIDA 4OPRA 3E2LA 3IX3A 1D1JA 4EQ1A 3A3FA 1OJ5A 3NI9A 2H0YA 4ZJ2A 1ES3A 2EX9A 3LICA 5A91A 3BY9A 4OPQA 1I2WA 1PW8A 1I2SA 3E2KA 4ME4A 3UB6A 1FCNA 2LB5A 1XP4A 2EWVA 2XR0A 1DJCA 3Q1FA 2QHKA 2EWWA 3BLSA 3C5AA 3CPTB 4HESA 3BQAA 2A3UA 4PHTA 3OC2A 4JXGA 4EV4A 5CTMA 1XKZA 3D4FA 3MFXA 1PFLA 1A0KA 1TF1A 3LCEA 1G68A 2R9XA 3HLCA 5DF8A 4KZ5A 1GSWA 2XF3A 4DMZA 5J7EA 4P87A 5KIZA 5DKLA 3V67A 2ZOIA 3VMAA 1O7EA 3B33A 3FV7A 2WYXA 5D3OA 3HBRA 1JWZA 4OONA 4LRYC 3PAGA 2QMIA 4E3KA 1GCEA 4R4RA 1H3QA 1P0ZA 5HARA 1YSPA 5EVEA 3RFBA 2VZWA 5EVIC 4PM5A 3E0YA 5M1AA 5IS1A 4E6WA 1NRJA 4EERA 3CJMA 3O5YA 4E3NA 4FUWA 5HDDA 3F1PB 1XPBA 3KSHA 1L3LA 4B4ZA 2QPNA 2C6WB 2Y55A 5TJJA 4MMNA 4CLCE 4A5RA 2GX5A 3CITA 5L2FA 1UWPX 5F5YA 4Y5FA 4DXCA 1PNEA 3N7WA 5FDHA 2HZ5A 4BQMA 4C3QA 3QNBA 1PI5A 3PBRA 2EX2A 2V0WA 4HY8A 5EOOA 4GDBA 5HWTA 4XUXA 1RGZA 4NXBA 4WM9A 3DTKA 4WYYA 2L4RA 3M2KA 2RCXA 1XJ3A 4ZTKA 1BLPA 4BD0A 4QD4A 5LBRA 3IHBA 5EVLA 5AQ9A 4O8GA 4UA9A 3EWKA 3L7HA 3GRJA 3W8KA 1Y4OA 3M6HA 4BJPA 3G34A 4JF6A 4IVIA 3TE8A 1M6KA 3DTIA 1K38A 1WYCA 3CUEA 2Y91A 3GSGA 4KZ8A 2IWBA 4DE2A 4R0QA 1YLTA 4HBUA 3W4PA 1S6RA 1NLYA 4N1HA 5EVID 3NOUC 3C4OA 2K31A 4M3KA 3P98A 4QB8A 3LY3A 1SKOA 4P6ZS 1PZPA 1JVJA 2EA9A 2ZJ9A 3ZNYA 5DJUA 4Y2FA 4UQIS 4KG6A 5HSQA 3K2NA 4QY5A 2V1BA 1ODVA 4RYEA 2JKTM 3T4SA 5M18A 3MFDA 3HVFA 4S2IA 3QNCA 1PRQA 4L9GA 3O88A 2J9PA 1OTDA 1IYOA 5EUAA 4KZBA 2XA7M 5DFYA 4GN2A 3HLGA 4XT2B 3NULA 3OOVA 4CLCA 1PWCA 5FAQA 3C4PA 5TBMB 2EFUA 1ZG6A 3VP0A 1S1YA 2PBYA 1K56A 1J9MA 1OTAA 2CMNA 5FAOA 3WS2A 3CPTA 4DE1A 2R9WA 3KYEA 1S4SA 1VB6A 4QPRA 2CC1A 5E2HA 4MN5A 4YINA 2JBFA 3C8CA 3UPNA 2ZC6B 4IUKA 2W1TB 4LENA 2PAVP 1MZUA 3EQUA 3G6OA 3ZHHA 2WGWA 2W3EA 5A93A 4PPRA 2E8JA 4UQIM 3GTCA 3OCNA 4PKYA 4QHCA 1FIKA 1RP5A 3SH9A 4DJ3A 3C7VA 3DWKA 1NRFA 4KZ7A 4S2LA 2VA0A 3U2AA 1MC0A 5DTTA 3H82B 2OLVA 1OPXA 2JKRM 3SW1A 1SZVA 1PWDA 4ETZA 4DKIA 4R3BA 3R7WB 3Q82A 3F1PA 3ITBA 2KOIA 4K08A 2QJ5A 1LT0A 4ZJ3A 4HI4A 5DF7A 1K56D 3DBAA 4WEJA 2XD5A 2O9CA 2FFFB 3UY6A 1E25A 3W2ZA 3QP2A 1XX2A 4IBRA 2HV1A 2G2UA 5F82A 2Z2LB 5E2FA 3LUQA 3ZG9B 3F1NA 3SZTA 2BLSA 3ZGAB 3WS5A 1P9RA 5EV0A 5F1FA 4EBPA 3VP2A 3V5MA 1K57C 4JKTA 3NDEA 3BWLA 3KSFA 4O7DA 2I72A 2W0NA 3UPOA 5F83A 4JLFA 5CERA 1GA0A 5FQJA 2R78A 4K91A 2BG1A 2L0WA 5HL6A 2O9BA 4WL9A 4KQRA 1Y54A 3SH7A 1LL9A 3UB5P 3PR6A 3E4QA 2HPBA 3UMDA 5FQIA 3G35A 3R4KA 4LPZA 4XXRA 3ULFA 4ZBEA 4E3MA 4ARZB 4WF0A 3IH9A 2Y2OA 4OQGA 4RX3A 3W4QA 1TS0A 3NCKA 2L1MA 2VGLM 1KE4A 5A8BA 3JPUA 1XJ2A 4IVKA 3PAEA 3QP6A 2Y2MA 3QP1A 1ZTUA 1K55A 2ZC4B 4CPKA 1YSQA 2P7JA 1GA9A 1XA1A 4LV1A 1JTGA 5EPHA 4MBFA 4LV3A 5FI7A 1MWSA 1ERQA 3P01A 4EEUA 2XFTA 1YLYA 3FYZA 1BSGA 4GHIA 4X25A 5AJGA 1P97A 1RGYA 1DY6A 2EX8A 2W3DA 4Q0HA 1H5XA 3HLFA 3FZCA 1FILA 3C30A 1N4OA 1DP9A 3A3EA 1NYMA 3IXDA 1ES4A 2Z6CA 4OPYA 3IH8A 3S7NA 4DDYA 5G4ZA 2H10A 2IWCA 3QP8A 4LGWA 3WS0A 2J3WA 3EEHA 3FKVA 4WLAA 5FQQA 3NOTC 2ZQCA 4GHIB 4WELA 4I38A 1G6OA 5EM1A 3MZDA 1SDEA 3IXHA 2WGIA 3HLWA 1IEMA 4X1MA 5GHXA 3K3CA 3IHAA 2I9VA 2PHYA 3T50A 3MBZA 1UGUA 1TVFA 5GL9A 4HH3A 3MZEA 3V39A 3DW0A 4HP9A 2PYRA 2OOLA 2PR6A 4EBNA 5HDSA 2W27A 4HBTA 4IHQA 4GLQA 4WBGA 3MXSA 2ZBBA 4X53A 3ZDJA 5TFQA 2WK0A 3LR4A 3IS2B 3MXQA 3UB7A 4KQQA 3T4QA 2V2FF 3GMWA 3S7PA 1TDGA 1BZAA 3I7JA 5CGXA 1Y28A 5TR7A 4IBXA 2C5WB 3K3DA 3ZQ5A 2W3GA 5EVIB 5HDCA 2VGJA 1DJBA 3UMEA 4GJ4A 1QMEA 3O3VA 1S66L 5A90A 2Y2KA 1I5QA 4EBLA 4OVDA 3LEZA 3GECA 1GHPA 3T4LA 1S1ZA 1F9IA 1EI5A 3S22A 1K54A 3M6BA 2QJ7A 5HAPA 3G30A 5GHZA 3P7NA 4NXEA 3IS2A 4LCMA 4HNBA 4WMCA 1AXBA 2O0YA 3TRCA 4MBKA 1EW0A 2FFYA 1TDLA 3DAVA 1M40A 2ZQ7A 3OPRA 4EXOA 1V9YA 3BY8A 5EM0A 1YT4A 1E3UD 1W8YA 3ZVWA 4HEFA 2ZM8A 2IWDA 4Y15A 2WKPA 2K2NA 3FPWA 3G4PA 4LFUA 4YNRA 4ZRRA 1YQSA 4FOFA 3PYPA 4OQHA 4OP8A 3BFEA 3A3DA 3NC8A 3IF6A 1LSWA 1CF0A 4YOFA 4QU3A 4HHDA 5HD5A 4BMWA 2P9VA 4GCZA 3NIAA 4DE0A 1ZC2A 2QWSA 3TW8A 3LYXA 4GNUA 1FSYA 4JGPA 1J3WA 1IKIA 4LV2A 1BLHA 1TS7A 2V1ZA 3UB9A 5F68A 1HTZA 4GZBA 3GR2A 5KSCA 5JYOA 4R3JA 1SKFA 2V8CA 5HFOA 5CHJA 5KZHA 3GQZA 2VV8A 2J9OA 1ESUA 3ZCZA 3ICYA 1KVMA 3V50A 3QP4A 5CX7A 3CHWP 4KZ6A 5DVAA 3KSIA 4ARZA 3T12B 3V3SA 3UDXA 1MWUA 3KYQA 3UE3A 1YMXA 1OT6A 3SS3A 3VE3A 5JYPA 2O9AA 2ZOHA 3L9KA 4GDNA 1H8MA 2KX6A 1UWNX 5J8XA 3N6IA 2DMWA 4ETXA 4UA7A 2JKTI 4MN6A 2ZMFA 4JXSA 1DJAA 3ZYTA 1VETA 2VLGA 4HJ6A 2OWHA 4JXVA 4OLGA 1F2KA 1FSWA 2ZC3B 1KDWA 2VGLS 2V9AA 3T1XA 1S67L 2AVXA 1BYWA 4ID4A 2XFSA 3MZFA 1W63Q 5DKKA 2J3TD 2Y2QA 1T1CA 1L2SA 1KGGA 3PBOA 3BW6A 4U0TA 3UO9A 5I5LA 5GLCA 2M7UA 4KQDA 4FH4A 2MJ6A 5HPIA 3LEQA 5E43A 3R7WA 1JTDA 2DCFA 4DXBA 1XFQA 2B18A 2A24A 1W79A 4U3TA 4NXGA 4QJGA 3LFVA 5GLAA 2P08A 2XD1A 1GHMA 1JWVA 1VQQA 1XJ6A 3S1YA 3DWZA 2VX8A 3T1QB 5CHMA 1CK3A 1GSVA 1FR1A 3UB8A 4LRXC 2PDRA 4UEYA 3VFFA 4PM9A 4OKPA 3C2WA 2V1AA 5HWWA 2PT7A 1H0MA 2ZQDA 2JN7A 4EQIA 2Y2JA 4JPMA 5HW3A 4PAUA 4G3VA 5E2EA 3RH8B 3Q7VA 2X02A 3E4OA 3H7WA 4FD8A 3LIEA 2XROA 4MEZA 3UDIA 1C3BA 1IKGA 2VK3A 3A0RA 4HIAA 4L9FA 1YLWA 2Y2HA 2ZM0A 4K0WA 5IT5A 2J80A 1YLZA 1SKOB 2J7VA 1T19A 4WUJA 2P74A 3AGDA 5FATA 4EU0A 4KZ4A 2Q9MA 3LI8A 5TBMA 4JBFA 4II7A 5AQBA 2NUPC 4B88A 1FCOA 4JF5A 1ONGA 1IYPA 4E6XA 1PYYA 3NHQA 1VEUA 5FQ9A 3PBQA 2W3HA 2O99A 2XEPA 4C6YA 4ZAMA 4B93A 1P9WA 1BTLA 4YWZA 3B3XA 1YLJA 4DJ2A 3D3OA 3IXBA 3SS5A 3S7QA 4H6JB 3TOIA 4CQHA 3G31A 5FI2A 4B9OA 4Q0JA 5DJTA 1CI9A 1ESIA 3U4LP 1KGEA 4LLOB 5M19A 1XGIA 4RX2A 4NXFA 4JGRA 2WKHA 4S2JA 4L0LA 2Y2IA 3HUMA 2HJEA 3IX8A 1F5MA 1FCMA 4YFMA 3RXXA 1MBLA 1NLZA 1IYQA 2JKGA 1PI4A 4GW9A 4RVAA 3IWQA 5J4EA 1Q2QA 5IU1A 1VM1A 4KG5A 4OQ0A 3T4JA 3HJKA 3BRMA 4Y0UA 2EFXA 5L09A 3BYDA 3HL9A 4Z9QA 4P6ZM 2ZL1B 5DF9A 4S2NA 2WZXA 1CEGA 2QKPA 4RA7A 1FR6A 3UDFA 3MQOA 4MCWA 1KOUA 5CHUA 2V0UA 1O07A 4EESA 3TJZC 4I39A 3PTEA 1FQGA 4BWIA 5EECA 3B42A 2M1CA 1HLUP 4KQOA 1K0KA 2OWJA 4F94A 3EQVA 3Q7ZA 2NUTC 4P6BA 4N92A 4JXWA 1F98A 4JGQA 3T4OA 3E4PA 5TGFA 4CJNA 1K55C 3Q7VB 5AVEA 2WKQA 1IFQA 4BL2A 4NETA 4R3AA 1K54C 1KGFA 1G28A 2JHEA 3CUEC 3T4KA 3A0VA 4X56A 2ZM2A 4BL3A 3BEBA 3OZHA 1DP8A 4IUHA 4FCFA 4P0MA 3KSGA 1AWIA 1JNUA 4DF6A 1SHVA 3RXWA 2B02A 1KVLA 5FA7A 4NK3A 1DP6A 4NG2A 3UE6A 5HWVA 2ZC5B 2RL3A 3MXRA 4HJ4A 1OJGA 3VSKA 3C38A 3G32A 3MQQA 1IYSA 3LR0A 1K4EA 3G2YA 4M4XA 1EROA 2JC7A 3JVUA 4X1LA 2JE5A 2OLUA 4N9LA 3VSLA 3ISGA 3UPPA 3BJNA 3EOIA 3HLEA 3UNWA 2WAEA 4GD8A 1TS8A 3BLMA 4C75A 4Y13A 3WS4A 4OOLA 4FTXA 2HDSA 3HLBA 4E3JA 2PD7A 2HGVA 4DRTA 3IWOA 2ZL1A 2ZQ9A 1OTEA 4R23A 4R70A 5CGWA 3VFHA 2G2WA 3EGXC 2H5SA 4GOGA 5KSHA 5J3WA 2WGVA 3ITAA 1LL8A 4KZ9A 4OOYA 3N4IA 4WZ5C 1PWGA 1YLPA 1TEMA 1NJ4A 2Q0OA 2XK1A 4JF4A 5FAPA 1ALQA 1FOFA 3UE0A 3F1NB 2DRWA 1T18A 3MR0A 3MJQA
chains in the Genus database with same CATH topology
1H8MA 4DJ3A 2KX6A 2LB9A 1UWNX 2VJWA 2INWA 2VA0A 3EGDC 3EEAA 3U2AA 4CLCD 1YKDA 2D01A 2DMWA 1MC0A 5HD3A 4ETXA 2JKTI 5EFWA 4MN6A 2ZMFA 5DFXA 3HCYA 3H82B 1LSXA 3ZYTA 3PXPA 1OPXA 2JKRM 2VLGA 4HJ6A 2OWHA 5HPFA 3SW1A 2VV6A 3CLOA 4G3WA 4ETZA 2JKRI 4L9EA 4I5SA 3PBSA 1TD5A 3OBFA 4GS9B 2VGLS 1T1BA 2V9AA 3F1PA 3R7WB 2KOIA 2KDKA 1S67L 4I3AA 4BBTA 4LRZE 1BYWA 4K08A 3MMHA 4G3KA 1W63Q 2QJ5A 5DKKA 5FL3A 2J3TD 1T1CA 1LT0A 3LR5A 4HI4A 3PBOA 3BW6A 4IJGA 3RTYA 3FPVA 2KLIA 3DBAA 4MDZA 4WEJA 1N9OA 4JGOA 2O9CA 3IBRA 5I5LA 3NJAA 4Z1WA 3A0SA 3W2ZA 4HQAA 2HV1A 2M7UA 4KQDA 4H6JA 4Q0IA 3KO6A 3LUQA 2MJ6A 2VEAA 3F1NA 3CAXA 4XT2A 3VV4A 5HPIA 1S4RA 4I3IA 2Z6DA 3PBNA 3R7WA 4FSFA 1P9RA 2H28A 5AVFA 1XFQA 2B18A 2GNXA 3CWFA 5HZHA 2A24A 5F69A 5F6AA 4NXGA 1DRMA 3LFVA 3BWLA 3LI9A 3KSFA 2P08A 2W0NA 3CI6A 4I3JA 4EEPA 2Y8HA 4E04A 1XJ6A 3FG8A 2R78A 4BBVA 2VX8A 2L0WA 3F1OB 5HL6A 2O9BA 3H9WA 3T4TA 1GSVA 4WL9A 3UB8A 2J3TC 4LRXC 2WKRA 2PDRA 4UEYA 3C2WA 2A2LA 3PR6A 2V1AA 5HWWA 5G4YA 1XFNA 2PT7A 3E4QA 3UMDA 1NWZA 2P04A 2PD8A 2JN7A 2W1TA 3R4KA 4LPZA 3B47A 3ULFA 4Y3IA 4EETB 3PBTA 4G3VA 4PAUA 3RH8B 4ARZB 2OAP1 4WF0A 3E4OA 1T1AA 3H7WA 2XROA 3LIEA 4F3LA 5L8MA 1TS0A 2FZ0A 2L1MA 2VGLM 5A8BA 2YKHA 1XJ2A 1GSXA 3OLOA 3A0RA 4HIAA 4L9FA 1TS6A 2D02A 3LIAA 1ZTUA 1D7EA 2GZAA 5IT5A 3H82A 2J80A 1YSQA 2P7JA 4HH2A 1STZA 3LIDA 1T19A 4WUJA 4HJ3A 4EU0A 2VV7A 1XJ4A 2ZMVA 3LI8A 4EQ1A 1OJ5A 5TBMA 3P01A 4EEUA 4II7A 2NUPC 4GHIA 2M7VA 3JVVA 1LSVA 3NHQA 5AJGA 1P97A 3LICA 3BY9A 3PBQA 2W3HA 2O99A 2W3DA 4Q0HA 4CLCB 4B93A 1P9WA 4EW7A 3C30A 1DP9A 4YWZA 4ME4A 3UB6A 2LB5A 4DJ2A 3D3OA 1N9NA 3HJIA 2EWVA 4HOIA 2Z6CA 3S7QA 2PR5A 2QHKA 2EWWA 4H6JB 3S7NA 2VKSA 3BQAA 5G4ZA 4PHTA 3OC2A 4CQHA 3MFXA 2J3WA 3EEHA 4WLAA 3NOTC 4B9OA 2QYBA 4GHIB 4WELA 4Q0JA 5DJTA 4I38A 1TF1A 1G6OA 2G7UA 3GDIA 1GSWA 3LR3A 3K3CA 3KX0X 4DMZA 5J7EA 4LLOB 2I9VA 2PHYA 3S7OA 5KIZA 5DKLA 3V67A 3T50A 2OAQ1 2ZOIA 1UGUA 4NXFA 4MN7A 4HH3A 3B33A 4JGRA 4L0LA 1WA9A 4PKYG 2HJEA 4HP9A 2PYRA 2OOLA 4O01A 2PR6A 3PHYA 1F5MA 4HP4A 4LRYC 4R6LA 3D72A 5HDSA 5K5BA 1H3QA 1NLZA 2W27A 4RQ9A 1P0ZA 5C5KA 1YSPA 4GW9A 1VHMA 4IHQA 4GLQA 2VZWA 3RFBA 2YKFA 5J4EA 2ZBBA 1IOUA 3OCLA 1OTBA 3E0YA 5IU1A 3LR4A 3IS2B 3MXQA 3UB7A 1W63M 3T4QA 5IS1A 3LIFA 3S7PA 1NRJA 4EERA 3T4JA 1Y28A 1YAXA 3HJKA 3K3DA 3O5YA 3ZQ5A 4KUOA 4CLCC 5HDDA 3F1PB 2W3GA 5HDCA 3KSHA 5TJJA 4MMNA 4P6ZM 4CLCE 3UMEA 2GX5A 3CITA 3KYZA 4GJ4A 1UWPX 5DF9A 5F5YA 1S66L 4O0PA 3MQ0A 4Y5FA 4EUVA 1N9LA 2QKPA 3GECA 3T4LA 1S1ZA 3MQOA 1F9IA 4MCWA 2K7SA 3PBRA 1KOUA 2V0WA 4HY8A 5HWTA 2V0UA 4NXBA 2QJ7A 4NKPA 3TJZC 4EESA 3P7NA 4I39A 4NXEA 3IS2A 4HNBA 2L4RA 2XSSA 3NOPC 1XJ3A 4BWIA 2W3FA 3B42A 2O0YA 5LBRA 2M1CA 3TRCA 4WN5A 1EW0A 4O8GA 4KQOA 3EWKA 2OWJA 1X0OA 3EQVA 2NUTC 4BJPA 2BASA 1F98A 2XA7S 4JGQA 3TE8A 4EXOA 3T4OA 1V9YA 3FC7A 3BY8A 3E4PA 5MC7A 3CUEA 2HJ9C 3VE4A 2GJ3A 3BQ8A 5AVEA 3H7WB 2HF6A 2WKQA 1NLYA 1IFQA 3NOUC 3MF0A 2K31A 4R3AA 2Y79A 1G28A 2JHEA 3CUEC 3T4KA 2WKPA 4P6ZS 2K2NA 3A0VA 2EA9A 3FPWA 4GS9A 4YNRA 5DJUA 4ZRRA 3IBJA 4Y2FA 1DP8A 4IUHA 4DN0A 4FOFA 4UQIS 3PYPA 1OTIA 2FH5A 1ZHHB 2IA2A 3KSGA 5HSQA 1JNUA 3K2NA 3T4SA 2V1BA 1ODVA 2JKTM 4BBUA 2B02A 1LSWA 4HHDA 4YOFA 1DP6A 5HD5A 4WEKA 3UE6A 4L9GA 4BMWA 5HWVA 2XRNA 4AFIA 1OTDA 4GCZA 4NEED 4HJ4A 1OJGA 2QWSA 2XA7M 3TW8A 3C38A 3MQQA 1OT9A 3LR0A 3LYXA 5DFYA 3LIBA 4XT2B 4JGPA 3F1OA 3OOVA 4CLCA 4M4XA 3JVUA 3VOLA 2A24B 4OOMA 5TBMB 1TS7A 3UB9A 1S1YA 5F68A 3BJNA 3EOIA 1OTAA 2CMNA 1TS8A 4R38A 4KUKA 1S4SA 1VB6A 4QPRA 4OOLA 4MN5A 2VV8A 2PD7A 2HGVA 3C8CA 1D06A 4IUKA 1OTEA 3ICYA 2W1TB 4R70A 3EGXC 1MZUA 3EQUA 3G6OA 5KSHA 5CX7A 2W3EA 3KSIA 5J3WA 4ARZA 2PYPA 1LL8A 3E98A 4UQIM 3MJQA 3OCNA 3KYQA 4PKYA 3UE3A 1OT6A 3VE3A 4F3LB 1V9ZA 2O9AA 1T18A 3F1NB 3MR0A 2ZOHA 1MKMA 2W1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DJ3 A;  4WF0 A;  2KX6 A;  1WA9 A;  4R3A A;  1UWN X;  3E4O A;  4PKY G;  4HP9 A;  2PYR A;  2INW A;  2OOL A;  2PR6 A;  1G28 A;  1T1A A;  2JHE A;  3H7W A;  3LIE A;  3PHY A;  4HP4 A;  4LRY C;  2D01 A;  4F3L A;  1TS0 A;  5HD3 A;  4R6L A;  3D72 A;  2L1M A;  5EFW A;  4MN6 A;  2WKP A;  5HDS A;  3A0V A;  5A8B A;  2EA9 A;  2YKH A;  3H82 B;  1LSX A;  1XJ2 A;  2W27 A;  4RQ9 A;  1P0Z A;  1GSX A;  4GS9 A;  3OLO A;  3A0R A;  4GW9 A;  2VLG A;  4HIA A;  4HJ6 A;  2OWH A;  5DJU A;  2YKF A;  5J4E A;  2ZBB A;  4L9F A;  3SW1 A;  2VV6 A;  1DP8 A;  1OTB A;  1TS6 A;  2D02 A;  3LIA A;  3CLO A;  5IU1 A;  3PYP A;  1D7E A;  4L9E A;  1OTI A;  3H82 A;  2J80 A;  4I5S A;  3IS2 B;  3MXQ A;  2P7J A;  3UB7 A;  5HSQ A;  1JNU A;  4HH2 A;  2V1B A;  1ODV A;  4GS9 B;  1T1B A;  2V9A A;  3F1P A;  5IS1 A;  2KDK A;  1S67 L;  3LID A;  3LIF A;  1T19 A;  4I3A A;  1BYW A;  2B02 A;  4LRZ E;  4WUJ A;  4K08 A;  4BBT A;  4HJ3 A;  1LSW A;  1Y28 A;  2VV7 A;  3HJK A;  4EER A;  4HHD A;  1XJ4 A;  1DP6 A;  2QJ5 A;  5DKK A;  5HD5 A;  4L9G A;  3UE6 A;  3K3D A;  5HWV A;  3LI8 A;  3ZQ5 A;  4EQ1 A;  1OJ5 A;  1OTD A;  1T1C A;  4GCZ A;  3F1P B;  4KUO A;  5HDD A;  5TBM A;  1LT0 A;  4HJ4 A;  4HI4 A;  5HDC A;  1OJG A;  2QWS A;  4EEU A;  3MQQ A;  3RTY A;  1OT9 A;  3LYX A;  3UME A;  4GHI A;  3LIB A;  4F3L B;  1N9O A;  4XT2 B;  1UWP X;  4JGO A;  5F5Y A;  4JGP A;  1S66 L;  3F1O A;  3IBR A;  5I5L A;  3NJA A;  4M4X A;  1LSV A;  3VOL A;  1N9L A;  3NHQ A;  3A0S A;  2A24 B;  2QKP A;  5TBM B;  1P97 A;  3GEC A;  3LIC A;  4HQA A;  1TS7 A;  3BY9 A;  1S1Z A;  2HV1 A;  3UB9 A;  1S1Y A;  3MQO A;  1F9I A;  4H6J A;  4KQD A;  5F68 A;  2K7S A;  3LUQ A;  1KOU A;  2V0W A;  2VEA A;  3F1N A;  3CAX A;  4HY8 A;  4XT2 A;  5HWT A;  1S4R A;  2V0U A;  1OTA A;  4I3I A;  4EW7 A;  2CMN A;  4NXB A;  2Z6D A;  1DP9 A;  2QJ7 A;  4EES A;  4YWZ A;  5AVF A;  2H28 A;  3P7N A;  4I39 A;  4NXE A;  3IS2 A;  1XFQ A;  3CWF A;  3UB6 A;  5HZH A;  1TS8 A;  2A24 A;  4HNB A;  5F69 A;  5F6A A;  4DJ2 A;  2L4R A;  1N9N A;  3HJI A;  3NOP C;  4R38 A;  1XJ3 A;  4KUK A;  1DRM A;  4HOI A;  1S4S A;  1VB6 A;  2Z6C A;  4NXG A;  3VE3 A;  2PR5 A;  2QHK A;  3BWL A;  4H6J B;  3LI9 A;  2M1C A;  4MN5 A;  4WN5 A;  2W0N A;  1EW0 A;  2VV8 A;  4I3J A;  5G4Z A;  4EEP A;  2PD7 A;  3EWK A;  2OWJ A;  1X0O A;  3C8C A;  1D06 A;  4E04 A;  3MFX A;  1XJ6 A;  3FG8 A;  2R78 A;  3EEH A;  1OTE A;  3ICY A;  4R70 A;  4WLA A;  4BBV A;  3NOT C;  2L0W A;  3F1O B;  4B9O A;  3H9W A;  1MZU A;  3G6O A;  4GHI B;  1GSV A;  4WL9 A;  3UB8 A;  2BAS A;  5DJT A;  4I38 A;  4LRX C;  1F98 A;  2WKR A;  4JGQ A;  2PDR A;  4EXO A;  5J3W A;  1V9Y A;  3GDI A;  1GSW A;  2PYP A;  3FC7 A;  3BY8 A;  3C2W A;  3E4P A;  1LL8 A;  3K3C A;  3KX0 X;  2V1A A;  5HWW A;  5J7E A;  4LLO B;  2I9V A;  2PHY A;  5KIZ A;  5G4Y A;  5DKL A;  1XFN A;  3E4Q A;  3MJQ A;  3UMD A;  3VE4 A;  1NWZ A;  2GJ3 A;  4PKY A;  3T50 A;  2PD8 A;  2JN7 A;  2ZOI A;  4LPZ A;  5AVE A;  3H7W B;  4BBU A;  1OT6 A;  1UGU A;  4NXF A;  3ULF A;  4HH3 A;  1V9Z A;  3B33 A;  1T18 A;  2WKQ A;  3F1N B;  3MR0 A;  4JGR A;  4EET B;  2ZOH A;  3NOU C;  3RH8 B; 
#chains in the Genus database with same CATH topology
 2LB9 A;  2VJW A;  3EGD C;  2HP9 A;  4CLC D;  4Y17 A;  1YKD A;  5HD3 A;  5EFW A;  5DFX A;  3UE1 A;  2PRF A;  5HPF A;  2WGW B;  2VV6 A;  1WYB A;  3CLO A;  5I94 A;  2JKR I;  4I5S A;  3PBS A;  1CEF A;  1TD5 A;  2XH9 A;  1XGJ A;  2HDR A;  4GS9 B;  3AGF A;  4I3A A;  4S2K A;  4LRZ E;  4BBT A;  1SDN A;  5FI6 A;  1LI0 A;  1MWR A;  3D9Y A;  3LR5 A;  3CG5 A;  4BLM A;  3FPV A;  1XA7 A;  4JGO A;  1E3U A;  5L10 A;  3NJA A;  3SS4 A;  4Z1W A;  1VET B;  1K57 A;  5AQ7 A;  1LI9 A;  4MBH A;  3S4X A;  4HQA A;  3IX4 A;  5CRF A;  5FAS A;  4Q0I A;  2B5R A;  3CAX A;  4X68 A;  4XT2 A;  3VV4 A;  1S4R A;  2Y59 A;  2E8I A;  2ZLY A;  3WRT A;  5AVF A;  2H28 A;  2HP5 A;  2BTF P;  2GNX A;  5HZH A;  1Q2P A;  5F69 A;  3GV9 A;  3WRZ A;  3LI9 A;  4ZDX A;  4N1X A;  4EEP A;  2Y8H A;  1K4F A;  3FG8 A;  1MPL A;  3T4T A;  5HAQ A;  1L0D A;  1W8Q A;  5CTN A;  3T1S A;  1MY8 A;  4OP5 A;  4PM6 A;  5G4Y A;  2XQZ A;  1XFN A;  2EXB A;  2EX6 A;  1NWZ A;  4E3L A;  2W1T A;  2HDQ A;  4QY6 A;  3B47 A;  4GD6 A;  4EET B;  3PBT A;  2Y2L A;  2WAF A;  5L8M A;  2FZ0 A;  2ZD8 A;  1BLC A;  4DDS A;  2YKH A;  3VOZ A;  5CXW A;  1GSX A;  3OLO A;  3MKF A;  3N8L A;  4Y7P A;  4OH0 A;  1TS6 A;  2D02 A;  1BT5 A;  4PMA A;  1D7E A;  2GZA A;  5KMW A;  4BEN A;  3G2Z A;  1SCW A;  4HH2 A;  1ES2 A;  1ACF A;  3TG9 A;  4HJ3 A;  2PBD P;  2VV7 A;  4Y0O A;  1XJ4 A;  2ZMV A;  3IF5 A;  2A49 A;  4KEN B;  4S2N C;  1NZU A;  3ZFZ A;  4OQI A;  4X6T A;  3DTM A;  1HZO A;  2M7V A;  3MSH A;  3JVV A;  1LSV A;  1ERM A;  4BD1 A;  1HD8 A;  4UHU A;  5EE8 A;  5FEF A;  3A3I A;  3M2J A;  3O86 A;  3MS6 A;  4CLC B;  2JCH A;  5DTK A;  4EW7 A;  4S2P A;  4S2O A;  1K25 A;  3WWX A;  3JYI A;  3QP5 A;  3HJI A;  1N9N A;  4HOI A;  5IHV A;  2PR5 A;  1BUE A;  1ZG4 A;  3OPP A;  2VKS A;  1L0G A;  3IXG A;  5F1G A;  5GHY A;  4X55 A;  1CJF A;  3GVB A;  4EUZ A;  2QYB A;  3VP1 A;  2G7U A;  1KE3 A;  3GDI A;  3LR3 A;  3KX0 X;  3S7O A;  1VEU B;  3LGO A;  3A3J A;  2OAQ 1;  3HUO A;  4EWF A;  4MN7 A;  2Y2N A;  5FQM A;  5EOE A;  1WA9 A;  4PKY G;  3TSG A;  4D2O A;  4O01 A;  3OPH A;  3PHY A;  4HP4 A;  4R6L A;  3D72 A;  4FH2 A;  5K5B A;  3LO7 A;  1L0F A;  4RQ9 A;  5C5K A;  1VHM A;  1IOU A;  1IEL A;  2YKF A;  4XUZ A;  3OCL A;  1OTB A;  2WKI A;  1MWT A;  2GDN A;  1W63 M;  1MKI A;  3LIF A;  1YAX A;  1G6A A;  1ONH A;  4E3I A;  4KUO A;  4CLC C;  3BM6 A;  5CEB A;  5CED A;  2Q9N A;  2ACG A;  2JKF A;  3KYZ A;  4UA6 A;  2Y4A A;  2Y2P A;  3IWI A;  4KZ3 A;  4O0P A;  1K6R A;  3MQ0 A;  4LCL A;  1KE0 A;  4PM8 A;  4EUV A;  1N9L A;  3SH8 A;  4Q8I A;  4MNR A;  5GLD A;  2K7S A;  5A92 A;  4NKP A;  2UWX A;  3Q81 A;  4E3O A;  4S2M A;  1U60 A;  2XSS A;  3HLD A;  3NOP C;  4UAA A;  3DTE A;  2W3F A;  3IQA A;  4P85 A;  2ZQA A;  1CQA A;  5FSR A;  3VOY A;  4WN5 A;  3C7U A;  5BOH A;  3QHY A;  1RCJ A;  1X0O A;  3O87 A;  4OPZ A;  2BAS A;  2XA7 S;  4WMC D;  5HX9 A;  3FC7 A;  4KZA A;  2XDM A;  3Q07 A;  5MC7 A;  3N8R A;  2HJ9 C;  3VE4 A;  2GJ3 A;  4Y0T A;  3BQ8 A;  1BLS A;  3H7W B;  2HF6 A;  5EVI A;  3MF0 A;  1G5U A;  1ES5 A;  2X01 A;  4PM7 A;  2Y79 A;  1HVB A;  1PZO A;  2Z2M B;  4ZJ1 A;  4GS9 A;  5E2G A;  3IBJ A;  5HL1 A;  4DN0 A;  2HDU A;  3BFF A;  1OTI A;  1Z09 A;  2FH5 A;  2X71 A;  1ZHH B;  2IA2 A;  1W7F A;  1PW1 A;  3MKE A;  4BBU A;  1NYY A;  4B4X A;  4LV0 A;  3BEC A;  4WEK A;  3NDG A;  2XRN A;  4AFI A;  2QZ6 A;  4NEE D;  5DTS A;  1L0E A;  1OT9 A;  4WZ4 A;  3LIB A;  1BUL A;  2ZC7 A;  3BFG A;  3IF6 C;  3F1O A;  4N9K A;  3IT9 A;  3VOL A;  1PIO A;  2A24 B;  4OOM A;  1N9B A;  1OME A;  2B95 A;  3NY4 A;  3BFC A;  5CEC A;  3OPL A;  3UN7 A;  5FEG A;  2WUQ A;  3ZG7 B;  4R38 A;  4KUK A;  4K0X A;  1S0W A;  1Z6F A;  2VGK A;  1D06 A;  1NZO A;  1YM1 A;  4DE3 A;  1MXO A;  2EXA A;  4OLD A;  4R4S A;  1QMF A;  1LLB A;  2PYP A;  3IF6 B;  3E98 A;  3LY4 A;  3HRE A;  3ZNT A;  2J8Y A;  3WS1 A;  4D60 A;  4U0X A;  4F3L B;  1V9Z A;  4QWO A;  1MKM A;  2W1R A;  3NEC A;  1KDS A;  2INW A;  2Y2G A;  3EEA A;  3CZD A;  3W4O A;  2D01 A;  3VP3 A;  1NY0 A;  5GLB A;  3HCY A;  4GB7 A;  3ZG0 A;  1LSX A;  3PXP A;  2OV5 A;  2WKE A;  4R1G A;  2PU2 A;  4G3W A;  1YPR A;  4L9E A;  1E4D A;  2DNS A;  1XXM A;  3OBF A;  1K6S A;  1T1B A;  2V20 A;  3ZG8 B;  2KDK A;  5FQK A;  4KG2 A;  2UV0 E;  4ESP A;  3HUN A;  3MMH A;  4G3K A;  5G18 A;  2V8F A;  5FL3 A;  1LL5 A;  5HAI A;  4WZ5 A;  4IJG A;  3RTY A;  3RJU A;  2KLI A;  4MDZ A;  3FWL A;  1N9O A;  5FDS A;  1W5D A;  5CGS A;  3IBR A;  4H8R A;  1GHI A;  3A0S A;  3AGE A;  5AQA A;  2HP6 A;  1H8Y A;  3NBL A;  3V3R A;  4MLL A;  4H6J A;  3KO6 A;  1YMS A;  2VEA A;  1CI8 A;  4I3I A;  3CMZ A;  4X69 A;  2Z6D A;  3PBN A;  3T1R A;  4FSF A;  3CWF A;  2ZQ8 A;  1WE4 A;  5F6A A;  4IED A;  2WAD A;  1DRM A;  3ZVT A;  2WZZ A;  2PU4 A;  3CI6 A;  4I3J A;  2XGN A;  3VP4 A;  4E04 A;  3BFD A;  4BBV A;  3F1O B;  4GKU A;  3H9W A;  2J3T C;  2WKR A;  3P09 A;  5L07 A;  3SOI A;  2A2L A;  1JWP A;  2P04 A;  2PD8 A;  4Y3I A;  2OAP 1;  5U47 A;  3FKW A;  2XLN A;  3ZG5 A;  1T1A A;  4F3L A;  2ZMA A;  1H8Z A;  1NXY A;  2OSU A;  1LHY A;  3N8S A;  1ZKJ A;  2P9V B;  3LIA A;  1EWZ A;  2H0T A;  3H82 A;  1STZ A;  3LID A;  4OPR A;  3E2L A;  3IX3 A;  1D1J A;  4EQ1 A;  3A3F A;  1OJ5 A;  3NI9 A;  2H0Y A;  4ZJ2 A;  1ES3 A;  2EX9 A;  3LIC A;  5A91 A;  3BY9 A;  4OPQ A;  1I2W A;  1PW8 A;  1I2S A;  3E2K A;  4ME4 A;  3UB6 A;  1FCN A;  2LB5 A;  1XP4 A;  2EWV A;  2XR0 A;  1DJC A;  3Q1F A;  2QHK A;  2EWW A;  3BLS A;  3C5A A;  3CPT B;  4HES A;  3BQA A;  2A3U A;  4PHT A;  3OC2 A;  4JXG A;  4EV4 A;  5CTM A;  1XKZ A;  3D4F A;  3MFX A;  1PFL A;  1A0K A;  1TF1 A;  3LCE A;  1G68 A;  2R9X A;  3HLC A;  5DF8 A;  4KZ5 A;  1GSW A;  2XF3 A;  4DMZ A;  5J7E A;  4P87 A;  5KIZ A;  5DKL A;  3V67 A;  2ZOI A;  3VMA A;  1O7E A;  3B33 A;  3FV7 A;  2WYX A;  5D3O A;  3HBR A;  1JWZ A;  4OON A;  4LRY C;  3PAG A;  2QMI A;  4E3K A;  1GCE A;  4R4R A;  1H3Q A;  1P0Z A;  5HAR A;  1YSP A;  5EVE A;  3RFB A;  2VZW A;  5EVI C;  4PM5 A;  3E0Y A;  5M1A A;  5IS1 A;  4E6W A;  1NRJ A;  4EER A;  3CJM A;  3O5Y A;  4E3N A;  4FUW A;  5HDD A;  3F1P B;  1XPB A;  3KSH A;  1L3L A;  4B4Z A;  2QPN A;  2C6W B;  2Y55 A;  5TJJ A;  4MMN A;  4CLC E;  4A5R A;  2GX5 A;  3CIT A;  5L2F A;  1UWP X;  5F5Y A;  4Y5F A;  4DXC A;  1PNE A;  3N7W A;  5FDH A;  2HZ5 A;  4BQM A;  4C3Q A;  3QNB A;  1PI5 A;  3PBR A;  2EX2 A;  2V0W A;  4HY8 A;  5EOO A;  4GDB A;  5HWT A;  4XUX A;  1RGZ A;  4NXB A;  4WM9 A;  3DTK A;  4WYY A;  2L4R A;  3M2K A;  2RCX A;  1XJ3 A;  4ZTK A;  1BLP A;  4BD0 A;  4QD4 A;  5LBR A;  3IHB A;  5EVL A;  5AQ9 A;  4O8G A;  4UA9 A;  3EWK A;  3L7H A;  3GRJ A;  3W8K A;  1Y4O A;  3M6H A;  4BJP A;  3G34 A;  4JF6 A;  4IVI A;  3TE8 A;  1M6K A;  3DTI A;  1K38 A;  1WYC A;  3CUE A;  2Y91 A;  3GSG A;  4KZ8 A;  2IWB A;  4DE2 A;  4R0Q A;  1YLT A;  4HBU A;  3W4P A;  1S6R A;  1NLY A;  4N1H A;  5EVI D;  3NOU C;  3C4O A;  2K31 A;  4M3K A;  3P98 A;  4QB8 A;  3LY3 A;  1SKO A;  4P6Z S;  1PZP A;  1JVJ A;  2EA9 A;  2ZJ9 A;  3ZNY A;  5DJU A;  4Y2F A;  4UQI S;  4KG6 A;  5HSQ A;  3K2N A;  4QY5 A;  2V1B A;  1ODV A;  4RYE A;  2JKT M;  3T4S A;  5M18 A;  3MFD A;  3HVF A;  4S2I A;  3QNC A;  1PRQ A;  4L9G A;  3O88 A;  2J9P A;  1OTD A;  1IYO A;  5EUA A;  4KZB A;  2XA7 M;  5DFY A;  4GN2 A;  3HLG A;  4XT2 B;  3NUL A;  3OOV A;  4CLC A;  1PWC A;  5FAQ A;  3C4P A;  5TBM B;  2EFU A;  1ZG6 A;  3VP0 A;  1S1Y A;  2PBY A;  1K56 A;  1J9M A;  1OTA A;  2CMN A;  5FAO A;  3WS2 A;  3CPT A;  4DE1 A;  2R9W A;  3KYE A;  1S4S A;  1VB6 A;  4QPR A;  2CC1 A;  5E2H A;  4MN5 A;  4YIN A;  2JBF A;  3C8C A;  3UPN A;  2ZC6 B;  4IUK A;  2W1T B;  4LEN A;  2PAV P;  1MZU A;  3EQU A;  3G6O A;  3ZHH A;  2WGW A;  2W3E A;  5A93 A;  4PPR A;  2E8J A;  4UQI M;  3GTC A;  3OCN A;  4PKY A;  4QHC A;  1FIK A;  1RP5 A;  3SH9 A;  4DJ3 A;  3C7V A;  3DWK A;  1NRF A;  4KZ7 A;  4S2L A;  2VA0 A;  3U2A A;  1MC0 A;  5DTT A;  3H82 B;  2OLV A;  1OPX A;  2JKR M;  3SW1 A;  1SZV A;  1PWD A;  4ETZ A;  4DKI A;  4R3B A;  3R7W B;  3Q82 A;  3F1P A;  3ITB A;  2KOI A;  4K08 A;  2QJ5 A;  1LT0 A;  4ZJ3 A;  4HI4 A;  5DF7 A;  1K56 D;  3DBA A;  4WEJ A;  2XD5 A;  2O9C A;  2FFF B;  3UY6 A;  1E25 A;  3W2Z A;  3QP2 A;  1XX2 A;  4IBR A;  2HV1 A;  2G2U A;  5F82 A;  2Z2L B;  5E2F A;  3LUQ A;  3ZG9 B;  3F1N A;  3SZT A;  2BLS A;  3ZGA B;  3WS5 A;  1P9R A;  5EV0 A;  5F1F A;  4EBP A;  3VP2 A;  3V5M A;  1K57 C;  4JKT A;  3NDE A;  3BWL A;  3KSF A;  4O7D A;  2I72 A;  2W0N A;  3UPO A;  5F83 A;  4JLF A;  5CER A;  1GA0 A;  5FQJ A;  2R78 A;  4K91 A;  2BG1 A;  2L0W A;  5HL6 A;  2O9B A;  4WL9 A;  4KQR A;  1Y54 A;  3SH7 A;  1LL9 A;  3UB5 P;  3PR6 A;  3E4Q A;  2HPB A;  3UMD A;  5FQI A;  3G35 A;  3R4K A;  4LPZ A;  4XXR A;  3ULF A;  4ZBE A;  4E3M A;  4ARZ B;  4WF0 A;  3IH9 A;  2Y2O A;  4OQG A;  4RX3 A;  3W4Q A;  1TS0 A;  3NCK A;  2L1M A;  2VGL M;  1KE4 A;  5A8B A;  3JPU A;  1XJ2 A;  4IVK A;  3PAE A;  3QP6 A;  2Y2M A;  3QP1 A;  1ZTU A;  1K55 A;  2ZC4 B;  4CPK A;  1YSQ A;  2P7J A;  1GA9 A;  1XA1 A;  4LV1 A;  1JTG A;  5EPH A;  4MBF A;  4LV3 A;  5FI7 A;  1MWS A;  1ERQ A;  3P01 A;  4EEU A;  2XFT A;  1YLY A;  3FYZ A;  1BSG A;  4GHI A;  4X25 A;  5AJG A;  1P97 A;  1RGY A;  1DY6 A;  2EX8 A;  2W3D A;  4Q0H A;  1H5X A;  3HLF A;  3FZC A;  1FIL A;  3C30 A;  1N4O A;  1DP9 A;  3A3E A;  1NYM A;  3IXD A;  1ES4 A;  2Z6C A;  4OPY A;  3IH8 A;  3S7N A;  4DDY A;  5G4Z A;  2H10 A;  2IWC A;  3QP8 A;  4LGW A;  3WS0 A;  2J3W A;  3EEH A;  3FKV A;  4WLA A;  5FQQ A;  3NOT C;  2ZQC A;  4GHI B;  4WEL A;  4I38 A;  1G6O A;  5EM1 A;  3MZD A;  1SDE A;  3IXH A;  2WGI A;  3HLW A;  1IEM A;  4X1M A;  5GHX A;  3K3C A;  3IHA A;  2I9V A;  2PHY A;  3T50 A;  3MBZ A;  1UGU A;  1TVF A;  5GL9 A;  4HH3 A;  3MZE A;  3V39 A;  3DW0 A;  4HP9 A;  2PYR A;  2OOL A;  2PR6 A;  4EBN A;  5HDS A;  2W27 A;  4HBT A;  4IHQ A;  4GLQ A;  4WBG A;  3MXS A;  2ZBB A;  4X53 A;  3ZDJ A;  5TFQ A;  2WK0 A;  3LR4 A;  3IS2 B;  3MXQ A;  3UB7 A;  4KQQ A;  3T4Q A;  2V2F F;  3GMW A;  3S7P A;  1TDG A;  1BZA A;  3I7J A;  5CGX A;  1Y28 A;  5TR7 A;  4IBX A;  2C5W B;  3K3D A;  3ZQ5 A;  2W3G A;  5EVI B;  5HDC A;  2VGJ A;  1DJB A;  3UME A;  4GJ4 A;  1QME A;  3O3V A;  1S66 L;  5A90 A;  2Y2K A;  1I5Q A;  4EBL A;  4OVD A;  3LEZ A;  3GEC A;  1GHP A;  3T4L A;  1S1Z A;  1F9I A;  1EI5 A;  3S22 A;  1K54 A;  3M6B A;  2QJ7 A;  5HAP A;  3G30 A;  5GHZ A;  3P7N A;  4NXE A;  3IS2 A;  4LCM A;  4HNB A;  4WMC A;  1AXB A;  2O0Y A;  3TRC A;  4MBK A;  1EW0 A;  2FFY A;  1TDL A;  3DAV A;  1M40 A;  2ZQ7 A;  3OPR A;  4EXO A;  1V9Y A;  3BY8 A;  5EM0 A;  1YT4 A;  1E3U D;  1W8Y A;  3ZVW A;  4HEF A;  2ZM8 A;  2IWD A;  4Y15 A;  2WKP A;  2K2N A;  3FPW A;  3G4P A;  4LFU A;  4YNR A;  4ZRR A;  1YQS A;  4FOF A;  3PYP A;  4OQH A;  4OP8 A;  3BFE A;  3A3D A;  3NC8 A;  3IF6 A;  1LSW A;  1CF0 A;  4YOF A;  4QU3 A;  4HHD A;  5HD5 A;  4BMW A;  2P9V A;  4GCZ A;  3NIA A;  4DE0 A;  1ZC2 A;  2QWS A;  3TW8 A;  3LYX A;  4GNU A;  1FSY A;  4JGP A;  1J3W A;  1IKI A;  4LV2 A;  1BLH A;  1TS7 A;  2V1Z A;  3UB9 A;  5F68 A;  1HTZ A;  4GZB A;  3GR2 A;  5KSC A;  5JYO A;  4R3J A;  1SKF A;  2V8C A;  5HFO A;  5CHJ A;  5KZH A;  3GQZ A;  2VV8 A;  2J9O A;  1ESU A;  3ZCZ A;  3ICY A;  1KVM A;  3V50 A;  3QP4 A;  5CX7 A;  3CHW P;  4KZ6 A;  5DVA A;  3KSI A;  4ARZ A;  3T12 B;  3V3S A;  3UDX A;  1MWU A;  3KYQ A;  3UE3 A;  1YMX A;  1OT6 A;  3SS3 A;  3VE3 A;  5JYP A;  2O9A A;  2ZOH A;  3L9K A;  4GDN A;  1H8M A;  2KX6 A;  1UWN X;  5J8X A;  3N6I A;  2DMW A;  4ETX A;  4UA7 A;  2JKT I;  4MN6 A;  2ZMF A;  4JXS A;  1DJA A;  3ZYT A;  1VET A;  2VLG A;  4HJ6 A;  2OWH A;  4JXV A;  4OLG A;  1F2K A;  1FSW A;  2ZC3 B;  1KDW A;  2VGL S;  2V9A A;  3T1X A;  1S67 L;  2AVX A;  1BYW A;  4ID4 A;  2XFS A;  3MZF A;  1W63 Q;  5DKK A;  2J3T D;  2Y2Q A;  1T1C A;  1L2S A;  1KGG A;  3PBO A;  3BW6 A;  4U0T A;  3UO9 A;  5I5L A;  5GLC A;  2M7U A;  4KQD A;  4FH4 A;  2MJ6 A;  5HPI A;  3LEQ A;  5E43 A;  3R7W A;  1JTD A;  2DCF A;  4DXB A;  1XFQ A;  2B18 A;  2A24 A;  1W79 A;  4U3T A;  4NXG A;  4QJG A;  3LFV A;  5GLA A;  2P08 A;  2XD1 A;  1GHM A;  1JWV A;  1VQQ A;  1XJ6 A;  3S1Y A;  3DWZ A;  2VX8 A;  3T1Q B;  5CHM A;  1CK3 A;  1GSV A;  1FR1 A;  3UB8 A;  4LRX C;  2PDR A;  4UEY A;  3VFF A;  4PM9 A;  4OKP A;  3C2W A;  2V1A A;  5HWW A;  2PT7 A;  1H0M A;  2ZQD A;  2JN7 A;  4EQI A;  2Y2J A;  4JPM A;  5HW3 A;  4PAU A;  4G3V A;  5E2E A;  3RH8 B;  3Q7V A;  2X02 A;  3E4O A;  3H7W A;  4FD8 A;  3LIE A;  2XRO A;  4MEZ A;  3UDI A;  1C3B A;  1IKG A;  2VK3 A;  3A0R A;  4HIA A;  4L9F A;  1YLW A;  2Y2H A;  2ZM0 A;  4K0W A;  5IT5 A;  2J80 A;  1YLZ A;  1SKO B;  2J7V A;  1T19 A;  4WUJ A;  2P74 A;  3AGD A;  5FAT A;  4EU0 A;  4KZ4 A;  2Q9M A;  3LI8 A;  5TBM A;  4JBF A;  4II7 A;  5AQB A;  2NUP C;  4B88 A;  1FCO A;  4JF5 A;  1ONG A;  1IYP A;  4E6X A;  1PYY A;  3NHQ A;  1VEU A;  5FQ9 A;  3PBQ A;  2W3H A;  2O99 A;  2XEP A;  4C6Y A;  4ZAM A;  4B93 A;  1P9W A;  1BTL A;  4YWZ A;  3B3X A;  1YLJ A;  4DJ2 A;  3D3O A;  3IXB A;  3SS5 A;  3S7Q A;  4H6J B;  3TOI A;  4CQH A;  3G31 A;  5FI2 A;  4B9O A;  4Q0J A;  5DJT A;  1CI9 A;  1ESI A;  3U4L P;  1KGE A;  4LLO B;  5M19 A;  1XGI A;  4RX2 A;  4NXF A;  4JGR A;  2WKH A;  4S2J A;  4L0L A;  2Y2I A;  3HUM A;  2HJE A;  3IX8 A;  1F5M A;  1FCM A;  4YFM A;  3RXX A;  1MBL A;  1NLZ A;  1IYQ A;  2JKG A;  1PI4 A;  4GW9 A;  4RVA A;  3IWQ A;  5J4E A;  1Q2Q A;  5IU1 A;  1VM1 A;  4KG5 A;  4OQ0 A;  3T4J A;  3HJK A;  3BRM A;  4Y0U A;  2EFX A;  5L09 A;  3BYD A;  3HL9 A;  4Z9Q A;  4P6Z M;  2ZL1 B;  5DF9 A;  4S2N A;  2WZX A;  1CEG A;  2QKP A;  4RA7 A;  1FR6 A;  3UDF A;  3MQO A;  4MCW A;  1KOU A;  5CHU A;  2V0U A;  1O07 A;  4EES A;  3TJZ C;  4I39 A;  3PTE A;  1FQG A;  4BWI A;  5EEC A;  3B42 A;  2M1C A;  1HLU P;  4KQO A;  1K0K A;  2OWJ A;  4F94 A;  3EQV A;  3Q7Z A;  2NUT C;  4P6B A;  4N92 A;  4JXW A;  1F98 A;  4JGQ A;  3T4O A;  3E4P A;  5TGF A;  4CJN A;  1K55 C;  3Q7V B;  5AVE A;  2WKQ A;  1IFQ A;  4BL2 A;  4NET A;  4R3A A;  1K54 C;  1KGF A;  1G28 A;  2JHE A;  3CUE C;  3T4K A;  3A0V A;  4X56 A;  2ZM2 A;  4BL3 A;  3BEB A;  3OZH A;  1DP8 A;  4IUH A;  4FCF A;  4P0M A;  3KSG A;  1AWI A;  1JNU A;  4DF6 A;  1SHV A;  3RXW A;  2B02 A;  1KVL A;  5FA7 A;  4NK3 A;  1DP6 A;  4NG2 A;  3UE6 A;  5HWV A;  2ZC5 B;  2RL3 A;  3MXR A;  4HJ4 A;  1OJG A;  3VSK A;  3C38 A;  3G32 A;  3MQQ A;  1IYS A;  3LR0 A;  1K4E A;  3G2Y A;  4M4X A;  1ERO A;  2JC7 A;  3JVU A;  4X1L A;  2JE5 A;  2OLU A;  4N9L A;  3VSL A;  3ISG A;  3UPP A;  3BJN A;  3EOI A;  3HLE A;  3UNW A;  2WAE A;  4GD8 A;  1TS8 A;  3BLM A;  4C75 A;  4Y13 A;  3WS4 A;  4OOL A;  4FTX A;  2HDS A;  3HLB A;  4E3J A;  2PD7 A;  2HGV A;  4DRT A;  3IWO A;  2ZL1 A;  2ZQ9 A;  1OTE A;  4R23 A;  4R70 A;  5CGW A;  3VFH A;  2G2W A;  3EGX C;  2H5S A;  4GOG A;  5KSH A;  5J3W A;  2WGV A;  3ITA A;  1LL8 A;  4KZ9 A;  4OOY A;  3N4I A;  4WZ5 C;  1PWG A;  1YLP A;  1TEM A;  1NJ4 A;  2Q0O A;  2XK1 A;  4JF4 A;  5FAP A;  1ALQ A;  1FOF A;  3UE0 A;  3F1N B;  2DRW A;  1T18 A;  3MR0 A;  3MJQ A; 
#chains in the Genus database with same CATH homology
 1H8M A;  4DJ3 A;  2KX6 A;  2LB9 A;  1UWN X;  2VJW A;  2INW A;  2VA0 A;  3EGD C;  3EEA A;  3U2A A;  4CLC D;  1YKD A;  2D01 A;  2DMW A;  1MC0 A;  5HD3 A;  4ETX A;  2JKT I;  5EFW A;  4MN6 A;  2ZMF A;  5DFX A;  3HCY A;  3H82 B;  1LSX A;  3ZYT A;  3PXP A;  1OPX A;  2JKR M;  2VLG A;  4HJ6 A;  2OWH A;  5HPF A;  3SW1 A;  2VV6 A;  3CLO A;  4G3W A;  4ETZ A;  2JKR I;  4L9E A;  4I5S A;  3PBS A;  1TD5 A;  3OBF A;  4GS9 B;  2VGL S;  1T1B A;  2V9A A;  3F1P A;  3R7W B;  2KOI A;  2KDK A;  1S67 L;  4I3A A;  4BBT A;  4LRZ E;  1BYW A;  4K08 A;  3MMH A;  4G3K A;  1W63 Q;  2QJ5 A;  5DKK A;  5FL3 A;  2J3T D;  1T1C A;  1LT0 A;  3LR5 A;  4HI4 A;  3PBO A;  3BW6 A;  4IJG A;  3RTY A;  3FPV A;  2KLI A;  3DBA A;  4MDZ A;  4WEJ A;  1N9O A;  4JGO A;  2O9C A;  3IBR A;  5I5L A;  3NJA A;  4Z1W A;  3A0S A;  3W2Z A;  4HQA A;  2HV1 A;  2M7U A;  4KQD A;  4H6J A;  4Q0I A;  3KO6 A;  3LUQ A;  2MJ6 A;  2VEA A;  3F1N A;  3CAX A;  4XT2 A;  3VV4 A;  5HPI A;  1S4R A;  4I3I A;  2Z6D A;  3PBN A;  3R7W A;  4FSF A;  1P9R A;  2H28 A;  5AVF A;  1XFQ A;  2B18 A;  2GNX A;  3CWF A;  5HZH A;  2A24 A;  5F69 A;  5F6A A;  4NXG A;  1DRM A;  3LFV A;  3BWL A;  3LI9 A;  3KSF A;  2P08 A;  2W0N A;  3CI6 A;  4I3J A;  4EEP A;  2Y8H A;  4E04 A;  1XJ6 A;  3FG8 A;  2R78 A;  4BBV A;  2VX8 A;  2L0W A;  3F1O B;  5HL6 A;  2O9B A;  3H9W A;  3T4T A;  1GSV A;  4WL9 A;  3UB8 A;  2J3T C;  4LRX C;  2WKR A;  2PDR A;  4UEY A;  3C2W A;  2A2L A;  3PR6 A;  2V1A A;  5HWW A;  5G4Y A;  1XFN A;  2PT7 A;  3E4Q A;  3UMD A;  1NWZ A;  2P04 A;  2PD8 A;  2JN7 A;  2W1T A;  3R4K A;  4LPZ A;  3B47 A;  3ULF A;  4Y3I A;  4EET B;  3PBT A;  4G3V A;  4PAU A;  3RH8 B;  4ARZ B;  2OAP 1;  4WF0 A;  3E4O A;  1T1A A;  3H7W A;  2XRO A;  3LIE A;  4F3L A;  5L8M A;  1TS0 A;  2FZ0 A;  2L1M A;  2VGL M;  5A8B A;  2YKH A;  1XJ2 A;  1GSX A;  3OLO A;  3A0R A;  4HIA A;  4L9F A;  1TS6 A;  2D02 A;  3LIA A;  1ZTU A;  1D7E A;  2GZA A;  5IT5 A;  3H82 A;  2J80 A;  1YSQ A;  2P7J A;  4HH2 A;  1STZ A;  3LID A;  1T19 A;  4WUJ A;  4HJ3 A;  4EU0 A;  2VV7 A;  1XJ4 A;  2ZMV A;  3LI8 A;  4EQ1 A;  1OJ5 A;  5TBM A;  3P01 A;  4EEU A;  4II7 A;  2NUP C;  4GHI A;  2M7V A;  3JVV A;  1LSV A;  3NHQ A;  5AJG A;  1P97 A;  3LIC A;  3BY9 A;  3PBQ A;  2W3H A;  2O99 A;  2W3D A;  4Q0H A;  4CLC B;  4B93 A;  1P9W A;  4EW7 A;  3C30 A;  1DP9 A;  4YWZ A;  4ME4 A;  3UB6 A;  2LB5 A;  4DJ2 A;  3D3O A;  1N9N A;  3HJI A;  2EWV A;  4HOI A;  2Z6C A;  3S7Q A;  2PR5 A;  2QHK A;  2EWW A;  4H6J B;  3S7N A;  2VKS A;  3BQA A;  5G4Z A;  4PHT A;  3OC2 A;  4CQH A;  3MFX A;  2J3W A;  3EEH A;  4WLA A;  3NOT C;  4B9O A;  2QYB A;  4GHI B;  4WEL A;  4Q0J A;  5DJT A;  4I38 A;  1TF1 A;  1G6O A;  2G7U A;  3GDI A;  1GSW A;  3LR3 A;  3K3C A;  3KX0 X;  4DMZ A;  5J7E A;  4LLO B;  2I9V A;  2PHY A;  3S7O A;  5KIZ A;  5DKL A;  3V67 A;  3T50 A;  2OAQ 1;  2ZOI A;  1UGU A;  4NXF A;  4MN7 A;  4HH3 A;  3B33 A;  4JGR A;  4L0L A;  1WA9 A;  4PKY G;  2HJE A;  4HP9 A;  2PYR A;  2OOL A;  4O01 A;  2PR6 A;  3PHY A;  1F5M A;  4HP4 A;  4LRY C;  4R6L A;  3D72 A;  5HDS A;  5K5B A;  1H3Q A;  1NLZ A;  2W27 A;  4RQ9 A;  1P0Z A;  5C5K A;  1YSP A;  4GW9 A;  1VHM A;  4IHQ A;  4GLQ A;  2VZW A;  3RFB A;  2YKF A;  5J4E A;  2ZBB A;  1IOU A;  3OCL A;  1OTB A;  3E0Y A;  5IU1 A;  3LR4 A;  3IS2 B;  3MXQ A;  3UB7 A;  1W63 M;  3T4Q A;  5IS1 A;  3LIF A;  3S7P A;  1NRJ A;  4EER A;  3T4J A;  1Y28 A;  1YAX A;  3HJK A;  3K3D A;  3O5Y A;  3ZQ5 A;  4KUO A;  4CLC C;  5HDD A;  3F1P B;  2W3G A;  5HDC A;  3KSH A;  5TJJ A;  4MMN A;  4P6Z M;  4CLC E;  3UME A;  2GX5 A;  3CIT A;  3KYZ A;  4GJ4 A;  1UWP X;  5DF9 A;  5F5Y A;  1S66 L;  4O0P A;  3MQ0 A;  4Y5F A;  4EUV A;  1N9L A;  2QKP A;  3GEC A;  3T4L A;  1S1Z A;  3MQO A;  1F9I A;  4MCW A;  2K7S A;  3PBR A;  1KOU A;  2V0W A;  4HY8 A;  5HWT A;  2V0U A;  4NXB A;  2QJ7 A;  4NKP A;  3TJZ C;  4EES A;  3P7N A;  4I39 A;  4NXE A;  3IS2 A;  4HNB A;  2L4R A;  2XSS A;  3NOP C;  1XJ3 A;  4BWI A;  2W3F A;  3B42 A;  2O0Y A;  5LBR A;  2M1C A;  3TRC A;  4WN5 A;  1EW0 A;  4O8G A;  4KQO A;  3EWK A;  2OWJ A;  1X0O A;  3EQV A;  2NUT C;  4BJP A;  2BAS A;  1F98 A;  2XA7 S;  4JGQ A;  3TE8 A;  4EXO A;  3T4O A;  1V9Y A;  3FC7 A;  3BY8 A;  3E4P A;  5MC7 A;  3CUE A;  2HJ9 C;  3VE4 A;  2GJ3 A;  3BQ8 A;  5AVE A;  3H7W B;  2HF6 A;  2WKQ A;  1NLY A;  1IFQ A;  3NOU C;  3MF0 A;  2K31 A;  4R3A A;  2Y79 A;  1G28 A;  2JHE A;  3CUE C;  3T4K A;  2WKP A;  4P6Z S;  2K2N A;  3A0V A;  2EA9 A;  3FPW A;  4GS9 A;  4YNR A;  5DJU A;  4ZRR A;  3IBJ A;  4Y2F A;  1DP8 A;  4IUH A;  4DN0 A;  4FOF A;  4UQI S;  3PYP A;  1OTI A;  2FH5 A;  1ZHH B;  2IA2 A;  3KSG A;  5HSQ A;  1JNU A;  3K2N A;  3T4S A;  2V1B A;  1ODV A;  2JKT M;  4BBU A;  2B02 A;  1LSW A;  4HHD A;  4YOF A;  1DP6 A;  5HD5 A;  4WEK A;  3UE6 A;  4L9G A;  4BMW A;  5HWV A;  2XRN A;  4AFI A;  1OTD A;  4GCZ A;  4NEE D;  4HJ4 A;  1OJG A;  2QWS A;  2XA7 M;  3TW8 A;  3C38 A;  3MQQ A;  1OT9 A;  3LR0 A;  3LYX A;  5DFY A;  3LIB A;  4XT2 B;  4JGP A;  3F1O A;  3OOV A;  4CLC A;  4M4X A;  3JVU A;  3VOL A;  2A24 B;  4OOM A;  5TBM B;  1TS7 A;  3UB9 A;  1S1Y A;  5F68 A;  3BJN A;  3EOI A;  1OTA A;  2CMN A;  1TS8 A;  4R38 A;  4KUK A;  1S4S A;  1VB6 A;  4QPR A;  4OOL A;  4MN5 A;  2VV8 A;  2PD7 A;  2HGV A;  3C8C A;  1D06 A;  4IUK A;  1OTE A;  3ICY A;  2W1T B;  4R70 A;  3EGX C;  1MZU A;  3EQU A;  3G6O A;  5KSH A;  5CX7 A;  2W3E A;  3KSI A;  5J3W A;  4ARZ A;  2PYP A;  1LL8 A;  3E98 A;  4UQI M;  3MJQ A;  3OCN A;  3KYQ A;  4PKY A;  3UE3 A;  1OT6 A;  3VE3 A;  4F3L B;  1V9Z A;  2O9A A;  1T18 A;  3F1N B;  3MR0 A;  2ZOH A;  1MKM A;  2W1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...