2ZQ9A

Cephalothin acyl-intermediate structure of class a beta-lactamase toho-1 e166a/r274n/r276n triple mutant
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
259
structure length
259
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Extend Spectrum Beta-Lactamase in Correlation of Enzymatic Kinetics and Thermal Stability of Acyl-Intermediates
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-lactamase Toho-1
total genus 93
structure length 259
sequence length 259
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2zq9A00
3EQVA 1TDGA 4ZJ1A 4OLDA 3VP4A 4LV1A 3WS2A 4OQIA 5EE8A 3A3DA 1WYCA 4IVKA 1IYOA 3ZG9B 3ZFZA 4BL2A 3NBLA 3ZNTA 3E2LA 3I7JA 4FH4A 4LV2A 3MBZA 1GHMA 4MEZA 1PW8A 2EX2A 4QY5A 4XUZA 4GD6A 3ZHHA 5E2HA 1IEMA 1DY6A 1PYYA 3Q7ZA 5E2FA 2X02A 2EX8A 3WS1A 5CGXA 2EXBA 3ITBA 4LCMA 4Z9QA 2R9XA 3M2JA 4R4RA 3GTCA 3LY4A 4C75A 1PWGA 2RL3A 1RGYA 1O07A 3MKEA 1ZG6A 3GQZA 3Q1FA 1E3UD 1IYSA 1ESUA 3GSGA 3QNBA 1TVFA 3GR2A 3BRMA 4MBHA 4PM8A 1I2WA 3ISGA 3Q81A 4RA7A 4BL3A 3P09A 4GD8A 2ZQAA 1K6SA 2A49A 3HLGA 4S2IA 4UAAA 2ZD8A 5A90A 1XX2A 2UWXA 1ALQA 4NK3A 4X6TA 3BFFA 3OPPA 4M3KA 5CGWA 2ZJ9A 3VOZA 5CEBA 2J7VA 2H10A 5CHJA 3VP2A 3NCKA 3BM6A 4GNUA 2ZQCA 1KGFA 1RP5A 3HLCA 4HEFA 4S2MA 4WM9A 1GA9A 3HLBA 4E3KA 4OP5A 4S2NA 3BFCA 3TOIA 4OOYA 5EECA 2V2FF 3GMWA 4KENB 2E8IA 4HESA 4UA6A 1HTZA 3O3VA 4DE3A 3VSKA 2DCFA 3IT9A 1PI4A 1FCOA 5FQJA 2R9WA 5GHXA 3QHYA 3ITAA 2ZM0A 2Z2LB 4UA7A 4Y0TA 3GV9A 3B3XA 4JXWA 2WGIA 4EBPA 2EX9A 4OPYA 1NYMA 3FV7A 3ZG5A 5KZHA 3AGDA 3IH8A 2WKHA 2IWDA 4BLMA 3W4OA 1NXYA 3IXGA 1Q2QA 3M2KA 1MKIA 2P74A 3HLEA 1HZOA 1N4OA 3G30A 3MFDA 1XA7A 4UHUA 3FYZA 4DRTA 4X56A 3ZVWA 1FQGA 1YM1A 1Q2PA 4IEDA 3ZNYA 2J9OA 2G2UA 2JE5A 1IYQA 3OPRA 4YINA 3IQAA 1L0DA 1K6RA 1NJ4A 2QMIA 5CXWA 1K38A 3TSGA 1PIOA 4KZ5A 5AQAA 1RGZA 1SDNA 2V1ZA 2DNSA 3HUNA 3HUOA 3OC2A 4GZBA 5FAPA 1XGIA 3BFDA 5E2EA 1XKZA 3M6BA 1NZOA 2XGNA 4KZ9A 4R23A 4B88A 1I2SA 4PMAA 1DJAA 1K4FA 4U3TA 3VFHA 1J9MA 5AQ9A 4MNRA 1IYPA 3IF6A 4WMCD 2V20A 1BZAA 2ZQDA 2WUQA 4ZDXA 2VGKA 5M18A 1FCNA 4NETA 4GB7A 3UDXA 4C6YA 4DF6A 1BULA 1WYBA 2WGVA 3A3EA 4KZ6A 1CK3A 3DWZA 4S2JA 2H0TA 3IHBA 3CG5A 1ES3A 5HX9A 3GVBA 4KQRA 1ZC2A 3M6HA 3S1YA 3VFFA 1YMXA 1PZOA 4QB8A 3O86A 3UN7A 1JWVA 3LO7A 3PTEA 4DXBA 2ZLYA 3HBRA 1NZUA 4K0XA 1VQQA 4PPRA 4Y7PA 1JWPA 1MWSA 2HP9A 4RVAA 4OKPA 4S2PA 3DTMA 4X68A 1SCWA 3SS4A 5GLBA 2Z2MB 2Y2IA 4KG6A 2ZQ7A 1L0EA 4DE0A 1YMSA 3IHAA 3GRJA 3WRZA 2H5SA 3W4PA 1TDLA 1S6RA 1VM1A 1CEFA 3ZG7B 4LENA 1EWZA 2J9PA 1GCEA 4DXCA 4BD1A 5GHYA 4OQHA 2G2WA 1E25A 4OPRA 2DRWA 5HAIA 4N9LA 3NY4A 1YQSA 4OQGA 4Y0OA 4JKTA 5EVLA 4JLFA 3CJMA 4EBLA 3LEZA 5EVIA 5HARA 4E3JA 1K54A 2VGJA 1MWUA 4PM5A 3FKWA 5F1FA 1XA1A 3V3RA 5CECA 3Q82A 1W8YA 3ZG0A 2X01A 4DDSA 3N4IA 2EFXA 4R0QA 5KSCA 3IXDA 3WS0A 3WS5A 1ES2A 3UNWA 2Y59A 4GDBA 1WE4A 3O87A 2XD1A 1MY8A 2P9VB 3PBNA 1ZKJA 2XLNA 4E6XA 1AXBA 1CI8A 1H8YA 3G34A 4HBUA 3IXHA 4LV0A 5E2GA 5EPHA 1ESIA 1RCJA 1FSYA 3WRTA 3OPLA 3MZDA 2WZXA 4RX2A 5FATA 3SH7A 3PAGA 3UDIA 4A5RA 3IXBA 4QD4A 2Y2OA 3NDEA 1ES4A 5EOOA 2Y55A 1K55C 4ZJ2A 1BTLA 2CC1A 2ZC7A 4KZAA 4K91A 2Y2QA 4S2NC 3UPPA 2HDRA 4BQMA 5FAOA 3IWQA 1K54C 3RJUA 3LY3A 5CTMA 4L0LA 3PBTA 1DJBA 1SHVA 5FI6A 1M6KA 3WS4A 1YLJA 3FKVA 4QJGA 3NC8A 3ZGAB 3UO9A 1KE0A 5FI2A 4OLGA 4EUZA 3W8KA 4OPZA 2ZC6B 2C5WB 2I72A 2GDNA 2HP5A 2JBFA 3D4FA 1CI9A 2Y4AA 5KMWA 2Y2MA 4QU3A 4EBNA 1G6AA 2IWCA 4IVIA 1KDWA 4E3MA 4OOLA 2P9VA 2WAEA 3HREA 2WKEA 1NRFA 1YT4A 1KE3A 1W7FA 1MXOA 4WEJA 1TEMA 1IKGA 2H0YA 2ZQ9A 1EI5A 3IF6B 1HD8A 4X69A 4N1HA 5GLCA 1KE4A 3UE3A 3PBRA 4FCFA 3BLMA 4DE2A 4S2LA 4IBXA 4PM9A 4X55A 3HLWA 1KGGA 5HAQA 1GHIA 4DE1A 3BECA 1KDSA 1ERQA 3PBQA 1PWCA 3CMZA 3OCLA 5U47A 2OLUA 5A93A 3Q7VB 1W5DA 4KZ8A 3V5MA 3IF5A 1LL9A 2JCHA 5EVID 1G68A 3MKFA 4JPMA 4N92A 3S4XA 5CEDA 2RCXA 4JBFA 2WGWA 5FA7A 2Y2GA 2FFYA 5CGSA 3FZCA 4X53A 4GKUA 1SDEA 2OV5A 3SS3A 3V3SA 3N8LA 3G31A 4R4SA 4E3NA 3VP0A 5FASA 5KSHA 3AGFA 5HFOA 4JF6A 4P0MA 3AGEA 5FDHA 3BLSA 2BG1A 4BD0A 1K25A 3BEBA 1BT5A 4C3QA 2XF3A 2XQZA 4KQQA 4F94A 4N9KA 1K4EA 1DJCA 1PWDA 2ZMAA 5BOHA 2Y2LA 4OH0A 3MXSA 3OPHA 4Q8IA 3HUMA 1BUEA 3ZG8B 5FI7A 2Y2HA 3IH9A 5HAPA 1ERMA 3DW0A 2OLVA 5FQQA 3HLDA 5I94A 3N6IA 1K57A 2QZ6A 1KVMA 3PBSA 1M40A 2Q9NA 4RYEA 1JTGA 4P85A 1BLSA 3A3JA 2HDUA 3ZCZA 4OVDA 4JXSA 2ZC3B 4OPQA 3G2ZA 4U0XA 1XXMA 3VP1A 4XUXA 4CJNA 1YLYA 5HW3A 1Z6FA 1I5QA 1KVLA 1JWZA 5CTNA 1L0GA 4WMCA 3UPNA 1K56D 2Y2KA 2WZZA 5DVAA 1U60A 4JXVA 5TFQA 2Y2NA 3C4OA 3EQUA 5DF7A 5CHUA 4P6BA 3MZFA 4OQ0A 4Y0UA 3FWLA 4S2KA 3PBOA 3ZVTA 1MPLA 3BYDA 4JF5A 4ZBEA 2IWBA 2BLSA 1MBLA 1LLBA 1W79A 1Y54A 3C5AA 1YLTA 3A3FA 4QY6A 1FSWA 4KG5A 1YLZA 5EUAA 3HVFA 1GHPA 3G4PA 1BLPA 3NDGA 1YLPA 4U0TA 5A91A 5CERA 4CPKA 4H8RA 2WAFA 1YLWA 2XH9A 3Q7VA 1CEGA 2XD5A 4O7DA 3G2YA 5FQ9A 4OOMA 1C3BA 1XPBA 3G35A 2FFFB 3LCEA 3Q07A 1PI5A 2C6WB 4GN2A 4WYYA 1ONGA 5D3OA 2X71A 3UPOA 3SOIA 2B5RA 3QNCA 4UA9A 1FR1A 3C7UA 4WZ4A 4FD8A 2ZM2A 2Q9MA 4QHCA 5EVIC 1JTDA 3A3IA 4R3JA 5GL9A 4B4ZA 2WYXA 4WBGA 5TR7A 1FOFA 5TGFA 1LI9A 3PAEA 3UY6A 5F82A 5JYPA 4ZJ3A 4KQOA 3ZDJA 1NY0A 1ES5A 2EX6A 1EROA 3C7VA 1K56A 4R3BA 4EWFA 1O7EA 3UDFA 1BSGA 1L0FA 4OP8A 2XFSA 2ZC5B 4MBFA 1IKIA 2HPBA 3C4PA 5F1GA 2WKIA 3VSLA 5DTKA 3MZEA 1XP4A 3NIAA 4MLLA 3N7WA 1MWRA 3BFGA 4MBKA 5DF8A 5GLAA 3SS5A 4KG2A 5AQ7A 5DTTA 1H8ZA 3W4QA 4E6WA 1FCMA 3OCNA 2Y2JA 1GA0A 4S2OA 1PZPA 5F83A 4PM7A 5A92A 3IWIA 2JC7A 3CZDA 4ZTKA 4WELA 4E3IA 3HL9A 3V39A 2A3UA 5L2FA 5IHVA 2HDQA 1LHYA 4IBRA 1K57C 4FH2A 5DTSA 1KGEA 1QMEA 2PU2A 4KZ4A 5FQIA 4JXGA 5CHMA 3UE0A 1QMFA 4GDNA 4LCLA 2HP6A 3WWXA 4KZ7A 3RXXA 4B4XA 3G32A 5EOEA 1E4DA 1W8QA 1L2SA 2XEPA 4GOGA 5AQBA 4E3LA 2J8YA 5GLDA 5FSRA 1PW1A 4ZAMA 3DWKA 4WEKA 3S22A 4LV3A 1NYYA 1OMEA 3JYIA 3OZHA 4BENA 3VOYA 2WGWB 3IWOA 4JF4A 4XXRA 4BJPA 5CRFA 4WZ5C 4EV4A 1HVBA 5HL1A 1JVJA 1MWTA 2ZM8A 4OONA 3O88A 1IELA 5FQKA 5G18A 2WADA 3P98A 3RXWA 1LL5A 2Y91A 3MXRA 5M1AA 4DDYA 4PM6A 1BLCA 5FQMA 1BLHA 1H5XA 3VMAA 1E3UA 4YFMA 2OSUA 3N8SA 2XDMA 3NI9A 3E2KA 4DKIA 2Y2PA 4KZ3A 4E3OA 5J8XA 1XGJA 4N1XA 3HLFA 4P87A 2ZQ8A 4RX3A 2EFUA 4ID4A 2XR0A 1ZG4A 4R1GA 3IF6C 1S0WA 2ZC4B 4KZBA 3BFEA 4FSFA 3SH9A 5EVIB 1FR6A 3VP3A 1SKFA 5E43A 1K55A 5JYOA 4WZ5A 5M19A 2EXAA 5FAQA 3TG9A 1N9BA 3SH8A 2PBYA 3V50A 2HDSA 2XFTA 4HBTA 3UE1A 4D2OA 2XK1A 1ONHA 4K0WA 2QPNA 1LI0A 4EQIA 5GHZA 3N8RA 5DF9A 2WK0A 2PU4A
chains in the Genus database with same CATH superfamily
3EGDC 2V8CA 2VEAA 4OQIA 4Y3IA 5EE8A 1OJGA 4IVKA 1IYOA 3ZG9B 3ZNTA 3I7JA 5HPIA 2M7UA 1PYYA 2X02A 1MC0A 3LEQA 2R9XA 1PWGA 1O07A 1OT9A 1ZG6A 1NLYA 3Q1FA 3T4TA 1I2WA 1LSWA 4BL3A 4BMWA 2A49A 1TF1A 3U2AA 4NK3A 1TS8A 1ALQA 5CEBA 4M3KA 2YKHA 4GNUA 2ZQCA 1RP5A 3HLCA 4IJGA 1UWPX 4S2NA 4OOYA 5EECA 4KENB 3CLOA 1HTZA 5FQJA 5GHXA 3QHYA 3GECA 3ITAA 2ZM0A 4ARZB 5C5KA 1OTDA 4OPYA 3AGDA 3LYXA 2IWDA 1MKIA 4JGOA 3G30A 3MFDA 1XA7A 4DRTA 1YM1A 2ZL1A 4MN7A 2J3TC 1L0DA 3TSGA 1K38A 4NXBA 3C30A 1RGZA 1SDNA 3OC2A 1VEUA 4PMAA 2GX5A 1K4FA 1IYPA 4MDZA 2A24A 1OT6A 1KOUA 4ZDXA 2OWJA 1FCNA 5FL3A 3FPWA 4GB7A 2KLIA 3A3EA 3DWZA 2W3DA 3IHBA 3RH8B 1PZOA 1JWVA 3HBRA 2PD8A 4OKPA 3MXQA 1V9ZA 2Z2MB 2Y2IA 4DE0A 3WRZA 1FILA 2J3TD 1VM1A 4LENA 1EWZA 2J9PA 1JNUA 1DRMA 5HAIA 2BASA 4JKTA 3CJMA 2IA2A 1K54A 3H9WA 1MWUA 4X25A 2JHEA 3Q82A 4DDSA 2X01A 4R0QA 5HD3A 3WS0A 3LIDA 2PD7A 1T1CA 2V8FA 3GDIA 4GHIB 1SKOB 3IXHA 5E2GA 1ESIA 2PBDP 3OPLA 4Q0JA 3H82A 3PAGA 5J7EA 3IBRA 1K55C 1BTLA 2CC1A 2ZC7A 2H28A 2HDRA 2QHKA 3LIBA 3ZYTA 2INWA 5CTMA 4NKPA 4D60A 2P04A 3LR4A 1KE0A 4EUZA 2VV8A 2GDNA 4Y15A 1X0OA 1CI9A 1G6AA 4IVIA 2VV6A 4OOLA 2WAEA 2WKEA 5EFWA 2P7JA 1NRFA 1MXOA 2B18A 4NXEA 2V9AA 4ETXA 4IBXA 1GHIA 4DE1A 3BECA 2PYRA 4CQHA 5A93A 3SZTA 3V5MA 4G3VA 3MKFA 4JPMA 4JBFA 4G3WA 5AVFA 3QP1A 4GS9B 3SS3A 1CF0A 3N8LA 1VEUB 3E98A 4P0MA 2VZWA 4HJ4A 1K25A 1BT5A 1XJ6A 4C3QA 3KX0X 1K4EA 1DJCA 1PWDA 4WN5A 1BUEA 3IH9A 1N9LA 5HAPA 2OLVA 5FQQA 5I94A 3UE6A 1M40A 4JXSA 2ZC3B 2XA7S 4OPQA 2VA0A 4XUXA 2EWWA 2ZOHA 1GSXA 3F1OA 2Y2KA 5DVAA 5DF7A 1DP8A 4PKYG 1VB6A 4P6BA 1MPLA 4JF5A 3C5AA 4KG5A 1GHPA 1BLPA 5CERA 4CPKA 2W3HA 2WAFA 2XH9A 3Q7VA 3NECA 2XD5A 5MC7A 2PHYA 5FQ9A 4OOMA 3Q07A 4GN2A 1PI5A 2JKFA 3KO6A 3C7UA 3T4QA 4WZ4A 4FD8A 1JTDA 5TGFA 3UY6A 5JYPA 5IS1A 2EX6A 1YPRA 3MF0A 4R3BA 4EWFA 3F1PA 4OP8A 4YOFA 2WKPA 3VSLA 4LRZE 1PNEA 1DP9A 3KYZA 3N7WA 1H8ZA 3OCNA 1GA0A 5F83A 4PM7A 3IWIA 3F1NB 3DTKA 3U4LP 4E3IA 2VK3A 3V39A 2A3UA 1HLUP 1OPXA 5DFYA 5DTSA 2PU2A 5FQIA 3WWXA 3RXXA 1E4DA 1W8QA 3CHWP 4EQ1A 4E3LA 3MQQA 2J8YA 2VKSA 1F98A 4BWIA 4XXRA 3DAVA 1P9WA 3LFVA 1HVBA 1MWTA 3L7HA 1IELA 5G18A 2WADA 1LL5A 5EVEA 3R7WA 1H5XA 3RTYA 1E3UA 3NI9A 2W27A 4L9GA 2ZMFA 4MCWA 3HLFA 4P87A 4Y13A 4Q0HA 1ZG4A 4R1GA 4KZBA 4FSFA 1FR6A 3TG9A 1GSVA 4EUVA 2HDSA 4HBTA 2J3WA 3N8RA 1EROA 3OOVA 5HWWA 4F3LB 1TDGA 4ZJ1A 4OLDA 3CAXA 4P6ZS 3WS2A 4QWOA 3A3DA 3ZFZA 4BL2A 3NBLA 3E2LA 4JGRA 4LV2A 3MBZA 4MEZA 1PW8A 2EX2A 4XUZA 3ZHHA 4GD6A 3UMDA 3MFXA 4BBTA 3VE3A 4XT2A 5CGXA 2W1RA 3ITBA 1NRJA 4R4RA 3LY4A 4I3JA 4DJ2A 3QNBA 1IYSA 1TVFA 1VETA 4MBHA 4PM8A 4RA7A 2ZMVA 2ZQAA 3HLGA 1XX2A 1OTBA 3A0RA 4X6TA 2O0YA 2PR6A 2ZJ9A 3LR5A 3VOZA 3NCKA 3BM6A 2KDKA 1KGFA 4S2MA 4WM9A 4E3KA 5AVEA 5HPFA 4UA6A 3O3VA 4DE3A 3VSKA 2DCFA 3IT9A 1FCOA 2MJ6A 2WKRA 2R9WA 1YAXA 4IUKA 2Z2LB 1TS0A 4Y17A 3B3XA 1OTIA 1D7EA 2EX9A 3D9YA 4O01A 1NYMA 5KZHA 3IH8A 2WKHA 2OAQ1 3W4OA 1Q2QA 2P74A 1CJFA 3FYZA 5HSQA 4EXOA 1Q2PA 4IEDA 4EU0A 3OLOA 1ZHHB 5G4ZA 2Z6DA 3IQAA 1ZTUA 1H8MA 5CXWA 2V1BA 1PIOA 4KZ5A 5AQAA 4LRXC 5DKLA 1NZOA 2XGNA 3E0YA 1I2SA 4U3TA 1D1JA 2V0WA 3MJQA 3LICA 2WUQA 2VGKA 1ACFA 1IFQA 4NETA 3UDXA 4C6YA 4DF6A 1BULA 1WYBA 4KZ6A 4S2JA 2H0TA 3CG5A 5TBMB 1ES3A 3VFFA 1YMXA 2HZ5A 3UN7A 3LO7A 4GLQA 4X1MA 5F69A 3P7NA 5HZHA 1MWSA 2HP9A 1LSXA 4KG6A 1BYWA 2ZQ7A 3BQ8A 2G2WA 1E25A 4N9LA 3NY4A 1YQSA 4B93A 2O9CA 4JLFA 4EBLA 3LEZA 4LLOB 5EVIA 5AJGA 4PM5A 1XA1A 3TJZC 1W8YA 1G6OA 2EFXA 2JKRI 1WE4A 3O87A 2XD1A 1MY8A 1T1AA 1TD5A 3PBNA 4E6XA 3G34A 5EPHA 1FSYA 4Y5FA 3UDIA 3SH7A 4A5RA 1ES4A 4G3KA 1F2KA 5FDSA 4ZJ2A 2K31A 3UPPA 4BQMA 5A8BA 1YSPA 5FAOA 2ACGA 1CQAA 2HGVA 1DJBA 3IX3A 3WS4A 1YLJA 3FKVA 3NC8A 3ZGAB 3MSHA 3UO9A 5FI2A 4OLGA 2ZC6B 3T1XA 2HP5A 2JBFA 2GJ3A 1LT0A 4II7A 1KDWA 4E3MA 2P9VA 1YSQA 3CPTA 1IKGA 3NJAA 1P0ZA 1EI5A 1HD8A 2XRNA 4X69A 5G4YA 5GLCA 3UMEA 2BTFP 1W63M 4FCFA 2V0UA 4S2LA 4PM9A 4X55A 1KGGA 4GJ4A 3UB7A 1KDSA 2VGLM 3OCLA 5U47A 5F5YA 2OLUA 3OBFA 1W5DA 4HP9A 3IF5A 3FC7A 2JCHA 3KSIA 1Z09A 4KQDA 4N92A 2WGWA 4GHIA 4R4SA 4I5SA 5FASA 3AGFA 2VLGA 4I39A 4BD0A 3UB6A 4EETB 3LR0A 4N9KA 5BOHA 4Q8IA 3MXSA 3OPHA 5DJUA 3HUMA 3ZG8B 2GNXA 1ERMA 3HLDA 1YKDA 3N6IA 3T12B 4O0PA 1K57A 3PBSA 1JTGA 1BLSA 3UB8A 1TS7A 4DN0A 4CJNA 2FH5A 5HW3A 1L0GA 4WMCA 1K56D 3VV4A 4XT2B 2QKPA 1MKMA 3ICYA 4MN5A 5FEGA 3MZFA 4Y0UA 3G6OA 1G5UA 3FWLA 4S2KA 4Q0IA 4EESA 1MBLA 1LLBA 1W79A 1YLTA 1FSWA 1YLZA 5EUAA 3NDGA 1YLPA 5A91A 1K0KA 1YLWA 4NEED 5FEFA 3ULFA 5HD5A 2D02A 3G35A 2FFFB 2B5RA 2W0NA 4UA9A 5EVIC 4HJ6A 3A3IA 4R3JA 2WYXA 3H82B 4QPRA 5L10A 5TR7A 1LL8A 1LI9A 3PAEA 4ZJ3A 4KQOA 3EEAA 1NY0A 3C7VA 3RFBA 1P97A 2XFSA 4MBFA 3EGXC 2WKIA 5DTKA 3MZEA 1XP4A 3EWKA 1MWRA 3SS5A 5IT5A 2PYPA 5DTTA 3L9KA 3IBJA 3BY8A 2ZBBA 3BW6A 2Y2JA 2FZ0A 5A92A 4ZRRA 4GCZA 3HL9A 2HDQA 3IS2B 1LHYA 4L9EA 2VV7A 5CHMA 4GW9A 2PT7A 2HP6A 2ZOIA 4B4XA 3G32A 4CLCB 3LIEA 4HIAA 5DKKA 5AQBA 5GLDA 1PW1A 3A0VA 4ZAMA 4RQ9A 1NYYA 3JYIA 2WGWB 1H3QA 3IWOA 4JF4A 5CRFA 4WZ5C 2D01A 4OONA 5FQKA 3RXWA 3O88A 1SKOA 4HY8A 4PAUA 3P98A 2Y91A 4DDYA 2R78A 3VMAA 3BWLA 2XDMA 3UB9A 2Y79A 4KZ3A 5J8XA 4N1XA 5EV0A 4RX3A 2EFUA 4ID4A 2XR0A 4LGWA 3IF6C 3BFEA 3KYQA 3NOTC 5EVIB 3VP3A 4JGPA 1SKFA 1K55A 2GZAA 2EXAA 3V50A 1W63Q 2XK1A 2HJ9C 5GHZA 5DF9A 3EQVA 5HDCA 3VP4A 1AWIA 3W2ZA 3LR3A 3BY9A 1EW0A 2P08A 4QY5A 5E2HA 5IU1A 2L1MA 1DY6A 3Q7ZA 3WS1A 3D3OA 4LCMA 1RGYA 2OWHA 1ESUA 2XSSA 3GSGA 4UEYA 3BRMA 3Q81A 3P09A 2QJ5A 4UAAA 2ZD8A 3BFFA 5CGWA 2J7VA 5CHJA 3TE8A 2KX6A 1S66L 4HEFA 5HL6A 3MMHA 4OP5A 3BFCA 2V2FF 3GMWA 3T4SA 2E8IA 4IUHA 3S7NA 3PYPA 2V1AA 4EEPA 2G7UA 4B9OA 4JXWA 2WGIA 4EBPA 1XJ4A 3ZG5A 3CI6A 4BLMA 3M2KA 3HLEA 1XJ2A 5HDSA 3ZVWA 1FQGA 3S7PA 3ZNYA 3K3CA 3JVUA 1IYQA 3OPRA 4YINA 1K6RA 5HWTA 1UGUA 2VGLS 2V1ZA 2DNSA 3UB5P 3VOLA 5FAPA 1XGIA 3BFDA 1XKZA 4CLCE 4R23A 4KZ9A 4B88A 1DJAA 1UWNX 1VETB 3HCYA 5AQ9A 4MNRA 5M18A 1G28A 3S7QA 2WGVA 5HX9A 3GVBA 4ESPA 3O86A 3PTEA 3KSGA 4K0XA 4PPRA 4Y7PA 3T4LA 2Y8HA 3T1RA 4S2PA 3DTMA 1SCWA 2B95A 2M7VA 3SS4A 5GLBA 3DBAA 2Q0OA 1S6RA 4I3AA 1CEFA 3ZG7B 4O8GA 1GCEA 4DXCA 4OQHA 4OPRA 2DRWA 4OQGA 4Y0OA 3ZQ5A 4E3JA 3NHQA 3FKWA 5CECA 3N4IA 3SW1A 3IXDA 1ES2A 2Y59A 2P9VB 3CPTB 1ZKJA 2XLNA 1CI8A 4R6LA 4HBUA 3PXPA 1RCJA 3WRTA 2UV0E 3MZDA 2WZXA 4RX2A 5FATA 3CWFA 1A0KA 3IXBA 2Y2OA 3NDEA 4KZAA 1LSVA 3C2WA 1K54C 3E4OA 4P6ZM 4R70A 4ME4A 3K3DA 5I5LA 1SHVA 4KUKA 1M6KA 4QJGA 2E8JA 3W8KA 4DJ3A 2C5WB 2I72A 3D4FA 3D72A 3NOUC 2Y4AA 4QU3A 4EBNA 2IWCA 1YT4A 1KE3A 1DP6A 4UQIS 4WEJA 1TEMA 4LFUA 4N1HA 1S1ZA 3UE3A 4LPZA 3C38A 1D06A 4PKYA 3HLWA 5HAQA 1PWCA 1L3LA 3Q7VB 4PHTA 1LL9A 3HJKA 3S4XA 1P9RA 5FA7A 4HJ3A 4IHQA 4X53A 5LBRA 1SDEA 2OV5A 4E3NA 5KSHA 2PDRA 5F6AA 4JF6A 3AGEA 2LB9A 4F94A 4HQAA 2ZMAA 2Y2LA 2JKRM 2WKQA 2Y2HA 5TBMA 4RYEA 4P85A 3PHYA 3A3JA 4HH3A 3ZCZA 4OVDA 2QJ7A 3DTIA 3G2ZA 4U0XA 3KSFA 1Z6FA 1I5QA 1JWZA 3QP6A 5CTNA 1Y28A 4NXFA 4K08A 2WZZA 4BBVA 4JXVA 4MN6A 2Y2NA 3C4OA 3NULA 3MR0A 3PBOA 3BYDA 1Y54A 3HVFA 3G4PA 4I3IA 4H8RA 1S4RA 3S7OA 4O7DA 3LGOA 3LCEA 3UPOA 4WYYA 2X71A 3QNCA 1FR1A 2ZM2A 2Q9MA 5J4EA 4B4ZA 4BBUA 5F82A 5EM0A 2I9VA 1ES5A 3T1SA 1K56A 2A24B 3UDFA 1BSGA 1L0FA 2ZC5B 5L8MA 1IKIA 3C4PA 5F1GA 3MQOA 4YWZA 4MLLA 1XFNA 3BFGA 4MBKA 4KG2A 3W4QA 3A0SA 1FCMA 4HP4A 4S2OA 1PZPA 4JGQA 2JC7A 3CZDA 4WELA 5TJJA 5L2FA 5IHVA 4IBRA 1K57C 4FH2A 3LIFA 1QMFA 4GDNA 2J80A 3LIAA 1L2SA 2XEPA 1STZA 2VX8A 3DWKA 3VOYA 3E4PA 2EA9A 4ARZA 1JVJA 5M1AA 1OTEA 2O9AA 5EM1A 2M1CA 1BLHA 2NUTC 4FTXA 2OSUA 2VJWA 3N8SA 4L9FA 3E2KA 2ZL1B 1F5MA 4E3OA 4WUJA 3QP4A 2ZQ8A 2A2LA 3T50A 1S0WA 2W3EA 3SH9A 4EERA 1WA9A 5JYOA 5M19A 2PBYA 2XFTA 4UQIM 3VE4A 4I38A 3UE1A 1ONHA 2QPNA 1LI0A 4EQIA 4R3AA 2PU4A 1T19A 2Z6CA 4LV1A 3EEHA 3F1PB 1WYCA 3QP5A 3MQ0A 3QP8A 4FH4A 4ETZA 1GHMA 4X1LA 2PAVP 1IEMA 2L0WA 1F9IA 5E2FA 2EX8A 3B47A 2EXBA 4Z9QA 3DTEA 3M2JA 3GTCA 4C75A 2RL3A 3MKEA 3GQZA 1E3UD 2PRFA 2YKFA 3GR2A 3P01A 3ISGA 4GD8A 1K6SA 1PFLA 4WF0A 4S2IA 5A90A 2UWXA 3OPPA 3VP2A 2H10A 2JKGA 3R4KA 4Z1WA 1GA9A 3HLBA 4AFIA 3TOIA 4KUOA 3T4KA 4HESA 1PI4A 3T4JA 4UA7A 4Y0TA 3GV9A 4LRYC 1TS6A 4FOFA 3FV7A 1NXYA 3IXGA 4NG2A 3QP2A 3IX4A 1HZOA 1N4OA 4UHUA 2W1TA 4X56A 1ODVA 2XROA 5J3WA 2J9OA 2G2UA 2JE5A 4H6JB 1NJ4A 1V9YA 2QMIA 2XA7M 3HUNA 2DMWA 3HUOA 4GZBA 5E2EA 3M6BA 2QYBA 3LI9A 3VFHA 1J9MA 3IF6A 2JKTI 4WMCD 1T1BA 2V20A 1BZAA 2ZQDA 1CK3A 4KQRA 1ZC2A 3M6HA 3S1YA 4QB8A 4DXBA 2ZLYA 1NZUA 4R38A 1VQQA 1JWPA 4RVAA 3C8CA 1IOUA 4X68A 2OAP1 1PRQA 1GSWA 1L0EA 1YMSA 3IHAA 3GRJA 2H5SA 2OOLA 3W4PA 1TDLA 4EW7A 2K7SA 4BD1A 5GHYA 1S67L 2O99A 5EVLA 5HARA 2VGJA 5F1FA 2EWVA 3V3RA 3ZG0A 5KSCA 3WS5A 3PR6A 3UNWA 4CLCA 4GDBA 4F3LA 1AXBA 1H8YA 4GS9A 4LV0A 5HDDA 3TW8A 4QD4A 5EOOA 2Y55A 4S2NC 1S1YA 4K91A 2Y2QA 2AVXA 3E4QA 3IWQA 5L07A 3RJUA 3B42A 4FUWA 3LY3A 1FIKA 3PBTA 4L0LA 3CITA 5FI6A 3NOPC 4WLAA 3O5YA 4OPZA 5KIZA 1H0MA 4HOIA 3FPVA 5KMWA 2Y2MA 1N9NA 3HREA 1W7FA 1XJ3A 2H0YA 2ZQ9A 3IF6B 1KE4A 3PBRA 3BLMA 4DE2A 3PBQA 1ERQA 5L09A 3CMZA 3JPUA 2HF6A 4H6JA 1J3WA 4KZ8A 5EVID 1G68A 5CEDA 2RCXA 2Y2GA 2FFYA 5CGSA 3FZCA 4GKUA 3F1NA 1Y4OA 3V3SA 3G31A 4HNBA 3VP0A 2PR5A 5HFOA 5FDHA 3BLSA 2BG1A 2W3FA 3BEBA 2XF3A 1OTAA 2QWSA 2XQZA 4KQQA 4OH0A 5FI7A 3IX8A 3DW0A 2QZ6A 1NLZA 1KVMA 3BJNA 1OJ5A 2Q9NA 3H7WA 2HDUA 1XXMA 4CLCD 3VP1A 1YLYA 1NWZA 2B02A 5F68A 1KVLA 4EEUA 3UPNA 1U60A 5TFQA 5HWVA 3EQUA 2KOIA 3IS2A 2HJEA 5CHUA 4OQ0A 3ZVTA 4ZBEA 2IWBA 2BLSA 3A3FA 4QY6A 4WL9A 5DJTA 4U0TA 1CEGA 2LB5A 3G2YA 1C3BA 1XPBA 5CX7A 2C6WB 5D3OA 1ONGA 3LUQA 3SOIA 5GL9A 4QHCA 4WBGA 3V67A 1FOFA 1MZUA 2L4RA 3ZDJA 4CLCC 3T1QB 2K2NA 1O7EA 3F1OB 4MMNA 2HPBA 3NIAA 2JN7A 1S4SA 5GLAA 5DF8A 2W1TB 3T4OA 2W3GA 5AQ7A 4E6WA 2JKTM 2NUPC 4Y2FA 4ZTKA 3K2NA 3CUEA 1KGEA 1QMEA 3CUEC 4KZ4A 2O9BA 4JXGA 3UE0A 4HH2A 4LCLA 4KZ7A 3JVVA 5EOEA 4M4XA 4GOGA 5FSRA 3EOIA 4WEKA 3S22A 2HV1A 4LV3A 1OMEA 3OZHA 3H7WB 4BENA 1T18A 4BJPA 1SZVA 2CMNA 4EV4A 5HL1A 3R7WB 2ZM8A 4NXGA 3MXRA 3TRCA 4PM6A 3BQAA 1BLCA 5FQMA 4YNRA 4YFMA 3B33A 3LI8A 4DKIA 2Y2PA 5K5BA 1XGJA 3HJIA 4E04A 3FG8A 2ZC4B 4DMZA 3KSHA 4HI4A 5E43A 1XFQA 1VHMA 4WZ5A 5FAQA 1N9BA 3MS6A 4HHDA 3SH8A 5DFXA 1N9OA 3KYEA 4D2OA 4K0WA 2WK0A
chains in the Genus database with same CATH topology
3EQVA 1TDGA 4ZJ1A 4OLDA 3VP4A 4LV1A 3WS2A 4OQIA 5EE8A 3A3DA 1WYCA 4IVKA 1IYOA 3ZG9B 3ZFZA 4BL2A 3NBLA 3ZNTA 3E2LA 3I7JA 4FH4A 4LV2A 3MBZA 1GHMA 4MEZA 1PW8A 2EX2A 4QY5A 4XUZA 4GD6A 3ZHHA 5E2HA 1IEMA 1DY6A 1PYYA 3Q7ZA 5E2FA 2X02A 2EX8A 3WS1A 5CGXA 2EXBA 3ITBA 4LCMA 4Z9QA 2R9XA 3M2JA 4R4RA 3GTCA 3LY4A 4C75A 1PWGA 2RL3A 1RGYA 1O07A 3MKEA 1ZG6A 3GQZA 3Q1FA 1E3UD 1IYSA 1ESUA 3GSGA 3QNBA 1TVFA 3GR2A 3BRMA 4MBHA 4PM8A 1I2WA 3ISGA 3Q81A 4RA7A 4BL3A 3P09A 4GD8A 2ZQAA 1K6SA 2A49A 3HLGA 4S2IA 4UAAA 2ZD8A 5A90A 1XX2A 2UWXA 1ALQA 4NK3A 4X6TA 3BFFA 3OPPA 4M3KA 5CGWA 2ZJ9A 3VOZA 5CEBA 2J7VA 2H10A 5CHJA 3VP2A 3NCKA 3BM6A 4GNUA 2ZQCA 1KGFA 1RP5A 3HLCA 4HEFA 4S2MA 4WM9A 1GA9A 3HLBA 4E3KA 4OP5A 4S2NA 3BFCA 3TOIA 4OOYA 5EECA 2V2FF 3GMWA 4KENB 2E8IA 4HESA 4UA6A 1HTZA 3O3VA 4DE3A 3VSKA 2DCFA 3IT9A 1PI4A 1FCOA 5FQJA 2R9WA 5GHXA 3QHYA 3ITAA 2ZM0A 2Z2LB 4UA7A 4Y0TA 3GV9A 3B3XA 4JXWA 2WGIA 4EBPA 2EX9A 4OPYA 1NYMA 3FV7A 3ZG5A 5KZHA 3AGDA 3IH8A 2WKHA 2IWDA 4BLMA 3W4OA 1NXYA 3IXGA 1Q2QA 3M2KA 1MKIA 2P74A 3HLEA 1HZOA 1N4OA 3G30A 3MFDA 1XA7A 4UHUA 3FYZA 4DRTA 4X56A 3ZVWA 1FQGA 1YM1A 1Q2PA 4IEDA 3ZNYA 2J9OA 2G2UA 2JE5A 1IYQA 3OPRA 4YINA 3IQAA 1L0DA 1K6RA 1NJ4A 2QMIA 5CXWA 1K38A 3TSGA 1PIOA 4KZ5A 5AQAA 1RGZA 1SDNA 2V1ZA 2DNSA 3HUNA 3HUOA 3OC2A 4GZBA 5FAPA 1XGIA 3BFDA 5E2EA 1XKZA 3M6BA 1NZOA 2XGNA 4KZ9A 4R23A 4B88A 1I2SA 4PMAA 1DJAA 1K4FA 4U3TA 3VFHA 1J9MA 5AQ9A 4MNRA 1IYPA 3IF6A 4WMCD 2V20A 1BZAA 2ZQDA 2WUQA 4ZDXA 2VGKA 5M18A 1FCNA 4NETA 4GB7A 3UDXA 4C6YA 4DF6A 1BULA 1WYBA 2WGVA 3A3EA 4KZ6A 1CK3A 3DWZA 4S2JA 2H0TA 3IHBA 3CG5A 1ES3A 5HX9A 3GVBA 4KQRA 1ZC2A 3M6HA 3S1YA 3VFFA 1YMXA 1PZOA 4QB8A 3O86A 3UN7A 1JWVA 3LO7A 3PTEA 4DXBA 2ZLYA 3HBRA 1NZUA 4K0XA 1VQQA 4PPRA 4Y7PA 1JWPA 1MWSA 2HP9A 4RVAA 4OKPA 4S2PA 3DTMA 4X68A 1SCWA 3SS4A 5GLBA 2Z2MB 2Y2IA 4KG6A 2ZQ7A 1L0EA 4DE0A 1YMSA 3IHAA 3GRJA 3WRZA 2H5SA 3W4PA 1TDLA 1S6RA 1VM1A 1CEFA 3ZG7B 4LENA 1EWZA 2J9PA 1GCEA 4DXCA 4BD1A 5GHYA 4OQHA 2G2WA 1E25A 4OPRA 2DRWA 5HAIA 4N9LA 3NY4A 1YQSA 4OQGA 4Y0OA 4JKTA 5EVLA 4JLFA 3CJMA 4EBLA 3LEZA 5EVIA 5HARA 4E3JA 1K54A 2VGJA 1MWUA 4PM5A 3FKWA 5F1FA 1XA1A 3V3RA 5CECA 3Q82A 1W8YA 3ZG0A 2X01A 4DDSA 3N4IA 2EFXA 4R0QA 5KSCA 3IXDA 3WS0A 3WS5A 1ES2A 3UNWA 2Y59A 4GDBA 1WE4A 3O87A 2XD1A 1MY8A 2P9VB 3PBNA 1ZKJA 2XLNA 4E6XA 1AXBA 1CI8A 1H8YA 3G34A 4HBUA 3IXHA 4LV0A 5E2GA 5EPHA 1ESIA 1RCJA 1FSYA 3WRTA 3OPLA 3MZDA 2WZXA 4RX2A 5FATA 3SH7A 3PAGA 3UDIA 4A5RA 3IXBA 4QD4A 2Y2OA 3NDEA 1ES4A 5EOOA 2Y55A 1K55C 4ZJ2A 1BTLA 2CC1A 2ZC7A 4KZAA 4K91A 2Y2QA 4S2NC 3UPPA 2HDRA 4BQMA 5FAOA 3IWQA 1K54C 3RJUA 3LY3A 5CTMA 4L0LA 3PBTA 1DJBA 1SHVA 5FI6A 1M6KA 3WS4A 1YLJA 3FKVA 4QJGA 3NC8A 3ZGAB 3UO9A 1KE0A 5FI2A 4OLGA 4EUZA 3W8KA 4OPZA 2ZC6B 2C5WB 2I72A 2GDNA 2HP5A 2JBFA 3D4FA 1CI9A 2Y4AA 5KMWA 2Y2MA 4QU3A 4EBNA 1G6AA 2IWCA 4IVIA 1KDWA 4E3MA 4OOLA 2P9VA 2WAEA 3HREA 2WKEA 1NRFA 1YT4A 1KE3A 1W7FA 1MXOA 4WEJA 1TEMA 1IKGA 2H0YA 2ZQ9A 1EI5A 3IF6B 1HD8A 4X69A 4N1HA 5GLCA 1KE4A 3UE3A 3PBRA 4FCFA 3BLMA 4DE2A 4S2LA 4IBXA 4PM9A 4X55A 3HLWA 1KGGA 5HAQA 1GHIA 4DE1A 3BECA 1KDSA 1ERQA 3PBQA 1PWCA 3CMZA 3OCLA 5U47A 2OLUA 5A93A 3Q7VB 1W5DA 4KZ8A 3V5MA 3IF5A 1LL9A 2JCHA 5EVID 1G68A 3MKFA 4JPMA 4N92A 3S4XA 5CEDA 2RCXA 4JBFA 2WGWA 5FA7A 2Y2GA 2FFYA 5CGSA 3FZCA 4X53A 4GKUA 1SDEA 2OV5A 3SS3A 3V3SA 3N8LA 3G31A 4R4SA 4E3NA 3VP0A 5FASA 5KSHA 3AGFA 5HFOA 4JF6A 4P0MA 3AGEA 5FDHA 3BLSA 2BG1A 4BD0A 1K25A 3BEBA 1BT5A 4C3QA 2XF3A 2XQZA 4KQQA 4F94A 4N9KA 1K4EA 1DJCA 1PWDA 2ZMAA 5BOHA 2Y2LA 4OH0A 3MXSA 3OPHA 4Q8IA 3HUMA 1BUEA 3ZG8B 5FI7A 2Y2HA 3IH9A 5HAPA 1ERMA 3DW0A 2OLVA 5FQQA 3HLDA 5I94A 3N6IA 1K57A 2QZ6A 1KVMA 3PBSA 1M40A 2Q9NA 4RYEA 1JTGA 4P85A 1BLSA 3A3JA 2HDUA 3ZCZA 4OVDA 4JXSA 2ZC3B 4OPQA 3G2ZA 4U0XA 1XXMA 3VP1A 4XUXA 4CJNA 1YLYA 5HW3A 1Z6FA 1I5QA 1KVLA 1JWZA 5CTNA 1L0GA 4WMCA 3UPNA 1K56D 2Y2KA 2WZZA 5DVAA 1U60A 4JXVA 5TFQA 2Y2NA 3C4OA 3EQUA 5DF7A 5CHUA 4P6BA 3MZFA 4OQ0A 4Y0UA 3FWLA 4S2KA 3PBOA 3ZVTA 1MPLA 3BYDA 4JF5A 4ZBEA 2IWBA 2BLSA 1MBLA 1LLBA 1W79A 1Y54A 3C5AA 1YLTA 3A3FA 4QY6A 1FSWA 4KG5A 1YLZA 5EUAA 3HVFA 1GHPA 3G4PA 1BLPA 3NDGA 1YLPA 4U0TA 5A91A 5CERA 4CPKA 4H8RA 2WAFA 1YLWA 2XH9A 3Q7VA 1CEGA 2XD5A 4O7DA 3G2YA 5FQ9A 4OOMA 1C3BA 1XPBA 3G35A 2FFFB 3LCEA 3Q07A 1PI5A 2C6WB 4GN2A 4WYYA 1ONGA 5D3OA 2X71A 3UPOA 3SOIA 2B5RA 3QNCA 4UA9A 1FR1A 3C7UA 4WZ4A 4FD8A 2ZM2A 2Q9MA 4QHCA 5EVIC 1JTDA 3A3IA 4R3JA 5GL9A 4B4ZA 2WYXA 4WBGA 5TR7A 1FOFA 5TGFA 1LI9A 3PAEA 3UY6A 5F82A 5JYPA 4ZJ3A 4KQOA 3ZDJA 1NY0A 1ES5A 2EX6A 1EROA 3C7VA 1K56A 4R3BA 4EWFA 1O7EA 3UDFA 1BSGA 1L0FA 4OP8A 2XFSA 2ZC5B 4MBFA 1IKIA 2HPBA 3C4PA 5F1GA 2WKIA 3VSLA 5DTKA 3MZEA 1XP4A 3NIAA 4MLLA 3N7WA 1MWRA 3BFGA 4MBKA 5DF8A 5GLAA 3SS5A 4KG2A 5AQ7A 5DTTA 1H8ZA 3W4QA 4E6WA 1FCMA 3OCNA 2Y2JA 1GA0A 4S2OA 1PZPA 5F83A 4PM7A 5A92A 3IWIA 2JC7A 3CZDA 4ZTKA 4WELA 4E3IA 3HL9A 3V39A 2A3UA 5L2FA 5IHVA 2HDQA 1LHYA 4IBRA 1K57C 4FH2A 5DTSA 1KGEA 1QMEA 2PU2A 4KZ4A 5FQIA 4JXGA 5CHMA 3UE0A 1QMFA 4GDNA 4LCLA 2HP6A 3WWXA 4KZ7A 3RXXA 4B4XA 3G32A 5EOEA 1E4DA 1W8QA 1L2SA 2XEPA 4GOGA 5AQBA 4E3LA 2J8YA 5GLDA 5FSRA 1PW1A 4ZAMA 3DWKA 4WEKA 3S22A 4LV3A 1NYYA 1OMEA 3JYIA 3OZHA 4BENA 3VOYA 2WGWB 3IWOA 4JF4A 4XXRA 4BJPA 5CRFA 4WZ5C 4EV4A 1HVBA 5HL1A 1JVJA 1MWTA 2ZM8A 4OONA 3O88A 1IELA 5FQKA 5G18A 2WADA 3P98A 3RXWA 1LL5A 2Y91A 3MXRA 5M1AA 4DDYA 4PM6A 1BLCA 5FQMA 1BLHA 1H5XA 3VMAA 1E3UA 4YFMA 2OSUA 3N8SA 2XDMA 3NI9A 3E2KA 4DKIA 2Y2PA 4KZ3A 4E3OA 5J8XA 1XGJA 4N1XA 3HLFA 4P87A 2ZQ8A 4RX3A 2EFUA 4ID4A 2XR0A 1ZG4A 4R1GA 3IF6C 1S0WA 2ZC4B 4KZBA 3BFEA 4FSFA 3SH9A 5EVIB 1FR6A 3VP3A 1SKFA 5E43A 1K55A 5JYOA 4WZ5A 5M19A 2EXAA 5FAQA 3TG9A 1N9BA 3SH8A 2PBYA 3V50A 2HDSA 2XFTA 4HBTA 3UE1A 4D2OA 2XK1A 1ONHA 4K0WA 2QPNA 1LI0A 4EQIA 5GHZA 3N8RA 5DF9A 2WK0A 2PU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EQV A;  1TDG A;  4ZJ1 A;  4OLD A;  3VP4 A;  4LV1 A;  3WS2 A;  4OQI A;  5EE8 A;  3A3D A;  1WYC A;  4IVK A;  1IYO A;  3ZG9 B;  3ZFZ A;  4BL2 A;  3NBL A;  3ZNT A;  3E2L A;  3I7J A;  4FH4 A;  4LV2 A;  3MBZ A;  1GHM A;  4MEZ A;  1PW8 A;  2EX2 A;  4QY5 A;  4XUZ A;  4GD6 A;  3ZHH A;  5E2H A;  1IEM A;  1DY6 A;  1PYY A;  3Q7Z A;  5E2F A;  2X02 A;  2EX8 A;  3WS1 A;  5CGX A;  2EXB A;  3ITB A;  4LCM A;  4Z9Q A;  2R9X A;  3M2J A;  4R4R A;  3GTC A;  3LY4 A;  4C75 A;  1PWG A;  2RL3 A;  1RGY A;  1O07 A;  3MKE A;  1ZG6 A;  3GQZ A;  3Q1F A;  1E3U D;  1IYS A;  1ESU A;  3GSG A;  3QNB A;  1TVF A;  3GR2 A;  3BRM A;  4MBH A;  4PM8 A;  1I2W A;  3ISG A;  3Q81 A;  4RA7 A;  4BL3 A;  3P09 A;  4GD8 A;  2ZQA A;  1K6S A;  2A49 A;  3HLG A;  4S2I A;  4UAA A;  2ZD8 A;  5A90 A;  1XX2 A;  2UWX A;  1ALQ A;  4NK3 A;  4X6T A;  3BFF A;  3OPP A;  4M3K A;  5CGW A;  2ZJ9 A;  3VOZ A;  5CEB A;  2J7V A;  2H10 A;  5CHJ A;  3VP2 A;  3NCK A;  3BM6 A;  4GNU A;  2ZQC A;  1KGF A;  1RP5 A;  3HLC A;  4HEF A;  4S2M A;  4WM9 A;  1GA9 A;  3HLB A;  4E3K A;  4OP5 A;  4S2N A;  3BFC A;  3TOI A;  4OOY A;  5EEC A;  2V2F F;  3GMW A;  4KEN B;  2E8I A;  4HES A;  4UA6 A;  1HTZ A;  3O3V A;  4DE3 A;  3VSK A;  2DCF A;  3IT9 A;  1PI4 A;  1FCO A;  5FQJ A;  2R9W A;  5GHX A;  3QHY A;  3ITA A;  2ZM0 A;  2Z2L B;  4UA7 A;  4Y0T A;  3GV9 A;  3B3X A;  4JXW A;  2WGI A;  4EBP A;  2EX9 A;  4OPY A;  1NYM A;  3FV7 A;  3ZG5 A;  5KZH A;  3AGD A;  3IH8 A;  2WKH A;  2IWD A;  4BLM A;  3W4O A;  1NXY A;  3IXG A;  1Q2Q A;  3M2K A;  1MKI A;  2P74 A;  3HLE A;  1HZO A;  1N4O A;  3G30 A;  3MFD A;  1XA7 A;  4UHU A;  3FYZ A;  4DRT A;  4X56 A;  3ZVW A;  1FQG A;  1YM1 A;  1Q2P A;  4IED A;  3ZNY A;  2J9O A;  2G2U A;  2JE5 A;  1IYQ A;  3OPR A;  4YIN A;  3IQA A;  1L0D A;  1K6R A;  1NJ4 A;  2QMI A;  5CXW A;  1K38 A;  3TSG A;  1PIO A;  4KZ5 A;  5AQA A;  1RGZ A;  1SDN A;  2V1Z A;  2DNS A;  3HUN A;  3HUO A;  3OC2 A;  4GZB A;  5FAP A;  1XGI A;  3BFD A;  5E2E A;  1XKZ A;  3M6B A;  1NZO A;  2XGN A;  4KZ9 A;  4R23 A;  4B88 A;  1I2S A;  4PMA A;  1DJA A;  1K4F A;  4U3T A;  3VFH A;  1J9M A;  5AQ9 A;  4MNR A;  1IYP A;  3IF6 A;  4WMC D;  2V20 A;  1BZA A;  2ZQD A;  2WUQ A;  4ZDX A;  2VGK A;  5M18 A;  1FCN A;  4NET A;  4GB7 A;  3UDX A;  4C6Y A;  4DF6 A;  1BUL A;  1WYB A;  2WGV A;  3A3E A;  4KZ6 A;  1CK3 A;  3DWZ A;  4S2J A;  2H0T A;  3IHB A;  3CG5 A;  1ES3 A;  5HX9 A;  3GVB A;  4KQR A;  1ZC2 A;  3M6H A;  3S1Y A;  3VFF A;  1YMX A;  1PZO A;  4QB8 A;  3O86 A;  3UN7 A;  1JWV A;  3LO7 A;  3PTE A;  4DXB A;  2ZLY A;  3HBR A;  1NZU A;  4K0X A;  1VQQ A;  4PPR A;  4Y7P A;  1JWP A;  1MWS A;  2HP9 A;  4RVA A;  4OKP A;  4S2P A;  3DTM A;  4X68 A;  1SCW A;  3SS4 A;  5GLB A;  2Z2M B;  2Y2I A;  4KG6 A;  2ZQ7 A;  1L0E A;  4DE0 A;  1YMS A;  3IHA A;  3GRJ A;  3WRZ A;  2H5S A;  3W4P A;  1TDL A;  1S6R A;  1VM1 A;  1CEF A;  3ZG7 B;  4LEN A;  1EWZ A;  2J9P A;  1GCE A;  4DXC A;  4BD1 A;  5GHY A;  4OQH A;  2G2W A;  1E25 A;  4OPR A;  2DRW A;  5HAI A;  4N9L A;  3NY4 A;  1YQS A;  4OQG A;  4Y0O A;  4JKT A;  5EVL A;  4JLF A;  3CJM A;  4EBL A;  3LEZ A;  5EVI A;  5HAR A;  4E3J A;  1K54 A;  2VGJ A;  1MWU A;  4PM5 A;  3FKW A;  5F1F A;  1XA1 A;  3V3R A;  5CEC A;  3Q82 A;  1W8Y A;  3ZG0 A;  2X01 A;  4DDS A;  3N4I A;  2EFX A;  4R0Q A;  5KSC A;  3IXD A;  3WS0 A;  3WS5 A;  1ES2 A;  3UNW A;  2Y59 A;  4GDB A;  1WE4 A;  3O87 A;  2XD1 A;  1MY8 A;  2P9V B;  3PBN A;  1ZKJ A;  2XLN A;  4E6X A;  1AXB A;  1CI8 A;  1H8Y A;  3G34 A;  4HBU A;  3IXH A;  4LV0 A;  5E2G A;  5EPH A;  1ESI A;  1RCJ A;  1FSY A;  3WRT A;  3OPL A;  3MZD A;  2WZX A;  4RX2 A;  5FAT A;  3SH7 A;  3PAG A;  3UDI A;  4A5R A;  3IXB A;  4QD4 A;  2Y2O A;  3NDE A;  1ES4 A;  5EOO A;  2Y55 A;  1K55 C;  4ZJ2 A;  1BTL A;  2CC1 A;  2ZC7 A;  4KZA A;  4K91 A;  2Y2Q A;  4S2N C;  3UPP A;  2HDR A;  4BQM A;  5FAO A;  3IWQ A;  1K54 C;  3RJU A;  3LY3 A;  5CTM A;  4L0L A;  3PBT A;  1DJB A;  1SHV A;  5FI6 A;  1M6K A;  3WS4 A;  1YLJ A;  3FKV A;  4QJG A;  3NC8 A;  3ZGA B;  3UO9 A;  1KE0 A;  5FI2 A;  4OLG A;  4EUZ A;  3W8K A;  4OPZ A;  2ZC6 B;  2C5W B;  2I72 A;  2GDN A;  2HP5 A;  2JBF A;  3D4F A;  1CI9 A;  2Y4A A;  5KMW A;  2Y2M A;  4QU3 A;  4EBN A;  1G6A A;  2IWC A;  4IVI A;  1KDW A;  4E3M A;  4OOL A;  2P9V A;  2WAE A;  3HRE A;  2WKE A;  1NRF A;  1YT4 A;  1KE3 A;  1W7F A;  1MXO A;  4WEJ A;  1TEM A;  1IKG A;  2H0Y A;  2ZQ9 A;  1EI5 A;  3IF6 B;  1HD8 A;  4X69 A;  4N1H A;  5GLC A;  1KE4 A;  3UE3 A;  3PBR A;  4FCF A;  3BLM A;  4DE2 A;  4S2L A;  4IBX A;  4PM9 A;  4X55 A;  3HLW A;  1KGG A;  5HAQ A;  1GHI A;  4DE1 A;  3BEC A;  1KDS A;  1ERQ A;  3PBQ A;  1PWC A;  3CMZ A;  3OCL A;  5U47 A;  2OLU A;  5A93 A;  3Q7V B;  1W5D A;  4KZ8 A;  3V5M A;  3IF5 A;  1LL9 A;  2JCH A;  5EVI D;  1G68 A;  3MKF A;  4JPM A;  4N92 A;  3S4X A;  5CED A;  2RCX A;  4JBF A;  2WGW A;  5FA7 A;  2Y2G A;  2FFY A;  5CGS A;  3FZC A;  4X53 A;  4GKU A;  1SDE A;  2OV5 A;  3SS3 A;  3V3S A;  3N8L A;  3G31 A;  4R4S A;  4E3N A;  3VP0 A;  5FAS A;  5KSH A;  3AGF A;  5HFO A;  4JF6 A;  4P0M A;  3AGE A;  5FDH A;  3BLS A;  2BG1 A;  4BD0 A;  1K25 A;  3BEB A;  1BT5 A;  4C3Q A;  2XF3 A;  2XQZ A;  4KQQ A;  4F94 A;  4N9K A;  1K4E A;  1DJC A;  1PWD A;  2ZMA A;  5BOH A;  2Y2L A;  4OH0 A;  3MXS A;  3OPH A;  4Q8I A;  3HUM A;  1BUE A;  3ZG8 B;  5FI7 A;  2Y2H A;  3IH9 A;  5HAP A;  1ERM A;  3DW0 A;  2OLV A;  5FQQ A;  3HLD A;  5I94 A;  3N6I A;  1K57 A;  2QZ6 A;  1KVM A;  3PBS A;  1M40 A;  2Q9N A;  4RYE A;  1JTG A;  4P85 A;  1BLS A;  3A3J A;  2HDU A;  3ZCZ A;  4OVD A;  4JXS A;  2ZC3 B;  4OPQ A;  3G2Z A;  4U0X A;  1XXM A;  3VP1 A;  4XUX A;  4CJN A;  1YLY A;  5HW3 A;  1Z6F A;  1I5Q A;  1KVL A;  1JWZ A;  5CTN A;  1L0G A;  4WMC A;  3UPN A;  1K56 D;  2Y2K A;  2WZZ A;  5DVA A;  1U60 A;  4JXV A;  5TFQ A;  2Y2N A;  3C4O A;  3EQU A;  5DF7 A;  5CHU A;  4P6B A;  3MZF A;  4OQ0 A;  4Y0U A;  3FWL A;  4S2K A;  3PBO A;  3ZVT A;  1MPL A;  3BYD A;  4JF5 A;  4ZBE A;  2IWB A;  2BLS A;  1MBL A;  1LLB A;  1W79 A;  1Y54 A;  3C5A A;  1YLT A;  3A3F A;  4QY6 A;  1FSW A;  4KG5 A;  1YLZ A;  5EUA A;  3HVF A;  1GHP A;  3G4P A;  1BLP A;  3NDG A;  1YLP A;  4U0T A;  5A91 A;  5CER A;  4CPK A;  4H8R A;  2WAF A;  1YLW A;  2XH9 A;  3Q7V A;  1CEG A;  2XD5 A;  4O7D A;  3G2Y A;  5FQ9 A;  4OOM A;  1C3B A;  1XPB A;  3G35 A;  2FFF B;  3LCE A;  3Q07 A;  1PI5 A;  2C6W B;  4GN2 A;  4WYY A;  1ONG A;  5D3O A;  2X71 A;  3UPO A;  3SOI A;  2B5R A;  3QNC A;  4UA9 A;  1FR1 A;  3C7U A;  4WZ4 A;  4FD8 A;  2ZM2 A;  2Q9M A;  4QHC A;  5EVI C;  1JTD A;  3A3I A;  4R3J A;  5GL9 A;  4B4Z A;  2WYX A;  4WBG A;  5TR7 A;  1FOF A;  5TGF A;  1LI9 A;  3PAE A;  3UY6 A;  5F82 A;  5JYP A;  4ZJ3 A;  4KQO A;  3ZDJ A;  1NY0 A;  1ES5 A;  2EX6 A;  1ERO A;  3C7V A;  1K56 A;  4R3B A;  4EWF A;  1O7E A;  3UDF A;  1BSG A;  1L0F A;  4OP8 A;  2XFS A;  2ZC5 B;  4MBF A;  1IKI A;  2HPB A;  3C4P A;  5F1G A;  2WKI A;  3VSL A;  5DTK A;  3MZE A;  1XP4 A;  3NIA A;  4MLL A;  3N7W A;  1MWR A;  3BFG A;  4MBK A;  5DF8 A;  5GLA A;  3SS5 A;  4KG2 A;  5AQ7 A;  5DTT A;  1H8Z A;  3W4Q A;  4E6W A;  1FCM A;  3OCN A;  2Y2J A;  1GA0 A;  4S2O A;  1PZP A;  5F83 A;  4PM7 A;  5A92 A;  3IWI A;  2JC7 A;  3CZD A;  4ZTK A;  4WEL A;  4E3I A;  3HL9 A;  3V39 A;  2A3U A;  5L2F A;  5IHV A;  2HDQ A;  1LHY A;  4IBR A;  1K57 C;  4FH2 A;  5DTS A;  1KGE A;  1QME A;  2PU2 A;  4KZ4 A;  5FQI A;  4JXG A;  5CHM A;  3UE0 A;  1QMF A;  4GDN A;  4LCL A;  2HP6 A;  3WWX A;  4KZ7 A;  3RXX A;  4B4X A;  3G32 A;  5EOE A;  1E4D A;  1W8Q A;  1L2S A;  2XEP A;  4GOG A;  5AQB A;  4E3L A;  2J8Y A;  5GLD A;  5FSR A;  1PW1 A;  4ZAM A;  3DWK A;  4WEK A;  3S22 A;  4LV3 A;  1NYY A;  1OME A;  3JYI A;  3OZH A;  4BEN A;  3VOY A;  2WGW B;  3IWO A;  4JF4 A;  4XXR A;  4BJP A;  5CRF A;  4WZ5 C;  4EV4 A;  1HVB A;  5HL1 A;  1JVJ A;  1MWT A;  2ZM8 A;  4OON A;  3O88 A;  1IEL A;  5FQK A;  5G18 A;  2WAD A;  3P98 A;  3RXW A;  1LL5 A;  2Y91 A;  3MXR A;  5M1A A;  4DDY A;  4PM6 A;  1BLC A;  5FQM A;  1BLH A;  1H5X A;  3VMA A;  1E3U A;  4YFM A;  2OSU A;  3N8S A;  2XDM A;  3NI9 A;  3E2K A;  4DKI A;  2Y2P A;  4KZ3 A;  4E3O A;  5J8X A;  1XGJ A;  4N1X A;  3HLF A;  4P87 A;  2ZQ8 A;  4RX3 A;  2EFU A;  4ID4 A;  2XR0 A;  1ZG4 A;  4R1G A;  3IF6 C;  1S0W A;  2ZC4 B;  4KZB A;  3BFE A;  4FSF A;  3SH9 A;  5EVI B;  1FR6 A;  3VP3 A;  1SKF A;  5E43 A;  1K55 A;  5JYO A;  4WZ5 A;  5M19 A;  2EXA A;  5FAQ A;  3TG9 A;  1N9B A;  3SH8 A;  2PBY A;  3V50 A;  2HDS A;  2XFT A;  4HBT A;  3UE1 A;  4D2O A;  2XK1 A;  1ONH A;  4K0W A;  2QPN A;  1LI0 A;  4EQI A;  5GHZ A;  3N8R A;  5DF9 A;  2WK0 A;  2PU4 A; 
#chains in the Genus database with same CATH topology
 3EGD C;  2V8C A;  2VEA A;  4OQI A;  4Y3I A;  5EE8 A;  1OJG A;  4IVK A;  1IYO A;  3ZG9 B;  3ZNT A;  3I7J A;  5HPI A;  2M7U A;  1PYY A;  2X02 A;  1MC0 A;  3LEQ A;  2R9X A;  1PWG A;  1O07 A;  1OT9 A;  1ZG6 A;  1NLY A;  3Q1F A;  3T4T A;  1I2W A;  1LSW A;  4BL3 A;  4BMW A;  2A49 A;  1TF1 A;  3U2A A;  4NK3 A;  1TS8 A;  1ALQ A;  5CEB A;  4M3K A;  2YKH A;  4GNU A;  2ZQC A;  1RP5 A;  3HLC A;  4IJG A;  1UWP X;  4S2N A;  4OOY A;  5EEC A;  4KEN B;  3CLO A;  1HTZ A;  5FQJ A;  5GHX A;  3QHY A;  3GEC A;  3ITA A;  2ZM0 A;  4ARZ B;  5C5K A;  1OTD A;  4OPY A;  3AGD A;  3LYX A;  2IWD A;  1MKI A;  4JGO A;  3G30 A;  3MFD A;  1XA7 A;  4DRT A;  1YM1 A;  2ZL1 A;  4MN7 A;  2J3T C;  1L0D A;  3TSG A;  1K38 A;  4NXB A;  3C30 A;  1RGZ A;  1SDN A;  3OC2 A;  1VEU A;  4PMA A;  2GX5 A;  1K4F A;  1IYP A;  4MDZ A;  2A24 A;  1OT6 A;  1KOU A;  4ZDX A;  2OWJ A;  1FCN A;  5FL3 A;  3FPW A;  4GB7 A;  2KLI A;  3A3E A;  3DWZ A;  2W3D A;  3IHB A;  3RH8 B;  1PZO A;  1JWV A;  3HBR A;  2PD8 A;  4OKP A;  3MXQ A;  1V9Z A;  2Z2M B;  2Y2I A;  4DE0 A;  3WRZ A;  1FIL A;  2J3T D;  1VM1 A;  4LEN A;  1EWZ A;  2J9P A;  1JNU A;  1DRM A;  5HAI A;  2BAS A;  4JKT A;  3CJM A;  2IA2 A;  1K54 A;  3H9W A;  1MWU A;  4X25 A;  2JHE A;  3Q82 A;  4DDS A;  2X01 A;  4R0Q A;  5HD3 A;  3WS0 A;  3LID A;  2PD7 A;  1T1C A;  2V8F A;  3GDI A;  4GHI B;  1SKO B;  3IXH A;  5E2G A;  1ESI A;  2PBD P;  3OPL A;  4Q0J A;  3H82 A;  3PAG A;  5J7E A;  3IBR A;  1K55 C;  1BTL A;  2CC1 A;  2ZC7 A;  2H28 A;  2HDR A;  2QHK A;  3LIB A;  3ZYT A;  2INW A;  5CTM A;  4NKP A;  4D60 A;  2P04 A;  3LR4 A;  1KE0 A;  4EUZ A;  2VV8 A;  2GDN A;  4Y15 A;  1X0O A;  1CI9 A;  1G6A A;  4IVI A;  2VV6 A;  4OOL A;  2WAE A;  2WKE A;  5EFW A;  2P7J A;  1NRF A;  1MXO A;  2B18 A;  4NXE A;  2V9A A;  4ETX A;  4IBX A;  1GHI A;  4DE1 A;  3BEC A;  2PYR A;  4CQH A;  5A93 A;  3SZT A;  3V5M A;  4G3V A;  3MKF A;  4JPM A;  4JBF A;  4G3W A;  5AVF A;  3QP1 A;  4GS9 B;  3SS3 A;  1CF0 A;  3N8L A;  1VEU B;  3E98 A;  4P0M A;  2VZW A;  4HJ4 A;  1K25 A;  1BT5 A;  1XJ6 A;  4C3Q A;  3KX0 X;  1K4E A;  1DJC A;  1PWD A;  4WN5 A;  1BUE A;  3IH9 A;  1N9L A;  5HAP A;  2OLV A;  5FQQ A;  5I94 A;  3UE6 A;  1M40 A;  4JXS A;  2ZC3 B;  2XA7 S;  4OPQ A;  2VA0 A;  4XUX A;  2EWW A;  2ZOH A;  1GSX A;  3F1O A;  2Y2K A;  5DVA A;  5DF7 A;  1DP8 A;  4PKY G;  1VB6 A;  4P6B A;  1MPL A;  4JF5 A;  3C5A A;  4KG5 A;  1GHP A;  1BLP A;  5CER A;  4CPK A;  2W3H A;  2WAF A;  2XH9 A;  3Q7V A;  3NEC A;  2XD5 A;  5MC7 A;  2PHY A;  5FQ9 A;  4OOM A;  3Q07 A;  4GN2 A;  1PI5 A;  2JKF A;  3KO6 A;  3C7U A;  3T4Q A;  4WZ4 A;  4FD8 A;  1JTD A;  5TGF A;  3UY6 A;  5JYP A;  5IS1 A;  2EX6 A;  1YPR A;  3MF0 A;  4R3B A;  4EWF A;  3F1P A;  4OP8 A;  4YOF A;  2WKP A;  3VSL A;  4LRZ E;  1PNE A;  1DP9 A;  3KYZ A;  3N7W A;  1H8Z A;  3OCN A;  1GA0 A;  5F83 A;  4PM7 A;  3IWI A;  3F1N B;  3DTK A;  3U4L P;  4E3I A;  2VK3 A;  3V39 A;  2A3U A;  1HLU P;  1OPX A;  5DFY A;  5DTS A;  2PU2 A;  5FQI A;  3WWX A;  3RXX A;  1E4D A;  1W8Q A;  3CHW P;  4EQ1 A;  4E3L A;  3MQQ A;  2J8Y A;  2VKS A;  1F98 A;  4BWI A;  4XXR A;  3DAV A;  1P9W A;  3LFV A;  1HVB A;  1MWT A;  3L7H A;  1IEL A;  5G18 A;  2WAD A;  1LL5 A;  5EVE A;  3R7W A;  1H5X A;  3RTY A;  1E3U A;  3NI9 A;  2W27 A;  4L9G A;  2ZMF A;  4MCW A;  3HLF A;  4P87 A;  4Y13 A;  4Q0H A;  1ZG4 A;  4R1G A;  4KZB A;  4FSF A;  1FR6 A;  3TG9 A;  1GSV A;  4EUV A;  2HDS A;  4HBT A;  2J3W A;  3N8R A;  1ERO A;  3OOV A;  5HWW A;  4F3L B;  1TDG A;  4ZJ1 A;  4OLD A;  3CAX A;  4P6Z S;  3WS2 A;  4QWO A;  3A3D A;  3ZFZ A;  4BL2 A;  3NBL A;  3E2L A;  4JGR A;  4LV2 A;  3MBZ A;  4MEZ A;  1PW8 A;  2EX2 A;  4XUZ A;  3ZHH A;  4GD6 A;  3UMD A;  3MFX A;  4BBT A;  3VE3 A;  4XT2 A;  5CGX A;  2W1R A;  3ITB A;  1NRJ A;  4R4R A;  3LY4 A;  4I3J A;  4DJ2 A;  3QNB A;  1IYS A;  1TVF A;  1VET A;  4MBH A;  4PM8 A;  4RA7 A;  2ZMV A;  2ZQA A;  3HLG A;  1XX2 A;  1OTB A;  3A0R A;  4X6T A;  2O0Y A;  2PR6 A;  2ZJ9 A;  3LR5 A;  3VOZ A;  3NCK A;  3BM6 A;  2KDK A;  1KGF A;  4S2M A;  4WM9 A;  4E3K A;  5AVE A;  5HPF A;  4UA6 A;  3O3V A;  4DE3 A;  3VSK A;  2DCF A;  3IT9 A;  1FCO A;  2MJ6 A;  2WKR A;  2R9W A;  1YAX A;  4IUK A;  2Z2L B;  1TS0 A;  4Y17 A;  3B3X A;  1OTI A;  1D7E A;  2EX9 A;  3D9Y A;  4O01 A;  1NYM A;  5KZH A;  3IH8 A;  2WKH A;  2OAQ 1;  3W4O A;  1Q2Q A;  2P74 A;  1CJF A;  3FYZ A;  5HSQ A;  4EXO A;  1Q2P A;  4IED A;  4EU0 A;  3OLO A;  1ZHH B;  5G4Z A;  2Z6D A;  3IQA A;  1ZTU A;  1H8M A;  5CXW A;  2V1B A;  1PIO A;  4KZ5 A;  5AQA A;  4LRX C;  5DKL A;  1NZO A;  2XGN A;  3E0Y A;  1I2S A;  4U3T A;  1D1J A;  2V0W A;  3MJQ A;  3LIC A;  2WUQ A;  2VGK A;  1ACF A;  1IFQ A;  4NET A;  3UDX A;  4C6Y A;  4DF6 A;  1BUL A;  1WYB A;  4KZ6 A;  4S2J A;  2H0T A;  3CG5 A;  5TBM B;  1ES3 A;  3VFF A;  1YMX A;  2HZ5 A;  3UN7 A;  3LO7 A;  4GLQ A;  4X1M A;  5F69 A;  3P7N A;  5HZH A;  1MWS A;  2HP9 A;  1LSX A;  4KG6 A;  1BYW A;  2ZQ7 A;  3BQ8 A;  2G2W A;  1E25 A;  4N9L A;  3NY4 A;  1YQS A;  4B93 A;  2O9C A;  4JLF A;  4EBL A;  3LEZ A;  4LLO B;  5EVI A;  5AJG A;  4PM5 A;  1XA1 A;  3TJZ C;  1W8Y A;  1G6O A;  2EFX A;  2JKR I;  1WE4 A;  3O87 A;  2XD1 A;  1MY8 A;  1T1A A;  1TD5 A;  3PBN A;  4E6X A;  3G34 A;  5EPH A;  1FSY A;  4Y5F A;  3UDI A;  3SH7 A;  4A5R A;  1ES4 A;  4G3K A;  1F2K A;  5FDS A;  4ZJ2 A;  2K31 A;  3UPP A;  4BQM A;  5A8B A;  1YSP A;  5FAO A;  2ACG A;  1CQA A;  2HGV A;  1DJB A;  3IX3 A;  3WS4 A;  1YLJ A;  3FKV A;  3NC8 A;  3ZGA B;  3MSH A;  3UO9 A;  5FI2 A;  4OLG A;  2ZC6 B;  3T1X A;  2HP5 A;  2JBF A;  2GJ3 A;  1LT0 A;  4II7 A;  1KDW A;  4E3M A;  2P9V A;  1YSQ A;  3CPT A;  1IKG A;  3NJA A;  1P0Z A;  1EI5 A;  1HD8 A;  2XRN A;  4X69 A;  5G4Y A;  5GLC A;  3UME A;  2BTF P;  1W63 M;  4FCF A;  2V0U A;  4S2L A;  4PM9 A;  4X55 A;  1KGG A;  4GJ4 A;  3UB7 A;  1KDS A;  2VGL M;  3OCL A;  5U47 A;  5F5Y A;  2OLU A;  3OBF A;  1W5D A;  4HP9 A;  3IF5 A;  3FC7 A;  2JCH A;  3KSI A;  1Z09 A;  4KQD A;  4N92 A;  2WGW A;  4GHI A;  4R4S A;  4I5S A;  5FAS A;  3AGF A;  2VLG A;  4I39 A;  4BD0 A;  3UB6 A;  4EET B;  3LR0 A;  4N9K A;  5BOH A;  4Q8I A;  3MXS A;  3OPH A;  5DJU A;  3HUM A;  3ZG8 B;  2GNX A;  1ERM A;  3HLD A;  1YKD A;  3N6I A;  3T12 B;  4O0P A;  1K57 A;  3PBS A;  1JTG A;  1BLS A;  3UB8 A;  1TS7 A;  4DN0 A;  4CJN A;  2FH5 A;  5HW3 A;  1L0G A;  4WMC A;  1K56 D;  3VV4 A;  4XT2 B;  2QKP A;  1MKM A;  3ICY A;  4MN5 A;  5FEG A;  3MZF A;  4Y0U A;  3G6O A;  1G5U A;  3FWL A;  4S2K A;  4Q0I A;  4EES A;  1MBL A;  1LLB A;  1W79 A;  1YLT A;  1FSW A;  1YLZ A;  5EUA A;  3NDG A;  1YLP A;  5A91 A;  1K0K A;  1YLW A;  4NEE D;  5FEF A;  3ULF A;  5HD5 A;  2D02 A;  3G35 A;  2FFF B;  2B5R A;  2W0N A;  4UA9 A;  5EVI C;  4HJ6 A;  3A3I A;  4R3J A;  2WYX A;  3H82 B;  4QPR A;  5L10 A;  5TR7 A;  1LL8 A;  1LI9 A;  3PAE A;  4ZJ3 A;  4KQO A;  3EEA A;  1NY0 A;  3C7V A;  3RFB A;  1P97 A;  2XFS A;  4MBF A;  3EGX C;  2WKI A;  5DTK A;  3MZE A;  1XP4 A;  3EWK A;  1MWR A;  3SS5 A;  5IT5 A;  2PYP A;  5DTT A;  3L9K A;  3IBJ A;  3BY8 A;  2ZBB A;  3BW6 A;  2Y2J A;  2FZ0 A;  5A92 A;  4ZRR A;  4GCZ A;  3HL9 A;  2HDQ A;  3IS2 B;  1LHY A;  4L9E A;  2VV7 A;  5CHM A;  4GW9 A;  2PT7 A;  2HP6 A;  2ZOI A;  4B4X A;  3G32 A;  4CLC B;  3LIE A;  4HIA A;  5DKK A;  5AQB A;  5GLD A;  1PW1 A;  3A0V A;  4ZAM A;  4RQ9 A;  1NYY A;  3JYI A;  2WGW B;  1H3Q A;  3IWO A;  4JF4 A;  5CRF A;  4WZ5 C;  2D01 A;  4OON A;  5FQK A;  3RXW A;  3O88 A;  1SKO A;  4HY8 A;  4PAU A;  3P98 A;  2Y91 A;  4DDY A;  2R78 A;  3VMA A;  3BWL A;  2XDM A;  3UB9 A;  2Y79 A;  4KZ3 A;  5J8X A;  4N1X A;  5EV0 A;  4RX3 A;  2EFU A;  4ID4 A;  2XR0 A;  4LGW A;  3IF6 C;  3BFE A;  3KYQ A;  3NOT C;  5EVI B;  3VP3 A;  4JGP A;  1SKF A;  1K55 A;  2GZA A;  2EXA A;  3V50 A;  1W63 Q;  2XK1 A;  2HJ9 C;  5GHZ A;  5DF9 A;  3EQV A;  5HDC A;  3VP4 A;  1AWI A;  3W2Z A;  3LR3 A;  3BY9 A;  1EW0 A;  2P08 A;  4QY5 A;  5E2H A;  5IU1 A;  2L1M A;  1DY6 A;  3Q7Z A;  3WS1 A;  3D3O A;  4LCM A;  1RGY A;  2OWH A;  1ESU A;  2XSS A;  3GSG A;  4UEY A;  3BRM A;  3Q81 A;  3P09 A;  2QJ5 A;  4UAA A;  2ZD8 A;  3BFF A;  5CGW A;  2J7V A;  5CHJ A;  3TE8 A;  2KX6 A;  1S66 L;  4HEF A;  5HL6 A;  3MMH A;  4OP5 A;  3BFC A;  2V2F F;  3GMW A;  3T4S A;  2E8I A;  4IUH A;  3S7N A;  3PYP A;  2V1A A;  4EEP A;  2G7U A;  4B9O A;  4JXW A;  2WGI A;  4EBP A;  1XJ4 A;  3ZG5 A;  3CI6 A;  4BLM A;  3M2K A;  3HLE A;  1XJ2 A;  5HDS A;  3ZVW A;  1FQG A;  3S7P A;  3ZNY A;  3K3C A;  3JVU A;  1IYQ A;  3OPR A;  4YIN A;  1K6R A;  5HWT A;  1UGU A;  2VGL S;  2V1Z A;  2DNS A;  3UB5 P;  3VOL A;  5FAP A;  1XGI A;  3BFD A;  1XKZ A;  4CLC E;  4R23 A;  4KZ9 A;  4B88 A;  1DJA A;  1UWN X;  1VET B;  3HCY A;  5AQ9 A;  4MNR A;  5M18 A;  1G28 A;  3S7Q A;  2WGV A;  5HX9 A;  3GVB A;  4ESP A;  3O86 A;  3PTE A;  3KSG A;  4K0X A;  4PPR A;  4Y7P A;  3T4L A;  2Y8H A;  3T1R A;  4S2P A;  3DTM A;  1SCW A;  2B95 A;  2M7V A;  3SS4 A;  5GLB A;  3DBA A;  2Q0O A;  1S6R A;  4I3A A;  1CEF A;  3ZG7 B;  4O8G A;  1GCE A;  4DXC A;  4OQH A;  4OPR A;  2DRW A;  4OQG A;  4Y0O A;  3ZQ5 A;  4E3J A;  3NHQ A;  3FKW A;  5CEC A;  3N4I A;  3SW1 A;  3IXD A;  1ES2 A;  2Y59 A;  2P9V B;  3CPT B;  1ZKJ A;  2XLN A;  1CI8 A;  4R6L A;  4HBU A;  3PXP A;  1RCJ A;  3WRT A;  2UV0 E;  3MZD A;  2WZX A;  4RX2 A;  5FAT A;  3CWF A;  1A0K A;  3IXB A;  2Y2O A;  3NDE A;  4KZA A;  1LSV A;  3C2W A;  1K54 C;  3E4O A;  4P6Z M;  4R70 A;  4ME4 A;  3K3D A;  5I5L A;  1SHV A;  4KUK A;  1M6K A;  4QJG A;  2E8J A;  3W8K A;  4DJ3 A;  2C5W B;  2I72 A;  3D4F A;  3D72 A;  3NOU C;  2Y4A A;  4QU3 A;  4EBN A;  2IWC A;  1YT4 A;  1KE3 A;  1DP6 A;  4UQI S;  4WEJ A;  1TEM A;  4LFU A;  4N1H A;  1S1Z A;  3UE3 A;  4LPZ A;  3C38 A;  1D06 A;  4PKY A;  3HLW A;  5HAQ A;  1PWC A;  1L3L A;  3Q7V B;  4PHT A;  1LL9 A;  3HJK A;  3S4X A;  1P9R A;  5FA7 A;  4HJ3 A;  4IHQ A;  4X53 A;  5LBR A;  1SDE A;  2OV5 A;  4E3N A;  5KSH A;  2PDR A;  5F6A A;  4JF6 A;  3AGE A;  2LB9 A;  4F94 A;  4HQA A;  2ZMA A;  2Y2L A;  2JKR M;  2WKQ A;  2Y2H A;  5TBM A;  4RYE A;  4P85 A;  3PHY A;  3A3J A;  4HH3 A;  3ZCZ A;  4OVD A;  2QJ7 A;  3DTI A;  3G2Z A;  4U0X A;  3KSF A;  1Z6F A;  1I5Q A;  1JWZ A;  3QP6 A;  5CTN A;  1Y28 A;  4NXF A;  4K08 A;  2WZZ A;  4BBV A;  4JXV A;  4MN6 A;  2Y2N A;  3C4O A;  3NUL A;  3MR0 A;  3PBO A;  3BYD A;  1Y54 A;  3HVF A;  3G4P A;  4I3I A;  4H8R A;  1S4R A;  3S7O A;  4O7D A;  3LGO A;  3LCE A;  3UPO A;  4WYY A;  2X71 A;  3QNC A;  1FR1 A;  2ZM2 A;  2Q9M A;  5J4E A;  4B4Z A;  4BBU A;  5F82 A;  5EM0 A;  2I9V A;  1ES5 A;  3T1S A;  1K56 A;  2A24 B;  3UDF A;  1BSG A;  1L0F A;  2ZC5 B;  5L8M A;  1IKI A;  3C4P A;  5F1G A;  3MQO A;  4YWZ A;  4MLL A;  1XFN A;  3BFG A;  4MBK A;  4KG2 A;  3W4Q A;  3A0S A;  1FCM A;  4HP4 A;  4S2O A;  1PZP A;  4JGQ A;  2JC7 A;  3CZD A;  4WEL A;  5TJJ A;  5L2F A;  5IHV A;  4IBR A;  1K57 C;  4FH2 A;  3LIF A;  1QMF A;  4GDN A;  2J80 A;  3LIA A;  1L2S A;  2XEP A;  1STZ A;  2VX8 A;  3DWK A;  3VOY A;  3E4P A;  2EA9 A;  4ARZ A;  1JVJ A;  5M1A A;  1OTE A;  2O9A A;  5EM1 A;  2M1C A;  1BLH A;  2NUT C;  4FTX A;  2OSU A;  2VJW A;  3N8S A;  4L9F A;  3E2K A;  2ZL1 B;  1F5M A;  4E3O A;  4WUJ A;  3QP4 A;  2ZQ8 A;  2A2L A;  3T50 A;  1S0W A;  2W3E A;  3SH9 A;  4EER A;  1WA9 A;  5JYO A;  5M19 A;  2PBY A;  2XFT A;  4UQI M;  3VE4 A;  4I38 A;  3UE1 A;  1ONH A;  2QPN A;  1LI0 A;  4EQI A;  4R3A A;  2PU4 A;  1T19 A;  2Z6C A;  4LV1 A;  3EEH A;  3F1P B;  1WYC A;  3QP5 A;  3MQ0 A;  3QP8 A;  4FH4 A;  4ETZ A;  1GHM A;  4X1L A;  2PAV P;  1IEM A;  2L0W A;  1F9I A;  5E2F A;  2EX8 A;  3B47 A;  2EXB A;  4Z9Q A;  3DTE A;  3M2J A;  3GTC A;  4C75 A;  2RL3 A;  3MKE A;  3GQZ A;  1E3U D;  2PRF A;  2YKF A;  3GR2 A;  3P01 A;  3ISG A;  4GD8 A;  1K6S A;  1PFL A;  4WF0 A;  4S2I A;  5A90 A;  2UWX A;  3OPP A;  3VP2 A;  2H10 A;  2JKG A;  3R4K A;  4Z1W A;  1GA9 A;  3HLB A;  4AFI A;  3TOI A;  4KUO A;  3T4K A;  4HES A;  1PI4 A;  3T4J A;  4UA7 A;  4Y0T A;  3GV9 A;  4LRY C;  1TS6 A;  4FOF A;  3FV7 A;  1NXY A;  3IXG A;  4NG2 A;  3QP2 A;  3IX4 A;  1HZO A;  1N4O A;  4UHU A;  2W1T A;  4X56 A;  1ODV A;  2XRO A;  5J3W A;  2J9O A;  2G2U A;  2JE5 A;  4H6J B;  1NJ4 A;  1V9Y A;  2QMI A;  2XA7 M;  3HUN A;  2DMW A;  3HUO A;  4GZB A;  5E2E A;  3M6B A;  2QYB A;  3LI9 A;  3VFH A;  1J9M A;  3IF6 A;  2JKT I;  4WMC D;  1T1B A;  2V20 A;  1BZA A;  2ZQD A;  1CK3 A;  4KQR A;  1ZC2 A;  3M6H A;  3S1Y A;  4QB8 A;  4DXB A;  2ZLY A;  1NZU A;  4R38 A;  1VQQ A;  1JWP A;  4RVA A;  3C8C A;  1IOU A;  4X68 A;  2OAP 1;  1PRQ A;  1GSW A;  1L0E A;  1YMS A;  3IHA A;  3GRJ A;  2H5S A;  2OOL A;  3W4P A;  1TDL A;  4EW7 A;  2K7S A;  4BD1 A;  5GHY A;  1S67 L;  2O99 A;  5EVL A;  5HAR A;  2VGJ A;  5F1F A;  2EWV A;  3V3R A;  3ZG0 A;  5KSC A;  3WS5 A;  3PR6 A;  3UNW A;  4CLC A;  4GDB A;  4F3L A;  1AXB A;  1H8Y A;  4GS9 A;  4LV0 A;  5HDD A;  3TW8 A;  4QD4 A;  5EOO A;  2Y55 A;  4S2N C;  1S1Y A;  4K91 A;  2Y2Q A;  2AVX A;  3E4Q A;  3IWQ A;  5L07 A;  3RJU A;  3B42 A;  4FUW A;  3LY3 A;  1FIK A;  3PBT A;  4L0L A;  3CIT A;  5FI6 A;  3NOP C;  4WLA A;  3O5Y A;  4OPZ A;  5KIZ A;  1H0M A;  4HOI A;  3FPV A;  5KMW A;  2Y2M A;  1N9N A;  3HRE A;  1W7F A;  1XJ3 A;  2H0Y A;  2ZQ9 A;  3IF6 B;  1KE4 A;  3PBR A;  3BLM A;  4DE2 A;  3PBQ A;  1ERQ A;  5L09 A;  3CMZ A;  3JPU A;  2HF6 A;  4H6J A;  1J3W A;  4KZ8 A;  5EVI D;  1G68 A;  5CED A;  2RCX A;  2Y2G A;  2FFY A;  5CGS A;  3FZC A;  4GKU A;  3F1N A;  1Y4O A;  3V3S A;  3G31 A;  4HNB A;  3VP0 A;  2PR5 A;  5HFO A;  5FDH A;  3BLS A;  2BG1 A;  2W3F A;  3BEB A;  2XF3 A;  1OTA A;  2QWS A;  2XQZ A;  4KQQ A;  4OH0 A;  5FI7 A;  3IX8 A;  3DW0 A;  2QZ6 A;  1NLZ A;  1KVM A;  3BJN A;  1OJ5 A;  2Q9N A;  3H7W A;  2HDU A;  1XXM A;  4CLC D;  3VP1 A;  1YLY A;  1NWZ A;  2B02 A;  5F68 A;  1KVL A;  4EEU A;  3UPN A;  1U60 A;  5TFQ A;  5HWV A;  3EQU A;  2KOI A;  3IS2 A;  2HJE A;  5CHU A;  4OQ0 A;  3ZVT A;  4ZBE A;  2IWB A;  2BLS A;  3A3F A;  4QY6 A;  4WL9 A;  5DJT A;  4U0T A;  1CEG A;  2LB5 A;  3G2Y A;  1C3B A;  1XPB A;  5CX7 A;  2C6W B;  5D3O A;  1ONG A;  3LUQ A;  3SOI A;  5GL9 A;  4QHC A;  4WBG A;  3V67 A;  1FOF A;  1MZU A;  2L4R A;  3ZDJ A;  4CLC C;  3T1Q B;  2K2N A;  1O7E A;  3F1O B;  4MMN A;  2HPB A;  3NIA A;  2JN7 A;  1S4S A;  5GLA A;  5DF8 A;  2W1T B;  3T4O A;  2W3G A;  5AQ7 A;  4E6W A;  2JKT M;  2NUP C;  4Y2F A;  4ZTK A;  3K2N A;  3CUE A;  1KGE A;  1QME A;  3CUE C;  4KZ4 A;  2O9B A;  4JXG A;  3UE0 A;  4HH2 A;  4LCL A;  4KZ7 A;  3JVV A;  5EOE A;  4M4X A;  4GOG A;  5FSR A;  3EOI A;  4WEK A;  3S22 A;  2HV1 A;  4LV3 A;  1OME A;  3OZH A;  3H7W B;  4BEN A;  1T18 A;  4BJP A;  1SZV A;  2CMN A;  4EV4 A;  5HL1 A;  3R7W B;  2ZM8 A;  4NXG A;  3MXR A;  3TRC A;  4PM6 A;  3BQA A;  1BLC A;  5FQM A;  4YNR A;  4YFM A;  3B33 A;  3LI8 A;  4DKI A;  2Y2P A;  5K5B A;  1XGJ A;  3HJI A;  4E04 A;  3FG8 A;  2ZC4 B;  4DMZ A;  3KSH A;  4HI4 A;  5E43 A;  1XFQ A;  1VHM A;  4WZ5 A;  5FAQ A;  1N9B A;  3MS6 A;  4HHD A;  3SH8 A;  5DFX A;  1N9O A;  3KYE A;  4D2O A;  4K0W A;  2WK0 A; 
#chains in the Genus database with same CATH homology
 3EQV A;  1TDG A;  4ZJ1 A;  4OLD A;  3VP4 A;  4LV1 A;  3WS2 A;  4OQI A;  5EE8 A;  3A3D A;  1WYC A;  4IVK A;  1IYO A;  3ZG9 B;  3ZFZ A;  4BL2 A;  3NBL A;  3ZNT A;  3E2L A;  3I7J A;  4FH4 A;  4LV2 A;  3MBZ A;  1GHM A;  4MEZ A;  1PW8 A;  2EX2 A;  4QY5 A;  4XUZ A;  4GD6 A;  3ZHH A;  5E2H A;  1IEM A;  1DY6 A;  1PYY A;  3Q7Z A;  5E2F A;  2X02 A;  2EX8 A;  3WS1 A;  5CGX A;  2EXB A;  3ITB A;  4LCM A;  4Z9Q A;  2R9X A;  3M2J A;  4R4R A;  3GTC A;  3LY4 A;  4C75 A;  1PWG A;  2RL3 A;  1RGY A;  1O07 A;  3MKE A;  1ZG6 A;  3GQZ A;  3Q1F A;  1E3U D;  1IYS A;  1ESU A;  3GSG A;  3QNB A;  1TVF A;  3GR2 A;  3BRM A;  4MBH A;  4PM8 A;  1I2W A;  3ISG A;  3Q81 A;  4RA7 A;  4BL3 A;  3P09 A;  4GD8 A;  2ZQA A;  1K6S A;  2A49 A;  3HLG A;  4S2I A;  4UAA A;  2ZD8 A;  5A90 A;  1XX2 A;  2UWX A;  1ALQ A;  4NK3 A;  4X6T A;  3BFF A;  3OPP A;  4M3K A;  5CGW A;  2ZJ9 A;  3VOZ A;  5CEB A;  2J7V A;  2H10 A;  5CHJ A;  3VP2 A;  3NCK A;  3BM6 A;  4GNU A;  2ZQC A;  1KGF A;  1RP5 A;  3HLC A;  4HEF A;  4S2M A;  4WM9 A;  1GA9 A;  3HLB A;  4E3K A;  4OP5 A;  4S2N A;  3BFC A;  3TOI A;  4OOY A;  5EEC A;  2V2F F;  3GMW A;  4KEN B;  2E8I A;  4HES A;  4UA6 A;  1HTZ A;  3O3V A;  4DE3 A;  3VSK A;  2DCF A;  3IT9 A;  1PI4 A;  1FCO A;  5FQJ A;  2R9W A;  5GHX A;  3QHY A;  3ITA A;  2ZM0 A;  2Z2L B;  4UA7 A;  4Y0T A;  3GV9 A;  3B3X A;  4JXW A;  2WGI A;  4EBP A;  2EX9 A;  4OPY A;  1NYM A;  3FV7 A;  3ZG5 A;  5KZH A;  3AGD A;  3IH8 A;  2WKH A;  2IWD A;  4BLM A;  3W4O A;  1NXY A;  3IXG A;  1Q2Q A;  3M2K A;  1MKI A;  2P74 A;  3HLE A;  1HZO A;  1N4O A;  3G30 A;  3MFD A;  1XA7 A;  4UHU A;  3FYZ A;  4DRT A;  4X56 A;  3ZVW A;  1FQG A;  1YM1 A;  1Q2P A;  4IED A;  3ZNY A;  2J9O A;  2G2U A;  2JE5 A;  1IYQ A;  3OPR A;  4YIN A;  3IQA A;  1L0D A;  1K6R A;  1NJ4 A;  2QMI A;  5CXW A;  1K38 A;  3TSG A;  1PIO A;  4KZ5 A;  5AQA A;  1RGZ A;  1SDN A;  2V1Z A;  2DNS A;  3HUN A;  3HUO A;  3OC2 A;  4GZB A;  5FAP A;  1XGI A;  3BFD A;  5E2E A;  1XKZ A;  3M6B A;  1NZO A;  2XGN A;  4KZ9 A;  4R23 A;  4B88 A;  1I2S A;  4PMA A;  1DJA A;  1K4F A;  4U3T A;  3VFH A;  1J9M A;  5AQ9 A;  4MNR A;  1IYP A;  3IF6 A;  4WMC D;  2V20 A;  1BZA A;  2ZQD A;  2WUQ A;  4ZDX A;  2VGK A;  5M18 A;  1FCN A;  4NET A;  4GB7 A;  3UDX A;  4C6Y A;  4DF6 A;  1BUL A;  1WYB A;  2WGV A;  3A3E A;  4KZ6 A;  1CK3 A;  3DWZ A;  4S2J A;  2H0T A;  3IHB A;  3CG5 A;  1ES3 A;  5HX9 A;  3GVB A;  4KQR A;  1ZC2 A;  3M6H A;  3S1Y A;  3VFF A;  1YMX A;  1PZO A;  4QB8 A;  3O86 A;  3UN7 A;  1JWV A;  3LO7 A;  3PTE A;  4DXB A;  2ZLY A;  3HBR A;  1NZU A;  4K0X A;  1VQQ A;  4PPR A;  4Y7P A;  1JWP A;  1MWS A;  2HP9 A;  4RVA A;  4OKP A;  4S2P A;  3DTM A;  4X68 A;  1SCW A;  3SS4 A;  5GLB A;  2Z2M B;  2Y2I A;  4KG6 A;  2ZQ7 A;  1L0E A;  4DE0 A;  1YMS A;  3IHA A;  3GRJ A;  3WRZ A;  2H5S A;  3W4P A;  1TDL A;  1S6R A;  1VM1 A;  1CEF A;  3ZG7 B;  4LEN A;  1EWZ A;  2J9P A;  1GCE A;  4DXC A;  4BD1 A;  5GHY A;  4OQH A;  2G2W A;  1E25 A;  4OPR A;  2DRW A;  5HAI A;  4N9L A;  3NY4 A;  1YQS A;  4OQG A;  4Y0O A;  4JKT A;  5EVL A;  4JLF A;  3CJM A;  4EBL A;  3LEZ A;  5EVI A;  5HAR A;  4E3J A;  1K54 A;  2VGJ A;  1MWU A;  4PM5 A;  3FKW A;  5F1F A;  1XA1 A;  3V3R A;  5CEC A;  3Q82 A;  1W8Y A;  3ZG0 A;  2X01 A;  4DDS A;  3N4I A;  2EFX A;  4R0Q A;  5KSC A;  3IXD A;  3WS0 A;  3WS5 A;  1ES2 A;  3UNW A;  2Y59 A;  4GDB A;  1WE4 A;  3O87 A;  2XD1 A;  1MY8 A;  2P9V B;  3PBN A;  1ZKJ A;  2XLN A;  4E6X A;  1AXB A;  1CI8 A;  1H8Y A;  3G34 A;  4HBU A;  3IXH A;  4LV0 A;  5E2G A;  5EPH A;  1ESI A;  1RCJ A;  1FSY A;  3WRT A;  3OPL A;  3MZD A;  2WZX A;  4RX2 A;  5FAT A;  3SH7 A;  3PAG A;  3UDI A;  4A5R A;  3IXB A;  4QD4 A;  2Y2O A;  3NDE A;  1ES4 A;  5EOO A;  2Y55 A;  1K55 C;  4ZJ2 A;  1BTL A;  2CC1 A;  2ZC7 A;  4KZA A;  4K91 A;  2Y2Q A;  4S2N C;  3UPP A;  2HDR A;  4BQM A;  5FAO A;  3IWQ A;  1K54 C;  3RJU A;  3LY3 A;  5CTM A;  4L0L A;  3PBT A;  1DJB A;  1SHV A;  5FI6 A;  1M6K A;  3WS4 A;  1YLJ A;  3FKV A;  4QJG A;  3NC8 A;  3ZGA B;  3UO9 A;  1KE0 A;  5FI2 A;  4OLG A;  4EUZ A;  3W8K A;  4OPZ A;  2ZC6 B;  2C5W B;  2I72 A;  2GDN A;  2HP5 A;  2JBF A;  3D4F A;  1CI9 A;  2Y4A A;  5KMW A;  2Y2M A;  4QU3 A;  4EBN A;  1G6A A;  2IWC A;  4IVI A;  1KDW A;  4E3M A;  4OOL A;  2P9V A;  2WAE A;  3HRE A;  2WKE A;  1NRF A;  1YT4 A;  1KE3 A;  1W7F A;  1MXO A;  4WEJ A;  1TEM A;  1IKG A;  2H0Y A;  2ZQ9 A;  1EI5 A;  3IF6 B;  1HD8 A;  4X69 A;  4N1H A;  5GLC A;  1KE4 A;  3UE3 A;  3PBR A;  4FCF A;  3BLM A;  4DE2 A;  4S2L A;  4IBX A;  4PM9 A;  4X55 A;  3HLW A;  1KGG A;  5HAQ A;  1GHI A;  4DE1 A;  3BEC A;  1KDS A;  1ERQ A;  3PBQ A;  1PWC A;  3CMZ A;  3OCL A;  5U47 A;  2OLU A;  5A93 A;  3Q7V B;  1W5D A;  4KZ8 A;  3V5M A;  3IF5 A;  1LL9 A;  2JCH A;  5EVI D;  1G68 A;  3MKF A;  4JPM A;  4N92 A;  3S4X A;  5CED A;  2RCX A;  4JBF A;  2WGW A;  5FA7 A;  2Y2G A;  2FFY A;  5CGS A;  3FZC A;  4X53 A;  4GKU A;  1SDE A;  2OV5 A;  3SS3 A;  3V3S A;  3N8L A;  3G31 A;  4R4S A;  4E3N A;  3VP0 A;  5FAS A;  5KSH A;  3AGF A;  5HFO A;  4JF6 A;  4P0M A;  3AGE A;  5FDH A;  3BLS A;  2BG1 A;  4BD0 A;  1K25 A;  3BEB A;  1BT5 A;  4C3Q A;  2XF3 A;  2XQZ A;  4KQQ A;  4F94 A;  4N9K A;  1K4E A;  1DJC A;  1PWD A;  2ZMA A;  5BOH A;  2Y2L A;  4OH0 A;  3MXS A;  3OPH A;  4Q8I A;  3HUM A;  1BUE A;  3ZG8 B;  5FI7 A;  2Y2H A;  3IH9 A;  5HAP A;  1ERM A;  3DW0 A;  2OLV A;  5FQQ A;  3HLD A;  5I94 A;  3N6I A;  1K57 A;  2QZ6 A;  1KVM A;  3PBS A;  1M40 A;  2Q9N A;  4RYE A;  1JTG A;  4P85 A;  1BLS A;  3A3J A;  2HDU A;  3ZCZ A;  4OVD A;  4JXS A;  2ZC3 B;  4OPQ A;  3G2Z A;  4U0X A;  1XXM A;  3VP1 A;  4XUX A;  4CJN A;  1YLY A;  5HW3 A;  1Z6F A;  1I5Q A;  1KVL A;  1JWZ A;  5CTN A;  1L0G A;  4WMC A;  3UPN A;  1K56 D;  2Y2K A;  2WZZ A;  5DVA A;  1U60 A;  4JXV A;  5TFQ A;  2Y2N A;  3C4O A;  3EQU A;  5DF7 A;  5CHU A;  4P6B A;  3MZF A;  4OQ0 A;  4Y0U A;  3FWL A;  4S2K A;  3PBO A;  3ZVT A;  1MPL A;  3BYD A;  4JF5 A;  4ZBE A;  2IWB A;  2BLS A;  1MBL A;  1LLB A;  1W79 A;  1Y54 A;  3C5A A;  1YLT A;  3A3F A;  4QY6 A;  1FSW A;  4KG5 A;  1YLZ A;  5EUA A;  3HVF A;  1GHP A;  3G4P A;  1BLP A;  3NDG A;  1YLP A;  4U0T A;  5A91 A;  5CER A;  4CPK A;  4H8R A;  2WAF A;  1YLW A;  2XH9 A;  3Q7V A;  1CEG A;  2XD5 A;  4O7D A;  3G2Y A;  5FQ9 A;  4OOM A;  1C3B A;  1XPB A;  3G35 A;  2FFF B;  3LCE A;  3Q07 A;  1PI5 A;  2C6W B;  4GN2 A;  4WYY A;  1ONG A;  5D3O A;  2X71 A;  3UPO A;  3SOI A;  2B5R A;  3QNC A;  4UA9 A;  1FR1 A;  3C7U A;  4WZ4 A;  4FD8 A;  2ZM2 A;  2Q9M A;  4QHC A;  5EVI C;  1JTD A;  3A3I A;  4R3J A;  5GL9 A;  4B4Z A;  2WYX A;  4WBG A;  5TR7 A;  1FOF A;  5TGF A;  1LI9 A;  3PAE A;  3UY6 A;  5F82 A;  5JYP A;  4ZJ3 A;  4KQO A;  3ZDJ A;  1NY0 A;  1ES5 A;  2EX6 A;  1ERO A;  3C7V A;  1K56 A;  4R3B A;  4EWF A;  1O7E A;  3UDF A;  1BSG A;  1L0F A;  4OP8 A;  2XFS A;  2ZC5 B;  4MBF A;  1IKI A;  2HPB A;  3C4P A;  5F1G A;  2WKI A;  3VSL A;  5DTK A;  3MZE A;  1XP4 A;  3NIA A;  4MLL A;  3N7W A;  1MWR A;  3BFG A;  4MBK A;  5DF8 A;  5GLA A;  3SS5 A;  4KG2 A;  5AQ7 A;  5DTT A;  1H8Z A;  3W4Q A;  4E6W A;  1FCM A;  3OCN A;  2Y2J A;  1GA0 A;  4S2O A;  1PZP A;  5F83 A;  4PM7 A;  5A92 A;  3IWI A;  2JC7 A;  3CZD A;  4ZTK A;  4WEL A;  4E3I A;  3HL9 A;  3V39 A;  2A3U A;  5L2F A;  5IHV A;  2HDQ A;  1LHY A;  4IBR A;  1K57 C;  4FH2 A;  5DTS A;  1KGE A;  1QME A;  2PU2 A;  4KZ4 A;  5FQI A;  4JXG A;  5CHM A;  3UE0 A;  1QMF A;  4GDN A;  4LCL A;  2HP6 A;  3WWX A;  4KZ7 A;  3RXX A;  4B4X A;  3G32 A;  5EOE A;  1E4D A;  1W8Q A;  1L2S A;  2XEP A;  4GOG A;  5AQB A;  4E3L A;  2J8Y A;  5GLD A;  5FSR A;  1PW1 A;  4ZAM A;  3DWK A;  4WEK A;  3S22 A;  4LV3 A;  1NYY A;  1OME A;  3JYI A;  3OZH A;  4BEN A;  3VOY A;  2WGW B;  3IWO A;  4JF4 A;  4XXR A;  4BJP A;  5CRF A;  4WZ5 C;  4EV4 A;  1HVB A;  5HL1 A;  1JVJ A;  1MWT A;  2ZM8 A;  4OON A;  3O88 A;  1IEL A;  5FQK A;  5G18 A;  2WAD A;  3P98 A;  3RXW A;  1LL5 A;  2Y91 A;  3MXR A;  5M1A A;  4DDY A;  4PM6 A;  1BLC A;  5FQM A;  1BLH A;  1H5X A;  3VMA A;  1E3U A;  4YFM A;  2OSU A;  3N8S A;  2XDM A;  3NI9 A;  3E2K A;  4DKI A;  2Y2P A;  4KZ3 A;  4E3O A;  5J8X A;  1XGJ A;  4N1X A;  3HLF A;  4P87 A;  2ZQ8 A;  4RX3 A;  2EFU A;  4ID4 A;  2XR0 A;  1ZG4 A;  4R1G A;  3IF6 C;  1S0W A;  2ZC4 B;  4KZB A;  3BFE A;  4FSF A;  3SH9 A;  5EVI B;  1FR6 A;  3VP3 A;  1SKF A;  5E43 A;  1K55 A;  5JYO A;  4WZ5 A;  5M19 A;  2EXA A;  5FAQ A;  3TG9 A;  1N9B A;  3SH8 A;  2PBY A;  3V50 A;  2HDS A;  2XFT A;  4HBT A;  3UE1 A;  4D2O A;  2XK1 A;  1ONH A;  4K0W A;  2QPN A;  1LI0 A;  4EQI A;  5GHZ A;  3N8R A;  5DF9 A;  2WK0 A;  2PU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...