2ZQ9A

Cephalothin acyl-intermediate structure of class a beta-lactamase toho-1 e166a/r274n/r276n triple mutant
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
259
structure length
259
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase Toho-1
publication title Structural Basis of Extend Spectrum Beta-Lactamase in Correlation of Enzymatic Kinetics and Thermal Stability of Acyl-Intermediates
rcsb
source organism Escherichia coli
total genus 93
structure length 259
sequence length 259
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2zq9A00
3MXRA 4MNRA 5U47A 2OLUA 4FCFA 1PW1A 2JCHA 2E8IA 4X68A 2R9XA 3NCKA 1NYMA 3IHBA 3S1YA 3VFHA 3WRZA 2J7VA 3IF6C 1Q2PA 5DVAA 1AXBA 5GLCA 4X55A 2ZQ7A 2WAFA 4OLGA 3ZG0A 4E3OA 3QHYA 5FAQA 1LLBA 3PTEA 2WUQA 3TOIA 1I2SA 4S2NA 1H8ZA 3PBTA 4EUZA 4JPMA 1HVBA 3IXBA 3MKEA 4QD4A 1K54C 1K55C 4GOGA 4KZ6A 3V5MA 1IEMA 2Y2IA 5DTKA 1K56D 5FA7A 3W8KA 3O88A 3IF5A 2XGNA 1W8QA 2Y2JA 1PWDA 2QZ6A 3O86A 5TFQA 1K57C 3G32A 3I7JA 4WEJA 3LO7A 4BD0A 4E3IA 5GHZA 3RJUA 3HL9A 4E3JA 3PBRA 4MBHA 1LL9A 5FAOA 5HARA 4C6YA 3N7WA 5AQ9A 1KE0A 4IVKA 4QHCA 3FKVA 1FCOA 3LEZA 1PZOA 4N9LA 2WZXA 4PM9A 3OPPA 1ZG4A 5AQBA 5HFOA 4WZ5C 2V20A 4GD6A 4JF6A 3EQUA 5CERA 1FCMA 2Z2LB 4GN2A 1KDSA 1Y54A 4ZJ2A 1ESUA 3N8RA 3VMAA 2XH9A 3HUOA 2R9WA 4M3KA 1TDGA 2Y4AA 3SOIA 4B4ZA 3WS0A 5FI7A 2J9PA 2EX2A 2QMIA 1KGFA 5A90A 1TEMA 4KG5A 1GHIA 2WYXA 2XLNA 3MXSA 4E6XA 1E3UD 3BFCA 3Q7ZA 5HX9A 3MZEA 3BFEA 3MZFA 1GA0A 5HAPA 3UDFA 3DW0A 4BQMA 1SCWA 4DE3A 4IBXA 3ZFZA 4E3KA 4WEKA 5AQAA 3LY3A 1ES3A 2XR0A 3OC2A 4RA7A 2PBYA 1ALQA 3A3IA 4K0WA 3GVBA 1HTZA 4Q8IA 1BULA 1YLYA 1ONHA 5KMWA 4XUZA 4R0QA 3P09A 4O7DA 5AQ7A 4UA9A 2ZD8A 4E3LA 4EWFA 3IQAA 1BT5A 1RGYA 2JBFA 3O87A 4NETA 4KG2A 4KZAA 2EFXA 1CEGA 1FQGA 3VP4A 1ERQA 1FOFA 3G2YA 1FR1A 3IF6B 3V39A 4DE0A 2Y2GA 4XXRA 4JF5A 4OP8A 4KZ4A 4RVAA 2I72A 4BLMA 5CTMA 4Y0OA 1K6RA 1SHVA 1ZC2A 3VP3A 2H0YA 3PAGA 4RX3A 1GHPA 5FQ9A 3HVFA 1E4DA 1PW8A 1JWZA 4OPYA 3UDXA 3VOYA 4HEFA 5CHJA 2H0TA 1WYBA 2WADA 3SH9A 4BD1A 1JWVA 4P6BA 1H8YA 4Y7PA 4ID4A 4PM7A 4LCMA 1YLJA 1PI4A 2H5SA 3CMZA 3A3DA 3MZDA 4OONA 4PMAA 3SS4A 3S4XA 5GLBA 5E2EA 3WS5A 1C3BA 2Y55A 3OZHA 1NXYA 1IELA 2ZM8A 1S0WA 1E3UA 3OCLA 4H8RA 4KQRA 4GB7A 5CGXA 2A3UA 4WMCD 3SH7A 3VP0A 5FATA 1IYSA 1YQSA 1NZOA 4QU3A 2ZC3B 5CTNA 4C75A 2V1ZA 4DDSA 5HL1A 4N1XA 2C6WB 4S2LA 5CHUA 3UE3A 3UY6A 5HW3A 3HLCA 1FSYA 1PI5A 3ZVWA 1CEFA 1W79A 4GNUA 5GLDA 2Y2KA 2WKEA 4DE2A 5EVID 1M40A 3HREA 3NIAA 2WZZA 4ZAMA 1NY0A 2X71A 1MBLA 2Z2MB 4S2MA 4KZ3A 1NYYA 3IF6A 1NJ4A 4KZ9A 3NBLA 4U0XA 1CI9A 2HDQA 3EQVA 5J8XA 3FYZA 1ES4A 1JTGA 4GDNA 4C3QA 1EI5A 5DTSA 5CHMA 1WYCA 2P9VA 2WGWA 4FSFA 1MWTA 3CG5A 4PM8A 4MBFA 3ITAA 1VQQA 3BRMA 1K54A 1K55A 2G2WA 3A3FA 2Y2QA 4OH0A 4PPRA 4ZTKA 1XA1A 1WE4A 3A3JA 2Y2NA 1MXOA 3FV7A 1W5DA 2PU4A 4KZBA 4R3JA 3P98A 3S22A 1XPBA 4F94A 4JF4A 5FAPA 2ZM0A 1EWZA 1L0GA 3V50A 3N4IA 1YLTA 4WYYA 2A49A 1K57A 1L0FA 2DNSA 2HDUA 5GHYA 4GD8A 1XP4A 5EUAA 1IYQA 4IBRA 1XGJA 4K91A 4QY5A 1G68A 5EE8A 5JYOA 3DWZA 1IYOA 2HP9A 3DWKA 4QY6A 5KSHA 1GHMA 5CGSA 2EX9A 4LV0A 5L2FA 2Y2MA 4WZ5A 3E2LA 3A3EA 4Z9QA 4EBPA 1BLHA 4OQGA 3G31A 3SS5A 1TVFA 3MBZA 3ISGA 3IH8A 2FFYA 4X56A 3FZCA 3G35A 3M6HA 4KZ7A 1ESIA 1ES2A 1VM1A 3VSKA 4BL2A 3C5AA 1LL5A 4DDYA 1DY6A 1L0EA 3GSGA 5FQKA 2CC1A 3HLBA 4UHUA 5EVIC 4JXGA 3N8LA 3UPNA 1CI8A 4RX2A 1KVLA 5DF7A 5BOHA 1RGZA 1QMFA 4KG6A 5DF8A 5FI2A 4DKIA 1ONGA 4K0XA 2Q9MA 1YM1A 3NI9A 4XUXA 3UPOA 1MY8A 5CECA 1OMEA 5CGWA 1I5QA 1W8YA 3IHAA 5CEDA 5F82A 4JKTA 2X01A 5E2HA 3RXXA 3ZHHA 5M19A 3N8SA 1M6KA 5TR7A 5FI6A 2QPNA 2Y91A 4L0LA 1K56A 1KE3A 1PIOA 2XFTA 4X53A 1GA9A 2RCXA 2V2FF 4OOLA 5F83A 4A5RA 1H5XA 2FFFB 1K4EA 1ES5A 3UE1A 1L0DA 1DJAA 3G30A 1EROA 5GL9A 5TGFA 1LI0A 4DXBA 1MWRA 1RCJA 5KZHA 1YT4A 3BM6A 2WGWB 2P9VB 4S2OA 5E2FA 1CK3A 2HDSA 3V3SA 2XDMA 4E3MA 4LV2A 1SDEA 1U60A 3TG9A 3CJMA 5HAIA 3Q82A 4WM9A 4EQIA 2XK1A 1KGGA 2EXBA 4BENA 3C4PA 3UN7A 3G34A 2WGVA 1ERMA 4N92A 3BECA 2XF3A 1FR6A 3B3XA 3PAEA 3VP1A 4R23A 1W7FA 2XEPA 2XQZA 3G4PA 3HLDA 4OPRA 4HBTA 3BFDA 1MWSA 4UA6A 4IVIA 4UA7A 3ZG9B 5FQIA 2ZQAA 5EECA 4LV3A 5EVLA 5GLAA 2WAEA 5F1GA 3VP2A 4KQQA 3AGEA 3HUMA 4OOYA 5KSCA 3GQZA 4DE1A 4OLDA 4BJPA 1O07A 3UO9A 4D2OA 3UDIA 4U3TA 4FH2A 2JE5A 1IYPA 2XD1A 3HBRA 1BUEA 3HLFA 2HP6A 3Q7VB 4KZ8A 1O7EA 1PWGA 3WS1A 2Y2HA 4N1HA 4BL3A 2Y2LA 1NRFA 1KE4A 1YLZA 2ZC7A 5EVIB 3NY4A 4DF6A 4JXVA 4RYEA 5CXWA 4N9KA 4GDBA 1YMSA 3PBOA 1JVJA 4B88A 4EBLA 4Y0TA 4QJGA 1LI9A 5FQQA 3UPPA 4IEDA 3IT9A 4MEZA 1ZG6A 5FDHA 1BLCA 1JTDA 4WBGA 4HBUA 2EFUA 3DTMA 2ZM2A 1N9BA 2P74A 1RP5A 4JBFA 1E25A 1SDNA 2ZMAA 4OPQA 4WZ4A 2ZJ9A 2PU2A 3ZG7B 2VGJA 1KVMA 2ZC4B 4JXSA 1SKFA 4OP5A 4CPKA 1MWUA 1NZUA 3BYDA 4GKUA 1XA7A 1Z6FA 4EBNA 5CRFA 2H10A 4R4RA 3BLMA 1TDLA 3GRJA 2J8YA 4X69A 3SS3A 2GDNA 3N6IA 4WELA 3OPLA 5JYPA 3IH9A 5EPHA 4S2NC 4DXCA 3SH8A 3IXHA 3BEBA 3WS4A 3W4QA 3CZDA 1K4FA 3NDEA 5DTTA 2ZC5B 3ITBA 4P0MA 3WWXA 2XD5A 2UWXA 1Q2QA 1DJCA 4P85A 4WMCA 2DCFA 3VSLA 2HP5A 5D3OA 3C7UA 1PYYA 2EX6A 1HD8A 1K38A 4R3BA 3HLWA 3Q7VA 2OSUA 2C5WB 1XGIA 2HPBA 3AGDA 4JXWA 5FQMA 1PZPA 4S2IA 5IHVA 4LCLA 5CEBA 2ZQ8A 5EVIA 4ZJ1A 1XXMA 2ZQ9A 3RXWA 4HESA 3BLSA 4OPZA 3ZNYA 4OQHA 5FSRA 2B5RA 3AGFA 1DJBA 1KGEA 4UAAA 4CJNA 3W4OA 2BG1A 1K6SA 5DF9A 3QNBA 2J9OA 1BLPA 3BFGA 4EV4A 5E43A 3GR2A 2X02A 2BLSA 4OVDA 4KENB 4S2KA 3MKFA 2ZC6B 3HUNA 3MFDA 3O3VA 4QB8A 3W4PA 3VFFA 4U0TA 1LHYA 1QMEA 5I94A 3ZG5A 3IWIA 3IXDA 4YINA 1YLWA 1G6AA 1HZOA 5E2GA 3M6BA 1BTLA 1KDWA 1YLPA 2VGKA 5G18A 1YMXA 3UE0A 3IWQA 4OQIA 4LENA 3ZGAB 3PBNA 4LV1A 2IWCA 3V3RA 3Q1FA 3VOZA 2OLVA 4NK3A 1XKZA 4R4SA 1MKIA 4E6WA 2IWDA 2RL3A 4KZ5A 4YFMA 2JC7A 5M1AA 3C7VA 5M18A 3PBSA 3HLGA 1J9MA 4R1GA 3HLEA 1IKIA 2DRWA 2Y2PA 1BSGA 1FSWA 4OOMA 1FCNA 4E3NA 4S2PA 1IKGA 3ZCZA 2EX8A 1L2SA 1N4OA 3LY4A 3LCEA 4FD8A 2Y2OA 3GTCA 3PBQA 4Y0UA 2ZQCA 1PWCA 4MBKA 4PM6A 3UNWA 1GCEA 3GMWA 3NC8A 5EOEA 2OV5A 4ZBEA 3Q07A 3NDGA 3IWOA 3ZDJA 2G2UA 4B4XA 4KQOA 1S6RA 3ZG8B 4ZJ3A 2WKIA 1ZKJA 4OQ0A 4MLLA 4ZDXA 2XFSA 3BFFA 3E2KA 2ZLYA 4OKPA 4FH4A 2ZQDA 3FKWA 3ZVTA 3OCNA 4X6TA 4PM5A 5EOOA 3TSGA 3OPRA 3QNCA 5A93A 3D4FA 3M2KA 2Y59A 3M2JA 5F1FA 2HDRA 1K25A 4GZBA 4DRTA 3G2ZA 2WKHA 3WS2A 2WK0A 1JWPA 3WRTA 3FWLA 3Q81A 3ZNTA 1XX2A 5FASA 5HAQA 4P87A 5GHXA 4S2JA 5A92A 1BZAA 3JYIA 5FQJA 3OPHA 2IWBA 2WGIA 1MPLA 4JLFA 2Q9NA 2EXAA 3C4OA 5A91A 3IXGA 1BLSA 3GV9A 1I2WA
chains in the Genus database with same CATH superfamily
4MNRA 4F3LB 1FILA 3LGOA 1Z09A 2E8IA 2NUPC 4IUHA 3IF6C 5DVAA 2ZQ7A 4E3OA 5FAQA 3PTEA 5AJGA 3T4OA 4JPMA 5DJUA 1K54C 1K55C 4GOGA 1V9YA 1K56D 5FA7A 3A0SA 1VEUA 3IF5A 3O86A 1K57C 3I7JA 3TE8A 3RJUA 3HL9A 2P04A 5HARA 1LL9A 5FAOA 4N9LA 1ZG4A 4R70A 2BTFP 4DMZA 4JF6A 5CERA 3KSGA 1H3QA 4PHTA 4GW9A 4F3LA 2R9WA 4BBTA 4Y17A 5FI7A 5IU1A 2EX2A 4KG5A 2QJ5A 4HP4A 4E6XA 3P7NA 3BFEA 4BQMA 4DN0A 3PYPA 3LY3A 3OC2A 4LRXC 4Q8IA 1BULA 3UB9A 2ZD8A 4E3LA 3VV4A 4NETA 4KZAA 3G2YA 4DE0A 1PNEA 1G28A 3MXQA 1ODVA 2KOIA 3O5YA 2PYPA 4UQIM 3S7OA 1YLJA 3SS4A 1C3BA 2Y55A 3OZHA 3OCLA 4GB7A 4IHQA 3VP0A 4QU3A 4ZRRA 4N1XA 3UE3A 3HLCA 1FSYA 1PI5A 3ZVWA 4EW7A 5FEFA 2LB5A 3NIAA 2Z2MB 1CI9A 3D3OA 3GECA 3ITAA 4WN5A 2G2WA 3A3FA 4EUVA 1OT9A 3NHQA 4F94A 1XPBA 1HLUP 4JF4A 1P0ZA 2A49A 1L0FA 3IBJA 2DNSA 2HDUA 5GHYA 4IBRA 4QY5A 1G68A 5EE8A 4QY6A 2EX9A 1WA9A 2M7UA 2LB9A 3CUEA 4OQGA 3G31A 3LFVA 3SS5A 3ISGA 3EEHA 4M4XA 4X56A 1VM1A 2ZBBA 5FQKA 3CITA 4JXGA 3N8LA 1CI8A 1KVLA 4MDZA 3CI6A 5DF8A 2Q9MA 4XUXA 1MY8A 5CECA 3T1QB 2OWHA 1IOUA 5E2HA 3ZHHA 2PBDP 5FI6A 2W1TB 2QPNA 4L0LA 3LIDA 5AVEA 4A5RA 1H5XA 2XA7M 1K4EA 4HH2A 1T1BA 1DP6A 1L0DA 2VV7A 1OT6A 2V8CA 4HOIA 5KZHA 5HZHA 3BM6A 2WGWB 2INWA 3LI9A 1U60A 1PRQA 2M1CA 4EQIA 2EXBA 4HJ3A 3EOIA 3G34A 2WGVA 3BECA 2XF3A 3PAEA 4Z1WA 2VGLS 1W7FA 2XEPA 3HLDA 4R23A 3BFDA 1OTAA 1MWSA 3A0VA 2VLGA 4UA7A 5FQIA 5EECA 2QHKA 4LV3A 5GLAA 3VE4A 5F1GA 3T4LA 4BBVA 3AGEA 4OOYA 3GQZA 2PYRA 1O07A 3VE3A 4D2OA 2EWVA 2W1TA 5DFYA 3HBRA 3WS1A 2Y2HA 3DAVA 4N1HA 1NRFA 1KE4A 4LRYC 2VV8A 2EWWA 2ZOIA 1YMSA 4B88A 3UPPA 4IEDA 4LGWA 2O9AA 3FC7A 1ZG6A 1SKOB 4HBUA 3DTMA 5L10A 1Y4OA 1RP5A 4CLCB 2KLIA 1SDNA 4WZ4A 2PU2A 2ZC4B 4JXSA 1SKFA 1N9LA 2VZWA 1MWUA 1TS8A 3GRJA 1XJ3A 2GDNA 3SH8A 3F1PB 5DTTA 3ITBA 5HD3A 2WKRA 3C8CA 3C7UA 2ZMVA 3NULA 4R3BA 3AGDA 4JXWA 1PZPA 5IHVA 2PHYA 2ZQ8A 3BW6A 4ZJ1A 2GJ3A 1XJ6A 1OTBA 4HESA 1DJBA 2BG1A 3QNBA 2J9OA 4EV4A 2X02A 1SKOA 4OVDA 4KENB 3CPTB 3CHWP 4CLCA 3HUNA 3O3VA 4MN5A 5AVFA 4X1MA 4EXOA 3IXDA 2O0YA 2W3FA 4Y3IA 1NLZA 3T50A 3BQAA 3ZGAB 3PBNA 3F1PA 3R4KA 4R38A 3Q1FA 1XKZA 4R6LA 3H82B 4KZ5A 2JC7A 5MC7A 3HJKA 3HLEA 1IKIA 1FSWA 1IKGA 4I5SA 1NWZA 3LCEA 2Y2OA 3PBQA 2ZQCA 2E8JA 1PWCA 2CMNA 4MBKA 1GCEA 2OV5A 4LFUA 1ZTUA 3LIFA 2WKIA 1ZKJA 3CPTA 4X25A 4ZDXA 5J3WA 2ZQDA 3FKWA 5HPIA 5J4EA 3TSGA 5A93A 2J3TD 5F1FA 4GZBA 3MF0A 2NUTC 4DRTA 3WS2A 1JWPA 3ZNTA 3Q81A 5EM1A 5FASA 5HDCA 4S2JA 1BZAA 1MKMA 3OPHA 4EQ1A 2Q9NA 3C4OA 2PRFA 3H82A 5F69A 4FCFA 1TF1A 4FUWA 2R9XA 3IHBA 3S1YA 1OJ5A 2J7VA 2GX5A 3U2AA 1AXBA 1LLBA 1I2SA 4HNBA 1HVBA 3MKEA 4HIAA 2W3GA 4O8GA 1XJ4A 3MSHA 3V5MA 3LR4A 3QP4A 3O88A 5DKLA 2QZ6A 5A8BA 4L9FA 3LO7A 2PT7A 1KE0A 2P7JA 4QHCA 3LEZA 1PZOA 2V20A 1FCMA 2Z2LB 1Y54A 3E4QA 3MS6A 5EFWA 1F9IA 2XH9A 3HUOA 1DRMA 1TDGA 1ACFA 3F1NB 4NXEA 2QMIA 1TEMA 3MXSA 3FPVA 3E4OA 5HX9A 3UDFA 1YAXA 4DE3A 3ZFZA 4ARZB 2PBYA 3A3IA 1YLYA 1ONHA 3UB6A 3TW8A 5KMWA 4Y15A 4EWFA 3IQAA 1BT5A 1ERQA 1FR1A 4JF5A 4OP8A 2I72A 4BLMA 5HPFA 1S1ZA 4L9GA 3VP3A 4HI4A 3QP6A 3K3DA 1JWZA 5I5LA 4LRZE 3FPWA 3F1NA 4BD1A 1JWVA 1H8YA 4Y7PA 1A0KA 2PD8A 5HWVA 3A3DA 4GCZA 3S4XA 5GLBA 1X0OA 4L9EA 5DJTA 4ARZA 4WMCD 5CTNA 1FIKA 2WKPA 2IA2A 5IS1A 1W79A 1N9OA 4DE2A 5EVID 1M40A 3HREA 2GZAA 4KZ3A 1NJ4A 1ES4A 4C3QA 3U4LP 5DTSA 1WYCA 2P9VA 2J3WA 4FSFA 4MBFA 1VQQA 2OAQ1 4OH0A 2XROA 5IT5A 3A3JA 1W5DA 3S22A 5FAPA 2OWJA 1EWZA 2O9CA 1YLTA 4WYYA 1STZA 4GD8A 5EUAA 2HJEA 2A24A 5JYOA 3DWZA 4UQIS 2HP9A 5KSHA 4LV0A 5L2FA 2Y2MA 3KYQA 3QP5A 3E2LA 4HP9A 4HJ4A 3MBZA 3FZCA 3H7WA 3M6HA 4H6JB 3T1RA 1L0EA 2W27A 2V9AA 3IBRA 5HWTA 5DF7A 1RGZA 4KG6A 3RFBA 1YM1A 4GS9A 1I5QA 1W8YA 4CLCC 1S4SA 3N8SA 1M6KA 1G5UA 2Y91A 1K56A 1KE3A 1PIOA 2XFTA 4X53A 5G4ZA 1GA9A 1KOUA 2RCXA 4ETXA 2FFFB 3G6OA 2V0UA 1EROA 1LI0A 1N9NA 4IJGA 4DXBA 1RCJA 3RTYA 1P9WA 1LSXA 5E2FA 4S2OA 4P6ZM 2XDMA 4E3MA 5HAIA 2XK1A 3DTIA 1KGGA 3C4PA 4H6JA 3UN7A 1ERMA 4HHDA 4N92A 3VP1A 4UA6A 1CJFA 2WAEA 5J7EA 3VP2A 5KSCA 4DE1A 4OLDA 4BJPA 4X1LA 3UO9A 5HWWA 1LL8A 2XD1A 1IYPA 4KZ8A 5G4YA 3LR3A 4DF6A 3NY4A 4JXVA 4N9KA 4EEPA 3FG8A 1VB6A 5FQQA 2XA7S 3IT9A 4MEZA 4LPZA 2W3HA 5FDHA 1BLCA 1N9BA 2P74A 1E25A 1VETA 2ZJ9A 1P97A 3ZG7B 1KVMA 2ZOHA 2ZMFA 5DKKA 4OP5A 4CPKA 1GSWA 5FDSA 4R4RA 1D1JA 1T1CA 1TDLA 2J8YA 4X69A 2L4RA 3SS3A 3N6IA 5JYPA 3OPLA 4DXCA 3TJZC 3WS4A 3CZDA 3PR6A 2XD5A 2W3EA 2UWXA 1D06A 1Q2QA 2HP5A 1HD8A 2C5WB 2XSSA 5CEBA 1XXMA 3RXWA 1OTEA 3KO6A 3BLSA 4OPZA 1K6SA 5DF9A 1AWIA 2BLSA 2ZC6B 4YNRA 3T1XA 3MFDA 2EA9A 3W4PA 4U0TA 1QMEA 4GJ4A 4EETB 3T4SA 2AVXA 1G6AA 5E2GA 4I38A 2O99A 2VGKA 1YMXA 3IWQA 4OQIA 4LV1A 4PKYA 1EW0A 3VOZA 4WUJA 5C5KA 1MKIA 4E6WA 2IWDA 4EESA 5M1AA 5M18A 1S1YA 3IX4A 3CLOA 1DP9A 3ZCZA 1L2SA 3LIEA 1YSQA 3GTCA 4Y0UA 3JVVA 4PM6A 3QP8A 4JGQA 3NC8A 2OOLA 5EOEA 3KSIA 2D01A 3ZDJA 2G2UA 3LICA 2H28A 3BY8A 2HJ9C 3D4FA 4Y13A 2Y59A 1XX2A 5HAQA 4P87A 5FQJA 3OBFA 2IWBA 4JLFA 1MPLA 1BLSA 2VK3A 1J3WA 2OLUA 2JCHA 3NCKA 4D60A 3WRZA 4Q0HA 5DFXA 1F98A 2WAFA 4I3JA 4S2NA 4FTXA 4EUZA 3IXBA 4DJ2A 1IEMA 2Y2IA 5DTKA 1LSVA 3BJNA 1H0MA 1PWDA 4WEJA 4BD0A 4KQDA 4Y5FA 4E3JA 4KUOA 5AQ9A 4IVKA 4WL9A 3UB7A 3FKVA 4PM9A 2I9VA 5TBMB 2B02A 4ZJ2A 4O0PA 3N8RA 4IUKA 4R3AA 3VMAA 4M3KA 2Y4AA 4NXFA 4B4ZA 3WS0A 1MZUA 3LR0A 1KGFA 1P9RA 1GHIA 2WYXA 5F68A 2XLNA 2DMWA 3Q7ZA 2B18A 3MZEA 2PDRA 3MZFA 5HAPA 4IBXA 1V9ZA 4E3KA 2JHEA 4WEKA 2XR0A 4RA7A 2JKFA 4MCWA 4O7DA 5AQ7A 4UA9A 5K5BA 2EFXA 3DTEA 4WF0A 3VP4A 3V39A 4XXRA 4RVAA 5CTMA 1K6RA 5TBMA 2H0YA 4RX3A 1GHPA 5FQ9A 3HVFA 2Z6DA 1PW8A 3C2WA 4OPYA 5CHJA 2WADA 3SH9A 3T4JA 3E4PA 3UE6A 4PMAA 3CMZA 2W0NA 4OONA 1NXYA 3CAXA 3DTKA 5CGXA 3LR5A 2A3UA 3SH7A 1LSWA 4DDSA 2V1ZA 4S2LA 2C6WB 5CHUA 3UY6A 1CEFA 2K31A 4ZAMA 1NY0A 2X71A 1MBLA 2FH5A 3T1SA 2HDQA 3E0YA 3FYZA 4QPRA 1EI5A 4I3AA 1MWTA 3NOPC 5FL3A 4PPRA 1WE4A 2Y2NA 1MXOA 4KZBA 4R3JA 4WLAA 2ZM0A 1L0GA 3V50A 1UWPX 5CX7A 1W63Q 1XP4A 4K91A 3D72A 3LIBA 2V1BA 3RH8B 1IYOA 3DWKA 4WZ5A 4Z9QA 3CUEC 2W1RA 4EBPA 4QWOA 1OTDA 3IH8A 2FFYA 3G35A 4EU0A 4KZ7A 3VSKA 3EGDC 2MJ6A 3C5AA 2VJWA 3LI8A 4JGOA 1DY6A 3GSGA 2CC1A 3HLBA 3UPNA 3K2NA 3T4KA 3LUQA 4DKIA 4NKPA 1XJ2A 4LLOB 2W3DA 4CLCE 3UPOA 4G3VA 3NECA 5F82A 5HDDA 2X01A 3RXXA 3ZQ5A 4I39A 5F5YA 3C30A 1DP8A 3LYXA 3R7WB 1K0KA 4OOLA 4NEED 1YT4A 4Y2FA 2P9VB 3KYZA 2HDSA 3V3SA 1UGUA 1SDEA 3TG9A 4WM9A 4BENA 4PKYG 4NG2A 2A2LA 1FR6A 2XQZA 3G4PA 2ACGA 2A24B 3ZG9B 5EVLA 1S67L 2UV0E 4KQQA 3HUMA 3S7NA 1SZVA 5HDSA 3UDIA 3L9KA 3H7WB 3R7WA 3Q7VB 2PAVP 1PWGA 4DJ3A 2L1MA 2Y2LA 5EVIB 3EGXC 1YLZA 3NOTC 4RYEA 5CXWA 1OPXA 4GDBA 3PXPA 4EBLA 4Y0TA 4QJGA 4PAUA 1G6OA 2O9BA 1ZHHB 1JTDA 4GS9B 2ZM2A 4JBFA 2ZMAA 1LT0A 3OLOA 4P6ZS 1NZUA 3BYDA 4GKUA 1XA7A 4EBNA 3EEAA 4WELA 3IH9A 5EPHA 4S2NC 3BEBA 3A0RA 2JKTI 3NDEA 2ZC5B 3WWXA 1TS7A 4P85A 4WMCA 3VSLA 4GHIB 1PYYA 1K38A 3HLWA 3Q7VA 1XGIA 4II7A 2HPBA 4S2IA 3HJIA 5EVIA 2ZQ9A 4OQHA 3AGFA 1L3LA 4UAAA 3KSFA 2JKRI 4B9OA 3BFGA 3GR2A 3MKFA 3S7PA 1T1AA 1NLYA 3VFFA 2JN7A 1LHYA 3OOVA 5I94A 3ZG5A 3IWIA 4YINA 3T4TA 1HZOA 2QJ7A 3UE0A 2HV1A 3V3RA 2OLVA 4NK3A 3T12B 4R4SA 2RL3A 2R78A 3MJQA 4YFMA 3C7VA 3HLGA 4GHIA 1J9MA 1PFLA 4R1GA 1VETB 3C38A 2DRWA 4YWZA 1FCNA 3QP2A 1N4OA 3KSHA 3LY4A 4FD8A 5TJJA 3UNWA 4ZBEA 3Q07A 1S6RA 3ZG8B 2XFSA 3BFFA 3E2KA 1BYWA 2ZLYA 4OKPA 4FH4A 3ZVTA 4X6TA 3OPRA 3QNCA 3UMEA 3MQ0A 3M2JA 2HDRA 3S7QA 4UEYA 2P08A 3G2ZA 2WKHA 3WRTA 3P01A 4XT2B 5GHXA 4GLQA 5A92A 4ETZA 2WGIA 5A91A 1I2WA 2VX8A 3MXRA 5U47A 2ZL1B 1PW1A 4X68A 1NYMA 4ESPA 3VFHA 4ME4A 1Q2PA 5GLCA 4X55A 4OLGA 3ZG0A 3QHYA 2KX6A 2WUQA 3TOIA 2VKSA 1Y28A 1H8ZA 4O01A 3PBTA 4QD4A 3SZTA 4KZ6A 3BY9A 3LIAA 3W8KA 2XGNA 1W8QA 2Y2JA 3TRCA 5TFQA 3G32A 4E3IA 4HH3A 5GHZA 1XFNA 3PBRA 4MBHA 4C6YA 3N7WA 2J3TC 1FCOA 1UWNX 4XT2A 5AQBA 2WZXA 3OPPA 5HFOA 1CF0A 3QP1A 4WZ5C 4EERA 2YKHA 4GD6A 3EQUA 4GN2A 1KDSA 2VV6A 1YKDA 1ESUA 4BMWA 2ZL1A 4Q0IA 3SOIA 2J9PA 2BASA 2V1AA 5A90A 1T18A 2B95A 1E3UD 3BFCA 1GA0A 3DW0A 2QYBA 1SCWA 2OAP1 5AQAA 1ES3A 1ALQA 4K0WA 3GVBA 1HTZA 4XUZA 4R0QA 3P09A 3HCYA 2JBFA 1RGYA 3O87A 4KG2A 1CEGA 1FQGA 2L0WA 1GSVA 1FOFA 3IF6B 4MN6A 2Y2GA 4KZ4A 4Y0OA 1SHVA 1ZC2A 2PR6A 3PAGA 2K2NA 2WKQA 4HJ6A 1E4DA 5L8MA 3UDXA 5HD5A 3VOYA 4HEFA 2H0TA 1WYBA 2YKFA 4P6BA 3ULFA 4ID4A 4PM7A 5L09A 2K7SA 4LCMA 1PI4A 2H5SA 3ICYA 3MZDA 2G7UA 5E2EA 3WS5A 3JPUA 1IELA 2ZM8A 1S0WA 1E3UA 4H8RA 4KQRA 3IS2B 5FATA 1IYSA 1YQSA 1NZOA 4C75A 2ZC3B 2HGVA 5HL1A 5HW3A 1F2KA 3UMDA 4GNUA 2J80A 5GLDA 2Y2KA 3IX3A 2WKEA 2M7VA 2WZZA 3BQ8A 4S2MA 1F5MA 1NYYA 3IF6A 4KZ9A 3UB5P 3NBLA 4U0XA 3EQVA 5J8XA 3B47A 1JTGA 4GDNA 3KYEA 4B93A 5CHMA 2WGWA 3CG5A 3NOUC 4PM8A 4CLCD 1W63M 4G3WA 5L07A 3BRMA 1K54A 2JKTM 2JKGA 1K55A 5EM0A 3B33A 2Y2QA 4ZTKA 1XA1A 2V0WA 3FV7A 5LBRA 2PU4A 3P98A 2VEAA 3N4IA 1K57A 1OJGA 1IYQA 1XGJA 3F1OB 3D9YA 1GHMA 5CGSA 3IS2A 4NXGA 3A3EA 1BLHA 3MR0A 1TD5A 2HZ5A 1TVFA 2JKRM 2VGLM 4NXBA 3MFXA 1ESIA 1ES2A 4BL2A 4DDYA 1LL5A 3K3CA 4UHUA 5EVIC 4RX2A 5BOHA 1QMFA 5FI2A 1ONGA 4K0XA 4I3IA 3NI9A 1OMEA 5CGWA 3IHAA 5CEDA 4JKTA 3CWFA 5M19A 2QWSA 3BWLA 5TR7A 3B42A 2Y79A 2V2FF 5F83A 1GSXA 5F6AA 1ES5A 3UE1A 3F1OA 1DJAA 3G30A 5GL9A 5TGFA 1MWRA 3SW1A 3ZYTA 1CK3A 3DBAA 2PD7A 3KX0X 4LV2A 3MMHA 1T19A 3CJMA 3EWKA 3Q82A 3V67A 4KUKA 3VOLA 1JNUA 3B3XA 4OPRA 4HY8A 4HBTA 4IVIA 1NRJA 2D02A 2ZQAA 4YOFA 5HSQA 3W2ZA 4U3TA 4FH2A 4E04A 2JE5A 1S66L 1BUEA 3HLFA 2HP6A 3UB8A 1O7EA 2Y8HA 2GNXA 1XFQA 4BL3A 2ZC7A 3PHYA 3PBOA 2Z6CA 1JVJA 4G3KA 1LI9A 4K08A 3JVUA 3E98A 3NJAA 4WBGA 4MN7A 2EFUA 2XRNA 2VA0A 2Q0OA 4OPQA 2VGJA 4AFIA 1Z6FA 2PR5A 5CRFA 2H10A 3BLMA 3IXHA 3W4QA 1K4FA 4RQ9A 4P0MA 1DJCA 2DCFA 5D3OA 1VHMA 1MC0A 2EX6A 2OSUA 5EVEA 5FQMA 4LCLA 1CQAA 4EEUA 3ZNYA 5FSRA 2B5RA 1KGEA 2V8FA 4CJNA 3W4OA 2KDKA 2HF6A 1BLPA 3MQQA 4JGPA 4Q0JA 5E43A 3GDIA 4S2KA 3L7HA 4QB8A 1TS6A 1YLWA 5HL6A 3M6BA 1BTLA 1KDWA 4BBUA 1YLPA 5G18A 1H8MA 3LEQA 4LENA 2IWCA 1OTIA 3T4QA 5FEGA 3PBSA 2Y2PA 1BSGA 4E3NA 4OOMA 4JGRA 4S2PA 2EX8A 1YSPA 4CQHA 1D7EA 4BWIA 3MQOA 3GMWA 2FZ0A 1IFQA 3NDGA 3IWOA 4B4XA 4KQOA 4ZJ3A 4OQ0A 3H9WA 4MLLA 5EV0A 1VEUB 3OCNA 1YPRA 4PM5A 5EOOA 3M2KA 4MMNA 1K25A 2QKPA 5KIZA 2WK0A 3FWLA 4HQAA 1TS0A 3JYIA 3IX8A 1S4RA 2EXAA 4FOFA 3IXGA 3GV9A
chains in the Genus database with same CATH topology
3MXRA 4MNRA 5U47A 2OLUA 4FCFA 1PW1A 2JCHA 2E8IA 4X68A 2R9XA 3NCKA 1NYMA 3IHBA 3S1YA 3VFHA 3WRZA 2J7VA 3IF6C 1Q2PA 5DVAA 1AXBA 5GLCA 4X55A 2ZQ7A 2WAFA 4OLGA 3ZG0A 4E3OA 3QHYA 5FAQA 1LLBA 3PTEA 2WUQA 3TOIA 1I2SA 4S2NA 1H8ZA 3PBTA 4EUZA 4JPMA 1HVBA 3IXBA 3MKEA 4QD4A 1K54C 1K55C 4GOGA 4KZ6A 3V5MA 1IEMA 2Y2IA 5DTKA 1K56D 5FA7A 3W8KA 3O88A 3IF5A 2XGNA 1W8QA 2Y2JA 1PWDA 2QZ6A 3O86A 5TFQA 1K57C 3G32A 3I7JA 4WEJA 3LO7A 4BD0A 4E3IA 5GHZA 3RJUA 3HL9A 4E3JA 3PBRA 4MBHA 1LL9A 5FAOA 5HARA 4C6YA 3N7WA 5AQ9A 1KE0A 4IVKA 4QHCA 3FKVA 1FCOA 3LEZA 1PZOA 4N9LA 2WZXA 4PM9A 3OPPA 1ZG4A 5AQBA 5HFOA 4WZ5C 2V20A 4GD6A 4JF6A 3EQUA 5CERA 1FCMA 2Z2LB 4GN2A 1KDSA 1Y54A 4ZJ2A 1ESUA 3N8RA 3VMAA 2XH9A 3HUOA 2R9WA 4M3KA 1TDGA 2Y4AA 3SOIA 4B4ZA 3WS0A 5FI7A 2J9PA 2EX2A 2QMIA 1KGFA 5A90A 1TEMA 4KG5A 1GHIA 2WYXA 2XLNA 3MXSA 4E6XA 1E3UD 3BFCA 3Q7ZA 5HX9A 3MZEA 3BFEA 3MZFA 1GA0A 5HAPA 3UDFA 3DW0A 4BQMA 1SCWA 4DE3A 4IBXA 3ZFZA 4E3KA 4WEKA 5AQAA 3LY3A 1ES3A 2XR0A 3OC2A 4RA7A 2PBYA 1ALQA 3A3IA 4K0WA 3GVBA 1HTZA 4Q8IA 1BULA 1YLYA 1ONHA 5KMWA 4XUZA 4R0QA 3P09A 4O7DA 5AQ7A 4UA9A 2ZD8A 4E3LA 4EWFA 3IQAA 1BT5A 1RGYA 2JBFA 3O87A 4NETA 4KG2A 4KZAA 2EFXA 1CEGA 1FQGA 3VP4A 1ERQA 1FOFA 3G2YA 1FR1A 3IF6B 3V39A 4DE0A 2Y2GA 4XXRA 4JF5A 4OP8A 4KZ4A 4RVAA 2I72A 4BLMA 5CTMA 4Y0OA 1K6RA 1SHVA 1ZC2A 3VP3A 2H0YA 3PAGA 4RX3A 1GHPA 5FQ9A 3HVFA 1E4DA 1PW8A 1JWZA 4OPYA 3UDXA 3VOYA 4HEFA 5CHJA 2H0TA 1WYBA 2WADA 3SH9A 4BD1A 1JWVA 4P6BA 1H8YA 4Y7PA 4ID4A 4PM7A 4LCMA 1YLJA 1PI4A 2H5SA 3CMZA 3A3DA 3MZDA 4OONA 4PMAA 3SS4A 3S4XA 5GLBA 5E2EA 3WS5A 1C3BA 2Y55A 3OZHA 1NXYA 1IELA 2ZM8A 1S0WA 1E3UA 3OCLA 4H8RA 4KQRA 4GB7A 5CGXA 2A3UA 4WMCD 3SH7A 3VP0A 5FATA 1IYSA 1YQSA 1NZOA 4QU3A 2ZC3B 5CTNA 4C75A 2V1ZA 4DDSA 5HL1A 4N1XA 2C6WB 4S2LA 5CHUA 3UE3A 3UY6A 5HW3A 3HLCA 1FSYA 1PI5A 3ZVWA 1CEFA 1W79A 4GNUA 5GLDA 2Y2KA 2WKEA 4DE2A 5EVID 1M40A 3HREA 3NIAA 2WZZA 4ZAMA 1NY0A 2X71A 1MBLA 2Z2MB 4S2MA 4KZ3A 1NYYA 3IF6A 1NJ4A 4KZ9A 3NBLA 4U0XA 1CI9A 2HDQA 3EQVA 5J8XA 3FYZA 1ES4A 1JTGA 4GDNA 4C3QA 1EI5A 5DTSA 5CHMA 1WYCA 2P9VA 2WGWA 4FSFA 1MWTA 3CG5A 4PM8A 4MBFA 3ITAA 1VQQA 3BRMA 1K54A 1K55A 2G2WA 3A3FA 2Y2QA 4OH0A 4PPRA 4ZTKA 1XA1A 1WE4A 3A3JA 2Y2NA 1MXOA 3FV7A 1W5DA 2PU4A 4KZBA 4R3JA 3P98A 3S22A 1XPBA 4F94A 4JF4A 5FAPA 2ZM0A 1EWZA 1L0GA 3V50A 3N4IA 1YLTA 4WYYA 2A49A 1K57A 1L0FA 2DNSA 2HDUA 5GHYA 4GD8A 1XP4A 5EUAA 1IYQA 4IBRA 1XGJA 4K91A 4QY5A 1G68A 5EE8A 5JYOA 3DWZA 1IYOA 2HP9A 3DWKA 4QY6A 5KSHA 1GHMA 5CGSA 2EX9A 4LV0A 5L2FA 2Y2MA 4WZ5A 3E2LA 3A3EA 4Z9QA 4EBPA 1BLHA 4OQGA 3G31A 3SS5A 1TVFA 3MBZA 3ISGA 3IH8A 2FFYA 4X56A 3FZCA 3G35A 3M6HA 4KZ7A 1ESIA 1ES2A 1VM1A 3VSKA 4BL2A 3C5AA 1LL5A 4DDYA 1DY6A 1L0EA 3GSGA 5FQKA 2CC1A 3HLBA 4UHUA 5EVIC 4JXGA 3N8LA 3UPNA 1CI8A 4RX2A 1KVLA 5DF7A 5BOHA 1RGZA 1QMFA 4KG6A 5DF8A 5FI2A 4DKIA 1ONGA 4K0XA 2Q9MA 1YM1A 3NI9A 4XUXA 3UPOA 1MY8A 5CECA 1OMEA 5CGWA 1I5QA 1W8YA 3IHAA 5CEDA 5F82A 4JKTA 2X01A 5E2HA 3RXXA 3ZHHA 5M19A 3N8SA 1M6KA 5TR7A 5FI6A 2QPNA 2Y91A 4L0LA 1K56A 1KE3A 1PIOA 2XFTA 4X53A 1GA9A 2RCXA 2V2FF 4OOLA 5F83A 4A5RA 1H5XA 2FFFB 1K4EA 1ES5A 3UE1A 1L0DA 1DJAA 3G30A 1EROA 5GL9A 5TGFA 1LI0A 4DXBA 1MWRA 1RCJA 5KZHA 1YT4A 3BM6A 2WGWB 2P9VB 4S2OA 5E2FA 1CK3A 2HDSA 3V3SA 2XDMA 4E3MA 4LV2A 1SDEA 1U60A 3TG9A 3CJMA 5HAIA 3Q82A 4WM9A 4EQIA 2XK1A 1KGGA 2EXBA 4BENA 3C4PA 3UN7A 3G34A 2WGVA 1ERMA 4N92A 3BECA 2XF3A 1FR6A 3B3XA 3PAEA 3VP1A 4R23A 1W7FA 2XEPA 2XQZA 3G4PA 3HLDA 4OPRA 4HBTA 3BFDA 1MWSA 4UA6A 4IVIA 4UA7A 3ZG9B 5FQIA 2ZQAA 5EECA 4LV3A 5EVLA 5GLAA 2WAEA 5F1GA 3VP2A 4KQQA 3AGEA 3HUMA 4OOYA 5KSCA 3GQZA 4DE1A 4OLDA 4BJPA 1O07A 3UO9A 4D2OA 3UDIA 4U3TA 4FH2A 2JE5A 1IYPA 2XD1A 3HBRA 1BUEA 3HLFA 2HP6A 3Q7VB 4KZ8A 1O7EA 1PWGA 3WS1A 2Y2HA 4N1HA 4BL3A 2Y2LA 1NRFA 1KE4A 1YLZA 2ZC7A 5EVIB 3NY4A 4DF6A 4JXVA 4RYEA 5CXWA 4N9KA 4GDBA 1YMSA 3PBOA 1JVJA 4B88A 4EBLA 4Y0TA 4QJGA 1LI9A 5FQQA 3UPPA 4IEDA 3IT9A 4MEZA 1ZG6A 5FDHA 1BLCA 1JTDA 4WBGA 4HBUA 2EFUA 3DTMA 2ZM2A 1N9BA 2P74A 1RP5A 4JBFA 1E25A 1SDNA 2ZMAA 4OPQA 4WZ4A 2ZJ9A 2PU2A 3ZG7B 2VGJA 1KVMA 2ZC4B 4JXSA 1SKFA 4OP5A 4CPKA 1MWUA 1NZUA 3BYDA 4GKUA 1XA7A 1Z6FA 4EBNA 5CRFA 2H10A 4R4RA 3BLMA 1TDLA 3GRJA 2J8YA 4X69A 3SS3A 2GDNA 3N6IA 4WELA 3OPLA 5JYPA 3IH9A 5EPHA 4S2NC 4DXCA 3SH8A 3IXHA 3BEBA 3WS4A 3W4QA 3CZDA 1K4FA 3NDEA 5DTTA 2ZC5B 3ITBA 4P0MA 3WWXA 2XD5A 2UWXA 1Q2QA 1DJCA 4P85A 4WMCA 2DCFA 3VSLA 2HP5A 5D3OA 3C7UA 1PYYA 2EX6A 1HD8A 1K38A 4R3BA 3HLWA 3Q7VA 2OSUA 2C5WB 1XGIA 2HPBA 3AGDA 4JXWA 5FQMA 1PZPA 4S2IA 5IHVA 4LCLA 5CEBA 2ZQ8A 5EVIA 4ZJ1A 1XXMA 2ZQ9A 3RXWA 4HESA 3BLSA 4OPZA 3ZNYA 4OQHA 5FSRA 2B5RA 3AGFA 1DJBA 1KGEA 4UAAA 4CJNA 3W4OA 2BG1A 1K6SA 5DF9A 3QNBA 2J9OA 1BLPA 3BFGA 4EV4A 5E43A 3GR2A 2X02A 2BLSA 4OVDA 4KENB 4S2KA 3MKFA 2ZC6B 3HUNA 3MFDA 3O3VA 4QB8A 3W4PA 3VFFA 4U0TA 1LHYA 1QMEA 5I94A 3ZG5A 3IWIA 3IXDA 4YINA 1YLWA 1G6AA 1HZOA 5E2GA 3M6BA 1BTLA 1KDWA 1YLPA 2VGKA 5G18A 1YMXA 3UE0A 3IWQA 4OQIA 4LENA 3ZGAB 3PBNA 4LV1A 2IWCA 3V3RA 3Q1FA 3VOZA 2OLVA 4NK3A 1XKZA 4R4SA 1MKIA 4E6WA 2IWDA 2RL3A 4KZ5A 4YFMA 2JC7A 5M1AA 3C7VA 5M18A 3PBSA 3HLGA 1J9MA 4R1GA 3HLEA 1IKIA 2DRWA 2Y2PA 1BSGA 1FSWA 4OOMA 1FCNA 4E3NA 4S2PA 1IKGA 3ZCZA 2EX8A 1L2SA 1N4OA 3LY4A 3LCEA 4FD8A 2Y2OA 3GTCA 3PBQA 4Y0UA 2ZQCA 1PWCA 4MBKA 4PM6A 3UNWA 1GCEA 3GMWA 3NC8A 5EOEA 2OV5A 4ZBEA 3Q07A 3NDGA 3IWOA 3ZDJA 2G2UA 4B4XA 4KQOA 1S6RA 3ZG8B 4ZJ3A 2WKIA 1ZKJA 4OQ0A 4MLLA 4ZDXA 2XFSA 3BFFA 3E2KA 2ZLYA 4OKPA 4FH4A 2ZQDA 3FKWA 3ZVTA 3OCNA 4X6TA 4PM5A 5EOOA 3TSGA 3OPRA 3QNCA 5A93A 3D4FA 3M2KA 2Y59A 3M2JA 5F1FA 2HDRA 1K25A 4GZBA 4DRTA 3G2ZA 2WKHA 3WS2A 2WK0A 1JWPA 3WRTA 3FWLA 3Q81A 3ZNTA 1XX2A 5FASA 5HAQA 4P87A 5GHXA 4S2JA 5A92A 1BZAA 3JYIA 5FQJA 3OPHA 2IWBA 2WGIA 1MPLA 4JLFA 2Q9NA 2EXAA 3C4OA 5A91A 3IXGA 1BLSA 3GV9A 1I2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MXR A;  4MNR A;  5U47 A;  2OLU A;  4FCF A;  1PW1 A;  2JCH A;  2E8I A;  4X68 A;  2R9X A;  3NCK A;  1NYM A;  3IHB A;  3S1Y A;  3VFH A;  3WRZ A;  2J7V A;  3IF6 C;  1Q2P A;  5DVA A;  1AXB A;  5GLC A;  4X55 A;  2ZQ7 A;  2WAF A;  4OLG A;  3ZG0 A;  4E3O A;  3QHY A;  5FAQ A;  1LLB A;  3PTE A;  2WUQ A;  3TOI A;  1I2S A;  4S2N A;  1H8Z A;  3PBT A;  4EUZ A;  4JPM A;  1HVB A;  3IXB A;  3MKE A;  4QD4 A;  1K54 C;  1K55 C;  4GOG A;  4KZ6 A;  3V5M A;  1IEM A;  2Y2I A;  5DTK A;  1K56 D;  5FA7 A;  3W8K A;  3O88 A;  3IF5 A;  2XGN A;  1W8Q A;  2Y2J A;  1PWD A;  2QZ6 A;  3O86 A;  5TFQ A;  1K57 C;  3G32 A;  3I7J A;  4WEJ A;  3LO7 A;  4BD0 A;  4E3I A;  5GHZ A;  3RJU A;  3HL9 A;  4E3J A;  3PBR A;  4MBH A;  1LL9 A;  5FAO A;  5HAR A;  4C6Y A;  3N7W A;  5AQ9 A;  1KE0 A;  4IVK A;  4QHC A;  3FKV A;  1FCO A;  3LEZ A;  1PZO A;  4N9L A;  2WZX A;  4PM9 A;  3OPP A;  1ZG4 A;  5AQB A;  5HFO A;  4WZ5 C;  2V20 A;  4GD6 A;  4JF6 A;  3EQU A;  5CER A;  1FCM A;  2Z2L B;  4GN2 A;  1KDS A;  1Y54 A;  4ZJ2 A;  1ESU A;  3N8R A;  3VMA A;  2XH9 A;  3HUO A;  2R9W A;  4M3K A;  1TDG A;  2Y4A A;  3SOI A;  4B4Z A;  3WS0 A;  5FI7 A;  2J9P A;  2EX2 A;  2QMI A;  1KGF A;  5A90 A;  1TEM A;  4KG5 A;  1GHI A;  2WYX A;  2XLN A;  3MXS A;  4E6X A;  1E3U D;  3BFC A;  3Q7Z A;  5HX9 A;  3MZE A;  3BFE A;  3MZF A;  1GA0 A;  5HAP A;  3UDF A;  3DW0 A;  4BQM A;  1SCW A;  4DE3 A;  4IBX A;  3ZFZ A;  4E3K A;  4WEK A;  5AQA A;  3LY3 A;  1ES3 A;  2XR0 A;  3OC2 A;  4RA7 A;  2PBY A;  1ALQ A;  3A3I A;  4K0W A;  3GVB A;  1HTZ A;  4Q8I A;  1BUL A;  1YLY A;  1ONH A;  5KMW A;  4XUZ A;  4R0Q A;  3P09 A;  4O7D A;  5AQ7 A;  4UA9 A;  2ZD8 A;  4E3L A;  4EWF A;  3IQA A;  1BT5 A;  1RGY A;  2JBF A;  3O87 A;  4NET A;  4KG2 A;  4KZA A;  2EFX A;  1CEG A;  1FQG A;  3VP4 A;  1ERQ A;  1FOF A;  3G2Y A;  1FR1 A;  3IF6 B;  3V39 A;  4DE0 A;  2Y2G A;  4XXR A;  4JF5 A;  4OP8 A;  4KZ4 A;  4RVA A;  2I72 A;  4BLM A;  5CTM A;  4Y0O A;  1K6R A;  1SHV A;  1ZC2 A;  3VP3 A;  2H0Y A;  3PAG A;  4RX3 A;  1GHP A;  5FQ9 A;  3HVF A;  1E4D A;  1PW8 A;  1JWZ A;  4OPY A;  3UDX A;  3VOY A;  4HEF A;  5CHJ A;  2H0T A;  1WYB A;  2WAD A;  3SH9 A;  4BD1 A;  1JWV A;  4P6B A;  1H8Y A;  4Y7P A;  4ID4 A;  4PM7 A;  4LCM A;  1YLJ A;  1PI4 A;  2H5S A;  3CMZ A;  3A3D A;  3MZD A;  4OON A;  4PMA A;  3SS4 A;  3S4X A;  5GLB A;  5E2E A;  3WS5 A;  1C3B A;  2Y55 A;  3OZH A;  1NXY A;  1IEL A;  2ZM8 A;  1S0W A;  1E3U A;  3OCL A;  4H8R A;  4KQR A;  4GB7 A;  5CGX A;  2A3U A;  4WMC D;  3SH7 A;  3VP0 A;  5FAT A;  1IYS A;  1YQS A;  1NZO A;  4QU3 A;  2ZC3 B;  5CTN A;  4C75 A;  2V1Z A;  4DDS A;  5HL1 A;  4N1X A;  2C6W B;  4S2L A;  5CHU A;  3UE3 A;  3UY6 A;  5HW3 A;  3HLC A;  1FSY A;  1PI5 A;  3ZVW A;  1CEF A;  1W79 A;  4GNU A;  5GLD A;  2Y2K A;  2WKE A;  4DE2 A;  5EVI D;  1M40 A;  3HRE A;  3NIA A;  2WZZ A;  4ZAM A;  1NY0 A;  2X71 A;  1MBL A;  2Z2M B;  4S2M A;  4KZ3 A;  1NYY A;  3IF6 A;  1NJ4 A;  4KZ9 A;  3NBL A;  4U0X A;  1CI9 A;  2HDQ A;  3EQV A;  5J8X A;  3FYZ A;  1ES4 A;  1JTG A;  4GDN A;  4C3Q A;  1EI5 A;  5DTS A;  5CHM A;  1WYC A;  2P9V A;  2WGW A;  4FSF A;  1MWT A;  3CG5 A;  4PM8 A;  4MBF A;  3ITA A;  1VQQ A;  3BRM A;  1K54 A;  1K55 A;  2G2W A;  3A3F A;  2Y2Q A;  4OH0 A;  4PPR A;  4ZTK A;  1XA1 A;  1WE4 A;  3A3J A;  2Y2N A;  1MXO A;  3FV7 A;  1W5D A;  2PU4 A;  4KZB A;  4R3J A;  3P98 A;  3S22 A;  1XPB A;  4F94 A;  4JF4 A;  5FAP A;  2ZM0 A;  1EWZ A;  1L0G A;  3V50 A;  3N4I A;  1YLT A;  4WYY A;  2A49 A;  1K57 A;  1L0F A;  2DNS A;  2HDU A;  5GHY A;  4GD8 A;  1XP4 A;  5EUA A;  1IYQ A;  4IBR A;  1XGJ A;  4K91 A;  4QY5 A;  1G68 A;  5EE8 A;  5JYO A;  3DWZ A;  1IYO A;  2HP9 A;  3DWK A;  4QY6 A;  5KSH A;  1GHM A;  5CGS A;  2EX9 A;  4LV0 A;  5L2F A;  2Y2M A;  4WZ5 A;  3E2L A;  3A3E A;  4Z9Q A;  4EBP A;  1BLH A;  4OQG A;  3G31 A;  3SS5 A;  1TVF A;  3MBZ A;  3ISG A;  3IH8 A;  2FFY A;  4X56 A;  3FZC A;  3G35 A;  3M6H A;  4KZ7 A;  1ESI A;  1ES2 A;  1VM1 A;  3VSK A;  4BL2 A;  3C5A A;  1LL5 A;  4DDY A;  1DY6 A;  1L0E A;  3GSG A;  5FQK A;  2CC1 A;  3HLB A;  4UHU A;  5EVI C;  4JXG A;  3N8L A;  3UPN A;  1CI8 A;  4RX2 A;  1KVL A;  5DF7 A;  5BOH A;  1RGZ A;  1QMF A;  4KG6 A;  5DF8 A;  5FI2 A;  4DKI A;  1ONG A;  4K0X A;  2Q9M A;  1YM1 A;  3NI9 A;  4XUX A;  3UPO A;  1MY8 A;  5CEC A;  1OME A;  5CGW A;  1I5Q A;  1W8Y A;  3IHA A;  5CED A;  5F82 A;  4JKT A;  2X01 A;  5E2H A;  3RXX A;  3ZHH A;  5M19 A;  3N8S A;  1M6K A;  5TR7 A;  5FI6 A;  2QPN A;  2Y91 A;  4L0L A;  1K56 A;  1KE3 A;  1PIO A;  2XFT A;  4X53 A;  1GA9 A;  2RCX A;  2V2F F;  4OOL A;  5F83 A;  4A5R A;  1H5X A;  2FFF B;  1K4E A;  1ES5 A;  3UE1 A;  1L0D A;  1DJA A;  3G30 A;  1ERO A;  5GL9 A;  5TGF A;  1LI0 A;  4DXB A;  1MWR A;  1RCJ A;  5KZH A;  1YT4 A;  3BM6 A;  2WGW B;  2P9V B;  4S2O A;  5E2F A;  1CK3 A;  2HDS A;  3V3S A;  2XDM A;  4E3M A;  4LV2 A;  1SDE A;  1U60 A;  3TG9 A;  3CJM A;  5HAI A;  3Q82 A;  4WM9 A;  4EQI A;  2XK1 A;  1KGG A;  2EXB A;  4BEN A;  3C4P A;  3UN7 A;  3G34 A;  2WGV A;  1ERM A;  4N92 A;  3BEC A;  2XF3 A;  1FR6 A;  3B3X A;  3PAE A;  3VP1 A;  4R23 A;  1W7F A;  2XEP A;  2XQZ A;  3G4P A;  3HLD A;  4OPR A;  4HBT A;  3BFD A;  1MWS A;  4UA6 A;  4IVI A;  4UA7 A;  3ZG9 B;  5FQI A;  2ZQA A;  5EEC A;  4LV3 A;  5EVL A;  5GLA A;  2WAE A;  5F1G A;  3VP2 A;  4KQQ A;  3AGE A;  3HUM A;  4OOY A;  5KSC A;  3GQZ A;  4DE1 A;  4OLD A;  4BJP A;  1O07 A;  3UO9 A;  4D2O A;  3UDI A;  4U3T A;  4FH2 A;  2JE5 A;  1IYP A;  2XD1 A;  3HBR A;  1BUE A;  3HLF A;  2HP6 A;  3Q7V B;  4KZ8 A;  1O7E A;  1PWG A;  3WS1 A;  2Y2H A;  4N1H A;  4BL3 A;  2Y2L A;  1NRF A;  1KE4 A;  1YLZ A;  2ZC7 A;  5EVI B;  3NY4 A;  4DF6 A;  4JXV A;  4RYE A;  5CXW A;  4N9K A;  4GDB A;  1YMS A;  3PBO A;  1JVJ A;  4B88 A;  4EBL A;  4Y0T A;  4QJG A;  1LI9 A;  5FQQ A;  3UPP A;  4IED A;  3IT9 A;  4MEZ A;  1ZG6 A;  5FDH A;  1BLC A;  1JTD A;  4WBG A;  4HBU A;  2EFU A;  3DTM A;  2ZM2 A;  1N9B A;  2P74 A;  1RP5 A;  4JBF A;  1E25 A;  1SDN A;  2ZMA A;  4OPQ A;  4WZ4 A;  2ZJ9 A;  2PU2 A;  3ZG7 B;  2VGJ A;  1KVM A;  2ZC4 B;  4JXS A;  1SKF A;  4OP5 A;  4CPK A;  1MWU A;  1NZU A;  3BYD A;  4GKU A;  1XA7 A;  1Z6F A;  4EBN A;  5CRF A;  2H10 A;  4R4R A;  3BLM A;  1TDL A;  3GRJ A;  2J8Y A;  4X69 A;  3SS3 A;  2GDN A;  3N6I A;  4WEL A;  3OPL A;  5JYP A;  3IH9 A;  5EPH A;  4S2N C;  4DXC A;  3SH8 A;  3IXH A;  3BEB A;  3WS4 A;  3W4Q A;  3CZD A;  1K4F A;  3NDE A;  5DTT A;  2ZC5 B;  3ITB A;  4P0M A;  3WWX A;  2XD5 A;  2UWX A;  1Q2Q A;  1DJC A;  4P85 A;  4WMC A;  2DCF A;  3VSL A;  2HP5 A;  5D3O A;  3C7U A;  1PYY A;  2EX6 A;  1HD8 A;  1K38 A;  4R3B A;  3HLW A;  3Q7V A;  2OSU A;  2C5W B;  1XGI A;  2HPB A;  3AGD A;  4JXW A;  5FQM A;  1PZP A;  4S2I A;  5IHV A;  4LCL A;  5CEB A;  2ZQ8 A;  5EVI A;  4ZJ1 A;  1XXM A;  2ZQ9 A;  3RXW A;  4HES A;  3BLS A;  4OPZ A;  3ZNY A;  4OQH A;  5FSR A;  2B5R A;  3AGF A;  1DJB A;  1KGE A;  4UAA A;  4CJN A;  3W4O A;  2BG1 A;  1K6S A;  5DF9 A;  3QNB A;  2J9O A;  1BLP A;  3BFG A;  4EV4 A;  5E43 A;  3GR2 A;  2X02 A;  2BLS A;  4OVD A;  4KEN B;  4S2K A;  3MKF A;  2ZC6 B;  3HUN A;  3MFD A;  3O3V A;  4QB8 A;  3W4P A;  3VFF A;  4U0T A;  1LHY A;  1QME A;  5I94 A;  3ZG5 A;  3IWI A;  3IXD A;  4YIN A;  1YLW A;  1G6A A;  1HZO A;  5E2G A;  3M6B A;  1BTL A;  1KDW A;  1YLP A;  2VGK A;  5G18 A;  1YMX A;  3UE0 A;  3IWQ A;  4OQI A;  4LEN A;  3ZGA B;  3PBN A;  4LV1 A;  2IWC A;  3V3R A;  3Q1F A;  3VOZ A;  2OLV A;  4NK3 A;  1XKZ A;  4R4S A;  1MKI A;  4E6W A;  2IWD A;  2RL3 A;  4KZ5 A;  4YFM A;  2JC7 A;  5M1A A;  3C7V A;  5M18 A;  3PBS A;  3HLG A;  1J9M A;  4R1G A;  3HLE A;  1IKI A;  2DRW A;  2Y2P A;  1BSG A;  1FSW A;  4OOM A;  1FCN A;  4E3N A;  4S2P A;  1IKG A;  3ZCZ A;  2EX8 A;  1L2S A;  1N4O A;  3LY4 A;  3LCE A;  4FD8 A;  2Y2O A;  3GTC A;  3PBQ A;  4Y0U A;  2ZQC A;  1PWC A;  4MBK A;  4PM6 A;  3UNW A;  1GCE A;  3GMW A;  3NC8 A;  5EOE A;  2OV5 A;  4ZBE A;  3Q07 A;  3NDG A;  3IWO A;  3ZDJ A;  2G2U A;  4B4X A;  4KQO A;  1S6R A;  3ZG8 B;  4ZJ3 A;  2WKI A;  1ZKJ A;  4OQ0 A;  4MLL A;  4ZDX A;  2XFS A;  3BFF A;  3E2K A;  2ZLY A;  4OKP A;  4FH4 A;  2ZQD A;  3FKW A;  3ZVT A;  3OCN A;  4X6T A;  4PM5 A;  5EOO A;  3TSG A;  3OPR A;  3QNC A;  5A93 A;  3D4F A;  3M2K A;  2Y59 A;  3M2J A;  5F1F A;  2HDR A;  1K25 A;  4GZB A;  4DRT A;  3G2Z A;  2WKH A;  3WS2 A;  2WK0 A;  1JWP A;  3WRT A;  3FWL A;  3Q81 A;  3ZNT A;  1XX2 A;  5FAS A;  5HAQ A;  4P87 A;  5GHX A;  4S2J A;  5A92 A;  1BZA A;  3JYI A;  5FQJ A;  3OPH A;  2IWB A;  2WGI A;  1MPL A;  4JLF A;  2Q9N A;  2EXA A;  3C4O A;  5A91 A;  3IXG A;  1BLS A;  3GV9 A;  1I2W A; 
#chains in the Genus database with same CATH topology
 4MNR A;  4F3L B;  1FIL A;  3LGO A;  1Z09 A;  2E8I A;  2NUP C;  4IUH A;  3IF6 C;  5DVA A;  2ZQ7 A;  4E3O A;  5FAQ A;  3PTE A;  5AJG A;  3T4O A;  4JPM A;  5DJU A;  1K54 C;  1K55 C;  4GOG A;  1V9Y A;  1K56 D;  5FA7 A;  3A0S A;  1VEU A;  3IF5 A;  3O86 A;  1K57 C;  3I7J A;  3TE8 A;  3RJU A;  3HL9 A;  2P04 A;  5HAR A;  1LL9 A;  5FAO A;  4N9L A;  1ZG4 A;  4R70 A;  2BTF P;  4DMZ A;  4JF6 A;  5CER A;  3KSG A;  1H3Q A;  4PHT A;  4GW9 A;  4F3L A;  2R9W A;  4BBT A;  4Y17 A;  5FI7 A;  5IU1 A;  2EX2 A;  4KG5 A;  2QJ5 A;  4HP4 A;  4E6X A;  3P7N A;  3BFE A;  4BQM A;  4DN0 A;  3PYP A;  3LY3 A;  3OC2 A;  4LRX C;  4Q8I A;  1BUL A;  3UB9 A;  2ZD8 A;  4E3L A;  3VV4 A;  4NET A;  4KZA A;  3G2Y A;  4DE0 A;  1PNE A;  1G28 A;  3MXQ A;  1ODV A;  2KOI A;  3O5Y A;  2PYP A;  4UQI M;  3S7O A;  1YLJ A;  3SS4 A;  1C3B A;  2Y55 A;  3OZH A;  3OCL A;  4GB7 A;  4IHQ A;  3VP0 A;  4QU3 A;  4ZRR A;  4N1X A;  3UE3 A;  3HLC A;  1FSY A;  1PI5 A;  3ZVW A;  4EW7 A;  5FEF A;  2LB5 A;  3NIA A;  2Z2M B;  1CI9 A;  3D3O A;  3GEC A;  3ITA A;  4WN5 A;  2G2W A;  3A3F A;  4EUV A;  1OT9 A;  3NHQ A;  4F94 A;  1XPB A;  1HLU P;  4JF4 A;  1P0Z A;  2A49 A;  1L0F A;  3IBJ A;  2DNS A;  2HDU A;  5GHY A;  4IBR A;  4QY5 A;  1G68 A;  5EE8 A;  4QY6 A;  2EX9 A;  1WA9 A;  2M7U A;  2LB9 A;  3CUE A;  4OQG A;  3G31 A;  3LFV A;  3SS5 A;  3ISG A;  3EEH A;  4M4X A;  4X56 A;  1VM1 A;  2ZBB A;  5FQK A;  3CIT A;  4JXG A;  3N8L A;  1CI8 A;  1KVL A;  4MDZ A;  3CI6 A;  5DF8 A;  2Q9M A;  4XUX A;  1MY8 A;  5CEC A;  3T1Q B;  2OWH A;  1IOU A;  5E2H A;  3ZHH A;  2PBD P;  5FI6 A;  2W1T B;  2QPN A;  4L0L A;  3LID A;  5AVE A;  4A5R A;  1H5X A;  2XA7 M;  1K4E A;  4HH2 A;  1T1B A;  1DP6 A;  1L0D A;  2VV7 A;  1OT6 A;  2V8C A;  4HOI A;  5KZH A;  5HZH A;  3BM6 A;  2WGW B;  2INW A;  3LI9 A;  1U60 A;  1PRQ A;  2M1C A;  4EQI A;  2EXB A;  4HJ3 A;  3EOI A;  3G34 A;  2WGV A;  3BEC A;  2XF3 A;  3PAE A;  4Z1W A;  2VGL S;  1W7F A;  2XEP A;  3HLD A;  4R23 A;  3BFD A;  1OTA A;  1MWS A;  3A0V A;  2VLG A;  4UA7 A;  5FQI A;  5EEC A;  2QHK A;  4LV3 A;  5GLA A;  3VE4 A;  5F1G A;  3T4L A;  4BBV A;  3AGE A;  4OOY A;  3GQZ A;  2PYR A;  1O07 A;  3VE3 A;  4D2O A;  2EWV A;  2W1T A;  5DFY A;  3HBR A;  3WS1 A;  2Y2H A;  3DAV A;  4N1H A;  1NRF A;  1KE4 A;  4LRY C;  2VV8 A;  2EWW A;  2ZOI A;  1YMS A;  4B88 A;  3UPP A;  4IED A;  4LGW A;  2O9A A;  3FC7 A;  1ZG6 A;  1SKO B;  4HBU A;  3DTM A;  5L10 A;  1Y4O A;  1RP5 A;  4CLC B;  2KLI A;  1SDN A;  4WZ4 A;  2PU2 A;  2ZC4 B;  4JXS A;  1SKF A;  1N9L A;  2VZW A;  1MWU A;  1TS8 A;  3GRJ A;  1XJ3 A;  2GDN A;  3SH8 A;  3F1P B;  5DTT A;  3ITB A;  5HD3 A;  2WKR A;  3C8C A;  3C7U A;  2ZMV A;  3NUL A;  4R3B A;  3AGD A;  4JXW A;  1PZP A;  5IHV A;  2PHY A;  2ZQ8 A;  3BW6 A;  4ZJ1 A;  2GJ3 A;  1XJ6 A;  1OTB A;  4HES A;  1DJB A;  2BG1 A;  3QNB A;  2J9O A;  4EV4 A;  2X02 A;  1SKO A;  4OVD A;  4KEN B;  3CPT B;  3CHW P;  4CLC A;  3HUN A;  3O3V A;  4MN5 A;  5AVF A;  4X1M A;  4EXO A;  3IXD A;  2O0Y A;  2W3F A;  4Y3I A;  1NLZ A;  3T50 A;  3BQA A;  3ZGA B;  3PBN A;  3F1P A;  3R4K A;  4R38 A;  3Q1F A;  1XKZ A;  4R6L A;  3H82 B;  4KZ5 A;  2JC7 A;  5MC7 A;  3HJK A;  3HLE A;  1IKI A;  1FSW A;  1IKG A;  4I5S A;  1NWZ A;  3LCE A;  2Y2O A;  3PBQ A;  2ZQC A;  2E8J A;  1PWC A;  2CMN A;  4MBK A;  1GCE A;  2OV5 A;  4LFU A;  1ZTU A;  3LIF A;  2WKI A;  1ZKJ A;  3CPT A;  4X25 A;  4ZDX A;  5J3W A;  2ZQD A;  3FKW A;  5HPI A;  5J4E A;  3TSG A;  5A93 A;  2J3T D;  5F1F A;  4GZB A;  3MF0 A;  2NUT C;  4DRT A;  3WS2 A;  1JWP A;  3ZNT A;  3Q81 A;  5EM1 A;  5FAS A;  5HDC A;  4S2J A;  1BZA A;  1MKM A;  3OPH A;  4EQ1 A;  2Q9N A;  3C4O A;  2PRF A;  3H82 A;  5F69 A;  4FCF A;  1TF1 A;  4FUW A;  2R9X A;  3IHB A;  3S1Y A;  1OJ5 A;  2J7V A;  2GX5 A;  3U2A A;  1AXB A;  1LLB A;  1I2S A;  4HNB A;  1HVB A;  3MKE A;  4HIA A;  2W3G A;  4O8G A;  1XJ4 A;  3MSH A;  3V5M A;  3LR4 A;  3QP4 A;  3O88 A;  5DKL A;  2QZ6 A;  5A8B A;  4L9F A;  3LO7 A;  2PT7 A;  1KE0 A;  2P7J A;  4QHC A;  3LEZ A;  1PZO A;  2V20 A;  1FCM A;  2Z2L B;  1Y54 A;  3E4Q A;  3MS6 A;  5EFW A;  1F9I A;  2XH9 A;  3HUO A;  1DRM A;  1TDG A;  1ACF A;  3F1N B;  4NXE A;  2QMI A;  1TEM A;  3MXS A;  3FPV A;  3E4O A;  5HX9 A;  3UDF A;  1YAX A;  4DE3 A;  3ZFZ A;  4ARZ B;  2PBY A;  3A3I A;  1YLY A;  1ONH A;  3UB6 A;  3TW8 A;  5KMW A;  4Y15 A;  4EWF A;  3IQA A;  1BT5 A;  1ERQ A;  1FR1 A;  4JF5 A;  4OP8 A;  2I72 A;  4BLM A;  5HPF A;  1S1Z A;  4L9G A;  3VP3 A;  4HI4 A;  3QP6 A;  3K3D A;  1JWZ A;  5I5L A;  4LRZ E;  3FPW A;  3F1N A;  4BD1 A;  1JWV A;  1H8Y A;  4Y7P A;  1A0K A;  2PD8 A;  5HWV A;  3A3D A;  4GCZ A;  3S4X A;  5GLB A;  1X0O A;  4L9E A;  5DJT A;  4ARZ A;  4WMC D;  5CTN A;  1FIK A;  2WKP A;  2IA2 A;  5IS1 A;  1W79 A;  1N9O A;  4DE2 A;  5EVI D;  1M40 A;  3HRE A;  2GZA A;  4KZ3 A;  1NJ4 A;  1ES4 A;  4C3Q A;  3U4L P;  5DTS A;  1WYC A;  2P9V A;  2J3W A;  4FSF A;  4MBF A;  1VQQ A;  2OAQ 1;  4OH0 A;  2XRO A;  5IT5 A;  3A3J A;  1W5D A;  3S22 A;  5FAP A;  2OWJ A;  1EWZ A;  2O9C A;  1YLT A;  4WYY A;  1STZ A;  4GD8 A;  5EUA A;  2HJE A;  2A24 A;  5JYO A;  3DWZ A;  4UQI S;  2HP9 A;  5KSH A;  4LV0 A;  5L2F A;  2Y2M A;  3KYQ A;  3QP5 A;  3E2L A;  4HP9 A;  4HJ4 A;  3MBZ A;  3FZC A;  3H7W A;  3M6H A;  4H6J B;  3T1R A;  1L0E A;  2W27 A;  2V9A A;  3IBR A;  5HWT A;  5DF7 A;  1RGZ A;  4KG6 A;  3RFB A;  1YM1 A;  4GS9 A;  1I5Q A;  1W8Y A;  4CLC C;  1S4S A;  3N8S A;  1M6K A;  1G5U A;  2Y91 A;  1K56 A;  1KE3 A;  1PIO A;  2XFT A;  4X53 A;  5G4Z A;  1GA9 A;  1KOU A;  2RCX A;  4ETX A;  2FFF B;  3G6O A;  2V0U A;  1ERO A;  1LI0 A;  1N9N A;  4IJG A;  4DXB A;  1RCJ A;  3RTY A;  1P9W A;  1LSX A;  5E2F A;  4S2O A;  4P6Z M;  2XDM A;  4E3M A;  5HAI A;  2XK1 A;  3DTI A;  1KGG A;  3C4P A;  4H6J A;  3UN7 A;  1ERM A;  4HHD A;  4N92 A;  3VP1 A;  4UA6 A;  1CJF A;  2WAE A;  5J7E A;  3VP2 A;  5KSC A;  4DE1 A;  4OLD A;  4BJP A;  4X1L A;  3UO9 A;  5HWW A;  1LL8 A;  2XD1 A;  1IYP A;  4KZ8 A;  5G4Y A;  3LR3 A;  4DF6 A;  3NY4 A;  4JXV A;  4N9K A;  4EEP A;  3FG8 A;  1VB6 A;  5FQQ A;  2XA7 S;  3IT9 A;  4MEZ A;  4LPZ A;  2W3H A;  5FDH A;  1BLC A;  1N9B A;  2P74 A;  1E25 A;  1VET A;  2ZJ9 A;  1P97 A;  3ZG7 B;  1KVM A;  2ZOH A;  2ZMF A;  5DKK A;  4OP5 A;  4CPK A;  1GSW A;  5FDS A;  4R4R A;  1D1J A;  1T1C A;  1TDL A;  2J8Y A;  4X69 A;  2L4R A;  3SS3 A;  3N6I A;  5JYP A;  3OPL A;  4DXC A;  3TJZ C;  3WS4 A;  3CZD A;  3PR6 A;  2XD5 A;  2W3E A;  2UWX A;  1D06 A;  1Q2Q A;  2HP5 A;  1HD8 A;  2C5W B;  2XSS A;  5CEB A;  1XXM A;  3RXW A;  1OTE A;  3KO6 A;  3BLS A;  4OPZ A;  1K6S A;  5DF9 A;  1AWI A;  2BLS A;  2ZC6 B;  4YNR A;  3T1X A;  3MFD A;  2EA9 A;  3W4P A;  4U0T A;  1QME A;  4GJ4 A;  4EET B;  3T4S A;  2AVX A;  1G6A A;  5E2G A;  4I38 A;  2O99 A;  2VGK A;  1YMX A;  3IWQ A;  4OQI A;  4LV1 A;  4PKY A;  1EW0 A;  3VOZ A;  4WUJ A;  5C5K A;  1MKI A;  4E6W A;  2IWD A;  4EES A;  5M1A A;  5M18 A;  1S1Y A;  3IX4 A;  3CLO A;  1DP9 A;  3ZCZ A;  1L2S A;  3LIE A;  1YSQ A;  3GTC A;  4Y0U A;  3JVV A;  4PM6 A;  3QP8 A;  4JGQ A;  3NC8 A;  2OOL A;  5EOE A;  3KSI A;  2D01 A;  3ZDJ A;  2G2U A;  3LIC A;  2H28 A;  3BY8 A;  2HJ9 C;  3D4F A;  4Y13 A;  2Y59 A;  1XX2 A;  5HAQ A;  4P87 A;  5FQJ A;  3OBF A;  2IWB A;  4JLF A;  1MPL A;  1BLS A;  2VK3 A;  1J3W A;  2OLU A;  2JCH A;  3NCK A;  4D60 A;  3WRZ A;  4Q0H A;  5DFX A;  1F98 A;  2WAF A;  4I3J A;  4S2N A;  4FTX A;  4EUZ A;  3IXB A;  4DJ2 A;  1IEM A;  2Y2I A;  5DTK A;  1LSV A;  3BJN A;  1H0M A;  1PWD A;  4WEJ A;  4BD0 A;  4KQD A;  4Y5F A;  4E3J A;  4KUO A;  5AQ9 A;  4IVK A;  4WL9 A;  3UB7 A;  3FKV A;  4PM9 A;  2I9V A;  5TBM B;  2B02 A;  4ZJ2 A;  4O0P A;  3N8R A;  4IUK A;  4R3A A;  3VMA A;  4M3K A;  2Y4A A;  4NXF A;  4B4Z A;  3WS0 A;  1MZU A;  3LR0 A;  1KGF A;  1P9R A;  1GHI A;  2WYX A;  5F68 A;  2XLN A;  2DMW A;  3Q7Z A;  2B18 A;  3MZE A;  2PDR A;  3MZF A;  5HAP A;  4IBX A;  1V9Z A;  4E3K A;  2JHE A;  4WEK A;  2XR0 A;  4RA7 A;  2JKF A;  4MCW A;  4O7D A;  5AQ7 A;  4UA9 A;  5K5B A;  2EFX A;  3DTE A;  4WF0 A;  3VP4 A;  3V39 A;  4XXR A;  4RVA A;  5CTM A;  1K6R A;  5TBM A;  2H0Y A;  4RX3 A;  1GHP A;  5FQ9 A;  3HVF A;  2Z6D A;  1PW8 A;  3C2W A;  4OPY A;  5CHJ A;  2WAD A;  3SH9 A;  3T4J A;  3E4P A;  3UE6 A;  4PMA A;  3CMZ A;  2W0N A;  4OON A;  1NXY A;  3CAX A;  3DTK A;  5CGX A;  3LR5 A;  2A3U A;  3SH7 A;  1LSW A;  4DDS A;  2V1Z A;  4S2L A;  2C6W B;  5CHU A;  3UY6 A;  1CEF A;  2K31 A;  4ZAM A;  1NY0 A;  2X71 A;  1MBL A;  2FH5 A;  3T1S A;  2HDQ A;  3E0Y A;  3FYZ A;  4QPR A;  1EI5 A;  4I3A A;  1MWT A;  3NOP C;  5FL3 A;  4PPR A;  1WE4 A;  2Y2N A;  1MXO A;  4KZB A;  4R3J A;  4WLA A;  2ZM0 A;  1L0G A;  3V50 A;  1UWP X;  5CX7 A;  1W63 Q;  1XP4 A;  4K91 A;  3D72 A;  3LIB A;  2V1B A;  3RH8 B;  1IYO A;  3DWK A;  4WZ5 A;  4Z9Q A;  3CUE C;  2W1R A;  4EBP A;  4QWO A;  1OTD A;  3IH8 A;  2FFY A;  3G35 A;  4EU0 A;  4KZ7 A;  3VSK A;  3EGD C;  2MJ6 A;  3C5A A;  2VJW A;  3LI8 A;  4JGO A;  1DY6 A;  3GSG A;  2CC1 A;  3HLB A;  3UPN A;  3K2N A;  3T4K A;  3LUQ A;  4DKI A;  4NKP A;  1XJ2 A;  4LLO B;  2W3D A;  4CLC E;  3UPO A;  4G3V A;  3NEC A;  5F82 A;  5HDD A;  2X01 A;  3RXX A;  3ZQ5 A;  4I39 A;  5F5Y A;  3C30 A;  1DP8 A;  3LYX A;  3R7W B;  1K0K A;  4OOL A;  4NEE D;  1YT4 A;  4Y2F A;  2P9V B;  3KYZ A;  2HDS A;  3V3S A;  1UGU A;  1SDE A;  3TG9 A;  4WM9 A;  4BEN A;  4PKY G;  4NG2 A;  2A2L A;  1FR6 A;  2XQZ A;  3G4P A;  2ACG A;  2A24 B;  3ZG9 B;  5EVL A;  1S67 L;  2UV0 E;  4KQQ A;  3HUM A;  3S7N A;  1SZV A;  5HDS A;  3UDI A;  3L9K A;  3H7W B;  3R7W A;  3Q7V B;  2PAV P;  1PWG A;  4DJ3 A;  2L1M A;  2Y2L A;  5EVI B;  3EGX C;  1YLZ A;  3NOT C;  4RYE A;  5CXW A;  1OPX A;  4GDB A;  3PXP A;  4EBL A;  4Y0T A;  4QJG A;  4PAU A;  1G6O A;  2O9B A;  1ZHH B;  1JTD A;  4GS9 B;  2ZM2 A;  4JBF A;  2ZMA A;  1LT0 A;  3OLO A;  4P6Z S;  1NZU A;  3BYD A;  4GKU A;  1XA7 A;  4EBN A;  3EEA A;  4WEL A;  3IH9 A;  5EPH A;  4S2N C;  3BEB A;  3A0R A;  2JKT I;  3NDE A;  2ZC5 B;  3WWX A;  1TS7 A;  4P85 A;  4WMC A;  3VSL A;  4GHI B;  1PYY A;  1K38 A;  3HLW A;  3Q7V A;  1XGI A;  4II7 A;  2HPB A;  4S2I A;  3HJI A;  5EVI A;  2ZQ9 A;  4OQH A;  3AGF A;  1L3L A;  4UAA A;  3KSF A;  2JKR I;  4B9O A;  3BFG A;  3GR2 A;  3MKF A;  3S7P A;  1T1A A;  1NLY A;  3VFF A;  2JN7 A;  1LHY A;  3OOV A;  5I94 A;  3ZG5 A;  3IWI A;  4YIN A;  3T4T A;  1HZO A;  2QJ7 A;  3UE0 A;  2HV1 A;  3V3R A;  2OLV A;  4NK3 A;  3T12 B;  4R4S A;  2RL3 A;  2R78 A;  3MJQ A;  4YFM A;  3C7V A;  3HLG A;  4GHI A;  1J9M A;  1PFL A;  4R1G A;  1VET B;  3C38 A;  2DRW A;  4YWZ A;  1FCN A;  3QP2 A;  1N4O A;  3KSH A;  3LY4 A;  4FD8 A;  5TJJ A;  3UNW A;  4ZBE A;  3Q07 A;  1S6R A;  3ZG8 B;  2XFS A;  3BFF A;  3E2K A;  1BYW A;  2ZLY A;  4OKP A;  4FH4 A;  3ZVT A;  4X6T A;  3OPR A;  3QNC A;  3UME A;  3MQ0 A;  3M2J A;  2HDR A;  3S7Q A;  4UEY A;  2P08 A;  3G2Z A;  2WKH A;  3WRT A;  3P01 A;  4XT2 B;  5GHX A;  4GLQ A;  5A92 A;  4ETZ A;  2WGI A;  5A91 A;  1I2W A;  2VX8 A;  3MXR A;  5U47 A;  2ZL1 B;  1PW1 A;  4X68 A;  1NYM A;  4ESP A;  3VFH A;  4ME4 A;  1Q2P A;  5GLC A;  4X55 A;  4OLG A;  3ZG0 A;  3QHY A;  2KX6 A;  2WUQ A;  3TOI A;  2VKS A;  1Y28 A;  1H8Z A;  4O01 A;  3PBT A;  4QD4 A;  3SZT A;  4KZ6 A;  3BY9 A;  3LIA A;  3W8K A;  2XGN A;  1W8Q A;  2Y2J A;  3TRC A;  5TFQ A;  3G32 A;  4E3I A;  4HH3 A;  5GHZ A;  1XFN A;  3PBR A;  4MBH A;  4C6Y A;  3N7W A;  2J3T C;  1FCO A;  1UWN X;  4XT2 A;  5AQB A;  2WZX A;  3OPP A;  5HFO A;  1CF0 A;  3QP1 A;  4WZ5 C;  4EER A;  2YKH A;  4GD6 A;  3EQU A;  4GN2 A;  1KDS A;  2VV6 A;  1YKD A;  1ESU A;  4BMW A;  2ZL1 A;  4Q0I A;  3SOI A;  2J9P A;  2BAS A;  2V1A A;  5A90 A;  1T18 A;  2B95 A;  1E3U D;  3BFC A;  1GA0 A;  3DW0 A;  2QYB A;  1SCW A;  2OAP 1;  5AQA A;  1ES3 A;  1ALQ A;  4K0W A;  3GVB A;  1HTZ A;  4XUZ A;  4R0Q A;  3P09 A;  3HCY A;  2JBF A;  1RGY A;  3O87 A;  4KG2 A;  1CEG A;  1FQG A;  2L0W A;  1GSV A;  1FOF A;  3IF6 B;  4MN6 A;  2Y2G A;  4KZ4 A;  4Y0O A;  1SHV A;  1ZC2 A;  2PR6 A;  3PAG A;  2K2N A;  2WKQ A;  4HJ6 A;  1E4D A;  5L8M A;  3UDX A;  5HD5 A;  3VOY A;  4HEF A;  2H0T A;  1WYB A;  2YKF A;  4P6B A;  3ULF A;  4ID4 A;  4PM7 A;  5L09 A;  2K7S A;  4LCM A;  1PI4 A;  2H5S A;  3ICY A;  3MZD A;  2G7U A;  5E2E A;  3WS5 A;  3JPU A;  1IEL A;  2ZM8 A;  1S0W A;  1E3U A;  4H8R A;  4KQR A;  3IS2 B;  5FAT A;  1IYS A;  1YQS A;  1NZO A;  4C75 A;  2ZC3 B;  2HGV A;  5HL1 A;  5HW3 A;  1F2K A;  3UMD A;  4GNU A;  2J80 A;  5GLD A;  2Y2K A;  3IX3 A;  2WKE A;  2M7V A;  2WZZ A;  3BQ8 A;  4S2M A;  1F5M A;  1NYY A;  3IF6 A;  4KZ9 A;  3UB5 P;  3NBL A;  4U0X A;  3EQV A;  5J8X A;  3B47 A;  1JTG A;  4GDN A;  3KYE A;  4B93 A;  5CHM A;  2WGW A;  3CG5 A;  3NOU C;  4PM8 A;  4CLC D;  1W63 M;  4G3W A;  5L07 A;  3BRM A;  1K54 A;  2JKT M;  2JKG A;  1K55 A;  5EM0 A;  3B33 A;  2Y2Q A;  4ZTK A;  1XA1 A;  2V0W A;  3FV7 A;  5LBR A;  2PU4 A;  3P98 A;  2VEA A;  3N4I A;  1K57 A;  1OJG A;  1IYQ A;  1XGJ A;  3F1O B;  3D9Y A;  1GHM A;  5CGS A;  3IS2 A;  4NXG A;  3A3E A;  1BLH A;  3MR0 A;  1TD5 A;  2HZ5 A;  1TVF A;  2JKR M;  2VGL M;  4NXB A;  3MFX A;  1ESI A;  1ES2 A;  4BL2 A;  4DDY A;  1LL5 A;  3K3C A;  4UHU A;  5EVI C;  4RX2 A;  5BOH A;  1QMF A;  5FI2 A;  1ONG A;  4K0X A;  4I3I A;  3NI9 A;  1OME A;  5CGW A;  3IHA A;  5CED A;  4JKT A;  3CWF A;  5M19 A;  2QWS A;  3BWL A;  5TR7 A;  3B42 A;  2Y79 A;  2V2F F;  5F83 A;  1GSX A;  5F6A A;  1ES5 A;  3UE1 A;  3F1O A;  1DJA A;  3G30 A;  5GL9 A;  5TGF A;  1MWR A;  3SW1 A;  3ZYT A;  1CK3 A;  3DBA A;  2PD7 A;  3KX0 X;  4LV2 A;  3MMH A;  1T19 A;  3CJM A;  3EWK A;  3Q82 A;  3V67 A;  4KUK A;  3VOL A;  1JNU A;  3B3X A;  4OPR A;  4HY8 A;  4HBT A;  4IVI A;  1NRJ A;  2D02 A;  2ZQA A;  4YOF A;  5HSQ A;  3W2Z A;  4U3T A;  4FH2 A;  4E04 A;  2JE5 A;  1S66 L;  1BUE A;  3HLF A;  2HP6 A;  3UB8 A;  1O7E A;  2Y8H A;  2GNX A;  1XFQ A;  4BL3 A;  2ZC7 A;  3PHY A;  3PBO A;  2Z6C A;  1JVJ A;  4G3K A;  1LI9 A;  4K08 A;  3JVU A;  3E98 A;  3NJA A;  4WBG A;  4MN7 A;  2EFU A;  2XRN A;  2VA0 A;  2Q0O A;  4OPQ A;  2VGJ A;  4AFI A;  1Z6F A;  2PR5 A;  5CRF A;  2H10 A;  3BLM A;  3IXH A;  3W4Q A;  1K4F A;  4RQ9 A;  4P0M A;  1DJC A;  2DCF A;  5D3O A;  1VHM A;  1MC0 A;  2EX6 A;  2OSU A;  5EVE A;  5FQM A;  4LCL A;  1CQA A;  4EEU A;  3ZNY A;  5FSR A;  2B5R A;  1KGE A;  2V8F A;  4CJN A;  3W4O A;  2KDK A;  2HF6 A;  1BLP A;  3MQQ A;  4JGP A;  4Q0J A;  5E43 A;  3GDI A;  4S2K A;  3L7H A;  4QB8 A;  1TS6 A;  1YLW A;  5HL6 A;  3M6B A;  1BTL A;  1KDW A;  4BBU A;  1YLP A;  5G18 A;  1H8M A;  3LEQ A;  4LEN A;  2IWC A;  1OTI A;  3T4Q A;  5FEG A;  3PBS A;  2Y2P A;  1BSG A;  4E3N A;  4OOM A;  4JGR A;  4S2P A;  2EX8 A;  1YSP A;  4CQH A;  1D7E A;  4BWI A;  3MQO A;  3GMW A;  2FZ0 A;  1IFQ A;  3NDG A;  3IWO A;  4B4X A;  4KQO A;  4ZJ3 A;  4OQ0 A;  3H9W A;  4MLL A;  5EV0 A;  1VEU B;  3OCN A;  1YPR A;  4PM5 A;  5EOO A;  3M2K A;  4MMN A;  1K25 A;  2QKP A;  5KIZ A;  2WK0 A;  3FWL A;  4HQA A;  1TS0 A;  3JYI A;  3IX8 A;  1S4R A;  2EXA A;  4FOF A;  3IXG A;  3GV9 A; 
#chains in the Genus database with same CATH homology
 3MXR A;  4MNR A;  5U47 A;  2OLU A;  4FCF A;  1PW1 A;  2JCH A;  2E8I A;  4X68 A;  2R9X A;  3NCK A;  1NYM A;  3IHB A;  3S1Y A;  3VFH A;  3WRZ A;  2J7V A;  3IF6 C;  1Q2P A;  5DVA A;  1AXB A;  5GLC A;  4X55 A;  2ZQ7 A;  2WAF A;  4OLG A;  3ZG0 A;  4E3O A;  3QHY A;  5FAQ A;  1LLB A;  3PTE A;  2WUQ A;  3TOI A;  1I2S A;  4S2N A;  1H8Z A;  3PBT A;  4EUZ A;  4JPM A;  1HVB A;  3IXB A;  3MKE A;  4QD4 A;  1K54 C;  1K55 C;  4GOG A;  4KZ6 A;  3V5M A;  1IEM A;  2Y2I A;  5DTK A;  1K56 D;  5FA7 A;  3W8K A;  3O88 A;  3IF5 A;  2XGN A;  1W8Q A;  2Y2J A;  1PWD A;  2QZ6 A;  3O86 A;  5TFQ A;  1K57 C;  3G32 A;  3I7J A;  4WEJ A;  3LO7 A;  4BD0 A;  4E3I A;  5GHZ A;  3RJU A;  3HL9 A;  4E3J A;  3PBR A;  4MBH A;  1LL9 A;  5FAO A;  5HAR A;  4C6Y A;  3N7W A;  5AQ9 A;  1KE0 A;  4IVK A;  4QHC A;  3FKV A;  1FCO A;  3LEZ A;  1PZO A;  4N9L A;  2WZX A;  4PM9 A;  3OPP A;  1ZG4 A;  5AQB A;  5HFO A;  4WZ5 C;  2V20 A;  4GD6 A;  4JF6 A;  3EQU A;  5CER A;  1FCM A;  2Z2L B;  4GN2 A;  1KDS A;  1Y54 A;  4ZJ2 A;  1ESU A;  3N8R A;  3VMA A;  2XH9 A;  3HUO A;  2R9W A;  4M3K A;  1TDG A;  2Y4A A;  3SOI A;  4B4Z A;  3WS0 A;  5FI7 A;  2J9P A;  2EX2 A;  2QMI A;  1KGF A;  5A90 A;  1TEM A;  4KG5 A;  1GHI A;  2WYX A;  2XLN A;  3MXS A;  4E6X A;  1E3U D;  3BFC A;  3Q7Z A;  5HX9 A;  3MZE A;  3BFE A;  3MZF A;  1GA0 A;  5HAP A;  3UDF A;  3DW0 A;  4BQM A;  1SCW A;  4DE3 A;  4IBX A;  3ZFZ A;  4E3K A;  4WEK A;  5AQA A;  3LY3 A;  1ES3 A;  2XR0 A;  3OC2 A;  4RA7 A;  2PBY A;  1ALQ A;  3A3I A;  4K0W A;  3GVB A;  1HTZ A;  4Q8I A;  1BUL A;  1YLY A;  1ONH A;  5KMW A;  4XUZ A;  4R0Q A;  3P09 A;  4O7D A;  5AQ7 A;  4UA9 A;  2ZD8 A;  4E3L A;  4EWF A;  3IQA A;  1BT5 A;  1RGY A;  2JBF A;  3O87 A;  4NET A;  4KG2 A;  4KZA A;  2EFX A;  1CEG A;  1FQG A;  3VP4 A;  1ERQ A;  1FOF A;  3G2Y A;  1FR1 A;  3IF6 B;  3V39 A;  4DE0 A;  2Y2G A;  4XXR A;  4JF5 A;  4OP8 A;  4KZ4 A;  4RVA A;  2I72 A;  4BLM A;  5CTM A;  4Y0O A;  1K6R A;  1SHV A;  1ZC2 A;  3VP3 A;  2H0Y A;  3PAG A;  4RX3 A;  1GHP A;  5FQ9 A;  3HVF A;  1E4D A;  1PW8 A;  1JWZ A;  4OPY A;  3UDX A;  3VOY A;  4HEF A;  5CHJ A;  2H0T A;  1WYB A;  2WAD A;  3SH9 A;  4BD1 A;  1JWV A;  4P6B A;  1H8Y A;  4Y7P A;  4ID4 A;  4PM7 A;  4LCM A;  1YLJ A;  1PI4 A;  2H5S A;  3CMZ A;  3A3D A;  3MZD A;  4OON A;  4PMA A;  3SS4 A;  3S4X A;  5GLB A;  5E2E A;  3WS5 A;  1C3B A;  2Y55 A;  3OZH A;  1NXY A;  1IEL A;  2ZM8 A;  1S0W A;  1E3U A;  3OCL A;  4H8R A;  4KQR A;  4GB7 A;  5CGX A;  2A3U A;  4WMC D;  3SH7 A;  3VP0 A;  5FAT A;  1IYS A;  1YQS A;  1NZO A;  4QU3 A;  2ZC3 B;  5CTN A;  4C75 A;  2V1Z A;  4DDS A;  5HL1 A;  4N1X A;  2C6W B;  4S2L A;  5CHU A;  3UE3 A;  3UY6 A;  5HW3 A;  3HLC A;  1FSY A;  1PI5 A;  3ZVW A;  1CEF A;  1W79 A;  4GNU A;  5GLD A;  2Y2K A;  2WKE A;  4DE2 A;  5EVI D;  1M40 A;  3HRE A;  3NIA A;  2WZZ A;  4ZAM A;  1NY0 A;  2X71 A;  1MBL A;  2Z2M B;  4S2M A;  4KZ3 A;  1NYY A;  3IF6 A;  1NJ4 A;  4KZ9 A;  3NBL A;  4U0X A;  1CI9 A;  2HDQ A;  3EQV A;  5J8X A;  3FYZ A;  1ES4 A;  1JTG A;  4GDN A;  4C3Q A;  1EI5 A;  5DTS A;  5CHM A;  1WYC A;  2P9V A;  2WGW A;  4FSF A;  1MWT A;  3CG5 A;  4PM8 A;  4MBF A;  3ITA A;  1VQQ A;  3BRM A;  1K54 A;  1K55 A;  2G2W A;  3A3F A;  2Y2Q A;  4OH0 A;  4PPR A;  4ZTK A;  1XA1 A;  1WE4 A;  3A3J A;  2Y2N A;  1MXO A;  3FV7 A;  1W5D A;  2PU4 A;  4KZB A;  4R3J A;  3P98 A;  3S22 A;  1XPB A;  4F94 A;  4JF4 A;  5FAP A;  2ZM0 A;  1EWZ A;  1L0G A;  3V50 A;  3N4I A;  1YLT A;  4WYY A;  2A49 A;  1K57 A;  1L0F A;  2DNS A;  2HDU A;  5GHY A;  4GD8 A;  1XP4 A;  5EUA A;  1IYQ A;  4IBR A;  1XGJ A;  4K91 A;  4QY5 A;  1G68 A;  5EE8 A;  5JYO A;  3DWZ A;  1IYO A;  2HP9 A;  3DWK A;  4QY6 A;  5KSH A;  1GHM A;  5CGS A;  2EX9 A;  4LV0 A;  5L2F A;  2Y2M A;  4WZ5 A;  3E2L A;  3A3E A;  4Z9Q A;  4EBP A;  1BLH A;  4OQG A;  3G31 A;  3SS5 A;  1TVF A;  3MBZ A;  3ISG A;  3IH8 A;  2FFY A;  4X56 A;  3FZC A;  3G35 A;  3M6H A;  4KZ7 A;  1ESI A;  1ES2 A;  1VM1 A;  3VSK A;  4BL2 A;  3C5A A;  1LL5 A;  4DDY A;  1DY6 A;  1L0E A;  3GSG A;  5FQK A;  2CC1 A;  3HLB A;  4UHU A;  5EVI C;  4JXG A;  3N8L A;  3UPN A;  1CI8 A;  4RX2 A;  1KVL A;  5DF7 A;  5BOH A;  1RGZ A;  1QMF A;  4KG6 A;  5DF8 A;  5FI2 A;  4DKI A;  1ONG A;  4K0X A;  2Q9M A;  1YM1 A;  3NI9 A;  4XUX A;  3UPO A;  1MY8 A;  5CEC A;  1OME A;  5CGW A;  1I5Q A;  1W8Y A;  3IHA A;  5CED A;  5F82 A;  4JKT A;  2X01 A;  5E2H A;  3RXX A;  3ZHH A;  5M19 A;  3N8S A;  1M6K A;  5TR7 A;  5FI6 A;  2QPN A;  2Y91 A;  4L0L A;  1K56 A;  1KE3 A;  1PIO A;  2XFT A;  4X53 A;  1GA9 A;  2RCX A;  2V2F F;  4OOL A;  5F83 A;  4A5R A;  1H5X A;  2FFF B;  1K4E A;  1ES5 A;  3UE1 A;  1L0D A;  1DJA A;  3G30 A;  1ERO A;  5GL9 A;  5TGF A;  1LI0 A;  4DXB A;  1MWR A;  1RCJ A;  5KZH A;  1YT4 A;  3BM6 A;  2WGW B;  2P9V B;  4S2O A;  5E2F A;  1CK3 A;  2HDS A;  3V3S A;  2XDM A;  4E3M A;  4LV2 A;  1SDE A;  1U60 A;  3TG9 A;  3CJM A;  5HAI A;  3Q82 A;  4WM9 A;  4EQI A;  2XK1 A;  1KGG A;  2EXB A;  4BEN A;  3C4P A;  3UN7 A;  3G34 A;  2WGV A;  1ERM A;  4N92 A;  3BEC A;  2XF3 A;  1FR6 A;  3B3X A;  3PAE A;  3VP1 A;  4R23 A;  1W7F A;  2XEP A;  2XQZ A;  3G4P A;  3HLD A;  4OPR A;  4HBT A;  3BFD A;  1MWS A;  4UA6 A;  4IVI A;  4UA7 A;  3ZG9 B;  5FQI A;  2ZQA A;  5EEC A;  4LV3 A;  5EVL A;  5GLA A;  2WAE A;  5F1G A;  3VP2 A;  4KQQ A;  3AGE A;  3HUM A;  4OOY A;  5KSC A;  3GQZ A;  4DE1 A;  4OLD A;  4BJP A;  1O07 A;  3UO9 A;  4D2O A;  3UDI A;  4U3T A;  4FH2 A;  2JE5 A;  1IYP A;  2XD1 A;  3HBR A;  1BUE A;  3HLF A;  2HP6 A;  3Q7V B;  4KZ8 A;  1O7E A;  1PWG A;  3WS1 A;  2Y2H A;  4N1H A;  4BL3 A;  2Y2L A;  1NRF A;  1KE4 A;  1YLZ A;  2ZC7 A;  5EVI B;  3NY4 A;  4DF6 A;  4JXV A;  4RYE A;  5CXW A;  4N9K A;  4GDB A;  1YMS A;  3PBO A;  1JVJ A;  4B88 A;  4EBL A;  4Y0T A;  4QJG A;  1LI9 A;  5FQQ A;  3UPP A;  4IED A;  3IT9 A;  4MEZ A;  1ZG6 A;  5FDH A;  1BLC A;  1JTD A;  4WBG A;  4HBU A;  2EFU A;  3DTM A;  2ZM2 A;  1N9B A;  2P74 A;  1RP5 A;  4JBF A;  1E25 A;  1SDN A;  2ZMA A;  4OPQ A;  4WZ4 A;  2ZJ9 A;  2PU2 A;  3ZG7 B;  2VGJ A;  1KVM A;  2ZC4 B;  4JXS A;  1SKF A;  4OP5 A;  4CPK A;  1MWU A;  1NZU A;  3BYD A;  4GKU A;  1XA7 A;  1Z6F A;  4EBN A;  5CRF A;  2H10 A;  4R4R A;  3BLM A;  1TDL A;  3GRJ A;  2J8Y A;  4X69 A;  3SS3 A;  2GDN A;  3N6I A;  4WEL A;  3OPL A;  5JYP A;  3IH9 A;  5EPH A;  4S2N C;  4DXC A;  3SH8 A;  3IXH A;  3BEB A;  3WS4 A;  3W4Q A;  3CZD A;  1K4F A;  3NDE A;  5DTT A;  2ZC5 B;  3ITB A;  4P0M A;  3WWX A;  2XD5 A;  2UWX A;  1Q2Q A;  1DJC A;  4P85 A;  4WMC A;  2DCF A;  3VSL A;  2HP5 A;  5D3O A;  3C7U A;  1PYY A;  2EX6 A;  1HD8 A;  1K38 A;  4R3B A;  3HLW A;  3Q7V A;  2OSU A;  2C5W B;  1XGI A;  2HPB A;  3AGD A;  4JXW A;  5FQM A;  1PZP A;  4S2I A;  5IHV A;  4LCL A;  5CEB A;  2ZQ8 A;  5EVI A;  4ZJ1 A;  1XXM A;  2ZQ9 A;  3RXW A;  4HES A;  3BLS A;  4OPZ A;  3ZNY A;  4OQH A;  5FSR A;  2B5R A;  3AGF A;  1DJB A;  1KGE A;  4UAA A;  4CJN A;  3W4O A;  2BG1 A;  1K6S A;  5DF9 A;  3QNB A;  2J9O A;  1BLP A;  3BFG A;  4EV4 A;  5E43 A;  3GR2 A;  2X02 A;  2BLS A;  4OVD A;  4KEN B;  4S2K A;  3MKF A;  2ZC6 B;  3HUN A;  3MFD A;  3O3V A;  4QB8 A;  3W4P A;  3VFF A;  4U0T A;  1LHY A;  1QME A;  5I94 A;  3ZG5 A;  3IWI A;  3IXD A;  4YIN A;  1YLW A;  1G6A A;  1HZO A;  5E2G A;  3M6B A;  1BTL A;  1KDW A;  1YLP A;  2VGK A;  5G18 A;  1YMX A;  3UE0 A;  3IWQ A;  4OQI A;  4LEN A;  3ZGA B;  3PBN A;  4LV1 A;  2IWC A;  3V3R A;  3Q1F A;  3VOZ A;  2OLV A;  4NK3 A;  1XKZ A;  4R4S A;  1MKI A;  4E6W A;  2IWD A;  2RL3 A;  4KZ5 A;  4YFM A;  2JC7 A;  5M1A A;  3C7V A;  5M18 A;  3PBS A;  3HLG A;  1J9M A;  4R1G A;  3HLE A;  1IKI A;  2DRW A;  2Y2P A;  1BSG A;  1FSW A;  4OOM A;  1FCN A;  4E3N A;  4S2P A;  1IKG A;  3ZCZ A;  2EX8 A;  1L2S A;  1N4O A;  3LY4 A;  3LCE A;  4FD8 A;  2Y2O A;  3GTC A;  3PBQ A;  4Y0U A;  2ZQC A;  1PWC A;  4MBK A;  4PM6 A;  3UNW A;  1GCE A;  3GMW A;  3NC8 A;  5EOE A;  2OV5 A;  4ZBE A;  3Q07 A;  3NDG A;  3IWO A;  3ZDJ A;  2G2U A;  4B4X A;  4KQO A;  1S6R A;  3ZG8 B;  4ZJ3 A;  2WKI A;  1ZKJ A;  4OQ0 A;  4MLL A;  4ZDX A;  2XFS A;  3BFF A;  3E2K A;  2ZLY A;  4OKP A;  4FH4 A;  2ZQD A;  3FKW A;  3ZVT A;  3OCN A;  4X6T A;  4PM5 A;  5EOO A;  3TSG A;  3OPR A;  3QNC A;  5A93 A;  3D4F A;  3M2K A;  2Y59 A;  3M2J A;  5F1F A;  2HDR A;  1K25 A;  4GZB A;  4DRT A;  3G2Z A;  2WKH A;  3WS2 A;  2WK0 A;  1JWP A;  3WRT A;  3FWL A;  3Q81 A;  3ZNT A;  1XX2 A;  5FAS A;  5HAQ A;  4P87 A;  5GHX A;  4S2J A;  5A92 A;  1BZA A;  3JYI A;  5FQJ A;  3OPH A;  2IWB A;  2WGI A;  1MPL A;  4JLF A;  2Q9N A;  2EXA A;  3C4O A;  5A91 A;  3IXG A;  1BLS A;  3GV9 A;  1I2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...