2ZQ9A

Cephalothin acyl-intermediate structure of class a beta-lactamase toho-1 e166a/r274n/r276n triple mutant
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
259
structure length
259
Chain Sequence
b'NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase Toho-1
publication title Structural Basis of Extend Spectrum Beta-Lactamase in Correlation of Enzymatic Kinetics and Thermal Stability of Acyl-Intermediates
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 93
structure length 259
sequence length 259
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2zq9A00
4UHUA 4B4ZA 1K57A 3W4OA 4X69A 5HAIA 2XD5A 4WZ4A 3HBRA 5DF7A 1JWZA 2WKEA 3ZVTA 3DTMA 4OP5A 4OPYA 4FH4A 5M18A 2V2FF 1MBLA 5AQAA 4ZJ2A 3Q1FA 4E3LA 1FR1A 3ZFZA 1M6KA 1PYYA 1SCWA 3IWOA 1G68A 2XK1A 4PPRA 5AQ9A 2PU4A 4JXVA 3V5MA 4KG5A 3UPOA 1LHYA 5DF8A 4IBRA 4X55A 4R0QA 4S2LA 3N8RA 2P9VA 3UE3A 1IKGA 1EI5A 3OCNA 3BEBA 4IEDA 3HLWA 3PBSA 1C3BA 2C6WB 4MBHA 2HDQA 4GD8A 2EFXA 3PBNA 1WE4A 2P9VB 5GHXA 4OQHA 3Q82A 4CPKA 4DRTA 3HLEA 4KQRA 3IXDA 1RP5A 1NZOA 3WS2A 1KGEA 1IYOA 3W8KA 3PBRA 2EX2A 2RL3A 3MKFA 3TG9A 1XPBA 1XX2A 2WUQA 4BL2A 4NK3A 3GSGA 4B88A 3FKWA 3IWQA 4OONA 5CEBA 3MFDA 4JXSA 1L0EA 3IHBA 2P74A 2Y2IA 3C4PA 4QHCA 4S2KA 5CTNA 4XUZA 2H10A 4KG2A 2J7VA 2A3UA 4LENA 3S1YA 1BULA 1NRFA 3HUNA 3GVBA 4FSFA 4HEFA 4U0TA 3SS3A 3S4XA 5FA7A 5JYOA 1GA9A 4GOGA 1YMXA 4OPRA 4Y0TA 3P09A 1ESIA 4KZ7A 3OPRA 1ERMA 5I94A 1M40A 2H5SA 4JF4A 1DJCA 5CRFA 5DTTA 3N6IA 4JPMA 5FI2A 5E2GA 2WK0A 4GDNA 5A91A 1XP4A 4K0XA 3UDIA 3IH9A 1ALQA 1ES3A 3IF6C 4ID4A 3PTEA 5E2FA 3OPLA 1GHMA 4OKPA 1U60A 2XR0A 2HPBA 3OPPA 1IYPA 3BLSA 3OC2A 4HESA 3O3VA 4LV0A 1BT5A 4JXGA 3Q81A 4QD4A 1SKFA 4FH2A 5CHUA 5FQIA 2ZC3B 3BECA 4JKTA 5EECA 4FCFA 4N9KA 3BFDA 4N9LA 1PW8A 3ISGA 5AQ7A 5HARA 1ERQA 3HLBA 3IF6A 2ZM2A 1KE4A 1PWGA 2WAEA 1TVFA 4DKIA 5GLAA 4P0MA 5EUAA 4DE2A 3IF6B 3OCLA 5FAOA 3HUMA 5CTMA 1L2SA 3RJUA 4EBPA 3QNCA 3TOIA 2Y2OA 3FYZA 2HP9A 5FQJA 1CEGA 1W7FA 1MWTA 1IEMA 2DCFA 4XUXA 3NDGA 3Q7ZA 3VSKA 1XA1A 2X71A 2JCHA 1K6SA 3PAEA 2GDNA 2XLNA 2VGKA 3CJMA 4E6XA 5A92A 1K55A 4WZ5C 3ZG5A 1FCOA 3G35A 3TSGA 2DNSA 2XDMA 3V50A 4RYEA 5F83A 4KZ3A 3I7JA 1K57C 2WGWA 5FQKA 3AGFA 2QMIA 1XXMA 4S2JA 4R4SA 5EVIA 1LI9A 2JE5A 1LI0A 1YT4A 4WELA 3A3IA 1W79A 3UNWA 3HLFA 5EVIB 4LV3A 4E3JA 1KVMA 2XFTA 3MZEA 3UE1A 4BL3A 2IWDA 3GQZA 3NCKA 4GZBA 5HFOA 1XGJA 4KZAA 4KQQA 1L0FA 1N4OA 1GA0A 5E43A 3RXXA 4PM6A 4RX3A 5EE8A 2BG1A 1JVJA 1SDNA 2DRWA 3HREA 2EFUA 3PBQA 5GLBA 5DTSA 1FCNA 1N9BA 3CG5A 1KE3A 1S6RA 3EQUA 5JYPA 3NI9A 1NY0A 3N8SA 3BFEA 4EV4A 3UPPA 3ITAA 3CZDA 1Z6FA 1EROA 1AXBA 3UO9A 3GTCA 2Y2JA 3Q07A 3A3DA 3RXWA 3V3SA 1K56D 1E3UD 4E3MA 3FWLA 4KQOA 3HLDA 2H0TA 2J9OA 4BQMA 1HZOA 4LV2A 3UPNA 4DF6A 2ZC7A 3QNBA 5CERA 4E3OA 1KGFA 3EQVA 1QMEA 4X6TA 1CI9A 4OOYA 3ZG0A 1S0WA 3GR2A 3AGDA 1SDEA 4WBGA 5DF9A 4BENA 2R9XA 1CK3A 4RA7A 1NZUA 3A3JA 3VOYA 1NYYA 1BTLA 2EX9A 5HX9A 2FFFB 4HBTA 1JWPA 5FQMA 1RGYA 3V39A 4N1HA 1BUEA 2XEPA 3OPHA 4QY5A 2ZQ8A 5CGXA 3IF5A 3LY3A 1TDGA 3W4QA 4HBUA 4OPZA 1SHVA 3O86A 4GB7A 3ITBA 2WZXA 1MWUA 4WM9A 1BZAA 3FKVA 3LEZA 3LO7A 3ZG8B 5TGFA 2I72A 2OSUA 3MXRA 3DW0A 4ZBEA 4EBNA 4RVAA 1K54A 3G4PA 3MBZA 2WKIA 1L0GA 3VP4A 2QPNA 4C6YA 4ZDXA 4H8RA 3MXSA 4N1XA 4EQIA 4M3KA 1Q2PA 3NY4A 4OQIA 3VFFA 4R4RA 5DTKA 2Y4AA 4UA9A 1PWDA 3HLGA 4S2OA 3ZNYA 4DDYA 1LL5A 4Y0OA 5E2HA 2HP6A 2BLSA 5L2FA 4DXCA 5CGSA 1HD8A 4Y0UA 5EVLA 4XXRA 3N4IA 1IELA 4IVKA 1ES4A 3DWZA 2VGJA 3VFHA 5EOEA 3IH8A 2ZLYA 1I2WA 3HUOA 5TR7A 1IYSA 5CHMA 1IKIA 5FAQA 1TEMA 2Y2LA 1PW1A 2B5RA 4S2PA 2HDUA 1H8ZA 3ZGAB 1K55C 2XF3A 3UY6A 2H0YA 2J9PA 1NXYA 4LCLA 4OLDA 2IWCA 4WEKA 4OOLA 4E3IA 3O88A 3SH8A 5KSCA 3VP1A 2J8YA 1ZG4A 5GL9A 3MZDA 5EVIC 1W8YA 2EX6A 3IT9A 4ZJ3A 1ONGA 4R23A 2Y55A 4KZ4A 5A90A 4DXBA 1MY8A 1XA7A 1OMEA 1KGGA 1PI5A 3GV9A 4EBLA 2Y91A 4ZJ1A 3M2JA 5CHJA 3SS4A 4DE0A 4R3BA 4DE3A 3C7UA 4DDSA 2WADA 4ZTKA 4X53A 2EX8A 4MBKA 3WS5A 1YQSA 3G34A 4OOMA 3WS1A 4GN2A 1I2SA 1JTDA 1MKIA 2WGVA 5GHZA 3VP0A 2WGWB 1E25A 3PAGA 1H5XA 4Q8IA 1BLPA 1K25A 4JF6A 2RCXA 4YINA 5GLDA 1W5DA 4S2NC 5A93A 2ZQ7A 2ZQAA 1VM1A 3SS5A 1GCEA 5HW3A 1WYBA 3OZHA 1XKZA 3NBLA 1RGZA 3WS4A 5FDHA 4WEJA 3FZCA 4MNRA 1K38A 4PMAA 2Y2NA 3A3FA 2ZQCA 5GLCA 4GKUA 3WS0A 3D4FA 3UDXA 2QZ6A 5J8XA 3CMZA 2ZQ9A 4EWFA 1LLBA 1H8YA 3G30A 1JWVA 4S2NA 1K56A 1E3UA 2R9WA 2ZD8A 2Y2MA 5KZHA 5G18A 3HLCA 4K0WA 3GMWA 2WGIA 3VP3A 3S22A 3NC8A 4P6BA 4WYYA 3IXBA 1YLPA 4OP8A 1IYQA 2ZQDA 5M1AA 4WMCD 1G6AA 1YLTA 2HDSA 3VMAA 2Y2HA 5D3OA 1YLYA 2Y2QA 4E6WA 4OQ0A 2XQZA 4D2OA 2G2WA 3M6HA 1W8QA 4QJGA 5FAPA 1MWSA 4GDBA 1FSWA 1RCJA 3E2LA 4LCMA 4OH0A 2EXAA 4MLLA 4P87A 2Q9NA 4A5RA 3C7VA 5HL1A 4KZ5A 4UA6A 2E8IA 2HP5A 4QU3A 4IBXA 4DE1A 1MWRA 4K91A 3BRMA 2A49A 3UE0A 3C4OA 5FASA 1K54C 1E4DA 2OLUA 1QMFA 4S2MA 3P98A 4KENB 4U0XA 4PM8A 3IXGA 2CC1A 3G2YA 4X68A 5E2EA 3ZG7B 2ZM8A 4Y7PA 4MEZA 1O07A 3ZDJA 4N92A 3BM6A 5TFQA 4MBFA 5FI7A 1DJAA 3A3EA 1WYCA 1PZOA 4IVIA 2C5WB 3PBOA 3BYDA 3Q7VA 4BD1A 4PM5A 4ZAMA 5BOHA 1XGIA 3MZFA 1LL9A 1PZPA 2Q9MA 4JLFA 4PM7A 4KZ6A 3Q7VB 3HVFA 3ZHHA 2ZJ9A 1DY6A 4OQGA 1VQQA 4YFMA 5KSHA 2V1ZA 5FSRA 4KG6A 4BJPA 4R1GA 3MKEA 3W4PA 1TDLA 4OVDA 1L0DA 2JC7A 3C5AA 4LV1A 2HDRA 1NYMA 1YM1A 2XFSA 5GHYA 2ZC6B 3FV7A 5U47A 4RX2A 1ZKJA 1HVBA 5FI6A 3GRJA 4NETA 2PU2A 4F94A 5DVAA 2ZC5B 1FOFA 4O7DA 2WYXA 3G31A 3M6BA 5F82A 5CEDA 5FQ9A 3LY4A 1K4EA 2Z2MB 2ZM0A 3UN7A 1ESUA 1GHPA 1MPLA 3IXHA 3JYIA 2PBYA 2EXBA 4QY6A 3V3RA 2IWBA 1ONHA 1NJ4A 2WAFA 3N7WA 4R3JA 2OLVA 1YLZA 1KDWA 1EWZA 5CECA 4BLMA 2ZMAA 1BLCA 5CXWA 3VSLA 3WRTA 2Y2KA 2Y59A 1PI4A 1BSGA 1GHIA 5F1FA 2FFYA 1MXOA 1K6RA 3G32A 1Q2QA 1O7EA 3ZCZA 4JBFA 4PM9A 4GD6A 5HAPA 3O87A 3HL9A 2X01A 2UWXA 1BLSA 1CI8A 1FR6A 2Y2GA 4FD8A 3E2KA 5FQQA 3BFFA 4CJNA 1YLWA 4L0LA 3B3XA 4UA7A 5EPHA 5M19A 3PBTA 4E3NA 3ZG9B 3AGEA 3UDFA 1FQGA 4BD0A 2XGNA 5HAQA 1Y54A 5F1GA 1BLHA 2WZZA 3IHAA 1FSYA 2V20A 2JBFA 1ZG6A 3SH7A 3WWXA 2Y2PA 4E3KA 2ZC4B 4KZ9A 1ZC2A 3VOZA 4EUZA 1JTGA 3BFGA 2XH9A 3DWKA 4KZBA 5FATA 1I5QA 1FCMA 4JF5A 1J9MA 3SOIA 4OPQA 5AQBA 1KE0A 1K4FA 1HTZA 4KZ8A 2X02A 1ES5A 3N8LA 3NIAA 3IWIA 3BLMA 2G2UA 3M2KA 3NDEA 1PIOA 4OLGA 4S2IA 4C3QA 1YLJA 4QB8A 2Z2LB 3VP2A 3LCEA 3ZNTA 1KDSA 5IHVA 1ES2A 5EOOA 3BFCA 5CGWA 4B4XA 5KMWA 4GNUA 4C75A 1DJBA 2WKHA 3IQAA 3QHYA 2XD1A 4JXWA 4UAAA 4P85A 4WZ5A 4X56A 5EVID 2OV5A 4WMCA 3ZVWA 3G2ZA 4Z9QA 1CEFA 4U3TA 1YMSA 1PWCA 3SH9A 1KVLA 3WRZA
chains in the Genus database with same CATH superfamily
3W4OA 4X69A 4ESPA 3VE4A 4HH3A 3HBRA 1OTDA 3GDIA 3UB9A 3DTMA 4OP5A 4Y2FA 4FH4A 3CLOA 3ULFA 4BBUA 5HDCA 4E3LA 1FR1A 3ZFZA 1M6KA 3IWOA 5FEFA 4PPRA 2PU4A 2R78A 4CLCE 3N8RA 5TJJA 3BEBA 3HLWA 3PBSA 2HZ5A 2VKSA 2EFXA 2P9VB 1N9LA 1TS8A 1N9OA 3P7NA 3Q82A 4CPKA 3CAXA 4KQRA 3IXDA 3QP8A 5DFXA 2RL3A 3BWLA 4YNRA 3DAVA 2WUQA 3L9KA 1CF0A 4BL2A 4NK3A 1SKOB 1GSWA 4JXSA 5EM0A 1L0EA 2B18A 4ETZA 2Y2IA 4XUZA 3T4KA 2H10A 2V0WA 3HUNA 3T4QA 3GVBA 4U0TA 2VX8A 4BMWA 3P09A 1M40A 1S4RA 4JF4A 5CRFA 5AJGA 5FI2A 3KSFA 2WK0A 3HJKA 1XP4A 4K0XA 3ZQ5A 4LRXC 2QYBA 4M4XA 3JVUA 1K0KA 1IYPA 3O3VA 3Q81A 4FH2A 2YKFA 5FQIA 2D02A 2VLGA 4FCFA 1H0MA 4N9LA 1PW8A 3ISGA 4HJ4A 4JGPA 5HARA 2ZM2A 1J3WA 2V1AA 3BW6A 3UMEA 1LL8A 1OTBA 3MSHA 5CTMA 1L2SA 4EBPA 3TOIA 2LB5A 2Y2OA 3MQ0A 4GHIB 5FQJA 1CEGA 1W7FA 1IEMA 1W63M 3VSKA 3Q7ZA 5K5BA 1XA1A 1K6SA 2GDNA 4E6XA 3EEAA 4WZ5C 3TSGA 2XDMA 3V50A 3CPTA 3I7JA 2OOLA 1XXMA 2QJ5A 3U2AA 4PAUA 3A3IA 1W79A 1BYWA 3T4JA 4I39A 3TW8A 3UE1A 2IWDA 3NCKA 3QP2A 5HFOA 4BBVA 4KZAA 1GA0A 1JVJA 1SDNA 3NOPC 3HREA 1S6RA 2A2LA 3H7WA 3UPPA 1UWNX 4FUWA 3H9WA 3A3DA 1K56D 4E3MA 4KQOA 3PR6A 4DF6A 4E3OA 4QWOA 5TBMA 4X6TA 1S0WA 5DF9A 5HDDA 1VEUB 3A3JA 4KUOA 3LGOA 3EGDC 1P97A 3T4TA 2FFFB 1BUEA 3LI8A 3LY3A 1TDGA 3W4QA 4PHTA 4XT2A 1TS0A 2WZXA 4WM9A 1BZAA 3FKVA 1T18A 3H82B 2I72A 2JKTI 3DW0A 4EBNA 1PRQA 3A0VA 3MBZA 3VP4A 3CHWP 2XA7M 2WKQA 3MXSA 5AVEA 3VFFA 4R4RA 3F1NA 2J80A 1YPRA 1S1YA 5IU1A 3T4SA 3N4IA 3DWZA 2VGJA 3NJAA 2HV1A 1I2WA 3HUOA 5I5LA 4CQHA 3ZGAB 4EERA 1L3LA 2H0YA 4EUVA 2IWCA 4LFUA 3O88A 3VP1A 1ZG4A 1D7EA 2EX6A 2A24B 2HF6A 2XROA 3GV9A 4EW7A 2W3GA 4KUKA 4ZJ1A 4DE3A 2EX8A 3A0SA 1LSWA 4MBKA 3E4OA 1YQSA 4GN2A 1MKIA 1JTDA 5GHZA 3VP0A 5A93A 2RCXA 5GLDA 2ZQ7A 4HH2A 1UWPX 3SS5A 1GCEA 2AVXA 3F1PA 3OZHA 3LIBA 3WS4A 2XSSA 4MNRA 2KOIA 4PMAA 3A3FA 4I3IA 4IJGA 2QZ6A 3NOUC 1H8YA 3MMHA 3F1OA 1E3UA 2R9WA 2QKPA 5G18A 1CQAA 1G5UA 3NC8A 2HDSA 1YLTA 1D1JA 1YLYA 4E6WA 4OQ0A 3UB8A 5HPFA 4D2OA 3M6HA 5FAPA 4GDBA 5HWWA 3B42A 2PHYA 3C7VA 4QU3A 4DE1A 4IBXA 2VK3A 3UMDA 1OTAA 3P98A 4U0XA 4PM8A 1XFNA 3G2YA 4NXFA 3ZG7B 2ZM8A 4IUKA 3ZDJA 4MBFA 2W3FA 2ZMVA 2Q9MA 1PZPA 3K3CA 4Q0IA 1N9NA 3HVFA 1DY6A 4OQGA 4KG6A 3MKEA 3W4PA 1TDLA 4NG2A 3IX4A 2VZWA 4NXGA 3JVVA 3MFXA 1OPXA 3FV7A 5U47A 4HHDA 5FI6A 3O5YA 2PU2A 2ZC5B 4O7DA 5L09A 2WYXA 3G31A 5FQ9A 3LY4A 1K4EA 3IXHA 3JYIA 3V3RA 3QP5A 4GS9B 3MJQA 5CECA 2ZMAA 2M1CA 4O8GA 3WRTA 2O0YA 3VSLA 1PI4A 1GHIA 5F1FA 2FFYA 4R70A 3MR0A 3O87A 2L0WA 1CI8A 1FR6A 1XJ6A 3D72A 4L0LA 3PXPA 4I38A 4UA7A 3KYEA 4GHIA 2P04A 3C8CA 3IHAA 1ZG6A 3LEQA 4II7A 1FCMA 1J9MA 1KE0A 3S7QA 4FOFA 5HZHA 3N8LA 3NIAA 3BLMA 4OLGA 4S2IA 3EGXC 1STZA 1ES2A 5KMWA 4GNUA 1OT9A 4HNBA 4P85A 4AFIA 4X56A 1NLZA 3D3OA 1YMSA 1PWCA 5HPIA 4EEPA 4MN5A 4WZ4A 1V9ZA 3DTEA 4ME4A 2PRFA 1DP9A 5L10A 5MC7A 3Q1FA 5AVFA 5A8BA 3V5MA 3PYPA 4IUHA 3UE3A 1IKGA 3OCNA 4IEDA 3QP1A 5GHXA 4OQHA 4DRTA 3R4KA 2EX2A 3TG9A 3R7WA 2BASA 4BWIA 3FKWA 4HOIA 2P74A 3H82A 1BULA 1NRFA 4HEFA 2Z6CA 3S4XA 3SS3A 4GOGA 4KQDA 2V8CA 5DTTA 1DJCA 5E2GA 2JKRI 4GDNA 5J7EA 3IH9A 4ID4A 3EEHA 3OPLA 3KYZA 4HY8A 4HESA 4LV0A 3DBAA 2ZC3B 3BECA 4JKTA 1VB6A 3BFDA 5AQ7A 3IF6A 1KE4A 1PWGA 2WAEA 2PD8A 1SZVA 2VGLS 3C30A 2ZL1B 5FAOA 2V8FA 3HUMA 3K3DA 5IT5A 3FYZA 2HP9A 2O9CA 5J4EA 5HL6A 2DCFA 2X71A 3EOIA 4MN7A 1T1AA 3ZG5A 1P9RA 3P01A 1TF1A 5C5KA 3G35A 5F83A 4KZ3A 4EQ1A 1K57C 2QMIA 3PHYA 1VETB 1NWZA 3CUEA 2JE5A 2W1RA 1YT4A 4WELA 1Y4OA 3HLFA 5EVIB 4E3JA 5DFYA 3OOVA 3MZEA 4BL3A 3GQZA 3KSIA 4GZBA 4MDZA 1XGJA 5E43A 3RXXA 2PBDP 4D60A 5EE8A 2BG1A 4G3WA 2EFUA 5GLBA 5DTSA 4F3LB 3NI9A 3BFEA 3OBFA 1MKMA 1XJ3A 3VV4A 2W1TB 2H0TA 4BQMA 4LV2A 2FH5A 3QNBA 1XFQA 4OOYA 3ZG0A 3GR2A 4WBGA 4BENA 1UGUA 4JGOA 1XJ2A 2PYRA 2ZOHA 4FTXA 4HBTA 3U4LP 5FQMA 2I9VA 1ACFA 2XEPA 3OPHA 2ZQ8A 2OAP1 4Q0HA 4GB7A 2KDKA 1V9YA 5DKLA 3LEZA 3ZG8B 4H6JA 2ZOIA 4GJ4A 4HJ3A 1OTEA 4RVAA 3G4PA 2JN7A 2WKIA 1L0GA 5J3WA 3DTKA 1Q2PA 3NY4A 5DTKA 2Y4AA 3FPWA 1PWDA 4S2OA 4UA9A 4DDYA 4L9FA 2HP6A 5E2HA 5L2FA 4DXCA 3TRCA 5EVLA 2VV7A 3VFHA 5EOEA 3IH8A 2GNXA 4YWZA 4GS9A 2P08A 2Z6DA 5CHMA 3LR4A 5FAQA 1PW1A 2B5RA 1H8ZA 1K55C 3B47A 1OJ5A 4LCLA 5DKKA 5KSCA 2J8YA 5EVIC 3IT9A 1HLUP 4ZJ3A 1ONGA 4WLAA 5A90A 2CMNA 1OMEA 1KGGA 2Y79A 4PKYA 3M2JA 5CHJA 3C7UA 4ZTKA 3WS1A 2IA2A 3T50A 3MF0A 5HL1A 1K25A 4JF6A 4YINA 4CLCB 1XJ4A 2EWWA 1XKZA 3NBLA 5G4YA 5FDHA 1VHMA 1LT0A 1A0KA 1D06A 3NOTC 3UDXA 4HI4A 2L1MA 1F9IA 1DP6A 2ZQ9A 1LLBA 1K56A 1F5MA 2ZD8A 2JHEA 5KZHA 3VP3A 4P6BA 1YLPA 1IYQA 4LGWA 2HJ9C 5M1AA 2O9BA 3VMAA 2Y2QA 3UB7A 2XQZA 4QJGA 1ODVA 1FSWA 4I3AA 2Q9NA 4UQIS 4KZ5A 2E8IA 2HP5A 1MWRA 4ARZB 4EESA 2QJ7A 2A49A 3C4OA 4Y17A 1K54C 1E4DA 1P0ZA 5E2EA 2D01A 4Y7PA 4MEZA 2VGLM 1O07A 3BM6A 1WYCA 2C5WB 3BYDA 3Q7VA 4PM5A 4ZAMA 3IX3A 4JLFA 1LL9A 2ZJ9A 2M7VA 1VQQA 1S4SA 3FC7A 4EXOA 4LV1A 2HDRA 1YM1A 2W0NA 3NULA 2XFSA 4LPZA 2ZC6B 3GRJA 4F94A 3M6BA 5F82A 2Q0OA 2Z2MB 4EETB 1MPLA 1MZUA 2PBYA 2EXBA 2VA0A 2O99A 2WAFA 5F6AA 1EWZA 3FG8A 2Y2KA 2Y59A 3BQAA 2B02A 1MXOA 1T19A 1K6RA 3G32A 4JGRA 4CLCC 3BY8A 2Y2GA 2ZBBA 2PD7A 3BFFA 2O9AA 1LSXA 3PBTA 4E3NA 2Y8HA 3AGEA 2P7JA 4Y5FA 2XGNA 1DRMA 5HAQA 1BLHA 4JGQA 1FSYA 3SH7A 4EUZA 2VV8A 1JTGA 1WA9A 4MN6A 2FZ0A 2XH9A 1I5QA 5F5YA 1H8MA 4OPQA 4KZ8A 1VETA 3M2KA 1YLJA 3ZNTA 3T1QB 5CGWA 3RFBA 3TE8A 4C75A 2OWJA 1DJBA 5HDSA 5EVID 4WZ5A 2OV5A 3G2ZA 4U3TA 3BQ8A 1KVLA 4UHUA 4B4ZA 2KLIA 2XD5A 2V0UA 5DF7A 1JWZA 4OPYA 2V2FF 1PYYA 1SCWA 2W1TA 5AQ9A 4KG5A 4LRZE 4YOFA 1LHYA 5DF8A 4X55A 4R0QA 5L8MA 4WN5A 2P9VA 1EI5A 2HDQA 4GD8A 3B33A 3JPUA 2PR5A 3HLEA 1RP5A 3KSGA 3C38A 3C2WA 1SKOA 1YKDA 4DJ2A 3GSGA 3IWQA 1CJFA 3HCYA 5CEBA 3MFDA 4S2KA 4QHCA 2ZMFA 1X0OA 3S1YA 2J7VA 2LB9A 1FILA 4LENA 4NXBA 4Z1WA 5FA7A 5JYOA 4ZRRA 1GA9A 1YMXA 4Y0TA 3IX8A 1ESIA 4KZ7A 1ERMA 5I94A 5EM1A 4JPMA 2K31A 3UDIA 4ETXA 3IF6C 3MQQA 3PTEA 5E2FA 1GHMA 4R6LA 4WF0A 3BY9A 1U60A 2HPBA 3BLSA 3OC2A 4JXGA 2PYPA 1LSVA 4N9KA 1ERQA 3HLBA 1JNUA 1TVFA 4DKIA 5GLAA 5EUAA 4DE2A 3OCLA 3QNCA 1MWTA 4XUXA 4PKYG 3NDGA 2JCHA 3MXQA 4UQIM 3PAEA 3CJMA 1NRJA 2VGKA 2XLNA 1YSPA 5A92A 2QWSA 4RYEA 3KSHA 4MCWA 1TD5A 2PDRA 3CPTB 2PT7A 4R4SA 4S2JA 1LI9A 1YAXA 4CLCD 4PM6A 4RX3A 5HWVA 3PBQA 3V67A 2ACGA 1N9BA 3CG5A 5HD3A 4WUJA 5JYPA 1NY0A 3N8SA 4EV4A 3ITAA 5LBRA 1Z6FA 1EROA 3H7WB 2Y2JA 3V3SA 2W3HA 3HLDA 4P6ZS 1HZOA 2ZC7A 2QHKA 1CI9A 5FEGA 1VEUA 3IBJA 1H3QA 5TBMB 2R9XA 4QPRA 1CK3A 1NZUA 3VOYA 1NYYA 2EX9A 4ARZA 4NXEA 5HX9A 2KX6A 1RGYA 5CGXA 3O86A 3ITBA 1MWUA 2VV6A 4XT2B 5TGFA 3MXRA 4ZBEA 2QPNA 4ZDXA 4LRYC 4DN0A 4M3KA 3VOLA 3ZNYA 1GSXA 2K2NA 1LL5A 3GECA 3E0YA 4L9GA 4IVKA 1ES4A 2JKFA 1Z09A 5TR7A 1IKIA 1TEMA 2H28A 2Y2LA 5FL3A 3LR3A 1ZTUA 2XF3A 2J9PA 1IFQA 4OLDA 4OOLA 2A24A 5GL9A 1W8YA 4R23A 4KZ4A 1MY8A 1XA7A 4EBLA 4UEYA 3T1RA 4DDSA 4X53A 2PAVP 3WS5A 3CWFA 3G34A 2WGVA 4L9EA 2WGWB 1E25A 1BLPA 3DTIA 3T1SA 1RGZA 5CX7A 2L4RA 2Y2NA 2ZQCA 3WS0A 5HSQA 3D4FA 1MC0A 3CMZA 3G30A 4S2NA 3W2ZA 2Y2MA 3F1OB 3S22A 3IXBA 4OP8A 4WMCD 1G6AA 5D3OA 2G2WA 1W8QA 2OAQ1 1W63Q 1MWSA 4OH0A 3E2LA 4A5RA 3LR0A 4Y13A 4K91A 5FASA 4X1MA 2OLUA 1QMFA 1PFLA 3LICA 4KENB 4HJ6A 1G6OA 2CC1A 4X68A 1PZOA 4NEED 1XGIA 3MZFA 4PM7A 5F68A 4R1GA 1L0DA 3C5AA 1F2KA 1NYMA 2W3EA 1ZKJA 4RX2A 3LYXA 5DVAA 1T1CA 3NHQA 5CEDA 5G4ZA 4G3KA 1ESUA 4Y15A 4QY6A 1ONHA 4R3JA 1YLZA 1KDWA 4BLMA 4G3VA 4I5SA 1BLCA 5CXWA 3VE3A 3L7HA 1BSGA 3RH8B 1O7EA 3ZCZA 4JBFA 4PM9A 4GD6A 4HIAA 5HAPA 2V1BA 3HL9A 2VEAA 2UWXA 1BLSA 2WKPA 1IOUA 4FD8A 3E2KA 3MQOA 5FQQA 4P6ZM 5IS1A 4CJNA 5KIZA 2V9AA 3ZG9B 1Y54A 5F1GA 2WZZA 2V20A 3WWXA 2JBFA 4E3KA 2ZC4B 3QP4A 4X25A 1P9WA 3DWKA 4KZBA 5FATA 3SOIA 2J3WA 5AQBA 1K4FA 1KOUA 4DMZA 2G2UA 4C3QA 4QB8A 2Z2LB 2NUPC 3VP2A 2VJWA 1KDSA 2JKTM 5EOOA 2OWHA 3QHYA 2XD1A 3ZVWA 4Z9QA 3SH9A 1AWIA 3T1XA 3WRZA 1K57A 5HAIA 2WKEA 3ZVTA 3HJIA 5M18A 1MBLA 5AQAA 4ZJ2A 3QP6A 4BBTA 1G68A 2XK1A 2UV0E 4JXVA 3UPOA 4IBRA 4S2LA 3T4LA 3SZTA 1C3BA 2C6WB 4O0PA 4MBHA 3PBNA 1WE4A 5HD5A 3CI6A 4I3JA 1NZOA 4GCZA 3WS2A 1KGEA 1S1ZA 1IYOA 3W8KA 3PBRA 3MKFA 1XPBA 1XX2A 3UB5P 4B88A 3R7WB 4OONA 2BTFP 3IHBA 3C4PA 5CTNA 4KG2A 2A3UA 4FSFA 1DP8A 4IHQA 2XRNA 4OPRA 3OPRA 4EEUA 2H5SA 3N6IA 2B95A 5A91A 3ICYA 1ALQA 1ES3A 3E98A 3G6OA 4OKPA 2XR0A 3OPPA 5FDSA 1BT5A 3LIEA 1SKFA 2J3TC 4QD4A 5CHUA 5DJTA 5EECA 2JKGA 1GSVA 3S7OA 4GLQA 2ZL1A 4RQ9A 4P0MA 4R38A 3IF6B 1S67L 3RJUA 3FPVA 1PNEA 5DJUA 3KYQA 1K55A 1FCOA 2DNSA 3BJNA 2WGWA 5FQKA 3AGFA 5F69A 3LR5A 5EVIA 4HP4A 1LI0A 3KX0X 1G28A 3UNWA 4LV3A 1KVMA 2XFTA 3CITA 4KQQA 1L0FA 1N4OA 3IS2B 4F3LA 2DRWA 2PR6A 1FCNA 3EQUA 1KE3A 3CZDA 5EV0A 1AXBA 5EFWA 3UO9A 3GTCA 3Q07A 3RXWA 1E3UD 2DMWA 3FWLA 2J9OA 3UPNA 5CERA 1KGFA 3EQVA 1QMEA 3AGDA 1SDEA 4RA7A 3T4OA 1BTLA 4X1LA 1JWPA 4WL9A 3V39A 4N1HA 2WKRA 4QY5A 1Y28A 3IF5A 4HBUA 2G7UA 4OPZA 1SHVA 4B93A 3K2NA 3LO7A 2OSUA 4H6JB 1K54A 2W27A 1OJGA 4C6YA 1F98A 4H8RA 4N1XA 4EQIA 4OQIA 3HLGA 4Y0OA 2BLSA 5CGSA 1HD8A 4Y0UA 4XXRA 1IELA 1TS7A 2ZLYA 1OTIA 1IYSA 4S2PA 2HDUA 3UY6A 1EW0A 1NXYA 4WEKA 4E3IA 3E4PA 3SH8A 2GX5A 3LI9A 3MZDA 4DJ3A 3CUEC 4MMNA 2Y55A 4DXBA 5HWTA 1PI5A 3EWKA 2GJ3A 2Y91A 2MJ6A 1TS6A 3SS4A 4DE0A 4R3BA 3LFVA 2WADA 2NUTC 1ZHHB 3NECA 4OOMA 4CLCA 1I2SA 3PAGA 1H5XA 4Q8IA 1W5DA 4S2NC 2ZQAA 1VM1A 2J3TD 5HW3A 1WYBA 4B9OA 3S7PA 2EA9A 4WEJA 3FZCA 1NLYA 1K38A 5GLCA 4GKUA 5J8XA 2HJEA 4EWFA 4O01A 1JWVA 4K08A 2YKHA 3S7NA 2W3DA 3HLCA 4K0WA 3GMWA 2WGIA 4Q0JA 2JKRM 4WYYA 3E4QA 3LIFA 2ZQDA 2Y2HA 1FIKA 3LIDA 1RCJA 4LCMA 4P87A 2EXAA 4MLLA 4UA6A 3BRMA 3UE0A 4S2MA 4EU0A 3IXGA 5L07A 4N92A 5TFQA 5FI7A 1DJAA 3A3EA 4IVIA 3PBOA 4BD1A 5BOHA 4KZ6A 3Q7VB 3KO6A 3ZHHA 3UB6A 3T12B 4YFMA 5KSHA 2V1ZA 5FSRA 3RTYA 4BJPA 4OVDA 4R3AA 2JC7A 2GZAA 5GHYA 4HQAA 3F1NB 1YSQA 1HVBA 4NETA 2E8JA 1FOFA 1T1BA 2ZM0A 3UN7A 1GHPA 2M7UA 2IWBA 3MS6A 2INWA 1NJ4A 3TJZC 3N7WA 2OLVA 3UE6A 3A0RA 5EVEA 3LUQA 4E04A 1Q2QA 3SW1A 4GW9A 2X01A 3D9YA 3LIAA 1OT6A 3ZYTA 1YLWA 3B3XA 5EPHA 5M19A 3IBRA 4BD0A 3UDFA 1FQGA 4Y3IA 2Y2PA 4KZ9A 1ZC2A 2HGVA 2XA7S 3VOZA 3BFGA 2EWVA 4JF5A 3F1PB 1HTZA 2X02A 2K7SA 1ES5A 3IWIA 4HP9A 3NDEA 1PIOA 3LCEA 4LLOB 5IHVA 4B4XA 3BFCA 1S66L 4UAAA 2WKHA 3IQAA 4JXWA 3IS2A 4NKPA 4WMCA 1CEFA 3OLOA
chains in the Genus database with same CATH topology
4UHUA 4B4ZA 1K57A 3W4OA 4X69A 5HAIA 2XD5A 4WZ4A 3HBRA 5DF7A 1JWZA 2WKEA 3ZVTA 3DTMA 4OP5A 4OPYA 4FH4A 5M18A 2V2FF 1MBLA 5AQAA 4ZJ2A 3Q1FA 4E3LA 1FR1A 3ZFZA 1M6KA 1PYYA 1SCWA 3IWOA 1G68A 2XK1A 4PPRA 5AQ9A 2PU4A 4JXVA 3V5MA 4KG5A 3UPOA 1LHYA 5DF8A 4IBRA 4X55A 4R0QA 4S2LA 3N8RA 2P9VA 3UE3A 1IKGA 1EI5A 3OCNA 3BEBA 4IEDA 3HLWA 3PBSA 1C3BA 2C6WB 4MBHA 2HDQA 4GD8A 2EFXA 3PBNA 1WE4A 2P9VB 5GHXA 4OQHA 3Q82A 4CPKA 4DRTA 3HLEA 4KQRA 3IXDA 1RP5A 1NZOA 3WS2A 1KGEA 1IYOA 3W8KA 3PBRA 2EX2A 2RL3A 3MKFA 3TG9A 1XPBA 1XX2A 2WUQA 4BL2A 4NK3A 3GSGA 4B88A 3FKWA 3IWQA 4OONA 5CEBA 3MFDA 4JXSA 1L0EA 3IHBA 2P74A 2Y2IA 3C4PA 4QHCA 4S2KA 5CTNA 4XUZA 2H10A 4KG2A 2J7VA 2A3UA 4LENA 3S1YA 1BULA 1NRFA 3HUNA 3GVBA 4FSFA 4HEFA 4U0TA 3SS3A 3S4XA 5FA7A 5JYOA 1GA9A 4GOGA 1YMXA 4OPRA 4Y0TA 3P09A 1ESIA 4KZ7A 3OPRA 1ERMA 5I94A 1M40A 2H5SA 4JF4A 1DJCA 5CRFA 5DTTA 3N6IA 4JPMA 5FI2A 5E2GA 2WK0A 4GDNA 5A91A 1XP4A 4K0XA 3UDIA 3IH9A 1ALQA 1ES3A 3IF6C 4ID4A 3PTEA 5E2FA 3OPLA 1GHMA 4OKPA 1U60A 2XR0A 2HPBA 3OPPA 1IYPA 3BLSA 3OC2A 4HESA 3O3VA 4LV0A 1BT5A 4JXGA 3Q81A 4QD4A 1SKFA 4FH2A 5CHUA 5FQIA 2ZC3B 3BECA 4JKTA 5EECA 4FCFA 4N9KA 3BFDA 4N9LA 1PW8A 3ISGA 5AQ7A 5HARA 1ERQA 3HLBA 3IF6A 2ZM2A 1KE4A 1PWGA 2WAEA 1TVFA 4DKIA 5GLAA 4P0MA 5EUAA 4DE2A 3IF6B 3OCLA 5FAOA 3HUMA 5CTMA 1L2SA 3RJUA 4EBPA 3QNCA 3TOIA 2Y2OA 3FYZA 2HP9A 5FQJA 1CEGA 1W7FA 1MWTA 1IEMA 2DCFA 4XUXA 3NDGA 3Q7ZA 3VSKA 1XA1A 2X71A 2JCHA 1K6SA 3PAEA 2GDNA 2XLNA 2VGKA 3CJMA 4E6XA 5A92A 1K55A 4WZ5C 3ZG5A 1FCOA 3G35A 3TSGA 2DNSA 2XDMA 3V50A 4RYEA 5F83A 4KZ3A 3I7JA 1K57C 2WGWA 5FQKA 3AGFA 2QMIA 1XXMA 4S2JA 4R4SA 5EVIA 1LI9A 2JE5A 1LI0A 1YT4A 4WELA 3A3IA 1W79A 3UNWA 3HLFA 5EVIB 4LV3A 4E3JA 1KVMA 2XFTA 3MZEA 3UE1A 4BL3A 2IWDA 3GQZA 3NCKA 4GZBA 5HFOA 1XGJA 4KZAA 4KQQA 1L0FA 1N4OA 1GA0A 5E43A 3RXXA 4PM6A 4RX3A 5EE8A 2BG1A 1JVJA 1SDNA 2DRWA 3HREA 2EFUA 3PBQA 5GLBA 5DTSA 1FCNA 1N9BA 3CG5A 1KE3A 1S6RA 3EQUA 5JYPA 3NI9A 1NY0A 3N8SA 3BFEA 4EV4A 3UPPA 3ITAA 3CZDA 1Z6FA 1EROA 1AXBA 3UO9A 3GTCA 2Y2JA 3Q07A 3A3DA 3RXWA 3V3SA 1K56D 1E3UD 4E3MA 3FWLA 4KQOA 3HLDA 2H0TA 2J9OA 4BQMA 1HZOA 4LV2A 3UPNA 4DF6A 2ZC7A 3QNBA 5CERA 4E3OA 1KGFA 3EQVA 1QMEA 4X6TA 1CI9A 4OOYA 3ZG0A 1S0WA 3GR2A 3AGDA 1SDEA 4WBGA 5DF9A 4BENA 2R9XA 1CK3A 4RA7A 1NZUA 3A3JA 3VOYA 1NYYA 1BTLA 2EX9A 5HX9A 2FFFB 4HBTA 1JWPA 5FQMA 1RGYA 3V39A 4N1HA 1BUEA 2XEPA 3OPHA 4QY5A 2ZQ8A 5CGXA 3IF5A 3LY3A 1TDGA 3W4QA 4HBUA 4OPZA 1SHVA 3O86A 4GB7A 3ITBA 2WZXA 1MWUA 4WM9A 1BZAA 3FKVA 3LEZA 3LO7A 3ZG8B 5TGFA 2I72A 2OSUA 3MXRA 3DW0A 4ZBEA 4EBNA 4RVAA 1K54A 3G4PA 3MBZA 2WKIA 1L0GA 3VP4A 2QPNA 4C6YA 4ZDXA 4H8RA 3MXSA 4N1XA 4EQIA 4M3KA 1Q2PA 3NY4A 4OQIA 3VFFA 4R4RA 5DTKA 2Y4AA 4UA9A 1PWDA 3HLGA 4S2OA 3ZNYA 4DDYA 1LL5A 4Y0OA 5E2HA 2HP6A 2BLSA 5L2FA 4DXCA 5CGSA 1HD8A 4Y0UA 5EVLA 4XXRA 3N4IA 1IELA 4IVKA 1ES4A 3DWZA 2VGJA 3VFHA 5EOEA 3IH8A 2ZLYA 1I2WA 3HUOA 5TR7A 1IYSA 5CHMA 1IKIA 5FAQA 1TEMA 2Y2LA 1PW1A 2B5RA 4S2PA 2HDUA 1H8ZA 3ZGAB 1K55C 2XF3A 3UY6A 2H0YA 2J9PA 1NXYA 4LCLA 4OLDA 2IWCA 4WEKA 4OOLA 4E3IA 3O88A 3SH8A 5KSCA 3VP1A 2J8YA 1ZG4A 5GL9A 3MZDA 5EVIC 1W8YA 2EX6A 3IT9A 4ZJ3A 1ONGA 4R23A 2Y55A 4KZ4A 5A90A 4DXBA 1MY8A 1XA7A 1OMEA 1KGGA 1PI5A 3GV9A 4EBLA 2Y91A 4ZJ1A 3M2JA 5CHJA 3SS4A 4DE0A 4R3BA 4DE3A 3C7UA 4DDSA 2WADA 4ZTKA 4X53A 2EX8A 4MBKA 3WS5A 1YQSA 3G34A 4OOMA 3WS1A 4GN2A 1I2SA 1JTDA 1MKIA 2WGVA 5GHZA 3VP0A 2WGWB 1E25A 3PAGA 1H5XA 4Q8IA 1BLPA 1K25A 4JF6A 2RCXA 4YINA 5GLDA 1W5DA 4S2NC 5A93A 2ZQ7A 2ZQAA 1VM1A 3SS5A 1GCEA 5HW3A 1WYBA 3OZHA 1XKZA 3NBLA 1RGZA 3WS4A 5FDHA 4WEJA 3FZCA 4MNRA 1K38A 4PMAA 2Y2NA 3A3FA 2ZQCA 5GLCA 4GKUA 3WS0A 3D4FA 3UDXA 2QZ6A 5J8XA 3CMZA 2ZQ9A 4EWFA 1LLBA 1H8YA 3G30A 1JWVA 4S2NA 1K56A 1E3UA 2R9WA 2ZD8A 2Y2MA 5KZHA 5G18A 3HLCA 4K0WA 3GMWA 2WGIA 3VP3A 3S22A 3NC8A 4P6BA 4WYYA 3IXBA 1YLPA 4OP8A 1IYQA 2ZQDA 5M1AA 4WMCD 1G6AA 1YLTA 2HDSA 3VMAA 2Y2HA 5D3OA 1YLYA 2Y2QA 4E6WA 4OQ0A 2XQZA 4D2OA 2G2WA 3M6HA 1W8QA 4QJGA 5FAPA 1MWSA 4GDBA 1FSWA 1RCJA 3E2LA 4LCMA 4OH0A 2EXAA 4MLLA 4P87A 2Q9NA 4A5RA 3C7VA 5HL1A 4KZ5A 4UA6A 2E8IA 2HP5A 4QU3A 4IBXA 4DE1A 1MWRA 4K91A 3BRMA 2A49A 3UE0A 3C4OA 5FASA 1K54C 1E4DA 2OLUA 1QMFA 4S2MA 3P98A 4KENB 4U0XA 4PM8A 3IXGA 2CC1A 3G2YA 4X68A 5E2EA 3ZG7B 2ZM8A 4Y7PA 4MEZA 1O07A 3ZDJA 4N92A 3BM6A 5TFQA 4MBFA 5FI7A 1DJAA 3A3EA 1WYCA 1PZOA 4IVIA 2C5WB 3PBOA 3BYDA 3Q7VA 4BD1A 4PM5A 4ZAMA 5BOHA 1XGIA 3MZFA 1LL9A 1PZPA 2Q9MA 4JLFA 4PM7A 4KZ6A 3Q7VB 3HVFA 3ZHHA 2ZJ9A 1DY6A 4OQGA 1VQQA 4YFMA 5KSHA 2V1ZA 5FSRA 4KG6A 4BJPA 4R1GA 3MKEA 3W4PA 1TDLA 4OVDA 1L0DA 2JC7A 3C5AA 4LV1A 2HDRA 1NYMA 1YM1A 2XFSA 5GHYA 2ZC6B 3FV7A 5U47A 4RX2A 1ZKJA 1HVBA 5FI6A 3GRJA 4NETA 2PU2A 4F94A 5DVAA 2ZC5B 1FOFA 4O7DA 2WYXA 3G31A 3M6BA 5F82A 5CEDA 5FQ9A 3LY4A 1K4EA 2Z2MB 2ZM0A 3UN7A 1ESUA 1GHPA 1MPLA 3IXHA 3JYIA 2PBYA 2EXBA 4QY6A 3V3RA 2IWBA 1ONHA 1NJ4A 2WAFA 3N7WA 4R3JA 2OLVA 1YLZA 1KDWA 1EWZA 5CECA 4BLMA 2ZMAA 1BLCA 5CXWA 3VSLA 3WRTA 2Y2KA 2Y59A 1PI4A 1BSGA 1GHIA 5F1FA 2FFYA 1MXOA 1K6RA 3G32A 1Q2QA 1O7EA 3ZCZA 4JBFA 4PM9A 4GD6A 5HAPA 3O87A 3HL9A 2X01A 2UWXA 1BLSA 1CI8A 1FR6A 2Y2GA 4FD8A 3E2KA 5FQQA 3BFFA 4CJNA 1YLWA 4L0LA 3B3XA 4UA7A 5EPHA 5M19A 3PBTA 4E3NA 3ZG9B 3AGEA 3UDFA 1FQGA 4BD0A 2XGNA 5HAQA 1Y54A 5F1GA 1BLHA 2WZZA 3IHAA 1FSYA 2V20A 2JBFA 1ZG6A 3SH7A 3WWXA 2Y2PA 4E3KA 2ZC4B 4KZ9A 1ZC2A 3VOZA 4EUZA 1JTGA 3BFGA 2XH9A 3DWKA 4KZBA 5FATA 1I5QA 1FCMA 4JF5A 1J9MA 3SOIA 4OPQA 5AQBA 1KE0A 1K4FA 1HTZA 4KZ8A 2X02A 1ES5A 3N8LA 3NIAA 3IWIA 3BLMA 2G2UA 3M2KA 3NDEA 1PIOA 4OLGA 4S2IA 4C3QA 1YLJA 4QB8A 2Z2LB 3VP2A 3LCEA 3ZNTA 1KDSA 5IHVA 1ES2A 5EOOA 3BFCA 5CGWA 4B4XA 5KMWA 4GNUA 4C75A 1DJBA 2WKHA 3IQAA 3QHYA 2XD1A 4JXWA 4UAAA 4P85A 4WZ5A 4X56A 5EVID 2OV5A 4WMCA 3ZVWA 3G2ZA 4Z9QA 1CEFA 4U3TA 1YMSA 1PWCA 3SH9A 1KVLA 3WRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UHU A;  4B4Z A;  1K57 A;  3W4O A;  4X69 A;  5HAI A;  2XD5 A;  4WZ4 A;  3HBR A;  5DF7 A;  1JWZ A;  2WKE A;  3ZVT A;  3DTM A;  4OP5 A;  4OPY A;  4FH4 A;  5M18 A;  2V2F F;  1MBL A;  5AQA A;  4ZJ2 A;  3Q1F A;  4E3L A;  1FR1 A;  3ZFZ A;  1M6K A;  1PYY A;  1SCW A;  3IWO A;  1G68 A;  2XK1 A;  4PPR A;  5AQ9 A;  2PU4 A;  4JXV A;  3V5M A;  4KG5 A;  3UPO A;  1LHY A;  5DF8 A;  4IBR A;  4X55 A;  4R0Q A;  4S2L A;  3N8R A;  2P9V A;  3UE3 A;  1IKG A;  1EI5 A;  3OCN A;  3BEB A;  4IED A;  3HLW A;  3PBS A;  1C3B A;  2C6W B;  4MBH A;  2HDQ A;  4GD8 A;  2EFX A;  3PBN A;  1WE4 A;  2P9V B;  5GHX A;  4OQH A;  3Q82 A;  4CPK A;  4DRT A;  3HLE A;  4KQR A;  3IXD A;  1RP5 A;  1NZO A;  3WS2 A;  1KGE A;  1IYO A;  3W8K A;  3PBR A;  2EX2 A;  2RL3 A;  3MKF A;  3TG9 A;  1XPB A;  1XX2 A;  2WUQ A;  4BL2 A;  4NK3 A;  3GSG A;  4B88 A;  3FKW A;  3IWQ A;  4OON A;  5CEB A;  3MFD A;  4JXS A;  1L0E A;  3IHB A;  2P74 A;  2Y2I A;  3C4P A;  4QHC A;  4S2K A;  5CTN A;  4XUZ A;  2H10 A;  4KG2 A;  2J7V A;  2A3U A;  4LEN A;  3S1Y A;  1BUL A;  1NRF A;  3HUN A;  3GVB A;  4FSF A;  4HEF A;  4U0T A;  3SS3 A;  3S4X A;  5FA7 A;  5JYO A;  1GA9 A;  4GOG A;  1YMX A;  4OPR A;  4Y0T A;  3P09 A;  1ESI A;  4KZ7 A;  3OPR A;  1ERM A;  5I94 A;  1M40 A;  2H5S A;  4JF4 A;  1DJC A;  5CRF A;  5DTT A;  3N6I A;  4JPM A;  5FI2 A;  5E2G A;  2WK0 A;  4GDN A;  5A91 A;  1XP4 A;  4K0X A;  3UDI A;  3IH9 A;  1ALQ A;  1ES3 A;  3IF6 C;  4ID4 A;  3PTE A;  5E2F A;  3OPL A;  1GHM A;  4OKP A;  1U60 A;  2XR0 A;  2HPB A;  3OPP A;  1IYP A;  3BLS A;  3OC2 A;  4HES A;  3O3V A;  4LV0 A;  1BT5 A;  4JXG A;  3Q81 A;  4QD4 A;  1SKF A;  4FH2 A;  5CHU A;  5FQI A;  2ZC3 B;  3BEC A;  4JKT A;  5EEC A;  4FCF A;  4N9K A;  3BFD A;  4N9L A;  1PW8 A;  3ISG A;  5AQ7 A;  5HAR A;  1ERQ A;  3HLB A;  3IF6 A;  2ZM2 A;  1KE4 A;  1PWG A;  2WAE A;  1TVF A;  4DKI A;  5GLA A;  4P0M A;  5EUA A;  4DE2 A;  3IF6 B;  3OCL A;  5FAO A;  3HUM A;  5CTM A;  1L2S A;  3RJU A;  4EBP A;  3QNC A;  3TOI A;  2Y2O A;  3FYZ A;  2HP9 A;  5FQJ A;  1CEG A;  1W7F A;  1MWT A;  1IEM A;  2DCF A;  4XUX A;  3NDG A;  3Q7Z A;  3VSK A;  1XA1 A;  2X71 A;  2JCH A;  1K6S A;  3PAE A;  2GDN A;  2XLN A;  2VGK A;  3CJM A;  4E6X A;  5A92 A;  1K55 A;  4WZ5 C;  3ZG5 A;  1FCO A;  3G35 A;  3TSG A;  2DNS A;  2XDM A;  3V50 A;  4RYE A;  5F83 A;  4KZ3 A;  3I7J A;  1K57 C;  2WGW A;  5FQK A;  3AGF A;  2QMI A;  1XXM A;  4S2J A;  4R4S A;  5EVI A;  1LI9 A;  2JE5 A;  1LI0 A;  1YT4 A;  4WEL A;  3A3I A;  1W79 A;  3UNW A;  3HLF A;  5EVI B;  4LV3 A;  4E3J A;  1KVM A;  2XFT A;  3MZE A;  3UE1 A;  4BL3 A;  2IWD A;  3GQZ A;  3NCK A;  4GZB A;  5HFO A;  1XGJ A;  4KZA A;  4KQQ A;  1L0F A;  1N4O A;  1GA0 A;  5E43 A;  3RXX A;  4PM6 A;  4RX3 A;  5EE8 A;  2BG1 A;  1JVJ A;  1SDN A;  2DRW A;  3HRE A;  2EFU A;  3PBQ A;  5GLB A;  5DTS A;  1FCN A;  1N9B A;  3CG5 A;  1KE3 A;  1S6R A;  3EQU A;  5JYP A;  3NI9 A;  1NY0 A;  3N8S A;  3BFE A;  4EV4 A;  3UPP A;  3ITA A;  3CZD A;  1Z6F A;  1ERO A;  1AXB A;  3UO9 A;  3GTC A;  2Y2J A;  3Q07 A;  3A3D A;  3RXW A;  3V3S A;  1K56 D;  1E3U D;  4E3M A;  3FWL A;  4KQO A;  3HLD A;  2H0T A;  2J9O A;  4BQM A;  1HZO A;  4LV2 A;  3UPN A;  4DF6 A;  2ZC7 A;  3QNB A;  5CER A;  4E3O A;  1KGF A;  3EQV A;  1QME A;  4X6T A;  1CI9 A;  4OOY A;  3ZG0 A;  1S0W A;  3GR2 A;  3AGD A;  1SDE A;  4WBG A;  5DF9 A;  4BEN A;  2R9X A;  1CK3 A;  4RA7 A;  1NZU A;  3A3J A;  3VOY A;  1NYY A;  1BTL A;  2EX9 A;  5HX9 A;  2FFF B;  4HBT A;  1JWP A;  5FQM A;  1RGY A;  3V39 A;  4N1H A;  1BUE A;  2XEP A;  3OPH A;  4QY5 A;  2ZQ8 A;  5CGX A;  3IF5 A;  3LY3 A;  1TDG A;  3W4Q A;  4HBU A;  4OPZ A;  1SHV A;  3O86 A;  4GB7 A;  3ITB A;  2WZX A;  1MWU A;  4WM9 A;  1BZA A;  3FKV A;  3LEZ A;  3LO7 A;  3ZG8 B;  5TGF A;  2I72 A;  2OSU A;  3MXR A;  3DW0 A;  4ZBE A;  4EBN A;  4RVA A;  1K54 A;  3G4P A;  3MBZ A;  2WKI A;  1L0G A;  3VP4 A;  2QPN A;  4C6Y A;  4ZDX A;  4H8R A;  3MXS A;  4N1X A;  4EQI A;  4M3K A;  1Q2P A;  3NY4 A;  4OQI A;  3VFF A;  4R4R A;  5DTK A;  2Y4A A;  4UA9 A;  1PWD A;  3HLG A;  4S2O A;  3ZNY A;  4DDY A;  1LL5 A;  4Y0O A;  5E2H A;  2HP6 A;  2BLS A;  5L2F A;  4DXC A;  5CGS A;  1HD8 A;  4Y0U A;  5EVL A;  4XXR A;  3N4I A;  1IEL A;  4IVK A;  1ES4 A;  3DWZ A;  2VGJ A;  3VFH A;  5EOE A;  3IH8 A;  2ZLY A;  1I2W A;  3HUO A;  5TR7 A;  1IYS A;  5CHM A;  1IKI A;  5FAQ A;  1TEM A;  2Y2L A;  1PW1 A;  2B5R A;  4S2P A;  2HDU A;  1H8Z A;  3ZGA B;  1K55 C;  2XF3 A;  3UY6 A;  2H0Y A;  2J9P A;  1NXY A;  4LCL A;  4OLD A;  2IWC A;  4WEK A;  4OOL A;  4E3I A;  3O88 A;  3SH8 A;  5KSC A;  3VP1 A;  2J8Y A;  1ZG4 A;  5GL9 A;  3MZD A;  5EVI C;  1W8Y A;  2EX6 A;  3IT9 A;  4ZJ3 A;  1ONG A;  4R23 A;  2Y55 A;  4KZ4 A;  5A90 A;  4DXB A;  1MY8 A;  1XA7 A;  1OME A;  1KGG A;  1PI5 A;  3GV9 A;  4EBL A;  2Y91 A;  4ZJ1 A;  3M2J A;  5CHJ A;  3SS4 A;  4DE0 A;  4R3B A;  4DE3 A;  3C7U A;  4DDS A;  2WAD A;  4ZTK A;  4X53 A;  2EX8 A;  4MBK A;  3WS5 A;  1YQS A;  3G34 A;  4OOM A;  3WS1 A;  4GN2 A;  1I2S A;  1JTD A;  1MKI A;  2WGV A;  5GHZ A;  3VP0 A;  2WGW B;  1E25 A;  3PAG A;  1H5X A;  4Q8I A;  1BLP A;  1K25 A;  4JF6 A;  2RCX A;  4YIN A;  5GLD A;  1W5D A;  4S2N C;  5A93 A;  2ZQ7 A;  2ZQA A;  1VM1 A;  3SS5 A;  1GCE A;  5HW3 A;  1WYB A;  3OZH A;  1XKZ A;  3NBL A;  1RGZ A;  3WS4 A;  5FDH A;  4WEJ A;  3FZC A;  4MNR A;  1K38 A;  4PMA A;  2Y2N A;  3A3F A;  2ZQC A;  5GLC A;  4GKU A;  3WS0 A;  3D4F A;  3UDX A;  2QZ6 A;  5J8X A;  3CMZ A;  2ZQ9 A;  4EWF A;  1LLB A;  1H8Y A;  3G30 A;  1JWV A;  4S2N A;  1K56 A;  1E3U A;  2R9W A;  2ZD8 A;  2Y2M A;  5KZH A;  5G18 A;  3HLC A;  4K0W A;  3GMW A;  2WGI A;  3VP3 A;  3S22 A;  3NC8 A;  4P6B A;  4WYY A;  3IXB A;  1YLP A;  4OP8 A;  1IYQ A;  2ZQD A;  5M1A A;  4WMC D;  1G6A A;  1YLT A;  2HDS A;  3VMA A;  2Y2H A;  5D3O A;  1YLY A;  2Y2Q A;  4E6W A;  4OQ0 A;  2XQZ A;  4D2O A;  2G2W A;  3M6H A;  1W8Q A;  4QJG A;  5FAP A;  1MWS A;  4GDB A;  1FSW A;  1RCJ A;  3E2L A;  4LCM A;  4OH0 A;  2EXA A;  4MLL A;  4P87 A;  2Q9N A;  4A5R A;  3C7V A;  5HL1 A;  4KZ5 A;  4UA6 A;  2E8I A;  2HP5 A;  4QU3 A;  4IBX A;  4DE1 A;  1MWR A;  4K91 A;  3BRM A;  2A49 A;  3UE0 A;  3C4O A;  5FAS A;  1K54 C;  1E4D A;  2OLU A;  1QMF A;  4S2M A;  3P98 A;  4KEN B;  4U0X A;  4PM8 A;  3IXG A;  2CC1 A;  3G2Y A;  4X68 A;  5E2E A;  3ZG7 B;  2ZM8 A;  4Y7P A;  4MEZ A;  1O07 A;  3ZDJ A;  4N92 A;  3BM6 A;  5TFQ A;  4MBF A;  5FI7 A;  1DJA A;  3A3E A;  1WYC A;  1PZO A;  4IVI A;  2C5W B;  3PBO A;  3BYD A;  3Q7V A;  4BD1 A;  4PM5 A;  4ZAM A;  5BOH A;  1XGI A;  3MZF A;  1LL9 A;  1PZP A;  2Q9M A;  4JLF A;  4PM7 A;  4KZ6 A;  3Q7V B;  3HVF A;  3ZHH A;  2ZJ9 A;  1DY6 A;  4OQG A;  1VQQ A;  4YFM A;  5KSH A;  2V1Z A;  5FSR A;  4KG6 A;  4BJP A;  4R1G A;  3MKE A;  3W4P A;  1TDL A;  4OVD A;  1L0D A;  2JC7 A;  3C5A A;  4LV1 A;  2HDR A;  1NYM A;  1YM1 A;  2XFS A;  5GHY A;  2ZC6 B;  3FV7 A;  5U47 A;  4RX2 A;  1ZKJ A;  1HVB A;  5FI6 A;  3GRJ A;  4NET A;  2PU2 A;  4F94 A;  5DVA A;  2ZC5 B;  1FOF A;  4O7D A;  2WYX A;  3G31 A;  3M6B A;  5F82 A;  5CED A;  5FQ9 A;  3LY4 A;  1K4E A;  2Z2M B;  2ZM0 A;  3UN7 A;  1ESU A;  1GHP A;  1MPL A;  3IXH A;  3JYI A;  2PBY A;  2EXB A;  4QY6 A;  3V3R A;  2IWB A;  1ONH A;  1NJ4 A;  2WAF A;  3N7W A;  4R3J A;  2OLV A;  1YLZ A;  1KDW A;  1EWZ A;  5CEC A;  4BLM A;  2ZMA A;  1BLC A;  5CXW A;  3VSL A;  3WRT A;  2Y2K A;  2Y59 A;  1PI4 A;  1BSG A;  1GHI A;  5F1F A;  2FFY A;  1MXO A;  1K6R A;  3G32 A;  1Q2Q A;  1O7E A;  3ZCZ A;  4JBF A;  4PM9 A;  4GD6 A;  5HAP A;  3O87 A;  3HL9 A;  2X01 A;  2UWX A;  1BLS A;  1CI8 A;  1FR6 A;  2Y2G A;  4FD8 A;  3E2K A;  5FQQ A;  3BFF A;  4CJN A;  1YLW A;  4L0L A;  3B3X A;  4UA7 A;  5EPH A;  5M19 A;  3PBT A;  4E3N A;  3ZG9 B;  3AGE A;  3UDF A;  1FQG A;  4BD0 A;  2XGN A;  5HAQ A;  1Y54 A;  5F1G A;  1BLH A;  2WZZ A;  3IHA A;  1FSY A;  2V20 A;  2JBF A;  1ZG6 A;  3SH7 A;  3WWX A;  2Y2P A;  4E3K A;  2ZC4 B;  4KZ9 A;  1ZC2 A;  3VOZ A;  4EUZ A;  1JTG A;  3BFG A;  2XH9 A;  3DWK A;  4KZB A;  5FAT A;  1I5Q A;  1FCM A;  4JF5 A;  1J9M A;  3SOI A;  4OPQ A;  5AQB A;  1KE0 A;  1K4F A;  1HTZ A;  4KZ8 A;  2X02 A;  1ES5 A;  3N8L A;  3NIA A;  3IWI A;  3BLM A;  2G2U A;  3M2K A;  3NDE A;  1PIO A;  4OLG A;  4S2I A;  4C3Q A;  1YLJ A;  4QB8 A;  2Z2L B;  3VP2 A;  3LCE A;  3ZNT A;  1KDS A;  5IHV A;  1ES2 A;  5EOO A;  3BFC A;  5CGW A;  4B4X A;  5KMW A;  4GNU A;  4C75 A;  1DJB A;  2WKH A;  3IQA A;  3QHY A;  2XD1 A;  4JXW A;  4UAA A;  4P85 A;  4WZ5 A;  4X56 A;  5EVI D;  2OV5 A;  4WMC A;  3ZVW A;  3G2Z A;  4Z9Q A;  1CEF A;  4U3T A;  1YMS A;  1PWC A;  3SH9 A;  1KVL A;  3WRZ A; 
#chains in the Genus database with same CATH topology
 3W4O A;  4X69 A;  4ESP A;  3VE4 A;  4HH3 A;  3HBR A;  1OTD A;  3GDI A;  3UB9 A;  3DTM A;  4OP5 A;  4Y2F A;  4FH4 A;  3CLO A;  3ULF A;  4BBU A;  5HDC A;  4E3L A;  1FR1 A;  3ZFZ A;  1M6K A;  3IWO A;  5FEF A;  4PPR A;  2PU4 A;  2R78 A;  4CLC E;  3N8R A;  5TJJ A;  3BEB A;  3HLW A;  3PBS A;  2HZ5 A;  2VKS A;  2EFX A;  2P9V B;  1N9L A;  1TS8 A;  1N9O A;  3P7N A;  3Q82 A;  4CPK A;  3CAX A;  4KQR A;  3IXD A;  3QP8 A;  5DFX A;  2RL3 A;  3BWL A;  4YNR A;  3DAV A;  2WUQ A;  3L9K A;  1CF0 A;  4BL2 A;  4NK3 A;  1SKO B;  1GSW A;  4JXS A;  5EM0 A;  1L0E A;  2B18 A;  4ETZ A;  2Y2I A;  4XUZ A;  3T4K A;  2H10 A;  2V0W A;  3HUN A;  3T4Q A;  3GVB A;  4U0T A;  2VX8 A;  4BMW A;  3P09 A;  1M40 A;  1S4R A;  4JF4 A;  5CRF A;  5AJG A;  5FI2 A;  3KSF A;  2WK0 A;  3HJK A;  1XP4 A;  4K0X A;  3ZQ5 A;  4LRX C;  2QYB A;  4M4X A;  3JVU A;  1K0K A;  1IYP A;  3O3V A;  3Q81 A;  4FH2 A;  2YKF A;  5FQI A;  2D02 A;  2VLG A;  4FCF A;  1H0M A;  4N9L A;  1PW8 A;  3ISG A;  4HJ4 A;  4JGP A;  5HAR A;  2ZM2 A;  1J3W A;  2V1A A;  3BW6 A;  3UME A;  1LL8 A;  1OTB A;  3MSH A;  5CTM A;  1L2S A;  4EBP A;  3TOI A;  2LB5 A;  2Y2O A;  3MQ0 A;  4GHI B;  5FQJ A;  1CEG A;  1W7F A;  1IEM A;  1W63 M;  3VSK A;  3Q7Z A;  5K5B A;  1XA1 A;  1K6S A;  2GDN A;  4E6X A;  3EEA A;  4WZ5 C;  3TSG A;  2XDM A;  3V50 A;  3CPT A;  3I7J A;  2OOL A;  1XXM A;  2QJ5 A;  3U2A A;  4PAU A;  3A3I A;  1W79 A;  1BYW A;  3T4J A;  4I39 A;  3TW8 A;  3UE1 A;  2IWD A;  3NCK A;  3QP2 A;  5HFO A;  4BBV A;  4KZA A;  1GA0 A;  1JVJ A;  1SDN A;  3NOP C;  3HRE A;  1S6R A;  2A2L A;  3H7W A;  3UPP A;  1UWN X;  4FUW A;  3H9W A;  3A3D A;  1K56 D;  4E3M A;  4KQO A;  3PR6 A;  4DF6 A;  4E3O A;  4QWO A;  5TBM A;  4X6T A;  1S0W A;  5DF9 A;  5HDD A;  1VEU B;  3A3J A;  4KUO A;  3LGO A;  3EGD C;  1P97 A;  3T4T A;  2FFF B;  1BUE A;  3LI8 A;  3LY3 A;  1TDG A;  3W4Q A;  4PHT A;  4XT2 A;  1TS0 A;  2WZX A;  4WM9 A;  1BZA A;  3FKV A;  1T18 A;  3H82 B;  2I72 A;  2JKT I;  3DW0 A;  4EBN A;  1PRQ A;  3A0V A;  3MBZ A;  3VP4 A;  3CHW P;  2XA7 M;  2WKQ A;  3MXS A;  5AVE A;  3VFF A;  4R4R A;  3F1N A;  2J80 A;  1YPR A;  1S1Y A;  5IU1 A;  3T4S A;  3N4I A;  3DWZ A;  2VGJ A;  3NJA A;  2HV1 A;  1I2W A;  3HUO A;  5I5L A;  4CQH A;  3ZGA B;  4EER A;  1L3L A;  2H0Y A;  4EUV A;  2IWC A;  4LFU A;  3O88 A;  3VP1 A;  1ZG4 A;  1D7E A;  2EX6 A;  2A24 B;  2HF6 A;  2XRO A;  3GV9 A;  4EW7 A;  2W3G A;  4KUK A;  4ZJ1 A;  4DE3 A;  2EX8 A;  3A0S A;  1LSW A;  4MBK A;  3E4O A;  1YQS A;  4GN2 A;  1MKI A;  1JTD A;  5GHZ A;  3VP0 A;  5A93 A;  2RCX A;  5GLD A;  2ZQ7 A;  4HH2 A;  1UWP X;  3SS5 A;  1GCE A;  2AVX A;  3F1P A;  3OZH A;  3LIB A;  3WS4 A;  2XSS A;  4MNR A;  2KOI A;  4PMA A;  3A3F A;  4I3I A;  4IJG A;  2QZ6 A;  3NOU C;  1H8Y A;  3MMH A;  3F1O A;  1E3U A;  2R9W A;  2QKP A;  5G18 A;  1CQA A;  1G5U A;  3NC8 A;  2HDS A;  1YLT A;  1D1J A;  1YLY A;  4E6W A;  4OQ0 A;  3UB8 A;  5HPF A;  4D2O A;  3M6H A;  5FAP A;  4GDB A;  5HWW A;  3B42 A;  2PHY A;  3C7V A;  4QU3 A;  4DE1 A;  4IBX A;  2VK3 A;  3UMD A;  1OTA A;  3P98 A;  4U0X A;  4PM8 A;  1XFN A;  3G2Y A;  4NXF A;  3ZG7 B;  2ZM8 A;  4IUK A;  3ZDJ A;  4MBF A;  2W3F A;  2ZMV A;  2Q9M A;  1PZP A;  3K3C A;  4Q0I A;  1N9N A;  3HVF A;  1DY6 A;  4OQG A;  4KG6 A;  3MKE A;  3W4P A;  1TDL A;  4NG2 A;  3IX4 A;  2VZW A;  4NXG A;  3JVV A;  3MFX A;  1OPX A;  3FV7 A;  5U47 A;  4HHD A;  5FI6 A;  3O5Y A;  2PU2 A;  2ZC5 B;  4O7D A;  5L09 A;  2WYX A;  3G31 A;  5FQ9 A;  3LY4 A;  1K4E A;  3IXH A;  3JYI A;  3V3R A;  3QP5 A;  4GS9 B;  3MJQ A;  5CEC A;  2ZMA A;  2M1C A;  4O8G A;  3WRT A;  2O0Y A;  3VSL A;  1PI4 A;  1GHI A;  5F1F A;  2FFY A;  4R70 A;  3MR0 A;  3O87 A;  2L0W A;  1CI8 A;  1FR6 A;  1XJ6 A;  3D72 A;  4L0L A;  3PXP A;  4I38 A;  4UA7 A;  3KYE A;  4GHI A;  2P04 A;  3C8C A;  3IHA A;  1ZG6 A;  3LEQ A;  4II7 A;  1FCM A;  1J9M A;  1KE0 A;  3S7Q A;  4FOF A;  5HZH A;  3N8L A;  3NIA A;  3BLM A;  4OLG A;  4S2I A;  3EGX C;  1STZ A;  1ES2 A;  5KMW A;  4GNU A;  1OT9 A;  4HNB A;  4P85 A;  4AFI A;  4X56 A;  1NLZ A;  3D3O A;  1YMS A;  1PWC A;  5HPI A;  4EEP A;  4MN5 A;  4WZ4 A;  1V9Z A;  3DTE A;  4ME4 A;  2PRF A;  1DP9 A;  5L10 A;  5MC7 A;  3Q1F A;  5AVF A;  5A8B A;  3V5M A;  3PYP A;  4IUH A;  3UE3 A;  1IKG A;  3OCN A;  4IED A;  3QP1 A;  5GHX A;  4OQH A;  4DRT A;  3R4K A;  2EX2 A;  3TG9 A;  3R7W A;  2BAS A;  4BWI A;  3FKW A;  4HOI A;  2P74 A;  3H82 A;  1BUL A;  1NRF A;  4HEF A;  2Z6C A;  3S4X A;  3SS3 A;  4GOG A;  4KQD A;  2V8C A;  5DTT A;  1DJC A;  5E2G A;  2JKR I;  4GDN A;  5J7E A;  3IH9 A;  4ID4 A;  3EEH A;  3OPL A;  3KYZ A;  4HY8 A;  4HES A;  4LV0 A;  3DBA A;  2ZC3 B;  3BEC A;  4JKT A;  1VB6 A;  3BFD A;  5AQ7 A;  3IF6 A;  1KE4 A;  1PWG A;  2WAE A;  2PD8 A;  1SZV A;  2VGL S;  3C30 A;  2ZL1 B;  5FAO A;  2V8F A;  3HUM A;  3K3D A;  5IT5 A;  3FYZ A;  2HP9 A;  2O9C A;  5J4E A;  5HL6 A;  2DCF A;  2X71 A;  3EOI A;  4MN7 A;  1T1A A;  3ZG5 A;  1P9R A;  3P01 A;  1TF1 A;  5C5K A;  3G35 A;  5F83 A;  4KZ3 A;  4EQ1 A;  1K57 C;  2QMI A;  3PHY A;  1VET B;  1NWZ A;  3CUE A;  2JE5 A;  2W1R A;  1YT4 A;  4WEL A;  1Y4O A;  3HLF A;  5EVI B;  4E3J A;  5DFY A;  3OOV A;  3MZE A;  4BL3 A;  3GQZ A;  3KSI A;  4GZB A;  4MDZ A;  1XGJ A;  5E43 A;  3RXX A;  2PBD P;  4D60 A;  5EE8 A;  2BG1 A;  4G3W A;  2EFU A;  5GLB A;  5DTS A;  4F3L B;  3NI9 A;  3BFE A;  3OBF A;  1MKM A;  1XJ3 A;  3VV4 A;  2W1T B;  2H0T A;  4BQM A;  4LV2 A;  2FH5 A;  3QNB A;  1XFQ A;  4OOY A;  3ZG0 A;  3GR2 A;  4WBG A;  4BEN A;  1UGU A;  4JGO A;  1XJ2 A;  2PYR A;  2ZOH A;  4FTX A;  4HBT A;  3U4L P;  5FQM A;  2I9V A;  1ACF A;  2XEP A;  3OPH A;  2ZQ8 A;  2OAP 1;  4Q0H A;  4GB7 A;  2KDK A;  1V9Y A;  5DKL A;  3LEZ A;  3ZG8 B;  4H6J A;  2ZOI A;  4GJ4 A;  4HJ3 A;  1OTE A;  4RVA A;  3G4P A;  2JN7 A;  2WKI A;  1L0G A;  5J3W A;  3DTK A;  1Q2P A;  3NY4 A;  5DTK A;  2Y4A A;  3FPW A;  1PWD A;  4S2O A;  4UA9 A;  4DDY A;  4L9F A;  2HP6 A;  5E2H A;  5L2F A;  4DXC A;  3TRC A;  5EVL A;  2VV7 A;  3VFH A;  5EOE A;  3IH8 A;  2GNX A;  4YWZ A;  4GS9 A;  2P08 A;  2Z6D A;  5CHM A;  3LR4 A;  5FAQ A;  1PW1 A;  2B5R A;  1H8Z A;  1K55 C;  3B47 A;  1OJ5 A;  4LCL A;  5DKK A;  5KSC A;  2J8Y A;  5EVI C;  3IT9 A;  1HLU P;  4ZJ3 A;  1ONG A;  4WLA A;  5A90 A;  2CMN A;  1OME A;  1KGG A;  2Y79 A;  4PKY A;  3M2J A;  5CHJ A;  3C7U A;  4ZTK A;  3WS1 A;  2IA2 A;  3T50 A;  3MF0 A;  5HL1 A;  1K25 A;  4JF6 A;  4YIN A;  4CLC B;  1XJ4 A;  2EWW A;  1XKZ A;  3NBL A;  5G4Y A;  5FDH A;  1VHM A;  1LT0 A;  1A0K A;  1D06 A;  3NOT C;  3UDX A;  4HI4 A;  2L1M A;  1F9I A;  1DP6 A;  2ZQ9 A;  1LLB A;  1K56 A;  1F5M A;  2ZD8 A;  2JHE A;  5KZH A;  3VP3 A;  4P6B A;  1YLP A;  1IYQ A;  4LGW A;  2HJ9 C;  5M1A A;  2O9B A;  3VMA A;  2Y2Q A;  3UB7 A;  2XQZ A;  4QJG A;  1ODV A;  1FSW A;  4I3A A;  2Q9N A;  4UQI S;  4KZ5 A;  2E8I A;  2HP5 A;  1MWR A;  4ARZ B;  4EES A;  2QJ7 A;  2A49 A;  3C4O A;  4Y17 A;  1K54 C;  1E4D A;  1P0Z A;  5E2E A;  2D01 A;  4Y7P A;  4MEZ A;  2VGL M;  1O07 A;  3BM6 A;  1WYC A;  2C5W B;  3BYD A;  3Q7V A;  4PM5 A;  4ZAM A;  3IX3 A;  4JLF A;  1LL9 A;  2ZJ9 A;  2M7V A;  1VQQ A;  1S4S A;  3FC7 A;  4EXO A;  4LV1 A;  2HDR A;  1YM1 A;  2W0N A;  3NUL A;  2XFS A;  4LPZ A;  2ZC6 B;  3GRJ A;  4F94 A;  3M6B A;  5F82 A;  2Q0O A;  2Z2M B;  4EET B;  1MPL A;  1MZU A;  2PBY A;  2EXB A;  2VA0 A;  2O99 A;  2WAF A;  5F6A A;  1EWZ A;  3FG8 A;  2Y2K A;  2Y59 A;  3BQA A;  2B02 A;  1MXO A;  1T19 A;  1K6R A;  3G32 A;  4JGR A;  4CLC C;  3BY8 A;  2Y2G A;  2ZBB A;  2PD7 A;  3BFF A;  2O9A A;  1LSX A;  3PBT A;  4E3N A;  2Y8H A;  3AGE A;  2P7J A;  4Y5F A;  2XGN A;  1DRM A;  5HAQ A;  1BLH A;  4JGQ A;  1FSY A;  3SH7 A;  4EUZ A;  2VV8 A;  1JTG A;  1WA9 A;  4MN6 A;  2FZ0 A;  2XH9 A;  1I5Q A;  5F5Y A;  1H8M A;  4OPQ A;  4KZ8 A;  1VET A;  3M2K A;  1YLJ A;  3ZNT A;  3T1Q B;  5CGW A;  3RFB A;  3TE8 A;  4C75 A;  2OWJ A;  1DJB A;  5HDS A;  5EVI D;  4WZ5 A;  2OV5 A;  3G2Z A;  4U3T A;  3BQ8 A;  1KVL A;  4UHU A;  4B4Z A;  2KLI A;  2XD5 A;  2V0U A;  5DF7 A;  1JWZ A;  4OPY A;  2V2F F;  1PYY A;  1SCW A;  2W1T A;  5AQ9 A;  4KG5 A;  4LRZ E;  4YOF A;  1LHY A;  5DF8 A;  4X55 A;  4R0Q A;  5L8M A;  4WN5 A;  2P9V A;  1EI5 A;  2HDQ A;  4GD8 A;  3B33 A;  3JPU A;  2PR5 A;  3HLE A;  1RP5 A;  3KSG A;  3C38 A;  3C2W A;  1SKO A;  1YKD A;  4DJ2 A;  3GSG A;  3IWQ A;  1CJF A;  3HCY A;  5CEB A;  3MFD A;  4S2K A;  4QHC A;  2ZMF A;  1X0O A;  3S1Y A;  2J7V A;  2LB9 A;  1FIL A;  4LEN A;  4NXB A;  4Z1W A;  5FA7 A;  5JYO A;  4ZRR A;  1GA9 A;  1YMX A;  4Y0T A;  3IX8 A;  1ESI A;  4KZ7 A;  1ERM A;  5I94 A;  5EM1 A;  4JPM A;  2K31 A;  3UDI A;  4ETX A;  3IF6 C;  3MQQ A;  3PTE A;  5E2F A;  1GHM A;  4R6L A;  4WF0 A;  3BY9 A;  1U60 A;  2HPB A;  3BLS A;  3OC2 A;  4JXG A;  2PYP A;  1LSV A;  4N9K A;  1ERQ A;  3HLB A;  1JNU A;  1TVF A;  4DKI A;  5GLA A;  5EUA A;  4DE2 A;  3OCL A;  3QNC A;  1MWT A;  4XUX A;  4PKY G;  3NDG A;  2JCH A;  3MXQ A;  4UQI M;  3PAE A;  3CJM A;  1NRJ A;  2VGK A;  2XLN A;  1YSP A;  5A92 A;  2QWS A;  4RYE A;  3KSH A;  4MCW A;  1TD5 A;  2PDR A;  3CPT B;  2PT7 A;  4R4S A;  4S2J A;  1LI9 A;  1YAX A;  4CLC D;  4PM6 A;  4RX3 A;  5HWV A;  3PBQ A;  3V67 A;  2ACG A;  1N9B A;  3CG5 A;  5HD3 A;  4WUJ A;  5JYP A;  1NY0 A;  3N8S A;  4EV4 A;  3ITA A;  5LBR A;  1Z6F A;  1ERO A;  3H7W B;  2Y2J A;  3V3S A;  2W3H A;  3HLD A;  4P6Z S;  1HZO A;  2ZC7 A;  2QHK A;  1CI9 A;  5FEG A;  1VEU A;  3IBJ A;  1H3Q A;  5TBM B;  2R9X A;  4QPR A;  1CK3 A;  1NZU A;  3VOY A;  1NYY A;  2EX9 A;  4ARZ A;  4NXE A;  5HX9 A;  2KX6 A;  1RGY A;  5CGX A;  3O86 A;  3ITB A;  1MWU A;  2VV6 A;  4XT2 B;  5TGF A;  3MXR A;  4ZBE A;  2QPN A;  4ZDX A;  4LRY C;  4DN0 A;  4M3K A;  3VOL A;  3ZNY A;  1GSX A;  2K2N A;  1LL5 A;  3GEC A;  3E0Y A;  4L9G A;  4IVK A;  1ES4 A;  2JKF A;  1Z09 A;  5TR7 A;  1IKI A;  1TEM A;  2H28 A;  2Y2L A;  5FL3 A;  3LR3 A;  1ZTU A;  2XF3 A;  2J9P A;  1IFQ A;  4OLD A;  4OOL A;  2A24 A;  5GL9 A;  1W8Y A;  4R23 A;  4KZ4 A;  1MY8 A;  1XA7 A;  4EBL A;  4UEY A;  3T1R A;  4DDS A;  4X53 A;  2PAV P;  3WS5 A;  3CWF A;  3G34 A;  2WGV A;  4L9E A;  2WGW B;  1E25 A;  1BLP A;  3DTI A;  3T1S A;  1RGZ A;  5CX7 A;  2L4R A;  2Y2N A;  2ZQC A;  3WS0 A;  5HSQ A;  3D4F A;  1MC0 A;  3CMZ A;  3G30 A;  4S2N A;  3W2Z A;  2Y2M A;  3F1O B;  3S22 A;  3IXB A;  4OP8 A;  4WMC D;  1G6A A;  5D3O A;  2G2W A;  1W8Q A;  2OAQ 1;  1W63 Q;  1MWS A;  4OH0 A;  3E2L A;  4A5R A;  3LR0 A;  4Y13 A;  4K91 A;  5FAS A;  4X1M A;  2OLU A;  1QMF A;  1PFL A;  3LIC A;  4KEN B;  4HJ6 A;  1G6O A;  2CC1 A;  4X68 A;  1PZO A;  4NEE D;  1XGI A;  3MZF A;  4PM7 A;  5F68 A;  4R1G A;  1L0D A;  3C5A A;  1F2K A;  1NYM A;  2W3E A;  1ZKJ A;  4RX2 A;  3LYX A;  5DVA A;  1T1C A;  3NHQ A;  5CED A;  5G4Z A;  4G3K A;  1ESU A;  4Y15 A;  4QY6 A;  1ONH A;  4R3J A;  1YLZ A;  1KDW A;  4BLM A;  4G3V A;  4I5S A;  1BLC A;  5CXW A;  3VE3 A;  3L7H A;  1BSG A;  3RH8 B;  1O7E A;  3ZCZ A;  4JBF A;  4PM9 A;  4GD6 A;  4HIA A;  5HAP A;  2V1B A;  3HL9 A;  2VEA A;  2UWX A;  1BLS A;  2WKP A;  1IOU A;  4FD8 A;  3E2K A;  3MQO A;  5FQQ A;  4P6Z M;  5IS1 A;  4CJN A;  5KIZ A;  2V9A A;  3ZG9 B;  1Y54 A;  5F1G A;  2WZZ A;  2V20 A;  3WWX A;  2JBF A;  4E3K A;  2ZC4 B;  3QP4 A;  4X25 A;  1P9W A;  3DWK A;  4KZB A;  5FAT A;  3SOI A;  2J3W A;  5AQB A;  1K4F A;  1KOU A;  4DMZ A;  2G2U A;  4C3Q A;  4QB8 A;  2Z2L B;  2NUP C;  3VP2 A;  2VJW A;  1KDS A;  2JKT M;  5EOO A;  2OWH A;  3QHY A;  2XD1 A;  3ZVW A;  4Z9Q A;  3SH9 A;  1AWI A;  3T1X A;  3WRZ A;  1K57 A;  5HAI A;  2WKE A;  3ZVT A;  3HJI A;  5M18 A;  1MBL A;  5AQA A;  4ZJ2 A;  3QP6 A;  4BBT A;  1G68 A;  2XK1 A;  2UV0 E;  4JXV A;  3UPO A;  4IBR A;  4S2L A;  3T4L A;  3SZT A;  1C3B A;  2C6W B;  4O0P A;  4MBH A;  3PBN A;  1WE4 A;  5HD5 A;  3CI6 A;  4I3J A;  1NZO A;  4GCZ A;  3WS2 A;  1KGE A;  1S1Z A;  1IYO A;  3W8K A;  3PBR A;  3MKF A;  1XPB A;  1XX2 A;  3UB5 P;  4B88 A;  3R7W B;  4OON A;  2BTF P;  3IHB A;  3C4P A;  5CTN A;  4KG2 A;  2A3U A;  4FSF A;  1DP8 A;  4IHQ A;  2XRN A;  4OPR A;  3OPR A;  4EEU A;  2H5S A;  3N6I A;  2B95 A;  5A91 A;  3ICY A;  1ALQ A;  1ES3 A;  3E98 A;  3G6O A;  4OKP A;  2XR0 A;  3OPP A;  5FDS A;  1BT5 A;  3LIE A;  1SKF A;  2J3T C;  4QD4 A;  5CHU A;  5DJT A;  5EEC A;  2JKG A;  1GSV A;  3S7O A;  4GLQ A;  2ZL1 A;  4RQ9 A;  4P0M A;  4R38 A;  3IF6 B;  1S67 L;  3RJU A;  3FPV A;  1PNE A;  5DJU A;  3KYQ A;  1K55 A;  1FCO A;  2DNS A;  3BJN A;  2WGW A;  5FQK A;  3AGF A;  5F69 A;  3LR5 A;  5EVI A;  4HP4 A;  1LI0 A;  3KX0 X;  1G28 A;  3UNW A;  4LV3 A;  1KVM A;  2XFT A;  3CIT A;  4KQQ A;  1L0F A;  1N4O A;  3IS2 B;  4F3L A;  2DRW A;  2PR6 A;  1FCN A;  3EQU A;  1KE3 A;  3CZD A;  5EV0 A;  1AXB A;  5EFW A;  3UO9 A;  3GTC A;  3Q07 A;  3RXW A;  1E3U D;  2DMW A;  3FWL A;  2J9O A;  3UPN A;  5CER A;  1KGF A;  3EQV A;  1QME A;  3AGD A;  1SDE A;  4RA7 A;  3T4O A;  1BTL A;  4X1L A;  1JWP A;  4WL9 A;  3V39 A;  4N1H A;  2WKR A;  4QY5 A;  1Y28 A;  3IF5 A;  4HBU A;  2G7U A;  4OPZ A;  1SHV A;  4B93 A;  3K2N A;  3LO7 A;  2OSU A;  4H6J B;  1K54 A;  2W27 A;  1OJG A;  4C6Y A;  1F98 A;  4H8R A;  4N1X A;  4EQI A;  4OQI A;  3HLG A;  4Y0O A;  2BLS A;  5CGS A;  1HD8 A;  4Y0U A;  4XXR A;  1IEL A;  1TS7 A;  2ZLY A;  1OTI A;  1IYS A;  4S2P A;  2HDU A;  3UY6 A;  1EW0 A;  1NXY A;  4WEK A;  4E3I A;  3E4P A;  3SH8 A;  2GX5 A;  3LI9 A;  3MZD A;  4DJ3 A;  3CUE C;  4MMN A;  2Y55 A;  4DXB A;  5HWT A;  1PI5 A;  3EWK A;  2GJ3 A;  2Y91 A;  2MJ6 A;  1TS6 A;  3SS4 A;  4DE0 A;  4R3B A;  3LFV A;  2WAD A;  2NUT C;  1ZHH B;  3NEC A;  4OOM A;  4CLC A;  1I2S A;  3PAG A;  1H5X A;  4Q8I A;  1W5D A;  4S2N C;  2ZQA A;  1VM1 A;  2J3T D;  5HW3 A;  1WYB A;  4B9O A;  3S7P A;  2EA9 A;  4WEJ A;  3FZC A;  1NLY A;  1K38 A;  5GLC A;  4GKU A;  5J8X A;  2HJE A;  4EWF A;  4O01 A;  1JWV A;  4K08 A;  2YKH A;  3S7N A;  2W3D A;  3HLC A;  4K0W A;  3GMW A;  2WGI A;  4Q0J A;  2JKR M;  4WYY A;  3E4Q A;  3LIF A;  2ZQD A;  2Y2H A;  1FIK A;  3LID A;  1RCJ A;  4LCM A;  4P87 A;  2EXA A;  4MLL A;  4UA6 A;  3BRM A;  3UE0 A;  4S2M A;  4EU0 A;  3IXG A;  5L07 A;  4N92 A;  5TFQ A;  5FI7 A;  1DJA A;  3A3E A;  4IVI A;  3PBO A;  4BD1 A;  5BOH A;  4KZ6 A;  3Q7V B;  3KO6 A;  3ZHH A;  3UB6 A;  3T12 B;  4YFM A;  5KSH A;  2V1Z A;  5FSR A;  3RTY A;  4BJP A;  4OVD A;  4R3A A;  2JC7 A;  2GZA A;  5GHY A;  4HQA A;  3F1N B;  1YSQ A;  1HVB A;  4NET A;  2E8J A;  1FOF A;  1T1B A;  2ZM0 A;  3UN7 A;  1GHP A;  2M7U A;  2IWB A;  3MS6 A;  2INW A;  1NJ4 A;  3TJZ C;  3N7W A;  2OLV A;  3UE6 A;  3A0R A;  5EVE A;  3LUQ A;  4E04 A;  1Q2Q A;  3SW1 A;  4GW9 A;  2X01 A;  3D9Y A;  3LIA A;  1OT6 A;  3ZYT A;  1YLW A;  3B3X A;  5EPH A;  5M19 A;  3IBR A;  4BD0 A;  3UDF A;  1FQG A;  4Y3I A;  2Y2P A;  4KZ9 A;  1ZC2 A;  2HGV A;  2XA7 S;  3VOZ A;  3BFG A;  2EWV A;  4JF5 A;  3F1P B;  1HTZ A;  2X02 A;  2K7S A;  1ES5 A;  3IWI A;  4HP9 A;  3NDE A;  1PIO A;  3LCE A;  4LLO B;  5IHV A;  4B4X A;  3BFC A;  1S66 L;  4UAA A;  2WKH A;  3IQA A;  4JXW A;  3IS2 A;  4NKP A;  4WMC A;  1CEF A;  3OLO A; 
#chains in the Genus database with same CATH homology
 4UHU A;  4B4Z A;  1K57 A;  3W4O A;  4X69 A;  5HAI A;  2XD5 A;  4WZ4 A;  3HBR A;  5DF7 A;  1JWZ A;  2WKE A;  3ZVT A;  3DTM A;  4OP5 A;  4OPY A;  4FH4 A;  5M18 A;  2V2F F;  1MBL A;  5AQA A;  4ZJ2 A;  3Q1F A;  4E3L A;  1FR1 A;  3ZFZ A;  1M6K A;  1PYY A;  1SCW A;  3IWO A;  1G68 A;  2XK1 A;  4PPR A;  5AQ9 A;  2PU4 A;  4JXV A;  3V5M A;  4KG5 A;  3UPO A;  1LHY A;  5DF8 A;  4IBR A;  4X55 A;  4R0Q A;  4S2L A;  3N8R A;  2P9V A;  3UE3 A;  1IKG A;  1EI5 A;  3OCN A;  3BEB A;  4IED A;  3HLW A;  3PBS A;  1C3B A;  2C6W B;  4MBH A;  2HDQ A;  4GD8 A;  2EFX A;  3PBN A;  1WE4 A;  2P9V B;  5GHX A;  4OQH A;  3Q82 A;  4CPK A;  4DRT A;  3HLE A;  4KQR A;  3IXD A;  1RP5 A;  1NZO A;  3WS2 A;  1KGE A;  1IYO A;  3W8K A;  3PBR A;  2EX2 A;  2RL3 A;  3MKF A;  3TG9 A;  1XPB A;  1XX2 A;  2WUQ A;  4BL2 A;  4NK3 A;  3GSG A;  4B88 A;  3FKW A;  3IWQ A;  4OON A;  5CEB A;  3MFD A;  4JXS A;  1L0E A;  3IHB A;  2P74 A;  2Y2I A;  3C4P A;  4QHC A;  4S2K A;  5CTN A;  4XUZ A;  2H10 A;  4KG2 A;  2J7V A;  2A3U A;  4LEN A;  3S1Y A;  1BUL A;  1NRF A;  3HUN A;  3GVB A;  4FSF A;  4HEF A;  4U0T A;  3SS3 A;  3S4X A;  5FA7 A;  5JYO A;  1GA9 A;  4GOG A;  1YMX A;  4OPR A;  4Y0T A;  3P09 A;  1ESI A;  4KZ7 A;  3OPR A;  1ERM A;  5I94 A;  1M40 A;  2H5S A;  4JF4 A;  1DJC A;  5CRF A;  5DTT A;  3N6I A;  4JPM A;  5FI2 A;  5E2G A;  2WK0 A;  4GDN A;  5A91 A;  1XP4 A;  4K0X A;  3UDI A;  3IH9 A;  1ALQ A;  1ES3 A;  3IF6 C;  4ID4 A;  3PTE A;  5E2F A;  3OPL A;  1GHM A;  4OKP A;  1U60 A;  2XR0 A;  2HPB A;  3OPP A;  1IYP A;  3BLS A;  3OC2 A;  4HES A;  3O3V A;  4LV0 A;  1BT5 A;  4JXG A;  3Q81 A;  4QD4 A;  1SKF A;  4FH2 A;  5CHU A;  5FQI A;  2ZC3 B;  3BEC A;  4JKT A;  5EEC A;  4FCF A;  4N9K A;  3BFD A;  4N9L A;  1PW8 A;  3ISG A;  5AQ7 A;  5HAR A;  1ERQ A;  3HLB A;  3IF6 A;  2ZM2 A;  1KE4 A;  1PWG A;  2WAE A;  1TVF A;  4DKI A;  5GLA A;  4P0M A;  5EUA A;  4DE2 A;  3IF6 B;  3OCL A;  5FAO A;  3HUM A;  5CTM A;  1L2S A;  3RJU A;  4EBP A;  3QNC A;  3TOI A;  2Y2O A;  3FYZ A;  2HP9 A;  5FQJ A;  1CEG A;  1W7F A;  1MWT A;  1IEM A;  2DCF A;  4XUX A;  3NDG A;  3Q7Z A;  3VSK A;  1XA1 A;  2X71 A;  2JCH A;  1K6S A;  3PAE A;  2GDN A;  2XLN A;  2VGK A;  3CJM A;  4E6X A;  5A92 A;  1K55 A;  4WZ5 C;  3ZG5 A;  1FCO A;  3G35 A;  3TSG A;  2DNS A;  2XDM A;  3V50 A;  4RYE A;  5F83 A;  4KZ3 A;  3I7J A;  1K57 C;  2WGW A;  5FQK A;  3AGF A;  2QMI A;  1XXM A;  4S2J A;  4R4S A;  5EVI A;  1LI9 A;  2JE5 A;  1LI0 A;  1YT4 A;  4WEL A;  3A3I A;  1W79 A;  3UNW A;  3HLF A;  5EVI B;  4LV3 A;  4E3J A;  1KVM A;  2XFT A;  3MZE A;  3UE1 A;  4BL3 A;  2IWD A;  3GQZ A;  3NCK A;  4GZB A;  5HFO A;  1XGJ A;  4KZA A;  4KQQ A;  1L0F A;  1N4O A;  1GA0 A;  5E43 A;  3RXX A;  4PM6 A;  4RX3 A;  5EE8 A;  2BG1 A;  1JVJ A;  1SDN A;  2DRW A;  3HRE A;  2EFU A;  3PBQ A;  5GLB A;  5DTS A;  1FCN A;  1N9B A;  3CG5 A;  1KE3 A;  1S6R A;  3EQU A;  5JYP A;  3NI9 A;  1NY0 A;  3N8S A;  3BFE A;  4EV4 A;  3UPP A;  3ITA A;  3CZD A;  1Z6F A;  1ERO A;  1AXB A;  3UO9 A;  3GTC A;  2Y2J A;  3Q07 A;  3A3D A;  3RXW A;  3V3S A;  1K56 D;  1E3U D;  4E3M A;  3FWL A;  4KQO A;  3HLD A;  2H0T A;  2J9O A;  4BQM A;  1HZO A;  4LV2 A;  3UPN A;  4DF6 A;  2ZC7 A;  3QNB A;  5CER A;  4E3O A;  1KGF A;  3EQV A;  1QME A;  4X6T A;  1CI9 A;  4OOY A;  3ZG0 A;  1S0W A;  3GR2 A;  3AGD A;  1SDE A;  4WBG A;  5DF9 A;  4BEN A;  2R9X A;  1CK3 A;  4RA7 A;  1NZU A;  3A3J A;  3VOY A;  1NYY A;  1BTL A;  2EX9 A;  5HX9 A;  2FFF B;  4HBT A;  1JWP A;  5FQM A;  1RGY A;  3V39 A;  4N1H A;  1BUE A;  2XEP A;  3OPH A;  4QY5 A;  2ZQ8 A;  5CGX A;  3IF5 A;  3LY3 A;  1TDG A;  3W4Q A;  4HBU A;  4OPZ A;  1SHV A;  3O86 A;  4GB7 A;  3ITB A;  2WZX A;  1MWU A;  4WM9 A;  1BZA A;  3FKV A;  3LEZ A;  3LO7 A;  3ZG8 B;  5TGF A;  2I72 A;  2OSU A;  3MXR A;  3DW0 A;  4ZBE A;  4EBN A;  4RVA A;  1K54 A;  3G4P A;  3MBZ A;  2WKI A;  1L0G A;  3VP4 A;  2QPN A;  4C6Y A;  4ZDX A;  4H8R A;  3MXS A;  4N1X A;  4EQI A;  4M3K A;  1Q2P A;  3NY4 A;  4OQI A;  3VFF A;  4R4R A;  5DTK A;  2Y4A A;  4UA9 A;  1PWD A;  3HLG A;  4S2O A;  3ZNY A;  4DDY A;  1LL5 A;  4Y0O A;  5E2H A;  2HP6 A;  2BLS A;  5L2F A;  4DXC A;  5CGS A;  1HD8 A;  4Y0U A;  5EVL A;  4XXR A;  3N4I A;  1IEL A;  4IVK A;  1ES4 A;  3DWZ A;  2VGJ A;  3VFH A;  5EOE A;  3IH8 A;  2ZLY A;  1I2W A;  3HUO A;  5TR7 A;  1IYS A;  5CHM A;  1IKI A;  5FAQ A;  1TEM A;  2Y2L A;  1PW1 A;  2B5R A;  4S2P A;  2HDU A;  1H8Z A;  3ZGA B;  1K55 C;  2XF3 A;  3UY6 A;  2H0Y A;  2J9P A;  1NXY A;  4LCL A;  4OLD A;  2IWC A;  4WEK A;  4OOL A;  4E3I A;  3O88 A;  3SH8 A;  5KSC A;  3VP1 A;  2J8Y A;  1ZG4 A;  5GL9 A;  3MZD A;  5EVI C;  1W8Y A;  2EX6 A;  3IT9 A;  4ZJ3 A;  1ONG A;  4R23 A;  2Y55 A;  4KZ4 A;  5A90 A;  4DXB A;  1MY8 A;  1XA7 A;  1OME A;  1KGG A;  1PI5 A;  3GV9 A;  4EBL A;  2Y91 A;  4ZJ1 A;  3M2J A;  5CHJ A;  3SS4 A;  4DE0 A;  4R3B A;  4DE3 A;  3C7U A;  4DDS A;  2WAD A;  4ZTK A;  4X53 A;  2EX8 A;  4MBK A;  3WS5 A;  1YQS A;  3G34 A;  4OOM A;  3WS1 A;  4GN2 A;  1I2S A;  1JTD A;  1MKI A;  2WGV A;  5GHZ A;  3VP0 A;  2WGW B;  1E25 A;  3PAG A;  1H5X A;  4Q8I A;  1BLP A;  1K25 A;  4JF6 A;  2RCX A;  4YIN A;  5GLD A;  1W5D A;  4S2N C;  5A93 A;  2ZQ7 A;  2ZQA A;  1VM1 A;  3SS5 A;  1GCE A;  5HW3 A;  1WYB A;  3OZH A;  1XKZ A;  3NBL A;  1RGZ A;  3WS4 A;  5FDH A;  4WEJ A;  3FZC A;  4MNR A;  1K38 A;  4PMA A;  2Y2N A;  3A3F A;  2ZQC A;  5GLC A;  4GKU A;  3WS0 A;  3D4F A;  3UDX A;  2QZ6 A;  5J8X A;  3CMZ A;  2ZQ9 A;  4EWF A;  1LLB A;  1H8Y A;  3G30 A;  1JWV A;  4S2N A;  1K56 A;  1E3U A;  2R9W A;  2ZD8 A;  2Y2M A;  5KZH A;  5G18 A;  3HLC A;  4K0W A;  3GMW A;  2WGI A;  3VP3 A;  3S22 A;  3NC8 A;  4P6B A;  4WYY A;  3IXB A;  1YLP A;  4OP8 A;  1IYQ A;  2ZQD A;  5M1A A;  4WMC D;  1G6A A;  1YLT A;  2HDS A;  3VMA A;  2Y2H A;  5D3O A;  1YLY A;  2Y2Q A;  4E6W A;  4OQ0 A;  2XQZ A;  4D2O A;  2G2W A;  3M6H A;  1W8Q A;  4QJG A;  5FAP A;  1MWS A;  4GDB A;  1FSW A;  1RCJ A;  3E2L A;  4LCM A;  4OH0 A;  2EXA A;  4MLL A;  4P87 A;  2Q9N A;  4A5R A;  3C7V A;  5HL1 A;  4KZ5 A;  4UA6 A;  2E8I A;  2HP5 A;  4QU3 A;  4IBX A;  4DE1 A;  1MWR A;  4K91 A;  3BRM A;  2A49 A;  3UE0 A;  3C4O A;  5FAS A;  1K54 C;  1E4D A;  2OLU A;  1QMF A;  4S2M A;  3P98 A;  4KEN B;  4U0X A;  4PM8 A;  3IXG A;  2CC1 A;  3G2Y A;  4X68 A;  5E2E A;  3ZG7 B;  2ZM8 A;  4Y7P A;  4MEZ A;  1O07 A;  3ZDJ A;  4N92 A;  3BM6 A;  5TFQ A;  4MBF A;  5FI7 A;  1DJA A;  3A3E A;  1WYC A;  1PZO A;  4IVI A;  2C5W B;  3PBO A;  3BYD A;  3Q7V A;  4BD1 A;  4PM5 A;  4ZAM A;  5BOH A;  1XGI A;  3MZF A;  1LL9 A;  1PZP A;  2Q9M A;  4JLF A;  4PM7 A;  4KZ6 A;  3Q7V B;  3HVF A;  3ZHH A;  2ZJ9 A;  1DY6 A;  4OQG A;  1VQQ A;  4YFM A;  5KSH A;  2V1Z A;  5FSR A;  4KG6 A;  4BJP A;  4R1G A;  3MKE A;  3W4P A;  1TDL A;  4OVD A;  1L0D A;  2JC7 A;  3C5A A;  4LV1 A;  2HDR A;  1NYM A;  1YM1 A;  2XFS A;  5GHY A;  2ZC6 B;  3FV7 A;  5U47 A;  4RX2 A;  1ZKJ A;  1HVB A;  5FI6 A;  3GRJ A;  4NET A;  2PU2 A;  4F94 A;  5DVA A;  2ZC5 B;  1FOF A;  4O7D A;  2WYX A;  3G31 A;  3M6B A;  5F82 A;  5CED A;  5FQ9 A;  3LY4 A;  1K4E A;  2Z2M B;  2ZM0 A;  3UN7 A;  1ESU A;  1GHP A;  1MPL A;  3IXH A;  3JYI A;  2PBY A;  2EXB A;  4QY6 A;  3V3R A;  2IWB A;  1ONH A;  1NJ4 A;  2WAF A;  3N7W A;  4R3J A;  2OLV A;  1YLZ A;  1KDW A;  1EWZ A;  5CEC A;  4BLM A;  2ZMA A;  1BLC A;  5CXW A;  3VSL A;  3WRT A;  2Y2K A;  2Y59 A;  1PI4 A;  1BSG A;  1GHI A;  5F1F A;  2FFY A;  1MXO A;  1K6R A;  3G32 A;  1Q2Q A;  1O7E A;  3ZCZ A;  4JBF A;  4PM9 A;  4GD6 A;  5HAP A;  3O87 A;  3HL9 A;  2X01 A;  2UWX A;  1BLS A;  1CI8 A;  1FR6 A;  2Y2G A;  4FD8 A;  3E2K A;  5FQQ A;  3BFF A;  4CJN A;  1YLW A;  4L0L A;  3B3X A;  4UA7 A;  5EPH A;  5M19 A;  3PBT A;  4E3N A;  3ZG9 B;  3AGE A;  3UDF A;  1FQG A;  4BD0 A;  2XGN A;  5HAQ A;  1Y54 A;  5F1G A;  1BLH A;  2WZZ A;  3IHA A;  1FSY A;  2V20 A;  2JBF A;  1ZG6 A;  3SH7 A;  3WWX A;  2Y2P A;  4E3K A;  2ZC4 B;  4KZ9 A;  1ZC2 A;  3VOZ A;  4EUZ A;  1JTG A;  3BFG A;  2XH9 A;  3DWK A;  4KZB A;  5FAT A;  1I5Q A;  1FCM A;  4JF5 A;  1J9M A;  3SOI A;  4OPQ A;  5AQB A;  1KE0 A;  1K4F A;  1HTZ A;  4KZ8 A;  2X02 A;  1ES5 A;  3N8L A;  3NIA A;  3IWI A;  3BLM A;  2G2U A;  3M2K A;  3NDE A;  1PIO A;  4OLG A;  4S2I A;  4C3Q A;  1YLJ A;  4QB8 A;  2Z2L B;  3VP2 A;  3LCE A;  3ZNT A;  1KDS A;  5IHV A;  1ES2 A;  5EOO A;  3BFC A;  5CGW A;  4B4X A;  5KMW A;  4GNU A;  4C75 A;  1DJB A;  2WKH A;  3IQA A;  3QHY A;  2XD1 A;  4JXW A;  4UAA A;  4P85 A;  4WZ5 A;  4X56 A;  5EVI D;  2OV5 A;  4WMC A;  3ZVW A;  3G2Z A;  4Z9Q A;  1CEF A;  4U3T A;  1YMS A;  1PWC A;  3SH9 A;  1KVL A;  3WRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...