2ZQ9A

Cephalothin acyl-intermediate structure of class a beta-lactamase toho-1 e166a/r274n/r276n triple mutant
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
259
structure length
259
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase Toho-1
publication title Structural Basis of Extend Spectrum Beta-Lactamase in Correlation of Enzymatic Kinetics and Thermal Stability of Acyl-Intermediates
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 93
structure length 259
sequence length 259
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2zq9A00
1PW8A 3HBRA 3GQZA 3HLEA 4OVDA 1YLJA 4N9KA 2J7VA 2HP5A 3AGEA 4N1HA 1PWDA 4P87A 3HLDA 3WS2A 4QJGA 3OPLA 4FD8A 3IH8A 5FQQA 1LHYA 4KG5A 4IBRA 1YT4A 4FSFA 1L0DA 1PI5A 2ZMAA 3LCEA 5CHJA 4BENA 4DDSA 2VGJA 1K56D 2Y2IA 4BL2A 2QMIA 4E6WA 4RX2A 3M6BA 4KG2A 3MBZA 3GMWA 3V3SA 1KE0A 1WYBA 4QU3A 1PYYA 5KMWA 3NI9A 4IVIA 4R23A 5GHYA 3UNWA 4S2JA 4U0XA 1YLYA 3G35A 2ZD8A 2PU4A 2J8YA 3ZG0A 3ZG7B 3ISGA 1O7EA 1JVJA 2WGIA 4BLMA 3S22A 5CHUA 1FCMA 3DWKA 1IYQA 2H0YA 4E3LA 1JTGA 3IH9A 1JTDA 4OQGA 5GLBA 1W8YA 1Z6FA 3G2YA 5U47A 1ALQA 2JC7A 2QZ6A 2JE5A 3CG5A 3E2LA 4OP5A 1G6AA 4N1XA 4CJNA 4RA7A 5GHXA 4F94A 2FFFB 2WADA 4OOLA 1CK3A 2WGVA 4UAAA 2XF3A 1K54C 1K25A 5CHMA 1ESUA 2Y2MA 3OC2A 3N7WA 5EVIC 2B5RA 1NJ4A 4JF5A 5TGFA 2ZJ9A 3IF6C 4RVAA 3W4OA 5A93A 3A3IA 3M6HA 3SS4A 1YLWA 4MBHA 5DTSA 3IXGA 3IF6B 1ZG6A 4MNRA 4OH0A 4QD4A 5CTNA 1NZUA 3PBTA 3G30A 4GB7A 4PM5A 4X69A 3BFEA 4MBFA 3VOYA 1PIOA 1ES2A 1XKZA 5E43A 1W79A 3PAGA 4LV3A 4PM8A 4X55A 2QPNA 2EFUA 2V2FF 1LI0A 4YINA 4KZ3A 3C4PA 2PBYA 2WZXA 4OQHA 2ZM8A 4R4SA 1ERMA 4GD6A 5HARA 1N4OA 2ZC7A 2PU2A 1PZPA 1ESIA 1MWTA 2HDSA 3C5AA 5AQ9A 3ZVTA 1MWUA 1O07A 2Y2NA 4OQ0A 3VP3A 1TEMA 3QNBA 2RL3A 3O3VA 1ZG4A 3EQUA 3ZNTA 1ES5A 3HLWA 4JF6A 5DF8A 3SH7A 1MWRA 5GL9A 3M2JA 4NETA 1FR6A 2ZC6B 2GDNA 4ID4A 2WGWA 4Q8IA 2P9VA 1J9MA 2ZQCA 4LCLA 5FAOA 3ZCZA 2WKIA 3GR2A 3IWOA 1H5XA 2ZQAA 1IKIA 2WKEA 1HTZA 3C7VA 4OOYA 4Y0UA 2WUQA 4FCFA 4KZ6A 5EUAA 5IHVA 3VP0A 1QMFA 3RJUA 3AGFA 2FFYA 3BFGA 4DE0A 1XPBA 1KDSA 4N92A 4RYEA 5EPHA 4QY6A 3BLSA 3Q7VB 4BD0A 3UPOA 2IWCA 2EFXA 3W4PA 2XQZA 4LENA 2OLUA 4OLGA 2Y2QA 4HBTA 1Q2PA 4EWFA 2X71A 4CPKA 3UDXA 5E2HA 2Z2LB 1IEMA 1OMEA 1E4DA 2Y59A 4U3TA 3DWZA 5DF9A 3WS0A 4GDNA 5D3OA 5FDHA 4C75A 1NXYA 3HUOA 4OQIA 1EI5A 3UPNA 1LL5A 5CEBA 1E3UA 1FOFA 2IWBA 5GLAA 4Y0OA 1JWPA 1EROA 1PWCA 4KZBA 4OKPA 4RX3A 3M2KA 1HVBA 4C3QA 1DJAA 3FZCA 3MZFA 4K0WA 5CRFA 5BOHA 1L0FA 5EECA 1LLBA 1TDLA 1RCJA 3MZEA 2Y4AA 1NZOA 1YQSA 2Y2GA 1E25A 5F1FA 4JXGA 2XEPA 5A90A 4E3JA 4ZTKA 1S6RA 2EX9A 1H8ZA 2HP6A 2ZQ8A 4WM9A 4ZJ1A 2WKHA 4E3MA 3LEZA 3AGDA 4UHUA 5L2FA 4MLLA 2XD5A 1ONHA 3OCNA 3B3XA 1YMSA 3I7JA 3VP2A 5I94A 3IWIA 3VMAA 1CEGA 3HLCA 1YM1A 3VOZA 2G2WA 2XH9A 3WRTA 2H0TA 3C4OA 4KZAA 2ZC5B 4DXBA 3ZHHA 1WE4A 4GDBA 2DCFA 5FQJA 2R9WA 4JXVA 1SCWA 3SH8A 3HLGA 5EOEA 3HUMA 5EE8A 3ZG9B 3OPHA 4KZ4A 4WMCA 4DKIA 3BYDA 1BLPA 2X01A 1GHPA 5FA7A 3Q1FA 3A3DA 4JPMA 5FI2A 5M19A 2ZM2A 3O88A 3IHBA 5FQ9A 2Y2PA 4D2OA 3G31A 2WAEA 2CC1A 4KQOA 1K38A 2Y2KA 1K4FA 5EOOA 3OPRA 4DE3A 2DNSA 1NY0A 1IYPA 2IWDA 3GV9A 3PBOA 4BJPA 1KDWA 1JWVA 1BT5A 3ZDJA 2HDUA 1N9BA 2EXBA 3BLMA 4JXWA 3GVBA 1ES3A 4WZ5A 3SH9A 3LY4A 4E6XA 1KE4A 2XGNA 5FI6A 3MKFA 5EVIB 1ZC2A 4QB8A 2X02A 4WBGA 1MWSA 4K91A 5FAPA 3RXXA 5DTKA 1VQQA 4JXSA 1NYYA 4JLFA 2C5WB 3VSLA 4DDYA 4EQIA 5CGWA 3HVFA 2XDMA 1K57A 3UO9A 4X56A 4E3IA 3MKEA 3Q7ZA 4DF6A 1W5DA 5FSRA 2ZQ9A 3HREA 4R3BA 1CI9A 4Y0TA 5M18A 3VP1A 3ZFZA 4S2OA 5CEDA 4S2KA 4B4ZA 3BFCA 1SKFA 1RGZA 3CJMA 3NDEA 2Y55A 1XGIA 4JF4A 2ZQ7A 1Q2QA 4B88A 5G18A 4NK3A 3V50A 3FWLA 4OPRA 1C3BA 1KGFA 4IEDA 1K55A 4GD8A 5KSHA 4A5RA 4EUZA 3IXDA 3NIAA 4KQQA 4L0LA 4S2LA 1GA9A 5FQMA 2XFTA 4ZJ2A 1Y54A 3G2ZA 2UWXA 1KGEA 5J8XA 2ZM0A 2XFSA 3O87A 4K0XA 4GKUA 5HL1A 1XGJA 3IWQA 1K4EA 4MBKA 5F1GA 4IBXA 5M1AA 1TVFA 5EVID 3EQVA 5GHZA 3UY6A 5FASA 2WAFA 4R3JA 3P09A 1PWGA 1FCNA 3OZHA 1DJCA 3N8SA 1NYMA 3S1YA 1LI9A 3IF5A 2HP9A 3UN7A 3Q07A 3FKWA 5F83A 3TG9A 1W7FA 1XXMA 2EX6A 4U0TA 4DE1A 1HD8A 4PM6A 3N4IA 1VM1A 3N6IA 4JKTA 1E3UD 5DTTA 1I2WA 3NBLA 4WZ4A 4Y7PA 5F82A 1BTLA 1K6SA 5FQKA 3NC8A 2A49A 3V5MA 4WZ5C 3NCKA 4S2MA 5E2FA 3O86A 2Y2JA 4DRTA 1ZKJA 4YFMA 3OCLA 3NDGA 2G2UA 2Z2MB 3G34A 3MFDA 3DTMA 3W8KA 4E3NA 5FI7A 4DXCA 4PM9A 3UDIA 4PPRA 5FAQA 3BFDA 3IXBA 3IT9A 3SS5A 4OPYA 1IKGA 3UPPA 3N8RA 5HX9A 3A3EA 2JCHA 2H5SA 5GLCA 3UE1A 1YLPA 3FV7A 3HLFA 4R4RA 1MKIA 1K57C 1BUEA 4UA9A 4XUXA 4BQMA 1BLSA 4E3OA 4S2PA 4S2NA 1FCOA 2EXAA 2HDQA 5HAIA 4OPQA 2DRWA 1JWZA 2ZLYA 1XA7A 1I2SA 4LV2A 3TOIA 1M6KA 2JBFA 5CERA 4P85A 1GA0A 3VFHA 3Q82A 1IYSA 3ITBA 4BL3A 1L0EA 1BZAA 2ZQDA 4WMCD 4OOMA 3S4XA 4QY5A 4ZJ3A 4X53A 3A3JA 1EWZA 1BLCA 4WELA 3ZVWA 1K55C 1PZOA 5CGXA 2ZC4B 3MXRA 4KZ7A 3UDFA 2XLNA 4KQRA 3QNCA 1FQGA 3PTEA 5TFQA 3MXSA 4N9LA 2WGWB 2P9VB 4KZ8A 5AQBA 1TDGA 2Q9MA 4LV0A 1BLHA 1QMEA 4GN2A 4HBUA 5FATA 2A3UA 3WRZA 4EV4A 3Q7VA 1K56A 1ONGA 1DJBA 2R9XA 1KE3A 4UA6A 5FQIA 4XUZA 5HW3A 3A3FA 4ZBEA 1MPLA 1FR1A 5A91A 3V3RA 3FYZA 3GSGA 2P74A 3GRJA 3N8LA 3UE3A 1RGYA 4EBNA 4UA7A 3V39A 4GNUA 4B4XA 2OLVA 3BECA 5AQAA 3PAEA 2H10A 3IXHA 3HUNA 1GHMA 4O7DA 5KZHA 3BRMA 2XK1A 1M40A 3GTCA 3FKVA 3QHYA 3WS5A 4IVKA 3ITAA 1BULA 4XXRA 3ZG8B 5EVLA 1KVLA 3ZNYA 5JYPA 2J9PA 3ZGAB 5E2EA 5CXWA 4OLDA 3SS3A 5JYOA 3C7UA 3LY3A 4OONA 1MXOA 5DVAA 3HLBA 3Q81A 4FH2A 3RXWA 1SDEA 5TR7A 1ES4A 4LCMA 2J9OA 5CTMA 3G4PA 1YLTA 3VSKA 1K6RA 5GLDA 1XX2A 4WEJA 4S2IA 4FH4A 1I5QA 4S2NC 3IHAA 3UE0A 3SOIA 2Q9NA 4ZAMA 3HL9A 5HFOA 1SDNA 3PBQA 1L0GA 3IQAA 4KZ5A 4OPZA 5HAPA 1PI4A 3BM6A 3CMZA 1GHIA 3BEBA 1AXBA 4M3KA 4DE2A 3LO7A 1NRFA 1HZOA 2E8IA 2Y2HA 4R1GA 2Y2LA 1MBLA 2EX2A 4EBPA 2ZC3B 3NY4A 1CEFA 3VP4A 3W4QA 2V20A 2VGKA 2I72A 3WWXA 1ERQA 3ZG5A 1IYOA 2Y2OA 4P6BA 3WS1A 3JYIA 1YLZA 1CI8A 3P98A 3PBSA 4KENB 1KGGA 1W8QA 3G32A 2BLSA 4PMAA 4PM7A 1FSWA 4P0MA 2BG1A 1U60A 1G68A 4JBFA 4LV1A 2Y91A 4X68A 1MY8A 4GOGA 5E2GA 4EBLA 1K54A 4WEKA 2HDRA 2OSUA 5EVIA 2C6WB 2WK0A 2XD1A 3IF6A 3PBNA 5DF7A 1KVMA 4WYYA 1YMXA 1DY6A 1WYCA 5CECA 4HESA 3D4FA 1IELA 2EX8A 4H8RA 1PW1A 3DW0A 2OV5A 4KZ9A 3WS4A 4X6TA 5KSCA 5CGSA 3E2KA 1S0WA 4ZDXA 4E3KA 1XP4A 4R0QA 2V1ZA 1XA1A 4GZBA 1LL9A 4OP8A 2XR0A 3PBRA 5AQ7A 3BFFA 3TSGA 3MZDA 4HEFA 1L2SA 3CZDA 1SHVA 2WZZA 1GCEA 5HAQA 3VFFA 5A92A 4C6YA 1FSYA 2HPBA 2WYXA 1H8YA 4BD1A 1RP5A 4KG6A 4QHCA 1BSGA 2RCXA 4Z9QA 3OPPA 4MEZA
chains in the Genus database with same CATH superfamily
3HBRA 3HLEA 2J7VA 3QP4A 3AGEA 3B42A 2W3EA 1LHYA 1YSPA 1DRMA 4IBRA 4NEED 4P6ZS 4FSFA 1L0DA 1PI5A 2VGJA 2Y2IA 4BL2A 4Y17A 3GMWA 3V3SA 1WYBA 4CLCC 5KMWA 3NI9A 4IVIA 4IHQA 4X1MA 4S2JA 5TBMA 3QP5A 2P08A 5CHUA 3EEHA 5GLBA 1W8YA 1Z6FA 1ACFA 2JC7A 2JE5A 3CG5A 3ULFA 4CJNA 5GHXA 2WADA 4OOLA 1K25A 5CHMA 2XRNA 3OC2A 3N7WA 4BMWA 4JF5A 3MR0A 3W4OA 4RVAA 5MC7A 3A3IA 3M6HA 4II7A 2LB5A 2W1TA 3BFEA 4MBFA 3VOYA 4PM8A 4X55A 1JNUA 2EFUA 2V2FF 1LI0A 4KZ3A 1H0MA 3C4PA 2PBYA 2WZXA 2ZM8A 4R4SA 2PU2A 1ESIA 4IUHA 2Y2NA 2Y8HA 1TEMA 1XFNA 1ZG4A 3NHQA 1ES5A 3SH7A 5L09A 3L9KA 2ZC6B 2YKFA 1J9MA 5FAOA 4LCLA 1OTDA 2ZQAA 1IKIA 1HTZA 4OOYA 4Y0UA 4FCFA 4KZ6A 1QMFA 1SZVA 2VKSA 1KDSA 2QJ7A 2D02A 3CUEC 4LENA 4OLGA 5HWTA 3FG8A 3UDXA 5E2HA 1NLYA 1IEMA 3IX8A 2Y59A 4GDNA 2H28A 1EI5A 1LL5A 3S7PA 5GLAA 4Y0OA 1PWCA 3M2KA 3G6OA 4C3QA 4ARZA 2CMNA 3FZCA 5EECA 3UB9A 1F2KA 4JXGA 4L9GA 1H8ZA 1XFQA 3LEZA 5L2FA 4BBVA 3OCNA 3I7JA 5DJUA 1MC0A 3VOZA 2XH9A 4FUWA 3WRTA 2H0TA 3C4OA 4DXBA 3ZHHA 2DCFA 4KUOA 1OT9A 3HLGA 5EE8A 3OPHA 2FZ0A 1BLPA 2W0NA 3T1RA 5M19A 3O88A 5FQ9A 2Y2PA 2CC1A 4KQOA 4GHIB 5K5BA 4HH3A 3DAVA 1IYPA 3H82A 4BJPA 1BT5A 3ZDJA 4HJ4A 4I3JA 1KE4A 5J3WA 2XGNA 5FI6A 4QB8A 4PKYG 3BQ8A 1PNEA 2K31A 4WBGA 4O8GA 2D01A 1NYYA 3F1NB 2C5WB 3D3OA 3HVFA 1D7EA 1P97A 2JN7A 4E3IA 5DFXA 5FSRA 1F9IA 1CI9A 4Y0TA 5M18A 1OJGA 4Y15A 2JKRI 3ZFZA 5CEDA 4ARZB 2J3TD 3BFCA 5A8BA 2O9BA 3NDEA 1Q2QA 4IEDA 2VK3A 5KSHA 3QP8A 4L9FA 4Y2FA 3BQAA 3O87A 1XGJA 5EVID 3EQVA 3E4QA 5FASA 3LR3A 1PWGA 4YOFA 3N8SA 3S1YA 2HP9A 3UMDA 3HCYA 4DE1A 2HJ9C 1VM1A 4R38A 4HJ6A 2PDRA 3O86A 4DRTA 4E3NA 2Z2MB 3G34A 3MFDA 3DTMA 3W2ZA 4I5SA 4DXCA 2OOLA 4Q0IA 3UDIA 5EV0A 2H5SA 2V0UA 1BUEA 4E3OA 3MQQA 4LFUA 1JWZA 3EEAA 4LV2A 2XA7S 4HH2A 4HY8A 4WLAA 3VFHA 4BL3A 4LRYC 2ZQDA 4ZRRA 5DKKA 3S4XA 3A3JA 4CLCE 1ZTUA 3TE8A 3UDFA 1SKOB 4KQRA 1FQGA 4HQAA 4L9EA 2BTFP 2WGWB 2P9VB 2VGLS 4KZ8A 3T4JA 2W3DA 3WRZA 5DJTA 2VV7A 3IBJA 1DJBA 5FQIA 4AFIA 2W3HA 3LGOA 3V3RA 4E04A 3UE3A 2WKQA 3K3DA 4EW7A 3BRMA 3UE6A 3T4TA 1XJ4A 1BULA 1Y28A 2V8FA 1TS0A 1MKMA 5EVLA 2VZWA 5JYPA 3ZGAB 2M1CA 5E2EA 4OLDA 3SS3A 4WUJA 3LY3A 3E0YA 4OONA 4DN0A 3G4PA 3OLOA 4WEJA 3NOTC 3CPTB 4JGRA 3UE0A 4GS9A 2Q9NA 3PBQA 1S66L 3BM6A 3CMZA 1GHIA 1AXBA 2Z6CA 1MZUA 3BW6A 1HZOA 1MBLA 3VE4A 2O0YA 1CEFA 3UB6A 3VP4A 3NJAA 3W4QA 2AVXA 3WWXA 1ERQA 4KUKA 3ZG5A 1IYOA 3JYIA 2PD7A 4PM7A 3S7NA 2PT7A 3F1PB 3FPWA 1OTIA 5E2GA 1XJ6A 4EBLA 1K54A 1V9ZA 2QHKA 5HL6A 2WK0A 5DF7A 2P7JA 2NUTC 4WYYA 4JGOA 3D4FA 1EW0A 5CGSA 2YKHA 1W63M 4OP8A 3RH8B 3BFFA 2VEAA 3MZDA 4HEFA 3T4QA 1GCEA 3VOLA 2HPBA 2WYXA 1H8YA 4PM5A 4MEZA 2WKPA 4Y5FA 4N1HA 1PWDA 3HLDA 3U2AA 3DTKA 4FD8A 3IH8A 1IFQA 2B18A 4P6ZM 2ZMAA 4RX2A 3M6BA 2PBDP 4QU3A 2ACGA 5GHYA 4U0XA 3RFBA 1FIKA 2J8YA 2P04A 1O7EA 3S22A 2H0YA 1Z09A 1JTGA 5U47A 1ALQA 4HP9A 4OP5A 4HIAA 4N1XA 4RA7A 2GZAA 4NG2A 4UAAA 3CITA 1ESUA 2Y2MA 3LFVA 2B5RA 4X25A 3IF6C 4WL9A 5A93A 3SS4A 3KYZA 4WN5A 1ZG6A 4ME4A 4OH0A 3LR5A 3IS2B 4GB7A 1PIOA 1UGUA 2OWJA 3PAGA 5G4ZA 1PRQA 1LSXA 1ERMA 3PYPA 4GD6A 4CLCD 2ZC7A 4HI4A 1PZPA 1MWTA 2FH5A 1MWUA 4OQ0A 1A0KA 1FILA 3QNBA 3EQUA 2VV8A 3PHYA 3M2JA 2GDNA 4NKPA 5G4YA 2WKIA 2L0WA 1T1AA 2PR5A 3GR2A 3IWOA 2WKEA 3C7VA 1TS6A 2FFYA 1S4SA 3BFGA 3LIEA 1XPBA 5EPHA 1S1YA 3LYXA 3Q7VB 3F1OB 3W4PA 2OLUA 2Y2QA 4EWFA 1VEUA 3MQ0A 2Z2LB 4G3VA 3CI6A 5DF9A 2E8JA 3IX4A 5D3OA 1NXYA 2W27A 3HUOA 4K08A 2R78A 3HJKA 5HD3A 1JWPA 1YPRA 4RX3A 3KX0X 1DJAA 5CRFA 3JPUA 4YNRA 3MZEA 2Y4AA 1NZOA 1YQSA 2I9VA 2Y2GA 1E25A 5CX7A 5F1FA 3NOUC 2EX9A 2ZQ8A 3H7WB 1N9LA 4MLLA 3FPVA 3VP2A 5I94A 3IWIA 1T18A 3SZTA 3VMAA 1YM1A 2XROA 2ZC5B 1WE4A 4GDBA 5FQJA 1YAXA 3B47A 4ETZA 4WMCA 3KO6A 2X01A 4D2OA 3G31A 1K4FA 4DE3A 2DNSA 1NY0A 2IA2A 2IWDA 3GV9A 3PBOA 1KDWA 3BY9A 1DP9A 3U4LP 1H8MA 3BLMA 3LIBA 3SH9A 3LY4A 4E6XA 5EVIB 1F5MA 2HZ5A 3RXXA 5DTKA 4JLFA 3VSLA 2XDMA 1K57A 2V1AA 3MKEA 3KYEA 4R3BA 1IOUA 3VP1A 4S2OA 1CJFA 4DMZA 4JF4A 2Y55A 1XGIA 3LI8A 2ZQ7A 5G18A 4NK3A 2M7VA 1KGFA 2JHEA 3LIAA 3NIAA 1GA9A 5FQMA 3SW1A 3UB8A 2XFTA 3OBFA 1ODVA 5J8XA 2QJ5A 5HL1A 2V8CA 1K4EA 5M1AA 3UY6A 4R70A 2VLGA 1NYMA 5TBMB 3A0SA 5F83A 4G3WA 3TG9A 1YKDA 2EX6A 2M7UA 4U0TA 2O9AA 4Y3IA 4PM6A 4LPZA 4JKTA 1E3UD 4Y7PA 4IUKA 1DP8A 2A49A 4WZ5C 4S2MA 5E2FA 5IU1A 2HJEA 1ZKJA 3W8KA 3BFDA 1PFLA 1VB6A 3A3EA 2JCHA 5DFYA 5GLCA 3HLFA 2W1TB 4XUXA 4BQMA 5EVEA 4JGPA 2EXAA 2K7SA 2DRWA 1XA7A 3TOIA 1M6KA 1GA0A 5HSQA 3ITBA 4EU0A 1BZAA 4OOMA 4QY5A 1EWZA 3ZVWA 1K55C 2VJWA 1PZOA 3CWFA 2ZC4B 4KZ7A 1TS7A 2BASA 3QNCA 3PTEA 4XT2A 4LV0A 1BLHA 1TD5A 4EXOA 1QMEA 3O5YA 2A3UA 5FATA 4HP4A 2W3GA 2R9XA 3P01A 2ZOHA 4XUZA 3K3CA 4MN6A 5HWVA 3R7WA 3GRJA 4GLQA 3N8LA 1RGYA 3V39A 4GNUA 3BECA 5AQAA 5AVEA 4F3LA 3QHYA 4MN5A 2JKFA 4XXRA 4LRXC 2QYBA 3PR6A 3ZG8B 5FEFA 3ZNYA 3QP2A 3C7UA 3HLBA 5TR7A 4LCMA 2J9OA 5CTMA 1LSVA 3T4LA 3UB7A 1K6RA 4S2IA 4EEPA 4FH4A 4S2NC 3SOIA 3T12B 3L7HA 5IS1A 3HL9A 5HFOA 1SDNA 2V0WA 4Q0HA 1L0GA 4FTXA 4KZ5A 4HOIA 1LSWA 1ZHHB 5KIZA 3A0RA 3ICYA 1LT0A 4DE2A 4H6JA 4CLCA 2Y2HA 2ZC3B 5HD5A 4P6BA 3PBSA 4UQIS 1W8QA 1FSWA 4P0MA 4JBFA 1G5UA 3EGXC 4X68A 3EOIA 3H82B 3BWLA 2XSSA 2HDRA 2INWA 5CECA 1OT6A 4HESA 4H8RA 1PW1A 2KX6A 4B93A 3E2KA 4E3KA 4R0QA 1XA1A 4GZBA 2XR0A 3PBRA 4G3KA 4Q0JA 3E98A 3CZDA 4DJ2A 1FSYA 2L4RA 1RP5A 4KG6A 2RCXA 4WMCD 3OPPA 3TRCA 2Z6DA 2VX8A 2ZOIA 4OVDA 3OPLA 3LICA 1L3LA 4KG5A 4DDSA 4BENA 3MBZA 1KE0A 1PYYA 4R23A 2Q0OA 3IBRA 3UNWA 4H6JB 3G35A 2ZD8A 2PU4A 3CUEA 4CLCB 3ZG7B 2WGIA 3KYQA 1NLZA 1JTDA 4O0PA 3MSHA 1VETA 4I38A 1G6AA 1CK3A 5LBRA 5EVIC 5TGFA 1NJ4A 2ZJ9A 2NUPC 5TJJA 4MBHA 5DTSA 3IXGA 4DJ3A 2A24A 3PBTA 3G30A 4X69A 1ES2A 3KSHA 4YINA 4OQHA 3R4KA 2OWHA 2HGVA 1N4OA 4LGWA 3C5AA 3ZVTA 5AQ9A 3VP3A 1MWRA 5GL9A 4EUVA 4NETA 4ID4A 4NXEA 2ZQCA 1GSWA 1H3QA 1H5XA 2ZL1A 2WUQA 5IHVA 4O01A 3AGFA 4DE0A 4RYEA 4QY6A 3BLSA 3UPOA 2EFXA 2XQZA 1Q2PA 3A0VA 4HHDA 2PHYA 1OMEA 1E4DA 3WS0A 4OQIA 2EA9A 5CEBA 1E3UA 1EROA 4OKPA 5AJGA 4NXGA 4GW9A 3MZFA 1S1ZA 2ZMVA 1RCJA 2HV1A 2XEPA 2JKRM 3EWKA 1S6RA 1DP6A 4WM9A 5DKLA 4WF0A 3AGDA 2XD5A 1ONHA 3B3XA 1YMSA 3BJNA 4GS9B 5EM0A 1CEGA 2G2WA 3LR4A 4KZAA 4EQ1A 2R9WA 4JXVA 5EOEA 3ZG9B 4KZ4A 4DKIA 1X0OA 2G7UA 3Q1FA 4JPMA 2JKGA 2PRFA 2ZM2A 3KSGA 4LLOB 3GECA 5EOOA 3OPRA 3S7OA 3VV4A 1JWVA 2HDUA 1N9BA 3GVBA 1ES3A 3UB5P 4QPRA 1S4RA 1MWSA 4K91A 5FAPA 1VQQA 4DDYA 4EQIA 5CGWA 3C8CA 5L10A 1W5DA 2ZQ9A 5C5KA 4EERA 3BY8A 1RGZA 1P9WA 3V50A 2VA0A 4OPRA 1NRJA 4GD8A 3T50A 4KQQA 4S2LA 2KDKA 4ZJ2A 1Y54A 3G2ZA 2ZM0A 2XFSA 3IWQA 3B33A 5F1GA 5GHZA 4MN7A 2WAFA 4R3JA 3P09A 3LR0A 1DJCA 1LI9A 3IF5A 3UN7A 5F6AA 3Q07A 3FKWA 1XXMA 1HD8A 3N4IA 3T4OA 5F82A 3NC8A 3MFXA 3NCKA 5F68A 4R3AA 4YFMA 3OCLA 5FI7A 4Y13A 4PM9A 4QWOA 4PPRA 3IXBA 3UPPA 1GSVA 3N8RA 5HX9A 3UE1A 3FV7A 2HF6A 4R4RA 4UA9A 4S2PA 1NWZA 1FCOA 2O9CA 5HAIA 4OPQA 2ZLYA 1I2SA 2JBFA 4RQ9A 1OTEA 1IYSA 1L0EA 4I3IA 2W3FA 2KOIA 3JVUA 3MXRA 2XLNA 5TFQA 3EGDC 2J80A 2V9AA 3MXSA 4N9LA 1T1CA 1TDGA 2Q9MA 5HPIA 4NXBA 4GN2A 4EV4A 1P0ZA 4UA6A 1XJ2A 2J3WA 5HW3A 5HWWA 4ZBEA 1MPLA 1FR1A 3FYZA 4UA7A 1VEUB 4B4XA 2OLVA 2V1BA 3IXHA 3HUNA 5KZHA 1M40A 3GTCA 5F69A 3WS5A 3C30A 4IVKA 3ITAA 2O99A 3RTYA 1KVLA 2J9PA 5CXWA 5JYOA 4FH2A 1YLTA 3VSKA 3TW8A 2ZBBA 1OJ5A 4MMNA 5HAPA 1CF0A 4M3KA 1NRFA 2L1MA 4R1GA 3D72A 4EETB 4EBPA 2PYRA 2V20A 2VGKA 2B02A 2EWWA 4GHIA 3WS1A 4UQIM 1YLZA 1CI8A 2JKTI 4JGQA 3G32A 2BLSA 4PMAA 1J3WA 1G68A 2UV0E 2Y91A 1S67L 4GOGA 3K2NA 4GJ4A 2OAQ1 2K2NA 1N9NA 2OSUA 3IF6A 2XD1A 2GX5A 3TJZC 5HPFA 1KVMA 1DY6A 5L07A 3F1NA 4ZDXA 4BWIA 5FDSA 3TSGA 2XA7M 1L2SA 2DMWA 3VFFA 5A92A 1FCMA 3DWKA 2ZMFA 1PW8A 3GQZA 1W63Q 1YLJA 4N9KA 1KOUA 2HP5A 2OAP1 4NXFA 4P87A 3WS2A 4QJGA 5FQQA 3T1QB 2VGLM 3FC7A 1YT4A 3LCEA 5CHJA 1K56D 2QMIA 4E6WA 4KG2A 1BYWA 2QWSA 2MJ6A 1YLYA 3ZG0A 1CQAA 3ISGA 3MQOA 1JVJA 4BLMA 3PXPA 1AWIA 1IYQA 4PHTA 4E3LA 3IH9A 4OQGA 3GDIA 4EEUA 2PD8A 3G2YA 2QZ6A 3E2LA 1HLUP 4F94A 2FFFB 2WGVA 2XF3A 1K54C 1YLWA 3IF6B 4MNRA 4QD4A 5CTNA 1NZUA 2B95A 4HJ3A 5E43A 1XKZA 1W79A 4LV3A 2QPNA 4MDZA 3LIFA 5HARA 1V9YA 2HDSA 1O07A 2RL3A 3O3VA 3ZNTA 3P7NA 3T1SA 3HLWA 4JF6A 5DF8A 1SKOA 3E4PA 1T1BA 1STZA 1FR6A 2WGWA 4Q8IA 2P9VA 1G6OA 3ZCZA 4PKYA 3V67A 4XT2B 5EUAA 3VP0A 3RJUA 3LI9A 3NOPC 2VV6A 4N92A 5J7EA 4BD0A 3T4SA 2IWCA 3MF0A 4HBTA 3KSIA 2X71A 4CPKA 4GCZA 3R7WB 4U3TA 3DWZA 1TS8A 5FDHA 4C75A 3UPNA 4F3LB 1FOFA 2IWBA 3T1XA 4KZBA 5IT5A 1HVBA 4K0WA 3IX3A 5BOHA 3UMEA 1L0FA 5EM1A 1LLBA 1TDLA 2GJ3A 1N9OA 3CPTA 5A90A 4E3JA 4ZTKA 2WKRA 1WA9A 2HP6A 4ZJ1A 2WKHA 4E3MA 4EESA 4UHUA 2PAVP 3HLCA 4HNBA 1SCWA 2J3TC 3SH8A 3ZYTA 3HUMA 1TF1A 3BYDA 1GHPA 3LEQA 5FA7A 3A3DA 1OTAA 4YWZA 5FI2A 3IHBA 2WAEA 1K38A 2Y2KA 3F1PA 4B9OA 3MS6A 1YSQA 4CQHA 4KQDA 2EXBA 2JKTM 4Z1WA 4JXWA 1K0KA 4WZ5A 2EWVA 3MKFA 5AVFA 1ZC2A 2X02A 5HDDA 4JXSA 3E4OA 4X1LA 3UO9A 4I3AA 4X56A 4BBTA 3Q7ZA 4DF6A 3HREA 3JVVA 3OOVA 4S2KA 4B4ZA 1SKFA 3CJMA 4B88A 3C2WA 3FWLA 5I5LA 1C3BA 1K55A 4A5RA 4EUZA 3IXDA 4L0LA 4R6LA 1OTBA 2UWXA 1KGEA 4K0XA 4GKUA 4MBKA 2Y79A 4IBXA 1TVFA 4D60A 3LIDA 3MXQA 1FCNA 3OZHA 4MCWA 1Y4OA 1W7FA 4I39A 3QP1A 3N6IA 1F98A 5DTTA 1I2WA 3NBLA 4WZ4A 1BTLA 1K6SA 1VETB 5FQKA 3V5MA 3DTEA 2Y2JA 3NDGA 2G2UA 3IS2A 5FAQA 1OPXA 3SS5A 3IT9A 4OPYA 1IKGA 3D9YA 1YLPA 1MKIA 2A24B 1GSXA 1K57C 1BLSA 3T4KA 4S2NA 2HDQA 3NECA 4LRZE 1D1JA 3H9WA 5CERA 4P85A 2PYPA 3Q82A 3MMHA 1P9RA 3LUQA 4ZJ3A 4X53A 1D06A 1BLCA 4WELA 5HDSA 4ESPA 5CGXA 4M4XA 2GNXA 1VHMA 5AQBA 2ZL1B 4HBUA 3Q7VA 3F1OA 1K56A 1ONGA 1KE3A 3A3FA 3CHWP 5A91A 3GSGA 2P74A 4EBNA 3QP6A 3PAEA 2H10A 1GHMA 4O7DA 2XK1A 3FKVA 3DBAA 2A2LA 5HZHA 5DVAA 1MXOA 3Q81A 5FL3A 3RXWA 4IJGA 1SDEA 1ES4A 5GLDA 1XX2A 3H7WA 4BBUA 1I5QA 3IHAA 1LL8A 4ZAMA 1XJ3A 3IQAA 2PR6A 4OPZA 1PI4A 3BEBA 3LO7A 3HJIA 2E8IA 1T19A 3KSFA 2Y2LA 2EX2A 3NY4A 2I72A 3VE3A 1UWNX 2Y2OA 5HDCA 3P98A 4KENB 1KGGA 5F5YA 2BG1A 1U60A 4LV1A 4PAUA 1MY8A 5J4EA 3DTIA 4WEKA 3CAXA 3MJQA 5EVIA 2C6WB 3PBNA 2W1RA 3C38A 1YMXA 1WYCA 2KLIA 1IELA 2EX8A 2LB9A 3DW0A 2OV5A 5FEGA 4KZ9A 3WS4A 4X6TA 5KSCA 3NULA 1S0WA 4FOFA 1XP4A 2V1ZA 5EFWA 1LL9A 4ETXA 3S7QA 5AQ7A 1G28A 2QKPA 3CLOA 5L8MA 1SHVA 2WZZA 5HAQA 1UWPX 3ZQ5A 4C6YA 4BD1A 4QHCA 4Z9QA 1BSGA 4UEYA
chains in the Genus database with same CATH topology
1PW8A 3HBRA 3GQZA 3HLEA 4OVDA 1YLJA 4N9KA 2J7VA 2HP5A 3AGEA 4N1HA 1PWDA 4P87A 3HLDA 3WS2A 4QJGA 3OPLA 4FD8A 3IH8A 5FQQA 1LHYA 4KG5A 4IBRA 1YT4A 4FSFA 1L0DA 1PI5A 2ZMAA 3LCEA 5CHJA 4BENA 4DDSA 2VGJA 1K56D 2Y2IA 4BL2A 2QMIA 4E6WA 4RX2A 3M6BA 4KG2A 3MBZA 3GMWA 3V3SA 1KE0A 1WYBA 4QU3A 1PYYA 5KMWA 3NI9A 4IVIA 4R23A 5GHYA 3UNWA 4S2JA 4U0XA 1YLYA 3G35A 2ZD8A 2PU4A 2J8YA 3ZG0A 3ZG7B 3ISGA 1O7EA 1JVJA 2WGIA 4BLMA 3S22A 5CHUA 1FCMA 3DWKA 1IYQA 2H0YA 4E3LA 1JTGA 3IH9A 1JTDA 4OQGA 5GLBA 1W8YA 1Z6FA 3G2YA 5U47A 1ALQA 2JC7A 2QZ6A 2JE5A 3CG5A 3E2LA 4OP5A 1G6AA 4N1XA 4CJNA 4RA7A 5GHXA 4F94A 2FFFB 2WADA 4OOLA 1CK3A 2WGVA 4UAAA 2XF3A 1K54C 1K25A 5CHMA 1ESUA 2Y2MA 3OC2A 3N7WA 5EVIC 2B5RA 1NJ4A 4JF5A 5TGFA 2ZJ9A 3IF6C 4RVAA 3W4OA 5A93A 3A3IA 3M6HA 3SS4A 1YLWA 4MBHA 5DTSA 3IXGA 3IF6B 1ZG6A 4MNRA 4OH0A 4QD4A 5CTNA 1NZUA 3PBTA 3G30A 4GB7A 4PM5A 4X69A 3BFEA 4MBFA 3VOYA 1PIOA 1ES2A 1XKZA 5E43A 1W79A 3PAGA 4LV3A 4PM8A 4X55A 2QPNA 2EFUA 2V2FF 1LI0A 4YINA 4KZ3A 3C4PA 2PBYA 2WZXA 4OQHA 2ZM8A 4R4SA 1ERMA 4GD6A 5HARA 1N4OA 2ZC7A 2PU2A 1PZPA 1ESIA 1MWTA 2HDSA 3C5AA 5AQ9A 3ZVTA 1MWUA 1O07A 2Y2NA 4OQ0A 3VP3A 1TEMA 3QNBA 2RL3A 3O3VA 1ZG4A 3EQUA 3ZNTA 1ES5A 3HLWA 4JF6A 5DF8A 3SH7A 1MWRA 5GL9A 3M2JA 4NETA 1FR6A 2ZC6B 2GDNA 4ID4A 2WGWA 4Q8IA 2P9VA 1J9MA 2ZQCA 4LCLA 5FAOA 3ZCZA 2WKIA 3GR2A 3IWOA 1H5XA 2ZQAA 1IKIA 2WKEA 1HTZA 3C7VA 4OOYA 4Y0UA 2WUQA 4FCFA 4KZ6A 5EUAA 5IHVA 3VP0A 1QMFA 3RJUA 3AGFA 2FFYA 3BFGA 4DE0A 1XPBA 1KDSA 4N92A 4RYEA 5EPHA 4QY6A 3BLSA 3Q7VB 4BD0A 3UPOA 2IWCA 2EFXA 3W4PA 2XQZA 4LENA 2OLUA 4OLGA 2Y2QA 4HBTA 1Q2PA 4EWFA 2X71A 4CPKA 3UDXA 5E2HA 2Z2LB 1IEMA 1OMEA 1E4DA 2Y59A 4U3TA 3DWZA 5DF9A 3WS0A 4GDNA 5D3OA 5FDHA 4C75A 1NXYA 3HUOA 4OQIA 1EI5A 3UPNA 1LL5A 5CEBA 1E3UA 1FOFA 2IWBA 5GLAA 4Y0OA 1JWPA 1EROA 1PWCA 4KZBA 4OKPA 4RX3A 3M2KA 1HVBA 4C3QA 1DJAA 3FZCA 3MZFA 4K0WA 5CRFA 5BOHA 1L0FA 5EECA 1LLBA 1TDLA 1RCJA 3MZEA 2Y4AA 1NZOA 1YQSA 2Y2GA 1E25A 5F1FA 4JXGA 2XEPA 5A90A 4E3JA 4ZTKA 1S6RA 2EX9A 1H8ZA 2HP6A 2ZQ8A 4WM9A 4ZJ1A 2WKHA 4E3MA 3LEZA 3AGDA 4UHUA 5L2FA 4MLLA 2XD5A 1ONHA 3OCNA 3B3XA 1YMSA 3I7JA 3VP2A 5I94A 3IWIA 3VMAA 1CEGA 3HLCA 1YM1A 3VOZA 2G2WA 2XH9A 3WRTA 2H0TA 3C4OA 4KZAA 2ZC5B 4DXBA 3ZHHA 1WE4A 4GDBA 2DCFA 5FQJA 2R9WA 4JXVA 1SCWA 3SH8A 3HLGA 5EOEA 3HUMA 5EE8A 3ZG9B 3OPHA 4KZ4A 4WMCA 4DKIA 3BYDA 1BLPA 2X01A 1GHPA 5FA7A 3Q1FA 3A3DA 4JPMA 5FI2A 5M19A 2ZM2A 3O88A 3IHBA 5FQ9A 2Y2PA 4D2OA 3G31A 2WAEA 2CC1A 4KQOA 1K38A 2Y2KA 1K4FA 5EOOA 3OPRA 4DE3A 2DNSA 1NY0A 1IYPA 2IWDA 3GV9A 3PBOA 4BJPA 1KDWA 1JWVA 1BT5A 3ZDJA 2HDUA 1N9BA 2EXBA 3BLMA 4JXWA 3GVBA 1ES3A 4WZ5A 3SH9A 3LY4A 4E6XA 1KE4A 2XGNA 5FI6A 3MKFA 5EVIB 1ZC2A 4QB8A 2X02A 4WBGA 1MWSA 4K91A 5FAPA 3RXXA 5DTKA 1VQQA 4JXSA 1NYYA 4JLFA 2C5WB 3VSLA 4DDYA 4EQIA 5CGWA 3HVFA 2XDMA 1K57A 3UO9A 4X56A 4E3IA 3MKEA 3Q7ZA 4DF6A 1W5DA 5FSRA 2ZQ9A 3HREA 4R3BA 1CI9A 4Y0TA 5M18A 3VP1A 3ZFZA 4S2OA 5CEDA 4S2KA 4B4ZA 3BFCA 1SKFA 1RGZA 3CJMA 3NDEA 2Y55A 1XGIA 4JF4A 2ZQ7A 1Q2QA 4B88A 5G18A 4NK3A 3V50A 3FWLA 4OPRA 1C3BA 1KGFA 4IEDA 1K55A 4GD8A 5KSHA 4A5RA 4EUZA 3IXDA 3NIAA 4KQQA 4L0LA 4S2LA 1GA9A 5FQMA 2XFTA 4ZJ2A 1Y54A 3G2ZA 2UWXA 1KGEA 5J8XA 2ZM0A 2XFSA 3O87A 4K0XA 4GKUA 5HL1A 1XGJA 3IWQA 1K4EA 4MBKA 5F1GA 4IBXA 5M1AA 1TVFA 5EVID 3EQVA 5GHZA 3UY6A 5FASA 2WAFA 4R3JA 3P09A 1PWGA 1FCNA 3OZHA 1DJCA 3N8SA 1NYMA 3S1YA 1LI9A 3IF5A 2HP9A 3UN7A 3Q07A 3FKWA 5F83A 3TG9A 1W7FA 1XXMA 2EX6A 4U0TA 4DE1A 1HD8A 4PM6A 3N4IA 1VM1A 3N6IA 4JKTA 1E3UD 5DTTA 1I2WA 3NBLA 4WZ4A 4Y7PA 5F82A 1BTLA 1K6SA 5FQKA 3NC8A 2A49A 3V5MA 4WZ5C 3NCKA 4S2MA 5E2FA 3O86A 2Y2JA 4DRTA 1ZKJA 4YFMA 3OCLA 3NDGA 2G2UA 2Z2MB 3G34A 3MFDA 3DTMA 3W8KA 4E3NA 5FI7A 4DXCA 4PM9A 3UDIA 4PPRA 5FAQA 3BFDA 3IXBA 3IT9A 3SS5A 4OPYA 1IKGA 3UPPA 3N8RA 5HX9A 3A3EA 2JCHA 2H5SA 5GLCA 3UE1A 1YLPA 3FV7A 3HLFA 4R4RA 1MKIA 1K57C 1BUEA 4UA9A 4XUXA 4BQMA 1BLSA 4E3OA 4S2PA 4S2NA 1FCOA 2EXAA 2HDQA 5HAIA 4OPQA 2DRWA 1JWZA 2ZLYA 1XA7A 1I2SA 4LV2A 3TOIA 1M6KA 2JBFA 5CERA 4P85A 1GA0A 3VFHA 3Q82A 1IYSA 3ITBA 4BL3A 1L0EA 1BZAA 2ZQDA 4WMCD 4OOMA 3S4XA 4QY5A 4ZJ3A 4X53A 3A3JA 1EWZA 1BLCA 4WELA 3ZVWA 1K55C 1PZOA 5CGXA 2ZC4B 3MXRA 4KZ7A 3UDFA 2XLNA 4KQRA 3QNCA 1FQGA 3PTEA 5TFQA 3MXSA 4N9LA 2WGWB 2P9VB 4KZ8A 5AQBA 1TDGA 2Q9MA 4LV0A 1BLHA 1QMEA 4GN2A 4HBUA 5FATA 2A3UA 3WRZA 4EV4A 3Q7VA 1K56A 1ONGA 1DJBA 2R9XA 1KE3A 4UA6A 5FQIA 4XUZA 5HW3A 3A3FA 4ZBEA 1MPLA 1FR1A 5A91A 3V3RA 3FYZA 3GSGA 2P74A 3GRJA 3N8LA 3UE3A 1RGYA 4EBNA 4UA7A 3V39A 4GNUA 4B4XA 2OLVA 3BECA 5AQAA 3PAEA 2H10A 3IXHA 3HUNA 1GHMA 4O7DA 5KZHA 3BRMA 2XK1A 1M40A 3GTCA 3FKVA 3QHYA 3WS5A 4IVKA 3ITAA 1BULA 4XXRA 3ZG8B 5EVLA 1KVLA 3ZNYA 5JYPA 2J9PA 3ZGAB 5E2EA 5CXWA 4OLDA 3SS3A 5JYOA 3C7UA 3LY3A 4OONA 1MXOA 5DVAA 3HLBA 3Q81A 4FH2A 3RXWA 1SDEA 5TR7A 1ES4A 4LCMA 2J9OA 5CTMA 3G4PA 1YLTA 3VSKA 1K6RA 5GLDA 1XX2A 4WEJA 4S2IA 4FH4A 1I5QA 4S2NC 3IHAA 3UE0A 3SOIA 2Q9NA 4ZAMA 3HL9A 5HFOA 1SDNA 3PBQA 1L0GA 3IQAA 4KZ5A 4OPZA 5HAPA 1PI4A 3BM6A 3CMZA 1GHIA 3BEBA 1AXBA 4M3KA 4DE2A 3LO7A 1NRFA 1HZOA 2E8IA 2Y2HA 4R1GA 2Y2LA 1MBLA 2EX2A 4EBPA 2ZC3B 3NY4A 1CEFA 3VP4A 3W4QA 2V20A 2VGKA 2I72A 3WWXA 1ERQA 3ZG5A 1IYOA 2Y2OA 4P6BA 3WS1A 3JYIA 1YLZA 1CI8A 3P98A 3PBSA 4KENB 1KGGA 1W8QA 3G32A 2BLSA 4PMAA 4PM7A 1FSWA 4P0MA 2BG1A 1U60A 1G68A 4JBFA 4LV1A 2Y91A 4X68A 1MY8A 4GOGA 5E2GA 4EBLA 1K54A 4WEKA 2HDRA 2OSUA 5EVIA 2C6WB 2WK0A 2XD1A 3IF6A 3PBNA 5DF7A 1KVMA 4WYYA 1YMXA 1DY6A 1WYCA 5CECA 4HESA 3D4FA 1IELA 2EX8A 4H8RA 1PW1A 3DW0A 2OV5A 4KZ9A 3WS4A 4X6TA 5KSCA 5CGSA 3E2KA 1S0WA 4ZDXA 4E3KA 1XP4A 4R0QA 2V1ZA 1XA1A 4GZBA 1LL9A 4OP8A 2XR0A 3PBRA 5AQ7A 3BFFA 3TSGA 3MZDA 4HEFA 1L2SA 3CZDA 1SHVA 2WZZA 1GCEA 5HAQA 3VFFA 5A92A 4C6YA 1FSYA 2HPBA 2WYXA 1H8YA 4BD1A 1RP5A 4KG6A 4QHCA 1BSGA 2RCXA 4Z9QA 3OPPA 4MEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PW8 A;  3HBR A;  3GQZ A;  3HLE A;  4OVD A;  1YLJ A;  4N9K A;  2J7V A;  2HP5 A;  3AGE A;  4N1H A;  1PWD A;  4P87 A;  3HLD A;  3WS2 A;  4QJG A;  3OPL A;  4FD8 A;  3IH8 A;  5FQQ A;  1LHY A;  4KG5 A;  4IBR A;  1YT4 A;  4FSF A;  1L0D A;  1PI5 A;  2ZMA A;  3LCE A;  5CHJ A;  4BEN A;  4DDS A;  2VGJ A;  1K56 D;  2Y2I A;  4BL2 A;  2QMI A;  4E6W A;  4RX2 A;  3M6B A;  4KG2 A;  3MBZ A;  3GMW A;  3V3S A;  1KE0 A;  1WYB A;  4QU3 A;  1PYY A;  5KMW A;  3NI9 A;  4IVI A;  4R23 A;  5GHY A;  3UNW A;  4S2J A;  4U0X A;  1YLY A;  3G35 A;  2ZD8 A;  2PU4 A;  2J8Y A;  3ZG0 A;  3ZG7 B;  3ISG A;  1O7E A;  1JVJ A;  2WGI A;  4BLM A;  3S22 A;  5CHU A;  1FCM A;  3DWK A;  1IYQ A;  2H0Y A;  4E3L A;  1JTG A;  3IH9 A;  1JTD A;  4OQG A;  5GLB A;  1W8Y A;  1Z6F A;  3G2Y A;  5U47 A;  1ALQ A;  2JC7 A;  2QZ6 A;  2JE5 A;  3CG5 A;  3E2L A;  4OP5 A;  1G6A A;  4N1X A;  4CJN A;  4RA7 A;  5GHX A;  4F94 A;  2FFF B;  2WAD A;  4OOL A;  1CK3 A;  2WGV A;  4UAA A;  2XF3 A;  1K54 C;  1K25 A;  5CHM A;  1ESU A;  2Y2M A;  3OC2 A;  3N7W A;  5EVI C;  2B5R A;  1NJ4 A;  4JF5 A;  5TGF A;  2ZJ9 A;  3IF6 C;  4RVA A;  3W4O A;  5A93 A;  3A3I A;  3M6H A;  3SS4 A;  1YLW A;  4MBH A;  5DTS A;  3IXG A;  3IF6 B;  1ZG6 A;  4MNR A;  4OH0 A;  4QD4 A;  5CTN A;  1NZU A;  3PBT A;  3G30 A;  4GB7 A;  4PM5 A;  4X69 A;  3BFE A;  4MBF A;  3VOY A;  1PIO A;  1ES2 A;  1XKZ A;  5E43 A;  1W79 A;  3PAG A;  4LV3 A;  4PM8 A;  4X55 A;  2QPN A;  2EFU A;  2V2F F;  1LI0 A;  4YIN A;  4KZ3 A;  3C4P A;  2PBY A;  2WZX A;  4OQH A;  2ZM8 A;  4R4S A;  1ERM A;  4GD6 A;  5HAR A;  1N4O A;  2ZC7 A;  2PU2 A;  1PZP A;  1ESI A;  1MWT A;  2HDS A;  3C5A A;  5AQ9 A;  3ZVT A;  1MWU A;  1O07 A;  2Y2N A;  4OQ0 A;  3VP3 A;  1TEM A;  3QNB A;  2RL3 A;  3O3V A;  1ZG4 A;  3EQU A;  3ZNT A;  1ES5 A;  3HLW A;  4JF6 A;  5DF8 A;  3SH7 A;  1MWR A;  5GL9 A;  3M2J A;  4NET A;  1FR6 A;  2ZC6 B;  2GDN A;  4ID4 A;  2WGW A;  4Q8I A;  2P9V A;  1J9M A;  2ZQC A;  4LCL A;  5FAO A;  3ZCZ A;  2WKI A;  3GR2 A;  3IWO A;  1H5X A;  2ZQA A;  1IKI A;  2WKE A;  1HTZ A;  3C7V A;  4OOY A;  4Y0U A;  2WUQ A;  4FCF A;  4KZ6 A;  5EUA A;  5IHV A;  3VP0 A;  1QMF A;  3RJU A;  3AGF A;  2FFY A;  3BFG A;  4DE0 A;  1XPB A;  1KDS A;  4N92 A;  4RYE A;  5EPH A;  4QY6 A;  3BLS A;  3Q7V B;  4BD0 A;  3UPO A;  2IWC A;  2EFX A;  3W4P A;  2XQZ A;  4LEN A;  2OLU A;  4OLG A;  2Y2Q A;  4HBT A;  1Q2P A;  4EWF A;  2X71 A;  4CPK A;  3UDX A;  5E2H A;  2Z2L B;  1IEM A;  1OME A;  1E4D A;  2Y59 A;  4U3T A;  3DWZ A;  5DF9 A;  3WS0 A;  4GDN A;  5D3O A;  5FDH A;  4C75 A;  1NXY A;  3HUO A;  4OQI A;  1EI5 A;  3UPN A;  1LL5 A;  5CEB A;  1E3U A;  1FOF A;  2IWB A;  5GLA A;  4Y0O A;  1JWP A;  1ERO A;  1PWC A;  4KZB A;  4OKP A;  4RX3 A;  3M2K A;  1HVB A;  4C3Q A;  1DJA A;  3FZC A;  3MZF A;  4K0W A;  5CRF A;  5BOH A;  1L0F A;  5EEC A;  1LLB A;  1TDL A;  1RCJ A;  3MZE A;  2Y4A A;  1NZO A;  1YQS A;  2Y2G A;  1E25 A;  5F1F A;  4JXG A;  2XEP A;  5A90 A;  4E3J A;  4ZTK A;  1S6R A;  2EX9 A;  1H8Z A;  2HP6 A;  2ZQ8 A;  4WM9 A;  4ZJ1 A;  2WKH A;  4E3M A;  3LEZ A;  3AGD A;  4UHU A;  5L2F A;  4MLL A;  2XD5 A;  1ONH A;  3OCN A;  3B3X A;  1YMS A;  3I7J A;  3VP2 A;  5I94 A;  3IWI A;  3VMA A;  1CEG A;  3HLC A;  1YM1 A;  3VOZ A;  2G2W A;  2XH9 A;  3WRT A;  2H0T A;  3C4O A;  4KZA A;  2ZC5 B;  4DXB A;  3ZHH A;  1WE4 A;  4GDB A;  2DCF A;  5FQJ A;  2R9W A;  4JXV A;  1SCW A;  3SH8 A;  3HLG A;  5EOE A;  3HUM A;  5EE8 A;  3ZG9 B;  3OPH A;  4KZ4 A;  4WMC A;  4DKI A;  3BYD A;  1BLP A;  2X01 A;  1GHP A;  5FA7 A;  3Q1F A;  3A3D A;  4JPM A;  5FI2 A;  5M19 A;  2ZM2 A;  3O88 A;  3IHB A;  5FQ9 A;  2Y2P A;  4D2O A;  3G31 A;  2WAE A;  2CC1 A;  4KQO A;  1K38 A;  2Y2K A;  1K4F A;  5EOO A;  3OPR A;  4DE3 A;  2DNS A;  1NY0 A;  1IYP A;  2IWD A;  3GV9 A;  3PBO A;  4BJP A;  1KDW A;  1JWV A;  1BT5 A;  3ZDJ A;  2HDU A;  1N9B A;  2EXB A;  3BLM A;  4JXW A;  3GVB A;  1ES3 A;  4WZ5 A;  3SH9 A;  3LY4 A;  4E6X A;  1KE4 A;  2XGN A;  5FI6 A;  3MKF A;  5EVI B;  1ZC2 A;  4QB8 A;  2X02 A;  4WBG A;  1MWS A;  4K91 A;  5FAP A;  3RXX A;  5DTK A;  1VQQ A;  4JXS A;  1NYY A;  4JLF A;  2C5W B;  3VSL A;  4DDY A;  4EQI A;  5CGW A;  3HVF A;  2XDM A;  1K57 A;  3UO9 A;  4X56 A;  4E3I A;  3MKE A;  3Q7Z A;  4DF6 A;  1W5D A;  5FSR A;  2ZQ9 A;  3HRE A;  4R3B A;  1CI9 A;  4Y0T A;  5M18 A;  3VP1 A;  3ZFZ A;  4S2O A;  5CED A;  4S2K A;  4B4Z A;  3BFC A;  1SKF A;  1RGZ A;  3CJM A;  3NDE A;  2Y55 A;  1XGI A;  4JF4 A;  2ZQ7 A;  1Q2Q A;  4B88 A;  5G18 A;  4NK3 A;  3V50 A;  3FWL A;  4OPR A;  1C3B A;  1KGF A;  4IED A;  1K55 A;  4GD8 A;  5KSH A;  4A5R A;  4EUZ A;  3IXD A;  3NIA A;  4KQQ A;  4L0L A;  4S2L A;  1GA9 A;  5FQM A;  2XFT A;  4ZJ2 A;  1Y54 A;  3G2Z A;  2UWX A;  1KGE A;  5J8X A;  2ZM0 A;  2XFS A;  3O87 A;  4K0X A;  4GKU A;  5HL1 A;  1XGJ A;  3IWQ A;  1K4E A;  4MBK A;  5F1G A;  4IBX A;  5M1A A;  1TVF A;  5EVI D;  3EQV A;  5GHZ A;  3UY6 A;  5FAS A;  2WAF A;  4R3J A;  3P09 A;  1PWG A;  1FCN A;  3OZH A;  1DJC A;  3N8S A;  1NYM A;  3S1Y A;  1LI9 A;  3IF5 A;  2HP9 A;  3UN7 A;  3Q07 A;  3FKW A;  5F83 A;  3TG9 A;  1W7F A;  1XXM A;  2EX6 A;  4U0T A;  4DE1 A;  1HD8 A;  4PM6 A;  3N4I A;  1VM1 A;  3N6I A;  4JKT A;  1E3U D;  5DTT A;  1I2W A;  3NBL A;  4WZ4 A;  4Y7P A;  5F82 A;  1BTL A;  1K6S A;  5FQK A;  3NC8 A;  2A49 A;  3V5M A;  4WZ5 C;  3NCK A;  4S2M A;  5E2F A;  3O86 A;  2Y2J A;  4DRT A;  1ZKJ A;  4YFM A;  3OCL A;  3NDG A;  2G2U A;  2Z2M B;  3G34 A;  3MFD A;  3DTM A;  3W8K A;  4E3N A;  5FI7 A;  4DXC A;  4PM9 A;  3UDI A;  4PPR A;  5FAQ A;  3BFD A;  3IXB A;  3IT9 A;  3SS5 A;  4OPY A;  1IKG A;  3UPP A;  3N8R A;  5HX9 A;  3A3E A;  2JCH A;  2H5S A;  5GLC A;  3UE1 A;  1YLP A;  3FV7 A;  3HLF A;  4R4R A;  1MKI A;  1K57 C;  1BUE A;  4UA9 A;  4XUX A;  4BQM A;  1BLS A;  4E3O A;  4S2P A;  4S2N A;  1FCO A;  2EXA A;  2HDQ A;  5HAI A;  4OPQ A;  2DRW A;  1JWZ A;  2ZLY A;  1XA7 A;  1I2S A;  4LV2 A;  3TOI A;  1M6K A;  2JBF A;  5CER A;  4P85 A;  1GA0 A;  3VFH A;  3Q82 A;  1IYS A;  3ITB A;  4BL3 A;  1L0E A;  1BZA A;  2ZQD A;  4WMC D;  4OOM A;  3S4X A;  4QY5 A;  4ZJ3 A;  4X53 A;  3A3J A;  1EWZ A;  1BLC A;  4WEL A;  3ZVW A;  1K55 C;  1PZO A;  5CGX A;  2ZC4 B;  3MXR A;  4KZ7 A;  3UDF A;  2XLN A;  4KQR A;  3QNC A;  1FQG A;  3PTE A;  5TFQ A;  3MXS A;  4N9L A;  2WGW B;  2P9V B;  4KZ8 A;  5AQB A;  1TDG A;  2Q9M A;  4LV0 A;  1BLH A;  1QME A;  4GN2 A;  4HBU A;  5FAT A;  2A3U A;  3WRZ A;  4EV4 A;  3Q7V A;  1K56 A;  1ONG A;  1DJB A;  2R9X A;  1KE3 A;  4UA6 A;  5FQI A;  4XUZ A;  5HW3 A;  3A3F A;  4ZBE A;  1MPL A;  1FR1 A;  5A91 A;  3V3R A;  3FYZ A;  3GSG A;  2P74 A;  3GRJ A;  3N8L A;  3UE3 A;  1RGY A;  4EBN A;  4UA7 A;  3V39 A;  4GNU A;  4B4X A;  2OLV A;  3BEC A;  5AQA A;  3PAE A;  2H10 A;  3IXH A;  3HUN A;  1GHM A;  4O7D A;  5KZH A;  3BRM A;  2XK1 A;  1M40 A;  3GTC A;  3FKV A;  3QHY A;  3WS5 A;  4IVK A;  3ITA A;  1BUL A;  4XXR A;  3ZG8 B;  5EVL A;  1KVL A;  3ZNY A;  5JYP A;  2J9P A;  3ZGA B;  5E2E A;  5CXW A;  4OLD A;  3SS3 A;  5JYO A;  3C7U A;  3LY3 A;  4OON A;  1MXO A;  5DVA A;  3HLB A;  3Q81 A;  4FH2 A;  3RXW A;  1SDE A;  5TR7 A;  1ES4 A;  4LCM A;  2J9O A;  5CTM A;  3G4P A;  1YLT A;  3VSK A;  1K6R A;  5GLD A;  1XX2 A;  4WEJ A;  4S2I A;  4FH4 A;  1I5Q A;  4S2N C;  3IHA A;  3UE0 A;  3SOI A;  2Q9N A;  4ZAM A;  3HL9 A;  5HFO A;  1SDN A;  3PBQ A;  1L0G A;  3IQA A;  4KZ5 A;  4OPZ A;  5HAP A;  1PI4 A;  3BM6 A;  3CMZ A;  1GHI A;  3BEB A;  1AXB A;  4M3K A;  4DE2 A;  3LO7 A;  1NRF A;  1HZO A;  2E8I A;  2Y2H A;  4R1G A;  2Y2L A;  1MBL A;  2EX2 A;  4EBP A;  2ZC3 B;  3NY4 A;  1CEF A;  3VP4 A;  3W4Q A;  2V20 A;  2VGK A;  2I72 A;  3WWX A;  1ERQ A;  3ZG5 A;  1IYO A;  2Y2O A;  4P6B A;  3WS1 A;  3JYI A;  1YLZ A;  1CI8 A;  3P98 A;  3PBS A;  4KEN B;  1KGG A;  1W8Q A;  3G32 A;  2BLS A;  4PMA A;  4PM7 A;  1FSW A;  4P0M A;  2BG1 A;  1U60 A;  1G68 A;  4JBF A;  4LV1 A;  2Y91 A;  4X68 A;  1MY8 A;  4GOG A;  5E2G A;  4EBL A;  1K54 A;  4WEK A;  2HDR A;  2OSU A;  5EVI A;  2C6W B;  2WK0 A;  2XD1 A;  3IF6 A;  3PBN A;  5DF7 A;  1KVM A;  4WYY A;  1YMX A;  1DY6 A;  1WYC A;  5CEC A;  4HES A;  3D4F A;  1IEL A;  2EX8 A;  4H8R A;  1PW1 A;  3DW0 A;  2OV5 A;  4KZ9 A;  3WS4 A;  4X6T A;  5KSC A;  5CGS A;  3E2K A;  1S0W A;  4ZDX A;  4E3K A;  1XP4 A;  4R0Q A;  2V1Z A;  1XA1 A;  4GZB A;  1LL9 A;  4OP8 A;  2XR0 A;  3PBR A;  5AQ7 A;  3BFF A;  3TSG A;  3MZD A;  4HEF A;  1L2S A;  3CZD A;  1SHV A;  2WZZ A;  1GCE A;  5HAQ A;  3VFF A;  5A92 A;  4C6Y A;  1FSY A;  2HPB A;  2WYX A;  1H8Y A;  4BD1 A;  1RP5 A;  4KG6 A;  4QHC A;  1BSG A;  2RCX A;  4Z9Q A;  3OPP A;  4MEZ A; 
#chains in the Genus database with same CATH topology
 3HBR A;  3HLE A;  2J7V A;  3QP4 A;  3AGE A;  3B42 A;  2W3E A;  1LHY A;  1YSP A;  1DRM A;  4IBR A;  4NEE D;  4P6Z S;  4FSF A;  1L0D A;  1PI5 A;  2VGJ A;  2Y2I A;  4BL2 A;  4Y17 A;  3GMW A;  3V3S A;  1WYB A;  4CLC C;  5KMW A;  3NI9 A;  4IVI A;  4IHQ A;  4X1M A;  4S2J A;  5TBM A;  3QP5 A;  2P08 A;  5CHU A;  3EEH A;  5GLB A;  1W8Y A;  1Z6F A;  1ACF A;  2JC7 A;  2JE5 A;  3CG5 A;  3ULF A;  4CJN A;  5GHX A;  2WAD A;  4OOL A;  1K25 A;  5CHM A;  2XRN A;  3OC2 A;  3N7W A;  4BMW A;  4JF5 A;  3MR0 A;  3W4O A;  4RVA A;  5MC7 A;  3A3I A;  3M6H A;  4II7 A;  2LB5 A;  2W1T A;  3BFE A;  4MBF A;  3VOY A;  4PM8 A;  4X55 A;  1JNU A;  2EFU A;  2V2F F;  1LI0 A;  4KZ3 A;  1H0M A;  3C4P A;  2PBY A;  2WZX A;  2ZM8 A;  4R4S A;  2PU2 A;  1ESI A;  4IUH A;  2Y2N A;  2Y8H A;  1TEM A;  1XFN A;  1ZG4 A;  3NHQ A;  1ES5 A;  3SH7 A;  5L09 A;  3L9K A;  2ZC6 B;  2YKF A;  1J9M A;  5FAO A;  4LCL A;  1OTD A;  2ZQA A;  1IKI A;  1HTZ A;  4OOY A;  4Y0U A;  4FCF A;  4KZ6 A;  1QMF A;  1SZV A;  2VKS A;  1KDS A;  2QJ7 A;  2D02 A;  3CUE C;  4LEN A;  4OLG A;  5HWT A;  3FG8 A;  3UDX A;  5E2H A;  1NLY A;  1IEM A;  3IX8 A;  2Y59 A;  4GDN A;  2H28 A;  1EI5 A;  1LL5 A;  3S7P A;  5GLA A;  4Y0O A;  1PWC A;  3M2K A;  3G6O A;  4C3Q A;  4ARZ A;  2CMN A;  3FZC A;  5EEC A;  3UB9 A;  1F2K A;  4JXG A;  4L9G A;  1H8Z A;  1XFQ A;  3LEZ A;  5L2F A;  4BBV A;  3OCN A;  3I7J A;  5DJU A;  1MC0 A;  3VOZ A;  2XH9 A;  4FUW A;  3WRT A;  2H0T A;  3C4O A;  4DXB A;  3ZHH A;  2DCF A;  4KUO A;  1OT9 A;  3HLG A;  5EE8 A;  3OPH A;  2FZ0 A;  1BLP A;  2W0N A;  3T1R A;  5M19 A;  3O88 A;  5FQ9 A;  2Y2P A;  2CC1 A;  4KQO A;  4GHI B;  5K5B A;  4HH3 A;  3DAV A;  1IYP A;  3H82 A;  4BJP A;  1BT5 A;  3ZDJ A;  4HJ4 A;  4I3J A;  1KE4 A;  5J3W A;  2XGN A;  5FI6 A;  4QB8 A;  4PKY G;  3BQ8 A;  1PNE A;  2K31 A;  4WBG A;  4O8G A;  2D01 A;  1NYY A;  3F1N B;  2C5W B;  3D3O A;  3HVF A;  1D7E A;  1P97 A;  2JN7 A;  4E3I A;  5DFX A;  5FSR A;  1F9I A;  1CI9 A;  4Y0T A;  5M18 A;  1OJG A;  4Y15 A;  2JKR I;  3ZFZ A;  5CED A;  4ARZ B;  2J3T D;  3BFC A;  5A8B A;  2O9B A;  3NDE A;  1Q2Q A;  4IED A;  2VK3 A;  5KSH A;  3QP8 A;  4L9F A;  4Y2F A;  3BQA A;  3O87 A;  1XGJ A;  5EVI D;  3EQV A;  3E4Q A;  5FAS A;  3LR3 A;  1PWG A;  4YOF A;  3N8S A;  3S1Y A;  2HP9 A;  3UMD A;  3HCY A;  4DE1 A;  2HJ9 C;  1VM1 A;  4R38 A;  4HJ6 A;  2PDR A;  3O86 A;  4DRT A;  4E3N A;  2Z2M B;  3G34 A;  3MFD A;  3DTM A;  3W2Z A;  4I5S A;  4DXC A;  2OOL A;  4Q0I A;  3UDI A;  5EV0 A;  2H5S A;  2V0U A;  1BUE A;  4E3O A;  3MQQ A;  4LFU A;  1JWZ A;  3EEA A;  4LV2 A;  2XA7 S;  4HH2 A;  4HY8 A;  4WLA A;  3VFH A;  4BL3 A;  4LRY C;  2ZQD A;  4ZRR A;  5DKK A;  3S4X A;  3A3J A;  4CLC E;  1ZTU A;  3TE8 A;  3UDF A;  1SKO B;  4KQR A;  1FQG A;  4HQA A;  4L9E A;  2BTF P;  2WGW B;  2P9V B;  2VGL S;  4KZ8 A;  3T4J A;  2W3D A;  3WRZ A;  5DJT A;  2VV7 A;  3IBJ A;  1DJB A;  5FQI A;  4AFI A;  2W3H A;  3LGO A;  3V3R A;  4E04 A;  3UE3 A;  2WKQ A;  3K3D A;  4EW7 A;  3BRM A;  3UE6 A;  3T4T A;  1XJ4 A;  1BUL A;  1Y28 A;  2V8F A;  1TS0 A;  1MKM A;  5EVL A;  2VZW A;  5JYP A;  3ZGA B;  2M1C A;  5E2E A;  4OLD A;  3SS3 A;  4WUJ A;  3LY3 A;  3E0Y A;  4OON A;  4DN0 A;  3G4P A;  3OLO A;  4WEJ A;  3NOT C;  3CPT B;  4JGR A;  3UE0 A;  4GS9 A;  2Q9N A;  3PBQ A;  1S66 L;  3BM6 A;  3CMZ A;  1GHI A;  1AXB A;  2Z6C A;  1MZU A;  3BW6 A;  1HZO A;  1MBL A;  3VE4 A;  2O0Y A;  1CEF A;  3UB6 A;  3VP4 A;  3NJA A;  3W4Q A;  2AVX A;  3WWX A;  1ERQ A;  4KUK A;  3ZG5 A;  1IYO A;  3JYI A;  2PD7 A;  4PM7 A;  3S7N A;  2PT7 A;  3F1P B;  3FPW A;  1OTI A;  5E2G A;  1XJ6 A;  4EBL A;  1K54 A;  1V9Z A;  2QHK A;  5HL6 A;  2WK0 A;  5DF7 A;  2P7J A;  2NUT C;  4WYY A;  4JGO A;  3D4F A;  1EW0 A;  5CGS A;  2YKH A;  1W63 M;  4OP8 A;  3RH8 B;  3BFF A;  2VEA A;  3MZD A;  4HEF A;  3T4Q A;  1GCE A;  3VOL A;  2HPB A;  2WYX A;  1H8Y A;  4PM5 A;  4MEZ A;  2WKP A;  4Y5F A;  4N1H A;  1PWD A;  3HLD A;  3U2A A;  3DTK A;  4FD8 A;  3IH8 A;  1IFQ A;  2B18 A;  4P6Z M;  2ZMA A;  4RX2 A;  3M6B A;  2PBD P;  4QU3 A;  2ACG A;  5GHY A;  4U0X A;  3RFB A;  1FIK A;  2J8Y A;  2P04 A;  1O7E A;  3S22 A;  2H0Y A;  1Z09 A;  1JTG A;  5U47 A;  1ALQ A;  4HP9 A;  4OP5 A;  4HIA A;  4N1X A;  4RA7 A;  2GZA A;  4NG2 A;  4UAA A;  3CIT A;  1ESU A;  2Y2M A;  3LFV A;  2B5R A;  4X25 A;  3IF6 C;  4WL9 A;  5A93 A;  3SS4 A;  3KYZ A;  4WN5 A;  1ZG6 A;  4ME4 A;  4OH0 A;  3LR5 A;  3IS2 B;  4GB7 A;  1PIO A;  1UGU A;  2OWJ A;  3PAG A;  5G4Z A;  1PRQ A;  1LSX A;  1ERM A;  3PYP A;  4GD6 A;  4CLC D;  2ZC7 A;  4HI4 A;  1PZP A;  1MWT A;  2FH5 A;  1MWU A;  4OQ0 A;  1A0K A;  1FIL A;  3QNB A;  3EQU A;  2VV8 A;  3PHY A;  3M2J A;  2GDN A;  4NKP A;  5G4Y A;  2WKI A;  2L0W A;  1T1A A;  2PR5 A;  3GR2 A;  3IWO A;  2WKE A;  3C7V A;  1TS6 A;  2FFY A;  1S4S A;  3BFG A;  3LIE A;  1XPB A;  5EPH A;  1S1Y A;  3LYX A;  3Q7V B;  3F1O B;  3W4P A;  2OLU A;  2Y2Q A;  4EWF A;  1VEU A;  3MQ0 A;  2Z2L B;  4G3V A;  3CI6 A;  5DF9 A;  2E8J A;  3IX4 A;  5D3O A;  1NXY A;  2W27 A;  3HUO A;  4K08 A;  2R78 A;  3HJK A;  5HD3 A;  1JWP A;  1YPR A;  4RX3 A;  3KX0 X;  1DJA A;  5CRF A;  3JPU A;  4YNR A;  3MZE A;  2Y4A A;  1NZO A;  1YQS A;  2I9V A;  2Y2G A;  1E25 A;  5CX7 A;  5F1F A;  3NOU C;  2EX9 A;  2ZQ8 A;  3H7W B;  1N9L A;  4MLL A;  3FPV A;  3VP2 A;  5I94 A;  3IWI A;  1T18 A;  3SZT A;  3VMA A;  1YM1 A;  2XRO A;  2ZC5 B;  1WE4 A;  4GDB A;  5FQJ A;  1YAX A;  3B47 A;  4ETZ A;  4WMC A;  3KO6 A;  2X01 A;  4D2O A;  3G31 A;  1K4F A;  4DE3 A;  2DNS A;  1NY0 A;  2IA2 A;  2IWD A;  3GV9 A;  3PBO A;  1KDW A;  3BY9 A;  1DP9 A;  3U4L P;  1H8M A;  3BLM A;  3LIB A;  3SH9 A;  3LY4 A;  4E6X A;  5EVI B;  1F5M A;  2HZ5 A;  3RXX A;  5DTK A;  4JLF A;  3VSL A;  2XDM A;  1K57 A;  2V1A A;  3MKE A;  3KYE A;  4R3B A;  1IOU A;  3VP1 A;  4S2O A;  1CJF A;  4DMZ A;  4JF4 A;  2Y55 A;  1XGI A;  3LI8 A;  2ZQ7 A;  5G18 A;  4NK3 A;  2M7V A;  1KGF A;  2JHE A;  3LIA A;  3NIA A;  1GA9 A;  5FQM A;  3SW1 A;  3UB8 A;  2XFT A;  3OBF A;  1ODV A;  5J8X A;  2QJ5 A;  5HL1 A;  2V8C A;  1K4E A;  5M1A A;  3UY6 A;  4R70 A;  2VLG A;  1NYM A;  5TBM B;  3A0S A;  5F83 A;  4G3W A;  3TG9 A;  1YKD A;  2EX6 A;  2M7U A;  4U0T A;  2O9A A;  4Y3I A;  4PM6 A;  4LPZ A;  4JKT A;  1E3U D;  4Y7P A;  4IUK A;  1DP8 A;  2A49 A;  4WZ5 C;  4S2M A;  5E2F A;  5IU1 A;  2HJE A;  1ZKJ A;  3W8K A;  3BFD A;  1PFL A;  1VB6 A;  3A3E A;  2JCH A;  5DFY A;  5GLC A;  3HLF A;  2W1T B;  4XUX A;  4BQM A;  5EVE A;  4JGP A;  2EXA A;  2K7S A;  2DRW A;  1XA7 A;  3TOI A;  1M6K A;  1GA0 A;  5HSQ A;  3ITB A;  4EU0 A;  1BZA A;  4OOM A;  4QY5 A;  1EWZ A;  3ZVW A;  1K55 C;  2VJW A;  1PZO A;  3CWF A;  2ZC4 B;  4KZ7 A;  1TS7 A;  2BAS A;  3QNC A;  3PTE A;  4XT2 A;  4LV0 A;  1BLH A;  1TD5 A;  4EXO A;  1QME A;  3O5Y A;  2A3U A;  5FAT A;  4HP4 A;  2W3G A;  2R9X A;  3P01 A;  2ZOH A;  4XUZ A;  3K3C A;  4MN6 A;  5HWV A;  3R7W A;  3GRJ A;  4GLQ A;  3N8L A;  1RGY A;  3V39 A;  4GNU A;  3BEC A;  5AQA A;  5AVE A;  4F3L A;  3QHY A;  4MN5 A;  2JKF A;  4XXR A;  4LRX C;  2QYB A;  3PR6 A;  3ZG8 B;  5FEF A;  3ZNY A;  3QP2 A;  3C7U A;  3HLB A;  5TR7 A;  4LCM A;  2J9O A;  5CTM A;  1LSV A;  3T4L A;  3UB7 A;  1K6R A;  4S2I A;  4EEP A;  4FH4 A;  4S2N C;  3SOI A;  3T12 B;  3L7H A;  5IS1 A;  3HL9 A;  5HFO A;  1SDN A;  2V0W A;  4Q0H A;  1L0G A;  4FTX A;  4KZ5 A;  4HOI A;  1LSW A;  1ZHH B;  5KIZ A;  3A0R A;  3ICY A;  1LT0 A;  4DE2 A;  4H6J A;  4CLC A;  2Y2H A;  2ZC3 B;  5HD5 A;  4P6B A;  3PBS A;  4UQI S;  1W8Q A;  1FSW A;  4P0M A;  4JBF A;  1G5U A;  3EGX C;  4X68 A;  3EOI A;  3H82 B;  3BWL A;  2XSS A;  2HDR A;  2INW A;  5CEC A;  1OT6 A;  4HES A;  4H8R A;  1PW1 A;  2KX6 A;  4B93 A;  3E2K A;  4E3K A;  4R0Q A;  1XA1 A;  4GZB A;  2XR0 A;  3PBR A;  4G3K A;  4Q0J A;  3E98 A;  3CZD A;  4DJ2 A;  1FSY A;  2L4R A;  1RP5 A;  4KG6 A;  2RCX A;  4WMC D;  3OPP A;  3TRC A;  2Z6D A;  2VX8 A;  2ZOI A;  4OVD A;  3OPL A;  3LIC A;  1L3L A;  4KG5 A;  4DDS A;  4BEN A;  3MBZ A;  1KE0 A;  1PYY A;  4R23 A;  2Q0O A;  3IBR A;  3UNW A;  4H6J B;  3G35 A;  2ZD8 A;  2PU4 A;  3CUE A;  4CLC B;  3ZG7 B;  2WGI A;  3KYQ A;  1NLZ A;  1JTD A;  4O0P A;  3MSH A;  1VET A;  4I38 A;  1G6A A;  1CK3 A;  5LBR A;  5EVI C;  5TGF A;  1NJ4 A;  2ZJ9 A;  2NUP C;  5TJJ A;  4MBH A;  5DTS A;  3IXG A;  4DJ3 A;  2A24 A;  3PBT A;  3G30 A;  4X69 A;  1ES2 A;  3KSH A;  4YIN A;  4OQH A;  3R4K A;  2OWH A;  2HGV A;  1N4O A;  4LGW A;  3C5A A;  3ZVT A;  5AQ9 A;  3VP3 A;  1MWR A;  5GL9 A;  4EUV A;  4NET A;  4ID4 A;  4NXE A;  2ZQC A;  1GSW A;  1H3Q A;  1H5X A;  2ZL1 A;  2WUQ A;  5IHV A;  4O01 A;  3AGF A;  4DE0 A;  4RYE A;  4QY6 A;  3BLS A;  3UPO A;  2EFX A;  2XQZ A;  1Q2P A;  3A0V A;  4HHD A;  2PHY A;  1OME A;  1E4D A;  3WS0 A;  4OQI A;  2EA9 A;  5CEB A;  1E3U A;  1ERO A;  4OKP A;  5AJG A;  4NXG A;  4GW9 A;  3MZF A;  1S1Z A;  2ZMV A;  1RCJ A;  2HV1 A;  2XEP A;  2JKR M;  3EWK A;  1S6R A;  1DP6 A;  4WM9 A;  5DKL A;  4WF0 A;  3AGD A;  2XD5 A;  1ONH A;  3B3X A;  1YMS A;  3BJN A;  4GS9 B;  5EM0 A;  1CEG A;  2G2W A;  3LR4 A;  4KZA A;  4EQ1 A;  2R9W A;  4JXV A;  5EOE A;  3ZG9 B;  4KZ4 A;  4DKI A;  1X0O A;  2G7U A;  3Q1F A;  4JPM A;  2JKG A;  2PRF A;  2ZM2 A;  3KSG A;  4LLO B;  3GEC A;  5EOO A;  3OPR A;  3S7O A;  3VV4 A;  1JWV A;  2HDU A;  1N9B A;  3GVB A;  1ES3 A;  3UB5 P;  4QPR A;  1S4R A;  1MWS A;  4K91 A;  5FAP A;  1VQQ A;  4DDY A;  4EQI A;  5CGW A;  3C8C A;  5L10 A;  1W5D A;  2ZQ9 A;  5C5K A;  4EER A;  3BY8 A;  1RGZ A;  1P9W A;  3V50 A;  2VA0 A;  4OPR A;  1NRJ A;  4GD8 A;  3T50 A;  4KQQ A;  4S2L A;  2KDK A;  4ZJ2 A;  1Y54 A;  3G2Z A;  2ZM0 A;  2XFS A;  3IWQ A;  3B33 A;  5F1G A;  5GHZ A;  4MN7 A;  2WAF A;  4R3J A;  3P09 A;  3LR0 A;  1DJC A;  1LI9 A;  3IF5 A;  3UN7 A;  5F6A A;  3Q07 A;  3FKW A;  1XXM A;  1HD8 A;  3N4I A;  3T4O A;  5F82 A;  3NC8 A;  3MFX A;  3NCK A;  5F68 A;  4R3A A;  4YFM A;  3OCL A;  5FI7 A;  4Y13 A;  4PM9 A;  4QWO A;  4PPR A;  3IXB A;  3UPP A;  1GSV A;  3N8R A;  5HX9 A;  3UE1 A;  3FV7 A;  2HF6 A;  4R4R A;  4UA9 A;  4S2P A;  1NWZ A;  1FCO A;  2O9C A;  5HAI A;  4OPQ A;  2ZLY A;  1I2S A;  2JBF A;  4RQ9 A;  1OTE A;  1IYS A;  1L0E A;  4I3I A;  2W3F A;  2KOI A;  3JVU A;  3MXR A;  2XLN A;  5TFQ A;  3EGD C;  2J80 A;  2V9A A;  3MXS A;  4N9L A;  1T1C A;  1TDG A;  2Q9M A;  5HPI A;  4NXB A;  4GN2 A;  4EV4 A;  1P0Z A;  4UA6 A;  1XJ2 A;  2J3W A;  5HW3 A;  5HWW A;  4ZBE A;  1MPL A;  1FR1 A;  3FYZ A;  4UA7 A;  1VEU B;  4B4X A;  2OLV A;  2V1B A;  3IXH A;  3HUN A;  5KZH A;  1M40 A;  3GTC A;  5F69 A;  3WS5 A;  3C30 A;  4IVK A;  3ITA A;  2O99 A;  3RTY A;  1KVL A;  2J9P A;  5CXW A;  5JYO A;  4FH2 A;  1YLT A;  3VSK A;  3TW8 A;  2ZBB A;  1OJ5 A;  4MMN A;  5HAP A;  1CF0 A;  4M3K A;  1NRF A;  2L1M A;  4R1G A;  3D72 A;  4EET B;  4EBP A;  2PYR A;  2V20 A;  2VGK A;  2B02 A;  2EWW A;  4GHI A;  3WS1 A;  4UQI M;  1YLZ A;  1CI8 A;  2JKT I;  4JGQ A;  3G32 A;  2BLS A;  4PMA A;  1J3W A;  1G68 A;  2UV0 E;  2Y91 A;  1S67 L;  4GOG A;  3K2N A;  4GJ4 A;  2OAQ 1;  2K2N A;  1N9N A;  2OSU A;  3IF6 A;  2XD1 A;  2GX5 A;  3TJZ C;  5HPF A;  1KVM A;  1DY6 A;  5L07 A;  3F1N A;  4ZDX A;  4BWI A;  5FDS A;  3TSG A;  2XA7 M;  1L2S A;  2DMW A;  3VFF A;  5A92 A;  1FCM A;  3DWK A;  2ZMF A;  1PW8 A;  3GQZ A;  1W63 Q;  1YLJ A;  4N9K A;  1KOU A;  2HP5 A;  2OAP 1;  4NXF A;  4P87 A;  3WS2 A;  4QJG A;  5FQQ A;  3T1Q B;  2VGL M;  3FC7 A;  1YT4 A;  3LCE A;  5CHJ A;  1K56 D;  2QMI A;  4E6W A;  4KG2 A;  1BYW A;  2QWS A;  2MJ6 A;  1YLY A;  3ZG0 A;  1CQA A;  3ISG A;  3MQO A;  1JVJ A;  4BLM A;  3PXP A;  1AWI A;  1IYQ A;  4PHT A;  4E3L A;  3IH9 A;  4OQG A;  3GDI A;  4EEU A;  2PD8 A;  3G2Y A;  2QZ6 A;  3E2L A;  1HLU P;  4F94 A;  2FFF B;  2WGV A;  2XF3 A;  1K54 C;  1YLW A;  3IF6 B;  4MNR A;  4QD4 A;  5CTN A;  1NZU A;  2B95 A;  4HJ3 A;  5E43 A;  1XKZ A;  1W79 A;  4LV3 A;  2QPN A;  4MDZ A;  3LIF A;  5HAR A;  1V9Y A;  2HDS A;  1O07 A;  2RL3 A;  3O3V A;  3ZNT A;  3P7N A;  3T1S A;  3HLW A;  4JF6 A;  5DF8 A;  1SKO A;  3E4P A;  1T1B A;  1STZ A;  1FR6 A;  2WGW A;  4Q8I A;  2P9V A;  1G6O A;  3ZCZ A;  4PKY A;  3V67 A;  4XT2 B;  5EUA A;  3VP0 A;  3RJU A;  3LI9 A;  3NOP C;  2VV6 A;  4N92 A;  5J7E A;  4BD0 A;  3T4S A;  2IWC A;  3MF0 A;  4HBT A;  3KSI A;  2X71 A;  4CPK A;  4GCZ A;  3R7W B;  4U3T A;  3DWZ A;  1TS8 A;  5FDH A;  4C75 A;  3UPN A;  4F3L B;  1FOF A;  2IWB A;  3T1X A;  4KZB A;  5IT5 A;  1HVB A;  4K0W A;  3IX3 A;  5BOH A;  3UME A;  1L0F A;  5EM1 A;  1LLB A;  1TDL A;  2GJ3 A;  1N9O A;  3CPT A;  5A90 A;  4E3J A;  4ZTK A;  2WKR A;  1WA9 A;  2HP6 A;  4ZJ1 A;  2WKH A;  4E3M A;  4EES A;  4UHU A;  2PAV P;  3HLC A;  4HNB A;  1SCW A;  2J3T C;  3SH8 A;  3ZYT A;  3HUM A;  1TF1 A;  3BYD A;  1GHP A;  3LEQ A;  5FA7 A;  3A3D A;  1OTA A;  4YWZ A;  5FI2 A;  3IHB A;  2WAE A;  1K38 A;  2Y2K A;  3F1P A;  4B9O A;  3MS6 A;  1YSQ A;  4CQH A;  4KQD A;  2EXB A;  2JKT M;  4Z1W A;  4JXW A;  1K0K A;  4WZ5 A;  2EWV A;  3MKF A;  5AVF A;  1ZC2 A;  2X02 A;  5HDD A;  4JXS A;  3E4O A;  4X1L A;  3UO9 A;  4I3A A;  4X56 A;  4BBT A;  3Q7Z A;  4DF6 A;  3HRE A;  3JVV A;  3OOV A;  4S2K A;  4B4Z A;  1SKF A;  3CJM A;  4B88 A;  3C2W A;  3FWL A;  5I5L A;  1C3B A;  1K55 A;  4A5R A;  4EUZ A;  3IXD A;  4L0L A;  4R6L A;  1OTB A;  2UWX A;  1KGE A;  4K0X A;  4GKU A;  4MBK A;  2Y79 A;  4IBX A;  1TVF A;  4D60 A;  3LID A;  3MXQ A;  1FCN A;  3OZH A;  4MCW A;  1Y4O A;  1W7F A;  4I39 A;  3QP1 A;  3N6I A;  1F98 A;  5DTT A;  1I2W A;  3NBL A;  4WZ4 A;  1BTL A;  1K6S A;  1VET B;  5FQK A;  3V5M A;  3DTE A;  2Y2J A;  3NDG A;  2G2U A;  3IS2 A;  5FAQ A;  1OPX A;  3SS5 A;  3IT9 A;  4OPY A;  1IKG A;  3D9Y A;  1YLP A;  1MKI A;  2A24 B;  1GSX A;  1K57 C;  1BLS A;  3T4K A;  4S2N A;  2HDQ A;  3NEC A;  4LRZ E;  1D1J A;  3H9W A;  5CER A;  4P85 A;  2PYP A;  3Q82 A;  3MMH A;  1P9R A;  3LUQ A;  4ZJ3 A;  4X53 A;  1D06 A;  1BLC A;  4WEL A;  5HDS A;  4ESP A;  5CGX A;  4M4X A;  2GNX A;  1VHM A;  5AQB A;  2ZL1 B;  4HBU A;  3Q7V A;  3F1O A;  1K56 A;  1ONG A;  1KE3 A;  3A3F A;  3CHW P;  5A91 A;  3GSG A;  2P74 A;  4EBN A;  3QP6 A;  3PAE A;  2H10 A;  1GHM A;  4O7D A;  2XK1 A;  3FKV A;  3DBA A;  2A2L A;  5HZH A;  5DVA A;  1MXO A;  3Q81 A;  5FL3 A;  3RXW A;  4IJG A;  1SDE A;  1ES4 A;  5GLD A;  1XX2 A;  3H7W A;  4BBU A;  1I5Q A;  3IHA A;  1LL8 A;  4ZAM A;  1XJ3 A;  3IQA A;  2PR6 A;  4OPZ A;  1PI4 A;  3BEB A;  3LO7 A;  3HJI A;  2E8I A;  1T19 A;  3KSF A;  2Y2L A;  2EX2 A;  3NY4 A;  2I72 A;  3VE3 A;  1UWN X;  2Y2O A;  5HDC A;  3P98 A;  4KEN B;  1KGG A;  5F5Y A;  2BG1 A;  1U60 A;  4LV1 A;  4PAU A;  1MY8 A;  5J4E A;  3DTI A;  4WEK A;  3CAX A;  3MJQ A;  5EVI A;  2C6W B;  3PBN A;  2W1R A;  3C38 A;  1YMX A;  1WYC A;  2KLI A;  1IEL A;  2EX8 A;  2LB9 A;  3DW0 A;  2OV5 A;  5FEG A;  4KZ9 A;  3WS4 A;  4X6T A;  5KSC A;  3NUL A;  1S0W A;  4FOF A;  1XP4 A;  2V1Z A;  5EFW A;  1LL9 A;  4ETX A;  3S7Q A;  5AQ7 A;  1G28 A;  2QKP A;  3CLO A;  5L8M A;  1SHV A;  2WZZ A;  5HAQ A;  1UWP X;  3ZQ5 A;  4C6Y A;  4BD1 A;  4QHC A;  4Z9Q A;  1BSG A;  4UEY A; 
#chains in the Genus database with same CATH homology
 1PW8 A;  3HBR A;  3GQZ A;  3HLE A;  4OVD A;  1YLJ A;  4N9K A;  2J7V A;  2HP5 A;  3AGE A;  4N1H A;  1PWD A;  4P87 A;  3HLD A;  3WS2 A;  4QJG A;  3OPL A;  4FD8 A;  3IH8 A;  5FQQ A;  1LHY A;  4KG5 A;  4IBR A;  1YT4 A;  4FSF A;  1L0D A;  1PI5 A;  2ZMA A;  3LCE A;  5CHJ A;  4BEN A;  4DDS A;  2VGJ A;  1K56 D;  2Y2I A;  4BL2 A;  2QMI A;  4E6W A;  4RX2 A;  3M6B A;  4KG2 A;  3MBZ A;  3GMW A;  3V3S A;  1KE0 A;  1WYB A;  4QU3 A;  1PYY A;  5KMW A;  3NI9 A;  4IVI A;  4R23 A;  5GHY A;  3UNW A;  4S2J A;  4U0X A;  1YLY A;  3G35 A;  2ZD8 A;  2PU4 A;  2J8Y A;  3ZG0 A;  3ZG7 B;  3ISG A;  1O7E A;  1JVJ A;  2WGI A;  4BLM A;  3S22 A;  5CHU A;  1FCM A;  3DWK A;  1IYQ A;  2H0Y A;  4E3L A;  1JTG A;  3IH9 A;  1JTD A;  4OQG A;  5GLB A;  1W8Y A;  1Z6F A;  3G2Y A;  5U47 A;  1ALQ A;  2JC7 A;  2QZ6 A;  2JE5 A;  3CG5 A;  3E2L A;  4OP5 A;  1G6A A;  4N1X A;  4CJN A;  4RA7 A;  5GHX A;  4F94 A;  2FFF B;  2WAD A;  4OOL A;  1CK3 A;  2WGV A;  4UAA A;  2XF3 A;  1K54 C;  1K25 A;  5CHM A;  1ESU A;  2Y2M A;  3OC2 A;  3N7W A;  5EVI C;  2B5R A;  1NJ4 A;  4JF5 A;  5TGF A;  2ZJ9 A;  3IF6 C;  4RVA A;  3W4O A;  5A93 A;  3A3I A;  3M6H A;  3SS4 A;  1YLW A;  4MBH A;  5DTS A;  3IXG A;  3IF6 B;  1ZG6 A;  4MNR A;  4OH0 A;  4QD4 A;  5CTN A;  1NZU A;  3PBT A;  3G30 A;  4GB7 A;  4PM5 A;  4X69 A;  3BFE A;  4MBF A;  3VOY A;  1PIO A;  1ES2 A;  1XKZ A;  5E43 A;  1W79 A;  3PAG A;  4LV3 A;  4PM8 A;  4X55 A;  2QPN A;  2EFU A;  2V2F F;  1LI0 A;  4YIN A;  4KZ3 A;  3C4P A;  2PBY A;  2WZX A;  4OQH A;  2ZM8 A;  4R4S A;  1ERM A;  4GD6 A;  5HAR A;  1N4O A;  2ZC7 A;  2PU2 A;  1PZP A;  1ESI A;  1MWT A;  2HDS A;  3C5A A;  5AQ9 A;  3ZVT A;  1MWU A;  1O07 A;  2Y2N A;  4OQ0 A;  3VP3 A;  1TEM A;  3QNB A;  2RL3 A;  3O3V A;  1ZG4 A;  3EQU A;  3ZNT A;  1ES5 A;  3HLW A;  4JF6 A;  5DF8 A;  3SH7 A;  1MWR A;  5GL9 A;  3M2J A;  4NET A;  1FR6 A;  2ZC6 B;  2GDN A;  4ID4 A;  2WGW A;  4Q8I A;  2P9V A;  1J9M A;  2ZQC A;  4LCL A;  5FAO A;  3ZCZ A;  2WKI A;  3GR2 A;  3IWO A;  1H5X A;  2ZQA A;  1IKI A;  2WKE A;  1HTZ A;  3C7V A;  4OOY A;  4Y0U A;  2WUQ A;  4FCF A;  4KZ6 A;  5EUA A;  5IHV A;  3VP0 A;  1QMF A;  3RJU A;  3AGF A;  2FFY A;  3BFG A;  4DE0 A;  1XPB A;  1KDS A;  4N92 A;  4RYE A;  5EPH A;  4QY6 A;  3BLS A;  3Q7V B;  4BD0 A;  3UPO A;  2IWC A;  2EFX A;  3W4P A;  2XQZ A;  4LEN A;  2OLU A;  4OLG A;  2Y2Q A;  4HBT A;  1Q2P A;  4EWF A;  2X71 A;  4CPK A;  3UDX A;  5E2H A;  2Z2L B;  1IEM A;  1OME A;  1E4D A;  2Y59 A;  4U3T A;  3DWZ A;  5DF9 A;  3WS0 A;  4GDN A;  5D3O A;  5FDH A;  4C75 A;  1NXY A;  3HUO A;  4OQI A;  1EI5 A;  3UPN A;  1LL5 A;  5CEB A;  1E3U A;  1FOF A;  2IWB A;  5GLA A;  4Y0O A;  1JWP A;  1ERO A;  1PWC A;  4KZB A;  4OKP A;  4RX3 A;  3M2K A;  1HVB A;  4C3Q A;  1DJA A;  3FZC A;  3MZF A;  4K0W A;  5CRF A;  5BOH A;  1L0F A;  5EEC A;  1LLB A;  1TDL A;  1RCJ A;  3MZE A;  2Y4A A;  1NZO A;  1YQS A;  2Y2G A;  1E25 A;  5F1F A;  4JXG A;  2XEP A;  5A90 A;  4E3J A;  4ZTK A;  1S6R A;  2EX9 A;  1H8Z A;  2HP6 A;  2ZQ8 A;  4WM9 A;  4ZJ1 A;  2WKH A;  4E3M A;  3LEZ A;  3AGD A;  4UHU A;  5L2F A;  4MLL A;  2XD5 A;  1ONH A;  3OCN A;  3B3X A;  1YMS A;  3I7J A;  3VP2 A;  5I94 A;  3IWI A;  3VMA A;  1CEG A;  3HLC A;  1YM1 A;  3VOZ A;  2G2W A;  2XH9 A;  3WRT A;  2H0T A;  3C4O A;  4KZA A;  2ZC5 B;  4DXB A;  3ZHH A;  1WE4 A;  4GDB A;  2DCF A;  5FQJ A;  2R9W A;  4JXV A;  1SCW A;  3SH8 A;  3HLG A;  5EOE A;  3HUM A;  5EE8 A;  3ZG9 B;  3OPH A;  4KZ4 A;  4WMC A;  4DKI A;  3BYD A;  1BLP A;  2X01 A;  1GHP A;  5FA7 A;  3Q1F A;  3A3D A;  4JPM A;  5FI2 A;  5M19 A;  2ZM2 A;  3O88 A;  3IHB A;  5FQ9 A;  2Y2P A;  4D2O A;  3G31 A;  2WAE A;  2CC1 A;  4KQO A;  1K38 A;  2Y2K A;  1K4F A;  5EOO A;  3OPR A;  4DE3 A;  2DNS A;  1NY0 A;  1IYP A;  2IWD A;  3GV9 A;  3PBO A;  4BJP A;  1KDW A;  1JWV A;  1BT5 A;  3ZDJ A;  2HDU A;  1N9B A;  2EXB A;  3BLM A;  4JXW A;  3GVB A;  1ES3 A;  4WZ5 A;  3SH9 A;  3LY4 A;  4E6X A;  1KE4 A;  2XGN A;  5FI6 A;  3MKF A;  5EVI B;  1ZC2 A;  4QB8 A;  2X02 A;  4WBG A;  1MWS A;  4K91 A;  5FAP A;  3RXX A;  5DTK A;  1VQQ A;  4JXS A;  1NYY A;  4JLF A;  2C5W B;  3VSL A;  4DDY A;  4EQI A;  5CGW A;  3HVF A;  2XDM A;  1K57 A;  3UO9 A;  4X56 A;  4E3I A;  3MKE A;  3Q7Z A;  4DF6 A;  1W5D A;  5FSR A;  2ZQ9 A;  3HRE A;  4R3B A;  1CI9 A;  4Y0T A;  5M18 A;  3VP1 A;  3ZFZ A;  4S2O A;  5CED A;  4S2K A;  4B4Z A;  3BFC A;  1SKF A;  1RGZ A;  3CJM A;  3NDE A;  2Y55 A;  1XGI A;  4JF4 A;  2ZQ7 A;  1Q2Q A;  4B88 A;  5G18 A;  4NK3 A;  3V50 A;  3FWL A;  4OPR A;  1C3B A;  1KGF A;  4IED A;  1K55 A;  4GD8 A;  5KSH A;  4A5R A;  4EUZ A;  3IXD A;  3NIA A;  4KQQ A;  4L0L A;  4S2L A;  1GA9 A;  5FQM A;  2XFT A;  4ZJ2 A;  1Y54 A;  3G2Z A;  2UWX A;  1KGE A;  5J8X A;  2ZM0 A;  2XFS A;  3O87 A;  4K0X A;  4GKU A;  5HL1 A;  1XGJ A;  3IWQ A;  1K4E A;  4MBK A;  5F1G A;  4IBX A;  5M1A A;  1TVF A;  5EVI D;  3EQV A;  5GHZ A;  3UY6 A;  5FAS A;  2WAF A;  4R3J A;  3P09 A;  1PWG A;  1FCN A;  3OZH A;  1DJC A;  3N8S A;  1NYM A;  3S1Y A;  1LI9 A;  3IF5 A;  2HP9 A;  3UN7 A;  3Q07 A;  3FKW A;  5F83 A;  3TG9 A;  1W7F A;  1XXM A;  2EX6 A;  4U0T A;  4DE1 A;  1HD8 A;  4PM6 A;  3N4I A;  1VM1 A;  3N6I A;  4JKT A;  1E3U D;  5DTT A;  1I2W A;  3NBL A;  4WZ4 A;  4Y7P A;  5F82 A;  1BTL A;  1K6S A;  5FQK A;  3NC8 A;  2A49 A;  3V5M A;  4WZ5 C;  3NCK A;  4S2M A;  5E2F A;  3O86 A;  2Y2J A;  4DRT A;  1ZKJ A;  4YFM A;  3OCL A;  3NDG A;  2G2U A;  2Z2M B;  3G34 A;  3MFD A;  3DTM A;  3W8K A;  4E3N A;  5FI7 A;  4DXC A;  4PM9 A;  3UDI A;  4PPR A;  5FAQ A;  3BFD A;  3IXB A;  3IT9 A;  3SS5 A;  4OPY A;  1IKG A;  3UPP A;  3N8R A;  5HX9 A;  3A3E A;  2JCH A;  2H5S A;  5GLC A;  3UE1 A;  1YLP A;  3FV7 A;  3HLF A;  4R4R A;  1MKI A;  1K57 C;  1BUE A;  4UA9 A;  4XUX A;  4BQM A;  1BLS A;  4E3O A;  4S2P A;  4S2N A;  1FCO A;  2EXA A;  2HDQ A;  5HAI A;  4OPQ A;  2DRW A;  1JWZ A;  2ZLY A;  1XA7 A;  1I2S A;  4LV2 A;  3TOI A;  1M6K A;  2JBF A;  5CER A;  4P85 A;  1GA0 A;  3VFH A;  3Q82 A;  1IYS A;  3ITB A;  4BL3 A;  1L0E A;  1BZA A;  2ZQD A;  4WMC D;  4OOM A;  3S4X A;  4QY5 A;  4ZJ3 A;  4X53 A;  3A3J A;  1EWZ A;  1BLC A;  4WEL A;  3ZVW A;  1K55 C;  1PZO A;  5CGX A;  2ZC4 B;  3MXR A;  4KZ7 A;  3UDF A;  2XLN A;  4KQR A;  3QNC A;  1FQG A;  3PTE A;  5TFQ A;  3MXS A;  4N9L A;  2WGW B;  2P9V B;  4KZ8 A;  5AQB A;  1TDG A;  2Q9M A;  4LV0 A;  1BLH A;  1QME A;  4GN2 A;  4HBU A;  5FAT A;  2A3U A;  3WRZ A;  4EV4 A;  3Q7V A;  1K56 A;  1ONG A;  1DJB A;  2R9X A;  1KE3 A;  4UA6 A;  5FQI A;  4XUZ A;  5HW3 A;  3A3F A;  4ZBE A;  1MPL A;  1FR1 A;  5A91 A;  3V3R A;  3FYZ A;  3GSG A;  2P74 A;  3GRJ A;  3N8L A;  3UE3 A;  1RGY A;  4EBN A;  4UA7 A;  3V39 A;  4GNU A;  4B4X A;  2OLV A;  3BEC A;  5AQA A;  3PAE A;  2H10 A;  3IXH A;  3HUN A;  1GHM A;  4O7D A;  5KZH A;  3BRM A;  2XK1 A;  1M40 A;  3GTC A;  3FKV A;  3QHY A;  3WS5 A;  4IVK A;  3ITA A;  1BUL A;  4XXR A;  3ZG8 B;  5EVL A;  1KVL A;  3ZNY A;  5JYP A;  2J9P A;  3ZGA B;  5E2E A;  5CXW A;  4OLD A;  3SS3 A;  5JYO A;  3C7U A;  3LY3 A;  4OON A;  1MXO A;  5DVA A;  3HLB A;  3Q81 A;  4FH2 A;  3RXW A;  1SDE A;  5TR7 A;  1ES4 A;  4LCM A;  2J9O A;  5CTM A;  3G4P A;  1YLT A;  3VSK A;  1K6R A;  5GLD A;  1XX2 A;  4WEJ A;  4S2I A;  4FH4 A;  1I5Q A;  4S2N C;  3IHA A;  3UE0 A;  3SOI A;  2Q9N A;  4ZAM A;  3HL9 A;  5HFO A;  1SDN A;  3PBQ A;  1L0G A;  3IQA A;  4KZ5 A;  4OPZ A;  5HAP A;  1PI4 A;  3BM6 A;  3CMZ A;  1GHI A;  3BEB A;  1AXB A;  4M3K A;  4DE2 A;  3LO7 A;  1NRF A;  1HZO A;  2E8I A;  2Y2H A;  4R1G A;  2Y2L A;  1MBL A;  2EX2 A;  4EBP A;  2ZC3 B;  3NY4 A;  1CEF A;  3VP4 A;  3W4Q A;  2V20 A;  2VGK A;  2I72 A;  3WWX A;  1ERQ A;  3ZG5 A;  1IYO A;  2Y2O A;  4P6B A;  3WS1 A;  3JYI A;  1YLZ A;  1CI8 A;  3P98 A;  3PBS A;  4KEN B;  1KGG A;  1W8Q A;  3G32 A;  2BLS A;  4PMA A;  4PM7 A;  1FSW A;  4P0M A;  2BG1 A;  1U60 A;  1G68 A;  4JBF A;  4LV1 A;  2Y91 A;  4X68 A;  1MY8 A;  4GOG A;  5E2G A;  4EBL A;  1K54 A;  4WEK A;  2HDR A;  2OSU A;  5EVI A;  2C6W B;  2WK0 A;  2XD1 A;  3IF6 A;  3PBN A;  5DF7 A;  1KVM A;  4WYY A;  1YMX A;  1DY6 A;  1WYC A;  5CEC A;  4HES A;  3D4F A;  1IEL A;  2EX8 A;  4H8R A;  1PW1 A;  3DW0 A;  2OV5 A;  4KZ9 A;  3WS4 A;  4X6T A;  5KSC A;  5CGS A;  3E2K A;  1S0W A;  4ZDX A;  4E3K A;  1XP4 A;  4R0Q A;  2V1Z A;  1XA1 A;  4GZB A;  1LL9 A;  4OP8 A;  2XR0 A;  3PBR A;  5AQ7 A;  3BFF A;  3TSG A;  3MZD A;  4HEF A;  1L2S A;  3CZD A;  1SHV A;  2WZZ A;  1GCE A;  5HAQ A;  3VFF A;  5A92 A;  4C6Y A;  1FSY A;  2HPB A;  2WYX A;  1H8Y A;  4BD1 A;  1RP5 A;  4KG6 A;  4QHC A;  1BSG A;  2RCX A;  4Z9Q A;  3OPP A;  4MEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...