2ZQ9A

Cephalothin acyl-intermediate structure of class a beta-lactamase toho-1 e166a/r274n/r276n triple mutant
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
259
structure length
259
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase Toho-1
publication title Structural Basis of Extend Spectrum Beta-Lactamase in Correlation of Enzymatic Kinetics and Thermal Stability of Acyl-Intermediates
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 93
structure length 259
sequence length 259
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2zq9A00
3QNCA 2Q9MA 1Q2PA 3UY6A 1ES4A 3BYDA 1W5DA 4E3IA 2V2FF 1I2SA 2Y2PA 3CMZA 4JXGA 2C6WB 4L0LA 3WRZA 2XD5A 3PAGA 4BLMA 5FQIA 3BFGA 1YMSA 3G31A 3HUMA 3GTCA 3O88A 1XGIA 3G4PA 3N4IA 1TDLA 5M18A 4OP5A 4DKIA 3I7JA 1XA7A 2WKIA 1RGYA 3A3JA 4NK3A 2WYXA 4D2OA 4N9LA 4FH2A 4QY5A 4WM9A 5EVLA 2WKEA 3PTEA 3ZG0A 4BJPA 1H8YA 2ZC7A 3BFFA 2B5RA 2JE5A 3MFDA 2EX2A 1LI9A 1BZAA 1ALQA 1IELA 4X53A 3V5MA 1EROA 1JWPA 4WEKA 2XH9A 4ID4A 4ZDXA 4EQIA 3IF6C 1J9MA 1GHPA 4LENA 1NZUA 4KG2A 4BL3A 3EQUA 3P09A 4WYYA 1U60A 4Y0UA 5AQ9A 4GD8A 3C7UA 3W4PA 1K6SA 1JTGA 4JXSA 5A93A 2HDSA 1GHMA 1G68A 2ZQCA 4ZJ2A 3UPPA 1FQGA 4E3OA 5FQJA 3G34A 4KENB 3WWXA 5L2FA 2WADA 4XUXA 2ZMAA 2Y2IA 5FI7A 1ONGA 1HTZA 4ZJ3A 3FYZA 1E3UA 2HP9A 4HEFA 5EVID 5EPHA 2Y2GA 2J9PA 1XGJA 1ZKJA 2Y2KA 2CC1A 3PBRA 3GMWA 4OKPA 4B4ZA 2IWBA 4K91A 5FATA 4R3JA 3ITAA 4FCFA 4E3KA 1FCOA 1O07A 1K55A 5AQBA 1SCWA 3A3EA 1Q2QA 3VSLA 2Z2MB 2ZQ9A 3G2YA 2BLSA 5CGWA 1W8YA 3C4OA 4R23A 4OQHA 1QMEA 2V20A 3NBLA 4P87A 4U0XA 5FAQA 3HLWA 4KZ9A 3ZG9B 1IYSA 3GQZA 4ZJ1A 1L0DA 3QHYA 1W79A 4WBGA 5M1AA 4S2KA 1NY0A 4E6XA 1LHYA 3IQAA 2QZ6A 4X69A 4N1XA 5EVIC 2Y91A 4C3QA 4DE3A 3IXDA 1MWUA 4CPKA 2RL3A 4DDYA 5DF9A 2BG1A 2J8YA 1FOFA 3HUOA 5GLDA 4PMAA 4MBHA 5FA7A 2EX9A 4KZ6A 1KVMA 4PM7A 1K56A 1SDNA 3HLBA 1KE3A 2XFTA 1M6KA 5E2FA 3LO7A 2R9XA 3SS5A 4JBFA 1K57A 4B88A 5HAPA 2ZQAA 1W7FA 3GVBA 1S6RA 3MXRA 4JKTA 4JPMA 1BTLA 3LY4A 3ISGA 3WS1A 2JC7A 3HLCA 5IHVA 3FZCA 3SS3A 5CHMA 2ZM2A 4E3LA 4K0XA 3UPNA 2OLVA 4OONA 4S2JA 3BLSA 5DF7A 1Z6FA 1KGEA 5A92A 3VP0A 2HP5A 1YLJA 3UDFA 1SKFA 2DNSA 2ZJ9A 4E3MA 1PWCA 3IXGA 5F83A 3SOIA 5TGFA 4WELA 5BOHA 4LV3A 1YLZA 3AGDA 1ONHA 2HPBA 4OVDA 4S2OA 3FKWA 4PM9A 3VFFA 4WZ5C 3AGFA 2XLNA 4UA6A 2ZC4B 4E3JA 5FDHA 2EFXA 1YT4A 1W8QA 1JTDA 2WUQA 3W8KA 3HLFA 1KDWA 1ESIA 2Y4AA 2XR0A 1DJBA 3NCKA 3Q81A 1IYQA 2I72A 3VP3A 1MWSA 1NRFA 1VQQA 4R4SA 4DE2A 1BLHA 1SHVA 4A5RA 4LV1A 3VP1A 4Y0TA 4UHUA 1KGFA 1BUEA 4NETA 3BFDA 1L0FA 1PIOA 2EX6A 5E2EA 1DJAA 4X68A 5CGSA 5F1FA 2GDNA 2C5WB 2VGJA 1K54C 4B4XA 1QMFA 3RXXA 4PM5A 1PW8A 2Y59A 5GLBA 2HDRA 2HDQA 3P98A 1K6RA 5EVIB 3VOYA 1K25A 4GDNA 1WE4A 4PM8A 1RGZA 4R4RA 2ZQ8A 3IXBA 4QHCA 2ZLYA 3HLDA 3Q82A 3PBOA 2WGWA 2FFYA 3IWQA 1DJCA 2XGNA 3CJMA 4Q8IA 5U47A 5KZHA 1ESUA 3DW0A 3N7WA 4HBUA 3IH9A 2WGWB 3BRMA 3DTMA 3MZEA 5EUAA 4HESA 1HZOA 3IHAA 2A49A 3PBSA 5E2GA 2XEPA 3GV9A 3V50A 1VM1A 4OP8A 4WMCA 4MBKA 5DTSA 5A90A 4OQIA 4X6TA 5A91A 5JYPA 1TDGA 4PM6A 4RVAA 4YFMA 2V1ZA 1CI9A 2XDMA 4R3BA 3ZG5A 4BQMA 3VOZA 3OPHA 5CTMA 3RXWA 1I5QA 1FSYA 2WKHA 4U0TA 4Z9QA 3MXSA 1CEFA 3A3DA 1LL5A 4S2MA 5EE8A 2ZD8A 5E43A 3CZDA 1BLCA 3NDGA 4S2NC 5GHYA 4EWFA 4MLLA 4N1HA 5HX9A 3ZG8B 2Y2LA 5FQMA 2A3UA 2RCXA 5GL9A 1NJ4A 1NYMA 1FR1A 1FCNA 1KDSA 1L0EA 3MZDA 4WEJA 5D3OA 2XFSA 1PI5A 2XD1A 5DVAA 4GZBA 2P74A 3C7VA 4C75A 4N9KA 1OMEA 2WK0A 5FQQA 1E4DA 5DF8A 5GLAA 1MKIA 1YLWA 5KSHA 4OOLA 3GSGA 3HLEA 1ZG4A 4ZTKA 3UNWA 3G2ZA 4IVIA 4QD4A 1YM1A 3OPPA 3PBQA 4KZ7A 5AQ7A 2XK1A 3VP2A 4JF6A 3VMAA 1NXYA 5FQKA 4FSFA 1MXOA 3OZHA 4C6YA 1IYPA 1XPBA 5KMWA 4GB7A 1DY6A 1YLYA 3UDXA 3FWLA 3IF5A 2J7VA 3O86A 1FSWA 3IF6A 5EECA 1NYYA 4P6BA 1HD8A 1XX2A 4N92A 4MEZA 3BM6A 1BLSA 2ZC3B 2PU4A 3IF6B 4KG5A 5AQAA 2G2WA 1NZOA 5JYOA 3UE0A 1YLTA 3PAEA 4UAAA 3N8SA 3M6HA 4KQRA 3M2JA 4DXBA 3LCEA 1XKZA 1E3UD 3HREA 3HLGA 3OPLA 4DF6A 1MY8A 1TVFA 1BT5A 3WS2A 2E8IA 2FFFB 4QB8A 2H5SA 2J9OA 4Y0OA 3DWKA 5HAIA 3HL9A 5KSCA 1PI4A 3O87A 4RX2A 1PZPA 4UA7A 4S2NA 5FQ9A 1BLPA 4GOGA 5CHJA 4E3NA 2QPNA 4DRTA 5CHUA 1KGGA 3NI9A 5HW3A 4JXVA 3PBTA 3CG5A 3W4OA 2Y2MA 1PW1A 4EV4A 1LLBA 1EWZA 3QNBA 1YMXA 3BECA 1TEMA 3ZNYA 1ERQA 3IWIA 3ZDJA 4QJGA 1MWRA 2EXAA 5CGXA 4DXCA 1S0WA 3TSGA 5EOEA 1RCJA 1XP4A 3G32A 3WRTA 2WGIA 4OOYA 3NIAA 4OPQA 4GN2A 2Y2HA 2JCHA 3BFEA 1YQSA 4JXWA 5FSRA 4GNUA 5EVIA 4KQQA 2PU2A 3HBRA 4RX3A 5CXWA 4PPRA 3E2KA 4X55A 1FR6A 2QMIA 4KG6A 4RA7A 5FI2A 4ZBEA 4EBPA 1CI8A 1K56D 3ITBA 1WYCA 3W4QA 1ES2A 3HVFA 1ERMA 4OQ0A 5DTKA 5F82A 5FAPA 1JVJA 1GCEA 2ZC5B 3UDIA 2OLUA 1IKGA 1ZC2A 1LL9A 5F1GA 1ES3A 4MNRA 4EUZA 2DRWA 1GHIA 1LI0A 5CERA 3MBZA 2ZM0A 1H5XA 4IBRA 4QU3A 5EOOA 3S1YA 1YLPA 4U3TA 2Z2LB 4IBXA 2WAEA 1M40A 3SH7A 1WYBA 3UPOA 2H0TA 3JYIA 5HAQA 3GRJA 4KZ3A 4FD8A 2EXBA 4KZAA 4Y7PA 3ZFZA 4EBNA 3SH8A 1G6AA 4S2IA 3RJUA 5GHZA 2Q9NA 1KE4A 2VGKA 4WZ5A 3LEZA 2Y2NA 5FAOA 4KZ4A 3UN7A 5HFOA 2P9VA 5CECA 2XF3A 3C4PA 3G35A 3V39A 5I94A 1K57C 2WZZA 1O7EA 4OPRA 3SS4A 2Y55A 1XXMA 2H10A 2P9VB 2X02A 2IWDA 3DWZA 3PBNA 3UE1A 3MKEA 3BLMA 3ZNTA 1HVBA 5CEBA 4K0WA 2OV5A 1CEGA 1ZG6A 2JBFA 4LCLA 3G30A 2ZQDA 1ES5A 3Q7ZA 1MPLA 3N6IA 3NDEA 2DCFA 3IHBA 3IT9A 2X71A 2ZM8A 3UE3A 1K54A 4JF4A 1GA0A 1PZOA 5TFQA 4OLDA 4YINA 4LV2A 1C3BA 2HP6A 1FCMA 3IWOA 5G18A 1MWTA 2UWXA 3E2LA 1JWZA 1K4EA 4XXRA 1EI5A 5HL1A 1XA1A 3Q7VA 4BD0A 3LY3A 1KVLA 3ZVTA 5J8XA 4GKUA 1SDEA 4QY6A 3ZG7B 3ZCZA 1MBLA 3A3IA 4E6WA 3Q7VB 2IWCA 2XQZA 1L2SA 4S2PA 2WAFA 1GA9A 2HDUA 4GDBA 3OCLA 4OOMA 4LV0A 1BULA 4M3KA 3A3FA 4H8RA 4JF5A 4P0MA 1K38A 3OCNA 4FH4A 4KQOA 1PYYA 4HBTA 4EBLA 5CRFA 4BD1A 4JLFA 4WMCD 1K4FA 1I2WA 3M6BA 3D4FA 3NC8A 4ZAMA 3OC2A 3BFCA 1KE0A 5GLCA 4BL2A 3VFHA 2EFUA 1H8ZA 3IH8A 1E25A 3VSKA 2ZQ7A 2WGVA 2OSUA 2WZXA 1IKIA 2EX8A 4WZ4A 3EQVA 4OPZA 5HARA 5GHXA 2Y2OA 3IXHA 1BSGA 2ZC6B 5DTTA 5TR7A 3ZHHA 3C5AA 3MKFA 4DE1A 3WS4A 5CTNA 5E2HA 3V3RA 4IEDA 3N8LA 4DE0A 3Q1FA 4MBFA 3N8RA 4KZBA 1PWGA 1CK3A 3NY4A 2PBYA 3UO9A 1IEMA 3S4XA 2R9WA 4DDSA 4R1GA 3Q07A 4KZ5A 3WS0A 3OPRA 4BENA 4LCMA 4OH0A 2Y2QA 4RYEA 3M2KA 3FKVA 3TG9A 4OQGA 3BEBA 3FV7A 5CEDA 4KZ8A 1JWVA 2X01A 1Y54A 2Y2JA 4P85A 2G2UA 3MZFA 3ZGAB 4X56A 1L0GA 3AGEA 2H0YA 4CJNA 4S2LA 3S22A 5M19A 3ZVWA 3SH9A 1N9BA 4XUZA 4OPYA 5FI6A 1PWDA 4OLGA 3TOIA 3V3SA 1RP5A 3WS5A 4GD6A 3GR2A 4F94A 1IYOA 3VP4A 1N4OA 1AXBA 1K55C 3O3VA 4IVKA 4O7DA 4UA9A 5FASA 4R0QA 3HUNA 3B3XA
chains in the Genus database with same CATH superfamily
1ES4A 4E3IA 1I2SA 3CMZA 4L0LA 4ARZB 1S1ZA 2C6WB 1F5MA 2ZOIA 3TRCA 3GTCA 3S7PA 3BQAA 1TDLA 1SKOB 3BW6A 1XA7A 2JHEA 3A3JA 2HJ9C 5F5YA 3E4OA 5L8MA 1EROA 1GHPA 4LENA 4MN6A 2JKRM 4BL3A 5AQ9A 3T4SA 3C7UA 1GHMA 2ZQCA 4WLAA 4BBVA 1FQGA 5L2FA 4R38A 2M7VA 1HTZA 5FEFA 4IUKA 3CITA 3PBRA 5J7EA 2GNXA 3T4QA 3ITAA 2HGVA 1FCOA 4Q0JA 3A3EA 1Q2QA 2Z2MB 2BLSA 1W8YA 4R23A 1QMEA 1TF1A 1IYSA 3DTKA 3GQZA 4S2KA 2Y91A 1V9ZA 3IXDA 4CPKA 4DDYA 5DF9A 1FOFA 4MBHA 1OT6A 2XFTA 3LO7A 3SS5A 4B88A 2HJEA 4IUHA 4JPMA 1BTLA 4KUOA 5CHMA 1T1BA 2K2NA 5EM1A 2OLVA 4OONA 5DF7A 5C5KA 5F83A 1ONHA 4UEYA 4S2OA 3VFFA 3FKWA 3E98A 4WZ5C 3AGFA 3G6OA 4UA6A 2ZC4B 2WUQA 1JTDA 2W3GA 4DMZA 1MWSA 4QPRA 4GCZA 1W63M 4UHUA 1KGFA 4NETA 3D72A 2GDNA 4NEED 1K54C 3RXXA 3RTYA 2Y59A 2HDQA 4O01A 3DTEA 4GDNA 2ZQ8A 2M7UA 3CUEC 1Y28A 3PBOA 2JKRI 4RQ9A 2XGNA 3CJMA 3JVVA 4Q8IA 3T1SA 5U47A 2L0WA 3N7WA 2WGWB 4EQ1A 3EWKA 5EM0A 5E2GA 2OWJA 1OTDA 4MBKA 4JGOA 4LRXC 4OQIA 4X6TA 1DP8A 1TDGA 4PM6A 4RVAA 2KOIA 3ZG5A 3B42A 3OPHA 5CTMA 1I5QA 3MXSA 1MKMA 3CZDA 2P08A 3ZG8B 1NYMA 1L0EA 2XFSA 1PI5A 4GZBA 4HP9A 3L9KA 1OMEA 4Y17A 5FQQA 5DF8A 5GLAA 1MKIA 4OOLA 4E04A 1ZG4A 3SW1A 5HD3A 4GLQA 3DBAA 3OPPA 3PBQA 4JF6A 3JVUA 1XPBA 3HJIA 1DY6A 3UDXA 4FOFA 3NULA 3O86A 1S1YA 2VLGA 4HJ4A 1N9OA 2G2WA 1NZOA 2W3EA 4EEUA 1VETB 3PAEA 3N8SA 3M6HA 1VHMA 5L09A 4MN7A 2E8IA 4ZRRA 2H5SA 2J9OA 3P7NA 3CI6A 5CHJA 4HY8A 4E3NA 2ACGA 5CHUA 3KX0X 4EV4A 1LLBA 1VEUB 3QNBA 3BECA 4DXCA 4ETXA 3BFEA 4JXWA 4KQQA 4Y3IA 4X55A 4KG6A 4O0PA 5FI2A 1WYCA 3W4QA 3HVFA 2W3HA 2OLUA 2JKTM 1ZC2A 1ES3A 4NXGA 2DRWA 1W63Q 2ZM0A 3S1YA 4IBXA 3HCYA 3T1QB 1OTEA 3UPOA 1CQAA 2H0TA 3GRJA 2EXBA 4Y7PA 3ZFZA 1AWIA 3RJUA 5L10A 2OWHA 3B47A 1XJ6A 1O7EA 2BASA 2VK3A 1N9NA 3SS4A 1XXMA 4F3LA 1XJ4A 2IWDA 3TW8A 3BLMA 1HVBA 4BMWA 4K0WA 1CEGA 1ZG6A 1MPLA 2DCFA 1FCMA 3LR0A 5G18A 2UWXA 5HL1A 4GKUA 4QY6A 1YKDA 2QJ7A 3ZCZA 5AVEA 4E6WA 4MMNA 2XQZA 4S2PA 2WAFA 1VETA 4GDBA 4JF5A 4B9OA 2D01A 4HBTA 4JLFA 4WMCD 4I39A 2WKRA 5GLCA 4ETZA 3VFHA 3ULFA 2XRNA 2WGVA 3LIDA 5HARA 1STZA 5GHXA 1BSGA 5DTTA 5TBMA 4DE1A 4MBFA 1VEUA 1CK3A 2YKHA 1IEMA 4KZ5A 4OH0A 3FKVA 5CEDA 1Y54A 3EEAA 1L0GA 3AGEA 2L1MA 5M19A 3ZVWA 3SH9A 1N9BA 4OLGA 1RP5A 3WS5A 4GD6A 4F94A 1AXBA 1HLUP 3KYQA 2JKTI 3BJNA 1T1AA 3B3XA 4E3MA 3QNCA 1W5DA 2Y2PA 1BYWA 3K3CA 3PAGA 3G31A 3HUMA 3O88A 4D60A 3I7JA 2KX6A 4FH2A 4QY5A 5EVLA 2WKEA 3PTEA 4BJPA 1H8YA 2V9AA 2ZC7A 3BFFA 2B5RA 4Q0IA 4CQHA 2JN7A 4EETB 4EQIA 2R78A 4WYYA 4Y0UA 3W4PA 1K6SA 1JTGA 5A93A 1G68A 5FQJA 2A2LA 3FYZA 2O9BA 2J9PA 1XGJA 2Y2KA 4H6JA 4OKPA 2EA9A 2IWBA 4R3JA 3GDIA 3P01A 3VSLA 1S4RA 5G4ZA 3G2YA 2IA2A 1F9IA 2B18A 5EV0A 3W2ZA 4MDZA 1XFNA 4P87A 3KO6A 3FPWA 1X0OA 4ZJ1A 3QHYA 4WBGA 5M1AA 2QKPA 5DFYA 5HPIA 4BBUA 3IQAA 4X69A 4N1XA 5L07A 4DN0A 3V67A 2RL3A 4R6LA 3S7NA 5FA7A 3UB6A 1KVMA 4PM7A 1K56A 3QP2A 1M6KA 5E2FA 1YSQA 2R9XA 3KSIA 2PYPA 1K57A 3H82A 5HAPA 2OAP1 2K7SA 3KYZA 4JKTA 2O0YA 2INWA 2JC7A 3HLCA 5IHVA 3FZCA 3SS3A 3LI8A 2VEAA 4S2JA 3BLSA 5A92A 3U4LP 3VP0A 1YLJA 4HIAA 3NJAA 1PWCA 3SOIA 4LV3A 1YLZA 3AGDA 1DP9A 5EFWA 2HPBA 4OVDA 2PD7A 2XLNA 2V8FA 3W8KA 1W8QA 1ESIA 3MQOA 2XR0A 1DJBA 1IYQA 2I72A 4PHTA 3KSFA 1NRFA 1VQQA 5K5BA 4R4SA 3QP4A 4EERA 1L0FA 1PIOA 3LGOA 4X68A 4G3WA 5F1FA 4B4XA 1QMFA 4PM5A 4HH3A 5EVIB 1H3QA 1VB6A 3VOYA 1K25A 4HQAA 3IXBA 3UE6A 3OOVA 3C8CA 2A24A 2O9CA 5TJJA 2FFYA 1V9YA 2PT7A 1TS7A 3DTMA 1EW0A 2WKQA 5CX7A 3GV9A 4OP8A 5A90A 5JYPA 4YFMA 2V1ZA 1CI9A 2XDMA 4R3BA 4BQMA 3RXWA 4UQIM 3T1RA 4U0TA 4YWZA 1CEFA 3A3DA 1LL5A 3CHWP 4S2MA 1OTBA 1BLCA 4N1HA 2A3UA 4UQIS 1NJ4A 1FR1A 1FCNA 5DVAA 3RFBA 3C7VA 3GSGA 1DRMA 4IVIA 3F1OB 2ZBBA 4KZ7A 5FQKA 1P9RA 1MXOA 3OZHA 1IYPA 4GB7A 1YLYA 3FWLA 4I38A 2J7VA 1FSWA 3IF6A 3B33A 1NLYA 4I5SA 2ZC3B 5AQAA 4P6ZM 3LIBA 4KQRA 4IJGA 4CLCB 4HNBA 4QWOA 1TVFA 3WS2A 4P6ZS 4Y5FA 5KSCA 1PI4A 3K3DA 4X25A 1PZPA 1D7EA 3C2WA 1UWPX 4S2NA 1BLPA 4DRTA 1KGGA 3NI9A 3BY8A 3W4OA 3CG5A 2Y2MA 1PW1A 1MZUA 2OAQ1 3ZNYA 1ERQA 5MC7A 1MWRA 2PR5A 5CGXA 1UGUA 1OTAA 1CJFA 1XP4A 3NIAA 1G28A 1T18A 4GNUA 5DKKA 5EVIA 4RX3A 5CXWA 2PHYA 2HF6A 1FR6A 4RA7A 4ZBEA 5HWWA 1CI8A 2L4RA 1ERMA 5DTKA 5FAPA 1GCEA 2ZC5B 3UDIA 4AFIA 1Y4OA 1LL9A 4KUKA 4EU0A 4MNRA 3MJQA 1G6OA 4EUZA 1LI0A 4IBRA 1YLPA 3T1XA 2Z2LB 3MR0A 4FD8A 4R3AA 3SH8A 1G6AA 3LI9A 5GHZA 2Q9NA 3LEZA 3MSHA 5FAOA 4MCWA 2P9VA 3C4PA 1K57C 4OPRA 1NWZA 3EOIA 3PBNA 3DWZA 3UE1A 3MKEA 1YPRA 5CEBA 2OV5A 4F3LB 2JBFA 4LCLA 1ES5A 3QP5A 3F1OA 3MF0A 4L9FA 4LRZE 3K2NA 5HPFA 1C3BA 2W1TB 1MWTA 3IS2A 1P0ZA 1EI5A 2GX5A 1XA1A 5HL6A 1S4SA 3LR5A 1UWNX 4JGRA 1L2SA 3KYEA 2W3FA 1PYYA 5CRFA 4BD1A 4CLCA 1XJ3A 4R70A 4ZAMA 3OC2A 2EFUA 2QJ5A 1E25A 2OSUA 3LIAA 1J3WA 4XT2A 2Y2OA 3ZHHA 3TE8A 3C5AA 3MKFA 3V3RA 4DE0A 3Q1FA 1PWGA 3NY4A 5TBMB 3S4XA 3WS0A 3OPRA 4LCMA 2ZL1A 3IX8A 4RYEA 2HV1A 3QP6A 3LICA 4Y15A 3TG9A 2Z6CA 3BEBA 3FV7A 1JWVA 4NXEA 5DJUA 3ZGAB 3UB5P 5A8BA 4CJNA 3S22A 3CWFA 3V3SA 3TOIA 2XSSA 3GR2A 1IYOA 1XFQA 2M1CA 4GS9A 1N4OA 3O3VA 5J4EA 2Q9MA 3UY6A 3BYDA 2V2FF 4JXGA 1ODVA 3GECA 3WRZA 2EWVA 3CLOA 4BLMA 5FQIA 3BFGA 4GJ4A 3UB8A 3T4LA 3G4PA 5M18A 3H7WA 4DKIA 2O99A 1RGYA 4NK3A 4D2OA 2WYXA 1YAXA 1T19A 4WM9A 2Q0OA 1NRJA 3RH8B 2JE5A 3MFDA 2EX2A 1BZAA 4X53A 1ALQA 4NG2A 3S7OA 3V5MA 1JWPA 5HSQA 3IF6C 4NXBA 1J9MA 3T12B 2LB9A 1NZUA 4KG2A 3EQUA 1U60A 4GD8A 5FDSA 3IX3A 2HDSA 3IX4A 3UPPA 4EUVA 5HWVA 3WWXA 2WADA 4XUXA 2Y2IA 5FI7A 1ONGA 3BQ8A 3VOLA 4ZJ3A 1E3UA 2W1TA 2CC1A 3GMWA 4B4ZA 4K91A 4H6JB 1K55A 3F1NA 5AQBA 2ZQ9A 1A0KA 5CGWA 3C4OA 4Z1WA 4OQHA 5EVEA 2V20A 4U0XA 5FAQA 3HLWA 4II7A 3DAVA 1W79A 1NY0A 2QZ6A 4LRYC 5EVIC 4C3QA 3MMHA 5HDSA 4JGPA 4HP4A 2EX9A 3E4QA 1SDNA 2LB5A 1P97A 2B02A 2Y79A 3LY4A 3ISGA 2W1RA 3H82B 3WS1A 4HI4A 1OPXA 2ZM2A 4E3LA 1L3LA 1Z6FA 1KGEA 1SKFA 3IXGA 4WELA 5BOHA 2J3TC 4PM9A 4ESPA 1H8MA 3T4KA 1WA9A 3H9WA 3LYXA 4E3JA 1OJ5A 3T4JA 3HLFA 1KDWA 3Q81A 5KIZA 4DE2A 1BLHA 4A5RA 4LV1A 4Y0TA 1BUEA 4ME4A 2FH5A 2EX6A 1DJAA 4KQDA 1FIKA 3MQQA 3OLOA 2HDRA 3P98A 1K6RA 1WE4A 4PM8A 3L7HA 1RGZA 4Q0HA 4R4RA 4QHCA 4LLOB 2ZLYA 3HLDA 3Q82A 1DJCA 5KZHA 1ESUA 2A24B 3MZEA 1HZOA 3PBSA 3R7WA 4CLCC 3V50A 2EWWA 3VE4A 1FSYA 1G5UA 5EE8A 1ZTUA 3NOTC 5E43A 4X1LA 1N9LA 3NDGA 5GHYA 4EWFA 3MZDA 2VA0A 1DP6A 3EEHA 4I3IA 2XD1A 2B95A 2P74A 5DFXA 2WK0A 1E4DA 2V1AA 5KSHA 1S66L 3HLEA 2O9AA 3G2ZA 2PAVP 3LIEA 3VP2A 2XK1A 3VMAA 1NXYA 4FSFA 3CUEA 5KMWA 2KDKA 5EECA 3UMEA 1HD8A 1XX2A 4N92A 4MEZA 3BM6A 3IF6B 2PU4A 3U2AA 3LR4A 5HZHA 5G4YA 4UAAA 5IT5A 3LCEA 1XKZA 3C30A 3ZQ5A 1MY8A 4M4XA 1BT5A 2FFFB 4QB8A 2VV6A 3O87A 4RX2A 2PD8A 4GOGA 4HHDA 4GHIB 4PKYA 5HW3A 2VZWA 4JXVA 3PXPA 1EWZA 3LR3A 1TEMA 3VE3A 4QJGA 2EXAA 3T50A 5EOEA 4Y2FA 1RCJA 1T1CA 2JCHA 1YQSA 5HWTA 2PU2A 2V8CA 4PPRA 1F2KA 3E2KA 2VJWA 4EBPA 1K56D 2Z6DA 1ES2A 4OQ0A 1LSXA 5F82A 3UB9A 3ICYA 2XA7M 3DTIA 2PBDP 5FL3A 5F1GA 3KSGA 2G7UA 5EOOA 4QU3A 5IU1A 2XA7S 4U3TA 2WAEA 1M40A 5HDDA 1WYBA 3SH7A 4JGQA 3JYIA 4DJ3A 4YNRA 4KZ3A 2PYRA 4KZAA 4X1MA 2VKSA 3E4PA 2V1BA 1KE4A 4EW7A 4KZ4A 3UN7A 5CECA 2XF3A 4WN5A 3V39A 5I94A 2OOLA 2WZZA 2Y8HA 2Y55A 4HJ6A 2P9VB 3BWLA 4GW9A 4G3KA 3ZNTA 4YOFA 3MXQA 3NHQA 3G30A 2ZQDA 3IHBA 2X71A 3UE3A 1PZOA 4OLDA 3FC7A 4LV2A 3IWOA 1OJGA 1K4EA 4XXRA 4I3JA 3Q7VA 4BD0A 3IS2B 1KVLA 3ZVTA 3ZG7B 3PYPA 1MBLA 3A3IA 2IWCA 1GA9A 1KOUA 2HDUA 4OOMA 3OBFA 2J3WA 3OCNA 3IBJA 1K4FA 1I2WA 3M6BA 3NC8A 3BFCA 3LEQA 2W27A 2ZOHA 3O5YA 4L9GA 2ZQ7A 5IS1A 2WZXA 1IKIA 3EQVA 2NUPC 4GHIA 3WS4A 5E2HA 3N8LA 4XT2B 3N8RA 4KZBA 2PBYA 2V0WA 2R9WA 4DDSA 3Q07A 3IBRA 2Y2QA 3S7QA 3M2KA 2WKPA 4OQGA 2X01A 2ZL1B 3FPVA 3KSHA 4P85A 2I9VA 3TJZC 3MZFA 1PFLA 4X56A 3NOPC 1D1JA 2H0YA 4S2LA 4XUZA 4OPYA 1PWDA 2DMWA 5J3WA 4FTXA 2W0NA 4IVKA 4O8GA 4UA9A 4ARZA 3HUNA 5GLDA 2HZ5A 4GS9B 1Q2PA 3HJKA 2XD5A 1PNEA 1XJ2A 1YMSA 1LL8A 1SKOA 1XGIA 3N4IA 5DJTA 4OP5A 2WKIA 5DKLA 4N9LA 3ZG0A 1CF0A 5AVFA 3H7WB 3ZYTA 3UMDA 1LI9A 1IELA 4WL9A 4LGWA 4ZDXA 4WEKA 2XH9A 4ID4A 5AJGA 5LBRA 2P7JA 3P09A 3MQ0A 4JXSA 4DJ2A 4ZJ2A 4NKPA 4E3OA 3G34A 4KENB 2ZMAA 4L9EA 2HP9A 4HEFA 5EVID 5EPHA 2Y2GA 1ZKJA 3JPUA 1NLZA 2UV0E 5FATA 3T4OA 4FCFA 4E3KA 1O07A 2GJ3A 3QP1A 1SCWA 3F1NB 1K0KA 3NBLA 4KZ9A 3ZG9B 1L0DA 5HD5A 3F1PB 4E6XA 1LHYA 4DE3A 1MWUA 2PDRA 2BG1A 2J8YA 2J3TD 3HUOA 2QWSA 4PMAA 3UB7A 4KZ6A 3HLBA 1KE3A 3SZTA 2H28A 3E0YA 1PRQA 4JBFA 2ZQAA 1W7FA 3GVBA 1S6RA 3MXRA 4K0XA 3UPNA 4Y13A 2QYBA 2HP5A 3UDFA 2DNSA 2ZJ9A 4EESA 5TGFA 4EEPA 1D06A 2VX8A 5FDHA 2EFXA 1YT4A 2Y4AA 3NCKA 2E8JA 3VP3A 2W3DA 4CLCD 1SHVA 3VP1A 3BFDA 5E2EA 2YKFA 5CGSA 3C38A 3VV4A 2ZMVA 2C5WB 2VGJA 2PRFA 1S67L 1PW8A 5GLBA 2ZMFA 4B93A 1Z09A 2WGWA 1TS6A 3IWQA 3NECA 3DW0A 4HBUA 3IH9A 3BRMA 3R4KA 1MC0A 5EUAA 4HESA 4LPZA 3PHYA 3FG8A 3IHAA 2A49A 2XEPA 1VM1A 2FZ0A 4WMCA 5DTSA 5A91A 3R7WB 3VOZA 1P9WA 2WKHA 4Z9QA 2ZD8A 1JNUA 4S2NC 4MLLA 5HX9A 2PR6A 2Y2LA 5FQMA 2RCXA 5GL9A 1FILA 1KDSA 4K08A 5D3OA 4WEJA 2VGLM 4C75A 4N9KA 1YLWA 3F1PA 4BWIA 2VGLS 4ZTKA 3UNWA 3MFXA 4QD4A 1YM1A 1IFQA 5AQ7A 1OTIA 4C6YA 3IF5A 2J80A 1NYYA 4P6BA 1TS8A 1BLSA 3EGXC 1IOUA 4KG5A 5JYOA 3LFVA 3UE0A 1YLTA 2GZAA 3EGDC 2AVXA 3M2JA 4DXBA 1E3UD 3HREA 3HLGA 3OPLA 4DF6A 3CPTB 2QHKA 4Y0OA 3DWKA 5HAIA 3HL9A 4UA7A 5FQ9A 4CLCE 2QPNA 4PKYG 3PBTA 3PR6A 4PAUA 1LSWA 1YSPA 1YMXA 4NXFA 3IWIA 3ZDJA 1S0WA 3TSGA 3QP8A 3WRTA 3G32A 2NUTC 2WGIA 4OOYA 2D02A 4OPQA 4GN2A 1SZVA 2Y2HA 1ACFA 5FSRA 4LFUA 3HBRA 2QMIA 5FEGA 3ITBA 5F68A 4HOIA 5I5LA 1JVJA 1IKGA 1GHIA 3LIFA 3NOUC 3MBZA 5CERA 1H5XA 4FUWA 5F69A 1OT9A 5HAQA 1LSVA 2CMNA 4EBNA 4S2IA 2K31A 2VGKA 4WZ5A 2KLIA 2Y2NA 4I3AA 5HFOA 3CAXA 3G35A 2H10A 2X02A 2BTFP 4WF0A 2XROA 1H0MA 2VV8A 1GSVA 3Q7ZA 3N6IA 3NDEA 3IT9A 2ZM8A 1K54A 4JF4A 1GA0A 5TFQA 4YINA 2HP6A 3D3OA 3E2LA 1JWZA 1TS0A 3BY9A 3LY3A 5J8XA 4IHQA 4BBTA 1SDEA 2JKGA 3A0VA 3Q7VB 3OCLA 5HDCA 4LV0A 1BULA 4M3KA 3A3FA 1ZHHB 4H8RA 4P0MA 1K38A 1F98A 2JKFA 4FH4A 4KQOA 5F6AA 4EBLA 4HJ3A 3CPTA 3A0RA 3D4FA 1KE0A 3D9YA 4BL2A 1H8ZA 3IH8A 3T4TA 3VSKA 4HH2A 1LT0A 2EX8A 2MJ6A 4WZ4A 4OPZA 1GSXA 3IXHA 2ZC6B 5TR7A 5CTNA 4IEDA 3UO9A 3LUQA 4R1GA 4BENA 4MN5A 2P04A 1TD5A 2V0UA 4KZ8A 2Y2JA 4G3VA 4WUJA 2G2UA 3MS6A 1GSWA 4EXOA 5FI6A 3A0SA 3VP4A 4O7DA 1K55C 5FASA 4R0QA 2VV7A
chains in the Genus database with same CATH topology
3QNCA 2Q9MA 1Q2PA 3UY6A 1ES4A 3BYDA 1W5DA 4E3IA 2V2FF 1I2SA 2Y2PA 3CMZA 4JXGA 2C6WB 4L0LA 3WRZA 2XD5A 3PAGA 4BLMA 5FQIA 3BFGA 1YMSA 3G31A 3HUMA 3GTCA 3O88A 1XGIA 3G4PA 3N4IA 1TDLA 5M18A 4OP5A 4DKIA 3I7JA 1XA7A 2WKIA 1RGYA 3A3JA 4NK3A 2WYXA 4D2OA 4N9LA 4FH2A 4QY5A 4WM9A 5EVLA 2WKEA 3PTEA 3ZG0A 4BJPA 1H8YA 2ZC7A 3BFFA 2B5RA 2JE5A 3MFDA 2EX2A 1LI9A 1BZAA 1ALQA 1IELA 4X53A 3V5MA 1EROA 1JWPA 4WEKA 2XH9A 4ID4A 4ZDXA 4EQIA 3IF6C 1J9MA 1GHPA 4LENA 1NZUA 4KG2A 4BL3A 3EQUA 3P09A 4WYYA 1U60A 4Y0UA 5AQ9A 4GD8A 3C7UA 3W4PA 1K6SA 1JTGA 4JXSA 5A93A 2HDSA 1GHMA 1G68A 2ZQCA 4ZJ2A 3UPPA 1FQGA 4E3OA 5FQJA 3G34A 4KENB 3WWXA 5L2FA 2WADA 4XUXA 2ZMAA 2Y2IA 5FI7A 1ONGA 1HTZA 4ZJ3A 3FYZA 1E3UA 2HP9A 4HEFA 5EVID 5EPHA 2Y2GA 2J9PA 1XGJA 1ZKJA 2Y2KA 2CC1A 3PBRA 3GMWA 4OKPA 4B4ZA 2IWBA 4K91A 5FATA 4R3JA 3ITAA 4FCFA 4E3KA 1FCOA 1O07A 1K55A 5AQBA 1SCWA 3A3EA 1Q2QA 3VSLA 2Z2MB 2ZQ9A 3G2YA 2BLSA 5CGWA 1W8YA 3C4OA 4R23A 4OQHA 1QMEA 2V20A 3NBLA 4P87A 4U0XA 5FAQA 3HLWA 4KZ9A 3ZG9B 1IYSA 3GQZA 4ZJ1A 1L0DA 3QHYA 1W79A 4WBGA 5M1AA 4S2KA 1NY0A 4E6XA 1LHYA 3IQAA 2QZ6A 4X69A 4N1XA 5EVIC 2Y91A 4C3QA 4DE3A 3IXDA 1MWUA 4CPKA 2RL3A 4DDYA 5DF9A 2BG1A 2J8YA 1FOFA 3HUOA 5GLDA 4PMAA 4MBHA 5FA7A 2EX9A 4KZ6A 1KVMA 4PM7A 1K56A 1SDNA 3HLBA 1KE3A 2XFTA 1M6KA 5E2FA 3LO7A 2R9XA 3SS5A 4JBFA 1K57A 4B88A 5HAPA 2ZQAA 1W7FA 3GVBA 1S6RA 3MXRA 4JKTA 4JPMA 1BTLA 3LY4A 3ISGA 3WS1A 2JC7A 3HLCA 5IHVA 3FZCA 3SS3A 5CHMA 2ZM2A 4E3LA 4K0XA 3UPNA 2OLVA 4OONA 4S2JA 3BLSA 5DF7A 1Z6FA 1KGEA 5A92A 3VP0A 2HP5A 1YLJA 3UDFA 1SKFA 2DNSA 2ZJ9A 4E3MA 1PWCA 3IXGA 5F83A 3SOIA 5TGFA 4WELA 5BOHA 4LV3A 1YLZA 3AGDA 1ONHA 2HPBA 4OVDA 4S2OA 3FKWA 4PM9A 3VFFA 4WZ5C 3AGFA 2XLNA 4UA6A 2ZC4B 4E3JA 5FDHA 2EFXA 1YT4A 1W8QA 1JTDA 2WUQA 3W8KA 3HLFA 1KDWA 1ESIA 2Y4AA 2XR0A 1DJBA 3NCKA 3Q81A 1IYQA 2I72A 3VP3A 1MWSA 1NRFA 1VQQA 4R4SA 4DE2A 1BLHA 1SHVA 4A5RA 4LV1A 3VP1A 4Y0TA 4UHUA 1KGFA 1BUEA 4NETA 3BFDA 1L0FA 1PIOA 2EX6A 5E2EA 1DJAA 4X68A 5CGSA 5F1FA 2GDNA 2C5WB 2VGJA 1K54C 4B4XA 1QMFA 3RXXA 4PM5A 1PW8A 2Y59A 5GLBA 2HDRA 2HDQA 3P98A 1K6RA 5EVIB 3VOYA 1K25A 4GDNA 1WE4A 4PM8A 1RGZA 4R4RA 2ZQ8A 3IXBA 4QHCA 2ZLYA 3HLDA 3Q82A 3PBOA 2WGWA 2FFYA 3IWQA 1DJCA 2XGNA 3CJMA 4Q8IA 5U47A 5KZHA 1ESUA 3DW0A 3N7WA 4HBUA 3IH9A 2WGWB 3BRMA 3DTMA 3MZEA 5EUAA 4HESA 1HZOA 3IHAA 2A49A 3PBSA 5E2GA 2XEPA 3GV9A 3V50A 1VM1A 4OP8A 4WMCA 4MBKA 5DTSA 5A90A 4OQIA 4X6TA 5A91A 5JYPA 1TDGA 4PM6A 4RVAA 4YFMA 2V1ZA 1CI9A 2XDMA 4R3BA 3ZG5A 4BQMA 3VOZA 3OPHA 5CTMA 3RXWA 1I5QA 1FSYA 2WKHA 4U0TA 4Z9QA 3MXSA 1CEFA 3A3DA 1LL5A 4S2MA 5EE8A 2ZD8A 5E43A 3CZDA 1BLCA 3NDGA 4S2NC 5GHYA 4EWFA 4MLLA 4N1HA 5HX9A 3ZG8B 2Y2LA 5FQMA 2A3UA 2RCXA 5GL9A 1NJ4A 1NYMA 1FR1A 1FCNA 1KDSA 1L0EA 3MZDA 4WEJA 5D3OA 2XFSA 1PI5A 2XD1A 5DVAA 4GZBA 2P74A 3C7VA 4C75A 4N9KA 1OMEA 2WK0A 5FQQA 1E4DA 5DF8A 5GLAA 1MKIA 1YLWA 5KSHA 4OOLA 3GSGA 3HLEA 1ZG4A 4ZTKA 3UNWA 3G2ZA 4IVIA 4QD4A 1YM1A 3OPPA 3PBQA 4KZ7A 5AQ7A 2XK1A 3VP2A 4JF6A 3VMAA 1NXYA 5FQKA 4FSFA 1MXOA 3OZHA 4C6YA 1IYPA 1XPBA 5KMWA 4GB7A 1DY6A 1YLYA 3UDXA 3FWLA 3IF5A 2J7VA 3O86A 1FSWA 3IF6A 5EECA 1NYYA 4P6BA 1HD8A 1XX2A 4N92A 4MEZA 3BM6A 1BLSA 2ZC3B 2PU4A 3IF6B 4KG5A 5AQAA 2G2WA 1NZOA 5JYOA 3UE0A 1YLTA 3PAEA 4UAAA 3N8SA 3M6HA 4KQRA 3M2JA 4DXBA 3LCEA 1XKZA 1E3UD 3HREA 3HLGA 3OPLA 4DF6A 1MY8A 1TVFA 1BT5A 3WS2A 2E8IA 2FFFB 4QB8A 2H5SA 2J9OA 4Y0OA 3DWKA 5HAIA 3HL9A 5KSCA 1PI4A 3O87A 4RX2A 1PZPA 4UA7A 4S2NA 5FQ9A 1BLPA 4GOGA 5CHJA 4E3NA 2QPNA 4DRTA 5CHUA 1KGGA 3NI9A 5HW3A 4JXVA 3PBTA 3CG5A 3W4OA 2Y2MA 1PW1A 4EV4A 1LLBA 1EWZA 3QNBA 1YMXA 3BECA 1TEMA 3ZNYA 1ERQA 3IWIA 3ZDJA 4QJGA 1MWRA 2EXAA 5CGXA 4DXCA 1S0WA 3TSGA 5EOEA 1RCJA 1XP4A 3G32A 3WRTA 2WGIA 4OOYA 3NIAA 4OPQA 4GN2A 2Y2HA 2JCHA 3BFEA 1YQSA 4JXWA 5FSRA 4GNUA 5EVIA 4KQQA 2PU2A 3HBRA 4RX3A 5CXWA 4PPRA 3E2KA 4X55A 1FR6A 2QMIA 4KG6A 4RA7A 5FI2A 4ZBEA 4EBPA 1CI8A 1K56D 3ITBA 1WYCA 3W4QA 1ES2A 3HVFA 1ERMA 4OQ0A 5DTKA 5F82A 5FAPA 1JVJA 1GCEA 2ZC5B 3UDIA 2OLUA 1IKGA 1ZC2A 1LL9A 5F1GA 1ES3A 4MNRA 4EUZA 2DRWA 1GHIA 1LI0A 5CERA 3MBZA 2ZM0A 1H5XA 4IBRA 4QU3A 5EOOA 3S1YA 1YLPA 4U3TA 2Z2LB 4IBXA 2WAEA 1M40A 3SH7A 1WYBA 3UPOA 2H0TA 3JYIA 5HAQA 3GRJA 4KZ3A 4FD8A 2EXBA 4KZAA 4Y7PA 3ZFZA 4EBNA 3SH8A 1G6AA 4S2IA 3RJUA 5GHZA 2Q9NA 1KE4A 2VGKA 4WZ5A 3LEZA 2Y2NA 5FAOA 4KZ4A 3UN7A 5HFOA 2P9VA 5CECA 2XF3A 3C4PA 3G35A 3V39A 5I94A 1K57C 2WZZA 1O7EA 4OPRA 3SS4A 2Y55A 1XXMA 2H10A 2P9VB 2X02A 2IWDA 3DWZA 3PBNA 3UE1A 3MKEA 3BLMA 3ZNTA 1HVBA 5CEBA 4K0WA 2OV5A 1CEGA 1ZG6A 2JBFA 4LCLA 3G30A 2ZQDA 1ES5A 3Q7ZA 1MPLA 3N6IA 3NDEA 2DCFA 3IHBA 3IT9A 2X71A 2ZM8A 3UE3A 1K54A 4JF4A 1GA0A 1PZOA 5TFQA 4OLDA 4YINA 4LV2A 1C3BA 2HP6A 1FCMA 3IWOA 5G18A 1MWTA 2UWXA 3E2LA 1JWZA 1K4EA 4XXRA 1EI5A 5HL1A 1XA1A 3Q7VA 4BD0A 3LY3A 1KVLA 3ZVTA 5J8XA 4GKUA 1SDEA 4QY6A 3ZG7B 3ZCZA 1MBLA 3A3IA 4E6WA 3Q7VB 2IWCA 2XQZA 1L2SA 4S2PA 2WAFA 1GA9A 2HDUA 4GDBA 3OCLA 4OOMA 4LV0A 1BULA 4M3KA 3A3FA 4H8RA 4JF5A 4P0MA 1K38A 3OCNA 4FH4A 4KQOA 1PYYA 4HBTA 4EBLA 5CRFA 4BD1A 4JLFA 4WMCD 1K4FA 1I2WA 3M6BA 3D4FA 3NC8A 4ZAMA 3OC2A 3BFCA 1KE0A 5GLCA 4BL2A 3VFHA 2EFUA 1H8ZA 3IH8A 1E25A 3VSKA 2ZQ7A 2WGVA 2OSUA 2WZXA 1IKIA 2EX8A 4WZ4A 3EQVA 4OPZA 5HARA 5GHXA 2Y2OA 3IXHA 1BSGA 2ZC6B 5DTTA 5TR7A 3ZHHA 3C5AA 3MKFA 4DE1A 3WS4A 5CTNA 5E2HA 3V3RA 4IEDA 3N8LA 4DE0A 3Q1FA 4MBFA 3N8RA 4KZBA 1PWGA 1CK3A 3NY4A 2PBYA 3UO9A 1IEMA 3S4XA 2R9WA 4DDSA 4R1GA 3Q07A 4KZ5A 3WS0A 3OPRA 4BENA 4LCMA 4OH0A 2Y2QA 4RYEA 3M2KA 3FKVA 3TG9A 4OQGA 3BEBA 3FV7A 5CEDA 4KZ8A 1JWVA 2X01A 1Y54A 2Y2JA 4P85A 2G2UA 3MZFA 3ZGAB 4X56A 1L0GA 3AGEA 2H0YA 4CJNA 4S2LA 3S22A 5M19A 3ZVWA 3SH9A 1N9BA 4XUZA 4OPYA 5FI6A 1PWDA 4OLGA 3TOIA 3V3SA 1RP5A 3WS5A 4GD6A 3GR2A 4F94A 1IYOA 3VP4A 1N4OA 1AXBA 1K55C 3O3VA 4IVKA 4O7DA 4UA9A 5FASA 4R0QA 3HUNA 3B3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QNC A;  2Q9M A;  1Q2P A;  3UY6 A;  1ES4 A;  3BYD A;  1W5D A;  4E3I A;  2V2F F;  1I2S A;  2Y2P A;  3CMZ A;  4JXG A;  2C6W B;  4L0L A;  3WRZ A;  2XD5 A;  3PAG A;  4BLM A;  5FQI A;  3BFG A;  1YMS A;  3G31 A;  3HUM A;  3GTC A;  3O88 A;  1XGI A;  3G4P A;  3N4I A;  1TDL A;  5M18 A;  4OP5 A;  4DKI A;  3I7J A;  1XA7 A;  2WKI A;  1RGY A;  3A3J A;  4NK3 A;  2WYX A;  4D2O A;  4N9L A;  4FH2 A;  4QY5 A;  4WM9 A;  5EVL A;  2WKE A;  3PTE A;  3ZG0 A;  4BJP A;  1H8Y A;  2ZC7 A;  3BFF A;  2B5R A;  2JE5 A;  3MFD A;  2EX2 A;  1LI9 A;  1BZA A;  1ALQ A;  1IEL A;  4X53 A;  3V5M A;  1ERO A;  1JWP A;  4WEK A;  2XH9 A;  4ID4 A;  4ZDX A;  4EQI A;  3IF6 C;  1J9M A;  1GHP A;  4LEN A;  1NZU A;  4KG2 A;  4BL3 A;  3EQU A;  3P09 A;  4WYY A;  1U60 A;  4Y0U A;  5AQ9 A;  4GD8 A;  3C7U A;  3W4P A;  1K6S A;  1JTG A;  4JXS A;  5A93 A;  2HDS A;  1GHM A;  1G68 A;  2ZQC A;  4ZJ2 A;  3UPP A;  1FQG A;  4E3O A;  5FQJ A;  3G34 A;  4KEN B;  3WWX A;  5L2F A;  2WAD A;  4XUX A;  2ZMA A;  2Y2I A;  5FI7 A;  1ONG A;  1HTZ A;  4ZJ3 A;  3FYZ A;  1E3U A;  2HP9 A;  4HEF A;  5EVI D;  5EPH A;  2Y2G A;  2J9P A;  1XGJ A;  1ZKJ A;  2Y2K A;  2CC1 A;  3PBR A;  3GMW A;  4OKP A;  4B4Z A;  2IWB A;  4K91 A;  5FAT A;  4R3J A;  3ITA A;  4FCF A;  4E3K A;  1FCO A;  1O07 A;  1K55 A;  5AQB A;  1SCW A;  3A3E A;  1Q2Q A;  3VSL A;  2Z2M B;  2ZQ9 A;  3G2Y A;  2BLS A;  5CGW A;  1W8Y A;  3C4O A;  4R23 A;  4OQH A;  1QME A;  2V20 A;  3NBL A;  4P87 A;  4U0X A;  5FAQ A;  3HLW A;  4KZ9 A;  3ZG9 B;  1IYS A;  3GQZ A;  4ZJ1 A;  1L0D A;  3QHY A;  1W79 A;  4WBG A;  5M1A A;  4S2K A;  1NY0 A;  4E6X A;  1LHY A;  3IQA A;  2QZ6 A;  4X69 A;  4N1X A;  5EVI C;  2Y91 A;  4C3Q A;  4DE3 A;  3IXD A;  1MWU A;  4CPK A;  2RL3 A;  4DDY A;  5DF9 A;  2BG1 A;  2J8Y A;  1FOF A;  3HUO A;  5GLD A;  4PMA A;  4MBH A;  5FA7 A;  2EX9 A;  4KZ6 A;  1KVM A;  4PM7 A;  1K56 A;  1SDN A;  3HLB A;  1KE3 A;  2XFT A;  1M6K A;  5E2F A;  3LO7 A;  2R9X A;  3SS5 A;  4JBF A;  1K57 A;  4B88 A;  5HAP A;  2ZQA A;  1W7F A;  3GVB A;  1S6R A;  3MXR A;  4JKT A;  4JPM A;  1BTL A;  3LY4 A;  3ISG A;  3WS1 A;  2JC7 A;  3HLC A;  5IHV A;  3FZC A;  3SS3 A;  5CHM A;  2ZM2 A;  4E3L A;  4K0X A;  3UPN A;  2OLV A;  4OON A;  4S2J A;  3BLS A;  5DF7 A;  1Z6F A;  1KGE A;  5A92 A;  3VP0 A;  2HP5 A;  1YLJ A;  3UDF A;  1SKF A;  2DNS A;  2ZJ9 A;  4E3M A;  1PWC A;  3IXG A;  5F83 A;  3SOI A;  5TGF A;  4WEL A;  5BOH A;  4LV3 A;  1YLZ A;  3AGD A;  1ONH A;  2HPB A;  4OVD A;  4S2O A;  3FKW A;  4PM9 A;  3VFF A;  4WZ5 C;  3AGF A;  2XLN A;  4UA6 A;  2ZC4 B;  4E3J A;  5FDH A;  2EFX A;  1YT4 A;  1W8Q A;  1JTD A;  2WUQ A;  3W8K A;  3HLF A;  1KDW A;  1ESI A;  2Y4A A;  2XR0 A;  1DJB A;  3NCK A;  3Q81 A;  1IYQ A;  2I72 A;  3VP3 A;  1MWS A;  1NRF A;  1VQQ A;  4R4S A;  4DE2 A;  1BLH A;  1SHV A;  4A5R A;  4LV1 A;  3VP1 A;  4Y0T A;  4UHU A;  1KGF A;  1BUE A;  4NET A;  3BFD A;  1L0F A;  1PIO A;  2EX6 A;  5E2E A;  1DJA A;  4X68 A;  5CGS A;  5F1F A;  2GDN A;  2C5W B;  2VGJ A;  1K54 C;  4B4X A;  1QMF A;  3RXX A;  4PM5 A;  1PW8 A;  2Y59 A;  5GLB A;  2HDR A;  2HDQ A;  3P98 A;  1K6R A;  5EVI B;  3VOY A;  1K25 A;  4GDN A;  1WE4 A;  4PM8 A;  1RGZ A;  4R4R A;  2ZQ8 A;  3IXB A;  4QHC A;  2ZLY A;  3HLD A;  3Q82 A;  3PBO A;  2WGW A;  2FFY A;  3IWQ A;  1DJC A;  2XGN A;  3CJM A;  4Q8I A;  5U47 A;  5KZH A;  1ESU A;  3DW0 A;  3N7W A;  4HBU A;  3IH9 A;  2WGW B;  3BRM A;  3DTM A;  3MZE A;  5EUA A;  4HES A;  1HZO A;  3IHA A;  2A49 A;  3PBS A;  5E2G A;  2XEP A;  3GV9 A;  3V50 A;  1VM1 A;  4OP8 A;  4WMC A;  4MBK A;  5DTS A;  5A90 A;  4OQI A;  4X6T A;  5A91 A;  5JYP A;  1TDG A;  4PM6 A;  4RVA A;  4YFM A;  2V1Z A;  1CI9 A;  2XDM A;  4R3B A;  3ZG5 A;  4BQM A;  3VOZ A;  3OPH A;  5CTM A;  3RXW A;  1I5Q A;  1FSY A;  2WKH A;  4U0T A;  4Z9Q A;  3MXS A;  1CEF A;  3A3D A;  1LL5 A;  4S2M A;  5EE8 A;  2ZD8 A;  5E43 A;  3CZD A;  1BLC A;  3NDG A;  4S2N C;  5GHY A;  4EWF A;  4MLL A;  4N1H A;  5HX9 A;  3ZG8 B;  2Y2L A;  5FQM A;  2A3U A;  2RCX A;  5GL9 A;  1NJ4 A;  1NYM A;  1FR1 A;  1FCN A;  1KDS A;  1L0E A;  3MZD A;  4WEJ A;  5D3O A;  2XFS A;  1PI5 A;  2XD1 A;  5DVA A;  4GZB A;  2P74 A;  3C7V A;  4C75 A;  4N9K A;  1OME A;  2WK0 A;  5FQQ A;  1E4D A;  5DF8 A;  5GLA A;  1MKI A;  1YLW A;  5KSH A;  4OOL A;  3GSG A;  3HLE A;  1ZG4 A;  4ZTK A;  3UNW A;  3G2Z A;  4IVI A;  4QD4 A;  1YM1 A;  3OPP A;  3PBQ A;  4KZ7 A;  5AQ7 A;  2XK1 A;  3VP2 A;  4JF6 A;  3VMA A;  1NXY A;  5FQK A;  4FSF A;  1MXO A;  3OZH A;  4C6Y A;  1IYP A;  1XPB A;  5KMW A;  4GB7 A;  1DY6 A;  1YLY A;  3UDX A;  3FWL A;  3IF5 A;  2J7V A;  3O86 A;  1FSW A;  3IF6 A;  5EEC A;  1NYY A;  4P6B A;  1HD8 A;  1XX2 A;  4N92 A;  4MEZ A;  3BM6 A;  1BLS A;  2ZC3 B;  2PU4 A;  3IF6 B;  4KG5 A;  5AQA A;  2G2W A;  1NZO A;  5JYO A;  3UE0 A;  1YLT A;  3PAE A;  4UAA A;  3N8S A;  3M6H A;  4KQR A;  3M2J A;  4DXB A;  3LCE A;  1XKZ A;  1E3U D;  3HRE A;  3HLG A;  3OPL A;  4DF6 A;  1MY8 A;  1TVF A;  1BT5 A;  3WS2 A;  2E8I A;  2FFF B;  4QB8 A;  2H5S A;  2J9O A;  4Y0O A;  3DWK A;  5HAI A;  3HL9 A;  5KSC A;  1PI4 A;  3O87 A;  4RX2 A;  1PZP A;  4UA7 A;  4S2N A;  5FQ9 A;  1BLP A;  4GOG A;  5CHJ A;  4E3N A;  2QPN A;  4DRT A;  5CHU A;  1KGG A;  3NI9 A;  5HW3 A;  4JXV A;  3PBT A;  3CG5 A;  3W4O A;  2Y2M A;  1PW1 A;  4EV4 A;  1LLB A;  1EWZ A;  3QNB A;  1YMX A;  3BEC A;  1TEM A;  3ZNY A;  1ERQ A;  3IWI A;  3ZDJ A;  4QJG A;  1MWR A;  2EXA A;  5CGX A;  4DXC A;  1S0W A;  3TSG A;  5EOE A;  1RCJ A;  1XP4 A;  3G32 A;  3WRT A;  2WGI A;  4OOY A;  3NIA A;  4OPQ A;  4GN2 A;  2Y2H A;  2JCH A;  3BFE A;  1YQS A;  4JXW A;  5FSR A;  4GNU A;  5EVI A;  4KQQ A;  2PU2 A;  3HBR A;  4RX3 A;  5CXW A;  4PPR A;  3E2K A;  4X55 A;  1FR6 A;  2QMI A;  4KG6 A;  4RA7 A;  5FI2 A;  4ZBE A;  4EBP A;  1CI8 A;  1K56 D;  3ITB A;  1WYC A;  3W4Q A;  1ES2 A;  3HVF A;  1ERM A;  4OQ0 A;  5DTK A;  5F82 A;  5FAP A;  1JVJ A;  1GCE A;  2ZC5 B;  3UDI A;  2OLU A;  1IKG A;  1ZC2 A;  1LL9 A;  5F1G A;  1ES3 A;  4MNR A;  4EUZ A;  2DRW A;  1GHI A;  1LI0 A;  5CER A;  3MBZ A;  2ZM0 A;  1H5X A;  4IBR A;  4QU3 A;  5EOO A;  3S1Y A;  1YLP A;  4U3T A;  2Z2L B;  4IBX A;  2WAE A;  1M40 A;  3SH7 A;  1WYB A;  3UPO A;  2H0T A;  3JYI A;  5HAQ A;  3GRJ A;  4KZ3 A;  4FD8 A;  2EXB A;  4KZA A;  4Y7P A;  3ZFZ A;  4EBN A;  3SH8 A;  1G6A A;  4S2I A;  3RJU A;  5GHZ A;  2Q9N A;  1KE4 A;  2VGK A;  4WZ5 A;  3LEZ A;  2Y2N A;  5FAO A;  4KZ4 A;  3UN7 A;  5HFO A;  2P9V A;  5CEC A;  2XF3 A;  3C4P A;  3G35 A;  3V39 A;  5I94 A;  1K57 C;  2WZZ A;  1O7E A;  4OPR A;  3SS4 A;  2Y55 A;  1XXM A;  2H10 A;  2P9V B;  2X02 A;  2IWD A;  3DWZ A;  3PBN A;  3UE1 A;  3MKE A;  3BLM A;  3ZNT A;  1HVB A;  5CEB A;  4K0W A;  2OV5 A;  1CEG A;  1ZG6 A;  2JBF A;  4LCL A;  3G30 A;  2ZQD A;  1ES5 A;  3Q7Z A;  1MPL A;  3N6I A;  3NDE A;  2DCF A;  3IHB A;  3IT9 A;  2X71 A;  2ZM8 A;  3UE3 A;  1K54 A;  4JF4 A;  1GA0 A;  1PZO A;  5TFQ A;  4OLD A;  4YIN A;  4LV2 A;  1C3B A;  2HP6 A;  1FCM A;  3IWO A;  5G18 A;  1MWT A;  2UWX A;  3E2L A;  1JWZ A;  1K4E A;  4XXR A;  1EI5 A;  5HL1 A;  1XA1 A;  3Q7V A;  4BD0 A;  3LY3 A;  1KVL A;  3ZVT A;  5J8X A;  4GKU A;  1SDE A;  4QY6 A;  3ZG7 B;  3ZCZ A;  1MBL A;  3A3I A;  4E6W A;  3Q7V B;  2IWC A;  2XQZ A;  1L2S A;  4S2P A;  2WAF A;  1GA9 A;  2HDU A;  4GDB A;  3OCL A;  4OOM A;  4LV0 A;  1BUL A;  4M3K A;  3A3F A;  4H8R A;  4JF5 A;  4P0M A;  1K38 A;  3OCN A;  4FH4 A;  4KQO A;  1PYY A;  4HBT A;  4EBL A;  5CRF A;  4BD1 A;  4JLF A;  4WMC D;  1K4F A;  1I2W A;  3M6B A;  3D4F A;  3NC8 A;  4ZAM A;  3OC2 A;  3BFC A;  1KE0 A;  5GLC A;  4BL2 A;  3VFH A;  2EFU A;  1H8Z A;  3IH8 A;  1E25 A;  3VSK A;  2ZQ7 A;  2WGV A;  2OSU A;  2WZX A;  1IKI A;  2EX8 A;  4WZ4 A;  3EQV A;  4OPZ A;  5HAR A;  5GHX A;  2Y2O A;  3IXH A;  1BSG A;  2ZC6 B;  5DTT A;  5TR7 A;  3ZHH A;  3C5A A;  3MKF A;  4DE1 A;  3WS4 A;  5CTN A;  5E2H A;  3V3R A;  4IED A;  3N8L A;  4DE0 A;  3Q1F A;  4MBF A;  3N8R A;  4KZB A;  1PWG A;  1CK3 A;  3NY4 A;  2PBY A;  3UO9 A;  1IEM A;  3S4X A;  2R9W A;  4DDS A;  4R1G A;  3Q07 A;  4KZ5 A;  3WS0 A;  3OPR A;  4BEN A;  4LCM A;  4OH0 A;  2Y2Q A;  4RYE A;  3M2K A;  3FKV A;  3TG9 A;  4OQG A;  3BEB A;  3FV7 A;  5CED A;  4KZ8 A;  1JWV A;  2X01 A;  1Y54 A;  2Y2J A;  4P85 A;  2G2U A;  3MZF A;  3ZGA B;  4X56 A;  1L0G A;  3AGE A;  2H0Y A;  4CJN A;  4S2L A;  3S22 A;  5M19 A;  3ZVW A;  3SH9 A;  1N9B A;  4XUZ A;  4OPY A;  5FI6 A;  1PWD A;  4OLG A;  3TOI A;  3V3S A;  1RP5 A;  3WS5 A;  4GD6 A;  3GR2 A;  4F94 A;  1IYO A;  3VP4 A;  1N4O A;  1AXB A;  1K55 C;  3O3V A;  4IVK A;  4O7D A;  4UA9 A;  5FAS A;  4R0Q A;  3HUN A;  3B3X A; 
#chains in the Genus database with same CATH topology
 1ES4 A;  4E3I A;  1I2S A;  3CMZ A;  4L0L A;  4ARZ B;  1S1Z A;  2C6W B;  1F5M A;  2ZOI A;  3TRC A;  3GTC A;  3S7P A;  3BQA A;  1TDL A;  1SKO B;  3BW6 A;  1XA7 A;  2JHE A;  3A3J A;  2HJ9 C;  5F5Y A;  3E4O A;  5L8M A;  1ERO A;  1GHP A;  4LEN A;  4MN6 A;  2JKR M;  4BL3 A;  5AQ9 A;  3T4S A;  3C7U A;  1GHM A;  2ZQC A;  4WLA A;  4BBV A;  1FQG A;  5L2F A;  4R38 A;  2M7V A;  1HTZ A;  5FEF A;  4IUK A;  3CIT A;  3PBR A;  5J7E A;  2GNX A;  3T4Q A;  3ITA A;  2HGV A;  1FCO A;  4Q0J A;  3A3E A;  1Q2Q A;  2Z2M B;  2BLS A;  1W8Y A;  4R23 A;  1QME A;  1TF1 A;  1IYS A;  3DTK A;  3GQZ A;  4S2K A;  2Y91 A;  1V9Z A;  3IXD A;  4CPK A;  4DDY A;  5DF9 A;  1FOF A;  4MBH A;  1OT6 A;  2XFT A;  3LO7 A;  3SS5 A;  4B88 A;  2HJE A;  4IUH A;  4JPM A;  1BTL A;  4KUO A;  5CHM A;  1T1B A;  2K2N A;  5EM1 A;  2OLV A;  4OON A;  5DF7 A;  5C5K A;  5F83 A;  1ONH A;  4UEY A;  4S2O A;  3VFF A;  3FKW A;  3E98 A;  4WZ5 C;  3AGF A;  3G6O A;  4UA6 A;  2ZC4 B;  2WUQ A;  1JTD A;  2W3G A;  4DMZ A;  1MWS A;  4QPR A;  4GCZ A;  1W63 M;  4UHU A;  1KGF A;  4NET A;  3D72 A;  2GDN A;  4NEE D;  1K54 C;  3RXX A;  3RTY A;  2Y59 A;  2HDQ A;  4O01 A;  3DTE A;  4GDN A;  2ZQ8 A;  2M7U A;  3CUE C;  1Y28 A;  3PBO A;  2JKR I;  4RQ9 A;  2XGN A;  3CJM A;  3JVV A;  4Q8I A;  3T1S A;  5U47 A;  2L0W A;  3N7W A;  2WGW B;  4EQ1 A;  3EWK A;  5EM0 A;  5E2G A;  2OWJ A;  1OTD A;  4MBK A;  4JGO A;  4LRX C;  4OQI A;  4X6T A;  1DP8 A;  1TDG A;  4PM6 A;  4RVA A;  2KOI A;  3ZG5 A;  3B42 A;  3OPH A;  5CTM A;  1I5Q A;  3MXS A;  1MKM A;  3CZD A;  2P08 A;  3ZG8 B;  1NYM A;  1L0E A;  2XFS A;  1PI5 A;  4GZB A;  4HP9 A;  3L9K A;  1OME A;  4Y17 A;  5FQQ A;  5DF8 A;  5GLA A;  1MKI A;  4OOL A;  4E04 A;  1ZG4 A;  3SW1 A;  5HD3 A;  4GLQ A;  3DBA A;  3OPP A;  3PBQ A;  4JF6 A;  3JVU A;  1XPB A;  3HJI A;  1DY6 A;  3UDX A;  4FOF A;  3NUL A;  3O86 A;  1S1Y A;  2VLG A;  4HJ4 A;  1N9O A;  2G2W A;  1NZO A;  2W3E A;  4EEU A;  1VET B;  3PAE A;  3N8S A;  3M6H A;  1VHM A;  5L09 A;  4MN7 A;  2E8I A;  4ZRR A;  2H5S A;  2J9O A;  3P7N A;  3CI6 A;  5CHJ A;  4HY8 A;  4E3N A;  2ACG A;  5CHU A;  3KX0 X;  4EV4 A;  1LLB A;  1VEU B;  3QNB A;  3BEC A;  4DXC A;  4ETX A;  3BFE A;  4JXW A;  4KQQ A;  4Y3I A;  4X55 A;  4KG6 A;  4O0P A;  5FI2 A;  1WYC A;  3W4Q A;  3HVF A;  2W3H A;  2OLU A;  2JKT M;  1ZC2 A;  1ES3 A;  4NXG A;  2DRW A;  1W63 Q;  2ZM0 A;  3S1Y A;  4IBX A;  3HCY A;  3T1Q B;  1OTE A;  3UPO A;  1CQA A;  2H0T A;  3GRJ A;  2EXB A;  4Y7P A;  3ZFZ A;  1AWI A;  3RJU A;  5L10 A;  2OWH A;  3B47 A;  1XJ6 A;  1O7E A;  2BAS A;  2VK3 A;  1N9N A;  3SS4 A;  1XXM A;  4F3L A;  1XJ4 A;  2IWD A;  3TW8 A;  3BLM A;  1HVB A;  4BMW A;  4K0W A;  1CEG A;  1ZG6 A;  1MPL A;  2DCF A;  1FCM A;  3LR0 A;  5G18 A;  2UWX A;  5HL1 A;  4GKU A;  4QY6 A;  1YKD A;  2QJ7 A;  3ZCZ A;  5AVE A;  4E6W A;  4MMN A;  2XQZ A;  4S2P A;  2WAF A;  1VET A;  4GDB A;  4JF5 A;  4B9O A;  2D01 A;  4HBT A;  4JLF A;  4WMC D;  4I39 A;  2WKR A;  5GLC A;  4ETZ A;  3VFH A;  3ULF A;  2XRN A;  2WGV A;  3LID A;  5HAR A;  1STZ A;  5GHX A;  1BSG A;  5DTT A;  5TBM A;  4DE1 A;  4MBF A;  1VEU A;  1CK3 A;  2YKH A;  1IEM A;  4KZ5 A;  4OH0 A;  3FKV A;  5CED A;  1Y54 A;  3EEA A;  1L0G A;  3AGE A;  2L1M A;  5M19 A;  3ZVW A;  3SH9 A;  1N9B A;  4OLG A;  1RP5 A;  3WS5 A;  4GD6 A;  4F94 A;  1AXB A;  1HLU P;  3KYQ A;  2JKT I;  3BJN A;  1T1A A;  3B3X A;  4E3M A;  3QNC A;  1W5D A;  2Y2P A;  1BYW A;  3K3C A;  3PAG A;  3G31 A;  3HUM A;  3O88 A;  4D60 A;  3I7J A;  2KX6 A;  4FH2 A;  4QY5 A;  5EVL A;  2WKE A;  3PTE A;  4BJP A;  1H8Y A;  2V9A A;  2ZC7 A;  3BFF A;  2B5R A;  4Q0I A;  4CQH A;  2JN7 A;  4EET B;  4EQI A;  2R78 A;  4WYY A;  4Y0U A;  3W4P A;  1K6S A;  1JTG A;  5A93 A;  1G68 A;  5FQJ A;  2A2L A;  3FYZ A;  2O9B A;  2J9P A;  1XGJ A;  2Y2K A;  4H6J A;  4OKP A;  2EA9 A;  2IWB A;  4R3J A;  3GDI A;  3P01 A;  3VSL A;  1S4R A;  5G4Z A;  3G2Y A;  2IA2 A;  1F9I A;  2B18 A;  5EV0 A;  3W2Z A;  4MDZ A;  1XFN A;  4P87 A;  3KO6 A;  3FPW A;  1X0O A;  4ZJ1 A;  3QHY A;  4WBG A;  5M1A A;  2QKP A;  5DFY A;  5HPI A;  4BBU A;  3IQA A;  4X69 A;  4N1X A;  5L07 A;  4DN0 A;  3V67 A;  2RL3 A;  4R6L A;  3S7N A;  5FA7 A;  3UB6 A;  1KVM A;  4PM7 A;  1K56 A;  3QP2 A;  1M6K A;  5E2F A;  1YSQ A;  2R9X A;  3KSI A;  2PYP A;  1K57 A;  3H82 A;  5HAP A;  2OAP 1;  2K7S A;  3KYZ A;  4JKT A;  2O0Y A;  2INW A;  2JC7 A;  3HLC A;  5IHV A;  3FZC A;  3SS3 A;  3LI8 A;  2VEA A;  4S2J A;  3BLS A;  5A92 A;  3U4L P;  3VP0 A;  1YLJ A;  4HIA A;  3NJA A;  1PWC A;  3SOI A;  4LV3 A;  1YLZ A;  3AGD A;  1DP9 A;  5EFW A;  2HPB A;  4OVD A;  2PD7 A;  2XLN A;  2V8F A;  3W8K A;  1W8Q A;  1ESI A;  3MQO A;  2XR0 A;  1DJB A;  1IYQ A;  2I72 A;  4PHT A;  3KSF A;  1NRF A;  1VQQ A;  5K5B A;  4R4S A;  3QP4 A;  4EER A;  1L0F A;  1PIO A;  3LGO A;  4X68 A;  4G3W A;  5F1F A;  4B4X A;  1QMF A;  4PM5 A;  4HH3 A;  5EVI B;  1H3Q A;  1VB6 A;  3VOY A;  1K25 A;  4HQA A;  3IXB A;  3UE6 A;  3OOV A;  3C8C A;  2A24 A;  2O9C A;  5TJJ A;  2FFY A;  1V9Y A;  2PT7 A;  1TS7 A;  3DTM A;  1EW0 A;  2WKQ A;  5CX7 A;  3GV9 A;  4OP8 A;  5A90 A;  5JYP A;  4YFM A;  2V1Z A;  1CI9 A;  2XDM A;  4R3B A;  4BQM A;  3RXW A;  4UQI M;  3T1R A;  4U0T A;  4YWZ A;  1CEF A;  3A3D A;  1LL5 A;  3CHW P;  4S2M A;  1OTB A;  1BLC A;  4N1H A;  2A3U A;  4UQI S;  1NJ4 A;  1FR1 A;  1FCN A;  5DVA A;  3RFB A;  3C7V A;  3GSG A;  1DRM A;  4IVI A;  3F1O B;  2ZBB A;  4KZ7 A;  5FQK A;  1P9R A;  1MXO A;  3OZH A;  1IYP A;  4GB7 A;  1YLY A;  3FWL A;  4I38 A;  2J7V A;  1FSW A;  3IF6 A;  3B33 A;  1NLY A;  4I5S A;  2ZC3 B;  5AQA A;  4P6Z M;  3LIB A;  4KQR A;  4IJG A;  4CLC B;  4HNB A;  4QWO A;  1TVF A;  3WS2 A;  4P6Z S;  4Y5F A;  5KSC A;  1PI4 A;  3K3D A;  4X25 A;  1PZP A;  1D7E A;  3C2W A;  1UWP X;  4S2N A;  1BLP A;  4DRT A;  1KGG A;  3NI9 A;  3BY8 A;  3W4O A;  3CG5 A;  2Y2M A;  1PW1 A;  1MZU A;  2OAQ 1;  3ZNY A;  1ERQ A;  5MC7 A;  1MWR A;  2PR5 A;  5CGX A;  1UGU A;  1OTA A;  1CJF A;  1XP4 A;  3NIA A;  1G28 A;  1T18 A;  4GNU A;  5DKK A;  5EVI A;  4RX3 A;  5CXW A;  2PHY A;  2HF6 A;  1FR6 A;  4RA7 A;  4ZBE A;  5HWW A;  1CI8 A;  2L4R A;  1ERM A;  5DTK A;  5FAP A;  1GCE A;  2ZC5 B;  3UDI A;  4AFI A;  1Y4O A;  1LL9 A;  4KUK A;  4EU0 A;  4MNR A;  3MJQ A;  1G6O A;  4EUZ A;  1LI0 A;  4IBR A;  1YLP A;  3T1X A;  2Z2L B;  3MR0 A;  4FD8 A;  4R3A A;  3SH8 A;  1G6A A;  3LI9 A;  5GHZ A;  2Q9N A;  3LEZ A;  3MSH A;  5FAO A;  4MCW A;  2P9V A;  3C4P A;  1K57 C;  4OPR A;  1NWZ A;  3EOI A;  3PBN A;  3DWZ A;  3UE1 A;  3MKE A;  1YPR A;  5CEB A;  2OV5 A;  4F3L B;  2JBF A;  4LCL A;  1ES5 A;  3QP5 A;  3F1O A;  3MF0 A;  4L9F A;  4LRZ E;  3K2N A;  5HPF A;  1C3B A;  2W1T B;  1MWT A;  3IS2 A;  1P0Z A;  1EI5 A;  2GX5 A;  1XA1 A;  5HL6 A;  1S4S A;  3LR5 A;  1UWN X;  4JGR A;  1L2S A;  3KYE A;  2W3F A;  1PYY A;  5CRF A;  4BD1 A;  4CLC A;  1XJ3 A;  4R70 A;  4ZAM A;  3OC2 A;  2EFU A;  2QJ5 A;  1E25 A;  2OSU A;  3LIA A;  1J3W A;  4XT2 A;  2Y2O A;  3ZHH A;  3TE8 A;  3C5A A;  3MKF A;  3V3R A;  4DE0 A;  3Q1F A;  1PWG A;  3NY4 A;  5TBM B;  3S4X A;  3WS0 A;  3OPR A;  4LCM A;  2ZL1 A;  3IX8 A;  4RYE A;  2HV1 A;  3QP6 A;  3LIC A;  4Y15 A;  3TG9 A;  2Z6C A;  3BEB A;  3FV7 A;  1JWV A;  4NXE A;  5DJU A;  3ZGA B;  3UB5 P;  5A8B A;  4CJN A;  3S22 A;  3CWF A;  3V3S A;  3TOI A;  2XSS A;  3GR2 A;  1IYO A;  1XFQ A;  2M1C A;  4GS9 A;  1N4O A;  3O3V A;  5J4E A;  2Q9M A;  3UY6 A;  3BYD A;  2V2F F;  4JXG A;  1ODV A;  3GEC A;  3WRZ A;  2EWV A;  3CLO A;  4BLM A;  5FQI A;  3BFG A;  4GJ4 A;  3UB8 A;  3T4L A;  3G4P A;  5M18 A;  3H7W A;  4DKI A;  2O99 A;  1RGY A;  4NK3 A;  4D2O A;  2WYX A;  1YAX A;  1T19 A;  4WM9 A;  2Q0O A;  1NRJ A;  3RH8 B;  2JE5 A;  3MFD A;  2EX2 A;  1BZA A;  4X53 A;  1ALQ A;  4NG2 A;  3S7O A;  3V5M A;  1JWP A;  5HSQ A;  3IF6 C;  4NXB A;  1J9M A;  3T12 B;  2LB9 A;  1NZU A;  4KG2 A;  3EQU A;  1U60 A;  4GD8 A;  5FDS A;  3IX3 A;  2HDS A;  3IX4 A;  3UPP A;  4EUV A;  5HWV A;  3WWX A;  2WAD A;  4XUX A;  2Y2I A;  5FI7 A;  1ONG A;  3BQ8 A;  3VOL A;  4ZJ3 A;  1E3U A;  2W1T A;  2CC1 A;  3GMW A;  4B4Z A;  4K91 A;  4H6J B;  1K55 A;  3F1N A;  5AQB A;  2ZQ9 A;  1A0K A;  5CGW A;  3C4O A;  4Z1W A;  4OQH A;  5EVE A;  2V20 A;  4U0X A;  5FAQ A;  3HLW A;  4II7 A;  3DAV A;  1W79 A;  1NY0 A;  2QZ6 A;  4LRY C;  5EVI C;  4C3Q A;  3MMH A;  5HDS A;  4JGP A;  4HP4 A;  2EX9 A;  3E4Q A;  1SDN A;  2LB5 A;  1P97 A;  2B02 A;  2Y79 A;  3LY4 A;  3ISG A;  2W1R A;  3H82 B;  3WS1 A;  4HI4 A;  1OPX A;  2ZM2 A;  4E3L A;  1L3L A;  1Z6F A;  1KGE A;  1SKF A;  3IXG A;  4WEL A;  5BOH A;  2J3T C;  4PM9 A;  4ESP A;  1H8M A;  3T4K A;  1WA9 A;  3H9W A;  3LYX A;  4E3J A;  1OJ5 A;  3T4J A;  3HLF A;  1KDW A;  3Q81 A;  5KIZ A;  4DE2 A;  1BLH A;  4A5R A;  4LV1 A;  4Y0T A;  1BUE A;  4ME4 A;  2FH5 A;  2EX6 A;  1DJA A;  4KQD A;  1FIK A;  3MQQ A;  3OLO A;  2HDR A;  3P98 A;  1K6R A;  1WE4 A;  4PM8 A;  3L7H A;  1RGZ A;  4Q0H A;  4R4R A;  4QHC A;  4LLO B;  2ZLY A;  3HLD A;  3Q82 A;  1DJC A;  5KZH A;  1ESU A;  2A24 B;  3MZE A;  1HZO A;  3PBS A;  3R7W A;  4CLC C;  3V50 A;  2EWW A;  3VE4 A;  1FSY A;  1G5U A;  5EE8 A;  1ZTU A;  3NOT C;  5E43 A;  4X1L A;  1N9L A;  3NDG A;  5GHY A;  4EWF A;  3MZD A;  2VA0 A;  1DP6 A;  3EEH A;  4I3I A;  2XD1 A;  2B95 A;  2P74 A;  5DFX A;  2WK0 A;  1E4D A;  2V1A A;  5KSH A;  1S66 L;  3HLE A;  2O9A A;  3G2Z A;  2PAV P;  3LIE A;  3VP2 A;  2XK1 A;  3VMA A;  1NXY A;  4FSF A;  3CUE A;  5KMW A;  2KDK A;  5EEC A;  3UME A;  1HD8 A;  1XX2 A;  4N92 A;  4MEZ A;  3BM6 A;  3IF6 B;  2PU4 A;  3U2A A;  3LR4 A;  5HZH A;  5G4Y A;  4UAA A;  5IT5 A;  3LCE A;  1XKZ A;  3C30 A;  3ZQ5 A;  1MY8 A;  4M4X A;  1BT5 A;  2FFF B;  4QB8 A;  2VV6 A;  3O87 A;  4RX2 A;  2PD8 A;  4GOG A;  4HHD A;  4GHI B;  4PKY A;  5HW3 A;  2VZW A;  4JXV A;  3PXP A;  1EWZ A;  3LR3 A;  1TEM A;  3VE3 A;  4QJG A;  2EXA A;  3T50 A;  5EOE A;  4Y2F A;  1RCJ A;  1T1C A;  2JCH A;  1YQS A;  5HWT A;  2PU2 A;  2V8C A;  4PPR A;  1F2K A;  3E2K A;  2VJW A;  4EBP A;  1K56 D;  2Z6D A;  1ES2 A;  4OQ0 A;  1LSX A;  5F82 A;  3UB9 A;  3ICY A;  2XA7 M;  3DTI A;  2PBD P;  5FL3 A;  5F1G A;  3KSG A;  2G7U A;  5EOO A;  4QU3 A;  5IU1 A;  2XA7 S;  4U3T A;  2WAE A;  1M40 A;  5HDD A;  1WYB A;  3SH7 A;  4JGQ A;  3JYI A;  4DJ3 A;  4YNR A;  4KZ3 A;  2PYR A;  4KZA A;  4X1M A;  2VKS A;  3E4P A;  2V1B A;  1KE4 A;  4EW7 A;  4KZ4 A;  3UN7 A;  5CEC A;  2XF3 A;  4WN5 A;  3V39 A;  5I94 A;  2OOL A;  2WZZ A;  2Y8H A;  2Y55 A;  4HJ6 A;  2P9V B;  3BWL A;  4GW9 A;  4G3K A;  3ZNT A;  4YOF A;  3MXQ A;  3NHQ A;  3G30 A;  2ZQD A;  3IHB A;  2X71 A;  3UE3 A;  1PZO A;  4OLD A;  3FC7 A;  4LV2 A;  3IWO A;  1OJG A;  1K4E A;  4XXR A;  4I3J A;  3Q7V A;  4BD0 A;  3IS2 B;  1KVL A;  3ZVT A;  3ZG7 B;  3PYP A;  1MBL A;  3A3I A;  2IWC A;  1GA9 A;  1KOU A;  2HDU A;  4OOM A;  3OBF A;  2J3W A;  3OCN A;  3IBJ A;  1K4F A;  1I2W A;  3M6B A;  3NC8 A;  3BFC A;  3LEQ A;  2W27 A;  2ZOH A;  3O5Y A;  4L9G A;  2ZQ7 A;  5IS1 A;  2WZX A;  1IKI A;  3EQV A;  2NUP C;  4GHI A;  3WS4 A;  5E2H A;  3N8L A;  4XT2 B;  3N8R A;  4KZB A;  2PBY A;  2V0W A;  2R9W A;  4DDS A;  3Q07 A;  3IBR A;  2Y2Q A;  3S7Q A;  3M2K A;  2WKP A;  4OQG A;  2X01 A;  2ZL1 B;  3FPV A;  3KSH A;  4P85 A;  2I9V A;  3TJZ C;  3MZF A;  1PFL A;  4X56 A;  3NOP C;  1D1J A;  2H0Y A;  4S2L A;  4XUZ A;  4OPY A;  1PWD A;  2DMW A;  5J3W A;  4FTX A;  2W0N A;  4IVK A;  4O8G A;  4UA9 A;  4ARZ A;  3HUN A;  5GLD A;  2HZ5 A;  4GS9 B;  1Q2P A;  3HJK A;  2XD5 A;  1PNE A;  1XJ2 A;  1YMS A;  1LL8 A;  1SKO A;  1XGI A;  3N4I A;  5DJT A;  4OP5 A;  2WKI A;  5DKL A;  4N9L A;  3ZG0 A;  1CF0 A;  5AVF A;  3H7W B;  3ZYT A;  3UMD A;  1LI9 A;  1IEL A;  4WL9 A;  4LGW A;  4ZDX A;  4WEK A;  2XH9 A;  4ID4 A;  5AJG A;  5LBR A;  2P7J A;  3P09 A;  3MQ0 A;  4JXS A;  4DJ2 A;  4ZJ2 A;  4NKP A;  4E3O A;  3G34 A;  4KEN B;  2ZMA A;  4L9E A;  2HP9 A;  4HEF A;  5EVI D;  5EPH A;  2Y2G A;  1ZKJ A;  3JPU A;  1NLZ A;  2UV0 E;  5FAT A;  3T4O A;  4FCF A;  4E3K A;  1O07 A;  2GJ3 A;  3QP1 A;  1SCW A;  3F1N B;  1K0K A;  3NBL A;  4KZ9 A;  3ZG9 B;  1L0D A;  5HD5 A;  3F1P B;  4E6X A;  1LHY A;  4DE3 A;  1MWU A;  2PDR A;  2BG1 A;  2J8Y A;  2J3T D;  3HUO A;  2QWS A;  4PMA A;  3UB7 A;  4KZ6 A;  3HLB A;  1KE3 A;  3SZT A;  2H28 A;  3E0Y A;  1PRQ A;  4JBF A;  2ZQA A;  1W7F A;  3GVB A;  1S6R A;  3MXR A;  4K0X A;  3UPN A;  4Y13 A;  2QYB A;  2HP5 A;  3UDF A;  2DNS A;  2ZJ9 A;  4EES A;  5TGF A;  4EEP A;  1D06 A;  2VX8 A;  5FDH A;  2EFX A;  1YT4 A;  2Y4A A;  3NCK A;  2E8J A;  3VP3 A;  2W3D A;  4CLC D;  1SHV A;  3VP1 A;  3BFD A;  5E2E A;  2YKF A;  5CGS A;  3C38 A;  3VV4 A;  2ZMV A;  2C5W B;  2VGJ A;  2PRF A;  1S67 L;  1PW8 A;  5GLB A;  2ZMF A;  4B93 A;  1Z09 A;  2WGW A;  1TS6 A;  3IWQ A;  3NEC A;  3DW0 A;  4HBU A;  3IH9 A;  3BRM A;  3R4K A;  1MC0 A;  5EUA A;  4HES A;  4LPZ A;  3PHY A;  3FG8 A;  3IHA A;  2A49 A;  2XEP A;  1VM1 A;  2FZ0 A;  4WMC A;  5DTS A;  5A91 A;  3R7W B;  3VOZ A;  1P9W A;  2WKH A;  4Z9Q A;  2ZD8 A;  1JNU A;  4S2N C;  4MLL A;  5HX9 A;  2PR6 A;  2Y2L A;  5FQM A;  2RCX A;  5GL9 A;  1FIL A;  1KDS A;  4K08 A;  5D3O A;  4WEJ A;  2VGL M;  4C75 A;  4N9K A;  1YLW A;  3F1P A;  4BWI A;  2VGL S;  4ZTK A;  3UNW A;  3MFX A;  4QD4 A;  1YM1 A;  1IFQ A;  5AQ7 A;  1OTI A;  4C6Y A;  3IF5 A;  2J80 A;  1NYY A;  4P6B A;  1TS8 A;  1BLS A;  3EGX C;  1IOU A;  4KG5 A;  5JYO A;  3LFV A;  3UE0 A;  1YLT A;  2GZA A;  3EGD C;  2AVX A;  3M2J A;  4DXB A;  1E3U D;  3HRE A;  3HLG A;  3OPL A;  4DF6 A;  3CPT B;  2QHK A;  4Y0O A;  3DWK A;  5HAI A;  3HL9 A;  4UA7 A;  5FQ9 A;  4CLC E;  2QPN A;  4PKY G;  3PBT A;  3PR6 A;  4PAU A;  1LSW A;  1YSP A;  1YMX A;  4NXF A;  3IWI A;  3ZDJ A;  1S0W A;  3TSG A;  3QP8 A;  3WRT A;  3G32 A;  2NUT C;  2WGI A;  4OOY A;  2D02 A;  4OPQ A;  4GN2 A;  1SZV A;  2Y2H A;  1ACF A;  5FSR A;  4LFU A;  3HBR A;  2QMI A;  5FEG A;  3ITB A;  5F68 A;  4HOI A;  5I5L A;  1JVJ A;  1IKG A;  1GHI A;  3LIF A;  3NOU C;  3MBZ A;  5CER A;  1H5X A;  4FUW A;  5F69 A;  1OT9 A;  5HAQ A;  1LSV A;  2CMN A;  4EBN A;  4S2I A;  2K31 A;  2VGK A;  4WZ5 A;  2KLI A;  2Y2N A;  4I3A A;  5HFO A;  3CAX A;  3G35 A;  2H10 A;  2X02 A;  2BTF P;  4WF0 A;  2XRO A;  1H0M A;  2VV8 A;  1GSV A;  3Q7Z A;  3N6I A;  3NDE A;  3IT9 A;  2ZM8 A;  1K54 A;  4JF4 A;  1GA0 A;  5TFQ A;  4YIN A;  2HP6 A;  3D3O A;  3E2L A;  1JWZ A;  1TS0 A;  3BY9 A;  3LY3 A;  5J8X A;  4IHQ A;  4BBT A;  1SDE A;  2JKG A;  3A0V A;  3Q7V B;  3OCL A;  5HDC A;  4LV0 A;  1BUL A;  4M3K A;  3A3F A;  1ZHH B;  4H8R A;  4P0M A;  1K38 A;  1F98 A;  2JKF A;  4FH4 A;  4KQO A;  5F6A A;  4EBL A;  4HJ3 A;  3CPT A;  3A0R A;  3D4F A;  1KE0 A;  3D9Y A;  4BL2 A;  1H8Z A;  3IH8 A;  3T4T A;  3VSK A;  4HH2 A;  1LT0 A;  2EX8 A;  2MJ6 A;  4WZ4 A;  4OPZ A;  1GSX A;  3IXH A;  2ZC6 B;  5TR7 A;  5CTN A;  4IED A;  3UO9 A;  3LUQ A;  4R1G A;  4BEN A;  4MN5 A;  2P04 A;  1TD5 A;  2V0U A;  4KZ8 A;  2Y2J A;  4G3V A;  4WUJ A;  2G2U A;  3MS6 A;  1GSW A;  4EXO A;  5FI6 A;  3A0S A;  3VP4 A;  4O7D A;  1K55 C;  5FAS A;  4R0Q A;  2VV7 A; 
#chains in the Genus database with same CATH homology
 3QNC A;  2Q9M A;  1Q2P A;  3UY6 A;  1ES4 A;  3BYD A;  1W5D A;  4E3I A;  2V2F F;  1I2S A;  2Y2P A;  3CMZ A;  4JXG A;  2C6W B;  4L0L A;  3WRZ A;  2XD5 A;  3PAG A;  4BLM A;  5FQI A;  3BFG A;  1YMS A;  3G31 A;  3HUM A;  3GTC A;  3O88 A;  1XGI A;  3G4P A;  3N4I A;  1TDL A;  5M18 A;  4OP5 A;  4DKI A;  3I7J A;  1XA7 A;  2WKI A;  1RGY A;  3A3J A;  4NK3 A;  2WYX A;  4D2O A;  4N9L A;  4FH2 A;  4QY5 A;  4WM9 A;  5EVL A;  2WKE A;  3PTE A;  3ZG0 A;  4BJP A;  1H8Y A;  2ZC7 A;  3BFF A;  2B5R A;  2JE5 A;  3MFD A;  2EX2 A;  1LI9 A;  1BZA A;  1ALQ A;  1IEL A;  4X53 A;  3V5M A;  1ERO A;  1JWP A;  4WEK A;  2XH9 A;  4ID4 A;  4ZDX A;  4EQI A;  3IF6 C;  1J9M A;  1GHP A;  4LEN A;  1NZU A;  4KG2 A;  4BL3 A;  3EQU A;  3P09 A;  4WYY A;  1U60 A;  4Y0U A;  5AQ9 A;  4GD8 A;  3C7U A;  3W4P A;  1K6S A;  1JTG A;  4JXS A;  5A93 A;  2HDS A;  1GHM A;  1G68 A;  2ZQC A;  4ZJ2 A;  3UPP A;  1FQG A;  4E3O A;  5FQJ A;  3G34 A;  4KEN B;  3WWX A;  5L2F A;  2WAD A;  4XUX A;  2ZMA A;  2Y2I A;  5FI7 A;  1ONG A;  1HTZ A;  4ZJ3 A;  3FYZ A;  1E3U A;  2HP9 A;  4HEF A;  5EVI D;  5EPH A;  2Y2G A;  2J9P A;  1XGJ A;  1ZKJ A;  2Y2K A;  2CC1 A;  3PBR A;  3GMW A;  4OKP A;  4B4Z A;  2IWB A;  4K91 A;  5FAT A;  4R3J A;  3ITA A;  4FCF A;  4E3K A;  1FCO A;  1O07 A;  1K55 A;  5AQB A;  1SCW A;  3A3E A;  1Q2Q A;  3VSL A;  2Z2M B;  2ZQ9 A;  3G2Y A;  2BLS A;  5CGW A;  1W8Y A;  3C4O A;  4R23 A;  4OQH A;  1QME A;  2V20 A;  3NBL A;  4P87 A;  4U0X A;  5FAQ A;  3HLW A;  4KZ9 A;  3ZG9 B;  1IYS A;  3GQZ A;  4ZJ1 A;  1L0D A;  3QHY A;  1W79 A;  4WBG A;  5M1A A;  4S2K A;  1NY0 A;  4E6X A;  1LHY A;  3IQA A;  2QZ6 A;  4X69 A;  4N1X A;  5EVI C;  2Y91 A;  4C3Q A;  4DE3 A;  3IXD A;  1MWU A;  4CPK A;  2RL3 A;  4DDY A;  5DF9 A;  2BG1 A;  2J8Y A;  1FOF A;  3HUO A;  5GLD A;  4PMA A;  4MBH A;  5FA7 A;  2EX9 A;  4KZ6 A;  1KVM A;  4PM7 A;  1K56 A;  1SDN A;  3HLB A;  1KE3 A;  2XFT A;  1M6K A;  5E2F A;  3LO7 A;  2R9X A;  3SS5 A;  4JBF A;  1K57 A;  4B88 A;  5HAP A;  2ZQA A;  1W7F A;  3GVB A;  1S6R A;  3MXR A;  4JKT A;  4JPM A;  1BTL A;  3LY4 A;  3ISG A;  3WS1 A;  2JC7 A;  3HLC A;  5IHV A;  3FZC A;  3SS3 A;  5CHM A;  2ZM2 A;  4E3L A;  4K0X A;  3UPN A;  2OLV A;  4OON A;  4S2J A;  3BLS A;  5DF7 A;  1Z6F A;  1KGE A;  5A92 A;  3VP0 A;  2HP5 A;  1YLJ A;  3UDF A;  1SKF A;  2DNS A;  2ZJ9 A;  4E3M A;  1PWC A;  3IXG A;  5F83 A;  3SOI A;  5TGF A;  4WEL A;  5BOH A;  4LV3 A;  1YLZ A;  3AGD A;  1ONH A;  2HPB A;  4OVD A;  4S2O A;  3FKW A;  4PM9 A;  3VFF A;  4WZ5 C;  3AGF A;  2XLN A;  4UA6 A;  2ZC4 B;  4E3J A;  5FDH A;  2EFX A;  1YT4 A;  1W8Q A;  1JTD A;  2WUQ A;  3W8K A;  3HLF A;  1KDW A;  1ESI A;  2Y4A A;  2XR0 A;  1DJB A;  3NCK A;  3Q81 A;  1IYQ A;  2I72 A;  3VP3 A;  1MWS A;  1NRF A;  1VQQ A;  4R4S A;  4DE2 A;  1BLH A;  1SHV A;  4A5R A;  4LV1 A;  3VP1 A;  4Y0T A;  4UHU A;  1KGF A;  1BUE A;  4NET A;  3BFD A;  1L0F A;  1PIO A;  2EX6 A;  5E2E A;  1DJA A;  4X68 A;  5CGS A;  5F1F A;  2GDN A;  2C5W B;  2VGJ A;  1K54 C;  4B4X A;  1QMF A;  3RXX A;  4PM5 A;  1PW8 A;  2Y59 A;  5GLB A;  2HDR A;  2HDQ A;  3P98 A;  1K6R A;  5EVI B;  3VOY A;  1K25 A;  4GDN A;  1WE4 A;  4PM8 A;  1RGZ A;  4R4R A;  2ZQ8 A;  3IXB A;  4QHC A;  2ZLY A;  3HLD A;  3Q82 A;  3PBO A;  2WGW A;  2FFY A;  3IWQ A;  1DJC A;  2XGN A;  3CJM A;  4Q8I A;  5U47 A;  5KZH A;  1ESU A;  3DW0 A;  3N7W A;  4HBU A;  3IH9 A;  2WGW B;  3BRM A;  3DTM A;  3MZE A;  5EUA A;  4HES A;  1HZO A;  3IHA A;  2A49 A;  3PBS A;  5E2G A;  2XEP A;  3GV9 A;  3V50 A;  1VM1 A;  4OP8 A;  4WMC A;  4MBK A;  5DTS A;  5A90 A;  4OQI A;  4X6T A;  5A91 A;  5JYP A;  1TDG A;  4PM6 A;  4RVA A;  4YFM A;  2V1Z A;  1CI9 A;  2XDM A;  4R3B A;  3ZG5 A;  4BQM A;  3VOZ A;  3OPH A;  5CTM A;  3RXW A;  1I5Q A;  1FSY A;  2WKH A;  4U0T A;  4Z9Q A;  3MXS A;  1CEF A;  3A3D A;  1LL5 A;  4S2M A;  5EE8 A;  2ZD8 A;  5E43 A;  3CZD A;  1BLC A;  3NDG A;  4S2N C;  5GHY A;  4EWF A;  4MLL A;  4N1H A;  5HX9 A;  3ZG8 B;  2Y2L A;  5FQM A;  2A3U A;  2RCX A;  5GL9 A;  1NJ4 A;  1NYM A;  1FR1 A;  1FCN A;  1KDS A;  1L0E A;  3MZD A;  4WEJ A;  5D3O A;  2XFS A;  1PI5 A;  2XD1 A;  5DVA A;  4GZB A;  2P74 A;  3C7V A;  4C75 A;  4N9K A;  1OME A;  2WK0 A;  5FQQ A;  1E4D A;  5DF8 A;  5GLA A;  1MKI A;  1YLW A;  5KSH A;  4OOL A;  3GSG A;  3HLE A;  1ZG4 A;  4ZTK A;  3UNW A;  3G2Z A;  4IVI A;  4QD4 A;  1YM1 A;  3OPP A;  3PBQ A;  4KZ7 A;  5AQ7 A;  2XK1 A;  3VP2 A;  4JF6 A;  3VMA A;  1NXY A;  5FQK A;  4FSF A;  1MXO A;  3OZH A;  4C6Y A;  1IYP A;  1XPB A;  5KMW A;  4GB7 A;  1DY6 A;  1YLY A;  3UDX A;  3FWL A;  3IF5 A;  2J7V A;  3O86 A;  1FSW A;  3IF6 A;  5EEC A;  1NYY A;  4P6B A;  1HD8 A;  1XX2 A;  4N92 A;  4MEZ A;  3BM6 A;  1BLS A;  2ZC3 B;  2PU4 A;  3IF6 B;  4KG5 A;  5AQA A;  2G2W A;  1NZO A;  5JYO A;  3UE0 A;  1YLT A;  3PAE A;  4UAA A;  3N8S A;  3M6H A;  4KQR A;  3M2J A;  4DXB A;  3LCE A;  1XKZ A;  1E3U D;  3HRE A;  3HLG A;  3OPL A;  4DF6 A;  1MY8 A;  1TVF A;  1BT5 A;  3WS2 A;  2E8I A;  2FFF B;  4QB8 A;  2H5S A;  2J9O A;  4Y0O A;  3DWK A;  5HAI A;  3HL9 A;  5KSC A;  1PI4 A;  3O87 A;  4RX2 A;  1PZP A;  4UA7 A;  4S2N A;  5FQ9 A;  1BLP A;  4GOG A;  5CHJ A;  4E3N A;  2QPN A;  4DRT A;  5CHU A;  1KGG A;  3NI9 A;  5HW3 A;  4JXV A;  3PBT A;  3CG5 A;  3W4O A;  2Y2M A;  1PW1 A;  4EV4 A;  1LLB A;  1EWZ A;  3QNB A;  1YMX A;  3BEC A;  1TEM A;  3ZNY A;  1ERQ A;  3IWI A;  3ZDJ A;  4QJG A;  1MWR A;  2EXA A;  5CGX A;  4DXC A;  1S0W A;  3TSG A;  5EOE A;  1RCJ A;  1XP4 A;  3G32 A;  3WRT A;  2WGI A;  4OOY A;  3NIA A;  4OPQ A;  4GN2 A;  2Y2H A;  2JCH A;  3BFE A;  1YQS A;  4JXW A;  5FSR A;  4GNU A;  5EVI A;  4KQQ A;  2PU2 A;  3HBR A;  4RX3 A;  5CXW A;  4PPR A;  3E2K A;  4X55 A;  1FR6 A;  2QMI A;  4KG6 A;  4RA7 A;  5FI2 A;  4ZBE A;  4EBP A;  1CI8 A;  1K56 D;  3ITB A;  1WYC A;  3W4Q A;  1ES2 A;  3HVF A;  1ERM A;  4OQ0 A;  5DTK A;  5F82 A;  5FAP A;  1JVJ A;  1GCE A;  2ZC5 B;  3UDI A;  2OLU A;  1IKG A;  1ZC2 A;  1LL9 A;  5F1G A;  1ES3 A;  4MNR A;  4EUZ A;  2DRW A;  1GHI A;  1LI0 A;  5CER A;  3MBZ A;  2ZM0 A;  1H5X A;  4IBR A;  4QU3 A;  5EOO A;  3S1Y A;  1YLP A;  4U3T A;  2Z2L B;  4IBX A;  2WAE A;  1M40 A;  3SH7 A;  1WYB A;  3UPO A;  2H0T A;  3JYI A;  5HAQ A;  3GRJ A;  4KZ3 A;  4FD8 A;  2EXB A;  4KZA A;  4Y7P A;  3ZFZ A;  4EBN A;  3SH8 A;  1G6A A;  4S2I A;  3RJU A;  5GHZ A;  2Q9N A;  1KE4 A;  2VGK A;  4WZ5 A;  3LEZ A;  2Y2N A;  5FAO A;  4KZ4 A;  3UN7 A;  5HFO A;  2P9V A;  5CEC A;  2XF3 A;  3C4P A;  3G35 A;  3V39 A;  5I94 A;  1K57 C;  2WZZ A;  1O7E A;  4OPR A;  3SS4 A;  2Y55 A;  1XXM A;  2H10 A;  2P9V B;  2X02 A;  2IWD A;  3DWZ A;  3PBN A;  3UE1 A;  3MKE A;  3BLM A;  3ZNT A;  1HVB A;  5CEB A;  4K0W A;  2OV5 A;  1CEG A;  1ZG6 A;  2JBF A;  4LCL A;  3G30 A;  2ZQD A;  1ES5 A;  3Q7Z A;  1MPL A;  3N6I A;  3NDE A;  2DCF A;  3IHB A;  3IT9 A;  2X71 A;  2ZM8 A;  3UE3 A;  1K54 A;  4JF4 A;  1GA0 A;  1PZO A;  5TFQ A;  4OLD A;  4YIN A;  4LV2 A;  1C3B A;  2HP6 A;  1FCM A;  3IWO A;  5G18 A;  1MWT A;  2UWX A;  3E2L A;  1JWZ A;  1K4E A;  4XXR A;  1EI5 A;  5HL1 A;  1XA1 A;  3Q7V A;  4BD0 A;  3LY3 A;  1KVL A;  3ZVT A;  5J8X A;  4GKU A;  1SDE A;  4QY6 A;  3ZG7 B;  3ZCZ A;  1MBL A;  3A3I A;  4E6W A;  3Q7V B;  2IWC A;  2XQZ A;  1L2S A;  4S2P A;  2WAF A;  1GA9 A;  2HDU A;  4GDB A;  3OCL A;  4OOM A;  4LV0 A;  1BUL A;  4M3K A;  3A3F A;  4H8R A;  4JF5 A;  4P0M A;  1K38 A;  3OCN A;  4FH4 A;  4KQO A;  1PYY A;  4HBT A;  4EBL A;  5CRF A;  4BD1 A;  4JLF A;  4WMC D;  1K4F A;  1I2W A;  3M6B A;  3D4F A;  3NC8 A;  4ZAM A;  3OC2 A;  3BFC A;  1KE0 A;  5GLC A;  4BL2 A;  3VFH A;  2EFU A;  1H8Z A;  3IH8 A;  1E25 A;  3VSK A;  2ZQ7 A;  2WGV A;  2OSU A;  2WZX A;  1IKI A;  2EX8 A;  4WZ4 A;  3EQV A;  4OPZ A;  5HAR A;  5GHX A;  2Y2O A;  3IXH A;  1BSG A;  2ZC6 B;  5DTT A;  5TR7 A;  3ZHH A;  3C5A A;  3MKF A;  4DE1 A;  3WS4 A;  5CTN A;  5E2H A;  3V3R A;  4IED A;  3N8L A;  4DE0 A;  3Q1F A;  4MBF A;  3N8R A;  4KZB A;  1PWG A;  1CK3 A;  3NY4 A;  2PBY A;  3UO9 A;  1IEM A;  3S4X A;  2R9W A;  4DDS A;  4R1G A;  3Q07 A;  4KZ5 A;  3WS0 A;  3OPR A;  4BEN A;  4LCM A;  4OH0 A;  2Y2Q A;  4RYE A;  3M2K A;  3FKV A;  3TG9 A;  4OQG A;  3BEB A;  3FV7 A;  5CED A;  4KZ8 A;  1JWV A;  2X01 A;  1Y54 A;  2Y2J A;  4P85 A;  2G2U A;  3MZF A;  3ZGA B;  4X56 A;  1L0G A;  3AGE A;  2H0Y A;  4CJN A;  4S2L A;  3S22 A;  5M19 A;  3ZVW A;  3SH9 A;  1N9B A;  4XUZ A;  4OPY A;  5FI6 A;  1PWD A;  4OLG A;  3TOI A;  3V3S A;  1RP5 A;  3WS5 A;  4GD6 A;  3GR2 A;  4F94 A;  1IYO A;  3VP4 A;  1N4O A;  1AXB A;  1K55 C;  3O3V A;  4IVK A;  4O7D A;  4UA9 A;  5FAS A;  4R0Q A;  3HUN A;  3B3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...