3LIAA

Crystal structure of the extracellular domain of the putative histidine kinase mmhk1s-z2
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
262
structure length
262
Chain Sequence
KLAYEKSIEMAGNYANQFDAQMEANQAIARTLACTMAEYGSQDREEAMSIIKRILNENPQLIGVYLGYEPDAFDGRDKNYINAPGHDSTGRFVPYCNKINGPVIIEPLVHYDSSDYYQLPKTTGKDTLTEPYFYEGIFMVSYDSPIFKNGEFAGIAGVDVPLEYVDDVASSIRTFDTGYAFMVSNTGIFLSHPTQKNWIGEKSLSDFDVEEIKNAASDIREGIGGHVEIKDPITGKTVIMFYEPVKTGDFSFVLVVPKEEML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical sensory transduction histidine kinase
publication title Structural characterization of the predominant family of histidine kinase sensor domains.
pubmed doi rcsb
source organism Methanosarcina mazei
molecule tags Signaling protein
total genus 77
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02743 dCache_1 Cache domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3liaA01
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3liaA02
5HDCA 2VV7A 2JHEA 1GSXA 4BBUA 2W0NA 3MFXA 3GECA 3BWLA 1OJGA 2QJ5A 3LI8A 4LLOB 4MN5A 3CLOA 2W27A 3D72A 2V1AA 3LICA 3CAXA 3EWKA 2OWJA 1N9NA 1F98A 3UB8A 1XJ4A 4HJ6A 4HJ4A 5HWVA 1S1YA 1P0ZA 5DJUA 2JN7A 4WF0A 1TS8A 3E4OA 4EERA 5HDSA 1KOUA 4HH2A 2WKRA 4BBVA 2V0WA 2PD7A 3A0SA 4KUOA 2D02A 2K7SA 3GDIA 3NOPC 5DKKA 3F1PA 1UWNX 3BY8A 5HD5A 1UWPX 2PR6A 4WUJA 4HP9A 3C8CA 2ZOHA 4R6LA 1V9ZA 4KQDA 2QHKA 2Z6CA 3E4QA 3C2WA 3MJQA 1T18A 1OT6A 2KDKA 1T1BA 3F1NB 4EEUA 5IU1A 5F69A 1OTIA 1XJ6A 2PDRA 4HY8A 5F6AA 4JGOA 3H7WA 3LIFA 4GS9B 5F68A 1S4RA 1DP9A 4GHIB 4L9GA 1S66L 3LYXA 4R70A 1XJ2A 3PYPA 1OTEA 3NOUC 2P7JA 4WLAA 3H9WA 2OWHA 5HWWA 3LIBA 5F5YA 5J4EA 1XFNA 2QKPA 3NOTC 4HH3A 4HJ3A 5HWTA 2VLGA 3LIDA 1LL8A 3PHYA 4JGRA 5A8BA 4EETB 4F3LA 3MQQA 2VV8A 4NXGA 3H82A 1Y28A 1OTAA 3VE3A 2A24A 3F1OA 4HHDA 4I39A 2ZBBA 5IS1A 2PD8A 1T1AA 4H6JA 4I5SA 4LRYC 1T19A 2QJ7A 2PHYA 3T50A 3MR0A 4YWZA 3HJKA 4B9OA 3CWFA 2QWSA 3MXQA 1P97A 4R38A 2PR5A 4NXFA 4M4XA 4BBTA 4GCZA 1LSXA 3OLOA 1DP8A 5TBMB 5G4ZA 2PYRA 2CMNA 1TS0A 2L4RA 4WL9A 4LRXC 2HV1A 4EQ1A 2L0WA 2V0UA 4E04A 1D7EA 1G28A 2M1CA 1D06A 3UE6A 1X0OA 2EA9A 4XT2B 2WKPA 3VE4A 5DKLA 2V9AA 3UMEA 1OT9A 1S4SA 3KX0X 5G4YA 3IS2B 3UMDA 2OOLA 1N9OA 3SW1A 1WA9A 2YKHA 1XJ3A 4EXOA 5AVFA 3LIAA 5HZHA 1MZUA 5HD3A 3VOLA 2L1MA 5KIZA 3E4PA 5TBMA 3ULFA 4HNBA 3A0RA 4MN6A 3UB7A 2VEAA 2V1BA 3NHQA 3LI9A 4HI4A 5EFWA 4PKYG 3A0VA 4L9EA 2I9VA 2J80A 4HOIA 4NXEA 1T1CA 2BASA 1UGUA 3F1NA 4DJ2A 1VB6A 4HQAA 1GSWA 1LSVA 1OTDA 2PYPA 2YKFA 2D01A 4GS9A 1ODVA 5HDDA 1OJ5A 2KX6A 4GHIA 4PKYA 3B33A 4R3AA 1F9IA 4LPZA 1V9YA 1LSWA 4I3IA 3F1PB 4GW9A 1DRMA 3HJIA 3LUQA 4JGPA 4EESA 2ZOIA 3MQOA 4JGQA 3UB6A 3ZQ5A 4I3AA 4WN5A 1JNUA 4NXBA 3LIEA 3H7WB 5DJTA 5J3WA 3EEHA 5AVEA 5J7EA 1LT0A 4LRZE 3G6OA 3FC7A 4DJ3A 2INWA 3IBRA 4EEPA 3FG8A 3NJAA 4L9FA 4K08A 2VV6A 1BYWA 3RH8B 1XFQA 4KUKA 3BY9A 1S67L 4I3JA 4F3LB 2R78A 3K3CA 2B02A 1TS7A 1GSVA 3H82B 4XT2A 2A24B 3F1OB 2H28A 1EW0A 3RTYA 2Z6DA 1OTBA 2GJ3A 4HIAA 4H6JB 4I38A 4HP4A 1TS6A 3IS2A 3P7NA 4RQ9A 1N9LA 5HSQA 3UB9A 1S1ZA 1NWZA 2WKQA 5I5LA 3ICYA 1DP6A 4EW7A 3K3DA
chains in the Genus database with same CATH superfamily
2XA7S 3A3IA 2VV7A 1GSXA 4BBUA 2Y4AA 2WKIA 4ID4A 2V8FA 3LI8A 1KVLA 3K2NA 4K0WA 3CLOA 2W27A 5EOOA 1JTDA 1JWZA 1KE0A 1NYYA 5EM0A 1N9NA 3CMZA 3QP2A 2ZMAA 2ZM8A 1XJ4A 5CXWA 5HARA 4HJ6A 1H5XA 3KSIA 4E3OA 1IYSA 3ZCZA 5DJUA 2OSUA 4Y2FA 4E3KA 3UDIA 4O0PA 3E4OA 2B18A 2ZQ7A 5HDSA 4EU0A 5EPHA 5CRFA 1BT5A 4BBVA 4P85A 3IX4A 1MWSA 4KUOA 3IT9A 4ARZB 2K7SA 1L2SA 3NOPC 1OPXA 4X6TA 5DKKA 2O9CA 4RX3A 4P6BA 3BY8A 1SKOB 5GHZA 5HD5A 2Y8HA 2PR6A 2C5WB 3IWOA 1WYBA 2ZC6B 2Z6CA 2WGWB 3UE3A 5FL3A 4LFUA 2ZC7A 4ZRRA 2KDKA 1K56D 2V2FF 3ZVWA 3F1NB 1S6RA 3CZDA 3IF6A 5F69A 1XJ6A 2VA0A 3VP4A 4OPZA 5F6AA 1TDGA 2Y59A 2HDSA 3MKEA 3G30A 5CEDA 1E3UA 4PM5A 5EOEA 4XUXA 2FFFB 4GHIB 4ZJ1A 1S66L 3IF6C 1VEUB 2UV0E 5EUAA 3PYPA 3NOUC 4G3WA 3CPTB 1P9WA 2JKGA 1Z09A 2BLSA 2OLUA 3C4OA 2A49A 1STZA 5KSCA 3DTKA 4HJ3A 5HFOA 3LIDA 4UAAA 4KZ9A 2PRFA 4EETB 2FH5A 2X01A 1MKIA 1OTAA 2A24A 3F1OA 3IWIA 3V39A 5F1FA 5L09A 2ZBBA 4WEKA 4Q0JA 3R7WA 2PD8A 1T1AA 4I5SA 4LRYC 5M1AA 4FUWA 5AJGA 1W63M 2Y2OA 1LHYA 2PHYA 5FAQA 3C4PA 3WS0A 4KQRA 1PZOA 4PPRA 4B9OA 3PBSA 2QWSA 4JF5A 3UN7A 2JKTI 2WGIA 4Y0TA 4IVKA 3UE1A 3ZNYA 4BBTA 4LV3A 1YLYA 4R3BA 2W3GA 4X55A 3P98A 3OLOA 2ZQCA 4FOFA 3HVFA 4S2PA 4PM6A 2UWXA 1YSPA 4Q0HA 2ZQDA 3OPRA 5G4ZA 3S22A 3IWQA 1MXOA 4WL9A 4JXSA 4EBLA 1CJFA 3PAGA 1E25A 1DJAA 4GZBA 2JC7A 5CX7A 3KSHA 4EBNA 5DKLA 3VE4A 2Y2LA 1IELA 3BEBA 3DWKA 4HESA 1OT9A 1S4SA 3KX0X 5G4YA 5HL1A 4Q0IA 3IS2B 3BECA 3UMDA 2B95A 3QP6A 3SW1A 4EWFA 3FV7A 4FH2A 3JPUA 2YKHA 4UQIM 1PYYA 5CGXA 2FZ0A 3VOLA 2L1MA 4ARZA 2LB9A 1TDLA 3BJNA 3IH8A 3HLGA 1SKOA 4HNBA 3IF5A 4DE1A 3T1QB 1PW8A 2XEPA 4NK3A 2V1BA 1MWUA 3UPPA 3W8KA 3NIAA 1M6KA 4HBUA 4BD1A 3ZFZA 5A91A 5EFWA 4PKYG 4OPRA 3A0VA 3OPPA 1BTLA 4QWOA 2WGWA 1JVJA 4PMAA 3ZG7B 2I9VA 3IH9A 2WZXA 2VK3A 1PFLA 1YM1A 3F1NA 4DJ2A 3HLWA 4CQHA 5EM1A 3KYZA 3U4LP 4E6WA 5HPFA 5KZHA 4BL3A 5HDDA 1YMSA 4KZ7A 4CLCD 2MJ6A 3W4QA 3FPWA 4GHIA 1VEUA 3B33A 1ES3A 3LO7A 5J8XA 4G3VA 4UHUA 3IXGA 4E3LA 3QHYA 3CPTA 4I3IA 1W8QA 3F1PB 3ZYTA 2OAP1 2Z2LB 4C6YA 2PAVP 5DF7A 1L0GA 1DY6A 2V1ZA 4GDBA 3GRJA 5HAPA 4E3JA 5M19A 2R9XA 3HJIA 4YNRA 2ZM0A 4IUKA 3MQOA 4AFIA 3NECA 3B47A 3LR5A 1EROA 1YMXA 2H0TA 3ZQ5A 4I3AA 2O9AA 2VGJA 5FDHA 4ZDXA 4NKPA 2W3DA 3H7WB 4KZAA 5DJTA 5EVIB 1IFQA 2J9PA 5HL6A 4Z9QA 3A3JA 2EX6A 2WYXA 4DE0A 3PXPA 2XROA 3AGEA 2EX8A 2XSSA 1LT0A 2ZC5B 4GJ4A 2J8YA 3G6OA 4L0LA 4LRZE 3FC7A 4ZBEA 3HCYA 3ZVTA 4XUZA 2INWA 3KYQA 3R4KA 1BZAA 3N7WA 1ERQA 2HGVA 1SZVA 4JF6A 4BMWA 2VV6A 3UY6A 2IWCA 2XA7M 1QMFA 1Q2PA 2QPNA 4R23A 3K3CA 3WRTA 1GSVA 1NLZA 4PHTA 2ZMFA 4JKTA 1W8YA 4GD6A 5M18A 2XR0A 5GHXA 2CC1A 3E2KA 1OTBA 2IWBA 2Y2NA 4CJNA 3IS2A 3P7NA 1XP4A 4MNRA 3O3VA 3OBFA 4E3NA 1IYPA 5HSQA 4WBGA 1S1ZA 2QMIA 1EWZA 4Y13A 3Q81A 3ICYA 4X68A 4Y0UA 5FI2A 3IXBA 1W79A 3HLCA 4KG6A 1H3QA 2W0NA 3BWLA 1OJGA 1NLYA 5CGWA 5EVLA 1FR6A 2QJ5A 3VSLA 4KENB 4LLOB 4E6XA 2V1AA 2ACGA 2EFUA 2RL3A 4OQIA 1JTGA 4MCWA 3DTMA 1BULA 2OWJA 3NY4A 1BSGA 1SDEA 4OP5A 2ZMVA 1Y54A 1S1YA 3BFGA 2HP5A 1P0ZA 5CEBA 1PW1A 2EXAA 2JN7A 4O01A 4WF0A 4EERA 2ZQ9A 4Y7PA 4HH2A 2PD7A 2JKFA 1MWTA 3IHBA 1FCMA 1LLBA 3FWLA 3F1PA 3FPVA 3TOIA 1UWPX 4WUJA 1MY8A 1TVFA 3BQAA 4WZ5C 3GMWA 1V9ZA 3CUEA 3SH7A 5A93A 1W5DA 2XD5A 2QHKA 3HLFA 3S1YA 3VSKA 1AWIA 3UDFA 1N9BA 1T18A 3TJZC 4EEUA 4G3KA 3PBNA 1E3UD 5EVEA 4HY8A 4JGOA 3H7WA 2XF3A 3LIFA 2QYBA 3CUEC 1ZTUA 5EVIA 3SH9A 3VFFA 5F68A 3IXHA 3O88A 3G2YA 5DTTA 1S4RA 2PBYA 1NXYA 4MLLA 2VZWA 4R70A 1XJ2A 1OTEA 1H8MA 1C3BA 5TGFA 4E3IA 4OLGA 4ETZA 5EVIC 1XPBA 5F5YA 5J4EA 5CTMA 3S7QA 3TSGA 3NDGA 4HH3A 4ZJ2A 2K2NA 2DNSA 1LL8A 3LFVA 3PHYA 2XFSA 1NRFA 2VX8A 3QP4A 5IT5A 3NC8A 3HLEA 4OQHA 1K57C 4DXBA 4NG2A 5GHYA 4OVDA 3VFHA 5GLBA 4I39A 5DFYA 4D2OA 1PNEA 4IBRA 2E8IA 3CITA 3ZNTA 3Q7ZA 3T4LA 1XA1A 5DTSA 3T50A 3WWXA 2ZJ9A 3HJKA 3QP1A 2G2WA 4PAUA 4GB7A 4IEDA 3JYIA 3N4IA 1NRJA 1S0WA 2GX5A 3N6IA 4R38A 2PR5A 4NXFA 2J3WA 2NUPC 2ZLYA 3G2ZA 4OKPA 5AQ7A 4B4XA 1LSXA 5E2GA 1GHPA 3L7HA 4K91A 1SCWA 1TS0A 4MBHA 2L4RA 4LRXC 1OMEA 2HV1A 1D7EA 2M1CA 1D06A 3WS4A 1K55A 3UE6A 1X0OA 1G6AA 4KZBA 4XT2B 4N92A 5TR7A 3NBLA 3NI9A 1LL9A 5EV0A 3VP2A 3QNBA 2OOLA 2P9VB 3M2KA 1GA9A 5CGSA 1K55C 1YQSA 1XGJA 2V20A 2VJWA 1L3LA 5HD3A 3VP1A 3CHWP 3S4XA 2ZC4B 4Q8IA 4X1MA 1YLTA 1NZOA 4MN6A 3UB7A 2EFXA 3OCLA 1K4FA 2VEAA 3GQZA 2Y2PA 3NHQA 1I5QA 4QU3A 2Y2IA 1K4EA 4KZ3A 2Q9MA 2WAEA 1NY0A 5LBRA 2J80A 2W3EA 3D9YA 1FQGA 3DAVA 3CI6A 1PIOA 3Q07A 2BASA 1ES5A 4IJGA 4HQAA 4S2LA 1LSVA 1BLSA 2D01A 3DWZA 3DBAA 4FH4A 2BTFP 3B42A 1KDSA 1Q2QA 2XH9A 1SDNA 1BUEA 2H10A 2GNXA 4PKYA 4Y17A 5E2EA 1DJBA 4LPZA 1I2WA 1V9YA 3HLBA 3L9KA 1CI8A 1KGGA 1DRMA 2WK0A 3IBJA 2O0YA 2NUTC 4EV4A 2ZC3B 4JGPA 3G34A 5FQQA 3E0YA 4R4SA 1VM1A 1LI0A 5DFXA 4EESA 2ZOIA 2J3TD 4MBKA 3KSGA 3MSHA 4UA9A 1ZKJA 5HPIA 2VKSA 4EBPA 1JNUA 3SOIA 4E3MA 1NZUA 4S2MA 3LIEA 1MC0A 2AVXA 2JBFA 5J3WA 4YOFA 2XFTA 2WZZA 5FI7A 4OLDA 4EUVA 4DJ3A 3T4QA 1TD5A 2G7UA 4O7DA 5BOHA 3ZHHA 3A3DA 4ETXA 3T4JA 5G18A 1BYWA 1RCJA 2H5SA 5FQ9A 1XFQA 2Y55A 1FIKA 4KUKA 4I3JA 3BFDA 3DTEA 5AQAA 2B02A 1TS7A 3UO9A 1GHIA 3H82B 2KOIA 4XT2A 4OQGA 4OPYA 2OV5A 4QB8A 3RTYA 2Z6DA 4WZ4A 2GJ3A 3NDEA 4S2NA 4HP4A 1TS6A 4EUZA 1K38A 4RQ9A 4EQIA 2ZQAA 2P9VA 3UB9A 2WKQA 3C7UA 5JYPA 3RJUA 3WS5A 3K3DA 1CI9A 4S2NC 5HDCA 4P87A 2PBDP 1D1JA 3BQ8A 2JHEA 2Y2KA 4C3QA 3MFXA 4NETA 4RA7A 4F94A 4ESPA 3O86A 4MN5A 4X69A 4LGWA 1MKMA 2XRNA 3HL9A 1PWCA 2Y2MA 1F98A 4Y15A 1BLHA 5IHVA 4JLFA 4OONA 2W3FA 5HWVA 2XK1A 3Q7VB 3MQ0A 2ZQ8A 4DF6A 5FQJA 4B88A 2EX2A 4RX2A 1KOUA 4MDZA 1HVBA 4DRTA 3LR0A 3U2AA 3D4FA 3GV9A 1KGEA 4C75A 3MBZA 3W4PA 5JYOA 1FOFA 1SHVA 4P0MA 2J3TC 4N9KA 3VP0A 1IEMA 5HAIA 4KZ5A 4R6LA 5L10A 1ZC2A 4DKIA 3SZTA 3C2WA 4WMCA 3MJQA 5FA7A 4BQMA 4S2KA 1OT6A 1JWPA 2P74A 1T1BA 1IOUA 1EI5A 3PAEA 5FQIA 5IU1A 5EVID 5MC7A 1OTIA 4D60A 3TG9A 2EWVA 4GS9B 3V67A 1K6RA 2XD1A 1L0FA 3PBQA 1CQAA 3W4OA 3G32A 4L9GA 2A2LA 3LYXA 4GDNA 4U0TA 3UE0A 1XKZA 4WLAA 1WYCA 2OWHA 5HWWA 3LIBA 1GA0A 1XFNA 1NJ4A 5FATA 2Y79A 3FYZA 3BFFA 1PI4A 3FKVA 5A8BA 2WKEA 3MQQA 2VV8A 4NXGA 3OCNA 3H82A 4KZ6A 1Y28A 5D3OA 5CECA 5FSRA 4GLQA 2EX9A 4UA6A 5IS1A 4O8GA 3G31A 1CF0A 1E4DA 3GR2A 3IX3A 4WELA 1T19A 2M7UA 4YWZA 2DCFA 4S2OA 1L0EA 3VOYA 3EQVA 3MXQA 1P97A 4YFMA 3BW6A 3VP3A 1YT4A 3UB5P 3EGDC 4M4XA 4X1LA 3BLSA 5DVAA 4IBXA 1DJCA 3OPHA 3UPOA 4GCZA 3HBRA 1GHMA 4X25A 5F1GA 2PYRA 2CMNA 4ZAMA 2V8CA 3ITBA 3I7JA 4OQ0A 5FEGA 2V0UA 3Q82A 2J7VA 2V9AA 2XGNA 4B4ZA 3N8LA 3BRMA 3FZCA 1ONGA 4UA7A 5DF9A 5FEFA 3KYEA 3VOZA 2XLNA 3Q7VA 3NCKA 4HEFA 1N9OA 5CHJA 4CPKA 3MMHA 4QY6A 1XJ3A 3AGDA 5AVFA 1CEGA 3IHAA 3MS6A 4M3KA 1VHMA 3MZEA 1LI9A 2P08A 4R0QA 1K25A 4CLCE 3E4PA 2Y2QA 2Z2MB 5TBMA 4X56A 2X02A 3A0RA 1U60A 4OOYA 4BENA 2HJ9C 4WEJA 2WKHA 3LR4A 5TJJA 3LI9A 1W63Q 4JXGA 3ITAA 4HBTA 1PZPA 4HI4A 1YLZA 4H8RA 1YLJA 4L9EA 4LENA 3G35A 1XA7A 1Z6FA 4HOIA 2OAQ1 3T1RA 1VB6A 1BLCA 1GSWA 2H0YA 3RXXA 1GCEA 1OTDA 2Q0OA 3BFEA 4R3JA 2YKFA 4GS9A 1YKDA 2IWDA 4QHCA 2DMWA 3MF0A 1OJ5A 2HZ5A 3RXWA 4QPRA 2O99A 3T4SA 5A90A 3UPNA 3RFBA 3A3EA 2FFYA 3HLDA 3V50A 1TF1A 4DXCA 3FKWA 1ACFA 1LSWA 3DW0A 2VGLS 3DTIA 1MPLA 2A3UA 4XXRA 1XGIA 1HTZA 3NULA 4FTXA 1KGFA 2Q9NA 5E2HA 4K0XA 3LUQA 5CERA 2WUQA 2HDQA 2DRWA 3UB6A 4OOMA 3E98A 2HP9A 4JPMA 3HUOA 4GN2A 1G6OA 1PWDA 3G4PA 2HF6A 1L0DA 3PBTA 4N9LA 4U0XA 2JE5A 5AVEA 2IA2A 5J7EA 3D3OA 3T4KA 1O07A 3VV4A 4MBFA 1A0KA 3IBRA 4S2IA 4EEPA 3FG8A 5GL9A 4L9FA 1WE4A 4ME4A 3UDXA 3WS2A 2O9BA 3LY4A 2HDUA 3Q1FA 1H8ZA 1PI5A 4NEED 3BY9A 4F3LB 2R78A 3JVVA 4JXVA 3LEQA 2EWWA 4A5RA 2JKTM 5FQMA 5U47A 2H28A 1ESIA 4H6JB 3IQAA 4I38A 4LCLA 4BJPA 1YPRA 4DE3A 1N9LA 2RCXA 2W3HA 4WM9A 4IHQA 3S7PA 1PRQA 5I5LA 1MWRA 5E43A 4LCMA 2LB5A 4EW7A 3MXSA 4R1GA 4P6ZS 5CHUA 2XDMA 3EOIA 3GECA 3MZDA 4OP8A 3ZG5A 4IUHA 3W2ZA 3D72A 3VMAA 3KSFA 4GOGA 3LICA 1HD8A 3CAXA 3EWKA 4QY5A 1XXMA 5L8MA 4KG5A 3UB8A 3UNWA 2GDNA 3V3RA 4HJ4A 1PWGA 3V3SA 3TE8A 1QMEA 4FD8A 5FAPA 2P04A 2ZL1B 3OPLA 1TS8A 5F82A 2K31A 3SS5A 5EECA 3TW8A 3MKFA 4KG2A 1K0KA 2WKRA 5CTNA 4KQQA 1BLPA 2V0WA 1YSQA 4OH0A 5FI6A 3A0SA 2D02A 1IYOA 2VGKA 1ZG6A 3GDIA 4Y5FA 1UWNX 5KMWA 3SH8A 3EGXC 2Y2HA 4PM9A 4HP9A 4YINA 5GLCA 4GKUA 3C8CA 2HDRA 3N8SA 1FSWA 4WMCD 2ZOHA 4KQDA 4PM8A 3E4QA 4MN7A 3QNCA 3S7OA 5I94A 3T1XA 3PBRA 1FILA 1ZHHB 2PDRA 1G5UA 5HX9A 1K56A 1CK3A 3BYDA 4KZ8A 2J9OA 3GSGA 3M6HA 3QP8A 3TRCA 1DP9A 4ZJ3A 3LEZA 5TFQA 3BLMA 3LCEA 4CLCB 1F2KA 2P7JA 2HPBA 3H9WA 3CG5A 1H8YA 4FCFA 2I72A 4JXWA 2QKPA 5AQ9A 2E8JA 5E2FA 3NOTC 3PTEA 4LV2A 1ES4A 1N4OA 3C30A 2VLGA 4S2JA 5HWTA 1HLUP 4JGRA 4FSFA 4F3LA 3P01A 5DTKA 2W1TB 4UEYA 1P9RA 3IXDA 3VE3A 4MMNA 4HHDA 3ZDJA 3T4TA 4H6JA 5FDSA 2QJ7A 1SKFA 3MR0A 3SS3A 1ERMA 3LGOA 1FCNA 3CWFA 3OZHA 4WYYA 2Y2GA 2EXBA 4Z1WA 4GD8A 3O87A 4BWIA 5FQKA 3P09A 1M40A 5K5BA 3C7VA 3V5MA 2W1RA 2PU2A 3EQUA 1YAXA 1DP8A 1K6SA 5TBMB 5CHMA 3ZG9B 3JVUA 5GLAA 1ES2A 4EQ1A 4X53A 2L0WA 5AQBA 5L2FA 4E04A 1RGYA 3T4OA 1G28A 3HREA 2EA9A 2WKPA 4OOLA 2QZ6A 3UMEA 5HW3A 1H0MA 2B5RA 5KSHA 3QP5A 2ZL1A 1FCOA 3IX8A 4N1HA 3O5YA 2KLIA 5FAOA 1WA9A 2ZM2A 4EXOA 1VETB 5DF8A 3LIAA 5HZHA 1MZUA 3LR3A 1ONHA 5KIZA 1O7EA 1RGZA 3ULFA 2BG1A 3M6BA 3ZG0A 4BLMA 3WS1A 3HUNA 1IYQA 1CEFA 5FASA 3S7NA 3AGFA 4PM7A 5EE8A 4ZTKA 2VGLM 3CJMA 3OOVA 2HP6A 3BM6A 1LL5A 3T12B 4N1XA 2Y91A 3C5AA 4LV0A 3SS4A 4NXEA 3LY3A 4RYEA 1T1CA 1UGUA 4UQIS 4Y0OA 2WADA 5C5KA 3ZGAB 2PYPA 4MEZA 2JKRM 1ODVA 4DDSA 3GVBA 3M2JA 1IKIA 3EEAA 1HZOA 2KX6A 2OLVA 4BD0A 1IKGA 2C6WB 5GLDA 4R3AA 4CLCA 4Y3IA 1F9IA 4KZ4A 3C38A 4U3TA 5HAQA 1KVMA 2PU4A 2WAFA 1TEMA 4GW9A 1J9MA 1J3WA 1ZG4A 3HUMA 3ZG8B 4CLCC 1AXBA 2R9WA 2W1TA 1MBLA 1G68A 4JGQA 3MFDA 2X71A 2PT7A 2JCHA 3IF6B 1Y4OA 4DE2A 1KDWA 2WGVA 4WN5A 4NXBA 4WZ5A 4OPQA 4GNUA 3KO6A 3E2LA 1YLPA 1JWVA 1K54A 2HJEA 3EEHA 4RVAA 3PBOA 4BL2A 3GTCA 1VQQA 3N8RA 4QD4A 1ESUA 2JKRI 3OC2A 4DMZA 4R4RA 3NJAA 4JBFA 2XQZA 4LV1A 5A92A 4K08A 1K54C 1KE4A 3RH8B 1YLWA 1ALQA 1I2SA 3A3FA 3MZFA 1FSYA 4P6ZM 1XX2A 1S67L 1NYMA 5F83A 1W7FA 4JF4A 2A24B 3F1OB 3MXRA 2ZD8A 3BFCA 4IVIA 1EW0A 4DDYA 3R7WB 3PR6A 2G2UA 4KQOA 4HIAA 2GZAA 3T1SA 4II7A 1KE3A 4DN0A 5L07A 1NWZA 1RP5A 3B3XA 2Y2JA 1F5MA 1K57A 1VETA 2M7VA 3WRZA 1DP6A 3ISGA 4QJGA 4B93A 1FR1A
chains in the Genus database with same CATH topology
2XA7S 5HDCA 2VV7A 3BQ8A 4P6ZS 2JHEA 1GSXA 1H3QA 4BBUA 2W0NA 3EOIA 3MFXA 3GECA 3BWLA 1OJGA 1NLYA 2QJ5A 3LI8A 4LLOB 4MN5A 3K2NA 3CLOA 1MKMA 4IUHA 3W2ZA 2XRNA 2W27A 3D72A 2V1AA 3KSFA 3LICA 3CAXA 3EWKA 4MCWA 2OWJA 1N9NA 1F98A 5L8MA 3UB8A 1XJ4A 4HJ6A 4HJ4A 3KSIA 2ZMVA 2W3FA 5HWVA 1S1YA 3TE8A 1P0ZA 5DJUA 2JN7A 4Y2FA 4O01A 2P04A 3MQ0A 4O0PA 4WF0A 1TS8A 3E4OA 2B18A 4EERA 2K31A 5HDSA 4EU0A 3TW8A 1KOUA 4MDZA 4HH2A 2WKRA 3LR0A 4BBVA 3U2AA 2V0WA 2PD7A 1YSQA 3A0SA 4KUOA 2D02A 4ARZB 2K7SA 3GDIA 3NOPC 1OPXA 4Y5FA 5DKKA 2O9CA 3F1PA 3FPVA 1UWNX 3BY8A 5HD5A 1UWPX 3EGXC 2Y8HA 2PR6A 4WUJA 4HP9A 2J3TC 3BQAA 3C8CA 2ZOHA 4R6LA 1V9ZA 3CUEA 4KQDA 2QHKA 2Z6CA 3UE3A 5FL3A 3E4QA 3C2WA 3MJQA 4MN7A 3S7OA 1T18A 1OT6A 4ZRRA 2KDKA 3TJZC 1T1BA 3F1NB 1IOUA 4EEUA 4G3KA 5IU1A 5F69A 5MC7A 3PBRA 3PBNA 1ZHHB 1OTIA 1XJ6A 2PDRA 2VA0A 4HY8A 5F6AA 4JGOA 3H7WA 2EWVA 3LIFA 2QYBA 3CUEC 1ZTUA 4GS9B 3V67A 5F68A 3PBQA 1S4RA 1DP9A 3TRCA 4GHIB 4L9GA 1S66L 2A2LA 3LYXA 2VZWA 4R70A 1XJ2A 3PYPA 4CLCB 1OTEA 1H8MA 3NOUC 2P7JA 4WLAA 4G3WA 3H9WA 4ETZA 1P9WA 2OWHA 5HWWA 3LIBA 5F5YA 5J4EA 1XFNA 2QKPA 3S7QA 3NOTC 1STZA 2Y79A 4HH3A 2K2NA 4HJ3A 3C30A 2VLGA 3LIDA 5HWTA 1LL8A 3LFVA 3PHYA 4JGRA 5A8BA 4EETB 2FH5A 2VX8A 3P01A 4FSFA 4F3LA 2W1TB 3MQQA 5IT5A 2VV8A 4UEYA 1P9RA 4NXGA 3OCNA 3H82A 1Y28A 1OTAA 3VE3A 4MMNA 2A24A 3F1OA 4HHDA 4GLQA 3T4TA 4I39A 2ZBBA 4WEKA 4Q0JA 5DFYA 3R7WA 2PD8A 5IS1A 4O8GA 1T1AA 4H6JA 4I5SA 4LRYC 5AJGA 3CITA 4WELA 1T19A 1W63M 2QJ7A 3T4LA 2PHYA 3T50A 3MR0A 2M7UA 4YWZA 3HJKA 4PAUA 4B9OA 3EQVA 3PBSA 3CWFA 2QWSA 1NRJA 2GX5A 3MXQA 1P97A 3BW6A 4R38A 2JKTI 2PR5A 4Z1WA 3EGDC 4NXFA 2J3WA 2NUPC 4M4XA 4BWIA 4BBTA 2W3GA 4GCZA 5K5BA 1LSXA 3OLOA 4FOFA 2W1RA 3EQUA 1YAXA 1DP8A 1YSPA 4Q0HA 5TBMB 5G4ZA 2PYRA 2CMNA 1TS0A 2L4RA 3JVUA 4LRXC 4WL9A 2HV1A 4EQ1A 2L0WA 2V0UA 4E04A 3T4OA 1D7EA 1G28A 2M1CA 1D06A 5CX7A 3KSHA 3UE6A 1X0OA 2EA9A 4XT2B 2WKPA 4OOLA 5DKLA 2V9AA 3VE4A 3UMEA 1OT9A 1S4SA 3KX0X 5G4YA 5DF9A 4Q0IA 3IS2B 3UMDA 5KSHA 2OOLA 1N9OA 3SW1A 3O5YA 2KLIA 3MMHA 1WA9A 2YKHA 4UQIM 1XJ3A 4EXOA 5AVFA 2VJWA 3LIAA 1VHMA 5HZHA 2P08A 1MZUA 2FZ0A 5HD3A 3LR3A 3VOLA 4CLCE 2L1MA 5KIZA 3E4PA 4ARZA 2LB9A 3BJNA 5TBMA 3ULFA 4HNBA 3A0RA 4MN6A 3UB7A 3OCLA 2HJ9C 2V1BA 2VEAA 4WEJA 3NHQA 3LR4A 5TJJA 3LI9A 3S7NA 1W63Q 4HI4A 5EFWA 4PKYG 2VGLM 3A0VA 3OOVA 4L9EA 5LBRA 2I9VA 2J80A 2W3EA 4HOIA 4NXEA 3CI6A 1T1CA 2BASA 1UGUA 2OAQ1 3F1NA 4DJ2A 4CQHA 4UQIS 1VB6A 4HQAA 4IJGA 1GSWA 5C5KA 1LSVA 1OTDA 2PYPA 2JKRM 3KYZA 2YKFA 2D01A 5HPFA 4GS9A 1ODVA 1YKDA 3DBAA 5HDDA 2DMWA 3MF0A 1OJ5A 3EEAA 3B42A 4CLCD 2MJ6A 2KX6A 2O99A 4QPRA 3FPWA 3T4SA 4GHIA 2GNXA 4PKYA 3RFBA 3B33A 4R3AA 4CLCA 4Y3IA 1F9IA 4LPZA 4G3VA 3C38A 1V9YA 1TF1A 1LSWA 2VGLS 4I3IA 3F1PB 3ZYTA 2OAP1 4GW9A 1DRMA 3IBJA 2O0YA 2NUTC 4CLCC 3HJIA 3LUQA 4JGPA 4YNRA 2W1TA 3E0YA 5DFXA 4EESA 2ZOIA 4IUKA 2J3TD 3MQOA 4JGQA 2PT7A 4AFIA 3UB6A 4OOMA 3KSGA 3B47A 3LR5A 5HPIA 3E98A 3ZQ5A 4I3AA 2O9AA 2VKSA 4NKPA 4WN5A 1JNUA 1G6OA 4NXBA 2W3DA 2HF6A 3H7WB 3LIEA 5DJTA 1MC0A 3KO6A 1IFQA 5HL6A 3PBTA 5J3WA 3PXPA 4YOFA 2HJEA 3EEHA 5AVEA 2XROA 2IA2A 3PBOA 5J7EA 2XSSA 3D3OA 1LT0A 4GJ4A 3T4KA 4L0LA 3G6OA 4LRZE 4EUVA 3FC7A 4DJ3A 3T4QA 3HCYA 3VV4A 2JKRI 1TD5A 2INWA 3IBRA 2G7UA 3OC2A 4DMZA 4EEPA 3FG8A 3KYQA 3R4KA 3NJAA 4L9FA 4ME4A 4ETXA 3T4JA 2HGVA 2O9BA 4K08A 4BMWA 2VV6A 1BYWA 3RH8B 2XA7M 1XFQA 4NEED 4KUKA 4P6ZM 3BY9A 1S67L 4I3JA 4F3LB 2R78A 3K3CA 2B02A 1TS7A 3JVVA 1GSVA 1NLZA 4PHTA 2ZMFA 3H82B 2KOIA 2EWWA 4XT2A 2JKTM 2A24B 3F1OB 2H28A 1EW0A 3RTYA 2Z6DA 1OTBA 3R7WB 3PR6A 2GJ3A 4KQOA 4HIAA 4H6JB 4I38A 4HP4A 1TS6A 3IS2A 3P7NA 2GZAA 4BJPA 4II7A 4RQ9A 3OBFA 1N9LA 4DN0A 5HSQA 2W3HA 3UB9A 1S1ZA 1NWZA 2WKQA 4IHQA 3S7PA 5I5LA 1F5MA 3ICYA 2M7VA 1DP6A 2LB5A 4EW7A 4B93A 3K3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HDC A;  2VV7 A;  2JHE A;  1GSX A;  4BBU A;  2W0N A;  3MFX A;  3GEC A;  3BWL A;  1OJG A;  2QJ5 A;  3LI8 A;  4LLO B;  4MN5 A;  3CLO A;  2W27 A;  3D72 A;  2V1A A;  3LIC A;  3CAX A;  3EWK A;  2OWJ A;  1N9N A;  1F98 A;  3UB8 A;  1XJ4 A;  4HJ6 A;  4HJ4 A;  5HWV A;  1S1Y A;  1P0Z A;  5DJU A;  2JN7 A;  4WF0 A;  1TS8 A;  3E4O A;  4EER A;  5HDS A;  1KOU A;  4HH2 A;  2WKR A;  4BBV A;  2V0W A;  2PD7 A;  3A0S A;  4KUO A;  2D02 A;  2K7S A;  3GDI A;  3NOP C;  5DKK A;  3F1P A;  1UWN X;  3BY8 A;  5HD5 A;  1UWP X;  2PR6 A;  4WUJ A;  4HP9 A;  3C8C A;  2ZOH A;  4R6L A;  1V9Z A;  4KQD A;  2QHK A;  2Z6C A;  3E4Q A;  3C2W A;  3MJQ A;  1T18 A;  1OT6 A;  2KDK A;  1T1B A;  3F1N B;  4EEU A;  5IU1 A;  5F69 A;  1OTI A;  1XJ6 A;  2PDR A;  4HY8 A;  5F6A A;  4JGO A;  3H7W A;  3LIF A;  4GS9 B;  5F68 A;  1S4R A;  1DP9 A;  4GHI B;  4L9G A;  1S66 L;  3LYX A;  4R70 A;  1XJ2 A;  3PYP A;  1OTE A;  3NOU C;  2P7J A;  4WLA A;  3H9W A;  2OWH A;  5HWW A;  3LIB A;  5F5Y A;  5J4E A;  1XFN A;  2QKP A;  3NOT C;  4HH3 A;  4HJ3 A;  5HWT A;  2VLG A;  3LID A;  1LL8 A;  3PHY A;  4JGR A;  5A8B A;  4EET B;  4F3L A;  3MQQ A;  2VV8 A;  4NXG A;  3H82 A;  1Y28 A;  1OTA A;  3VE3 A;  2A24 A;  3F1O A;  4HHD A;  4I39 A;  2ZBB A;  5IS1 A;  2PD8 A;  1T1A A;  4H6J A;  4I5S A;  4LRY C;  1T19 A;  2QJ7 A;  2PHY A;  3T50 A;  3MR0 A;  4YWZ A;  3HJK A;  4B9O A;  3CWF A;  2QWS A;  3MXQ A;  1P97 A;  4R38 A;  2PR5 A;  4NXF A;  4M4X A;  4BBT A;  4GCZ A;  1LSX A;  3OLO A;  1DP8 A;  5TBM B;  5G4Z A;  2PYR A;  2CMN A;  1TS0 A;  2L4R A;  4WL9 A;  4LRX C;  2HV1 A;  4EQ1 A;  2L0W A;  2V0U A;  4E04 A;  1D7E A;  1G28 A;  2M1C A;  1D06 A;  3UE6 A;  1X0O A;  2EA9 A;  4XT2 B;  2WKP A;  3VE4 A;  5DKL A;  2V9A A;  3UME A;  1OT9 A;  1S4S A;  3KX0 X;  5G4Y A;  3IS2 B;  3UMD A;  2OOL A;  1N9O A;  3SW1 A;  1WA9 A;  2YKH A;  1XJ3 A;  4EXO A;  5AVF A;  3LIA A;  5HZH A;  1MZU A;  5HD3 A;  3VOL A;  2L1M A;  5KIZ A;  3E4P A;  5TBM A;  3ULF A;  4HNB A;  3A0R A;  4MN6 A;  3UB7 A;  2VEA A;  2V1B A;  3NHQ A;  3LI9 A;  4HI4 A;  5EFW A;  4PKY G;  3A0V A;  4L9E A;  2I9V A;  2J80 A;  4HOI A;  4NXE A;  1T1C A;  2BAS A;  1UGU A;  3F1N A;  4DJ2 A;  1VB6 A;  4HQA A;  1GSW A;  1LSV A;  1OTD A;  2PYP A;  2YKF A;  2D01 A;  4GS9 A;  1ODV A;  5HDD A;  1OJ5 A;  2KX6 A;  4GHI A;  4PKY A;  3B33 A;  4R3A A;  1F9I A;  4LPZ A;  1V9Y A;  1LSW A;  4I3I A;  3F1P B;  4GW9 A;  1DRM A;  3HJI A;  3LUQ A;  4JGP A;  4EES A;  2ZOI A;  3MQO A;  4JGQ A;  3UB6 A;  3ZQ5 A;  4I3A A;  4WN5 A;  1JNU A;  4NXB A;  3LIE A;  3H7W B;  5DJT A;  5J3W A;  3EEH A;  5AVE A;  5J7E A;  1LT0 A;  4LRZ E;  3G6O A;  3FC7 A;  4DJ3 A;  2INW A;  3IBR A;  4EEP A;  3FG8 A;  3NJA A;  4L9F A;  4K08 A;  2VV6 A;  1BYW A;  3RH8 B;  1XFQ A;  4KUK A;  3BY9 A;  1S67 L;  4I3J A;  4F3L B;  2R78 A;  3K3C A;  2B02 A;  1TS7 A;  1GSV A;  3H82 B;  4XT2 A;  2A24 B;  3F1O B;  2H28 A;  1EW0 A;  3RTY A;  2Z6D A;  1OTB A;  2GJ3 A;  4HIA A;  4H6J B;  4I38 A;  4HP4 A;  1TS6 A;  3IS2 A;  3P7N A;  4RQ9 A;  1N9L A;  5HSQ A;  3UB9 A;  1S1Z A;  1NWZ A;  2WKQ A;  5I5L A;  3ICY A;  1DP6 A;  4EW7 A;  3K3D A; 
#chains in the Genus database with same CATH topology
 2XA7 S;  3A3I A;  2VV7 A;  1GSX A;  4BBU A;  2Y4A A;  2WKI A;  4ID4 A;  2V8F A;  3LI8 A;  1KVL A;  3K2N A;  4K0W A;  3CLO A;  2W27 A;  5EOO A;  1JTD A;  1JWZ A;  1KE0 A;  1NYY A;  5EM0 A;  1N9N A;  3CMZ A;  3QP2 A;  2ZMA A;  2ZM8 A;  1XJ4 A;  5CXW A;  5HAR A;  4HJ6 A;  1H5X A;  3KSI A;  4E3O A;  1IYS A;  3ZCZ A;  5DJU A;  2OSU A;  4Y2F A;  4E3K A;  3UDI A;  4O0P A;  3E4O A;  2B18 A;  2ZQ7 A;  5HDS A;  4EU0 A;  5EPH A;  5CRF A;  1BT5 A;  4BBV A;  4P85 A;  3IX4 A;  1MWS A;  4KUO A;  3IT9 A;  4ARZ B;  2K7S A;  1L2S A;  3NOP C;  1OPX A;  4X6T A;  5DKK A;  2O9C A;  4RX3 A;  4P6B A;  3BY8 A;  1SKO B;  5GHZ A;  5HD5 A;  2Y8H A;  2PR6 A;  2C5W B;  3IWO A;  1WYB A;  2ZC6 B;  2Z6C A;  2WGW B;  3UE3 A;  5FL3 A;  4LFU A;  2ZC7 A;  4ZRR A;  2KDK A;  1K56 D;  2V2F F;  3ZVW A;  3F1N B;  1S6R A;  3CZD A;  3IF6 A;  5F69 A;  1XJ6 A;  2VA0 A;  3VP4 A;  4OPZ A;  5F6A A;  1TDG A;  2Y59 A;  2HDS A;  3MKE A;  3G30 A;  5CED A;  1E3U A;  4PM5 A;  5EOE A;  4XUX A;  2FFF B;  4GHI B;  4ZJ1 A;  1S66 L;  3IF6 C;  1VEU B;  2UV0 E;  5EUA A;  3PYP A;  3NOU C;  4G3W A;  3CPT B;  1P9W A;  2JKG A;  1Z09 A;  2BLS A;  2OLU A;  3C4O A;  2A49 A;  1STZ A;  5KSC A;  3DTK A;  4HJ3 A;  5HFO A;  3LID A;  4UAA A;  4KZ9 A;  2PRF A;  4EET B;  2FH5 A;  2X01 A;  1MKI A;  1OTA A;  2A24 A;  3F1O A;  3IWI A;  3V39 A;  5F1F A;  5L09 A;  2ZBB A;  4WEK A;  4Q0J A;  3R7W A;  2PD8 A;  1T1A A;  4I5S A;  4LRY C;  5M1A A;  4FUW A;  5AJG A;  1W63 M;  2Y2O A;  1LHY A;  2PHY A;  5FAQ A;  3C4P A;  3WS0 A;  4KQR A;  1PZO A;  4PPR A;  4B9O A;  3PBS A;  2QWS A;  4JF5 A;  3UN7 A;  2JKT I;  2WGI A;  4Y0T A;  4IVK A;  3UE1 A;  3ZNY A;  4BBT A;  4LV3 A;  1YLY A;  4R3B A;  2W3G A;  4X55 A;  3P98 A;  3OLO A;  2ZQC A;  4FOF A;  3HVF A;  4S2P A;  4PM6 A;  2UWX A;  1YSP A;  4Q0H A;  2ZQD A;  3OPR A;  5G4Z A;  3S22 A;  3IWQ A;  1MXO A;  4WL9 A;  4JXS A;  4EBL A;  1CJF A;  3PAG A;  1E25 A;  1DJA A;  4GZB A;  2JC7 A;  5CX7 A;  3KSH A;  4EBN A;  5DKL A;  3VE4 A;  2Y2L A;  1IEL A;  3BEB A;  3DWK A;  4HES A;  1OT9 A;  1S4S A;  3KX0 X;  5G4Y A;  5HL1 A;  4Q0I A;  3IS2 B;  3BEC A;  3UMD A;  2B95 A;  3QP6 A;  3SW1 A;  4EWF A;  3FV7 A;  4FH2 A;  3JPU A;  2YKH A;  4UQI M;  1PYY A;  5CGX A;  2FZ0 A;  3VOL A;  2L1M A;  4ARZ A;  2LB9 A;  1TDL A;  3BJN A;  3IH8 A;  3HLG A;  1SKO A;  4HNB A;  3IF5 A;  4DE1 A;  3T1Q B;  1PW8 A;  2XEP A;  4NK3 A;  2V1B A;  1MWU A;  3UPP A;  3W8K A;  3NIA A;  1M6K A;  4HBU A;  4BD1 A;  3ZFZ A;  5A91 A;  5EFW A;  4PKY G;  4OPR A;  3A0V A;  3OPP A;  1BTL A;  4QWO A;  2WGW A;  1JVJ A;  4PMA A;  3ZG7 B;  2I9V A;  3IH9 A;  2WZX A;  2VK3 A;  1PFL A;  1YM1 A;  3F1N A;  4DJ2 A;  3HLW A;  4CQH A;  5EM1 A;  3KYZ A;  3U4L P;  4E6W A;  5HPF A;  5KZH A;  4BL3 A;  5HDD A;  1YMS A;  4KZ7 A;  4CLC D;  2MJ6 A;  3W4Q A;  3FPW A;  4GHI A;  1VEU A;  3B33 A;  1ES3 A;  3LO7 A;  5J8X A;  4G3V A;  4UHU A;  3IXG A;  4E3L A;  3QHY A;  3CPT A;  4I3I A;  1W8Q A;  3F1P B;  3ZYT A;  2OAP 1;  2Z2L B;  4C6Y A;  2PAV P;  5DF7 A;  1L0G A;  1DY6 A;  2V1Z A;  4GDB A;  3GRJ A;  5HAP A;  4E3J A;  5M19 A;  2R9X A;  3HJI A;  4YNR A;  2ZM0 A;  4IUK A;  3MQO A;  4AFI A;  3NEC A;  3B47 A;  3LR5 A;  1ERO A;  1YMX A;  2H0T A;  3ZQ5 A;  4I3A A;  2O9A A;  2VGJ A;  5FDH A;  4ZDX A;  4NKP A;  2W3D A;  3H7W B;  4KZA A;  5DJT A;  5EVI B;  1IFQ A;  2J9P A;  5HL6 A;  4Z9Q A;  3A3J A;  2EX6 A;  2WYX A;  4DE0 A;  3PXP A;  2XRO A;  3AGE A;  2EX8 A;  2XSS A;  1LT0 A;  2ZC5 B;  4GJ4 A;  2J8Y A;  3G6O A;  4L0L A;  4LRZ E;  3FC7 A;  4ZBE A;  3HCY A;  3ZVT A;  4XUZ A;  2INW A;  3KYQ A;  3R4K A;  1BZA A;  3N7W A;  1ERQ A;  2HGV A;  1SZV A;  4JF6 A;  4BMW A;  2VV6 A;  3UY6 A;  2IWC A;  2XA7 M;  1QMF A;  1Q2P A;  2QPN A;  4R23 A;  3K3C A;  3WRT A;  1GSV A;  1NLZ A;  4PHT A;  2ZMF A;  4JKT A;  1W8Y A;  4GD6 A;  5M18 A;  2XR0 A;  5GHX A;  2CC1 A;  3E2K A;  1OTB A;  2IWB A;  2Y2N A;  4CJN A;  3IS2 A;  3P7N A;  1XP4 A;  4MNR A;  3O3V A;  3OBF A;  4E3N A;  1IYP A;  5HSQ A;  4WBG A;  1S1Z A;  2QMI A;  1EWZ A;  4Y13 A;  3Q81 A;  3ICY A;  4X68 A;  4Y0U A;  5FI2 A;  3IXB A;  1W79 A;  3HLC A;  4KG6 A;  1H3Q A;  2W0N A;  3BWL A;  1OJG A;  1NLY A;  5CGW A;  5EVL A;  1FR6 A;  2QJ5 A;  3VSL A;  4KEN B;  4LLO B;  4E6X A;  2V1A A;  2ACG A;  2EFU A;  2RL3 A;  4OQI A;  1JTG A;  4MCW A;  3DTM A;  1BUL A;  2OWJ A;  3NY4 A;  1BSG A;  1SDE A;  4OP5 A;  2ZMV A;  1Y54 A;  1S1Y A;  3BFG A;  2HP5 A;  1P0Z A;  5CEB A;  1PW1 A;  2EXA A;  2JN7 A;  4O01 A;  4WF0 A;  4EER A;  2ZQ9 A;  4Y7P A;  4HH2 A;  2PD7 A;  2JKF A;  1MWT A;  3IHB A;  1FCM A;  1LLB A;  3FWL A;  3F1P A;  3FPV A;  3TOI A;  1UWP X;  4WUJ A;  1MY8 A;  1TVF A;  3BQA A;  4WZ5 C;  3GMW A;  1V9Z A;  3CUE A;  3SH7 A;  5A93 A;  1W5D A;  2XD5 A;  2QHK A;  3HLF A;  3S1Y A;  3VSK A;  1AWI A;  3UDF A;  1N9B A;  1T18 A;  3TJZ C;  4EEU A;  4G3K A;  3PBN A;  1E3U D;  5EVE A;  4HY8 A;  4JGO A;  3H7W A;  2XF3 A;  3LIF A;  2QYB A;  3CUE C;  1ZTU A;  5EVI A;  3SH9 A;  3VFF A;  5F68 A;  3IXH A;  3O88 A;  3G2Y A;  5DTT A;  1S4R A;  2PBY A;  1NXY A;  4MLL A;  2VZW A;  4R70 A;  1XJ2 A;  1OTE A;  1H8M A;  1C3B A;  5TGF A;  4E3I A;  4OLG A;  4ETZ A;  5EVI C;  1XPB A;  5F5Y A;  5J4E A;  5CTM A;  3S7Q A;  3TSG A;  3NDG A;  4HH3 A;  4ZJ2 A;  2K2N A;  2DNS A;  1LL8 A;  3LFV A;  3PHY A;  2XFS A;  1NRF A;  2VX8 A;  3QP4 A;  5IT5 A;  3NC8 A;  3HLE A;  4OQH A;  1K57 C;  4DXB A;  4NG2 A;  5GHY A;  4OVD A;  3VFH A;  5GLB A;  4I39 A;  5DFY A;  4D2O A;  1PNE A;  4IBR A;  2E8I A;  3CIT A;  3ZNT A;  3Q7Z A;  3T4L A;  1XA1 A;  5DTS A;  3T50 A;  3WWX A;  2ZJ9 A;  3HJK A;  3QP1 A;  2G2W A;  4PAU A;  4GB7 A;  4IED A;  3JYI A;  3N4I A;  1NRJ A;  1S0W A;  2GX5 A;  3N6I A;  4R38 A;  2PR5 A;  4NXF A;  2J3W A;  2NUP C;  2ZLY A;  3G2Z A;  4OKP A;  5AQ7 A;  4B4X A;  1LSX A;  5E2G A;  1GHP A;  3L7H A;  4K91 A;  1SCW A;  1TS0 A;  4MBH A;  2L4R A;  4LRX C;  1OME A;  2HV1 A;  1D7E A;  2M1C A;  1D06 A;  3WS4 A;  1K55 A;  3UE6 A;  1X0O A;  1G6A A;  4KZB A;  4XT2 B;  4N92 A;  5TR7 A;  3NBL A;  3NI9 A;  1LL9 A;  5EV0 A;  3VP2 A;  3QNB A;  2OOL A;  2P9V B;  3M2K A;  1GA9 A;  5CGS A;  1K55 C;  1YQS A;  1XGJ A;  2V20 A;  2VJW A;  1L3L A;  5HD3 A;  3VP1 A;  3CHW P;  3S4X A;  2ZC4 B;  4Q8I A;  4X1M A;  1YLT A;  1NZO A;  4MN6 A;  3UB7 A;  2EFX A;  3OCL A;  1K4F A;  2VEA A;  3GQZ A;  2Y2P A;  3NHQ A;  1I5Q A;  4QU3 A;  2Y2I A;  1K4E A;  4KZ3 A;  2Q9M A;  2WAE A;  1NY0 A;  5LBR A;  2J80 A;  2W3E A;  3D9Y A;  1FQG A;  3DAV A;  3CI6 A;  1PIO A;  3Q07 A;  2BAS A;  1ES5 A;  4IJG A;  4HQA A;  4S2L A;  1LSV A;  1BLS A;  2D01 A;  3DWZ A;  3DBA A;  4FH4 A;  2BTF P;  3B42 A;  1KDS A;  1Q2Q A;  2XH9 A;  1SDN A;  1BUE A;  2H10 A;  2GNX A;  4PKY A;  4Y17 A;  5E2E A;  1DJB A;  4LPZ A;  1I2W A;  1V9Y A;  3HLB A;  3L9K A;  1CI8 A;  1KGG A;  1DRM A;  2WK0 A;  3IBJ A;  2O0Y A;  2NUT C;  4EV4 A;  2ZC3 B;  4JGP A;  3G34 A;  5FQQ A;  3E0Y A;  4R4S A;  1VM1 A;  1LI0 A;  5DFX A;  4EES A;  2ZOI A;  2J3T D;  4MBK A;  3KSG A;  3MSH A;  4UA9 A;  1ZKJ A;  5HPI A;  2VKS A;  4EBP A;  1JNU A;  3SOI A;  4E3M A;  1NZU A;  4S2M A;  3LIE A;  1MC0 A;  2AVX A;  2JBF A;  5J3W A;  4YOF A;  2XFT A;  2WZZ A;  5FI7 A;  4OLD A;  4EUV A;  4DJ3 A;  3T4Q A;  1TD5 A;  2G7U A;  4O7D A;  5BOH A;  3ZHH A;  3A3D A;  4ETX A;  3T4J A;  5G18 A;  1BYW A;  1RCJ A;  2H5S A;  5FQ9 A;  1XFQ A;  2Y55 A;  1FIK A;  4KUK A;  4I3J A;  3BFD A;  3DTE A;  5AQA A;  2B02 A;  1TS7 A;  3UO9 A;  1GHI A;  3H82 B;  2KOI A;  4XT2 A;  4OQG A;  4OPY A;  2OV5 A;  4QB8 A;  3RTY A;  2Z6D A;  4WZ4 A;  2GJ3 A;  3NDE A;  4S2N A;  4HP4 A;  1TS6 A;  4EUZ A;  1K38 A;  4RQ9 A;  4EQI A;  2ZQA A;  2P9V A;  3UB9 A;  2WKQ A;  3C7U A;  5JYP A;  3RJU A;  3WS5 A;  3K3D A;  1CI9 A;  4S2N C;  5HDC A;  4P87 A;  2PBD P;  1D1J A;  3BQ8 A;  2JHE A;  2Y2K A;  4C3Q A;  3MFX A;  4NET A;  4RA7 A;  4F94 A;  4ESP A;  3O86 A;  4MN5 A;  4X69 A;  4LGW A;  1MKM A;  2XRN A;  3HL9 A;  1PWC A;  2Y2M A;  1F98 A;  4Y15 A;  1BLH A;  5IHV A;  4JLF A;  4OON A;  2W3F A;  5HWV A;  2XK1 A;  3Q7V B;  3MQ0 A;  2ZQ8 A;  4DF6 A;  5FQJ A;  4B88 A;  2EX2 A;  4RX2 A;  1KOU A;  4MDZ A;  1HVB A;  4DRT A;  3LR0 A;  3U2A A;  3D4F A;  3GV9 A;  1KGE A;  4C75 A;  3MBZ A;  3W4P A;  5JYO A;  1FOF A;  1SHV A;  4P0M A;  2J3T C;  4N9K A;  3VP0 A;  1IEM A;  5HAI A;  4KZ5 A;  4R6L A;  5L10 A;  1ZC2 A;  4DKI A;  3SZT A;  3C2W A;  4WMC A;  3MJQ A;  5FA7 A;  4BQM A;  4S2K A;  1OT6 A;  1JWP A;  2P74 A;  1T1B A;  1IOU A;  1EI5 A;  3PAE A;  5FQI A;  5IU1 A;  5EVI D;  5MC7 A;  1OTI A;  4D60 A;  3TG9 A;  2EWV A;  4GS9 B;  3V67 A;  1K6R A;  2XD1 A;  1L0F A;  3PBQ A;  1CQA A;  3W4O A;  3G32 A;  4L9G A;  2A2L A;  3LYX A;  4GDN A;  4U0T A;  3UE0 A;  1XKZ A;  4WLA A;  1WYC A;  2OWH A;  5HWW A;  3LIB A;  1GA0 A;  1XFN A;  1NJ4 A;  5FAT A;  2Y79 A;  3FYZ A;  3BFF A;  1PI4 A;  3FKV A;  5A8B A;  2WKE A;  3MQQ A;  2VV8 A;  4NXG A;  3OCN A;  3H82 A;  4KZ6 A;  1Y28 A;  5D3O A;  5CEC A;  5FSR A;  4GLQ A;  2EX9 A;  4UA6 A;  5IS1 A;  4O8G A;  3G31 A;  1CF0 A;  1E4D A;  3GR2 A;  3IX3 A;  4WEL A;  1T19 A;  2M7U A;  4YWZ A;  2DCF A;  4S2O A;  1L0E A;  3VOY A;  3EQV A;  3MXQ A;  1P97 A;  4YFM A;  3BW6 A;  3VP3 A;  1YT4 A;  3UB5 P;  3EGD C;  4M4X A;  4X1L A;  3BLS A;  5DVA A;  4IBX A;  1DJC A;  3OPH A;  3UPO A;  4GCZ A;  3HBR A;  1GHM A;  4X25 A;  5F1G A;  2PYR A;  2CMN A;  4ZAM A;  2V8C A;  3ITB A;  3I7J A;  4OQ0 A;  5FEG A;  2V0U A;  3Q82 A;  2J7V A;  2V9A A;  2XGN A;  4B4Z A;  3N8L A;  3BRM A;  3FZC A;  1ONG A;  4UA7 A;  5DF9 A;  5FEF A;  3KYE A;  3VOZ A;  2XLN A;  3Q7V A;  3NCK A;  4HEF A;  1N9O A;  5CHJ A;  4CPK A;  3MMH A;  4QY6 A;  1XJ3 A;  3AGD A;  5AVF A;  1CEG A;  3IHA A;  3MS6 A;  4M3K A;  1VHM A;  3MZE A;  1LI9 A;  2P08 A;  4R0Q A;  1K25 A;  4CLC E;  3E4P A;  2Y2Q A;  2Z2M B;  5TBM A;  4X56 A;  2X02 A;  3A0R A;  1U60 A;  4OOY A;  4BEN A;  2HJ9 C;  4WEJ A;  2WKH A;  3LR4 A;  5TJJ A;  3LI9 A;  1W63 Q;  4JXG A;  3ITA A;  4HBT A;  1PZP A;  4HI4 A;  1YLZ A;  4H8R A;  1YLJ A;  4L9E A;  4LEN A;  3G35 A;  1XA7 A;  1Z6F A;  4HOI A;  2OAQ 1;  3T1R A;  1VB6 A;  1BLC A;  1GSW A;  2H0Y A;  3RXX A;  1GCE A;  1OTD A;  2Q0O A;  3BFE A;  4R3J A;  2YKF A;  4GS9 A;  1YKD A;  2IWD A;  4QHC A;  2DMW A;  3MF0 A;  1OJ5 A;  2HZ5 A;  3RXW A;  4QPR A;  2O99 A;  3T4S A;  5A90 A;  3UPN A;  3RFB A;  3A3E A;  2FFY A;  3HLD A;  3V50 A;  1TF1 A;  4DXC A;  3FKW A;  1ACF A;  1LSW A;  3DW0 A;  2VGL S;  3DTI A;  1MPL A;  2A3U A;  4XXR A;  1XGI A;  1HTZ A;  3NUL A;  4FTX A;  1KGF A;  2Q9N A;  5E2H A;  4K0X A;  3LUQ A;  5CER A;  2WUQ A;  2HDQ A;  2DRW A;  3UB6 A;  4OOM A;  3E98 A;  2HP9 A;  4JPM A;  3HUO A;  4GN2 A;  1G6O A;  1PWD A;  3G4P A;  2HF6 A;  1L0D A;  3PBT A;  4N9L A;  4U0X A;  2JE5 A;  5AVE A;  2IA2 A;  5J7E A;  3D3O A;  3T4K A;  1O07 A;  3VV4 A;  4MBF A;  1A0K A;  3IBR A;  4S2I A;  4EEP A;  3FG8 A;  5GL9 A;  4L9F A;  1WE4 A;  4ME4 A;  3UDX A;  3WS2 A;  2O9B A;  3LY4 A;  2HDU A;  3Q1F A;  1H8Z A;  1PI5 A;  4NEE D;  3BY9 A;  4F3L B;  2R78 A;  3JVV A;  4JXV A;  3LEQ A;  2EWW A;  4A5R A;  2JKT M;  5FQM A;  5U47 A;  2H28 A;  1ESI A;  4H6J B;  3IQA A;  4I38 A;  4LCL A;  4BJP A;  1YPR A;  4DE3 A;  1N9L A;  2RCX A;  2W3H A;  4WM9 A;  4IHQ A;  3S7P A;  1PRQ A;  5I5L A;  1MWR A;  5E43 A;  4LCM A;  2LB5 A;  4EW7 A;  3MXS A;  4R1G A;  4P6Z S;  5CHU A;  2XDM A;  3EOI A;  3GEC A;  3MZD A;  4OP8 A;  3ZG5 A;  4IUH A;  3W2Z A;  3D72 A;  3VMA A;  3KSF A;  4GOG A;  3LIC A;  1HD8 A;  3CAX A;  3EWK A;  4QY5 A;  1XXM A;  5L8M A;  4KG5 A;  3UB8 A;  3UNW A;  2GDN A;  3V3R A;  4HJ4 A;  1PWG A;  3V3S A;  3TE8 A;  1QME A;  4FD8 A;  5FAP A;  2P04 A;  2ZL1 B;  3OPL A;  1TS8 A;  5F82 A;  2K31 A;  3SS5 A;  5EEC A;  3TW8 A;  3MKF A;  4KG2 A;  1K0K A;  2WKR A;  5CTN A;  4KQQ A;  1BLP A;  2V0W A;  1YSQ A;  4OH0 A;  5FI6 A;  3A0S A;  2D02 A;  1IYO A;  2VGK A;  1ZG6 A;  3GDI A;  4Y5F A;  1UWN X;  5KMW A;  3SH8 A;  3EGX C;  2Y2H A;  4PM9 A;  4HP9 A;  4YIN A;  5GLC A;  4GKU A;  3C8C A;  2HDR A;  3N8S A;  1FSW A;  4WMC D;  2ZOH A;  4KQD A;  4PM8 A;  3E4Q A;  4MN7 A;  3QNC A;  3S7O A;  5I94 A;  3T1X A;  3PBR A;  1FIL A;  1ZHH B;  2PDR A;  1G5U A;  5HX9 A;  1K56 A;  1CK3 A;  3BYD A;  4KZ8 A;  2J9O A;  3GSG A;  3M6H A;  3QP8 A;  3TRC A;  1DP9 A;  4ZJ3 A;  3LEZ A;  5TFQ A;  3BLM A;  3LCE A;  4CLC B;  1F2K A;  2P7J A;  2HPB A;  3H9W A;  3CG5 A;  1H8Y A;  4FCF A;  2I72 A;  4JXW A;  2QKP A;  5AQ9 A;  2E8J A;  5E2F A;  3NOT C;  3PTE A;  4LV2 A;  1ES4 A;  1N4O A;  3C30 A;  2VLG A;  4S2J A;  5HWT A;  1HLU P;  4JGR A;  4FSF A;  4F3L A;  3P01 A;  5DTK A;  2W1T B;  4UEY A;  1P9R A;  3IXD A;  3VE3 A;  4MMN A;  4HHD A;  3ZDJ A;  3T4T A;  4H6J A;  5FDS A;  2QJ7 A;  1SKF A;  3MR0 A;  3SS3 A;  1ERM A;  3LGO A;  1FCN A;  3CWF A;  3OZH A;  4WYY A;  2Y2G A;  2EXB A;  4Z1W A;  4GD8 A;  3O87 A;  4BWI A;  5FQK A;  3P09 A;  1M40 A;  5K5B A;  3C7V A;  3V5M A;  2W1R A;  2PU2 A;  3EQU A;  1YAX A;  1DP8 A;  1K6S A;  5TBM B;  5CHM A;  3ZG9 B;  3JVU A;  5GLA A;  1ES2 A;  4EQ1 A;  4X53 A;  2L0W A;  5AQB A;  5L2F A;  4E04 A;  1RGY A;  3T4O A;  1G28 A;  3HRE A;  2EA9 A;  2WKP A;  4OOL A;  2QZ6 A;  3UME A;  5HW3 A;  1H0M A;  2B5R A;  5KSH A;  3QP5 A;  2ZL1 A;  1FCO A;  3IX8 A;  4N1H A;  3O5Y A;  2KLI A;  5FAO A;  1WA9 A;  2ZM2 A;  4EXO A;  1VET B;  5DF8 A;  3LIA A;  5HZH A;  1MZU A;  3LR3 A;  1ONH A;  5KIZ A;  1O7E A;  1RGZ A;  3ULF A;  2BG1 A;  3M6B A;  3ZG0 A;  4BLM A;  3WS1 A;  3HUN A;  1IYQ A;  1CEF A;  5FAS A;  3S7N A;  3AGF A;  4PM7 A;  5EE8 A;  4ZTK A;  2VGL M;  3CJM A;  3OOV A;  2HP6 A;  3BM6 A;  1LL5 A;  3T12 B;  4N1X A;  2Y91 A;  3C5A A;  4LV0 A;  3SS4 A;  4NXE A;  3LY3 A;  4RYE A;  1T1C A;  1UGU A;  4UQI S;  4Y0O A;  2WAD A;  5C5K A;  3ZGA B;  2PYP A;  4MEZ A;  2JKR M;  1ODV A;  4DDS A;  3GVB A;  3M2J A;  1IKI A;  3EEA A;  1HZO A;  2KX6 A;  2OLV A;  4BD0 A;  1IKG A;  2C6W B;  5GLD A;  4R3A A;  4CLC A;  4Y3I A;  1F9I A;  4KZ4 A;  3C38 A;  4U3T A;  5HAQ A;  1KVM A;  2PU4 A;  2WAF A;  1TEM A;  4GW9 A;  1J9M A;  1J3W A;  1ZG4 A;  3HUM A;  3ZG8 B;  4CLC C;  1AXB A;  2R9W A;  2W1T A;  1MBL A;  1G68 A;  4JGQ A;  3MFD A;  2X71 A;  2PT7 A;  2JCH A;  3IF6 B;  1Y4O A;  4DE2 A;  1KDW A;  2WGV A;  4WN5 A;  4NXB A;  4WZ5 A;  4OPQ A;  4GNU A;  3KO6 A;  3E2L A;  1YLP A;  1JWV A;  1K54 A;  2HJE A;  3EEH A;  4RVA A;  3PBO A;  4BL2 A;  3GTC A;  1VQQ A;  3N8R A;  4QD4 A;  1ESU A;  2JKR I;  3OC2 A;  4DMZ A;  4R4R A;  3NJA A;  4JBF A;  2XQZ A;  4LV1 A;  5A92 A;  4K08 A;  1K54 C;  1KE4 A;  3RH8 B;  1YLW A;  1ALQ A;  1I2S A;  3A3F A;  3MZF A;  1FSY A;  4P6Z M;  1XX2 A;  1S67 L;  1NYM A;  5F83 A;  1W7F A;  4JF4 A;  2A24 B;  3F1O B;  3MXR A;  2ZD8 A;  3BFC A;  4IVI A;  1EW0 A;  4DDY A;  3R7W B;  3PR6 A;  2G2U A;  4KQO A;  4HIA A;  2GZA A;  3T1S A;  4II7 A;  1KE3 A;  4DN0 A;  5L07 A;  1NWZ A;  1RP5 A;  3B3X A;  2Y2J A;  1F5M A;  1K57 A;  1VET A;  2M7V A;  3WRZ A;  1DP6 A;  3ISG A;  4QJG A;  4B93 A;  1FR1 A; 
#chains in the Genus database with same CATH homology
 2XA7 S;  5HDC A;  2VV7 A;  3BQ8 A;  4P6Z S;  2JHE A;  1GSX A;  1H3Q A;  4BBU A;  2W0N A;  3EOI A;  3MFX A;  3GEC A;  3BWL A;  1OJG A;  1NLY A;  2QJ5 A;  3LI8 A;  4LLO B;  4MN5 A;  3K2N A;  3CLO A;  1MKM A;  4IUH A;  3W2Z A;  2XRN A;  2W27 A;  3D72 A;  2V1A A;  3KSF A;  3LIC A;  3CAX A;  3EWK A;  4MCW A;  2OWJ A;  1N9N A;  1F98 A;  5L8M A;  3UB8 A;  1XJ4 A;  4HJ6 A;  4HJ4 A;  3KSI A;  2ZMV A;  2W3F A;  5HWV A;  1S1Y A;  3TE8 A;  1P0Z A;  5DJU A;  2JN7 A;  4Y2F A;  4O01 A;  2P04 A;  3MQ0 A;  4O0P A;  4WF0 A;  1TS8 A;  3E4O A;  2B18 A;  4EER A;  2K31 A;  5HDS A;  4EU0 A;  3TW8 A;  1KOU A;  4MDZ A;  4HH2 A;  2WKR A;  3LR0 A;  4BBV A;  3U2A A;  2V0W A;  2PD7 A;  1YSQ A;  3A0S A;  4KUO A;  2D02 A;  4ARZ B;  2K7S A;  3GDI A;  3NOP C;  1OPX A;  4Y5F A;  5DKK A;  2O9C A;  3F1P A;  3FPV A;  1UWN X;  3BY8 A;  5HD5 A;  1UWP X;  3EGX C;  2Y8H A;  2PR6 A;  4WUJ A;  4HP9 A;  2J3T C;  3BQA A;  3C8C A;  2ZOH A;  4R6L A;  1V9Z A;  3CUE A;  4KQD A;  2QHK A;  2Z6C A;  3UE3 A;  5FL3 A;  3E4Q A;  3C2W A;  3MJQ A;  4MN7 A;  3S7O A;  1T18 A;  1OT6 A;  4ZRR A;  2KDK A;  3TJZ C;  1T1B A;  3F1N B;  1IOU A;  4EEU A;  4G3K A;  5IU1 A;  5F69 A;  5MC7 A;  3PBR A;  3PBN A;  1ZHH B;  1OTI A;  1XJ6 A;  2PDR A;  2VA0 A;  4HY8 A;  5F6A A;  4JGO A;  3H7W A;  2EWV A;  3LIF A;  2QYB A;  3CUE C;  1ZTU A;  4GS9 B;  3V67 A;  5F68 A;  3PBQ A;  1S4R A;  1DP9 A;  3TRC A;  4GHI B;  4L9G A;  1S66 L;  2A2L A;  3LYX A;  2VZW A;  4R70 A;  1XJ2 A;  3PYP A;  4CLC B;  1OTE A;  1H8M A;  3NOU C;  2P7J A;  4WLA A;  4G3W A;  3H9W A;  4ETZ A;  1P9W A;  2OWH A;  5HWW A;  3LIB A;  5F5Y A;  5J4E A;  1XFN A;  2QKP A;  3S7Q A;  3NOT C;  1STZ A;  2Y79 A;  4HH3 A;  2K2N A;  4HJ3 A;  3C30 A;  2VLG A;  3LID A;  5HWT A;  1LL8 A;  3LFV A;  3PHY A;  4JGR A;  5A8B A;  4EET B;  2FH5 A;  2VX8 A;  3P01 A;  4FSF A;  4F3L A;  2W1T B;  3MQQ A;  5IT5 A;  2VV8 A;  4UEY A;  1P9R A;  4NXG A;  3OCN A;  3H82 A;  1Y28 A;  1OTA A;  3VE3 A;  4MMN A;  2A24 A;  3F1O A;  4HHD A;  4GLQ A;  3T4T A;  4I39 A;  2ZBB A;  4WEK A;  4Q0J A;  5DFY A;  3R7W A;  2PD8 A;  5IS1 A;  4O8G A;  1T1A A;  4H6J A;  4I5S A;  4LRY C;  5AJG A;  3CIT A;  4WEL A;  1T19 A;  1W63 M;  2QJ7 A;  3T4L A;  2PHY A;  3T50 A;  3MR0 A;  2M7U A;  4YWZ A;  3HJK A;  4PAU A;  4B9O A;  3EQV A;  3PBS A;  3CWF A;  2QWS A;  1NRJ A;  2GX5 A;  3MXQ A;  1P97 A;  3BW6 A;  4R38 A;  2JKT I;  2PR5 A;  4Z1W A;  3EGD C;  4NXF A;  2J3W A;  2NUP C;  4M4X A;  4BWI A;  4BBT A;  2W3G A;  4GCZ A;  5K5B A;  1LSX A;  3OLO A;  4FOF A;  2W1R A;  3EQU A;  1YAX A;  1DP8 A;  1YSP A;  4Q0H A;  5TBM B;  5G4Z A;  2PYR A;  2CMN A;  1TS0 A;  2L4R A;  3JVU A;  4LRX C;  4WL9 A;  2HV1 A;  4EQ1 A;  2L0W A;  2V0U A;  4E04 A;  3T4O A;  1D7E A;  1G28 A;  2M1C A;  1D06 A;  5CX7 A;  3KSH A;  3UE6 A;  1X0O A;  2EA9 A;  4XT2 B;  2WKP A;  4OOL A;  5DKL A;  2V9A A;  3VE4 A;  3UME A;  1OT9 A;  1S4S A;  3KX0 X;  5G4Y A;  5DF9 A;  4Q0I A;  3IS2 B;  3UMD A;  5KSH A;  2OOL A;  1N9O A;  3SW1 A;  3O5Y A;  2KLI A;  3MMH A;  1WA9 A;  2YKH A;  4UQI M;  1XJ3 A;  4EXO A;  5AVF A;  2VJW A;  3LIA A;  1VHM A;  5HZH A;  2P08 A;  1MZU A;  2FZ0 A;  5HD3 A;  3LR3 A;  3VOL A;  4CLC E;  2L1M A;  5KIZ A;  3E4P A;  4ARZ A;  2LB9 A;  3BJN A;  5TBM A;  3ULF A;  4HNB A;  3A0R A;  4MN6 A;  3UB7 A;  3OCL A;  2HJ9 C;  2V1B A;  2VEA A;  4WEJ A;  3NHQ A;  3LR4 A;  5TJJ A;  3LI9 A;  3S7N A;  1W63 Q;  4HI4 A;  5EFW A;  4PKY G;  2VGL M;  3A0V A;  3OOV A;  4L9E A;  5LBR A;  2I9V A;  2J80 A;  2W3E A;  4HOI A;  4NXE A;  3CI6 A;  1T1C A;  2BAS A;  1UGU A;  2OAQ 1;  3F1N A;  4DJ2 A;  4CQH A;  4UQI S;  1VB6 A;  4HQA A;  4IJG A;  1GSW A;  5C5K A;  1LSV A;  1OTD A;  2PYP A;  2JKR M;  3KYZ A;  2YKF A;  2D01 A;  5HPF A;  4GS9 A;  1ODV A;  1YKD A;  3DBA A;  5HDD A;  2DMW A;  3MF0 A;  1OJ5 A;  3EEA A;  3B42 A;  4CLC D;  2MJ6 A;  2KX6 A;  2O99 A;  4QPR A;  3FPW A;  3T4S A;  4GHI A;  2GNX A;  4PKY A;  3RFB A;  3B33 A;  4R3A A;  4CLC A;  4Y3I A;  1F9I A;  4LPZ A;  4G3V A;  3C38 A;  1V9Y A;  1TF1 A;  1LSW A;  2VGL S;  4I3I A;  3F1P B;  3ZYT A;  2OAP 1;  4GW9 A;  1DRM A;  3IBJ A;  2O0Y A;  2NUT C;  4CLC C;  3HJI A;  3LUQ A;  4JGP A;  4YNR A;  2W1T A;  3E0Y A;  5DFX A;  4EES A;  2ZOI A;  4IUK A;  2J3T D;  3MQO A;  4JGQ A;  2PT7 A;  4AFI A;  3UB6 A;  4OOM A;  3KSG A;  3B47 A;  3LR5 A;  5HPI A;  3E98 A;  3ZQ5 A;  4I3A A;  2O9A A;  2VKS A;  4NKP A;  4WN5 A;  1JNU A;  1G6O A;  4NXB A;  2W3D A;  2HF6 A;  3H7W B;  3LIE A;  5DJT A;  1MC0 A;  3KO6 A;  1IFQ A;  5HL6 A;  3PBT A;  5J3W A;  3PXP A;  4YOF A;  2HJE A;  3EEH A;  5AVE A;  2XRO A;  2IA2 A;  3PBO A;  5J7E A;  2XSS A;  3D3O A;  1LT0 A;  4GJ4 A;  3T4K A;  4L0L A;  3G6O A;  4LRZ E;  4EUV A;  3FC7 A;  4DJ3 A;  3T4Q A;  3HCY A;  3VV4 A;  2JKR I;  1TD5 A;  2INW A;  3IBR A;  2G7U A;  3OC2 A;  4DMZ A;  4EEP A;  3FG8 A;  3KYQ A;  3R4K A;  3NJA A;  4L9F A;  4ME4 A;  4ETX A;  3T4J A;  2HGV A;  2O9B A;  4K08 A;  4BMW A;  2VV6 A;  1BYW A;  3RH8 B;  2XA7 M;  1XFQ A;  4NEE D;  4KUK A;  4P6Z M;  3BY9 A;  1S67 L;  4I3J A;  4F3L B;  2R78 A;  3K3C A;  2B02 A;  1TS7 A;  3JVV A;  1GSV A;  1NLZ A;  4PHT A;  2ZMF A;  3H82 B;  2KOI A;  2EWW A;  4XT2 A;  2JKT M;  2A24 B;  3F1O B;  2H28 A;  1EW0 A;  3RTY A;  2Z6D A;  1OTB A;  3R7W B;  3PR6 A;  2GJ3 A;  4KQO A;  4HIA A;  4H6J B;  4I38 A;  4HP4 A;  1TS6 A;  3IS2 A;  3P7N A;  2GZA A;  4BJP A;  4II7 A;  4RQ9 A;  3OBF A;  1N9L A;  4DN0 A;  5HSQ A;  2W3H A;  3UB9 A;  1S1Z A;  1NWZ A;  2WKQ A;  4IHQ A;  3S7P A;  5I5L A;  1F5M A;  3ICY A;  2M7V A;  1DP6 A;  2LB5 A;  4EW7 A;  4B93 A;  3K3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...