3LIAA

Crystal structure of the extracellular domain of the putative histidine kinase mmhk1s-z2
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
262
structure length
262
Chain Sequence
b'KLAYEKSIEMAGNYANQFDAQMEANQAIARTLACTMAEYGSQDREEAMSIIKRILNENPQLIGVYLGYEPDAFDGRDKNYINAPGHDSTGRFVPYCNKINGPVIIEPLVHYDSSDYYQLPKTTGKDTLTEPYFYEGIFMVSYDSPIFKNGEFAGIAGVDVPLEYVDDVASSIRTFDTGYAFMVSNTGIFLSHPTQKNWIGEKSLSDFDVEEIKNAASDIREGIGGHVEIKDPITGKTVIMFYEPVKTGDFSFVLVVPKEEML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical sensory transduction histidine kinase
publication title Structural characterization of the predominant family of histidine kinase sensor domains.
pubmed doi rcsb
source organism Methanosarcina mazei
molecule tags Signaling protein
total genus 77
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02743 dCache_1 Cache domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3liaA01
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3liaA02
1XJ6A 4HJ3A 4L9EA 5HDSA 4B9OA 3H9WA 4HH2A 2PDRA 2BASA 4GHIB 4BBUA 3UB9A 1GSXA 4HJ6A 3FC7A 1OTBA 3KX0X 4MN6A 4NXGA 4GHIA 3B33A 1EW0A 1UWNX 3A0VA 1OJ5A 4GS9B 3ULFA 3VE3A 2ZBBA 3K3CA 3EEHA 3UB8A 1T1AA 3BY9A 2OWJA 1LSVA 3UMDA 3MJQA 2PD7A 1OTIA 5J4EA 4KUKA 5A8BA 3LUQA 1LSXA 1XFQA 5DKKA 5HWWA 1ODVA 3FG8A 4WLAA 5TBMB 1OT6A 3HJKA 2QKPA 3MFXA 4H6JB 3NOUC 4I5SA 2P7JA 3NJAA 2KX6A 2B02A 5TBMA 1GSVA 4F3LB 4EERA 2W0NA 1D06A 5IS1A 4I39A 3IS2B 4H6JA 3BY8A 5G4ZA 4L9FA 3ZQ5A 3GDIA 2OWHA 1G28A 4HHDA 4F3LA 4JGRA 4EETB 4I38A 1S66L 3IS2A 5HZHA 3A0SA 3NOTC 1V9ZA 3PYPA 3CAXA 2A24B 2QWSA 2I9VA 3VOLA 2V1BA 3G6OA 4HJ4A 3LIBA 1N9OA 1BYWA 5HDCA 1OTDA 4NXFA 2A24A 5I5LA 3UE6A 1T19A 4EW7A 2VV6A 4R3AA 3BWLA 3SW1A 5IU1A 4KQDA 2WKRA 2V0WA 3P7NA 3GECA 3RH8B 4HNBA 1S1YA 3CWFA 2OOLA 1XJ4A 1UWPX 1DRMA 5HD3A 3D72A 2W27A 3OLOA 4HI4A 4EEUA 1Y28A 1F9IA 4K08A 5DJTA 3C8CA 3F1NB 2ZOHA 3MR0A 1OTAA 1TS7A 2VV7A 4HP9A 4JGOA 2VLGA 3LIEA 3F1NA 3H82B 4HIAA 2YKFA 1DP9A 4XT2B 1OTEA 4LRXC 5AVEA 1T1BA 2GJ3A 2HV1A 2L4RA 3CLOA 1DP8A 4I3IA 3NHQA 1V9YA 3PHYA 1S4RA 5HSQA 3H82A 1N9NA 3VE4A 4XT2A 1OJGA 1LSWA 5G4YA 2PYPA 1T18A 1P0ZA 1VB6A 1DP6A 2L0WA 4M4XA 1S67L 4EEPA 2L1MA 3LI9A 1GSWA 5EFWA 5AVFA 1UGUA 3LYXA 2J80A 3A0RA 4I3AA 3RTYA 1WA9A 2H28A 5J7EA 1LT0A 1T1CA 3IBRA 4YWZA 4LPZA 2V0UA 3LIFA 3UMEA 1F98A 1TS6A 5KIZA 4KUOA 2D01A 3HJIA 3E4PA 1N9LA 3E4QA 2M1CA 3MQOA 4JGQA 3F1OA 5J3WA 4PKYG 5F68A 2ZOIA 2PD8A 1X0OA 3LI8A 4WUJA 3H7WB 2V9AA 4L9GA 1JNUA 2PYRA 3MXQA 3H7WA 4EXOA 1P97A 1NWZA 3LIAA 1MZUA 4EQ1A 1OT9A 5DJUA 4HH3A 3MQQA 2PHYA 2PR6A 1TS0A 2JN7A 4PKYA 4EESA 4R70A 4HP4A 4WN5A 3C2WA 3ICYA 4R6LA 4HY8A 4LRZE 4BBTA 1TS8A 4GS9A 5HDDA 3LIDA 5HD5A 4HQAA 1D7EA 2INWA 2K7SA 3NOPC 4GCZA 5F5YA 4NXBA 4GW9A 3E4OA 3T50A 1S4SA 3F1PB 1XJ2A 4MN5A 2PR5A 3LICA 4WF0A 4NXEA 3EWKA 4I3JA 2WKQA 1XJ3A 2JHEA 2YKHA 2V1AA 4LRYC 4LLOB 4R38A 5F6AA 5F69A 4DJ2A 3F1PA 4JGPA 2R78A 3UB7A 4RQ9A 3F1OB 3UB6A 4BBVA 5DKLA 5HWTA 2QHKA 2QJ7A 2EA9A 2Z6DA 2D02A 2VEAA 3K3DA 2QJ5A 1LL8A 4HOIA 4DJ3A 2Z6CA 4E04A 1KOUA 1S1ZA 1XFNA 2KDKA 4WL9A 2CMNA 5HWVA 2VV8A 2WKPA
chains in the Genus database with same CATH superfamily
1XJ6A 1YLZA 3BJNA 1ESUA 3HVFA 1MKIA 3WS5A 1JWZA 4YOFA 2JKRM 4NKPA 2ZLYA 1IELA 4Z1WA 1GSXA 3UB9A 3IX4A 2ZJ9A 4X6TA 2J3TC 1NZUA 3EOIA 1GA9A 2ZM8A 3VFFA 4DRTA 3A3IA 3LFVA 1SZVA 2H0TA 3B33A 3VP0A 3MSHA 3E2LA 4XUZA 5HL1A 1K56D 3D9YA 2K2NA 4JXSA 5HL6A 4OQ0A 4Y7PA 4JXGA 2XFTA 3IHBA 1LSVA 5CEDA 1OTIA 3ZG5A 1PZOA 5J4EA 3N8LA 5FDHA 4KQRA 2XEPA 3LR0A 4ID4A 2XROA 4OP8A 1NXYA 5HWWA 1AWIA 3FG8A 5FQJA 5FA7A 4X56A 3M2KA 5TBMB 4HEFA 2PBDP 5FQIA 3MFXA 5JYOA 1KGFA 3NJAA 3PTEA 3V5MA 5TBMA 2WYXA 4DDYA 4IHQA 3ZVWA 2Y55A 4Y2FA 2EFXA 4QU3A 5HAPA 4FUWA 2RL3A 3FPWA 1PI4A 4JGRA 4I38A 3NC8A 1S66L 2Y2OA 1H3QA 2ZC6B 3IWIA 3NOTC 4JXVA 4UAAA 4P0MA 3LR3A 1A0KA 5IT5A 5EVIC 1QMEA 3HL9A 2WAFA 2V1BA 2HDSA 2CC1A 1N9OA 5HW3A 1OTDA 3OC2A 3UE6A 1EI5A 3P01A 2VV6A 1PWCA 1G68A 3BFFA 3BWLA 4KG2A 2IA2A 4MBFA 5GLDA 3EGXC 4Y13A 2V0WA 3P7NA 5AQ7A 1FCMA 3RH8B 4HNBA 1S1YA 1KE4A 3IX3A 3V3RA 1SDEA 5GHYA 3OPRA 3IF6B 1DRMA 3O88A 3G30A 3HUOA 3UNWA 3QP1A 4HI4A 3IH8A 5FSRA 3PAGA 3GTCA 4MEZA 2R9XA 4BD0A 4OQHA 1L0DA 4KZ3A 3M6BA 2JKTI 5EM1A 4DMZA 1XX2A 2JCHA 1AXBA 2VLGA 2G2UA 1O7EA 3HLCA 4CJNA 4Q8IA 2WGVA 1WE4A 1EWZA 3UPNA 1BTLA 4Q0IA 3W4OA 2IWDA 1ONHA 2L4RA 2W3HA 4I3IA 1V9YA 2HPBA 1S4RA 5HSQA 4DF6A 1N9NA 3MZFA 3LEZA 2R9WA 3GV9A 3S7NA 1CEFA 3FKVA 5G4YA 3SH7A 4DKIA 1N4OA 1S67L 4EEPA 4LCLA 2UV0E 2EXAA 3IWOA 5M19A 3UPPA 5GLCA 3LYXA 5LBRA 1JWPA 2J80A 5EVLA 3O5YA 4UHUA 4ZAMA 3DAVA 5GL9A 4ZJ3A 3RTYA 1WA9A 2H28A 2EXBA 5C5KA 1CJFA 1LT0A 3NBLA 2O9BA 3VSKA 4Z9QA 5EUAA 4KUOA 1H8MA 1BSGA 2Q9MA 5F1FA 4UEYA 2B18A 1TVFA 3SZTA 4FCFA 3E4QA 5A91A 4JGQA 3ZCZA 4DXCA 3C38A 4S2IA 3T1RA 1K54A 3HLWA 4Q0JA 2JBFA 3T4LA 2WGIA 4EUZA 2ZM2A 3U2AA 2PD8A 5AQAA 1ACFA 4A5RA 3MXSA 2ZL1B 3T12B 5CEBA 1ONGA 1L0GA 3QP4A 2DCFA 4QJGA 3IF5A 3IXDA 2OAP1 4EXOA 1P97A 2ZL1A 4LENA 1JVJA 1TDGA 3HLEA 3LIAA 1MZUA 1OT9A 4GZBA 4QWOA 3KSHA 2WAEA 4O8GA 2JN7A 3TOIA 1JWVA 2Y2GA 1PWGA 2H5SA 3G2ZA 5AJGA 3NDGA 2QPNA 2XA7S 4WZ5C 2ZQDA 5TFQA 3MS6A 3MXRA 1MWRA 4EBPA 3N6IA 4EBLA 2Y2MA 5HD5A 1LL5A 4P6ZS 5DFYA 2LB9A 4IVKA 1ALQA 4IUHA 2WKIA 1E3UA 3FPVA 3LO7A 3VOZA 3E4OA 5G18A 1W7FA 4ZJ1A 3BQ8A 1S4SA 3GRJA 1Q2PA 2ZC7A 3VP1A 3VSLA 1XJ2A 4BL3A 1M40A 1W8YA 3EWKA 4NK3A 4X55A 1MWTA 1KE3A 2YKHA 1K4FA 4R38A 5F6AA 4DJ2A 1K0KA 2ZQAA 4B93A 4FH2A 2R78A 3UB6A 4KZ6A 5DKLA 2QHKA 5HAIA 1J3WA 3NIAA 4EV4A 2NUTC 4Y15A 2V8FA 5L07A 2VZWA 3HLBA 2W3DA 2Z6CA 1XA1A 1S1ZA 1XFNA 1E4DA 1HZOA 2KDKA 4WL9A 4OPZA 2Z2MB 2VV8A 3E0YA 2WKPA 1ZKJA 5EVIB 4E3IA 1XA7A 2Y2IA 2XGNA 3T4QA 2VGKA 3OOVA 3H9WA 4U3TA 2PDRA 4KQQA 4YFMA 4OPYA 2VK3A 3WS4A 5EVIA 2H10A 3DTMA 4HJ6A 3S22A 3FC7A 4MCWA 4GJ4A 4P6ZM 3C4OA 3IWQA 1YM1A 4JPMA 2XQZA 3JYIA 3Q1FA 1IKIA 1EW0A 1F2KA 4E3JA 1UWNX 5M1AA 5TGFA 1BLPA 1XPBA 3A0VA 3V50A 4EUVA 4GS9B 3VE3A 2ZBBA 1N9BA 4IBXA 2ZQ9A 4B4XA 3EEHA 1T1AA 2XK1A 3BY9A 2J8YA 1BUEA 2MJ6A 4KG6A 4ETXA 5DTSA 3B3XA 3MJQA 3IT9A 2PD7A 2ZQ8A 1I5QA 4WELA 2Y79A 3BECA 3Q07A 5A8BA 4Y3IA 3PAEA 1CF0A 4WLAA 3MZEA 2PT7A 1OT6A 4KQOA 2W3GA 4FH4A 3LEQA 2PBYA 4E6XA 5FAOA 4UA6A 2B02A 5L2FA 1G6OA 4DXBA 1P9RA 5CGXA 3IXGA 3CPTB 4BQMA 2O9AA 1D06A 2QMIA 4PPRA 4I39A 1GHIA 3BY8A 5G4ZA 4L9FA 2EWVA 2OWHA 1NLYA 1W8QA 3CPTA 4IJGA 5FI6A 4EQIA 2C6WB 1I2WA 5FEFA 4C6YA 5HPFA 2ZMFA 3UDIA 3CAXA 2DRWA 4ETZA 2HGVA 2HP9A 1HD8A 1K57C 1MXOA 1YLJA 4HJ4A 3FYZA 4O01A 2FFYA 5I5LA 2PU4A 2OV5A 2WZXA 3UB5P 2EX9A 4EW7A 5J8XA 3G32A 5KZHA 2ZD8A 1LI9A 2W3FA 4PM7A 4Y5FA 1K55C 1L2SA 1NRFA 1BT5A 5EV0A 4FOFA 1SCWA 3T4KA 1H8ZA 2GX5A 2OOLA 3BFDA 3MF0A 5HD3A 3W4QA 4E3MA 3UDFA 3CITA 3JVUA 1F9IA 3ISGA 4K08A 3WS2A 3C8CA 3F1NB 3IXBA 3MR0A 1S0WA 2JKGA 1OTAA 4O7DA 2VV7A 4JGOA 4S2NA 5E2FA 1TD5A 1SKOB 4E6WA 3F1NA 1K6RA 4G3VA 2YKFA 3KYQA 4XT2B 1L0FA 1PI5A 1GA0A 1HTZA 1OTEA 2BG1A 4LRXC 1DY6A 3CLOA 1SKOA 4RX3A 2VJWA 5EM0A 4Y0TA 2JKFA 4XT2A 4OONA 1BLSA 1OJGA 1LSWA 1P0ZA 1VB6A 1YT4A 4S2MA 2OAQ1 4Q0HA 2P04A 2L0WA 2XH9A 4M4XA 1FSYA 2L1MA 4WZ5A 1EROA 3CJMA 5AVFA 3UE0A 4S2PA 4DE3A 3PBQA 3DWKA 5F1GA 1E25A 5J7EA 3GQZA 1T1CA 3IBRA 1FR1A 3IX8A 4EWFA 5TR7A 3CZDA 3UMEA 1F98A 5KIZA 4BLMA 1H5XA 3E4PA 1IKGA 2Y91A 2C5WB 5FEGA 2M7VA 4CLCC 3MQOA 4GDBA 2VX8A 1ZTUA 4PKYG 4BENA 2DNSA 3L9KA 2Q0OA 4MBKA 5F68A 1ES4A 2XLNA 4EU0A 1OMEA 4WUJA 5TJJA 4MN7A 3PBOA 4FD8A 4N9LA 1VQQA 1MPLA 2PYRA 2ACGA 3MXQA 2Y2PA 4QD4A 5EVEA 1PRQA 3OPHA 3SH9A 2HP5A 3MKEA 4S2KA 1RGYA 4PM6A 1NWZA 4KZ9A 4OOYA 2J7VA 1HLUP 3S4XA 1BULA 2EX8A 4OQGA 4XXRA 4R23A 1TS0A 3EEAA 3U4LP 4PHTA 4EESA 1BZAA 4R4SA 5KSCA 3TW8A 1KDWA 4HP4A 4WN5A 3ICYA 4X25A 1KVLA 4MMNA 1IEMA 2JKRI 4LRZE 1NY0A 4BBTA 1TS8A 3IQAA 4LV3A 5FQQA 3LR4A 4Y0UA 2X71A 2LB5A 2HJ9C 3PR6A 4HQAA 1D7EA 4KZAA 5HX9A 5F5YA 4GCZA 2XR0A 1MKMA 3EQUA 3T50A 4DE0A 3ZG0A 5DFXA 2PR5A 2HDQA 3LGOA 4WBGA 4WF0A 1NYYA 1TF1A 4I3JA 2WKQA 1XJ3A 2V1AA 2ZMVA 5F69A 3JPUA 1PWDA 1SKFA 3LCEA 1XP4A 4WZ4A 3O87A 5FAQA 2V20A 4BBVA 2JE5A 2VGLM 2HJEA 4GD8A 5HWTA 4WYYA 3ZFZA 4D60A 2XD1A 4S2OA 3K3DA 4UA9A 4ARZB 2XSSA 1KDSA 1LL8A 4E3NA 1DJBA 1YLTA 4E04A 1KOUA 4ZRRA 3UDXA 2VGJA 4ARZA 1OPXA 4QY5A 1F5MA 4HH2A 1VHMA 3SOIA 2BASA 4S2NC 4GHIB 5A90A 4ZJ2A 4LFUA 1WYBA 1HVBA 3QP5A 1K57A 3WS1A 1OTBA 4GHIA 1RGZA 2EFUA 3UN7A 3UE1A 4ME4A 1WYCA 3ULFA 4DE2A 3KYEA 3K3CA 3IBJA 3PBRA 1K55A 5HAQA 4C3QA 4U0XA 5F82A 1JTGA 1IYSA 3LUQA 3AGFA 2XF3A 1STZA 5DKKA 2J9PA 4WMCA 4IEDA 3T1QB 3T4OA 3Q81A 5EOEA 3HJKA 2QKPA 4BMWA 1XGJA 1ERQA 3DBAA 4PM5A 3NOUC 1K38A 2QZ6A 4I5SA 2P7JA 2Z2LB 2KX6A 3BLMA 3BQAA 5CXWA 4YINA 1GSVA 4F3LB 3B42A 4EERA 1KE0A 1DJCA 1ESIA 5IS1A 3IS2B 1G6AA 1ERMA 1K4EA 1G28A 4UA7A 2JC7A 4F3LA 5CECA 3IS2A 4WEKA 3T4TA 5HARA 3HBRA 5HZHA 3S7QA 3ITBA 3DTIA 2J3TD 2WZZA 1H8YA 3Q82A 3G6OA 1KVMA 3C30A 4LCMA 3BW6A 5HDCA 5FAPA 4OLDA 4RVAA 1E3UD 4CLCB 4R3AA 1Z6FA 2W1TB 3V39A 5IU1A 1VM1A 3M2JA 4KQDA 4MNRA 2GDNA 1BLHA 3A3EA 3PBTA 3CWFA 4JBFA 4C75A 1XJ4A 3SS3A 2Y2NA 4CLCA 3BM6A 3KSIA 2W1TA 4X1LA 3C4PA 3N4IA 2K31A 1S6RA 3GMWA 3D72A 2VA0A 2P08A 2W27A 3OLOA 4R3JA 4BJPA 1Y28A 3C7VA 4JF6A 5DJTA 3ZNYA 3NI9A 2ZOHA 1LL9A 1TDLA 1CI9A 4QPRA 2O9CA 3CUEC 1TS7A 5DTTA 5EE8A 1YMXA 1W63Q 3LIEA 5D3OA 4OPQA 3G31A 2ZC3B 5E2EA 1ZG6A 3UPOA 2J9OA 1W63M 1T1BA 4RA7A 3FWLA 2GJ3A 2HV1A 2UWXA 1ES2A 3V67A 3VP4A 3BFGA 1Y4OA 3ZVTA 1CEGA 3NY4A 4MBHA 3ZG9B 5FASA 4R1GA 1L3LA 2PYPA 5EVID 5CERA 2KOIA 3UY6A 4OH0A 4Y17A 2M7UA 5CHUA 5EFWA 4K0XA 2W1RA 1VEUA 4FTXA 1UGUA 3WWXA 3W8KA 3OZHA 3SS5A 2P74A 1K56A 1SDNA 3N7WA 2FFFB 1NLZA 3PBSA 3W4PA 2Y4AA 4HBUA 3LIFA 1TS6A 3FKWA 3HJIA 5DF9A 3E98A 3WS0A 1DJAA 2M1CA 3T1XA 2HP6A 3F1OA 5J3WA 3QHYA 4G3KA 4ZDXA 2JKTM 1NRJA 3PXPA 3MZDA 3SS4A 4FSFA 3HLFA 5FQ9A 5GLAA 5F83A 1ZHHB 2V9AA 2XRNA 3FZCA 4UQIS 2Y8HA 3RXWA 1W5DA 1JNUA 1XKZA 3C5AA 3RFBA 2OLUA 2NUPC 2Y2KA 1PW1A 4B88A 5CGWA 2W3EA 5DJUA 5FL3A 4BD1A 4GNUA 3BFCA 3MBZA 1D1JA 2FZ0A 4KZ7A 4KZBA 4HH3A 4PAUA 1GHPA 3KYZA 5HFOA 4PKYA 1XGIA 3G34A 3UE3A 3TRCA 3C2WA 1VETB 5CTMA 5DVAA 5A93A 4HY8A 3IH9A 5CX7A 4S2LA 5DF8A 3MMHA 3VMAA 5U47A 3VOYA 1G5UA 4X69A 2B5RA 2E8JA 3LIDA 2AVXA 1VETA 2INWA 4NEED 2K7SA 1RP5A 3NOPC 3T4JA 4NETA 3Q7VB 4JF4A 5AQBA 2BTFP 4K91A 3OPPA 3ZGAB 3F1PB 4MN5A 3T1SA 3BRMA 3LICA 4EBNA 5JYPA 3Q7VA 2JHEA 5CHMA 3AGDA 4LRYC 3OCLA 4LLOB 4BL2A 4GN2A 2FH5A 1CQAA 3G4PA 2Q9NA 1Q2QA 1FOFA 3F1PA 4UQIM 4N9KA 3UB7A 5IHVA 2P9VB 4L0LA 1ZG4A 3VP2A 5FI2A 4ESPA 2Y2QA 4OOMA 1MWSA 2D02A 3LR5A 2HDRA 2A49A 1IOUA 2P9VA 1C3BA 4KZ4A 1YKDA 1IFQA 1FILA 3ZNTA 1BLCA 4CQHA 2GNXA 3A3DA 3M6HA 2HF6A 4HJ3A 5KMWA 4L9EA 5HDSA 3VP3A 4B9OA 4E3LA 5L10A 1FQGA 4IBRA 3S1YA 4BBUA 4MLLA 2VGLS 1H0MA 4WM9A 1PFLA 4QB8A 5CHJA 1YSQA 1PYYA 4MN6A 3HREA 3KX0X 4JXWA 1ES3A 4NXGA 4X68A 2HDUA 2V8CA 4CLCE 4LGWA 1MBLA 4DDSA 1ES5A 4CPKA 1OJ5A 5DTKA 4BWIA 3QNBA 3S7OA 3UB8A 3KSGA 4DN0A 3TJZC 1PZPA 2OWJA 3IF6A 4N1HA 3UMDA 4WEJA 1QMFA 3C7UA 5I94A 4KUKA 1PNEA 4KENB 1FIKA 3MKFA 1LSXA 2WKEA 1XFQA 2E8IA 3FV7A 4GKUA 3B47A 1ODVA 1MWUA 4KZ5A 2ZC4B 3MFDA 1TEMA 3D4FA 1CK3A 5FDSA 4H6JB 4P85A 5CGSA 2ZQCA 2V1ZA 3P09A 4LV2A 1KGEA 3CUEA 3N8RA 4OKPA 4PM8A 3KSFA 2W0NA 3IHAA 4H6JA 3QP8A 4JF5A 1YLYA 3ZQ5A 3GDIA 2V2FF 1J9MA 4HHDA 3Q7ZA 4G3WA 4EETB 3I7JA 4QHCA 3ZG8B 1LI0A 1O07A 1MY8A 3A0SA 1FCOA 2EX2A 4OVDA 5FI7A 2A3UA 1V9ZA 3TSGA 3PYPA 4P6BA 2KLIA 4U0TA 1Y54A 3O3VA 2A24B 4F94A 3S7PA 2QWSA 3ZYTA 2I9VA 4M3KA 3QNCA 3VOLA 2EX6A 3OBFA 1NJ4A 3LIBA 1BYWA 3RXXA 4NXFA 2A24A 4IVIA 3A3JA 4RYEA 3VV4A 1T19A 3HUMA 1IYOA 1KGGA 3GSGA 5K5BA 1W79A 1FR6A 4YNRA 4OQIA 3SW1A 5E43A 1YSPA 2XDMA 1FSWA 1M6KA 3A3FA 3DTKA 2WKRA 3GECA 2RCXA 2A2LA 4H8RA 2X01A 3BFEA 3D3OA 5GLBA 3HCYA 3P98A 2PRFA 4AFIA 1UWPX 1YPRA 4Y0OA 4RX2A 3AGEA 4PM9A 1GHMA 4EEUA 1U60A 2B95A 3ZHHA 4OOLA 5GHZA 3HUNA 2PU2A 2WK0A 3SH8A 5L09A 4HP9A 1YAXA 5FQKA 4GLQA 1K25A 3H82B 4O0PA 4HIAA 4X53A 2X02A 1DP9A 3O86A 3NECA 2EWWA 3HLDA 3NDEA 4OPRA 5AVEA 1DP8A 3DWZA 3NHQA 3PHYA 4PMAA 4D2OA 2ZQ7A 3H82A 2Y2JA 5EOOA 3VE4A 1PW8A 2Y2LA 1T18A 4GDNA 3ITAA 4DE1A 1K6SA 2O99A 1DP6A 1CI8A 2VKSA 3LI9A 1GSWA 3NULA 4K0WA 4N92A 2GZAA 3BLSA 3K2NA 3DTEA 1NZOA 3CHWP 3A0RA 3NCKA 2I72A 2IWBA 4I3AA 3V3SA 2WGWB 3OCNA 4B4ZA 4YWZA 2Y59A 4OP5A 4X1MA 4LPZA 4R4RA 1MC0A 2V0UA 3GVBA 3N8SA 2D01A 2Y2HA 3EQVA 1JTDA 4LV0A 2WGWA 1N9LA 3EGDC 3MQ0A 2PAVP 5EPHA 4GOGA 2WKHA 3JVVA 1XXMA 3G35A 2G7UA 4WMCD 5A92A 4HBTA 1PIOA 5GHXA 2ZOIA 4E3OA 3WRTA 1X0OA 2XFSA 3IF6C 4R0QA 3LI8A 4QY6A 3H7WB 1LHYA 4GD6A 2XA7M 1ZC2A 4IUKA 3E2KA 3G2YA 1L0EA 4JKTA 5E2HA 2O0YA 1LLBA 4L9GA 4R3BA 3DW0A 2IWCA 3PBNA 1GCEA 3H7WA 1Z09A 3QP2A 5E2GA 3QP6A 3UO9A 3TE8A 2H0YA 1I2SA 3BYDA 4EQ1A 3LY4A 4P87A 1FCNA 3GR2A 1IYQA 2BLSA 3MQQA 2G2WA 3CG5A 2PHYA 2PR6A 5HPIA 3IXHA 4R70A 4JLFA 2ZC5B 3OPLA 4R6LA 3RJUA 5CRFA 2ZM0A 5L8MA 5EECA 4GS9A 4S2JA 3T4SA 4LV1A 2J3WA 4NG2A 5HDDA 3W2ZA 3ZG7B 2DMWA 3CI6A 1VEUB 4HESA 3WRZA 1SHVA 3R4KA 1YLWA 1NYMA 3HLGA 4NXBA 4GW9A 1RCJA 5BOHA 5DF7A 3TG9A 4OLGA 1P9WA 4E3KA 3VFHA 2OLVA 2ZMAA 5FATA 4II7A 3ZDJA 5FQMA 3R7WB 5MC7A 3BEBA 2HZ5A 2QYBA 5M18A 4CLCD 3LY3A 4XUXA 4NXEA 5AQ9A 4MDZA 1K54C 5CTNA 3CMZA 4ZBEA 3L7HA 3R7WA 4JGPA 4RQ9A 3F1OB 1IYPA 4GB7A 5KSHA 4ZTKA 2QJ7A 2EA9A 2Z6DA 2VEAA 2OSUA 1YQSA 2QJ5A 4KZ8A 2WUQA 1YMSA 4HOIA 4DJ3A 4KG5A 2XD5A 2CMNA 5HWVA 2WADA 3KO6A 4N1XA 1YLPA
chains in the Genus database with same CATH topology
2HF6A 1XJ6A 4HJ3A 4ARZA 4L9EA 5HDSA 3BJNA 1OPXA 3T4QA 4B9OA 3OOVA 3H9WA 1F5MA 4HH2A 1VHMA 2PDRA 2BASA 4GHIB 4YOFA 2JKRM 4BBUA 4NKPA 2VGLS 3UB9A 4Z1WA 1GSXA 2J3TC 4HJ6A 1YSQA 3EOIA 3FC7A 4MCWA 4GJ4A 1OTBA 3KX0X 4MN6A 4NXGA 4P6ZM 4GHIA 4CLCE 3LFVA 3B33A 1EW0A 1UWNX 4ME4A 3A0VA 2K2NA 4EUVA 1OJ5A 4GS9B 5HL6A 3ULFA 3VE3A 4BWIA 2ZBBA 3K3CA 3S7OA 3EEHA 3UB8A 1T1AA 3BY9A 3KSGA 4DN0A 3IBJA 3TJZC 2MJ6A 2OWJA 3PBRA 4ETXA 1LSVA 3UMDA 4WEJA 3MJQA 2PD7A 1OTIA 4WELA 2Y79A 5J4EA 4KUKA 5A8BA 3LR0A 3LUQA 2XROA 4Y3IA 1LSXA 1XFQA 1STZA 5DKKA 5HWWA 3B47A 1ODVA 3FG8A 4WLAA 3T4OA 2PT7A 5TBMB 1OT6A 3HJKA 4KQOA 2QKPA 4BMWA 2W3GA 3MFXA 3DBAA 4H6JB 3NOUC 4I5SA 2P7JA 3NJAA 2KX6A 2B02A 3BQAA 1G6OA 1P9RA 3CUEA 5TBMA 1GSVA 3KSFA 4F3LB 3B42A 4EERA 2O9AA 2W0NA 1D06A 4IHQA 4Y2FA 5IS1A 4I39A 3IS2B 4H6JA 3BY8A 5G4ZA 4L9FA 2EWVA 3GDIA 3ZQ5A 2OWHA 1G28A 1NLYA 4IJGA 3FPWA 4HHDA 4F3LA 4JGRA 4G3WA 4EETB 4I38A 1S66L 3IS2A 4WEKA 1H3QA 3T4TA 5HPFA 5HZHA 3A0SA 2ZMFA 3S7QA 3NOTC 1V9ZA 3PYPA 2KLIA 3CAXA 3LR3A 4ETZA 5IT5A 2A24B 3S7PA 2HGVA 2QWSA 3ZYTA 2I9VA 2J3TD 3VOLA 3OBFA 2V1BA 3G6OA 4HJ4A 3LIBA 1N9OA 1BYWA 3C30A 3BW6A 5HDCA 4O01A 1OTDA 4NXFA 2A24A 3OC2A 5I5LA 3UE6A 3VV4A 1T19A 4EW7A 3P01A 2VV6A 5K5BA 2W3FA 4CLCB 4R3AA 4YNRA 3BWLA 3SW1A 4Y5FA 1YSPA 2W1TB 2IA2A 3EGXC 5IU1A 4KQDA 2WKRA 2V0WA 3P7NA 3GECA 2A2LA 3PBTA 4FOFA 4HNBA 1S1YA 3CWFA 3RH8B 3D3OA 3T4KA 2GX5A 2OOLA 1XJ4A 3HCYA 4CLCA 4AFIA 1UWPX 1DRMA 3KSIA 2W1TA 3MF0A 2K31A 5HD3A 3D72A 2VA0A 2P08A 2W27A 3OLOA 4HI4A 4EEUA 3CITA 4BJPA 1Y28A 3JVUA 1F9IA 4K08A 5DJTA 3C8CA 3F1NB 2ZOHA 4OOLA 3MR0A 2JKTI 1OTAA 4QPRA 2O9CA 3CUEC 1TS7A 2VV7A 4DMZA 4HP9A 1YAXA 4JGOA 2VLGA 1W63Q 1TD5A 3LIEA 4GLQA 4O0PA 3F1NA 3H82B 4HIAA 4G3VA 2YKFA 1DP9A 3KYQA 4XT2B 2EWWA 1OTEA 4LRXC 4Q0IA 1W63M 1T1BA 5AVEA 2GJ3A 2HV1A 2L4RA 3CLOA 1DP8A 2W3HA 4I3IA 3NHQA 1V9YA 3PHYA 1S4RA 5HSQA 2VJWA 3H82A 3V67A 1N9NA 3VE4A 4XT2A 3S7NA 1OJGA 1LSWA 5G4YA 2PYPA 1T18A 1P0ZA 1VB6A 2KOIA 2OAQ1 2M7UA 4Q0HA 2O99A 1DP6A 2L0WA 2P04A 2VKSA 4M4XA 1S67L 4EEPA 2L1MA 3LI9A 1GSWA 5EFWA 2W1RA 5AVFA 2GZAA 3K2NA 3PBQA 1UGUA 3LYXA 5LBRA 2J80A 3A0RA 3O5YA 4I3AA 3RTYA 1WA9A 2H28A 3OCNA 5C5KA 1NLZA 5J7EA 1LT0A 3PBSA 1T1CA 3IBRA 4YWZA 2O9BA 4LPZA 1MC0A 2V0UA 3LIFA 3UMEA 1F98A 1TS6A 5KIZA 4KUOA 1H8MA 2D01A 3EQVA 3HJIA 3E4PA 1N9LA 5DF9A 3EGDC 3MQ0A 4UEYA 2M7VA 3E98A 2B18A 3E4QA 4CLCC 2M1CA 3MQOA 4JGQA 3JVVA 3F1OA 2G7UA 3C38A 2VX8A 1ZTUA 5J3WA 4PKYG 4Q0JA 4G3KA 3T4LA 2JKTM 1NRJA 3PXPA 5F68A 2ZOIA 3U2AA 2PD8A 1X0OA 4FSFA 4EU0A 3LI8A 4WUJA 3H7WB 5TJJA 1ZHHB 2V9AA 2XA7M 2XRNA 4MN7A 4IUKA 4UQIS 2Y8HA 3PBOA 2O0YA 4L9GA 1JNUA 3PBNA 2PYRA 3MXQA 3RFBA 2OAP1 3H7WA 4EXOA 2NUPC 1P97A 1NWZA 3LIAA 3TE8A 1MZUA 4EQ1A 2W3EA 1OT9A 5DJUA 5FL3A 3KSHA 2FZ0A 4HH3A 4PAUA 3MQQA 3KYZA 2PHYA 2PR6A 1TS0A 4O8GA 2JN7A 4PKYA 5HPIA 3EEAA 4PHTA 4EESA 4R70A 3UE3A 3TW8A 3TRCA 5AJGA 4HP4A 4WN5A 3C2WA 3ICYA 4R6LA 4MMNA 2XA7S 2JKRI 4HY8A 4LRZE 5CX7A 4BBTA 1TS8A 3MMHA 5L8MA 4GS9A 3T4SA 2J3WA 3LR4A 5HDDA 3LIDA 3W2ZA 2DMWA 2LB5A 3CI6A 5HD5A 2HJ9C 3R4KA 3PR6A 4HQAA 1D7EA 4P6ZS 2INWA 5DFYA 4NEED 2K7SA 2LB9A 3NOPC 4GCZA 5F5YA 4IUHA 3T4JA 4NXBA 3FPVA 4GW9A 3E4OA 3EQUA 1MKMA 1P9WA 3BQ8A 3T50A 1S4SA 4II7A 5DFXA 3F1PB 1XJ2A 3R7WB 5MC7A 4MN5A 2PR5A 2QYBA 3LICA 4CLCD 4WF0A 4NXEA 3EWKA 1TF1A 4I3JA 4MDZA 2WKQA 1XJ3A 2JHEA 2YKHA 2V1AA 4LRYC 3OCLA 4LLOB 2ZMVA 4R38A 5F6AA 5F69A 4DJ2A 2FH5A 3F1PA 4B93A 4UQIM 3R7WA 4JGPA 2R78A 3UB7A 4RQ9A 3F1OB 3UB6A 4BBVA 2VGLM 2HJEA 4L0LA 5DKLA 5HWTA 2QHKA 5KSHA 2QJ7A 2NUTC 4OOMA 2EA9A 2Z6DA 2D02A 2VEAA 3LR5A 2VZWA 3K3DA 1IOUA 2QJ5A 4ARZB 2W3DA 2XSSA 1LL8A 1YKDA 1IFQA 4HOIA 4DJ3A 2Z6CA 4E04A 1KOUA 1S1ZA 4ZRRA 1XFNA 2KDKA 4WL9A 2CMNA 5HWVA 4CQHA 3KO6A 2VV8A 2GNXA 3E0YA 2WKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XJ6 A;  4HJ3 A;  4L9E A;  5HDS A;  4B9O A;  3H9W A;  4HH2 A;  2PDR A;  2BAS A;  4GHI B;  4BBU A;  3UB9 A;  1GSX A;  4HJ6 A;  3FC7 A;  1OTB A;  3KX0 X;  4MN6 A;  4NXG A;  4GHI A;  3B33 A;  1EW0 A;  1UWN X;  3A0V A;  1OJ5 A;  4GS9 B;  3ULF A;  3VE3 A;  2ZBB A;  3K3C A;  3EEH A;  3UB8 A;  1T1A A;  3BY9 A;  2OWJ A;  1LSV A;  3UMD A;  3MJQ A;  2PD7 A;  1OTI A;  5J4E A;  4KUK A;  5A8B A;  3LUQ A;  1LSX A;  1XFQ A;  5DKK A;  5HWW A;  1ODV A;  3FG8 A;  4WLA A;  5TBM B;  1OT6 A;  3HJK A;  2QKP A;  3MFX A;  4H6J B;  3NOU C;  4I5S A;  2P7J A;  3NJA A;  2KX6 A;  2B02 A;  5TBM A;  1GSV A;  4F3L B;  4EER A;  2W0N A;  1D06 A;  5IS1 A;  4I39 A;  3IS2 B;  4H6J A;  3BY8 A;  5G4Z A;  4L9F A;  3ZQ5 A;  3GDI A;  2OWH A;  1G28 A;  4HHD A;  4F3L A;  4JGR A;  4EET B;  4I38 A;  1S66 L;  3IS2 A;  5HZH A;  3A0S A;  3NOT C;  1V9Z A;  3PYP A;  3CAX A;  2A24 B;  2QWS A;  2I9V A;  3VOL A;  2V1B A;  3G6O A;  4HJ4 A;  3LIB A;  1N9O A;  1BYW A;  5HDC A;  1OTD A;  4NXF A;  2A24 A;  5I5L A;  3UE6 A;  1T19 A;  4EW7 A;  2VV6 A;  4R3A A;  3BWL A;  3SW1 A;  5IU1 A;  4KQD A;  2WKR A;  2V0W A;  3P7N A;  3GEC A;  3RH8 B;  4HNB A;  1S1Y A;  3CWF A;  2OOL A;  1XJ4 A;  1UWP X;  1DRM A;  5HD3 A;  3D72 A;  2W27 A;  3OLO A;  4HI4 A;  4EEU A;  1Y28 A;  1F9I A;  4K08 A;  5DJT A;  3C8C A;  3F1N B;  2ZOH A;  3MR0 A;  1OTA A;  1TS7 A;  2VV7 A;  4HP9 A;  4JGO A;  2VLG A;  3LIE A;  3F1N A;  3H82 B;  4HIA A;  2YKF A;  1DP9 A;  4XT2 B;  1OTE A;  4LRX C;  5AVE A;  1T1B A;  2GJ3 A;  2HV1 A;  2L4R A;  3CLO A;  1DP8 A;  4I3I A;  3NHQ A;  1V9Y A;  3PHY A;  1S4R A;  5HSQ A;  3H82 A;  1N9N A;  3VE4 A;  4XT2 A;  1OJG A;  1LSW A;  5G4Y A;  2PYP A;  1T18 A;  1P0Z A;  1VB6 A;  1DP6 A;  2L0W A;  4M4X A;  1S67 L;  4EEP A;  2L1M A;  3LI9 A;  1GSW A;  5EFW A;  5AVF A;  1UGU A;  3LYX A;  2J80 A;  3A0R A;  4I3A A;  3RTY A;  1WA9 A;  2H28 A;  5J7E A;  1LT0 A;  1T1C A;  3IBR A;  4YWZ A;  4LPZ A;  2V0U A;  3LIF A;  3UME A;  1F98 A;  1TS6 A;  5KIZ A;  4KUO A;  2D01 A;  3HJI A;  3E4P A;  1N9L A;  3E4Q A;  2M1C A;  3MQO A;  4JGQ A;  3F1O A;  5J3W A;  4PKY G;  5F68 A;  2ZOI A;  2PD8 A;  1X0O A;  3LI8 A;  4WUJ A;  3H7W B;  2V9A A;  4L9G A;  1JNU A;  2PYR A;  3MXQ A;  3H7W A;  4EXO A;  1P97 A;  1NWZ A;  3LIA A;  1MZU A;  4EQ1 A;  1OT9 A;  5DJU A;  4HH3 A;  3MQQ A;  2PHY A;  2PR6 A;  1TS0 A;  2JN7 A;  4PKY A;  4EES A;  4R70 A;  4HP4 A;  4WN5 A;  3C2W A;  3ICY A;  4R6L A;  4HY8 A;  4LRZ E;  4BBT A;  1TS8 A;  4GS9 A;  5HDD A;  3LID A;  5HD5 A;  4HQA A;  1D7E A;  2INW A;  2K7S A;  3NOP C;  4GCZ A;  5F5Y A;  4NXB A;  4GW9 A;  3E4O A;  3T50 A;  1S4S A;  3F1P B;  1XJ2 A;  4MN5 A;  2PR5 A;  3LIC A;  4WF0 A;  4NXE A;  3EWK A;  4I3J A;  2WKQ A;  1XJ3 A;  2JHE A;  2YKH A;  2V1A A;  4LRY C;  4LLO B;  4R38 A;  5F6A A;  5F69 A;  4DJ2 A;  3F1P A;  4JGP A;  2R78 A;  3UB7 A;  4RQ9 A;  3F1O B;  3UB6 A;  4BBV A;  5DKL A;  5HWT A;  2QHK A;  2QJ7 A;  2EA9 A;  2Z6D A;  2D02 A;  2VEA A;  3K3D A;  2QJ5 A;  1LL8 A;  4HOI A;  4DJ3 A;  2Z6C A;  4E04 A;  1KOU A;  1S1Z A;  1XFN A;  2KDK A;  4WL9 A;  2CMN A;  5HWV A;  2VV8 A;  2WKP A; 
#chains in the Genus database with same CATH topology
 1XJ6 A;  1YLZ A;  3BJN A;  1ESU A;  3HVF A;  1MKI A;  3WS5 A;  1JWZ A;  4YOF A;  2JKR M;  4NKP A;  2ZLY A;  1IEL A;  4Z1W A;  1GSX A;  3UB9 A;  3IX4 A;  2ZJ9 A;  4X6T A;  2J3T C;  1NZU A;  3EOI A;  1GA9 A;  2ZM8 A;  3VFF A;  4DRT A;  3A3I A;  3LFV A;  1SZV A;  2H0T A;  3B33 A;  3VP0 A;  3MSH A;  3E2L A;  4XUZ A;  5HL1 A;  1K56 D;  3D9Y A;  2K2N A;  4JXS A;  5HL6 A;  4OQ0 A;  4Y7P A;  4JXG A;  2XFT A;  3IHB A;  1LSV A;  5CED A;  1OTI A;  3ZG5 A;  1PZO A;  5J4E A;  3N8L A;  5FDH A;  4KQR A;  2XEP A;  3LR0 A;  4ID4 A;  2XRO A;  4OP8 A;  1NXY A;  5HWW A;  1AWI A;  3FG8 A;  5FQJ A;  5FA7 A;  4X56 A;  3M2K A;  5TBM B;  4HEF A;  2PBD P;  5FQI A;  3MFX A;  5JYO A;  1KGF A;  3NJA A;  3PTE A;  3V5M A;  5TBM A;  2WYX A;  4DDY A;  4IHQ A;  3ZVW A;  2Y55 A;  4Y2F A;  2EFX A;  4QU3 A;  5HAP A;  4FUW A;  2RL3 A;  3FPW A;  1PI4 A;  4JGR A;  4I38 A;  3NC8 A;  1S66 L;  2Y2O A;  1H3Q A;  2ZC6 B;  3IWI A;  3NOT C;  4JXV A;  4UAA A;  4P0M A;  3LR3 A;  1A0K A;  5IT5 A;  5EVI C;  1QME A;  3HL9 A;  2WAF A;  2V1B A;  2HDS A;  2CC1 A;  1N9O A;  5HW3 A;  1OTD A;  3OC2 A;  3UE6 A;  1EI5 A;  3P01 A;  2VV6 A;  1PWC A;  1G68 A;  3BFF A;  3BWL A;  4KG2 A;  2IA2 A;  4MBF A;  5GLD A;  3EGX C;  4Y13 A;  2V0W A;  3P7N A;  5AQ7 A;  1FCM A;  3RH8 B;  4HNB A;  1S1Y A;  1KE4 A;  3IX3 A;  3V3R A;  1SDE A;  5GHY A;  3OPR A;  3IF6 B;  1DRM A;  3O88 A;  3G30 A;  3HUO A;  3UNW A;  3QP1 A;  4HI4 A;  3IH8 A;  5FSR A;  3PAG A;  3GTC A;  4MEZ A;  2R9X A;  4BD0 A;  4OQH A;  1L0D A;  4KZ3 A;  3M6B A;  2JKT I;  5EM1 A;  4DMZ A;  1XX2 A;  2JCH A;  1AXB A;  2VLG A;  2G2U A;  1O7E A;  3HLC A;  4CJN A;  4Q8I A;  2WGV A;  1WE4 A;  1EWZ A;  3UPN A;  1BTL A;  4Q0I A;  3W4O A;  2IWD A;  1ONH A;  2L4R A;  2W3H A;  4I3I A;  1V9Y A;  2HPB A;  1S4R A;  5HSQ A;  4DF6 A;  1N9N A;  3MZF A;  3LEZ A;  2R9W A;  3GV9 A;  3S7N A;  1CEF A;  3FKV A;  5G4Y A;  3SH7 A;  4DKI A;  1N4O A;  1S67 L;  4EEP A;  4LCL A;  2UV0 E;  2EXA A;  3IWO A;  5M19 A;  3UPP A;  5GLC A;  3LYX A;  5LBR A;  1JWP A;  2J80 A;  5EVL A;  3O5Y A;  4UHU A;  4ZAM A;  3DAV A;  5GL9 A;  4ZJ3 A;  3RTY A;  1WA9 A;  2H28 A;  2EXB A;  5C5K A;  1CJF A;  1LT0 A;  3NBL A;  2O9B A;  3VSK A;  4Z9Q A;  5EUA A;  4KUO A;  1H8M A;  1BSG A;  2Q9M A;  5F1F A;  4UEY A;  2B18 A;  1TVF A;  3SZT A;  4FCF A;  3E4Q A;  5A91 A;  4JGQ A;  3ZCZ A;  4DXC A;  3C38 A;  4S2I A;  3T1R A;  1K54 A;  3HLW A;  4Q0J A;  2JBF A;  3T4L A;  2WGI A;  4EUZ A;  2ZM2 A;  3U2A A;  2PD8 A;  5AQA A;  1ACF A;  4A5R A;  3MXS A;  2ZL1 B;  3T12 B;  5CEB A;  1ONG A;  1L0G A;  3QP4 A;  2DCF A;  4QJG A;  3IF5 A;  3IXD A;  2OAP 1;  4EXO A;  1P97 A;  2ZL1 A;  4LEN A;  1JVJ A;  1TDG A;  3HLE A;  3LIA A;  1MZU A;  1OT9 A;  4GZB A;  4QWO A;  3KSH A;  2WAE A;  4O8G A;  2JN7 A;  3TOI A;  1JWV A;  2Y2G A;  1PWG A;  2H5S A;  3G2Z A;  5AJG A;  3NDG A;  2QPN A;  2XA7 S;  4WZ5 C;  2ZQD A;  5TFQ A;  3MS6 A;  3MXR A;  1MWR A;  4EBP A;  3N6I A;  4EBL A;  2Y2M A;  5HD5 A;  1LL5 A;  4P6Z S;  5DFY A;  2LB9 A;  4IVK A;  1ALQ A;  4IUH A;  2WKI A;  1E3U A;  3FPV A;  3LO7 A;  3VOZ A;  3E4O A;  5G18 A;  1W7F A;  4ZJ1 A;  3BQ8 A;  1S4S A;  3GRJ A;  1Q2P A;  2ZC7 A;  3VP1 A;  3VSL A;  1XJ2 A;  4BL3 A;  1M40 A;  1W8Y A;  3EWK A;  4NK3 A;  4X55 A;  1MWT A;  1KE3 A;  2YKH A;  1K4F A;  4R38 A;  5F6A A;  4DJ2 A;  1K0K A;  2ZQA A;  4B93 A;  4FH2 A;  2R78 A;  3UB6 A;  4KZ6 A;  5DKL A;  2QHK A;  5HAI A;  1J3W A;  3NIA A;  4EV4 A;  2NUT C;  4Y15 A;  2V8F A;  5L07 A;  2VZW A;  3HLB A;  2W3D A;  2Z6C A;  1XA1 A;  1S1Z A;  1XFN A;  1E4D A;  1HZO A;  2KDK A;  4WL9 A;  4OPZ A;  2Z2M B;  2VV8 A;  3E0Y A;  2WKP A;  1ZKJ A;  5EVI B;  4E3I A;  1XA7 A;  2Y2I A;  2XGN A;  3T4Q A;  2VGK A;  3OOV A;  3H9W A;  4U3T A;  2PDR A;  4KQQ A;  4YFM A;  4OPY A;  2VK3 A;  3WS4 A;  5EVI A;  2H10 A;  3DTM A;  4HJ6 A;  3S22 A;  3FC7 A;  4MCW A;  4GJ4 A;  4P6Z M;  3C4O A;  3IWQ A;  1YM1 A;  4JPM A;  2XQZ A;  3JYI A;  3Q1F A;  1IKI A;  1EW0 A;  1F2K A;  4E3J A;  1UWN X;  5M1A A;  5TGF A;  1BLP A;  1XPB A;  3A0V A;  3V50 A;  4EUV A;  4GS9 B;  3VE3 A;  2ZBB A;  1N9B A;  4IBX A;  2ZQ9 A;  4B4X A;  3EEH A;  1T1A A;  2XK1 A;  3BY9 A;  2J8Y A;  1BUE A;  2MJ6 A;  4KG6 A;  4ETX A;  5DTS A;  3B3X A;  3MJQ A;  3IT9 A;  2PD7 A;  2ZQ8 A;  1I5Q A;  4WEL A;  2Y79 A;  3BEC A;  3Q07 A;  5A8B A;  4Y3I A;  3PAE A;  1CF0 A;  4WLA A;  3MZE A;  2PT7 A;  1OT6 A;  4KQO A;  2W3G A;  4FH4 A;  3LEQ A;  2PBY A;  4E6X A;  5FAO A;  4UA6 A;  2B02 A;  5L2F A;  1G6O A;  4DXB A;  1P9R A;  5CGX A;  3IXG A;  3CPT B;  4BQM A;  2O9A A;  1D06 A;  2QMI A;  4PPR A;  4I39 A;  1GHI A;  3BY8 A;  5G4Z A;  4L9F A;  2EWV A;  2OWH A;  1NLY A;  1W8Q A;  3CPT A;  4IJG A;  5FI6 A;  4EQI A;  2C6W B;  1I2W A;  5FEF A;  4C6Y A;  5HPF A;  2ZMF A;  3UDI A;  3CAX A;  2DRW A;  4ETZ A;  2HGV A;  2HP9 A;  1HD8 A;  1K57 C;  1MXO A;  1YLJ A;  4HJ4 A;  3FYZ A;  4O01 A;  2FFY A;  5I5L A;  2PU4 A;  2OV5 A;  2WZX A;  3UB5 P;  2EX9 A;  4EW7 A;  5J8X A;  3G32 A;  5KZH A;  2ZD8 A;  1LI9 A;  2W3F A;  4PM7 A;  4Y5F A;  1K55 C;  1L2S A;  1NRF A;  1BT5 A;  5EV0 A;  4FOF A;  1SCW A;  3T4K A;  1H8Z A;  2GX5 A;  2OOL A;  3BFD A;  3MF0 A;  5HD3 A;  3W4Q A;  4E3M A;  3UDF A;  3CIT A;  3JVU A;  1F9I A;  3ISG A;  4K08 A;  3WS2 A;  3C8C A;  3F1N B;  3IXB A;  3MR0 A;  1S0W A;  2JKG A;  1OTA A;  4O7D A;  2VV7 A;  4JGO A;  4S2N A;  5E2F A;  1TD5 A;  1SKO B;  4E6W A;  3F1N A;  1K6R A;  4G3V A;  2YKF A;  3KYQ A;  4XT2 B;  1L0F A;  1PI5 A;  1GA0 A;  1HTZ A;  1OTE A;  2BG1 A;  4LRX C;  1DY6 A;  3CLO A;  1SKO A;  4RX3 A;  2VJW A;  5EM0 A;  4Y0T A;  2JKF A;  4XT2 A;  4OON A;  1BLS A;  1OJG A;  1LSW A;  1P0Z A;  1VB6 A;  1YT4 A;  4S2M A;  2OAQ 1;  4Q0H A;  2P04 A;  2L0W A;  2XH9 A;  4M4X A;  1FSY A;  2L1M A;  4WZ5 A;  1ERO A;  3CJM A;  5AVF A;  3UE0 A;  4S2P A;  4DE3 A;  3PBQ A;  3DWK A;  5F1G A;  1E25 A;  5J7E A;  3GQZ A;  1T1C A;  3IBR A;  1FR1 A;  3IX8 A;  4EWF A;  5TR7 A;  3CZD A;  3UME A;  1F98 A;  5KIZ A;  4BLM A;  1H5X A;  3E4P A;  1IKG A;  2Y91 A;  2C5W B;  5FEG A;  2M7V A;  4CLC C;  3MQO A;  4GDB A;  2VX8 A;  1ZTU A;  4PKY G;  4BEN A;  2DNS A;  3L9K A;  2Q0O A;  4MBK A;  5F68 A;  1ES4 A;  2XLN A;  4EU0 A;  1OME A;  4WUJ A;  5TJJ A;  4MN7 A;  3PBO A;  4FD8 A;  4N9L A;  1VQQ A;  1MPL A;  2PYR A;  2ACG A;  3MXQ A;  2Y2P A;  4QD4 A;  5EVE A;  1PRQ A;  3OPH A;  3SH9 A;  2HP5 A;  3MKE A;  4S2K A;  1RGY A;  4PM6 A;  1NWZ A;  4KZ9 A;  4OOY A;  2J7V A;  1HLU P;  3S4X A;  1BUL A;  2EX8 A;  4OQG A;  4XXR A;  4R23 A;  1TS0 A;  3EEA A;  3U4L P;  4PHT A;  4EES A;  1BZA A;  4R4S A;  5KSC A;  3TW8 A;  1KDW A;  4HP4 A;  4WN5 A;  3ICY A;  4X25 A;  1KVL A;  4MMN A;  1IEM A;  2JKR I;  4LRZ E;  1NY0 A;  4BBT A;  1TS8 A;  3IQA A;  4LV3 A;  5FQQ A;  3LR4 A;  4Y0U A;  2X71 A;  2LB5 A;  2HJ9 C;  3PR6 A;  4HQA A;  1D7E A;  4KZA A;  5HX9 A;  5F5Y A;  4GCZ A;  2XR0 A;  1MKM A;  3EQU A;  3T50 A;  4DE0 A;  3ZG0 A;  5DFX A;  2PR5 A;  2HDQ A;  3LGO A;  4WBG A;  4WF0 A;  1NYY A;  1TF1 A;  4I3J A;  2WKQ A;  1XJ3 A;  2V1A A;  2ZMV A;  5F69 A;  3JPU A;  1PWD A;  1SKF A;  3LCE A;  1XP4 A;  4WZ4 A;  3O87 A;  5FAQ A;  2V20 A;  4BBV A;  2JE5 A;  2VGL M;  2HJE A;  4GD8 A;  5HWT A;  4WYY A;  3ZFZ A;  4D60 A;  2XD1 A;  4S2O A;  3K3D A;  4UA9 A;  4ARZ B;  2XSS A;  1KDS A;  1LL8 A;  4E3N A;  1DJB A;  1YLT A;  4E04 A;  1KOU A;  4ZRR A;  3UDX A;  2VGJ A;  4ARZ A;  1OPX A;  4QY5 A;  1F5M A;  4HH2 A;  1VHM A;  3SOI A;  2BAS A;  4S2N C;  4GHI B;  5A90 A;  4ZJ2 A;  4LFU A;  1WYB A;  1HVB A;  3QP5 A;  1K57 A;  3WS1 A;  1OTB A;  4GHI A;  1RGZ A;  2EFU A;  3UN7 A;  3UE1 A;  4ME4 A;  1WYC A;  3ULF A;  4DE2 A;  3KYE A;  3K3C A;  3IBJ A;  3PBR A;  1K55 A;  5HAQ A;  4C3Q A;  4U0X A;  5F82 A;  1JTG A;  1IYS A;  3LUQ A;  3AGF A;  2XF3 A;  1STZ A;  5DKK A;  2J9P A;  4WMC A;  4IED A;  3T1Q B;  3T4O A;  3Q81 A;  5EOE A;  3HJK A;  2QKP A;  4BMW A;  1XGJ A;  1ERQ A;  3DBA A;  4PM5 A;  3NOU C;  1K38 A;  2QZ6 A;  4I5S A;  2P7J A;  2Z2L B;  2KX6 A;  3BLM A;  3BQA A;  5CXW A;  4YIN A;  1GSV A;  4F3L B;  3B42 A;  4EER A;  1KE0 A;  1DJC A;  1ESI A;  5IS1 A;  3IS2 B;  1G6A A;  1ERM A;  1K4E A;  1G28 A;  4UA7 A;  2JC7 A;  4F3L A;  5CEC A;  3IS2 A;  4WEK A;  3T4T A;  5HAR A;  3HBR A;  5HZH A;  3S7Q A;  3ITB A;  3DTI A;  2J3T D;  2WZZ A;  1H8Y A;  3Q82 A;  3G6O A;  1KVM A;  3C30 A;  4LCM A;  3BW6 A;  5HDC A;  5FAP A;  4OLD A;  4RVA A;  1E3U D;  4CLC B;  4R3A A;  1Z6F A;  2W1T B;  3V39 A;  5IU1 A;  1VM1 A;  3M2J A;  4KQD A;  4MNR A;  2GDN A;  1BLH A;  3A3E A;  3PBT A;  3CWF A;  4JBF A;  4C75 A;  1XJ4 A;  3SS3 A;  2Y2N A;  4CLC A;  3BM6 A;  3KSI A;  2W1T A;  4X1L A;  3C4P A;  3N4I A;  2K31 A;  1S6R A;  3GMW A;  3D72 A;  2VA0 A;  2P08 A;  2W27 A;  3OLO A;  4R3J A;  4BJP A;  1Y28 A;  3C7V A;  4JF6 A;  5DJT A;  3ZNY A;  3NI9 A;  2ZOH A;  1LL9 A;  1TDL A;  1CI9 A;  4QPR A;  2O9C A;  3CUE C;  1TS7 A;  5DTT A;  5EE8 A;  1YMX A;  1W63 Q;  3LIE A;  5D3O A;  4OPQ A;  3G31 A;  2ZC3 B;  5E2E A;  1ZG6 A;  3UPO A;  2J9O A;  1W63 M;  1T1B A;  4RA7 A;  3FWL A;  2GJ3 A;  2HV1 A;  2UWX A;  1ES2 A;  3V67 A;  3VP4 A;  3BFG A;  1Y4O A;  3ZVT A;  1CEG A;  3NY4 A;  4MBH A;  3ZG9 B;  5FAS A;  4R1G A;  1L3L A;  2PYP A;  5EVI D;  5CER A;  2KOI A;  3UY6 A;  4OH0 A;  4Y17 A;  2M7U A;  5CHU A;  5EFW A;  4K0X A;  2W1R A;  1VEU A;  4FTX A;  1UGU A;  3WWX A;  3W8K A;  3OZH A;  3SS5 A;  2P74 A;  1K56 A;  1SDN A;  3N7W A;  2FFF B;  1NLZ A;  3PBS A;  3W4P A;  2Y4A A;  4HBU A;  3LIF A;  1TS6 A;  3FKW A;  3HJI A;  5DF9 A;  3E98 A;  3WS0 A;  1DJA A;  2M1C A;  3T1X A;  2HP6 A;  3F1O A;  5J3W A;  3QHY A;  4G3K A;  4ZDX A;  2JKT M;  1NRJ A;  3PXP A;  3MZD A;  3SS4 A;  4FSF A;  3HLF A;  5FQ9 A;  5GLA A;  5F83 A;  1ZHH B;  2V9A A;  2XRN A;  3FZC A;  4UQI S;  2Y8H A;  3RXW A;  1W5D A;  1JNU A;  1XKZ A;  3C5A A;  3RFB A;  2OLU A;  2NUP C;  2Y2K A;  1PW1 A;  4B88 A;  5CGW A;  2W3E A;  5DJU A;  5FL3 A;  4BD1 A;  4GNU A;  3BFC A;  3MBZ A;  1D1J A;  2FZ0 A;  4KZ7 A;  4KZB A;  4HH3 A;  4PAU A;  1GHP A;  3KYZ A;  5HFO A;  4PKY A;  1XGI A;  3G34 A;  3UE3 A;  3TRC A;  3C2W A;  1VET B;  5CTM A;  5DVA A;  5A93 A;  4HY8 A;  3IH9 A;  5CX7 A;  4S2L A;  5DF8 A;  3MMH A;  3VMA A;  5U47 A;  3VOY A;  1G5U A;  4X69 A;  2B5R A;  2E8J A;  3LID A;  2AVX A;  1VET A;  2INW A;  4NEE D;  2K7S A;  1RP5 A;  3NOP C;  3T4J A;  4NET A;  3Q7V B;  4JF4 A;  5AQB A;  2BTF P;  4K91 A;  3OPP A;  3ZGA B;  3F1P B;  4MN5 A;  3T1S A;  3BRM A;  3LIC A;  4EBN A;  5JYP A;  3Q7V A;  2JHE A;  5CHM A;  3AGD A;  4LRY C;  3OCL A;  4LLO B;  4BL2 A;  4GN2 A;  2FH5 A;  1CQA A;  3G4P A;  2Q9N A;  1Q2Q A;  1FOF A;  3F1P A;  4UQI M;  4N9K A;  3UB7 A;  5IHV A;  2P9V B;  4L0L A;  1ZG4 A;  3VP2 A;  5FI2 A;  4ESP A;  2Y2Q A;  4OOM A;  1MWS A;  2D02 A;  3LR5 A;  2HDR A;  2A49 A;  1IOU A;  2P9V A;  1C3B A;  4KZ4 A;  1YKD A;  1IFQ A;  1FIL A;  3ZNT A;  1BLC A;  4CQH A;  2GNX A;  3A3D A;  3M6H A;  2HF6 A;  4HJ3 A;  5KMW A;  4L9E A;  5HDS A;  3VP3 A;  4B9O A;  4E3L A;  5L10 A;  1FQG A;  4IBR A;  3S1Y A;  4BBU A;  4MLL A;  2VGL S;  1H0M A;  4WM9 A;  1PFL A;  4QB8 A;  5CHJ A;  1YSQ A;  1PYY A;  4MN6 A;  3HRE A;  3KX0 X;  4JXW A;  1ES3 A;  4NXG A;  4X68 A;  2HDU A;  2V8C A;  4CLC E;  4LGW A;  1MBL A;  4DDS A;  1ES5 A;  4CPK A;  1OJ5 A;  5DTK A;  4BWI A;  3QNB A;  3S7O A;  3UB8 A;  3KSG A;  4DN0 A;  3TJZ C;  1PZP A;  2OWJ A;  3IF6 A;  4N1H A;  3UMD A;  4WEJ A;  1QMF A;  3C7U A;  5I94 A;  4KUK A;  1PNE A;  4KEN B;  1FIK A;  3MKF A;  1LSX A;  2WKE A;  1XFQ A;  2E8I A;  3FV7 A;  4GKU A;  3B47 A;  1ODV A;  1MWU A;  4KZ5 A;  2ZC4 B;  3MFD A;  1TEM A;  3D4F A;  1CK3 A;  5FDS A;  4H6J B;  4P85 A;  5CGS A;  2ZQC A;  2V1Z A;  3P09 A;  4LV2 A;  1KGE A;  3CUE A;  3N8R A;  4OKP A;  4PM8 A;  3KSF A;  2W0N A;  3IHA A;  4H6J A;  3QP8 A;  4JF5 A;  1YLY A;  3ZQ5 A;  3GDI A;  2V2F F;  1J9M A;  4HHD A;  3Q7Z A;  4G3W A;  4EET B;  3I7J A;  4QHC A;  3ZG8 B;  1LI0 A;  1O07 A;  1MY8 A;  3A0S A;  1FCO A;  2EX2 A;  4OVD A;  5FI7 A;  2A3U A;  1V9Z A;  3TSG A;  3PYP A;  4P6B A;  2KLI A;  4U0T A;  1Y54 A;  3O3V A;  2A24 B;  4F94 A;  3S7P A;  2QWS A;  3ZYT A;  2I9V A;  4M3K A;  3QNC A;  3VOL A;  2EX6 A;  3OBF A;  1NJ4 A;  3LIB A;  1BYW A;  3RXX A;  4NXF A;  2A24 A;  4IVI A;  3A3J A;  4RYE A;  3VV4 A;  1T19 A;  3HUM A;  1IYO A;  1KGG A;  3GSG A;  5K5B A;  1W79 A;  1FR6 A;  4YNR A;  4OQI A;  3SW1 A;  5E43 A;  1YSP A;  2XDM A;  1FSW A;  1M6K A;  3A3F A;  3DTK A;  2WKR A;  3GEC A;  2RCX A;  2A2L A;  4H8R A;  2X01 A;  3BFE A;  3D3O A;  5GLB A;  3HCY A;  3P98 A;  2PRF A;  4AFI A;  1UWP X;  1YPR A;  4Y0O A;  4RX2 A;  3AGE A;  4PM9 A;  1GHM A;  4EEU A;  1U60 A;  2B95 A;  3ZHH A;  4OOL A;  5GHZ A;  3HUN A;  2PU2 A;  2WK0 A;  3SH8 A;  5L09 A;  4HP9 A;  1YAX A;  5FQK A;  4GLQ A;  1K25 A;  3H82 B;  4O0P A;  4HIA A;  4X53 A;  2X02 A;  1DP9 A;  3O86 A;  3NEC A;  2EWW A;  3HLD A;  3NDE A;  4OPR A;  5AVE A;  1DP8 A;  3DWZ A;  3NHQ A;  3PHY A;  4PMA A;  4D2O A;  2ZQ7 A;  3H82 A;  2Y2J A;  5EOO A;  3VE4 A;  1PW8 A;  2Y2L A;  1T18 A;  4GDN A;  3ITA A;  4DE1 A;  1K6S A;  2O99 A;  1DP6 A;  1CI8 A;  2VKS A;  3LI9 A;  1GSW A;  3NUL A;  4K0W A;  4N92 A;  2GZA A;  3BLS A;  3K2N A;  3DTE A;  1NZO A;  3CHW P;  3A0R A;  3NCK A;  2I72 A;  2IWB A;  4I3A A;  3V3S A;  2WGW B;  3OCN A;  4B4Z A;  4YWZ A;  2Y59 A;  4OP5 A;  4X1M A;  4LPZ A;  4R4R A;  1MC0 A;  2V0U A;  3GVB A;  3N8S A;  2D01 A;  2Y2H A;  3EQV A;  1JTD A;  4LV0 A;  2WGW A;  1N9L A;  3EGD C;  3MQ0 A;  2PAV P;  5EPH A;  4GOG A;  2WKH A;  3JVV A;  1XXM A;  3G35 A;  2G7U A;  4WMC D;  5A92 A;  4HBT A;  1PIO A;  5GHX A;  2ZOI A;  4E3O A;  3WRT A;  1X0O A;  2XFS A;  3IF6 C;  4R0Q A;  3LI8 A;  4QY6 A;  3H7W B;  1LHY A;  4GD6 A;  2XA7 M;  1ZC2 A;  4IUK A;  3E2K A;  3G2Y A;  1L0E A;  4JKT A;  5E2H A;  2O0Y A;  1LLB A;  4L9G A;  4R3B A;  3DW0 A;  2IWC A;  3PBN A;  1GCE A;  3H7W A;  1Z09 A;  3QP2 A;  5E2G A;  3QP6 A;  3UO9 A;  3TE8 A;  2H0Y A;  1I2S A;  3BYD A;  4EQ1 A;  3LY4 A;  4P87 A;  1FCN A;  3GR2 A;  1IYQ A;  2BLS A;  3MQQ A;  2G2W A;  3CG5 A;  2PHY A;  2PR6 A;  5HPI A;  3IXH A;  4R70 A;  4JLF A;  2ZC5 B;  3OPL A;  4R6L A;  3RJU A;  5CRF A;  2ZM0 A;  5L8M A;  5EEC A;  4GS9 A;  4S2J A;  3T4S A;  4LV1 A;  2J3W A;  4NG2 A;  5HDD A;  3W2Z A;  3ZG7 B;  2DMW A;  3CI6 A;  1VEU B;  4HES A;  3WRZ A;  1SHV A;  3R4K A;  1YLW A;  1NYM A;  3HLG A;  4NXB A;  4GW9 A;  1RCJ A;  5BOH A;  5DF7 A;  3TG9 A;  4OLG A;  1P9W A;  4E3K A;  3VFH A;  2OLV A;  2ZMA A;  5FAT A;  4II7 A;  3ZDJ A;  5FQM A;  3R7W B;  5MC7 A;  3BEB A;  2HZ5 A;  2QYB A;  5M18 A;  4CLC D;  3LY3 A;  4XUX A;  4NXE A;  5AQ9 A;  4MDZ A;  1K54 C;  5CTN A;  3CMZ A;  4ZBE A;  3L7H A;  3R7W A;  4JGP A;  4RQ9 A;  3F1O B;  1IYP A;  4GB7 A;  5KSH A;  4ZTK A;  2QJ7 A;  2EA9 A;  2Z6D A;  2VEA A;  2OSU A;  1YQS A;  2QJ5 A;  4KZ8 A;  2WUQ A;  1YMS A;  4HOI A;  4DJ3 A;  4KG5 A;  2XD5 A;  2CMN A;  5HWV A;  2WAD A;  3KO6 A;  4N1X A;  1YLP A; 
#chains in the Genus database with same CATH homology
 2HF6 A;  1XJ6 A;  4HJ3 A;  4ARZ A;  4L9E A;  5HDS A;  3BJN A;  1OPX A;  3T4Q A;  4B9O A;  3OOV A;  3H9W A;  1F5M A;  4HH2 A;  1VHM A;  2PDR A;  2BAS A;  4GHI B;  4YOF A;  2JKR M;  4BBU A;  4NKP A;  2VGL S;  3UB9 A;  4Z1W A;  1GSX A;  2J3T C;  4HJ6 A;  1YSQ A;  3EOI A;  3FC7 A;  4MCW A;  4GJ4 A;  1OTB A;  3KX0 X;  4MN6 A;  4NXG A;  4P6Z M;  4GHI A;  4CLC E;  3LFV A;  3B33 A;  1EW0 A;  1UWN X;  4ME4 A;  3A0V A;  2K2N A;  4EUV A;  1OJ5 A;  4GS9 B;  5HL6 A;  3ULF A;  3VE3 A;  4BWI A;  2ZBB A;  3K3C A;  3S7O A;  3EEH A;  3UB8 A;  1T1A A;  3BY9 A;  3KSG A;  4DN0 A;  3IBJ A;  3TJZ C;  2MJ6 A;  2OWJ A;  3PBR A;  4ETX A;  1LSV A;  3UMD A;  4WEJ A;  3MJQ A;  2PD7 A;  1OTI A;  4WEL A;  2Y79 A;  5J4E A;  4KUK A;  5A8B A;  3LR0 A;  3LUQ A;  2XRO A;  4Y3I A;  1LSX A;  1XFQ A;  1STZ A;  5DKK A;  5HWW A;  3B47 A;  1ODV A;  3FG8 A;  4WLA A;  3T4O A;  2PT7 A;  5TBM B;  1OT6 A;  3HJK A;  4KQO A;  2QKP A;  4BMW A;  2W3G A;  3MFX A;  3DBA A;  4H6J B;  3NOU C;  4I5S A;  2P7J A;  3NJA A;  2KX6 A;  2B02 A;  3BQA A;  1G6O A;  1P9R A;  3CUE A;  5TBM A;  1GSV A;  3KSF A;  4F3L B;  3B42 A;  4EER A;  2O9A A;  2W0N A;  1D06 A;  4IHQ A;  4Y2F A;  5IS1 A;  4I39 A;  3IS2 B;  4H6J A;  3BY8 A;  5G4Z A;  4L9F A;  2EWV A;  3GDI A;  3ZQ5 A;  2OWH A;  1G28 A;  1NLY A;  4IJG A;  3FPW A;  4HHD A;  4F3L A;  4JGR A;  4G3W A;  4EET B;  4I38 A;  1S66 L;  3IS2 A;  4WEK A;  1H3Q A;  3T4T A;  5HPF A;  5HZH A;  3A0S A;  2ZMF A;  3S7Q A;  3NOT C;  1V9Z A;  3PYP A;  2KLI A;  3CAX A;  3LR3 A;  4ETZ A;  5IT5 A;  2A24 B;  3S7P A;  2HGV A;  2QWS A;  3ZYT A;  2I9V A;  2J3T D;  3VOL A;  3OBF A;  2V1B A;  3G6O A;  4HJ4 A;  3LIB A;  1N9O A;  1BYW A;  3C30 A;  3BW6 A;  5HDC A;  4O01 A;  1OTD A;  4NXF A;  2A24 A;  3OC2 A;  5I5L A;  3UE6 A;  3VV4 A;  1T19 A;  4EW7 A;  3P01 A;  2VV6 A;  5K5B A;  2W3F A;  4CLC B;  4R3A A;  4YNR A;  3BWL A;  3SW1 A;  4Y5F A;  1YSP A;  2W1T B;  2IA2 A;  3EGX C;  5IU1 A;  4KQD A;  2WKR A;  2V0W A;  3P7N A;  3GEC A;  2A2L A;  3PBT A;  4FOF A;  4HNB A;  1S1Y A;  3CWF A;  3RH8 B;  3D3O A;  3T4K A;  2GX5 A;  2OOL A;  1XJ4 A;  3HCY A;  4CLC A;  4AFI A;  1UWP X;  1DRM A;  3KSI A;  2W1T A;  3MF0 A;  2K31 A;  5HD3 A;  3D72 A;  2VA0 A;  2P08 A;  2W27 A;  3OLO A;  4HI4 A;  4EEU A;  3CIT A;  4BJP A;  1Y28 A;  3JVU A;  1F9I A;  4K08 A;  5DJT A;  3C8C A;  3F1N B;  2ZOH A;  4OOL A;  3MR0 A;  2JKT I;  1OTA A;  4QPR A;  2O9C A;  3CUE C;  1TS7 A;  2VV7 A;  4DMZ A;  4HP9 A;  1YAX A;  4JGO A;  2VLG A;  1W63 Q;  1TD5 A;  3LIE A;  4GLQ A;  4O0P A;  3F1N A;  3H82 B;  4HIA A;  4G3V A;  2YKF A;  1DP9 A;  3KYQ A;  4XT2 B;  2EWW A;  1OTE A;  4LRX C;  4Q0I A;  1W63 M;  1T1B A;  5AVE A;  2GJ3 A;  2HV1 A;  2L4R A;  3CLO A;  1DP8 A;  2W3H A;  4I3I A;  3NHQ A;  1V9Y A;  3PHY A;  1S4R A;  5HSQ A;  2VJW A;  3H82 A;  3V67 A;  1N9N A;  3VE4 A;  4XT2 A;  3S7N A;  1OJG A;  1LSW A;  5G4Y A;  2PYP A;  1T18 A;  1P0Z A;  1VB6 A;  2KOI A;  2OAQ 1;  2M7U A;  4Q0H A;  2O99 A;  1DP6 A;  2L0W A;  2P04 A;  2VKS A;  4M4X A;  1S67 L;  4EEP A;  2L1M A;  3LI9 A;  1GSW A;  5EFW A;  2W1R A;  5AVF A;  2GZA A;  3K2N A;  3PBQ A;  1UGU A;  3LYX A;  5LBR A;  2J80 A;  3A0R A;  3O5Y A;  4I3A A;  3RTY A;  1WA9 A;  2H28 A;  3OCN A;  5C5K A;  1NLZ A;  5J7E A;  1LT0 A;  3PBS A;  1T1C A;  3IBR A;  4YWZ A;  2O9B A;  4LPZ A;  1MC0 A;  2V0U A;  3LIF A;  3UME A;  1F98 A;  1TS6 A;  5KIZ A;  4KUO A;  1H8M A;  2D01 A;  3EQV A;  3HJI A;  3E4P A;  1N9L A;  5DF9 A;  3EGD C;  3MQ0 A;  4UEY A;  2M7V A;  3E98 A;  2B18 A;  3E4Q A;  4CLC C;  2M1C A;  3MQO A;  4JGQ A;  3JVV A;  3F1O A;  2G7U A;  3C38 A;  2VX8 A;  1ZTU A;  5J3W A;  4PKY G;  4Q0J A;  4G3K A;  3T4L A;  2JKT M;  1NRJ A;  3PXP A;  5F68 A;  2ZOI A;  3U2A A;  2PD8 A;  1X0O A;  4FSF A;  4EU0 A;  3LI8 A;  4WUJ A;  3H7W B;  5TJJ A;  1ZHH B;  2V9A A;  2XA7 M;  2XRN A;  4MN7 A;  4IUK A;  4UQI S;  2Y8H A;  3PBO A;  2O0Y A;  4L9G A;  1JNU A;  3PBN A;  2PYR A;  3MXQ A;  3RFB A;  2OAP 1;  3H7W A;  4EXO A;  2NUP C;  1P97 A;  1NWZ A;  3LIA A;  3TE8 A;  1MZU A;  4EQ1 A;  2W3E A;  1OT9 A;  5DJU A;  5FL3 A;  3KSH A;  2FZ0 A;  4HH3 A;  4PAU A;  3MQQ A;  3KYZ A;  2PHY A;  2PR6 A;  1TS0 A;  4O8G A;  2JN7 A;  4PKY A;  5HPI A;  3EEA A;  4PHT A;  4EES A;  4R70 A;  3UE3 A;  3TW8 A;  3TRC A;  5AJG A;  4HP4 A;  4WN5 A;  3C2W A;  3ICY A;  4R6L A;  4MMN A;  2XA7 S;  2JKR I;  4HY8 A;  4LRZ E;  5CX7 A;  4BBT A;  1TS8 A;  3MMH A;  5L8M A;  4GS9 A;  3T4S A;  2J3W A;  3LR4 A;  5HDD A;  3LID A;  3W2Z A;  2DMW A;  2LB5 A;  3CI6 A;  5HD5 A;  2HJ9 C;  3R4K A;  3PR6 A;  4HQA A;  1D7E A;  4P6Z S;  2INW A;  5DFY A;  4NEE D;  2K7S A;  2LB9 A;  3NOP C;  4GCZ A;  5F5Y A;  4IUH A;  3T4J A;  4NXB A;  3FPV A;  4GW9 A;  3E4O A;  3EQU A;  1MKM A;  1P9W A;  3BQ8 A;  3T50 A;  1S4S A;  4II7 A;  5DFX A;  3F1P B;  1XJ2 A;  3R7W B;  5MC7 A;  4MN5 A;  2PR5 A;  2QYB A;  3LIC A;  4CLC D;  4WF0 A;  4NXE A;  3EWK A;  1TF1 A;  4I3J A;  4MDZ A;  2WKQ A;  1XJ3 A;  2JHE A;  2YKH A;  2V1A A;  4LRY C;  3OCL A;  4LLO B;  2ZMV A;  4R38 A;  5F6A A;  5F69 A;  4DJ2 A;  2FH5 A;  3F1P A;  4B93 A;  4UQI M;  3R7W A;  4JGP A;  2R78 A;  3UB7 A;  4RQ9 A;  3F1O B;  3UB6 A;  4BBV A;  2VGL M;  2HJE A;  4L0L A;  5DKL A;  5HWT A;  2QHK A;  5KSH A;  2QJ7 A;  2NUT C;  4OOM A;  2EA9 A;  2Z6D A;  2D02 A;  2VEA A;  3LR5 A;  2VZW A;  3K3D A;  1IOU A;  2QJ5 A;  4ARZ B;  2W3D A;  2XSS A;  1LL8 A;  1YKD A;  1IFQ A;  4HOI A;  4DJ3 A;  2Z6C A;  4E04 A;  1KOU A;  1S1Z A;  4ZRR A;  1XFN A;  2KDK A;  4WL9 A;  2CMN A;  5HWV A;  4CQH A;  3KO6 A;  2VV8 A;  2GNX A;  3E0Y A;  2WKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...