3LIAA

Crystal structure of the extracellular domain of the putative histidine kinase mmhk1s-z2
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
262
structure length
262
Chain Sequence
KLAYEKSIEMAGNYANQFDAQMEANQAIARTLACTMAEYGSQDREEAMSIIKRILNENPQLIGVYLGYEPDAFDGRDKNYINAPGHDSTGRFVPYCNKINGPVIIEPLVHYDSSDYYQLPKTTGKDTLTEPYFYEGIFMVSYDSPIFKNGEFAGIAGVDVPLEYVDDVASSIRTFDTGYAFMVSNTGIFLSHPTQKNWIGEKSLSDFDVEEIKNAASDIREGIGGHVEIKDPITGKTVIMFYEPVKTGDFSFVLVVPKEEML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Hypothetical sensory transduction histidine kinase
publication title Structural characterization of the predominant family of histidine kinase sensor domains.
pubmed doi rcsb
source organism Methanosarcina mazei
total genus 77
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02743 dCache_1 Cache domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3liaA01
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3liaA02
3FC7A 2I9VA 2P7JA 1DRMA 3B33A 5HDSA 3C2WA 3H7WA 5HD3A 1S1ZA 2YKHA 4WL9A 3F1OA 5DKKA 4EEUA 1P97A 1GSXA 2PD7A 4NXEA 2YKFA 3HJKA 1UWNX 4KQDA 2W27A 4BBVA 2QKPA 2QJ7A 2WKRA 1GSVA 5G4YA 4I3AA 1S4SA 2ZOHA 3A0VA 3D72A 5HSQA 3RTYA 3A0RA 3MQOA 1V9ZA 4LLOB 2QHKA 4PKYG 3EEHA 3PYPA 4EETB 4EQ1A 2M1CA 4HJ4A 5F68A 1ODVA 4HJ6A 3CAXA 2EA9A 4KUOA 2K7SA 2L0WA 3LI8A 2PR6A 1T18A 1OJGA 2V0UA 4LPZA 3LIAA 2L4RA 4M4XA 4NXFA 1JNUA 4F3LB 3IBRA 1T19A 3NOTC 5AVFA 4LRXC 5DJTA 1S66L 3P7NA 4GHIA 3MFXA 2VV6A 2VLGA 4HP9A 1UGUA 2GJ3A 3ICYA 1LSWA 4GCZA 3UB7A 4WF0A 5F69A 3UE6A 2KDKA 3UMEA 3UB6A 5F5YA 3LUQA 2ZOIA 4BBTA 4YWZA 2BASA 1GSWA 4E04A 3ZQ5A 3E4OA 4LRYC 4RQ9A 4KUKA 3LICA 5TBMA 2A24B 2D01A 1NWZA 2HV1A 2WKQA 2V0WA 1OTAA 4EERA 3F1PA 1LSVA 5G4ZA 5HZHA 4I39A 4I3JA 4WLAA 4HP4A 4HQAA 4EESA 2L1MA 3E4QA 1UWPX 1D06A 4GS9B 1S4RA 5EFWA 4WN5A 3NHQA 3VE4A 3BY8A 1LSXA 3MQQA 3EWKA 2PYPA 3H7WB 5IU1A 4JGRA 2QWSA 4MN6A 3OLOA 4XT2A 3BY9A 1S67L 2D02A 3F1OB 3G6OA 3K3DA 1F98A 2OWHA 2PR5A 4I5SA 1LT0A 5KIZA 3GDIA 2PYRA 1X0OA 5HDCA 5HDDA 3H82A 2V9AA 3RH8B 5AVEA 5F6AA 3GECA 4JGQA 5DJUA 4R70A 3PHYA 3MJQA 2CMNA 3VE3A 1TS6A 3F1NA 4LRZE 4H6JA 2R78A 2PDRA 1XFNA 5A8BA 3E4PA 2JN7A 1XJ2A 5HWTA 4HJ3A 1T1CA 3LI9A 3NOPC 3SW1A 1LL8A 1KOUA 3A0SA 2H28A 2JHEA 2WKPA 2VV8A 3K3CA 2V1BA 4L9GA 4HNBA 2QJ5A 2OWJA 4WUJA 1BYWA 4HY8A 4DJ2A 3LIFA 1MZUA 4EXOA 4PKYA 3F1NB 3LYXA 4DJ3A 1F9IA 5HWWA 5I5LA 1DP8A 4GHIB 4R6LA 1DP6A 2V1AA 4HIAA 4JGPA 4K08A 5HWVA 1D7EA 3HJIA 2Z6DA 5J7EA 2KX6A 3ULFA 2B02A 3LIBA 4I3IA 1VB6A 2W0NA 1EW0A 1TS8A 4R3AA 4HH2A 1WA9A 3H9WA 3UB9A 4NXGA 3BWLA 2PHYA 4L9EA 4HH3A 5TBMB 2INWA 2Z6CA 4I38A 3F1PB 2VV7A 1DP9A 3T50A 2VEAA 3NJAA 5J4EA 4NXBA 4F3LA 1N9NA 1V9YA 3UMDA 3MXQA 3KX0X 3CLOA 1XFQA 3NOUC 4HHDA 4XT2B 1OTBA 1S1YA 4R38A 1N9OA 3MR0A 2PD8A 1XJ3A 5IS1A 3IS2A 1N9LA 3VOLA 3H82B 4MN5A 2ZBBA 1XJ4A 1OJ5A 4L9FA 3LIDA 4HI4A 1OTEA 4GW9A 4BBUA 1OT9A 3LIEA 1G28A 5J3WA 4B9OA 1TS7A 1XJ6A 2A24A 4HOIA 4EEPA 4H6JB 4JGOA 1Y28A 1P0ZA 1OTIA 5DKLA 1OTDA 2OOLA 1TS0A 3FG8A 3IS2B 2J80A 1T1AA 1T1BA 4EW7A 5HD5A 3C8CA 3UB8A 3CWFA 1OT6A 4GS9A
chains in the Genus database with same CATH superfamily
2XD1A 4ZAMA 5CGSA 3CZDA 1LHYA 4S2PA 1J9MA 4X68A 2P7JA 2OLUA 4IUKA 3H7WA 2Y2JA 5HD3A 2ZC3B 1K55C 1S1ZA 4RX3A 2XR0A 2YKHA 4MMNA 3RFBA 5EVIA 3LR0A 4E3JA 1K4EA 3FPWA 5CRFA 3V3SA 4EBPA 3QP1A 3BRMA 1XXMA 1UWNX 2VGLS 3GQZA 1GSVA 5G4YA 1EI5A 2JKTM 4I3AA 4WZ4A 3IHBA 1MWTA 3A0VA 1YAXA 3RTYA 3PAGA 3QP6A 4PKYG 4LFUA 1XGJA 3UNWA 2HDQA 2WK0A 2O9BA 4R4SA 4LV3A 3S7OA 4LV2A 2OAQ1 2EWVA 4Y0TA 2PR6A 4FCFA 2V0UA 1EROA 2NUPC 4NXFA 3UPPA 4B88A 1SKOB 1RCJA 1M6KA 3L7HA 1XA7A 4PM8A 5L09A 5HW3A 3ZG7B 4LRXC 5DJTA 4N1XA 5EOOA 3MXRA 4LENA 3NIAA 4ESPA 5HL1A 2XD5A 2VLGA 3TJZC 4KQQA 3W4PA 1PZOA 4WM9A 1YSPA 4MBFA 1CQAA 3MKEA 1XX2A 2W1TB 4U0XA 1K6RA 4JPMA 1YSQA 3VOZA 3L9KA 1ES3A 2ZOIA 2CC1A 1IOUA 2H0TA 5L07A 2PT7A 3E4OA 4X1LA 3T4QA 3T1SA 1L0DA 4KUKA 2XSSA 1BLPA 4O7DA 1KDSA 2HV1A 2WKQA 3CUEA 1QMFA 4X53A 3SS5A 1ZC2A 4BJPA 5HZHA 5MC7A 4KZ9A 4X1MA 1W8YA 2W3HA 1SZVA 3FKVA 1H5XA 1UWPX 3SS3A 3BFGA 5FAPA 5EFWA 1N9BA 3OBFA 5EPHA 3UN7A 3DAVA 2V8CA 5L8MA 4JGRA 3K2NA 3OLOA 3IQAA 4XT2A 3C7VA 4S2NA 1S67L 3LGOA 3W8KA 1MKIA 1J3WA 1IYPA 3A3DA 3G6OA 3S7PA 4BD0A 2JBFA 4OLGA 4S2KA 1F98A 2OWHA 4MLLA 2QMIA 1D1JA 2PYRA 3BQ8A 2Y2NA 3EQUA 2OV5A 4WZ5A 1CI9A 5F6AA 3MBZA 4OP5A 2XA7S 2GX5A 4JGQA 3PHYA 4KZ5A 4BMWA 2VZWA 4P6BA 3E0YA 3V39A 3BFCA 3F1NA 3CPTA 4RA7A 1XFNA 2VKSA 2LB5A 3SW1A 1LL8A 2H28A 3FZCA 1E3UD 3OC2A 2WKEA 5FEFA 4XXRA 2V1BA 4C3QA 4B93A 5U47A 4KZ4A 3ZHHA 1KE0A 4LGWA 2OSUA 1U60A 1G6OA 3LIFA 4OQHA 3QP8A 4EXOA 3WS0A 1L3LA 5AQ9A 3F1NB 3PBSA 4QD4A 4CLCD 4DJ3A 1F5MA 2O9CA 2ZQ7A 2EX6A 1TVFA 1F9IA 5EM1A 5AJGA 5HWWA 5EOEA 1AWIA 2QPNA 1PIOA 3QP2A 4GHIB 4R6LA 5F83A 4GJ4A 4QY6A 2ZC6B 5M19A 4JGPA 1K57A 1HZOA 5HL6A 4K08A 5FASA 1D7EA 5GHXA 1XA1A 3HJIA 3IF6A 4FD8A 5EVIC 1PW1A 5M18A 1PW8A 3LIBA 1EW0A 4E3OA 4G3VA 4B4XA 5KSHA 2W1RA 5HAPA 2B5RA 1KVMA 3MKFA 2PHYA 2C5WB 4N1HA 2DCFA 2INWA 4FUWA 1YKDA 3WS4A 4CLCB 3F1PB 3T50A 4OKPA 1K56D 2WAFA 3NJAA 5FI6A 5FL3A 4F3LA 1N9NA 4Q0JA 2XGNA 2ZMAA 4WBGA 3KX0X 4EBNA 4E3LA 1ACFA 4JXGA 1XFQA 4OLDA 4HHDA 1FILA 1ES2A 4ARZB 3LEZA 3EGXC 1S0WA 1G68A 2X01A 5IS1A 3E98A 5E2HA 1ESUA 3BECA 4YFMA 3C4PA 3G34A 3VOLA 3C7UA 2X02A 3H82B 2WGWB 2OAP1 2WADA 5EVEA 1YLTA 1IKGA 1OJ5A 2A49A 3TRCA 4UQIS 5DF8A 3N7WA 4K0WA 1I2SA 5CECA 1FCMA 2E8IA 1JWPA 1OTEA 3G32A 3IHAA 5CHMA 4UEYA 1G28A 4ZBEA 4QJGA 5GLAA 1IELA 2A24A 4HOIA 4H6JB 1Y28A 2P9VA 3IXBA 3MSHA 1FCNA 4KG6A 1W5DA 1ZTUA 3C8CA 2A2LA 1VETB 3UB8A 3A3EA 3NCKA 2P04A 4XUZA 3VP3A 5EE8A 3MZDA 2XF3A 5FI2A 1STZA 3HUMA 4Q0IA 4QY5A 4WL9A 3FV7A 4S2LA 1H8YA 4LCLA 4EEUA 3Q7VA 3T4LA 3GR2A 2PD7A 1PFLA 2W3DA 2FH5A 2YKFA 3FWLA 3HJKA 2W27A 4Z9QA 3UO9A 2ZC5B 2HDSA 3UB5P 3TG9A 2HJEA 1S4SA 4Y7PA 2ZOHA 3QP5A 3KYEA 3G31A 4CQHA 3A0RA 4L0LA 3BLSA 4R3BA 1ES4A 1H0MA 5IHVA 4LLOB 2QHKA 4YNRA 4EETB 3PAEA 1YMSA 2PBYA 3BFEA 3HLCA 5F68A 4WZ5C 1PWCA 2EA9A 3ZG0A 1LI0A 2K7SA 4BL3A 2L0WA 5EUAA 1FR6A 3DWZA 3HLDA 1LL9A 4HEFA 1K0KA 3MMHA 1BUEA 1OPXA 4M4XA 2P74A 3DTKA 5HAIA 4IEDA 2FFFB 4K0XA 1SDEA 1KGGA 1C3BA 4O8GA 5GHYA 3IF5A 4K91A 2JKTI 4DKIA 3C4OA 4RVAA 5FEGA 2I72A 1L0GA 3P7NA 1E25A 3SH9A 3LR4A 1OMEA 1PI5A 4CPKA 2J3TC 1GHPA 1MPLA 4HP9A 2Z2LB 3LEQA 1Q2QA 4PPRA 2W3GA 4N92A 1WE4A 3DTIA 3ICYA 4GCZA 4OPQA 1FCOA 3N8SA 5FI7A 3UE6A 2KDKA 5EVID 2ZC4B 3NBLA 4LV1A 5FQJA 3G35A 3Q7ZA 4BBTA 3Q07A 3PBQA 1NLYA 4YWZA 2BASA 1GSWA 1FOFA 4E04A 5EECA 3ZQ5A 1SHVA 2C6WB 3KSFA 5BOHA 4JXWA 3A3FA 4LRYC 1NYMA 4OQIA 5AQ7A 1SCWA 4RQ9A 1K25A 3LICA 5TBMA 2D01A 4CLCC 4EERA 2K31A 4KENB 3ZDJA 1O07A 2BTFP 4I3JA 4WLAA 1HLUP 3NY4A 2L1MA 1ERMA 1D06A 4JF4A 3PBRA 1FR1A 3EWKA 2FZ0A 3H7WB 2QWSA 5CEBA 3DBAA 1QMEA 1NJ4A 2JKRM 1MWUA 5EVIB 1YLPA 4EQIA 3MZFA 4KQRA 5C5KA 4KZ6A 1TDLA 5KIZA 1LL5A 1NLZA 1X0OA 4ZRRA 1TEMA 5IT5A 3UPNA 5K5BA 5A90A 2HP5A 2WZZA 2JC7A 3UE0A 1HD8A 3T4OA 5KZHA 3IXGA 1PRQA 1VQQA 3UY6A 3GV9A 1WYBA 5DTTA 3VE3A 4OQ0A 3ZVTA 1NRFA 5F82A 2VGLM 2IWBA 3E4PA 2FFYA 2JN7A 5DTKA 3BW6A 3UDXA 3A0SA 1IYSA 4JXVA 2WUQA 4HBTA 1ONHA 2G7UA 3K3CA 4RYEA 4L9GA 2DMWA 3LR5A 2BLSA 1HTZA 4F94A 2QJ5A 2OWJA 3A3JA 2VGJA 1YT4A 5GHZA 4S2IA 4Y13A 3UE1A 4DDSA 2VA0A 1MWRA 4XUXA 2XFTA 2Y2LA 3DW0A 2G2WA 1YM1A 3ZYTA 3SH8A 4NK3A 1K38A 3Q82A 4DE3A 1BTLA 1RGZA 3D4FA 2PU4A 2B18A 3UE3A 3AGFA 2XFSA 4NEED 1L0EA 3PXPA 4GB7A 1FSWA 4RX2A 2Z6DA 2XRNA 2KX6A 3OPRA 4KZ8A 3M6HA 4JF5A 4BQMA 2W0NA 4R0QA 2RCXA 4HH2A 3KSGA 2HJ9C 1VHMA 2Q0OA 3G4PA 3NDGA 5M1AA 1K6SA 2H10A 3LY4A 1BSGA 2VEAA 3HUOA 2ZL1A 4PM5A 3MS6A 4EU0A 3G30A 4Y2FA 1DJAA 4JKTA 1KE4A 2JKGA 3R7WA 4DXCA 3CG5A 3JYIA 3NOUC 1L2SA 3T4KA 4XT2B 4KZ7A 1L0FA 3V5MA 4X55A 3E2KA 2J3TD 5CEDA 1VEUA 1N9OA 2Y91A 4MEZA 4Y15A 2PD8A 3U2AA 1DJCA 1JVJA 2VGKA 3S7QA 3NECA 3HLBA 2GDNA 5AQAA 3LIDA 4MBKA 3IXHA 4GD6A 3O5YA 4GW9A 1NYYA 4BBUA 4ETZA 4IHQA 2ZJ9A 3BLMA 4R23A 5JYPA 3CPTB 1PZPA 4JGOA 4P6ZS 1P0ZA 5DKLA 1GHMA 2O9AA 4BLMA 1ES5A 4JLFA 4P0MA 1GA9A 1TS0A 3ITBA 3IWQA 1T1AA 2XA7M 1BLCA 2Y2QA 5A91A 2ZM0A 4OONA 5DVAA 3CWFA 4GS9A 3FC7A 4NKPA 2I9VA 1DRMA 3P98A 5HDSA 3C2WA 1CEGA 2W3FA 4CJNA 3VFHA 3U4LP 1K55A 2GZAA 4WMCA 1SKFA 2IA2A 1FQGA 3F1OA 4ZJ3A 2R9WA 2IWCA 4Z1WA 4X6TA 1GSXA 1P97A 3B47A 1CEFA 3KO6A 4QU3A 3ZVWA 4BBVA 2QKPA 3IX3A 2WKIA 3W4QA 3V67A 2P08A 1CI8A 1IEMA 3JVVA 4KG5A 2XQZA 2VK3A 3EEAA 1XP4A 1WYCA 1KGFA 4R1GA 3IF6B 5HSQA 5FQKA 3MQOA 3IWIA 3EEHA 3PYPA 4EQ1A 4U0TA 3SOIA 3T1RA 2K2NA 2EXBA 2WAEA 2Y79A 4KUOA 3M2JA 1T18A 1OJGA 1Q2PA 4LPZA 1XPBA 3LIAA 5TGFA 3FKWA 2L4RA 3OZHA 4LV0A 4ZJ1A 2NUTC 4F3LB 3IBRA 4ZDXA 4DRTA 5D3OA 2ZLYA 5HPIA 1T19A 3NOTC 5AVFA 3V3RA 1IYOA 5L10A 4UA9A 3MFXA 3ITAA 2VV6A 4Y3IA 1DY6A 2HZ5A 5DFXA 1K54A 3G2YA 4BD1A 5CXWA 1KDWA 3WS1A 1LSWA 1P9WA 3N8RA 2BG1A 1JTDA 2ZMVA 5F5YA 3LUQA 1BLSA 2V1ZA 3EOIA 4R4RA 5HARA 3RJUA 3SS4A 2PAVP 5GL9A 3PBOA 4DN0A 2AVXA 1E4DA 1BULA 3IH8A 1W8QA 3OCLA 2A24B 3QNCA 3CUEC 1PNEA 3LFVA 1MC0A 1ZG6A 4GN2A 1OTAA 2HPBA 2XDMA 4ZTKA 2P9VB 4UQIM 4EWFA 1W79A 1MXOA 4DF6A 4I39A 4HESA 3ZNYA 3E4QA 5E2EA 3O86A 4FSFA 1G6AA 3VE4A 2XROA 1LSXA 4S2NC 4MN6A 2DRWA 4PM6A 2VJWA 5HX9A 3MF0A 2MJ6A 4OVDA 3W2ZA 2D02A 3P01A 4IJGA 1ZG4A 4OOYA 2R9XA 1G5UA 3K3DA 1BLHA 2PR5A 1YLZA 3Q7VB 2ZQ8A 1A0KA 3OPPA 3DWKA 3HLGA 2Y2PA 5FDHA 3GECA 3C30A 5CHJA 2PBDP 3T12B 1KVLA 5DJUA 5I94A 4DE2A 4E3NA 1HVBA 5E2GA 3T4TA 1PWGA 4EV4A 4S2JA 1MBLA 1JWVA 3FPVA 4AFIA 1TS6A 4LRZE 2PDRA 2Y2KA 5A8BA 2Y2HA 1YPRA 4HJ3A 2OLVA 3LI9A 3NOPC 3S22A 1NRJA 1KOUA 3HUNA 2JHEA 2WKPA 2VV8A 4E3KA 1YLWA 2JKRI 3RXXA 1JWZA 1KE3A 1Z6FA 2EX2A 3GMWA 1M40A 4WUJA 1CK3A 1BYWA 3HLFA 2LB9A 2Y2IA 1LI9A 2J9OA 3IT9A 3TSGA 4OPZA 1CF0A 3D3OA 2V8FA 1S6RA 1TF1A 2E8JA 3WS5A 4GLQA 3CMZA 5I5LA 1O7EA 1DP8A 2ZQ9A 4MN7A 2J3WA 4Y5FA 4U3TA 1K57C 3N4IA 4HIAA 2WZXA 5FAOA 1XKZA 3TE8A 3IF6C 5J7EA 2XH9A 3ULFA 3Q81A 3LCEA 3RXWA 3CHWP 3VP0A 3B3XA 3W4OA 5FQIA 4I3IA 4Q8IA 5KMWA 3KSHA 3NDEA 3A3IA 1WA9A 2HP9A 5CHUA 5JYOA 3T1XA 3UB9A 4NXGA 1NZUA 2M7VA 5TR7A 5G18A 4HH3A 3M2KA 4GZBA 5TBMB 2Z6CA 2EFUA 5GLCA 4I38A 5FQQA 2EWWA 1DP9A 3TOIA 4IBXA 3E2LA 1Y54A 3T4SA 3UDIA 3M6BA 3HCYA 1EWZA 5J4EA 2RL3A 4OH0A 2JE5A 5A93A 4E6XA 3QHYA 1SKOA 3UMDA 4GDBA 3MQ0A 1YQSA 2QYBA 4EUZA 4FTXA 5CX7A 2X71A 3SZTA 2WKHA 3ISGA 2V20A 2J7VA 3QP4A 1OTBA 5AQBA 4R38A 1NZOA 5CGWA 2PRFA 3R4KA 4G3WA 2W3EA 4GKUA 1RP5A 4EUVA 3IS2A 5EV0A 4IVKA 2XLNA 4UA6A 1N9LA 2EXAA 5E43A 3VMAA 2W1TA 4NG2A 2KLIA 1AXBA 2ZBBA 1XJ4A 2Y8HA 3GTCA 4L9FA 4PHTA 4DE0A 3DTMA 3IWOA 3KYQA 4HI4A 3T1QB 3EGDC 2XEPA 3WWXA 2Y2MA 4MNRA 2ZQAA 1OT9A 3BFDA 1MWSA 4KG2A 4B9OA 1TS7A 4EEPA 4DMZA 1FSYA 1LLBA 1OTIA 1K54C 2KOIA 3C38A 3HL9A 3ZNTA 3IS2B 2J80A 4ZJ2A 1YLJA 4EW7A 5HD5A 2XK1A 3WRZA 2QJ7A 1OT6A 4D60A 3B33A 4C6YA 1GA0A 5TJJA 4DDYA 1W63M 4QHCA 3IBJA 2WGVA 3S1YA 4D2OA 2Y2OA 5DKKA 3PR6A 1H8ZA 4KZAA 4NXEA 2JKFA 4KQDA 2WKRA 2ACGA 5EVLA 3VSKA 2G2UA 3V50A 3QNBA 5DTSA 4GD8A 4WEKA 1ERQA 3VSLA 3NULA 3D72A 1V9ZA 4X56A 4ME4A 2ZQCA 3CJMA 4YOFA 2M1CA 3AGEA 4HJ4A 5DFYA 3ZFZA 4CLCE 3JVUA 3VFFA 4QWOA 2HGVA 4GOGA 5LBRA 1ODVA 3BFFA 4B4ZA 4HJ6A 5EM0A 3CAXA 1I5QA 4O0PA 2O99A 3LI8A 1VM1A 5FQMA 5A92A 4UHUA 5GLBA 3LR3A 4Y17A 1Z09A 2ZL1B 4PM7A 1JNUA 3IH9A 5CTNA 4IBRA 1JTGA 1GCEA 2ZM8A 4X69A 4G3KA 3R7WB 4LCMA 3S7NA 5TFQA 5FSRA 1S66L 2UV0E 4GHIA 1ZKJA 2A3UA 3O87A 1VEUB 1CJFA 3JPUA 3EQVA 1UGUA 3MZEA 1N4OA 3ZG8B 2GJ3A 4BL2A 3SH7A 3VOYA 1I2WA 5F1FA 3UB7A 3CITA 4WF0A 5F69A 4WMCD 3UMEA 1P9RA 3UB6A 1E3UA 5HAQA 3N6IA 3IX8A 4IVIA 3PTEA 2Q9NA 4HBUA 3N8LA 2Y4AA 3UDFA 4E6WA 1NY0A 3OCNA 4DXBA 2JCHA 4KQOA 4S2MA 1NWZA 3OOVA 3Q1FA 2J8YA 4FOFA 2V0WA 3VP2A 4YINA 4CLCA 3F1PA 4X25A 1LSVA 4QB8A 5G4ZA 4ID4A 1H3QA 5FATA 4S2OA 4WYYA 5GLDA 4OP8A 4HP4A 5HFOA 4HQAA 4Y0UA 5DF7A 4EESA 4P85A 3B42A 5E2FA 5F1GA 3NC8A 3GSGA 1NXYA 4GS9B 1S4RA 4WN5A 3NHQA 4QPRA 3HLWA 4P6ZM 2PU2A 3BY8A 2Y2GA 3MQQA 2PYPA 5IU1A 3BY9A 1ALQA 4ARZA 4C75A 1PI4A 5FDSA 3AGDA 2M7UA 3F1OB 4O01A 2QZ6A 4FH2A 4I5SA 1LT0A 5KSCA 2Q9MA 1SDNA 4KZBA 3GDIA 5HDCA 4A5RA 5HDDA 3H82A 2WGWA 4WEJA 2V9AA 3RH8B 3BEBA 5AVEA 3CI6A 1MKMA 4MBHA 2GNXA 1ESIA 2WYXA 4M3KA 4R70A 4NETA 4ETXA 1YLYA 3MJQA 4E3MA 2CMNA 3I7JA 1K56A 5FAQA 2VX8A 3LY3A 4H6JA 2R78A 1W63Q 1ONGA 1XJ2A 4H8RA 5HWTA 1T1CA 2J9PA 3GVBA 5FA7A 5HPFA 3C5AA 1PYYA 1VETA 3PBNA 3HBRA 2H5SA 4HNBA 1YMXA 4GDNA 3MXSA 3G2ZA 1ZHHB 4IUHA 4HY8A 2HF6A 4DJ2A 1MZUA 4UA7A 3OPLA 4PKYA 3ZGAB 3LYXA 4GNUA 2H0YA 3IXDA 3MFDA 4WELA 4N9KA 1BT5A 2ZC7A 4OOMA 3LO7A 4OPYA 3UPOA 1DP6A 4Y0OA 1DJBA 3O88A 4BENA 3KSIA 2V1AA 2B95A 5CGXA 4OPRA 5HWVA 3O3VA 4JBFA 1W7FA 2B02A 4MDZA 4KZ3A 3VP1A 3VP4A 4FH4A 1IFQA 1VB6A 5CTMA 4Q0HA 3ZCZA 1TS8A 1XGIA 4R3AA 1Y4OA 4JXSA 2HDUA 4R3JA 3H9WA 3BWLA 4II7A 3T4JA 4L9EA 2O0YA 3NI9A 5CERA 4P87A 2VV7A 3VV4A 1GHIA 2EX9A 3DTEA 3ZG5A 4DE1A 3WRTA 4NXBA 1V9YA 2ZM2A 3MXQA 4PMAA 3BQAA 2HP6A 3OPHA 1MY8A 1RGYA 3HREA 2Y55A 2IWDA 3CLOA 3BJNA 4PM9A 2EX8A 4OOLA 1H8MA 1KGEA 3PBTA 4EBLA 3S4XA 5DF9A 1S1YA 2WGIA 1BZAA 3MR0A 1TDGA 1XJ3A 3IX4A 3TW8A 2HDRA 4E3IA 5L2FA 2UWXA 4MN5A 1TD5A 2V2FF 4OQGA 4N9LA 2Z2MB 3HVFA 4MCWA 4UAAA 5J8XA 3LIEA 4BWIA 1FIKA 2ZQDA 4PAUA 2EFXA 5J3WA 3P09A 1XJ6A 1IYQA 3BYDA 3GRJA 3D9YA 3BM6A 1IKIA 1F2KA 1PWDA 3WS2A 3ZG9B 3HLEA 1OTDA 2OOLA 3FG8A 2Y59A 2ZMFA 1K4FA 3KYZA 1T1BA 3FYZA 2DNSA 4JF6A 5FQ9A 2ZD8A
chains in the Genus database with same CATH topology
3FC7A 4NKPA 2I9VA 2P04A 2P7JA 1DRMA 3B33A 5HDSA 3C2WA 4IUKA 3H7WA 5HD3A 1STZA 5TJJA 1S1ZA 2W3FA 4Q0IA 2YKHA 1W63M 4WL9A 4MMNA 2GZAA 3IBJA 2IA2A 3RFBA 3F1OA 3LR0A 4Z1WA 3FPWA 5DKKA 3PR6A 4EEUA 3T4LA 1P97A 1GSXA 3B47A 2PD7A 2W3DA 4NXEA 2FH5A 2YKFA 3KO6A 3HJKA 1UWNX 4KQDA 2VGLS 2W27A 4BBVA 2QKPA 2QJ7A 2WKRA 1GSVA 3V67A 5G4YA 2JKTM 2P08A 4I3AA 2HJEA 1S4SA 3JVVA 4WEKA 2ZOHA 3EEAA 3A0VA 3D72A 1YAXA 5HSQA 4CQHA 3RTYA 3A0RA 3MQOA 4L0LA 1V9ZA 4ME4A 4LLOB 2QHKA 4PKYG 3EEHA 4YNRA 3PYPA 4YOFA 4EETB 4EQ1A 2M1CA 4HJ4A 5DFYA 4CLCE 3JVUA 2HGVA 2O9BA 5F68A 5LBRA 2K2NA 1ODVA 3S7OA 4HJ6A 3CAXA 2EA9A 2Y79A 2OAQ1 2EWVA 2K7SA 4KUOA 2L0WA 4O0PA 2O99A 3LI8A 2PR6A 3LR3A 1T18A 1OJGA 2V0UA 4LPZA 3LIAA 3MMHA 2NUPC 2L4RA 1OPXA 4M4XA 4NXFA 1JNUA 2NUTC 4F3LB 3IBRA 4O8GA 4G3KA 3R7WB 3S7NA 5HPIA 2JKTI 1T19A 3NOTC 5AVFA 4LRXC 5DJTA 1S66L 3P7NA 3LR4A 4GHIA 3MFXA 2J3TC 2VV6A 2VLGA 4Y3IA 3TJZC 4HP9A 3EQVA 1UGUA 5DFXA 2GJ3A 1YSPA 2W3GA 2W1TB 3ICYA 1LSWA 4GCZA 3UB7A 1P9WA 3CITA 4WF0A 5F69A 1YSQA 2KDKA 3UE6A 3UMEA 1P9RA 3UB6A 2ZMVA 5F5YA 3LUQA 3EOIA 2ZOIA 4BBTA 3PBQA 1NLYA 4YWZA 2BASA 1GSWA 4E04A 1IOUA 3ZQ5A 3PBOA 3OCNA 3KSFA 2PT7A 4DN0A 3E4OA 4LRYC 3T4QA 4KQOA 4RQ9A 4KUKA 2XSSA 3LICA 5TBMA 3OCLA 2A24B 3CUEC 2D01A 1NWZA 3OOVA 4CLCC 3LFVA 1MC0A 2HV1A 2WKQA 3CUEA 2V0WA 1OTAA 4FOFA 4EERA 2K31A 3F1PA 4CLCA 1LSVA 4UQIM 4BJPA 5G4ZA 5HZHA 5MC7A 1H3QA 4I39A 4I3JA 4WLAA 4HP4A 2W3HA 4HQAA 4EESA 2L1MA 3B42A 3E4QA 1UWPX 1D06A 4GS9B 1S4RA 5EFWA 4WN5A 4FSFA 3OBFA 3NHQA 3PBRA 4QPRA 4P6ZM 3VE4A 3BY8A 2XROA 1LSXA 3MQQA 5L8MA 3EWKA 2FZ0A 2PYPA 2QWSA 3H7WB 4JGRA 3K2NA 4MN6A 3OLOA 5IU1A 4XT2A 3BY9A 3DBAA 2VJWA 4ARZA 1S67L 2JKRM 3MF0A 2MJ6A 2M7UA 3W2ZA 2D02A 3F1OB 3G6OA 3P01A 4IJGA 3S7PA 4O01A 3K3DA 1F98A 2OWHA 2PR5A 5C5KA 4I5SA 1LT0A 5KIZA 3GDIA 1NLZA 2PYRA 1X0OA 5HDCA 3BQ8A 3H82A 4ZRRA 5HDDA 3EQUA 5IT5A 4WEJA 2V9AA 5K5BA 3RH8B 5AVEA 3CI6A 5F6AA 1MKMA 2GNXA 3GECA 3C30A 3T4OA 2XA7S 2GX5A 4JGQA 5DJUA 4R70A 3PHYA 4ETXA 3MJQA 3T4TA 2CMNA 4BMWA 2VZWA 3E0YA 3FPVA 3VE3A 4AFIA 1TS6A 3F1NA 2VX8A 4LRZE 2VGLM 4H6JA 2R78A 1W63Q 2PDRA 1XFNA 5A8BA 3E4PA 2VKSA 2JN7A 1XJ2A 5HWTA 4HJ3A 3BW6A 2LB5A 1T1CA 3LI9A 3NOPC 3SW1A 1LL8A 1KOUA 1NRJA 2H28A 3A0SA 2JHEA 2WKPA 3OC2A 2VV8A 5HPFA 2G7UA 3K3CA 3PBNA 2V1BA 2JKRI 4B93A 4L9GA 2DMWA 4HNBA 3LR5A 2QJ5A 2OWJA 1G6OA 1ZHHB 4IUHA 4WUJA 1BYWA 2LB9A 4HY8A 2HF6A 4DJ2A 3LIFA 1MZUA 4EXOA 2VA0A 4PKYA 3F1NB 3LYXA 3D3OA 3PBSA 4CLCD 4DJ3A 1F5MA 2O9CA 1F9IA 1TF1A 5AJGA 4WELA 5HWWA 4GLQA 5I5LA 1DP8A 3ZYTA 4OOMA 4GHIB 4MN7A 4R6LA 1DP6A 2J3WA 4GJ4A 4Y5FA 3KSIA 2V1AA 4HIAA 2B18A 4JGPA 3UE3A 5HL6A 4NEED 4K08A 3PXPA 3TE8A 5HWVA 1D7EA 3HJIA 2Z6DA 2XRNA 2KX6A 5J7EA 3ULFA 2B02A 4MDZA 3LIBA 4I3IA 1IFQA 1VB6A 1EW0A 2W0NA 4Q0HA 1TS8A 3KSHA 4G3VA 5KSHA 4R3AA 2W1RA 4HH2A 3KSGA 2HJ9C 1WA9A 3H9WA 3UB9A 4NXGA 1VHMA 3BWLA 4II7A 3T4JA 2PHYA 4L9EA 2M7VA 4HH3A 5TBMB 2INWA 2O0YA 1YKDA 2Z6CA 4I38A 4CLCB 3F1PB 2VV7A 2EWWA 1DP9A 3T50A 3VV4A 2VEAA 3T4SA 3NJAA 3HCYA 5J4EA 4EU0A 4NXBA 5FL3A 4F3LA 1N9NA 4Q0JA 1V9YA 3UMDA 3MQ0A 2QYBA 4Y2FA 3MXQA 3BQAA 3KX0X 3R7WA 5CX7A 3CLOA 3BJNA 1XFQA 3NOUC 4HHDA 3T4KA 4XT2B 4OOLA 1H8MA 4ARZB 3EGXC 3PBTA 1OTBA 5DF9A 2J3TD 1S1YA 4R38A 1N9OA 3MR0A 2PD8A 1XJ3A 3R4KA 4G3WA 2W3EA 5IS1A 3E98A 3U2AA 4EUVA 3IS2A 3TW8A 3S7QA 1N9LA 2W1TA 3VOLA 2KLIA 3H82B 4MN5A 2OAP1 1TD5A 2ZBBA 1XJ4A 2Y8HA 1OJ5A 4L9FA 4PHTA 3TRCA 3LIDA 4UQIS 3KYQA 3O5YA 4HI4A 4MCWA 3EGDC 1OTEA 4GW9A 4BBUA 4UEYA 3LIEA 1OT9A 4BWIA 4ETZA 4IHQA 1G28A 4PAUA 5J3WA 4B9OA 1TS7A 1XJ6A 2A24A 4HOIA 4EEPA 4DMZA 4H6JB 4JGOA 1Y28A 1P0ZA 4P6ZS 1OTIA 5DKLA 2KOIA 3C38A 2O9AA 1OTDA 2OOLA 1TS0A 3FG8A 3IS2B 2ZMFA 2J80A 1T1AA 2XA7M 3KYZA 1T1BA 4EW7A 5HD5A 1ZTUA 3C8CA 2A2LA 3UB8A 3CWFA 1OT6A 4GS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FC7 A;  2I9V A;  2P7J A;  1DRM A;  3B33 A;  5HDS A;  3C2W A;  3H7W A;  5HD3 A;  1S1Z A;  2YKH A;  4WL9 A;  3F1O A;  5DKK A;  4EEU A;  1P97 A;  1GSX A;  2PD7 A;  4NXE A;  2YKF A;  3HJK A;  1UWN X;  4KQD A;  2W27 A;  4BBV A;  2QKP A;  2QJ7 A;  2WKR A;  1GSV A;  5G4Y A;  4I3A A;  1S4S A;  2ZOH A;  3A0V A;  3D72 A;  5HSQ A;  3RTY A;  3A0R A;  3MQO A;  1V9Z A;  4LLO B;  2QHK A;  4PKY G;  3EEH A;  3PYP A;  4EET B;  4EQ1 A;  2M1C A;  4HJ4 A;  5F68 A;  1ODV A;  4HJ6 A;  3CAX A;  2EA9 A;  4KUO A;  2K7S A;  2L0W A;  3LI8 A;  2PR6 A;  1T18 A;  1OJG A;  2V0U A;  4LPZ A;  3LIA A;  2L4R A;  4M4X A;  4NXF A;  1JNU A;  4F3L B;  3IBR A;  1T19 A;  3NOT C;  5AVF A;  4LRX C;  5DJT A;  1S66 L;  3P7N A;  4GHI A;  3MFX A;  2VV6 A;  2VLG A;  4HP9 A;  1UGU A;  2GJ3 A;  3ICY A;  1LSW A;  4GCZ A;  3UB7 A;  4WF0 A;  5F69 A;  3UE6 A;  2KDK A;  3UME A;  3UB6 A;  5F5Y A;  3LUQ A;  2ZOI A;  4BBT A;  4YWZ A;  2BAS A;  1GSW A;  4E04 A;  3ZQ5 A;  3E4O A;  4LRY C;  4RQ9 A;  4KUK A;  3LIC A;  5TBM A;  2A24 B;  2D01 A;  1NWZ A;  2HV1 A;  2WKQ A;  2V0W A;  1OTA A;  4EER A;  3F1P A;  1LSV A;  5G4Z A;  5HZH A;  4I39 A;  4I3J A;  4WLA A;  4HP4 A;  4HQA A;  4EES A;  2L1M A;  3E4Q A;  1UWP X;  1D06 A;  4GS9 B;  1S4R A;  5EFW A;  4WN5 A;  3NHQ A;  3VE4 A;  3BY8 A;  1LSX A;  3MQQ A;  3EWK A;  2PYP A;  3H7W B;  5IU1 A;  4JGR A;  2QWS A;  4MN6 A;  3OLO A;  4XT2 A;  3BY9 A;  1S67 L;  2D02 A;  3F1O B;  3G6O A;  3K3D A;  1F98 A;  2OWH A;  2PR5 A;  4I5S A;  1LT0 A;  5KIZ A;  3GDI A;  2PYR A;  1X0O A;  5HDC A;  5HDD A;  3H82 A;  2V9A A;  3RH8 B;  5AVE A;  5F6A A;  3GEC A;  4JGQ A;  5DJU A;  4R70 A;  3PHY A;  3MJQ A;  2CMN A;  3VE3 A;  1TS6 A;  3F1N A;  4LRZ E;  4H6J A;  2R78 A;  2PDR A;  1XFN A;  5A8B A;  3E4P A;  2JN7 A;  1XJ2 A;  5HWT A;  4HJ3 A;  1T1C A;  3LI9 A;  3NOP C;  3SW1 A;  1LL8 A;  1KOU A;  3A0S A;  2H28 A;  2JHE A;  2WKP A;  2VV8 A;  3K3C A;  2V1B A;  4L9G A;  4HNB A;  2QJ5 A;  2OWJ A;  4WUJ A;  1BYW A;  4HY8 A;  4DJ2 A;  3LIF A;  1MZU A;  4EXO A;  4PKY A;  3F1N B;  3LYX A;  4DJ3 A;  1F9I A;  5HWW A;  5I5L A;  1DP8 A;  4GHI B;  4R6L A;  1DP6 A;  2V1A A;  4HIA A;  4JGP A;  4K08 A;  5HWV A;  1D7E A;  3HJI A;  2Z6D A;  5J7E A;  2KX6 A;  3ULF A;  2B02 A;  3LIB A;  4I3I A;  1VB6 A;  2W0N A;  1EW0 A;  1TS8 A;  4R3A A;  4HH2 A;  1WA9 A;  3H9W A;  3UB9 A;  4NXG A;  3BWL A;  2PHY A;  4L9E A;  4HH3 A;  5TBM B;  2INW A;  2Z6C A;  4I38 A;  3F1P B;  2VV7 A;  1DP9 A;  3T50 A;  2VEA A;  3NJA A;  5J4E A;  4NXB A;  4F3L A;  1N9N A;  1V9Y A;  3UMD A;  3MXQ A;  3KX0 X;  3CLO A;  1XFQ A;  3NOU C;  4HHD A;  4XT2 B;  1OTB A;  1S1Y A;  4R38 A;  1N9O A;  3MR0 A;  2PD8 A;  1XJ3 A;  5IS1 A;  3IS2 A;  1N9L A;  3VOL A;  3H82 B;  4MN5 A;  2ZBB A;  1XJ4 A;  1OJ5 A;  4L9F A;  3LID A;  4HI4 A;  1OTE A;  4GW9 A;  4BBU A;  1OT9 A;  3LIE A;  1G28 A;  5J3W A;  4B9O A;  1TS7 A;  1XJ6 A;  2A24 A;  4HOI A;  4EEP A;  4H6J B;  4JGO A;  1Y28 A;  1P0Z A;  1OTI A;  5DKL A;  1OTD A;  2OOL A;  1TS0 A;  3FG8 A;  3IS2 B;  2J80 A;  1T1A A;  1T1B A;  4EW7 A;  5HD5 A;  3C8C A;  3UB8 A;  3CWF A;  1OT6 A;  4GS9 A; 
#chains in the Genus database with same CATH topology
 2XD1 A;  4ZAM A;  5CGS A;  3CZD A;  1LHY A;  4S2P A;  1J9M A;  4X68 A;  2P7J A;  2OLU A;  4IUK A;  3H7W A;  2Y2J A;  5HD3 A;  2ZC3 B;  1K55 C;  1S1Z A;  4RX3 A;  2XR0 A;  2YKH A;  4MMN A;  3RFB A;  5EVI A;  3LR0 A;  4E3J A;  1K4E A;  3FPW A;  5CRF A;  3V3S A;  4EBP A;  3QP1 A;  3BRM A;  1XXM A;  1UWN X;  2VGL S;  3GQZ A;  1GSV A;  5G4Y A;  1EI5 A;  2JKT M;  4I3A A;  4WZ4 A;  3IHB A;  1MWT A;  3A0V A;  1YAX A;  3RTY A;  3PAG A;  3QP6 A;  4PKY G;  4LFU A;  1XGJ A;  3UNW A;  2HDQ A;  2WK0 A;  2O9B A;  4R4S A;  4LV3 A;  3S7O A;  4LV2 A;  2OAQ 1;  2EWV A;  4Y0T A;  2PR6 A;  4FCF A;  2V0U A;  1ERO A;  2NUP C;  4NXF A;  3UPP A;  4B88 A;  1SKO B;  1RCJ A;  1M6K A;  3L7H A;  1XA7 A;  4PM8 A;  5L09 A;  5HW3 A;  3ZG7 B;  4LRX C;  5DJT A;  4N1X A;  5EOO A;  3MXR A;  4LEN A;  3NIA A;  4ESP A;  5HL1 A;  2XD5 A;  2VLG A;  3TJZ C;  4KQQ A;  3W4P A;  1PZO A;  4WM9 A;  1YSP A;  4MBF A;  1CQA A;  3MKE A;  1XX2 A;  2W1T B;  4U0X A;  1K6R A;  4JPM A;  1YSQ A;  3VOZ A;  3L9K A;  1ES3 A;  2ZOI A;  2CC1 A;  1IOU A;  2H0T A;  5L07 A;  2PT7 A;  3E4O A;  4X1L A;  3T4Q A;  3T1S A;  1L0D A;  4KUK A;  2XSS A;  1BLP A;  4O7D A;  1KDS A;  2HV1 A;  2WKQ A;  3CUE A;  1QMF A;  4X53 A;  3SS5 A;  1ZC2 A;  4BJP A;  5HZH A;  5MC7 A;  4KZ9 A;  4X1M A;  1W8Y A;  2W3H A;  1SZV A;  3FKV A;  1H5X A;  1UWP X;  3SS3 A;  3BFG A;  5FAP A;  5EFW A;  1N9B A;  3OBF A;  5EPH A;  3UN7 A;  3DAV A;  2V8C A;  5L8M A;  4JGR A;  3K2N A;  3OLO A;  3IQA A;  4XT2 A;  3C7V A;  4S2N A;  1S67 L;  3LGO A;  3W8K A;  1MKI A;  1J3W A;  1IYP A;  3A3D A;  3G6O A;  3S7P A;  4BD0 A;  2JBF A;  4OLG A;  4S2K A;  1F98 A;  2OWH A;  4MLL A;  2QMI A;  1D1J A;  2PYR A;  3BQ8 A;  2Y2N A;  3EQU A;  2OV5 A;  4WZ5 A;  1CI9 A;  5F6A A;  3MBZ A;  4OP5 A;  2XA7 S;  2GX5 A;  4JGQ A;  3PHY A;  4KZ5 A;  4BMW A;  2VZW A;  4P6B A;  3E0Y A;  3V39 A;  3BFC A;  3F1N A;  3CPT A;  4RA7 A;  1XFN A;  2VKS A;  2LB5 A;  3SW1 A;  1LL8 A;  2H28 A;  3FZC A;  1E3U D;  3OC2 A;  2WKE A;  5FEF A;  4XXR A;  2V1B A;  4C3Q A;  4B93 A;  5U47 A;  4KZ4 A;  3ZHH A;  1KE0 A;  4LGW A;  2OSU A;  1U60 A;  1G6O A;  3LIF A;  4OQH A;  3QP8 A;  4EXO A;  3WS0 A;  1L3L A;  5AQ9 A;  3F1N B;  3PBS A;  4QD4 A;  4CLC D;  4DJ3 A;  1F5M A;  2O9C A;  2ZQ7 A;  2EX6 A;  1TVF A;  1F9I A;  5EM1 A;  5AJG A;  5HWW A;  5EOE A;  1AWI A;  2QPN A;  1PIO A;  3QP2 A;  4GHI B;  4R6L A;  5F83 A;  4GJ4 A;  4QY6 A;  2ZC6 B;  5M19 A;  4JGP A;  1K57 A;  1HZO A;  5HL6 A;  4K08 A;  5FAS A;  1D7E A;  5GHX A;  1XA1 A;  3HJI A;  3IF6 A;  4FD8 A;  5EVI C;  1PW1 A;  5M18 A;  1PW8 A;  3LIB A;  1EW0 A;  4E3O A;  4G3V A;  4B4X A;  5KSH A;  2W1R A;  5HAP A;  2B5R A;  1KVM A;  3MKF A;  2PHY A;  2C5W B;  4N1H A;  2DCF A;  2INW A;  4FUW A;  1YKD A;  3WS4 A;  4CLC B;  3F1P B;  3T50 A;  4OKP A;  1K56 D;  2WAF A;  3NJA A;  5FI6 A;  5FL3 A;  4F3L A;  1N9N A;  4Q0J A;  2XGN A;  2ZMA A;  4WBG A;  3KX0 X;  4EBN A;  4E3L A;  1ACF A;  4JXG A;  1XFQ A;  4OLD A;  4HHD A;  1FIL A;  1ES2 A;  4ARZ B;  3LEZ A;  3EGX C;  1S0W A;  1G68 A;  2X01 A;  5IS1 A;  3E98 A;  5E2H A;  1ESU A;  3BEC A;  4YFM A;  3C4P A;  3G34 A;  3VOL A;  3C7U A;  2X02 A;  3H82 B;  2WGW B;  2OAP 1;  2WAD A;  5EVE A;  1YLT A;  1IKG A;  1OJ5 A;  2A49 A;  3TRC A;  4UQI S;  5DF8 A;  3N7W A;  4K0W A;  1I2S A;  5CEC A;  1FCM A;  2E8I A;  1JWP A;  1OTE A;  3G32 A;  3IHA A;  5CHM A;  4UEY A;  1G28 A;  4ZBE A;  4QJG A;  5GLA A;  1IEL A;  2A24 A;  4HOI A;  4H6J B;  1Y28 A;  2P9V A;  3IXB A;  3MSH A;  1FCN A;  4KG6 A;  1W5D A;  1ZTU A;  3C8C A;  2A2L A;  1VET B;  3UB8 A;  3A3E A;  3NCK A;  2P04 A;  4XUZ A;  3VP3 A;  5EE8 A;  3MZD A;  2XF3 A;  5FI2 A;  1STZ A;  3HUM A;  4Q0I A;  4QY5 A;  4WL9 A;  3FV7 A;  4S2L A;  1H8Y A;  4LCL A;  4EEU A;  3Q7V A;  3T4L A;  3GR2 A;  2PD7 A;  1PFL A;  2W3D A;  2FH5 A;  2YKF A;  3FWL A;  3HJK A;  2W27 A;  4Z9Q A;  3UO9 A;  2ZC5 B;  2HDS A;  3UB5 P;  3TG9 A;  2HJE A;  1S4S A;  4Y7P A;  2ZOH A;  3QP5 A;  3KYE A;  3G31 A;  4CQH A;  3A0R A;  4L0L A;  3BLS A;  4R3B A;  1ES4 A;  1H0M A;  5IHV A;  4LLO B;  2QHK A;  4YNR A;  4EET B;  3PAE A;  1YMS A;  2PBY A;  3BFE A;  3HLC A;  5F68 A;  4WZ5 C;  1PWC A;  2EA9 A;  3ZG0 A;  1LI0 A;  2K7S A;  4BL3 A;  2L0W A;  5EUA A;  1FR6 A;  3DWZ A;  3HLD A;  1LL9 A;  4HEF A;  1K0K A;  3MMH A;  1BUE A;  1OPX A;  4M4X A;  2P74 A;  3DTK A;  5HAI A;  4IED A;  2FFF B;  4K0X A;  1SDE A;  1KGG A;  1C3B A;  4O8G A;  5GHY A;  3IF5 A;  4K91 A;  2JKT I;  4DKI A;  3C4O A;  4RVA A;  5FEG A;  2I72 A;  1L0G A;  3P7N A;  1E25 A;  3SH9 A;  3LR4 A;  1OME A;  1PI5 A;  4CPK A;  2J3T C;  1GHP A;  1MPL A;  4HP9 A;  2Z2L B;  3LEQ A;  1Q2Q A;  4PPR A;  2W3G A;  4N92 A;  1WE4 A;  3DTI A;  3ICY A;  4GCZ A;  4OPQ A;  1FCO A;  3N8S A;  5FI7 A;  3UE6 A;  2KDK A;  5EVI D;  2ZC4 B;  3NBL A;  4LV1 A;  5FQJ A;  3G35 A;  3Q7Z A;  4BBT A;  3Q07 A;  3PBQ A;  1NLY A;  4YWZ A;  2BAS A;  1GSW A;  1FOF A;  4E04 A;  5EEC A;  3ZQ5 A;  1SHV A;  2C6W B;  3KSF A;  5BOH A;  4JXW A;  3A3F A;  4LRY C;  1NYM A;  4OQI A;  5AQ7 A;  1SCW A;  4RQ9 A;  1K25 A;  3LIC A;  5TBM A;  2D01 A;  4CLC C;  4EER A;  2K31 A;  4KEN B;  3ZDJ A;  1O07 A;  2BTF P;  4I3J A;  4WLA A;  1HLU P;  3NY4 A;  2L1M A;  1ERM A;  1D06 A;  4JF4 A;  3PBR A;  1FR1 A;  3EWK A;  2FZ0 A;  3H7W B;  2QWS A;  5CEB A;  3DBA A;  1QME A;  1NJ4 A;  2JKR M;  1MWU A;  5EVI B;  1YLP A;  4EQI A;  3MZF A;  4KQR A;  5C5K A;  4KZ6 A;  1TDL A;  5KIZ A;  1LL5 A;  1NLZ A;  1X0O A;  4ZRR A;  1TEM A;  5IT5 A;  3UPN A;  5K5B A;  5A90 A;  2HP5 A;  2WZZ A;  2JC7 A;  3UE0 A;  1HD8 A;  3T4O A;  5KZH A;  3IXG A;  1PRQ A;  1VQQ A;  3UY6 A;  3GV9 A;  1WYB A;  5DTT A;  3VE3 A;  4OQ0 A;  3ZVT A;  1NRF A;  5F82 A;  2VGL M;  2IWB A;  3E4P A;  2FFY A;  2JN7 A;  5DTK A;  3BW6 A;  3UDX A;  3A0S A;  1IYS A;  4JXV A;  2WUQ A;  4HBT A;  1ONH A;  2G7U A;  3K3C A;  4RYE A;  4L9G A;  2DMW A;  3LR5 A;  2BLS A;  1HTZ A;  4F94 A;  2QJ5 A;  2OWJ A;  3A3J A;  2VGJ A;  1YT4 A;  5GHZ A;  4S2I A;  4Y13 A;  3UE1 A;  4DDS A;  2VA0 A;  1MWR A;  4XUX A;  2XFT A;  2Y2L A;  3DW0 A;  2G2W A;  1YM1 A;  3ZYT A;  3SH8 A;  4NK3 A;  1K38 A;  3Q82 A;  4DE3 A;  1BTL A;  1RGZ A;  3D4F A;  2PU4 A;  2B18 A;  3UE3 A;  3AGF A;  2XFS A;  4NEE D;  1L0E A;  3PXP A;  4GB7 A;  1FSW A;  4RX2 A;  2Z6D A;  2XRN A;  2KX6 A;  3OPR A;  4KZ8 A;  3M6H A;  4JF5 A;  4BQM A;  2W0N A;  4R0Q A;  2RCX A;  4HH2 A;  3KSG A;  2HJ9 C;  1VHM A;  2Q0O A;  3G4P A;  3NDG A;  5M1A A;  1K6S A;  2H10 A;  3LY4 A;  1BSG A;  2VEA A;  3HUO A;  2ZL1 A;  4PM5 A;  3MS6 A;  4EU0 A;  3G30 A;  4Y2F A;  1DJA A;  4JKT A;  1KE4 A;  2JKG A;  3R7W A;  4DXC A;  3CG5 A;  3JYI A;  3NOU C;  1L2S A;  3T4K A;  4XT2 B;  4KZ7 A;  1L0F A;  3V5M A;  4X55 A;  3E2K A;  2J3T D;  5CED A;  1VEU A;  1N9O A;  2Y91 A;  4MEZ A;  4Y15 A;  2PD8 A;  3U2A A;  1DJC A;  1JVJ A;  2VGK A;  3S7Q A;  3NEC A;  3HLB A;  2GDN A;  5AQA A;  3LID A;  4MBK A;  3IXH A;  4GD6 A;  3O5Y A;  4GW9 A;  1NYY A;  4BBU A;  4ETZ A;  4IHQ A;  2ZJ9 A;  3BLM A;  4R23 A;  5JYP A;  3CPT B;  1PZP A;  4JGO A;  4P6Z S;  1P0Z A;  5DKL A;  1GHM A;  2O9A A;  4BLM A;  1ES5 A;  4JLF A;  4P0M A;  1GA9 A;  1TS0 A;  3ITB A;  3IWQ A;  1T1A A;  2XA7 M;  1BLC A;  2Y2Q A;  5A91 A;  2ZM0 A;  4OON A;  5DVA A;  3CWF A;  4GS9 A;  3FC7 A;  4NKP A;  2I9V A;  1DRM A;  3P98 A;  5HDS A;  3C2W A;  1CEG A;  2W3F A;  4CJN A;  3VFH A;  3U4L P;  1K55 A;  2GZA A;  4WMC A;  1SKF A;  2IA2 A;  1FQG A;  3F1O A;  4ZJ3 A;  2R9W A;  2IWC A;  4Z1W A;  4X6T A;  1GSX A;  1P97 A;  3B47 A;  1CEF A;  3KO6 A;  4QU3 A;  3ZVW A;  4BBV A;  2QKP A;  3IX3 A;  2WKI A;  3W4Q A;  3V67 A;  2P08 A;  1CI8 A;  1IEM A;  3JVV A;  4KG5 A;  2XQZ A;  2VK3 A;  3EEA A;  1XP4 A;  1WYC A;  1KGF A;  4R1G A;  3IF6 B;  5HSQ A;  5FQK A;  3MQO A;  3IWI A;  3EEH A;  3PYP A;  4EQ1 A;  4U0T A;  3SOI A;  3T1R A;  2K2N A;  2EXB A;  2WAE A;  2Y79 A;  4KUO A;  3M2J A;  1T18 A;  1OJG A;  1Q2P A;  4LPZ A;  1XPB A;  3LIA A;  5TGF A;  3FKW A;  2L4R A;  3OZH A;  4LV0 A;  4ZJ1 A;  2NUT C;  4F3L B;  3IBR A;  4ZDX A;  4DRT A;  5D3O A;  2ZLY A;  5HPI A;  1T19 A;  3NOT C;  5AVF A;  3V3R A;  1IYO A;  5L10 A;  4UA9 A;  3MFX A;  3ITA A;  2VV6 A;  4Y3I A;  1DY6 A;  2HZ5 A;  5DFX A;  1K54 A;  3G2Y A;  4BD1 A;  5CXW A;  1KDW A;  3WS1 A;  1LSW A;  1P9W A;  3N8R A;  2BG1 A;  1JTD A;  2ZMV A;  5F5Y A;  3LUQ A;  1BLS A;  2V1Z A;  3EOI A;  4R4R A;  5HAR A;  3RJU A;  3SS4 A;  2PAV P;  5GL9 A;  3PBO A;  4DN0 A;  2AVX A;  1E4D A;  1BUL A;  3IH8 A;  1W8Q A;  3OCL A;  2A24 B;  3QNC A;  3CUE C;  1PNE A;  3LFV A;  1MC0 A;  1ZG6 A;  4GN2 A;  1OTA A;  2HPB A;  2XDM A;  4ZTK A;  2P9V B;  4UQI M;  4EWF A;  1W79 A;  1MXO A;  4DF6 A;  4I39 A;  4HES A;  3ZNY A;  3E4Q A;  5E2E A;  3O86 A;  4FSF A;  1G6A A;  3VE4 A;  2XRO A;  1LSX A;  4S2N C;  4MN6 A;  2DRW A;  4PM6 A;  2VJW A;  5HX9 A;  3MF0 A;  2MJ6 A;  4OVD A;  3W2Z A;  2D02 A;  3P01 A;  4IJG A;  1ZG4 A;  4OOY A;  2R9X A;  1G5U A;  3K3D A;  1BLH A;  2PR5 A;  1YLZ A;  3Q7V B;  2ZQ8 A;  1A0K A;  3OPP A;  3DWK A;  3HLG A;  2Y2P A;  5FDH A;  3GEC A;  3C30 A;  5CHJ A;  2PBD P;  3T12 B;  1KVL A;  5DJU A;  5I94 A;  4DE2 A;  4E3N A;  1HVB A;  5E2G A;  3T4T A;  1PWG A;  4EV4 A;  4S2J A;  1MBL A;  1JWV A;  3FPV A;  4AFI A;  1TS6 A;  4LRZ E;  2PDR A;  2Y2K A;  5A8B A;  2Y2H A;  1YPR A;  4HJ3 A;  2OLV A;  3LI9 A;  3NOP C;  3S22 A;  1NRJ A;  1KOU A;  3HUN A;  2JHE A;  2WKP A;  2VV8 A;  4E3K A;  1YLW A;  2JKR I;  3RXX A;  1JWZ A;  1KE3 A;  1Z6F A;  2EX2 A;  3GMW A;  1M40 A;  4WUJ A;  1CK3 A;  1BYW A;  3HLF A;  2LB9 A;  2Y2I A;  1LI9 A;  2J9O A;  3IT9 A;  3TSG A;  4OPZ A;  1CF0 A;  3D3O A;  2V8F A;  1S6R A;  1TF1 A;  2E8J A;  3WS5 A;  4GLQ A;  3CMZ A;  5I5L A;  1O7E A;  1DP8 A;  2ZQ9 A;  4MN7 A;  2J3W A;  4Y5F A;  4U3T A;  1K57 C;  3N4I A;  4HIA A;  2WZX A;  5FAO A;  1XKZ A;  3TE8 A;  3IF6 C;  5J7E A;  2XH9 A;  3ULF A;  3Q81 A;  3LCE A;  3RXW A;  3CHW P;  3VP0 A;  3B3X A;  3W4O A;  5FQI A;  4I3I A;  4Q8I A;  5KMW A;  3KSH A;  3NDE A;  3A3I A;  1WA9 A;  2HP9 A;  5CHU A;  5JYO A;  3T1X A;  3UB9 A;  4NXG A;  1NZU A;  2M7V A;  5TR7 A;  5G18 A;  4HH3 A;  3M2K A;  4GZB A;  5TBM B;  2Z6C A;  2EFU A;  5GLC A;  4I38 A;  5FQQ A;  2EWW A;  1DP9 A;  3TOI A;  4IBX A;  3E2L A;  1Y54 A;  3T4S A;  3UDI A;  3M6B A;  3HCY A;  1EWZ A;  5J4E A;  2RL3 A;  4OH0 A;  2JE5 A;  5A93 A;  4E6X A;  3QHY A;  1SKO A;  3UMD A;  4GDB A;  3MQ0 A;  1YQS A;  2QYB A;  4EUZ A;  4FTX A;  5CX7 A;  2X71 A;  3SZT A;  2WKH A;  3ISG A;  2V20 A;  2J7V A;  3QP4 A;  1OTB A;  5AQB A;  4R38 A;  1NZO A;  5CGW A;  2PRF A;  3R4K A;  4G3W A;  2W3E A;  4GKU A;  1RP5 A;  4EUV A;  3IS2 A;  5EV0 A;  4IVK A;  2XLN A;  4UA6 A;  1N9L A;  2EXA A;  5E43 A;  3VMA A;  2W1T A;  4NG2 A;  2KLI A;  1AXB A;  2ZBB A;  1XJ4 A;  2Y8H A;  3GTC A;  4L9F A;  4PHT A;  4DE0 A;  3DTM A;  3IWO A;  3KYQ A;  4HI4 A;  3T1Q B;  3EGD C;  2XEP A;  3WWX A;  2Y2M A;  4MNR A;  2ZQA A;  1OT9 A;  3BFD A;  1MWS A;  4KG2 A;  4B9O A;  1TS7 A;  4EEP A;  4DMZ A;  1FSY A;  1LLB A;  1OTI A;  1K54 C;  2KOI A;  3C38 A;  3HL9 A;  3ZNT A;  3IS2 B;  2J80 A;  4ZJ2 A;  1YLJ A;  4EW7 A;  5HD5 A;  2XK1 A;  3WRZ A;  2QJ7 A;  1OT6 A;  4D60 A;  3B33 A;  4C6Y A;  1GA0 A;  5TJJ A;  4DDY A;  1W63 M;  4QHC A;  3IBJ A;  2WGV A;  3S1Y A;  4D2O A;  2Y2O A;  5DKK A;  3PR6 A;  1H8Z A;  4KZA A;  4NXE A;  2JKF A;  4KQD A;  2WKR A;  2ACG A;  5EVL A;  3VSK A;  2G2U A;  3V50 A;  3QNB A;  5DTS A;  4GD8 A;  4WEK A;  1ERQ A;  3VSL A;  3NUL A;  3D72 A;  1V9Z A;  4X56 A;  4ME4 A;  2ZQC A;  3CJM A;  4YOF A;  2M1C A;  3AGE A;  4HJ4 A;  5DFY A;  3ZFZ A;  4CLC E;  3JVU A;  3VFF A;  4QWO A;  2HGV A;  4GOG A;  5LBR A;  1ODV A;  3BFF A;  4B4Z A;  4HJ6 A;  5EM0 A;  3CAX A;  1I5Q A;  4O0P A;  2O99 A;  3LI8 A;  1VM1 A;  5FQM A;  5A92 A;  4UHU A;  5GLB A;  3LR3 A;  4Y17 A;  1Z09 A;  2ZL1 B;  4PM7 A;  1JNU A;  3IH9 A;  5CTN A;  4IBR A;  1JTG A;  1GCE A;  2ZM8 A;  4X69 A;  4G3K A;  3R7W B;  4LCM A;  3S7N A;  5TFQ A;  5FSR A;  1S66 L;  2UV0 E;  4GHI A;  1ZKJ A;  2A3U A;  3O87 A;  1VEU B;  1CJF A;  3JPU A;  3EQV A;  1UGU A;  3MZE A;  1N4O A;  3ZG8 B;  2GJ3 A;  4BL2 A;  3SH7 A;  3VOY A;  1I2W A;  5F1F A;  3UB7 A;  3CIT A;  4WF0 A;  5F69 A;  4WMC D;  3UME A;  1P9R A;  3UB6 A;  1E3U A;  5HAQ A;  3N6I A;  3IX8 A;  4IVI A;  3PTE A;  2Q9N A;  4HBU A;  3N8L A;  2Y4A A;  3UDF A;  4E6W A;  1NY0 A;  3OCN A;  4DXB A;  2JCH A;  4KQO A;  4S2M A;  1NWZ A;  3OOV A;  3Q1F A;  2J8Y A;  4FOF A;  2V0W A;  3VP2 A;  4YIN A;  4CLC A;  3F1P A;  4X25 A;  1LSV A;  4QB8 A;  5G4Z A;  4ID4 A;  1H3Q A;  5FAT A;  4S2O A;  4WYY A;  5GLD A;  4OP8 A;  4HP4 A;  5HFO A;  4HQA A;  4Y0U A;  5DF7 A;  4EES A;  4P85 A;  3B42 A;  5E2F A;  5F1G A;  3NC8 A;  3GSG A;  1NXY A;  4GS9 B;  1S4R A;  4WN5 A;  3NHQ A;  4QPR A;  3HLW A;  4P6Z M;  2PU2 A;  3BY8 A;  2Y2G A;  3MQQ A;  2PYP A;  5IU1 A;  3BY9 A;  1ALQ A;  4ARZ A;  4C75 A;  1PI4 A;  5FDS A;  3AGD A;  2M7U A;  3F1O B;  4O01 A;  2QZ6 A;  4FH2 A;  4I5S A;  1LT0 A;  5KSC A;  2Q9M A;  1SDN A;  4KZB A;  3GDI A;  5HDC A;  4A5R A;  5HDD A;  3H82 A;  2WGW A;  4WEJ A;  2V9A A;  3RH8 B;  3BEB A;  5AVE A;  3CI6 A;  1MKM A;  4MBH A;  2GNX A;  1ESI A;  2WYX A;  4M3K A;  4R70 A;  4NET A;  4ETX A;  1YLY A;  3MJQ A;  4E3M A;  2CMN A;  3I7J A;  1K56 A;  5FAQ A;  2VX8 A;  3LY3 A;  4H6J A;  2R78 A;  1W63 Q;  1ONG A;  1XJ2 A;  4H8R A;  5HWT A;  1T1C A;  2J9P A;  3GVB A;  5FA7 A;  5HPF A;  3C5A A;  1PYY A;  1VET A;  3PBN A;  3HBR A;  2H5S A;  4HNB A;  1YMX A;  4GDN A;  3MXS A;  3G2Z A;  1ZHH B;  4IUH A;  4HY8 A;  2HF6 A;  4DJ2 A;  1MZU A;  4UA7 A;  3OPL A;  4PKY A;  3ZGA B;  3LYX A;  4GNU A;  2H0Y A;  3IXD A;  3MFD A;  4WEL A;  4N9K A;  1BT5 A;  2ZC7 A;  4OOM A;  3LO7 A;  4OPY A;  3UPO A;  1DP6 A;  4Y0O A;  1DJB A;  3O88 A;  4BEN A;  3KSI A;  2V1A A;  2B95 A;  5CGX A;  4OPR A;  5HWV A;  3O3V A;  4JBF A;  1W7F A;  2B02 A;  4MDZ A;  4KZ3 A;  3VP1 A;  3VP4 A;  4FH4 A;  1IFQ A;  1VB6 A;  5CTM A;  4Q0H A;  3ZCZ A;  1TS8 A;  1XGI A;  4R3A A;  1Y4O A;  4JXS A;  2HDU A;  4R3J A;  3H9W A;  3BWL A;  4II7 A;  3T4J A;  4L9E A;  2O0Y A;  3NI9 A;  5CER A;  4P87 A;  2VV7 A;  3VV4 A;  1GHI A;  2EX9 A;  3DTE A;  3ZG5 A;  4DE1 A;  3WRT A;  4NXB A;  1V9Y A;  2ZM2 A;  3MXQ A;  4PMA A;  3BQA A;  2HP6 A;  3OPH A;  1MY8 A;  1RGY A;  3HRE A;  2Y55 A;  2IWD A;  3CLO A;  3BJN A;  4PM9 A;  2EX8 A;  4OOL A;  1H8M A;  1KGE A;  3PBT A;  4EBL A;  3S4X A;  5DF9 A;  1S1Y A;  2WGI A;  1BZA A;  3MR0 A;  1TDG A;  1XJ3 A;  3IX4 A;  3TW8 A;  2HDR A;  4E3I A;  5L2F A;  2UWX A;  4MN5 A;  1TD5 A;  2V2F F;  4OQG A;  4N9L A;  2Z2M B;  3HVF A;  4MCW A;  4UAA A;  5J8X A;  3LIE A;  4BWI A;  1FIK A;  2ZQD A;  4PAU A;  2EFX A;  5J3W A;  3P09 A;  1XJ6 A;  1IYQ A;  3BYD A;  3GRJ A;  3D9Y A;  3BM6 A;  1IKI A;  1F2K A;  1PWD A;  3WS2 A;  3ZG9 B;  3HLE A;  1OTD A;  2OOL A;  3FG8 A;  2Y59 A;  2ZMF A;  1K4F A;  3KYZ A;  1T1B A;  3FYZ A;  2DNS A;  4JF6 A;  5FQ9 A;  2ZD8 A; 
#chains in the Genus database with same CATH homology
 3FC7 A;  4NKP A;  2I9V A;  2P04 A;  2P7J A;  1DRM A;  3B33 A;  5HDS A;  3C2W A;  4IUK A;  3H7W A;  5HD3 A;  1STZ A;  5TJJ A;  1S1Z A;  2W3F A;  4Q0I A;  2YKH A;  1W63 M;  4WL9 A;  4MMN A;  2GZA A;  3IBJ A;  2IA2 A;  3RFB A;  3F1O A;  3LR0 A;  4Z1W A;  3FPW A;  5DKK A;  3PR6 A;  4EEU A;  3T4L A;  1P97 A;  1GSX A;  3B47 A;  2PD7 A;  2W3D A;  4NXE A;  2FH5 A;  2YKF A;  3KO6 A;  3HJK A;  1UWN X;  4KQD A;  2VGL S;  2W27 A;  4BBV A;  2QKP A;  2QJ7 A;  2WKR A;  1GSV A;  3V67 A;  5G4Y A;  2JKT M;  2P08 A;  4I3A A;  2HJE A;  1S4S A;  3JVV A;  4WEK A;  2ZOH A;  3EEA A;  3A0V A;  3D72 A;  1YAX A;  5HSQ A;  4CQH A;  3RTY A;  3A0R A;  3MQO A;  4L0L A;  1V9Z A;  4ME4 A;  4LLO B;  2QHK A;  4PKY G;  3EEH A;  4YNR A;  3PYP A;  4YOF A;  4EET B;  4EQ1 A;  2M1C A;  4HJ4 A;  5DFY A;  4CLC E;  3JVU A;  2HGV A;  2O9B A;  5F68 A;  5LBR A;  2K2N A;  1ODV A;  3S7O A;  4HJ6 A;  3CAX A;  2EA9 A;  2Y79 A;  2OAQ 1;  2EWV A;  2K7S A;  4KUO A;  2L0W A;  4O0P A;  2O99 A;  3LI8 A;  2PR6 A;  3LR3 A;  1T18 A;  1OJG A;  2V0U A;  4LPZ A;  3LIA A;  3MMH A;  2NUP C;  2L4R A;  1OPX A;  4M4X A;  4NXF A;  1JNU A;  2NUT C;  4F3L B;  3IBR A;  4O8G A;  4G3K A;  3R7W B;  3S7N A;  5HPI A;  2JKT I;  1T19 A;  3NOT C;  5AVF A;  4LRX C;  5DJT A;  1S66 L;  3P7N A;  3LR4 A;  4GHI A;  3MFX A;  2J3T C;  2VV6 A;  2VLG A;  4Y3I A;  3TJZ C;  4HP9 A;  3EQV A;  1UGU A;  5DFX A;  2GJ3 A;  1YSP A;  2W3G A;  2W1T B;  3ICY A;  1LSW A;  4GCZ A;  3UB7 A;  1P9W A;  3CIT A;  4WF0 A;  5F69 A;  1YSQ A;  2KDK A;  3UE6 A;  3UME A;  1P9R A;  3UB6 A;  2ZMV A;  5F5Y A;  3LUQ A;  3EOI A;  2ZOI A;  4BBT A;  3PBQ A;  1NLY A;  4YWZ A;  2BAS A;  1GSW A;  4E04 A;  1IOU A;  3ZQ5 A;  3PBO A;  3OCN A;  3KSF A;  2PT7 A;  4DN0 A;  3E4O A;  4LRY C;  3T4Q A;  4KQO A;  4RQ9 A;  4KUK A;  2XSS A;  3LIC A;  5TBM A;  3OCL A;  2A24 B;  3CUE C;  2D01 A;  1NWZ A;  3OOV A;  4CLC C;  3LFV A;  1MC0 A;  2HV1 A;  2WKQ A;  3CUE A;  2V0W A;  1OTA A;  4FOF A;  4EER A;  2K31 A;  3F1P A;  4CLC A;  1LSV A;  4UQI M;  4BJP A;  5G4Z A;  5HZH A;  5MC7 A;  1H3Q A;  4I39 A;  4I3J A;  4WLA A;  4HP4 A;  2W3H A;  4HQA A;  4EES A;  2L1M A;  3B42 A;  3E4Q A;  1UWP X;  1D06 A;  4GS9 B;  1S4R A;  5EFW A;  4WN5 A;  4FSF A;  3OBF A;  3NHQ A;  3PBR A;  4QPR A;  4P6Z M;  3VE4 A;  3BY8 A;  2XRO A;  1LSX A;  3MQQ A;  5L8M A;  3EWK A;  2FZ0 A;  2PYP A;  2QWS A;  3H7W B;  4JGR A;  3K2N A;  4MN6 A;  3OLO A;  5IU1 A;  4XT2 A;  3BY9 A;  3DBA A;  2VJW A;  4ARZ A;  1S67 L;  2JKR M;  3MF0 A;  2MJ6 A;  2M7U A;  3W2Z A;  2D02 A;  3F1O B;  3G6O A;  3P01 A;  4IJG A;  3S7P A;  4O01 A;  3K3D A;  1F98 A;  2OWH A;  2PR5 A;  5C5K A;  4I5S A;  1LT0 A;  5KIZ A;  3GDI A;  1NLZ A;  2PYR A;  1X0O A;  5HDC A;  3BQ8 A;  3H82 A;  4ZRR A;  5HDD A;  3EQU A;  5IT5 A;  4WEJ A;  2V9A A;  5K5B A;  3RH8 B;  5AVE A;  3CI6 A;  5F6A A;  1MKM A;  2GNX A;  3GEC A;  3C30 A;  3T4O A;  2XA7 S;  2GX5 A;  4JGQ A;  5DJU A;  4R70 A;  3PHY A;  4ETX A;  3MJQ A;  3T4T A;  2CMN A;  4BMW A;  2VZW A;  3E0Y A;  3FPV A;  3VE3 A;  4AFI A;  1TS6 A;  3F1N A;  2VX8 A;  4LRZ E;  2VGL M;  4H6J A;  2R78 A;  1W63 Q;  2PDR A;  1XFN A;  5A8B A;  3E4P A;  2VKS A;  2JN7 A;  1XJ2 A;  5HWT A;  4HJ3 A;  3BW6 A;  2LB5 A;  1T1C A;  3LI9 A;  3NOP C;  3SW1 A;  1LL8 A;  1KOU A;  1NRJ A;  2H28 A;  3A0S A;  2JHE A;  2WKP A;  3OC2 A;  2VV8 A;  5HPF A;  2G7U A;  3K3C A;  3PBN A;  2V1B A;  2JKR I;  4B93 A;  4L9G A;  2DMW A;  4HNB A;  3LR5 A;  2QJ5 A;  2OWJ A;  1G6O A;  1ZHH B;  4IUH A;  4WUJ A;  1BYW A;  2LB9 A;  4HY8 A;  2HF6 A;  4DJ2 A;  3LIF A;  1MZU A;  4EXO A;  2VA0 A;  4PKY A;  3F1N B;  3LYX A;  3D3O A;  3PBS A;  4CLC D;  4DJ3 A;  1F5M A;  2O9C A;  1F9I A;  1TF1 A;  5AJG A;  4WEL A;  5HWW A;  4GLQ A;  5I5L A;  1DP8 A;  3ZYT A;  4OOM A;  4GHI B;  4MN7 A;  4R6L A;  1DP6 A;  2J3W A;  4GJ4 A;  4Y5F A;  3KSI A;  2V1A A;  4HIA A;  2B18 A;  4JGP A;  3UE3 A;  5HL6 A;  4NEE D;  4K08 A;  3PXP A;  3TE8 A;  5HWV A;  1D7E A;  3HJI A;  2Z6D A;  2XRN A;  2KX6 A;  5J7E A;  3ULF A;  2B02 A;  4MDZ A;  3LIB A;  4I3I A;  1IFQ A;  1VB6 A;  1EW0 A;  2W0N A;  4Q0H A;  1TS8 A;  3KSH A;  4G3V A;  5KSH A;  4R3A A;  2W1R A;  4HH2 A;  3KSG A;  2HJ9 C;  1WA9 A;  3H9W A;  3UB9 A;  4NXG A;  1VHM A;  3BWL A;  4II7 A;  3T4J A;  2PHY A;  4L9E A;  2M7V A;  4HH3 A;  5TBM B;  2INW A;  2O0Y A;  1YKD A;  2Z6C A;  4I38 A;  4CLC B;  3F1P B;  2VV7 A;  2EWW A;  1DP9 A;  3T50 A;  3VV4 A;  2VEA A;  3T4S A;  3NJA A;  3HCY A;  5J4E A;  4EU0 A;  4NXB A;  5FL3 A;  4F3L A;  1N9N A;  4Q0J A;  1V9Y A;  3UMD A;  3MQ0 A;  2QYB A;  4Y2F A;  3MXQ A;  3BQA A;  3KX0 X;  3R7W A;  5CX7 A;  3CLO A;  3BJN A;  1XFQ A;  3NOU C;  4HHD A;  3T4K A;  4XT2 B;  4OOL A;  1H8M A;  4ARZ B;  3EGX C;  3PBT A;  1OTB A;  5DF9 A;  2J3T D;  1S1Y A;  4R38 A;  1N9O A;  3MR0 A;  2PD8 A;  1XJ3 A;  3R4K A;  4G3W A;  2W3E A;  5IS1 A;  3E98 A;  3U2A A;  4EUV A;  3IS2 A;  3TW8 A;  3S7Q A;  1N9L A;  2W1T A;  3VOL A;  2KLI A;  3H82 B;  4MN5 A;  2OAP 1;  1TD5 A;  2ZBB A;  1XJ4 A;  2Y8H A;  1OJ5 A;  4L9F A;  4PHT A;  3TRC A;  3LID A;  4UQI S;  3KYQ A;  3O5Y A;  4HI4 A;  4MCW A;  3EGD C;  1OTE A;  4GW9 A;  4BBU A;  4UEY A;  3LIE A;  1OT9 A;  4BWI A;  4ETZ A;  4IHQ A;  1G28 A;  4PAU A;  5J3W A;  4B9O A;  1TS7 A;  1XJ6 A;  2A24 A;  4HOI A;  4EEP A;  4DMZ A;  4H6J B;  4JGO A;  1Y28 A;  1P0Z A;  4P6Z S;  1OTI A;  5DKL A;  2KOI A;  3C38 A;  2O9A A;  1OTD A;  2OOL A;  1TS0 A;  3FG8 A;  3IS2 B;  2ZMF A;  2J80 A;  1T1A A;  2XA7 M;  3KYZ A;  1T1B A;  4EW7 A;  5HD5 A;  1ZTU A;  3C8C A;  2A2L A;  3UB8 A;  3CWF A;  1OT6 A;  4GS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...