3CUEC

Crystal structure of a trapp subassembly activating the rab ypt1p
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
156
structure length
143
Chain Sequence
MGIYSFWIFDRHCNCIFDREWKQNEEDAKLLYGMIFSLRSITQKLSKGSVKNDIRSISTGKYRVHTYCTASGLWFVLLSDFKQQSYTQVLQYIYSHIYVKYVSNNLLSPYDFAENENEMRGQGTRKITNRNFISVLESFLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Transport protein particle 23 kDa subunit
publication title The structural basis for activation of the Rab Ypt1p by the TRAPP membrane-tethering complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 27
structure length 143
sequence length 156
chains with identical sequence I, O, U
ec nomenclature
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04099 Sybindin Sybindin-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.70 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3cueC00
2J3WA 2ZMVA 3CUEC 3PR6A 2J3TD 2J3TC 1H3QA 3CUEA
chains in the Genus database with same CATH superfamily
2XRNA 3UB5P 5CTMA 1YLWA 4OQ0A 3O86A 2VKSA 3A3IA 2PYPA 2OWJA 2J9PA 1VB6A 3PTEA 3VOLA 4DE3A 4BMWA 3ZYTA 3GECA 3MKFA 1XKZA 1JNUA 4GJ4A 3T4OA 4IEDA 2ZD8A 1NLZA 3IXBA 5FQKA 3OLOA 4Y5FA 1MZUA 2OV5A 4LV1A 3HLFA 5A93A 1GCEA 3BM6A 3W8KA 1FSWA 4PAUA 5AVFA 2XQZA 4JGPA 2V8CA 3N7WA 3FPWA 4HP4A 3N6IA 3GTCA 4HNBA 1M40A 3NECA 4GHIA 1IYOA 1NJ4A 2PDRA 1IYSA 2R9WA 2JBFA 4GNUA 2Q9NA 1KGGA 1NLYA 2PBYA 3VP0A 3CG5A 3FWLA 1PYYA 3G6OA 1BLHA 3V3RA 5EM1A 3BFGA 3IHAA 3KSFA 4OPQA 2W1TA 5L07A 4EW7A 3UO9A 2W3HA 3GVBA 1CK3A 1G6OA 3C4PA 3G32A 4G3VA 1IOUA 2KDKA 1K54A 2M7UA 3Q07A 5EFWA 4JXGA 1K56A 1D06A 3LIEA 4CLCC 4FH2A 4JPMA 3EGXC 3GMWA 5HAIA 5HDSA 4GS9B 2GJ3A 5E2GA 2WKHA 5DFXA 1NY0A 3GRJA 1ZG6A 4I5SA 4IVIA 2NUPC 3A3DA 3OZHA 2OAQ1 4Y0OA 5AJGA 3SH9A 3ZCZA 3HLWA 4MMNA 4ZJ1A 3MZEA 5F5YA 1STZA 1FOFA 5EOEA 3HLBA 3S7PA 4DE0A 4GN2A 2EXBA 4X25A 3CPTA 1H8YA 3WRZA 1ODVA 4DRTA 1T1AA 4EQ1A 4YFMA 2H5SA 4LV2A 5DTTA 1N9NA 3ZGAB 1S67L 1XX2A 3C7VA 3PHYA 4QD4A 5GLBA 1D7EA 5EVID 3KSHA 1S66L 4HH2A 3OC2A 4I3IA 4S2KA 4ARZB 1V9ZA 5CERA 2DRWA 3IH8A 5A90A 4S2LA 1XJ6A 1N9BA 1IYPA 4II7A 5J3WA 3NY4A 2O9CA 3BQ8A 4WM9A 1KE4A 1BLSA 2VGKA 4G3KA 4KG6A 5F69A 2ZQ9A 5FAQA 3I7JA 1DY6A 3NDEA 4DDSA 4S2MA 4Y3IA 2Y79A 3ZG7B 3PBRA 5E2EA 4ZBEA 2G2UA 3F1NA 2PRFA 3TOIA 3WWXA 2WAFA 4EBPA 3UB6A 4X55A 4L9GA 5MC7A 2HDRA 5GLCA 3SH7A 3S7QA 3IHBA 3OPHA 5A8BA 5JYOA 1UWPX 4X56A 4K08A 3BFFA 1QMEA 3IF6A 5DTKA 2W3EA 4NXEA 3BECA 2Y2KA 1K57A 4IVKA 1KVLA 3BFDA 4GB7A 4JF5A 3IWIA 3JPUA 1PIOA 4GW9A 3E0YA 3DBAA 4RVAA 1XXMA 2D01A 3T12B 3KO6A 3QP8A 1E25A 3G31A 1YKDA 4KENB 2OWHA 3IBJA 1K54C 4NEED 1XFQA 2G7UA 3NHQA 2J3WA 1GSWA 2VX8A 3DWKA 1A0KA 1GHMA 3VOYA 3BFCA 2B02A 3LICA 4NG2A 3OBFA 3W4OA 2EX8A 1G6AA 1JWVA 4DKIA 1KDSA 1VM1A 2P7JA 3OPRA 1ES4A 4ZTKA 3KX0X 1LSWA 2W1TB 4ZDXA 2WYXA 2WKQA 5BOHA 3OCLA 3MQOA 5AQAA 5DJUA 1SKOB 1OTIA 2WUQA 2ZBBA 2WK0A 4Q0IA 4WZ5A 3AGDA 3KYEA 3IBRA 1IFQA 4K0XA 4IUKA 3FG8A 1F9IA 3LGOA 4PM8A 2M7VA 1PZOA 4OQGA 4R38A 1LI0A 1GHIA 1TS7A 4OKPA 1YPRA 4XUXA 2HPBA 3WS5A 1G5UA 4A5RA 4IJGA 2P9VA 1BLCA 1VETB 4O01A 2INWA 2R78A 2ZQCA 3RJUA 2LB5A 1LL5A 3NBLA 4XT2A 2KOIA 3IXGA 1K38A 1DJAA 3V67A 2XK1A 1YMSA 2JKRI 1DJCA 3TRCA 4S2NA 5AVEA 1BTLA 4JXVA 3U2AA 4I3JA 1OTBA 2JN7A 1XJ2A 1C3BA 5CEBA 3W2ZA 4PM6A 4NKPA 1P9RA 3T4JA 2YKFA 3Q82A 3NOPC 3OPPA 4X6TA 2Z6DA 4EERA 3MQ0A 3KSIA 4OPZA 4KG5A 2FFYA 3VP3A 1BULA 3G35A 5HWWA 2XD1A 3LY4A 4WZ4A 2J9OA 3IF6C 5AQ9A 2Y59A 3HUMA 4KZAA 5IT5A 1K57C 4WUJA 1JTGA 1FCNA 4BD1A 2QPNA 4GS9A 4WL9A 1H8MA 1PFLA 2VLGA 3PBQA 1VEUB 1RGYA 1Q2QA 5I94A 5L8MA 2ZLYA 4M4XA 4S2IA 4GZBA 4D2OA 4R3JA 5GHYA 2JCHA 2WADA 1RP5A 4P6ZM 3PAGA 3H7WA 1ALQA 4B9OA 1DP8A 1TDLA 1MWSA 1L2SA 4WMCA 3LR3A 4P87A 1FIKA 1K4EA 4U3TA 5E2HA 4FCFA 1YLPA 4GOGA 4N1HA 3RH8B 5E2FA 5HPFA 2ZQ8A 4MCWA 2GX5A 4LGWA 4GKUA 3HUNA 1S1ZA 4R4SA 5FI7A 1TD5A 1YAXA 4UHUA 2NUTC 3RTYA 3UPPA 3S22A 4ARZA 1E4DA 3M2JA 1LT0A 5E43A 2DMWA 5A91A 3IF5A 2HJEA 2ZQDA 3MXSA 3NC8A 1OPXA 3BY8A 4X68A 5HL6A 4B4XA 1LLBA 3S4XA 4P0MA 4R70A 5DKKA 5FDSA 4QY5A 3LEQA 2YKHA 1K4FA 4Y2FA 2JHEA 4HJ6A 4EEUA 4GCZA 2J3TD 5K5BA 3UMEA 3IWQA 4L0LA 5EVIB 1BYWA 2JKGA 4CJNA 2IWDA 1PWDA 4EEPA 2FZ0A 3ZVTA 3SS5A 4AFIA 3O87A 3B42A 2ZQ7A 4Y15A 4KZ7A 3WS0A 1KE3A 1ESIA 2KLIA 4S2OA 2GNXA 4KZ9A 4IUHA 1UGUA 1DJBA 5FAPA 4BBVA 4S2NC 3LY3A 2JKTM 1FSYA 4R0QA 5AQBA 1JWPA 3A3FA 1Z09A 3M6BA 4OPRA 2HDSA 5GHZA 2ZJ9A 5FATA 3IX3A 5HWVA 2VV7A 3M6HA 1LHYA 1HVBA 3G2YA 2PYRA 5FEGA 3PBNA 4N9KA 2P9VB 1WA9A 4QHCA 3LI8A 3NOTC 4EXOA 1KGFA 3W4PA 1E3UD 3UB8A 4OH0A 2Z2MB 3MQQA 3NI9A 2EFXA 4GDBA 3ZHHA 3TG9A 4XT2B 4P6BA 1Q2PA 1K0KA 4EQIA 1UWNX 1T18A 2QYBA 3C5AA 4IBRA 2EWVA 3S1YA 3IX8A 2VA0A 4MLLA 1DP6A 5FQ9A 4Y13A 3E4QA 4HBTA 2FH5A 4F94A 3G34A 5CGSA 1SKOA 2XSSA 3MFDA 3EQUA 4Q0HA 2HJ9C 4R1GA 3BQAA 3R4KA 3BRMA 3UNWA 3BW6A 4Q0JA 5KSHA 3P09A 2H28A 4ZJ3A 3LIFA 3NDGA 3AGEA 3OCNA 4E3OA 4UA9A 2EWWA 1VETA 4CLCE 3VSLA 1PW8A 4WEKA 4U0TA 4ETZA 3CHWP 1SKFA 3MKEA 3PBTA 4UA6A 1NWZA 4BL3A 3H7WB 2IA2A 1S1YA 2H0YA 1K55A 2PHYA 2RCXA 1MC0A 4HJ4A 2WKEA 4HH3A 1Z6FA 1CI9A 4ZAMA 5M1AA 2CC1A 1MWRA 4JGQA 4EV4A 5HFOA 3HLGA 4Y0TA 5FQJA 1TS0A 3VMAA 1EROA 1PNEA 4UA7A 2ZM8A 4OOYA 1T19A 5DF9A 5FQMA 1U60A 1JVJA 2W3FA 3QNCA 3LUQA 5CHJA 2J7VA 4RX3A 2PR5A 4BENA 4BL2A 1ES2A 3NJAA 1XPBA 3IX4A 2ZQAA 1G28A 3EQVA 3VFHA 1FILA 4KZBA 3P01A 4OPYA 1IKIA 4U0XA 3RFBA 3E2KA 1VEUA 2Z2LB 5EPHA 2V2FF 4BQMA 3C38A 4EU0A 4H8RA 3CJMA 4UAAA 3ULFA 4O8GA 1LSXA 4NK3A 5TGFA 1G68A 2WGVA 3F1PA 1MPLA 2PU4A 4MDZA 2EX6A 4KQQA 3K3DA 3UB7A 3HLEA 2WAEA 1HLUP 4BD0A 2VV6A 3T4KA 4EETB 3S7NA 1F2KA 4HQAA 3JVUA 2W0NA 2Q0OA 5DKLA 2Y91A 1XJ3A 5J8XA 4QPRA 3GSGA 4LRYC 4X53A 4E3IA 1OJ5A 3QP2A 5HL1A 4DXBA 2ZC3B 1FCOA 2WZXA 4FSFA 3HL9A 4NXFA 3DTEA 2GZAA 3QNBA 1MBLA 4QJGA 4HBUA 1OT9A 1H3QA 2HF6A 1ONGA 3UY6A 2O0YA 2WKPA 1SCWA 2QJ7A 4FTXA 4MBHA 1OT6A 1W8YA 3V5MA 1SDNA 5DTSA 1GA9A 3ZVWA 5DF7A 2QKPA 4I38A 4IBXA 2V9AA 3PBOA 3GQZA 2ZOIA 3A0VA 1TF1A 3DTIA 4HI4A 3UE3A 2ZM0A 1XA7A 4JGOA 1S4RA 3N4IA 1QMFA 3CLOA 4KUKA 4MNRA 3T1SA 4PKYA 5EVIA 5HWTA 2XROA 5DFYA 3C8CA 1ESUA 2AVXA 2IWCA 2W1RA 4JGRA 4R23A 3IXDA 4OLDA 5FQIA 1GA0A 3ZQ5A 3BWLA 1YSPA 3IS2B 5F68A 4YOFA 2EFUA 3KYZA 4O7DA 5FDHA 2ZMFA 1W5DA 3MMHA 3UE0A 4S2PA 1K6SA 3VSKA 1EWZA 1ES3A 3T4SA 3VV4A 5TFQA 4KZ5A 4EUZA 4KZ8A 2XA7S 3ICYA 3UDXA 5KIZA 5G4YA 4OP8A 2ZL1B 4QB8A 1ZKJA 2VGJA 4BBUA 2O9BA 5EECA 5C5KA 3VE4A 3C7UA 3H9WA 1FR1A 1TDGA 4E6WA 5CXWA 4Z1WA 4ZJ2A 2B95A 4DF6A 5CTNA 2QJ5A 2FFFB 3IT9A 3LR5A 5LBRA 1W63M 4RA7A 3C2WA 2V1BA 5EE8A 3BEBA 3GR2A 3H82B 4PPRA 1BT5A 4DN0A 4CLCD 4OONA 2JKFA 3LEZA 2ZC4B 2GDNA 3VE3A 2HP5A 5U47A 3DAVA 4R3BA 2ZMVA 2WGWA 2W27A 4JLFA 1OMEA 1CJFA 5IU1A 2V1AA 2UWXA 4OOMA 3FYZA 3C30A 4KG2A 3BLMA 5FA7A 4O0PA 3VP2A 4PM9A 5EVEA 1W8QA 2JC7A 2RL3A 2Y2QA 2EX9A 1HTZA 3E2LA 1TEMA 3MFXA 4E04A 5HAPA 1ZTUA 1LL8A 1YLZA 2Y2LA 4FUWA 4MN6A 4HEFA 3T1RA 2XF3A 4NXBA 1OJGA 4UQIS 3T4QA 3ITBA 2ACGA 3FPVA 1IKGA 1YSQA 1YQSA 2C6WB 2Y8HA 4JF6A 1ZHHB 4ESPA 2Y2PA 5GLDA 3OOVA 1TVFA 1CQAA 4D60A 1P9WA 3B47A 1NRFA 1TS8A 2A24B 4R4RA 3NIAA 4Y17A 3F1PB 3N8RA 5F6AA 2WGIA 5EM0A 2L0WA 4HY8A 5F1GA 4KZ6A 4DMZA 3MZDA 4H6JB 1JWZA 1KOUA 2V1ZA 5EVIC 4YINA 4BLMA 4XXRA 1KGEA 3PBSA 1Y4OA 5CRFA 3A0RA 1CI8A 3EWKA 5KZHA 4PM7A 3T1XA 2OOLA 2BG1A 5M18A 5CEDA 2OSUA 1KE0A 3O3VA 1ACFA 3WRTA 4LLOB 4C3QA 3RXWA 4Y0UA 4HESA 3T4LA 4WZ5C 2X01A 3ZFZA 4Y7PA 2Y2GA 4C6YA 3HJKA 1SHVA 4HHDA 1F98A 5HAQA 4WEJA 4KZ4A 3QP5A 2VK3A 1PI4A 3UE6A 4HP9A 3L9KA 3ZG0A 2W3GA 1VHMA 3CUEA 3ZG9B 2XDMA 3FKWA 3Q7VB 1L0EA 1XA1A 4LV0A 4N1XA 1MKIA 1L0DA 1K56D 2W3DA 1L3LA 3K3CA 4FD8A 4RYEA 1XGIA 2QWSA 4GD8A 2BLSA 3SW1A 4M3KA 2V8FA 3R7WB 2CMNA 2WZZA 2BTFP 3RXXA 2OLVA 3QHYA 2XLNA 3F1OA 2OAP1 3U4LP 1L0GA 3T50A 3MS6A 4OVDA 3BLSA 1S0WA 4JXWA 4OQIA 4PMAA 1BUEA 4WF0A 1WYCA 3ZG8B 5FEFA 3FC7A 4B4ZA 3G30A 4I3AA 1OTEA 2Y4AA 4WN5A 2Y2JA 2Y55A 3Q81A 3VFFA 4HJ3A 2Y2NA 5EUAA 5TBMB 5HD3A 1P97A 1MWUA 3UDFA 1GHPA 1BZAA 2HDUA 4KZ3A 3IWOA 2D02A 3KSGA 3FV7A 4L9EA 1EI5A 3LFVA 4BBTA 3E4PA 4DXCA 3HJIA 3MF0A 2L4RA 3VOZA 1SDEA 3LIDA 5FSRA 2QMIA 4EBNA 2WGWB 4LRZE 1WE4A 3UPNA 5HD5A 3MSHA 2V20A 2Y2HA 4NETA 1I5QA 5EOOA 5IHVA 1JTDA 4EBLA 1VQQA 3HVFA 2H0TA 3ZDJA 2ZC5B 3IS2A 1H8ZA 4MBKA 2Y2IA 3BYDA 2Y2MA 4DJ3A 3UDIA 2X02A 2VGLS 3LR0A 1W63Q 2PT7A 5FI2A 4C75A 2B18A 5IS1A 5CX7A 5GHXA 2HGVA 3HLDA 3EGDC 2Q9MA 4DE2A 4OQHA 4GD6A 3T4TA 3TJZC 4B88A 1NXYA 2ZL1A 4JKTA 4OLGA 5DVAA 3K2NA 1YT4A 1YLYA 4WLAA 3JVVA 3N8LA 4HIAA 4EWFA 3LIAA 1BSGA 3NCKA 3PAEA 3WS1A 4NXGA 4LCLA 3G4PA 3UPOA 3Q1FA 3H82A 4ZRRA 3CWFA 5HDCA 3SH8A 5FI6A 3B3XA 4F3LB 1PI5A 1K25A 1NRJA 1J9MA 3LIBA 3OPLA 4WYYA 3V50A 4HOIA 1CEGA 5F83A 4LRXC 3V3SA 2O99A 3V39A 2VJWA 4Q8IA 4ME4A 1CF0A 1DRMA 5A92A 3A3JA 3HCYA 1NYMA 3LR4A 4KUOA 2HDQA 1BLPA 3WS2A 3EEAA 1XGJA 3CUEC 3D9YA 1V9YA 1KVMA 2I9VA 4QY6A 4EUVA 4E3JA 2A2LA 1E3UA 1ES5A 4N92A 2HP9A 4X1LA 1Y28A 4CQHA 3A3EA 4CLCB 4MEZA 1K6RA 2EXAA 2DNSA 4X69A 5HDDA 3M2KA 3SS3A 3D3OA 5AQ7A 2JKRM 5EV0A 2VGLM 5KMWA 4MN5A 1NZUA 3VP4A 1NYYA 3SS4A 3UE1A 5HZHA 2VV8A 2R9XA 2ZM2A 2C5WB 2HZ5A 3SZTA 4E3NA 2G2WA 1I2SA 5GL9A 5FAOA 4LFUA 2JKTI 3LCEA 4R6LA 5CHUA 1DP9A 2A24A 4BJPA 5CGWA 5L2FA 3NULA 2PBDP 1ERMA 2XH9A 2P74A 1PWGA 5HARA 2PD7A 2Z6CA 2ZC7A 3UN7A 1PZPA 4K0WA 5J4EA 4DJ2A 4H6JA 1WYBA 3B33A 2BASA 1ERQA 5D3OA 4RQ9A 1EW0A 3DTKA 3F1OB 3SOIA 1T1BA 3FZCA 3ITAA 2PD8A 1YMXA 2QZ6A 4S2JA 2MJ6A 2XEPA 3DW0A 2O9AA 3N8SA 3CAXA 4X1MA 2XR0A 4JXSA 1GSVA 3WS4A 5EVLA 2UV0E 1H5XA 2PAVP 5DF8A 5L09A 2J3TC 3LYXA 4L9FA 3PXPA 3IXHA 5L10A 3MJQA 3TSGA 3DWZA 1Y54A 2KX6A 4LCMA 5F1FA 3O5YA 1TS6A 5HPIA 5KSCA 1F5MA 4GHIB 4N9LA 3Q7VA 1W7FA 5HSQA 1N9LA 4ID4A 3TW8A 1RCJA 3CITA 3HBRA 1RGZA 2ZMAA 3QP4A 4UEYA 1K55C 1T1CA 1ZC2A 3DTMA 3R7WA 4KQDA 1I2WA 2L1MA 5TR7A 1O07A 4DDYA 1PRQA 2QHKA 2ZC6B 3G2ZA 3W4QA 1XP4A 3EEHA 4KQRA 5I5LA 3ZNYA 2K2NA 1KDWA 1CEFA 5CGXA 4E3LA 2OLUA 3O88A 3JYIA 4GLQA 3GV9A 4G3WA 4JBFA 1PWCA 4P6ZS 3UMDA 4WMCD 5TBMA 2DCFA 1M6KA 3CMZA 4Z9QA 1FR6A 4K91A 3P98A 2V0WA 2E8JA 4WELA 4DE1A 3ZG5A 2PU2A 3IQAA 2A3UA 1XJ4A 3C4OA 5CHMA 2XFTA 2PR6A 1HZOA 2WKRA 2EA9A 3P7NA 1MXOA 5FL3A 4WBGA 1NZOA 3GDIA 5HW3A 3HREA 3CI6A 5FASA 4R3AA 2H10A 4OOLA 2IWBA 4RX2A 1W79A 3MBZA 1PW1A 1GSXA 3ZNTA 3E4OA 1L0FA 3CPTB 2B5RA 3A0SA 1OTAA 4XUZA 4IHQA 3PYPA 2K7SA 4BWIA 2J80A 2E8IA 2VEAA 5F82A 3VP1A 2X71A 3HLCA 4MBFA 1YM1A 1O7EA 1FCMA 2WKIA 1P0ZA 1H0MA 2P04A 2XD5A 4YNRA 4OP5A 1IELA 4JF4A 3ISGA 4B93A 1N4OA 5G4ZA 3MR0A 3E98A 1MY8A 2XA7M 4MN7A 2HV1A 5CECA 3Q7ZA 4F3LA 4GDNA 1IEMA 4E6XA 1MKMA 4LV3A 1OTDA 3LI9A 1ONHA 1HD8A 1ZG4A 3EOIA 1FQGA 4ETXA 5M19A 4QWOA 5HX9A 3AGFA 3F1NB 5FQQA 2P08A 1LI9A 3PR6A 1S4SA 3QP1A 1XFNA 1AWIA 5G18A 2M1CA 3HUOA 2VZWA 1D1JA 4KQOA 2XGNA 3MXRA 1IYQA 3UB9A 3L7HA 3IH9A 4PHTA 1LL9A 3T1QB 3IF6B 2HP6A 3MXQA 5J7EA 4PKYG 4CLCA 3FKVA 1J3WA 2A49A 4FH4A 1S6RA 2EX2A 3QP6A 1LSVA 3BJNA 1YLTA 3S7OA 1MWTA 2XFSA 4YWZA 5DJTA 3TE8A 4QU3A 3NOUC 3LO7A 4EESA 2K31A 5GLAA 2LB9A 2J8YA 3D4FA 2Y2OA 2ZOHA 2I72A 4E3MA 5TJJA 3D72A 4LPZA 4E3KA 1N9OA 4I39A 5JYPA 1AXBA 4UQIM 4LENA 3CZDA 1YLJA 2JE5A 3MZFA 4CPKA 4FOFA 2V0UA 4PM5A 1SZVA 3KYQA 3BFEA 4P85A 1X0OA 3BY9A
chains in the Genus database with same CATH topology
2XRNA 1NRJA 4EERA 3LIBA 4HOIA 3MQ0A 3KSIA 4LRXC 2O99A 2QKPA 2VKSA 5HWWA 2VJWA 4I38A 2PYPA 2V9AA 2OWJA 1VB6A 3PBOA 4ME4A 2ZOIA 3A0VA 3VOLA 1TF1A 4HI4A 1DRMA 3UE3A 5IT5A 3HCYA 3LR4A 3ZYTA 4KUOA 4BMWA 3GECA 4JGOA 4WUJA 3EEAA 1S4RA 4GS9A 4WL9A 4KUKA 3CLOA 1H8MA 2VLGA 4PKYA 3CUEC 5HWTA 2XROA 3PBQA 5DFYA 1V9YA 3C8CA 1JNUA 4GJ4A 2I9VA 4EUVA 3T4OA 2A2LA 2W1RA 5L8MA 4JGRA 1Y28A 4M4XA 4CQHA 3ZQ5A 1NLZA 3BWLA 1YSPA 4CLCB 3OLOA 4Y5FA 1MZUA 3IS2B 5F68A 4YOFA 4P6ZM 3KYZA 3H7WA 2ZMFA 3MMHA 4B9OA 5HDDA 1DP8A 3D3OA 4PAUA 3T4SA 5AVFA 3VV4A 2JKRM 4JGPA 3FPWA 4HP4A 3LR3A 2XA7S 3ICYA 2VGLM 5KIZA 5G4YA 4HNBA 4MN5A 4GHIA 5HZHA 2VV8A 2PDRA 3RH8B 4BBUA 2O9BA 3VE4A 5C5KA 2JKTI 3H9WA 4R6LA 4Z1WA 5HPFA 1NLYA 4MCWA 2GX5A 1DP9A 2A24A 4BJPA 2QJ5A 3LR5A 3G6OA 1S1ZA 5LBRA 1W63M 1TD5A 1YAXA 3C2WA 2V1BA 3KSFA 2NUTC 3RTYA 4ARZA 2W1TA 3H82B 1LT0A 2PD7A 2Z6CA 4EW7A 2W3HA 4DN0A 2DMWA 4CLCD 5J4EA 4DJ2A 1G6OA 2HJEA 4H6JA 3VE3A 1OPXA 3BY8A 3B33A 4G3VA 2BASA 1IOUA 2KDKA 5HL6A 2M7UA 4RQ9A 2ZMVA 1EW0A 3F1OB 2W27A 1T1BA 5EFWA 4R70A 5DKKA 5IU1A 1D06A 2V1AA 3LIEA 4CLCC 2PD8A 2YKHA 4OOMA 4Y2FA 3EGXC 2JHEA 3C30A 4HJ6A 5HDSA 2MJ6A 4EEUA 4O0PA 4GCZA 2J3TD 4GS9B 5K5BA 2O9AA 2GJ3A 3UMEA 4L0LA 1BYWA 3CAXA 4EEPA 2FZ0A 5DFXA 4AFIA 1GSVA 4I5SA 2NUPC 3B42A 2OAQ1 5AJGA 3MFXA 4E04A 1ZTUA 2J3TC 3LYXA 4MMNA 1LL8A 4L9FA 3PXPA 5F5YA 1STZA 4MN6A 2GNXA 3MJQA 4NXBA 4IUHA 1OJGA 1UGUA 4UQIS 3T4QA 3S7PA 4BBVA 2KX6A 1ODVA 3O5YA 3FPVA 2JKTM 1TS6A 5HPIA 1YSQA 1T1AA 1F5MA 2Y8HA 4GHIB 1ZHHB 4EQ1A 5HSQA 1N9LA 3TW8A 5HWVA 2VV7A 3OOVA 3CITA 1N9NA 4UEYA 1P9WA 2PYRA 1T1CA 1S67L 3PBNA 1WA9A 3B47A 3PHYA 1TS8A 2A24B 1D7EA 3LI8A 3NOTC 3R7WA 4EXOA 4KQDA 2L1MA 3KSHA 3F1PB 1S66L 4HH2A 3OC2A 4I3IA 5F6AA 3UB8A 2L0WA 4ARZB 2QHKA 4HY8A 1V9ZA 3MQQA 3EEHA 4XT2B 5I5LA 4DMZA 2K2NA 4H6JB 1KOUA 1UWNX 1T18A 1XJ6A 2QYBA 4II7A 2EWVA 5J3WA 2O9CA 3BQ8A 4GLQA 4G3WA 2VA0A 3PBSA 1DP6A 3A0RA 3EWKA 2OOLA 4G3KA 4P6ZS 3UMDA 5F69A 5TBMA 3E4QA 4LLOB 2FH5A 4Y3IA 2V0WA 2Y79A 4WELA 3PBRA 1XJ4A 3T4LA 2PR6A 2WKRA 2XSSA 3F1NA 2EA9A 3P7NA 3UB6A 3HJKA 5MC7A 4L9GA 5FL3A 3EQUA 4Q0HA 2HJ9C 4HHDA 3BQAA 1F98A 3GDIA 3CI6A 3R4KA 4WEJA 3S7QA 4R3AA 5A8BA 4OOLA 3BW6A 1UWPX 4Q0JA 4K08A 5KSHA 2W3EA 4NXEA 2H28A 3UE6A 4HP9A 1GSXA 3E4OA 3LIFA 2W3GA 3OCNA 3A0SA 1OTAA 1VHMA 4IHQA 2EWWA 3PYPA 2K7SA 3CUEA 4BWIA 4CLCE 4GW9A 2J80A 3E0YA 3DBAA 4WEKA 4ETZA 2VEAA 2D01A 3KO6A 3PBTA 2W3DA 1NWZA 3K3CA 1YKDA 3H7WB 2IA2A 2QWSA 1S1YA 3SW1A 2PHYA 2OWHA 3IBJA 1P0ZA 1MC0A 3R7WB 4HJ4A 2P04A 4HH3A 4NEED 2CMNA 1XFQA 2G7UA 3NHQA 2J3WA 4YNRA 4JGQA 1GSWA 3F1OA 2OAP1 2VX8A 3T50A 4B93A 5G4ZA 3MR0A 2B02A 3LICA 1TS0A 3E98A 4WF0A 2XA7M 4MN7A 2HV1A 3OBFA 1T19A 5DF9A 2W3FA 3FC7A 4F3LA 4I3AA 1OTEA 3LUQA 4WN5A 1MKMA 1OTDA 3LI9A 4HJ3A 2P7JA 5TBMB 5HD3A 1P97A 3KX0X 2PR5A 3EOIA 1LSWA 2W1TB 3NJAA 4ETXA 2WKQA 3OCLA 3MQOA 5DJUA 1G28A 2D02A 3KSGA 4L9EA 1OTIA 3EQVA 2ZBBA 3LFVA 4BBTA 3E4PA 3F1NB 4Q0IA 2P08A 3HJIA 3MF0A 2L4RA 3P01A 3PR6A 1S4SA 3LIDA 3IBRA 1XFNA 1IFQA 3RFBA 4IUKA 2M1CA 2VZWA 4LRZE 4KQOA 3FG8A 5HD5A 1F9IA 3UB9A 2M7VA 4PHTA 4R38A 3C38A 4EU0A 3MXQA 1TS7A 5J7EA 4PKYG 4CLCA 3IS2A 4IJGA 4DJ3A 1LSVA 3BJNA 3ULFA 4O8GA 1LSXA 2VGLS 3S7OA 4O01A 2INWA 1W63Q 3LR0A 3F1PA 2PT7A 2R78A 4MDZA 2B18A 5IS1A 4YWZA 5CX7A 5DJTA 3TE8A 2HGVA 2LB5A 3EGDC 3K3DA 4XT2A 3UB7A 2KOIA 3NOUC 4EESA 3T4TA 3TJZC 2K31A 3V67A 2VV6A 2JKRI 3T4KA 2LB9A 3S7NA 4EETB 3K2NA 4HQAA 3JVUA 2W0NA 5DKLA 2ZOHA 4WLAA 1XJ3A 3JVVA 4HIAA 4QPRA 5TJJA 3TRCA 4LRYC 3D72A 3LIAA 4LPZA 1N9OA 1OJ5A 4I39A 5AVEA 4UQIM 3U2AA 4I3JA 4FSFA 1OTBA 2JN7A 4NXGA 1XJ2A 4NXFA 2GZAA 3W2ZA 1OT9A 1H3QA 2HF6A 4NKPA 1P9RA 3H82A 4FOFA 3CWFA 4ZRRA 5HDCA 3T4JA 2YKFA 2O0YA 2V0UA 2WKPA 3NOPC 4F3LB 2QJ7A 2Z6DA 3KYQA 2KLIA 1OT6A 1X0OA 3BY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J3W A;  2ZMV A;  3CUE C;  3PR6 A;  2J3T D;  2J3T C;  1H3Q A;  3CUE A; 
#chains in the Genus database with same CATH topology
 2XRN A;  3UB5 P;  5CTM A;  1YLW A;  4OQ0 A;  3O86 A;  2VKS A;  3A3I A;  2PYP A;  2OWJ A;  2J9P A;  1VB6 A;  3PTE A;  3VOL A;  4DE3 A;  4BMW A;  3ZYT A;  3GEC A;  3MKF A;  1XKZ A;  1JNU A;  4GJ4 A;  3T4O A;  4IED A;  2ZD8 A;  1NLZ A;  3IXB A;  5FQK A;  3OLO A;  4Y5F A;  1MZU A;  2OV5 A;  4LV1 A;  3HLF A;  5A93 A;  1GCE A;  3BM6 A;  3W8K A;  1FSW A;  4PAU A;  5AVF A;  2XQZ A;  4JGP A;  2V8C A;  3N7W A;  3FPW A;  4HP4 A;  3N6I A;  3GTC A;  4HNB A;  1M40 A;  3NEC A;  4GHI A;  1IYO A;  1NJ4 A;  2PDR A;  1IYS A;  2R9W A;  2JBF A;  4GNU A;  2Q9N A;  1KGG A;  1NLY A;  2PBY A;  3VP0 A;  3CG5 A;  3FWL A;  1PYY A;  3G6O A;  1BLH A;  3V3R A;  5EM1 A;  3BFG A;  3IHA A;  3KSF A;  4OPQ A;  2W1T A;  5L07 A;  4EW7 A;  3UO9 A;  2W3H A;  3GVB A;  1CK3 A;  1G6O A;  3C4P A;  3G32 A;  4G3V A;  1IOU A;  2KDK A;  1K54 A;  2M7U A;  3Q07 A;  5EFW A;  4JXG A;  1K56 A;  1D06 A;  3LIE A;  4CLC C;  4FH2 A;  4JPM A;  3EGX C;  3GMW A;  5HAI A;  5HDS A;  4GS9 B;  2GJ3 A;  5E2G A;  2WKH A;  5DFX A;  1NY0 A;  3GRJ A;  1ZG6 A;  4I5S A;  4IVI A;  2NUP C;  3A3D A;  3OZH A;  2OAQ 1;  4Y0O A;  5AJG A;  3SH9 A;  3ZCZ A;  3HLW A;  4MMN A;  4ZJ1 A;  3MZE A;  5F5Y A;  1STZ A;  1FOF A;  5EOE A;  3HLB A;  3S7P A;  4DE0 A;  4GN2 A;  2EXB A;  4X25 A;  3CPT A;  1H8Y A;  3WRZ A;  1ODV A;  4DRT A;  1T1A A;  4EQ1 A;  4YFM A;  2H5S A;  4LV2 A;  5DTT A;  1N9N A;  3ZGA B;  1S67 L;  1XX2 A;  3C7V A;  3PHY A;  4QD4 A;  5GLB A;  1D7E A;  5EVI D;  3KSH A;  1S66 L;  4HH2 A;  3OC2 A;  4I3I A;  4S2K A;  4ARZ B;  1V9Z A;  5CER A;  2DRW A;  3IH8 A;  5A90 A;  4S2L A;  1XJ6 A;  1N9B A;  1IYP A;  4II7 A;  5J3W A;  3NY4 A;  2O9C A;  3BQ8 A;  4WM9 A;  1KE4 A;  1BLS A;  2VGK A;  4G3K A;  4KG6 A;  5F69 A;  2ZQ9 A;  5FAQ A;  3I7J A;  1DY6 A;  3NDE A;  4DDS A;  4S2M A;  4Y3I A;  2Y79 A;  3ZG7 B;  3PBR A;  5E2E A;  4ZBE A;  2G2U A;  3F1N A;  2PRF A;  3TOI A;  3WWX A;  2WAF A;  4EBP A;  3UB6 A;  4X55 A;  4L9G A;  5MC7 A;  2HDR A;  5GLC A;  3SH7 A;  3S7Q A;  3IHB A;  3OPH A;  5A8B A;  5JYO A;  1UWP X;  4X56 A;  4K08 A;  3BFF A;  1QME A;  3IF6 A;  5DTK A;  2W3E A;  4NXE A;  3BEC A;  2Y2K A;  1K57 A;  4IVK A;  1KVL A;  3BFD A;  4GB7 A;  4JF5 A;  3IWI A;  3JPU A;  1PIO A;  4GW9 A;  3E0Y A;  3DBA A;  4RVA A;  1XXM A;  2D01 A;  3T12 B;  3KO6 A;  3QP8 A;  1E25 A;  3G31 A;  1YKD A;  4KEN B;  2OWH A;  3IBJ A;  1K54 C;  4NEE D;  1XFQ A;  2G7U A;  3NHQ A;  2J3W A;  1GSW A;  2VX8 A;  3DWK A;  1A0K A;  1GHM A;  3VOY A;  3BFC A;  2B02 A;  3LIC A;  4NG2 A;  3OBF A;  3W4O A;  2EX8 A;  1G6A A;  1JWV A;  4DKI A;  1KDS A;  1VM1 A;  2P7J A;  3OPR A;  1ES4 A;  4ZTK A;  3KX0 X;  1LSW A;  2W1T B;  4ZDX A;  2WYX A;  2WKQ A;  5BOH A;  3OCL A;  3MQO A;  5AQA A;  5DJU A;  1SKO B;  1OTI A;  2WUQ A;  2ZBB A;  2WK0 A;  4Q0I A;  4WZ5 A;  3AGD A;  3KYE A;  3IBR A;  1IFQ A;  4K0X A;  4IUK A;  3FG8 A;  1F9I A;  3LGO A;  4PM8 A;  2M7V A;  1PZO A;  4OQG A;  4R38 A;  1LI0 A;  1GHI A;  1TS7 A;  4OKP A;  1YPR A;  4XUX A;  2HPB A;  3WS5 A;  1G5U A;  4A5R A;  4IJG A;  2P9V A;  1BLC A;  1VET B;  4O01 A;  2INW A;  2R78 A;  2ZQC A;  3RJU A;  2LB5 A;  1LL5 A;  3NBL A;  4XT2 A;  2KOI A;  3IXG A;  1K38 A;  1DJA A;  3V67 A;  2XK1 A;  1YMS A;  2JKR I;  1DJC A;  3TRC A;  4S2N A;  5AVE A;  1BTL A;  4JXV A;  3U2A A;  4I3J A;  1OTB A;  2JN7 A;  1XJ2 A;  1C3B A;  5CEB A;  3W2Z A;  4PM6 A;  4NKP A;  1P9R A;  3T4J A;  2YKF A;  3Q82 A;  3NOP C;  3OPP A;  4X6T A;  2Z6D A;  4EER A;  3MQ0 A;  3KSI A;  4OPZ A;  4KG5 A;  2FFY A;  3VP3 A;  1BUL A;  3G35 A;  5HWW A;  2XD1 A;  3LY4 A;  4WZ4 A;  2J9O A;  3IF6 C;  5AQ9 A;  2Y59 A;  3HUM A;  4KZA A;  5IT5 A;  1K57 C;  4WUJ A;  1JTG A;  1FCN A;  4BD1 A;  2QPN A;  4GS9 A;  4WL9 A;  1H8M A;  1PFL A;  2VLG A;  3PBQ A;  1VEU B;  1RGY A;  1Q2Q A;  5I94 A;  5L8M A;  2ZLY A;  4M4X A;  4S2I A;  4GZB A;  4D2O A;  4R3J A;  5GHY A;  2JCH A;  2WAD A;  1RP5 A;  4P6Z M;  3PAG A;  3H7W A;  1ALQ A;  4B9O A;  1DP8 A;  1TDL A;  1MWS A;  1L2S A;  4WMC A;  3LR3 A;  4P87 A;  1FIK A;  1K4E A;  4U3T A;  5E2H A;  4FCF A;  1YLP A;  4GOG A;  4N1H A;  3RH8 B;  5E2F A;  5HPF A;  2ZQ8 A;  4MCW A;  2GX5 A;  4LGW A;  4GKU A;  3HUN A;  1S1Z A;  4R4S A;  5FI7 A;  1TD5 A;  1YAX A;  4UHU A;  2NUT C;  3RTY A;  3UPP A;  3S22 A;  4ARZ A;  1E4D A;  3M2J A;  1LT0 A;  5E43 A;  2DMW A;  5A91 A;  3IF5 A;  2HJE A;  2ZQD A;  3MXS A;  3NC8 A;  1OPX A;  3BY8 A;  4X68 A;  5HL6 A;  4B4X A;  1LLB A;  3S4X A;  4P0M A;  4R70 A;  5DKK A;  5FDS A;  4QY5 A;  3LEQ A;  2YKH A;  1K4F A;  4Y2F A;  2JHE A;  4HJ6 A;  4EEU A;  4GCZ A;  2J3T D;  5K5B A;  3UME A;  3IWQ A;  4L0L A;  5EVI B;  1BYW A;  2JKG A;  4CJN A;  2IWD A;  1PWD A;  4EEP A;  2FZ0 A;  3ZVT A;  3SS5 A;  4AFI A;  3O87 A;  3B42 A;  2ZQ7 A;  4Y15 A;  4KZ7 A;  3WS0 A;  1KE3 A;  1ESI A;  2KLI A;  4S2O A;  2GNX A;  4KZ9 A;  4IUH A;  1UGU A;  1DJB A;  5FAP A;  4BBV A;  4S2N C;  3LY3 A;  2JKT M;  1FSY A;  4R0Q A;  5AQB A;  1JWP A;  3A3F A;  1Z09 A;  3M6B A;  4OPR A;  2HDS A;  5GHZ A;  2ZJ9 A;  5FAT A;  3IX3 A;  5HWV A;  2VV7 A;  3M6H A;  1LHY A;  1HVB A;  3G2Y A;  2PYR A;  5FEG A;  3PBN A;  4N9K A;  2P9V B;  1WA9 A;  4QHC A;  3LI8 A;  3NOT C;  4EXO A;  1KGF A;  3W4P A;  1E3U D;  3UB8 A;  4OH0 A;  2Z2M B;  3MQQ A;  3NI9 A;  2EFX A;  4GDB A;  3ZHH A;  3TG9 A;  4XT2 B;  4P6B A;  1Q2P A;  1K0K A;  4EQI A;  1UWN X;  1T18 A;  2QYB A;  3C5A A;  4IBR A;  2EWV A;  3S1Y A;  3IX8 A;  2VA0 A;  4MLL A;  1DP6 A;  5FQ9 A;  4Y13 A;  3E4Q A;  4HBT A;  2FH5 A;  4F94 A;  3G34 A;  5CGS A;  1SKO A;  2XSS A;  3MFD A;  3EQU A;  4Q0H A;  2HJ9 C;  4R1G A;  3BQA A;  3R4K A;  3BRM A;  3UNW A;  3BW6 A;  4Q0J A;  5KSH A;  3P09 A;  2H28 A;  4ZJ3 A;  3LIF A;  3NDG A;  3AGE A;  3OCN A;  4E3O A;  4UA9 A;  2EWW A;  1VET A;  4CLC E;  3VSL A;  1PW8 A;  4WEK A;  4U0T A;  4ETZ A;  3CHW P;  1SKF A;  3MKE A;  3PBT A;  4UA6 A;  1NWZ A;  4BL3 A;  3H7W B;  2IA2 A;  1S1Y A;  2H0Y A;  1K55 A;  2PHY A;  2RCX A;  1MC0 A;  4HJ4 A;  2WKE A;  4HH3 A;  1Z6F A;  1CI9 A;  4ZAM A;  5M1A A;  2CC1 A;  1MWR A;  4JGQ A;  4EV4 A;  5HFO A;  3HLG A;  4Y0T A;  5FQJ A;  1TS0 A;  3VMA A;  1ERO A;  1PNE A;  4UA7 A;  2ZM8 A;  4OOY A;  1T19 A;  5DF9 A;  5FQM A;  1U60 A;  1JVJ A;  2W3F A;  3QNC A;  3LUQ A;  5CHJ A;  2J7V A;  4RX3 A;  2PR5 A;  4BEN A;  4BL2 A;  1ES2 A;  3NJA A;  1XPB A;  3IX4 A;  2ZQA A;  1G28 A;  3EQV A;  3VFH A;  1FIL A;  4KZB A;  3P01 A;  4OPY A;  1IKI A;  4U0X A;  3RFB A;  3E2K A;  1VEU A;  2Z2L B;  5EPH A;  2V2F F;  4BQM A;  3C38 A;  4EU0 A;  4H8R A;  3CJM A;  4UAA A;  3ULF A;  4O8G A;  1LSX A;  4NK3 A;  5TGF A;  1G68 A;  2WGV A;  3F1P A;  1MPL A;  2PU4 A;  4MDZ A;  2EX6 A;  4KQQ A;  3K3D A;  3UB7 A;  3HLE A;  2WAE A;  1HLU P;  4BD0 A;  2VV6 A;  3T4K A;  4EET B;  3S7N A;  1F2K A;  4HQA A;  3JVU A;  2W0N A;  2Q0O A;  5DKL A;  2Y91 A;  1XJ3 A;  5J8X A;  4QPR A;  3GSG A;  4LRY C;  4X53 A;  4E3I A;  1OJ5 A;  3QP2 A;  5HL1 A;  4DXB A;  2ZC3 B;  1FCO A;  2WZX A;  4FSF A;  3HL9 A;  4NXF A;  3DTE A;  2GZA A;  3QNB A;  1MBL A;  4QJG A;  4HBU A;  1OT9 A;  1H3Q A;  2HF6 A;  1ONG A;  3UY6 A;  2O0Y A;  2WKP A;  1SCW A;  2QJ7 A;  4FTX A;  4MBH A;  1OT6 A;  1W8Y A;  3V5M A;  1SDN A;  5DTS A;  1GA9 A;  3ZVW A;  5DF7 A;  2QKP A;  4I38 A;  4IBX A;  2V9A A;  3PBO A;  3GQZ A;  2ZOI A;  3A0V A;  1TF1 A;  3DTI A;  4HI4 A;  3UE3 A;  2ZM0 A;  1XA7 A;  4JGO A;  1S4R A;  3N4I A;  1QMF A;  3CLO A;  4KUK A;  4MNR A;  3T1S A;  4PKY A;  5EVI A;  5HWT A;  2XRO A;  5DFY A;  3C8C A;  1ESU A;  2AVX A;  2IWC A;  2W1R A;  4JGR A;  4R23 A;  3IXD A;  4OLD A;  5FQI A;  1GA0 A;  3ZQ5 A;  3BWL A;  1YSP A;  3IS2 B;  5F68 A;  4YOF A;  2EFU A;  3KYZ A;  4O7D A;  5FDH A;  2ZMF A;  1W5D A;  3MMH A;  3UE0 A;  4S2P A;  1K6S A;  3VSK A;  1EWZ A;  1ES3 A;  3T4S A;  3VV4 A;  5TFQ A;  4KZ5 A;  4EUZ A;  4KZ8 A;  2XA7 S;  3ICY A;  3UDX A;  5KIZ A;  5G4Y A;  4OP8 A;  2ZL1 B;  4QB8 A;  1ZKJ A;  2VGJ A;  4BBU A;  2O9B A;  5EEC A;  5C5K A;  3VE4 A;  3C7U A;  3H9W A;  1FR1 A;  1TDG A;  4E6W A;  5CXW A;  4Z1W A;  4ZJ2 A;  2B95 A;  4DF6 A;  5CTN A;  2QJ5 A;  2FFF B;  3IT9 A;  3LR5 A;  5LBR A;  1W63 M;  4RA7 A;  3C2W A;  2V1B A;  5EE8 A;  3BEB A;  3GR2 A;  3H82 B;  4PPR A;  1BT5 A;  4DN0 A;  4CLC D;  4OON A;  2JKF A;  3LEZ A;  2ZC4 B;  2GDN A;  3VE3 A;  2HP5 A;  5U47 A;  3DAV A;  4R3B A;  2ZMV A;  2WGW A;  2W27 A;  4JLF A;  1OME A;  1CJF A;  5IU1 A;  2V1A A;  2UWX A;  4OOM A;  3FYZ A;  3C30 A;  4KG2 A;  3BLM A;  5FA7 A;  4O0P A;  3VP2 A;  4PM9 A;  5EVE A;  1W8Q A;  2JC7 A;  2RL3 A;  2Y2Q A;  2EX9 A;  1HTZ A;  3E2L A;  1TEM A;  3MFX A;  4E04 A;  5HAP A;  1ZTU A;  1LL8 A;  1YLZ A;  2Y2L A;  4FUW A;  4MN6 A;  4HEF A;  3T1R A;  2XF3 A;  4NXB A;  1OJG A;  4UQI S;  3T4Q A;  3ITB A;  2ACG A;  3FPV A;  1IKG A;  1YSQ A;  1YQS A;  2C6W B;  2Y8H A;  4JF6 A;  1ZHH B;  4ESP A;  2Y2P A;  5GLD A;  3OOV A;  1TVF A;  1CQA A;  4D60 A;  1P9W A;  3B47 A;  1NRF A;  1TS8 A;  2A24 B;  4R4R A;  3NIA A;  4Y17 A;  3F1P B;  3N8R A;  5F6A A;  2WGI A;  5EM0 A;  2L0W A;  4HY8 A;  5F1G A;  4KZ6 A;  4DMZ A;  3MZD A;  4H6J B;  1JWZ A;  1KOU A;  2V1Z A;  5EVI C;  4YIN A;  4BLM A;  4XXR A;  1KGE A;  3PBS A;  1Y4O A;  5CRF A;  3A0R A;  1CI8 A;  3EWK A;  5KZH A;  4PM7 A;  3T1X A;  2OOL A;  2BG1 A;  5M18 A;  5CED A;  2OSU A;  1KE0 A;  3O3V A;  1ACF A;  3WRT A;  4LLO B;  4C3Q A;  3RXW A;  4Y0U A;  4HES A;  3T4L A;  4WZ5 C;  2X01 A;  3ZFZ A;  4Y7P A;  2Y2G A;  4C6Y A;  3HJK A;  1SHV A;  4HHD A;  1F98 A;  5HAQ A;  4WEJ A;  4KZ4 A;  3QP5 A;  2VK3 A;  1PI4 A;  3UE6 A;  4HP9 A;  3L9K A;  3ZG0 A;  2W3G A;  1VHM A;  3CUE A;  3ZG9 B;  2XDM A;  3FKW A;  3Q7V B;  1L0E A;  1XA1 A;  4LV0 A;  4N1X A;  1MKI A;  1L0D A;  1K56 D;  2W3D A;  1L3L A;  3K3C A;  4FD8 A;  4RYE A;  1XGI A;  2QWS A;  4GD8 A;  2BLS A;  3SW1 A;  4M3K A;  2V8F A;  3R7W B;  2CMN A;  2WZZ A;  2BTF P;  3RXX A;  2OLV A;  3QHY A;  2XLN A;  3F1O A;  2OAP 1;  3U4L P;  1L0G A;  3T50 A;  3MS6 A;  4OVD A;  3BLS A;  1S0W A;  4JXW A;  4OQI A;  4PMA A;  1BUE A;  4WF0 A;  1WYC A;  3ZG8 B;  5FEF A;  3FC7 A;  4B4Z A;  3G30 A;  4I3A A;  1OTE A;  2Y4A A;  4WN5 A;  2Y2J A;  2Y55 A;  3Q81 A;  3VFF A;  4HJ3 A;  2Y2N A;  5EUA A;  5TBM B;  5HD3 A;  1P97 A;  1MWU A;  3UDF A;  1GHP A;  1BZA A;  2HDU A;  4KZ3 A;  3IWO A;  2D02 A;  3KSG A;  3FV7 A;  4L9E A;  1EI5 A;  3LFV A;  4BBT A;  3E4P A;  4DXC A;  3HJI A;  3MF0 A;  2L4R A;  3VOZ A;  1SDE A;  3LID A;  5FSR A;  2QMI A;  4EBN A;  2WGW B;  4LRZ E;  1WE4 A;  3UPN A;  5HD5 A;  3MSH A;  2V20 A;  2Y2H A;  4NET A;  1I5Q A;  5EOO A;  5IHV A;  1JTD A;  4EBL A;  1VQQ A;  3HVF A;  2H0T A;  3ZDJ A;  2ZC5 B;  3IS2 A;  1H8Z A;  4MBK A;  2Y2I A;  3BYD A;  2Y2M A;  4DJ3 A;  3UDI A;  2X02 A;  2VGL S;  3LR0 A;  1W63 Q;  2PT7 A;  5FI2 A;  4C75 A;  2B18 A;  5IS1 A;  5CX7 A;  5GHX A;  2HGV A;  3HLD A;  3EGD C;  2Q9M A;  4DE2 A;  4OQH A;  4GD6 A;  3T4T A;  3TJZ C;  4B88 A;  1NXY A;  2ZL1 A;  4JKT A;  4OLG A;  5DVA A;  3K2N A;  1YT4 A;  1YLY A;  4WLA A;  3JVV A;  3N8L A;  4HIA A;  4EWF A;  3LIA A;  1BSG A;  3NCK A;  3PAE A;  3WS1 A;  4NXG A;  4LCL A;  3G4P A;  3UPO A;  3Q1F A;  3H82 A;  4ZRR A;  3CWF A;  5HDC A;  3SH8 A;  5FI6 A;  3B3X A;  4F3L B;  1PI5 A;  1K25 A;  1NRJ A;  1J9M A;  3LIB A;  3OPL A;  4WYY A;  3V50 A;  4HOI A;  1CEG A;  5F83 A;  4LRX C;  3V3S A;  2O99 A;  3V39 A;  2VJW A;  4Q8I A;  4ME4 A;  1CF0 A;  1DRM A;  5A92 A;  3A3J A;  3HCY A;  1NYM A;  3LR4 A;  4KUO A;  2HDQ A;  1BLP A;  3WS2 A;  3EEA A;  1XGJ A;  3CUE C;  3D9Y A;  1V9Y A;  1KVM A;  2I9V A;  4QY6 A;  4EUV A;  4E3J A;  2A2L A;  1E3U A;  1ES5 A;  4N92 A;  2HP9 A;  4X1L A;  1Y28 A;  4CQH A;  3A3E A;  4CLC B;  4MEZ A;  1K6R A;  2EXA A;  2DNS A;  4X69 A;  5HDD A;  3M2K A;  3SS3 A;  3D3O A;  5AQ7 A;  2JKR M;  5EV0 A;  2VGL M;  5KMW A;  4MN5 A;  1NZU A;  3VP4 A;  1NYY A;  3SS4 A;  3UE1 A;  5HZH A;  2VV8 A;  2R9X A;  2ZM2 A;  2C5W B;  2HZ5 A;  3SZT A;  4E3N A;  2G2W A;  1I2S A;  5GL9 A;  5FAO A;  4LFU A;  2JKT I;  3LCE A;  4R6L A;  5CHU A;  1DP9 A;  2A24 A;  4BJP A;  5CGW A;  5L2F A;  3NUL A;  2PBD P;  1ERM A;  2XH9 A;  2P74 A;  1PWG A;  5HAR A;  2PD7 A;  2Z6C A;  2ZC7 A;  3UN7 A;  1PZP A;  4K0W A;  5J4E A;  4DJ2 A;  4H6J A;  1WYB A;  3B33 A;  2BAS A;  1ERQ A;  5D3O A;  4RQ9 A;  1EW0 A;  3DTK A;  3F1O B;  3SOI A;  1T1B A;  3FZC A;  3ITA A;  2PD8 A;  1YMX A;  2QZ6 A;  4S2J A;  2MJ6 A;  2XEP A;  3DW0 A;  2O9A A;  3N8S A;  3CAX A;  4X1M A;  2XR0 A;  4JXS A;  1GSV A;  3WS4 A;  5EVL A;  2UV0 E;  1H5X A;  2PAV P;  5DF8 A;  5L09 A;  2J3T C;  3LYX A;  4L9F A;  3PXP A;  3IXH A;  5L10 A;  3MJQ A;  3TSG A;  3DWZ A;  1Y54 A;  2KX6 A;  4LCM A;  5F1F A;  3O5Y A;  1TS6 A;  5HPI A;  5KSC A;  1F5M A;  4GHI B;  4N9L A;  3Q7V A;  1W7F A;  5HSQ A;  1N9L A;  4ID4 A;  3TW8 A;  1RCJ A;  3CIT A;  3HBR A;  1RGZ A;  2ZMA A;  3QP4 A;  4UEY A;  1K55 C;  1T1C A;  1ZC2 A;  3DTM A;  3R7W A;  4KQD A;  1I2W A;  2L1M A;  5TR7 A;  1O07 A;  4DDY A;  1PRQ A;  2QHK A;  2ZC6 B;  3G2Z A;  3W4Q A;  1XP4 A;  3EEH A;  4KQR A;  5I5L A;  3ZNY A;  2K2N A;  1KDW A;  1CEF A;  5CGX A;  4E3L A;  2OLU A;  3O88 A;  3JYI A;  4GLQ A;  3GV9 A;  4G3W A;  4JBF A;  1PWC A;  4P6Z S;  3UMD A;  4WMC D;  5TBM A;  2DCF A;  1M6K A;  3CMZ A;  4Z9Q A;  1FR6 A;  4K91 A;  3P98 A;  2V0W A;  2E8J A;  4WEL A;  4DE1 A;  3ZG5 A;  2PU2 A;  3IQA A;  2A3U A;  1XJ4 A;  3C4O A;  5CHM A;  2XFT A;  2PR6 A;  1HZO A;  2WKR A;  2EA9 A;  3P7N A;  1MXO A;  5FL3 A;  4WBG A;  1NZO A;  3GDI A;  5HW3 A;  3HRE A;  3CI6 A;  5FAS A;  4R3A A;  2H10 A;  4OOL A;  2IWB A;  4RX2 A;  1W79 A;  3MBZ A;  1PW1 A;  1GSX A;  3ZNT A;  3E4O A;  1L0F A;  3CPT B;  2B5R A;  3A0S A;  1OTA A;  4XUZ A;  4IHQ A;  3PYP A;  2K7S A;  4BWI A;  2J80 A;  2E8I A;  2VEA A;  5F82 A;  3VP1 A;  2X71 A;  3HLC A;  4MBF A;  1YM1 A;  1O7E A;  1FCM A;  2WKI A;  1P0Z A;  1H0M A;  2P04 A;  2XD5 A;  4YNR A;  4OP5 A;  1IEL A;  4JF4 A;  3ISG A;  4B93 A;  1N4O A;  5G4Z A;  3MR0 A;  3E98 A;  1MY8 A;  2XA7 M;  4MN7 A;  2HV1 A;  5CEC A;  3Q7Z A;  4F3L A;  4GDN A;  1IEM A;  4E6X A;  1MKM A;  4LV3 A;  1OTD A;  3LI9 A;  1ONH A;  1HD8 A;  1ZG4 A;  3EOI A;  1FQG A;  4ETX A;  5M19 A;  4QWO A;  5HX9 A;  3AGF A;  3F1N B;  5FQQ A;  2P08 A;  1LI9 A;  3PR6 A;  1S4S A;  3QP1 A;  1XFN A;  1AWI A;  5G18 A;  2M1C A;  3HUO A;  2VZW A;  1D1J A;  4KQO A;  2XGN A;  3MXR A;  1IYQ A;  3UB9 A;  3L7H A;  3IH9 A;  4PHT A;  1LL9 A;  3T1Q B;  3IF6 B;  2HP6 A;  3MXQ A;  5J7E A;  4PKY G;  4CLC A;  3FKV A;  1J3W A;  2A49 A;  4FH4 A;  1S6R A;  2EX2 A;  3QP6 A;  1LSV A;  3BJN A;  1YLT A;  3S7O A;  1MWT A;  2XFS A;  4YWZ A;  5DJT A;  3TE8 A;  4QU3 A;  3NOU C;  3LO7 A;  4EES A;  2K31 A;  5GLA A;  2LB9 A;  2J8Y A;  3D4F A;  2Y2O A;  2ZOH A;  2I72 A;  4E3M A;  5TJJ A;  3D72 A;  4LPZ A;  4E3K A;  1N9O A;  4I39 A;  5JYP A;  1AXB A;  4UQI M;  4LEN A;  3CZD A;  1YLJ A;  2JE5 A;  3MZF A;  4CPK A;  4FOF A;  2V0U A;  4PM5 A;  1SZV A;  3KYQ A;  3BFE A;  4P85 A;  1X0O A;  3BY9 A; 
#chains in the Genus database with same CATH homology
 2XRN A;  1NRJ A;  4EER A;  3LIB A;  4HOI A;  3MQ0 A;  3KSI A;  4LRX C;  2O99 A;  2QKP A;  2VKS A;  5HWW A;  2VJW A;  4I38 A;  2PYP A;  2V9A A;  2OWJ A;  1VB6 A;  3PBO A;  4ME4 A;  2ZOI A;  3A0V A;  3VOL A;  1TF1 A;  4HI4 A;  1DRM A;  3UE3 A;  5IT5 A;  3HCY A;  3LR4 A;  3ZYT A;  4KUO A;  4BMW A;  3GEC A;  4JGO A;  4WUJ A;  3EEA A;  1S4R A;  4GS9 A;  4WL9 A;  4KUK A;  3CLO A;  1H8M A;  2VLG A;  4PKY A;  3CUE C;  5HWT A;  2XRO A;  3PBQ A;  5DFY A;  1V9Y A;  3C8C A;  1JNU A;  4GJ4 A;  2I9V A;  4EUV A;  3T4O A;  2A2L A;  2W1R A;  5L8M A;  4JGR A;  1Y28 A;  4M4X A;  4CQH A;  3ZQ5 A;  1NLZ A;  3BWL A;  1YSP A;  4CLC B;  3OLO A;  4Y5F A;  1MZU A;  3IS2 B;  5F68 A;  4YOF A;  4P6Z M;  3KYZ A;  3H7W A;  2ZMF A;  3MMH A;  4B9O A;  5HDD A;  1DP8 A;  3D3O A;  4PAU A;  3T4S A;  5AVF A;  3VV4 A;  2JKR M;  4JGP A;  3FPW A;  4HP4 A;  3LR3 A;  2XA7 S;  3ICY A;  2VGL M;  5KIZ A;  5G4Y A;  4HNB A;  4MN5 A;  4GHI A;  5HZH A;  2VV8 A;  2PDR A;  3RH8 B;  4BBU A;  2O9B A;  3VE4 A;  5C5K A;  2JKT I;  3H9W A;  4R6L A;  4Z1W A;  5HPF A;  1NLY A;  4MCW A;  2GX5 A;  1DP9 A;  2A24 A;  4BJP A;  2QJ5 A;  3LR5 A;  3G6O A;  1S1Z A;  5LBR A;  1W63 M;  1TD5 A;  1YAX A;  3C2W A;  2V1B A;  3KSF A;  2NUT C;  3RTY A;  4ARZ A;  2W1T A;  3H82 B;  1LT0 A;  2PD7 A;  2Z6C A;  4EW7 A;  2W3H A;  4DN0 A;  2DMW A;  4CLC D;  5J4E A;  4DJ2 A;  1G6O A;  2HJE A;  4H6J A;  3VE3 A;  1OPX A;  3BY8 A;  3B33 A;  4G3V A;  2BAS A;  1IOU A;  2KDK A;  5HL6 A;  2M7U A;  4RQ9 A;  2ZMV A;  1EW0 A;  3F1O B;  2W27 A;  1T1B A;  5EFW A;  4R70 A;  5DKK A;  5IU1 A;  1D06 A;  2V1A A;  3LIE A;  4CLC C;  2PD8 A;  2YKH A;  4OOM A;  4Y2F A;  3EGX C;  2JHE A;  3C30 A;  4HJ6 A;  5HDS A;  2MJ6 A;  4EEU A;  4O0P A;  4GCZ A;  2J3T D;  4GS9 B;  5K5B A;  2O9A A;  2GJ3 A;  3UME A;  4L0L A;  1BYW A;  3CAX A;  4EEP A;  2FZ0 A;  5DFX A;  4AFI A;  1GSV A;  4I5S A;  2NUP C;  3B42 A;  2OAQ 1;  5AJG A;  3MFX A;  4E04 A;  1ZTU A;  2J3T C;  3LYX A;  4MMN A;  1LL8 A;  4L9F A;  3PXP A;  5F5Y A;  1STZ A;  4MN6 A;  2GNX A;  3MJQ A;  4NXB A;  4IUH A;  1OJG A;  1UGU A;  4UQI S;  3T4Q A;  3S7P A;  4BBV A;  2KX6 A;  1ODV A;  3O5Y A;  3FPV A;  2JKT M;  1TS6 A;  5HPI A;  1YSQ A;  1T1A A;  1F5M A;  2Y8H A;  4GHI B;  1ZHH B;  4EQ1 A;  5HSQ A;  1N9L A;  3TW8 A;  5HWV A;  2VV7 A;  3OOV A;  3CIT A;  1N9N A;  4UEY A;  1P9W A;  2PYR A;  1T1C A;  1S67 L;  3PBN A;  1WA9 A;  3B47 A;  3PHY A;  1TS8 A;  2A24 B;  1D7E A;  3LI8 A;  3NOT C;  3R7W A;  4EXO A;  4KQD A;  2L1M A;  3KSH A;  3F1P B;  1S66 L;  4HH2 A;  3OC2 A;  4I3I A;  5F6A A;  3UB8 A;  2L0W A;  4ARZ B;  2QHK A;  4HY8 A;  1V9Z A;  3MQQ A;  3EEH A;  4XT2 B;  5I5L A;  4DMZ A;  2K2N A;  4H6J B;  1KOU A;  1UWN X;  1T18 A;  1XJ6 A;  2QYB A;  4II7 A;  2EWV A;  5J3W A;  2O9C A;  3BQ8 A;  4GLQ A;  4G3W A;  2VA0 A;  3PBS A;  1DP6 A;  3A0R A;  3EWK A;  2OOL A;  4G3K A;  4P6Z S;  3UMD A;  5F69 A;  5TBM A;  3E4Q A;  4LLO B;  2FH5 A;  4Y3I A;  2V0W A;  2Y79 A;  4WEL A;  3PBR A;  1XJ4 A;  3T4L A;  2PR6 A;  2WKR A;  2XSS A;  3F1N A;  2EA9 A;  3P7N A;  3UB6 A;  3HJK A;  5MC7 A;  4L9G A;  5FL3 A;  3EQU A;  4Q0H A;  2HJ9 C;  4HHD A;  3BQA A;  1F98 A;  3GDI A;  3CI6 A;  3R4K A;  4WEJ A;  3S7Q A;  4R3A A;  5A8B A;  4OOL A;  3BW6 A;  1UWP X;  4Q0J A;  4K08 A;  5KSH A;  2W3E A;  4NXE A;  2H28 A;  3UE6 A;  4HP9 A;  1GSX A;  3E4O A;  3LIF A;  2W3G A;  3OCN A;  3A0S A;  1OTA A;  1VHM A;  4IHQ A;  2EWW A;  3PYP A;  2K7S A;  3CUE A;  4BWI A;  4CLC E;  4GW9 A;  2J80 A;  3E0Y A;  3DBA A;  4WEK A;  4ETZ A;  2VEA A;  2D01 A;  3KO6 A;  3PBT A;  2W3D A;  1NWZ A;  3K3C A;  1YKD A;  3H7W B;  2IA2 A;  2QWS A;  1S1Y A;  3SW1 A;  2PHY A;  2OWH A;  3IBJ A;  1P0Z A;  1MC0 A;  3R7W B;  4HJ4 A;  2P04 A;  4HH3 A;  4NEE D;  2CMN A;  1XFQ A;  2G7U A;  3NHQ A;  2J3W A;  4YNR A;  4JGQ A;  1GSW A;  3F1O A;  2OAP 1;  2VX8 A;  3T50 A;  4B93 A;  5G4Z A;  3MR0 A;  2B02 A;  3LIC A;  1TS0 A;  3E98 A;  4WF0 A;  2XA7 M;  4MN7 A;  2HV1 A;  3OBF A;  1T19 A;  5DF9 A;  2W3F A;  3FC7 A;  4F3L A;  4I3A A;  1OTE A;  3LUQ A;  4WN5 A;  1MKM A;  1OTD A;  3LI9 A;  4HJ3 A;  2P7J A;  5TBM B;  5HD3 A;  1P97 A;  3KX0 X;  2PR5 A;  3EOI A;  1LSW A;  2W1T B;  3NJA A;  4ETX A;  2WKQ A;  3OCL A;  3MQO A;  5DJU A;  1G28 A;  2D02 A;  3KSG A;  4L9E A;  1OTI A;  3EQV A;  2ZBB A;  3LFV A;  4BBT A;  3E4P A;  3F1N B;  4Q0I A;  2P08 A;  3HJI A;  3MF0 A;  2L4R A;  3P01 A;  3PR6 A;  1S4S A;  3LID A;  3IBR A;  1XFN A;  1IFQ A;  3RFB A;  4IUK A;  2M1C A;  2VZW A;  4LRZ E;  4KQO A;  3FG8 A;  5HD5 A;  1F9I A;  3UB9 A;  2M7V A;  4PHT A;  4R38 A;  3C38 A;  4EU0 A;  3MXQ A;  1TS7 A;  5J7E A;  4PKY G;  4CLC A;  3IS2 A;  4IJG A;  4DJ3 A;  1LSV A;  3BJN A;  3ULF A;  4O8G A;  1LSX A;  2VGL S;  3S7O A;  4O01 A;  2INW A;  1W63 Q;  3LR0 A;  3F1P A;  2PT7 A;  2R78 A;  4MDZ A;  2B18 A;  5IS1 A;  4YWZ A;  5CX7 A;  5DJT A;  3TE8 A;  2HGV A;  2LB5 A;  3EGD C;  3K3D A;  4XT2 A;  3UB7 A;  2KOI A;  3NOU C;  4EES A;  3T4T A;  3TJZ C;  2K31 A;  3V67 A;  2VV6 A;  2JKR I;  3T4K A;  2LB9 A;  3S7N A;  4EET B;  3K2N A;  4HQA A;  3JVU A;  2W0N A;  5DKL A;  2ZOH A;  4WLA A;  1XJ3 A;  3JVV A;  4HIA A;  4QPR A;  5TJJ A;  3TRC A;  4LRY C;  3D72 A;  3LIA A;  4LPZ A;  1N9O A;  1OJ5 A;  4I39 A;  5AVE A;  4UQI M;  3U2A A;  4I3J A;  4FSF A;  1OTB A;  2JN7 A;  4NXG A;  1XJ2 A;  4NXF A;  2GZA A;  3W2Z A;  1OT9 A;  1H3Q A;  2HF6 A;  4NKP A;  1P9R A;  3H82 A;  4FOF A;  3CWF A;  4ZRR A;  5HDC A;  3T4J A;  2YKF A;  2O0Y A;  2V0U A;  2WKP A;  3NOP C;  4F3L B;  2QJ7 A;  2Z6D A;  3KYQ A;  2KLI A;  1OT6 A;  1X0O A;  3BY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...