3BY9A

Crystal structure of the v. cholerae histidine kinase dctb sensor domain
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
259
structure length
259
Chain Sequence
MRFQYQALLNEHQSQLDRFSSHIVATLDKYAHIPHLISKDKELVDALLSAQNSAQIDITNRYLEQVNEVIQAADTYLIDRFGNTIASSNWNLDRSFIGRNFAWRPYFYLSIAGQKSQYFALGSTSGQRGYYYAYPVIYAAEILGVIVVKMDLSAIEQGWQNKSSYFVATDDHQVVFMSSQPAWLFHSVADLSPAQLNDIRQSQQYLDSPIPSLGWQGDLQAEQSEWRKPEKHWLQDDYIVSSRPLPELALTIRVLSPKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of C4-Dicarboxylate Ligand Complexes with Sensor Domains of Histidine Kinases DcuS and DctB.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transferase
molecule keywords Sensor protein
total genus 84
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3by9A02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3by9A01
4EESA 3A0SA 5F68A 4GS9B 1X0OA 2BASA 3CWFA 4LPZA 1GSXA 4WUJA 3HJIA 2W27A 5HZHA 2L1MA 3F1PB 3K3DA 4HIAA 2QJ7A 3E4QA 3IS2A 3LI9A 1N9LA 4HOIA 4PKYA 5TBMB 1GSWA 4I3JA 4EETB 1LSWA 4JGRA 1S4RA 2WKPA 3UB9A 2CMNA 3MFXA 2YKFA 4GHIB 2D02A 2V0WA 1T19A 2PYPA 3E4PA 3IBRA 5EFWA 4YWZA 4E04A 2VLGA 2VV7A 1UGUA 2V1BA 3EEHA 3PYPA 3K3CA 5AVFA 4R38A 4L9GA 1T1CA 3OLOA 3C2WA 4LRXC 5TBMA 3MJQA 2PD8A 3EWKA 2VV6A 4XT2B 1OTDA 4KUKA 1XJ2A 3F1OA 3NOPC 2ZOHA 4L9FA 3T50A 3UB8A 3E4OA 4H6JB 3UE6A 5DKLA 3LYXA 5HWWA 1TS8A 4BBUA 1OTBA 4HP4A 5HD3A 1OJGA 1S1ZA 1XJ4A 2KDKA 2PDRA 4LLOB 1MZUA 4LRZE 3C8CA 1LT0A 3F1NA 2L4RA 4MN5A 5F5YA 3RH8B 2V9AA 4B9OA 1DRMA 1OTIA 3LIEA 3LUQA 4MN6A 3BY8A 2A24A 2J80A 3A0VA 2I9VA 3FC7A 3KX0X 3P7NA 4H6JA 4HJ4A 4RQ9A 2QWSA 1OTEA 1TS7A 4HNBA 5HWVA 4I38A 1D06A 5F69A 3MQQA 1NWZA 1TS6A 1OTAA 2ZBBA 3LIDA 3NHQA 4GS9A 4K08A 2QJ5A 2VV8A 4JGPA 4EERA 5J3WA 3H7WA 1GSVA 2K7SA 3PHYA 3GECA 1UWNX 3IS2B 4HH3A 1V9YA 1WA9A 2INWA 4EXOA 5HSQA 4L9EA 1P97A 1S4SA 5HDCA 1DP8A 1N9OA 3MR0A 1LL8A 1S67L 2A24B 1S1YA 2QHKA 2OOLA 3A0RA 2GJ3A 4HQAA 4HY8A 3H82B 4NXEA 4R3AA 1UWPX 3G6OA 4M4XA 5DJTA 5IS1A 4GW9A 2EA9A 3RTYA 3BWLA 2ZOIA 2JHEA 1JNUA 4HH2A 3H7WB 4EEUA 2Z6DA 3UB7A 2YKHA 1KOUA 1DP9A 1ODVA 2OWJA 2VEAA 4XT2A 1XJ6A 3LIAA 1OT9A 3B33A 3F1OB 3MXQA 1T18A 2OWHA 1BYWA 3NOUC 5G4YA 5HD5A 3UB6A 4DJ2A 2HV1A 4JGOA 1OJ5A 2QKPA 1LSVA 2PHYA 1LSXA 3ULFA 1VB6A 3ICYA 1XFQA 1XFNA 3LIBA 4JGQA 1T1BA 4GCZA 1TS0A 3F1NB 2R78A 3NOTC 5J4EA 1XJ3A 4HI4A 1G28A 3CAXA 4KQDA 4NXBA 5I5LA 2B02A 4PKYG 5A8BA 4HJ3A 1F9IA 4F3LA 3D72A 4BBTA 4I39A 3LIFA 1F98A 2V0UA 3BY9A 5AVEA 3FG8A 2PR6A 3HJKA 4GHIA 3CLOA 5DKKA 3VE4A 4EQ1A 2PR5A 4NXGA 3LI8A 4HP9A 3UMEA 2WKQA 4I3IA 4WL9A 1D7EA 5G4ZA 4KUOA 1S66L 4DJ3A 2L0WA 4HJ6A 4F3LB 1P0ZA 5IU1A 5HDDA 4WF0A 4EW7A 1OT6A 2JN7A 4R70A 3H82A 1Y28A 4EEPA 3VOLA 2W0NA 4R6LA 2KX6A 2M1CA 3LICA 3UMDA 5DJUA 2D01A 3SW1A 2P7JA 3MQOA 3GDIA 3NJAA 4LRYC 2PD7A 4NXFA 1N9NA 4I5SA 3F1PA 3H9WA 4HHDA 5J7EA 1DP6A 5HWTA 1EW0A 3ZQ5A 4BBVA 2Z6CA 4WN5A 5F6AA 4I3AA 5KIZA 1T1AA 1V9ZA 2PYRA 4WLAA 5HDSA 2H28A 2V1AA 3VE3A 2WKRA
chains in the Genus database with same CATH superfamily
5FDHA 3FWLA 3QP4A 2A3UA 1GSXA 3IWQA 1YLJA 3KSFA 1N9LA 3IF6B 4XXRA 2K31A 3LR4A 2X01A 4S2OA 3PBTA 2C6WB 4P85A 4L9GA 3OLOA 3KYEA 2ZOHA 3ISGA 1NYYA 1MZUA 3N6IA 4MN7A 5HD3A 5DF8A 3UDXA 1CEGA 3V67A 4EWFA 4GZBA 1VEUB 3FZCA 2J8YA 5HDCA 4KZ9A 3DBAA 3HREA 1MWSA 3EOIA 2OLVA 4C3QA 2JKRI 1HZOA 3WS5A 3ZFZA 3HL9A 5BOHA 4LCLA 3ZYTA 2JCHA 4O0PA 5EM0A 2QKPA 3V5MA 3T4JA 5CHUA 3UE3A 1BULA 1KE3A 2WGVA 2P08A 5FQJA 5A91A 3WS2A 1ES3A 3T4SA 1FSYA 2J3TC 2VGLM 4OPZA 5HDDA 3MSHA 4GNUA 3O3VA 2M7UA 1VETB 2B95A 3T1RA 1YLYA 4S2NC 2PU4A 2Y91A 2PD7A 3VSKA 2LB9A 1EW0A 2Z6CA 5F6AA 4OOLA 2BG1A 1X0OA 2V8CA 3HJIA 3RXXA 4DMZA 1H8ZA 5EE8A 3UB9A 3OC2A 3PBNA 2OV5A 3IBRA 3DWKA 1BLPA 1TVFA 2HGVA 4R38A 2HJEA 4UQIM 5CTMA 5E2HA 4RX3A 3CPTA 4BBUA 4EU0A 1L0GA 3W4OA 4OPYA 3T4LA 4MN5A 2L4RA 4YINA 4S2MA 2PAVP 4OQGA 3BY8A 1CJFA 4QWOA 4EBPA 2HJ9C 4MBKA 3L9KA 4JXGA 4NXFA 1EWZA 4N9LA 3GQZA 4S2PA 1IELA 2QMIA 5FQKA 5FI6A 5EVID 3NOUC 4U0XA 1LL9A 4GCZA 5J4EA 4HI4A 4NXBA 1VHMA 2JBFA 3P09A 4HJ3A 5DTSA 1F9IA 1LL5A 4GHIA 1VETA 3PAGA 5F1FA 4G3KA 3UDFA 4BD1A 4IBXA 1Z6FA 2JKTI 5GHZA 5A93A 4QY6A 2KLIA 3HLCA 4EEPA 3VOLA 5L07A 3OOVA 3GTCA 2OAQ1 5TGFA 3IXGA 5HDSA 2PYRA 5M1AA 3VE3A 5GL9A 5HAQA 3A0SA 1I2WA 3JVUA 1DJAA 2FFYA 3LI9A 4EETB 1ZG6A 2WKPA 1XP4A 4LFUA 4JKTA 1M6KA 2PT7A 2XA7S 4HEFA 4DRTA 2PRFA 5FEFA 1PWDA 4S2NA 5HW3A 3UNWA 1S1ZA 4P0MA 4NETA 3VOZA 1LLBA 1LT0A 3FPVA 4RVAA 2W3DA 2VGKA 5E2EA 1ESIA 2QWSA 1OTEA 3PBSA 2HF6A 2EX2A 5HSQA 4BLMA 5KMWA 1ONGA 2A24B 5JYPA 1WYCA 3MBZA 1NXYA 2Z2LB 3RTYA 1TDLA 3RXWA 1XA7A 4FH2A 3UPNA 3ZG0A 4WELA 3V3SA 4B88A 2O9AA 5GLDA 4GB7A 4F3LA 3UPPA 1F98A 3W4PA 3KSHA 1JTGA 4C75A 4IVKA 4I3IA 1MWTA 3NIAA 4GDBA 2EX6A 2JN7A 1PYYA 2W3GA 4S2JA 3TE8A 1H8YA 4DE0A 2ZD8A 5AQBA 4WN5A 2HP6A 1CEFA 3IH8A 4MBHA 4KZ5A 3BFFA 5FAOA 3CUEA 4QJGA 1L2SA 1N4OA 4Y0OA 1LSWA 3IQAA 2XSSA 3T4KA 2W3EA 5HL6A 3D9YA 1PW1A 3PR6A 3C4OA 5AVFA 4X6TA 3WS4A 4R4RA 4LV0A 3G31A 5DF9A 1PRQA 3MKEA 1J3WA 3B42A 5A90A 3LIEA 3CITA 1KGFA 5TR7A 3FC7A 4HNBA 1NLYA 2ZBBA 1TS6A 3C7VA 5J3WA 2GX5A 1RCJA 1MPLA 3L7HA 4Q0HA 3KSGA 1KDWA 2GJ3A 4Z9QA 4LENA 4KQOA 3MXSA 3TRCA 2ZOIA 3SZTA 3H7WB 2EX9A 3HVFA 3LR3A 2OWJA 3CJMA 4KZ6A 3SH9A 4B4XA 3B33A 3ZHHA 4EQIA 1ACFA 5DTTA 3F1NB 2B02A 4OOYA 3D72A 3RJUA 2WGWB 3LIFA 4B4ZA 3CZDA 1CQAA 3HUOA 4R3JA 4HJ6A 3BFDA 4O7DA 3ZG8B 2ZC5B 1XPBA 4HHDA 1FQGA 3ZVTA 5F83A 5TJJA 4OKPA 3K3DA 1KGGA 4I3JA 1MKIA 2CMNA 1OMEA 1ONHA 5FQMA 4E04A 3BQAA 3W2ZA 4S2KA 1ZC2A 3QP6A 2B5RA 2CC1A 5DFXA 3BQ8A 1YMSA 2V20A 5F5YA 2Y4AA 4B9OA 1DRMA 5EOEA 3VSLA 5MC7A 4JXVA 3S7OA 2Y2NA 3LR0A 5L8MA 1VQQA 2K7SA 2A49A 4HH3A 5CXWA 1V9YA 1S4SA 4WMCD 4E6XA 1S1YA 3BFGA 5E43A 4R3AA 1UWPX 3SOIA 4IVIA 3N8RA 1K57A 1JNUA 3NDGA 4EEUA 1MC0A 2W1RA 3A3IA 2VEAA 3P98A 1OT9A 1BYWA 4JGOA 1TEMA 1FILA 1MWUA 2G2UA 4Y15A 5AJGA 4S2IA 4E3NA 1Y4OA 4Q0IA 5J8XA 3BY9A 5DKKA 2LB5A 4BENA 4R23A 3T4TA 1D7EA 3IX8A 2ZQCA 5CRFA 1AWIA 4F3LB 3HLWA 4R70A 1Y28A 4WEJA 1K0KA 4R6LA 4KZ4A 1STZA 2P9VB 2XQZA 3W8KA 5CTNA 4UQIS 3ZQ5A 1Z09A 2ZC4B 4I3AA 1ES4A 3NBLA 4JBFA 3EGXC 3TSGA 2Y2OA 4WMCA 5F68A 4D2OA 1BT5A 2EXBA 3N8LA 3F1PB 3IS2A 5DFYA 3C38A 4WEKA 4IUKA 1E3UA 2PYPA 2VLGA 1MKMA 4N92A 3VP1A 3V3RA 4LRXC 4EBNA 1OTDA 4BBTA 3DTKA 4H6JB 2P74A 4PM7A 2ZC6B 4H8RA 4N1XA 1PW8A 2HP5A 3HBRA 3NHQA 1LI0A 5FASA 3OPRA 1GSVA 2G7UA 4CLCA 2ZMFA 1DP8A 3N7WA 4E3KA 2QZ6A 3IHBA 4NXEA 3ITBA 3IXBA 2EA9A 3R4KA 3NCKA 1ZHHB 3IF6C 1BLHA 5AQ7A 2WKIA 2PU2A 2E8IA 1LSVA 2PHYA 1TS0A 4ZTKA 2X71A 3S7NA 1ESUA 3IT9A 4X53A 3ZGAB 4DDSA 1U60A 3O88A 2H0TA 3FKVA 2DMWA 2L0WA 1ZKJA 2ZQ7A 1G68A 4KG5A 4PAUA 1N9NA 1W5DA 3F1PA 1W7FA 2K2NA 2Y2PA 4OLGA 4HESA 4II7A 4DJ2A 1IEMA 2J9OA 1GCEA 4MLLA 4UEYA 4GS9B 2ZC7A 3BFCA 3SH8A 4ZBEA 4DXCA 2ZL1A 4UHUA 4MEZA 3E4OA 2XFSA 3DTEA 4EV4A 3CHWP 4PM5A 1JWPA 3PAEA 3RH8B 5AQAA 1TDGA 1GA0A 2J80A 4Q0JA 2I9VA 3M2KA 3CPTB 5EVEA 1D06A 2W1TA 3QP5A 4LV2A 1TD5A 2INWA 2J3TD 4IEDA 3A0RA 2QHKA 4N1HA 3MZDA 5GHYA 5DJTA 5HARA 3Q1FA 3WS0A 1KVMA 3MS6A 4LCMA 1K54C 1XJ6A 4PM9A 5FI2A 3F1OB 1T18A 5HD5A 1YKDA 4P6BA 4R4SA 3KSIA 4BWIA 4DE3A 3VOYA 2DNSA 2WADA 3U2AA 3WS1A 3WWXA 1P9WA 3PBOA 4ARZB 3S22A 1K57C 4QU3A 5E2FA 1K38A 2FZ0A 3VP2A 4K0XA 1YQSA 2VGJA 4OLDA 2XK1A 1IYQA 2XR0A 3SW1A 2HDQA 1D1JA 2H10A 5F82A 4BBVA 1FSWA 3V50A 4WLAA 4U0TA 5FEGA 4OVDA 3BW6A 4DE2A 4WM9A 4IBRA 2A2LA 1YM1A 4LPZA 4U3TA 3M2JA 1FOFA 5FATA 2L1MA 4HBUA 1SDEA 5A92A 5TFQA 1E25A 2QPNA 2ZQDA 3MF0A 5EFWA 1CI8A 2V1ZA 2DRWA 3EEHA 3U4LP 2Y55A 2XFTA 3T50A 4ZAMA 3C7UA 3F1OA 4AFIA 1ZTUA 4OQIA 4WZ5C 5FQIA 3F1NA 1FCNA 4IJGA 4KQRA 1DJCA 1I2SA 5GLBA 4H6JA 5KSHA 1NYMA 3PBQA 1KGEA 1OPXA 5EOOA 1I5QA 4Y0UA 5CGSA 4EXOA 1LI9A 1Y54A 3MR0A 5AQ9A 1S67L 4QPRA 3BLMA 4E3MA 3GRJA 5GLAA 4OQHA 3UPOA 5EUAA 4OONA 3NDEA 2EWVA 5I94A 1N9BA 3BEBA 1L0EA 3KYQA 5LBRA 2R78A 3CUEC 5A8BA 4ETZA 4S2LA 5EV0A 2V0UA 4P6ZS 1H0MA 2VKSA 4UA7A 4CJNA 2ZC3B 1O07A 4XUZA 3HLGA 3V39A 3H9WA 1K4FA 4ZJ3A 1T1AA 1YLWA 3HLEA 4A5RA 4Y17A 4BQMA 4EUZA 3LO7A 2BASA 3CWFA 2NUTC 4DXBA 4E3IA 4P87A 4KZAA 1MY8A 4WZ4A 5GLCA 4X25A 2AVXA 3BM6A 4MMNA 5HAPA 3LR5A 5EECA 1NJ4A 4CQHA 2HP9A 2Y2MA 1OJGA 2ACGA 3T1SA 1H8MA 4X69A 4ETXA 3OCNA 3A0VA 2GZAA 3AGFA 3QHYA 2I72A 1PZOA 5C5KA 1A0KA 1WA9A 4NKPA 4FH4A 2WZZA 4RYEA 3OPLA 4O8GA 2W1TB 3ZG9B 3DWZA 2YKHA 3OPPA 1LHYA 2B18A 3PXPA 2FH5A 4ESPA 2H0YA 3E98A 4JXSA 1OJ5A 1SKOB 2Y2HA 3P01A 3UY6A 5M18A 1IOUA 1SHVA 3AGEA 2R9XA 3VP3A 1W63M 1IKIA 2PR6A 3CLOA 3CMZA 4OPRA 1DY6A 4QHCA 1MWRA 4DJ3A 4DN0A 2XLNA 1P0ZA 2WAFA 1OT6A 1K56A 1QMEA 2KX6A 2P7JA 4PM8A 2XROA 1ZG4A 1DP6A 3JVVA 1HLUP 2RL3A 5HFOA 3TOIA 3E0YA 4K91A 4DF6A 3N8SA 4DDYA 1KE4A 1K56D 1SCWA 4JLFA 5TBMB 3R7WA 3O5YA 1SZVA 3O86A 4IUHA 4RA7A 4FD8A 2VGLS 2VV7A 2V1BA 1IYSA 3UO9A 1XJ2A 5FA7A 3NOPC 5HWWA 1FCMA 4ZDXA 2O9BA 3FYZA 2ZM2A 3GV9A 3OPHA 4GN2A 4GJ4A 3WRZA 4O01A 3NI9A 3MQQA 1NWZA 1RGYA 3LIDA 4JGPA 4EERA 3PHYA 5HX9A 1KE0A 2ZM0A 3CG5A 1FCOA 3DW0A 4HY8A 5GHXA 2ZMVA 4HH2A 3UB7A 2J3WA 5CX7A 5G4YA 4CLCC 3A3DA 1WE4A 5CHJA 3KYZA 2Z2MB 3IBJA 1T1BA 2Y2GA 3NOTC 1G28A 4KQQA 3IF6A 1SKFA 4EBLA 1L3LA 2PR5A 4BL2A 2WKQA 1S66L 2EX8A 1BTLA 2ZM8A 3G30A 2HDSA 4BL3A 3H82A 4YOFA 1XGJA 2W0NA 2PBDP 4KG6A 5DJUA 2D01A 5HWTA 3IXDA 2XH9A 1NRJA 1YT4A 3SS3A 2WKRA 4FTXA 2VK3A 4GOGA 3LY4A 4WUJA 2W27A 4DE1A 4FCFA 4HOIA 1G6AA 3A3JA 3O87A 1S4RA 4M3KA 5CGXA 3Q81A 1GHIA 3VFHA 4OPQA 4X1LA 1E4DA 1UGUA 3LEZA 2Y8HA 1ALQA 2PD8A 2VV6A 3UDIA 1OTBA 4HP4A 2Q9NA 2WKEA 4JXWA 2DCFA 1FR6A 4Y0TA 3EQVA 2WUQA 3MFDA 1OTIA 3FKWA 4MN6A 4QY5A 2A24A 3RFBA 1W8YA 3JYIA 1TS7A 4X56A 5HWVA 2C5WB 2M7VA 2OAP1 1NRFA 2JKFA 3T4OA 2WZXA 1MXOA 1L0FA 2XEPA 1PI5A 4HQAA 1YSPA 1KVLA 2EFXA 4CLCE 4PPRA 3Q07A 2JE5A 4XT2A 3MXQA 3UB6A 1W8QA 2ZJ9A 3QNCA 1QMFA 2HV1A 4JGQA 1XFNA 3LIBA 2VZWA 3LY3A 3GVBA 4MDZA 2Q9MA 2J7VA 2UWXA 1XX2A 2ZQ9A 2PBYA 1ERQA 5L10A 1HTZA 3NC8A 4KUOA 1GHPA 3HUNA 4X1MA 3M6BA 3MKFA 5FAQA 3VMAA 3Q7VB 1RP5A 2HDUA 3NJAA 5FQ9A 4WZ5A 1CK3A 5J7EA 3G2YA 4Y5FA 2XD5A 2QJ7A 2OLUA 1YAXA 2D02A 4FSFA 1HVBA 2E8JA 3C2WA 2VX8A 4XT2B 4KUKA 3UB8A 3UE6A 3GMWA 1SDNA 3C30A 4KG2A 1XXMA 4WBGA 3IXHA 2KDKA 2P9VA 5L2FA 4X55A 4F94A 3MZFA 5K5BA 1S0WA 3ZCZA 1JVJA 3KX0X 3NULA 3UB5P 2WGIA 4E6WA 3H7WA 4P6ZM 4PHTA 4NEED 3IS2B 4OP8A 1N9OA 1XGIA 2OOLA 3FPWA 4MCWA 2JHEA 3OCLA 1K55A 5IT5A 1IFQA 1YMXA 2XGNA 3HLFA 1ODVA 3MXRA 1G5UA 1BLSA 3ULFA 1KDSA 5FAPA 3VFFA 4BD0A 2O99A 1WYBA 1BZAA 2X02A 1NZUA 4OOMA 3EGDC 2HDRA 3C5AA 3MZEA 3I7JA 3VE4A 1K6SA 3T1QB 3Q7VA 3LI8A 3T12B 3LEQA 3ZNYA 5IU1A 1BUEA 2Y79A 3HLBA 2WGWA 2M1CA 3K2NA 4D60A 3N4IA 4JPMA 3SS4A 4NG2A 4JF5A 3SH7A 4DKIA 5KIZA 2BLSA 3BYDA 5KZHA 2V2FF 5HZHA 2WYXA 4QD4A 3ZVWA 3QNBA 3W4QA 3T4QA 4BJPA 1TF1A 2YKFA 4GD8A 2V0WA 4YWZA 5U47A 3NECA 5FL3A 3UMDA 3EWKA 1VM1A 2IA2A 4L0LA 3WRTA 1XA1A 1SKOA 5FSRA 3C8CA 4N9KA 3HCYA 3D4FA 1GHMA 1ES2A 3QP2A 1F2KA 1NY0A 3VP4A 2JKGA 4JF6A 2H5SA 4I38A 1OTAA 4GS9A 3MQ0A 5F1GA 5M19A 3GECA 3IX4A 5CEDA 1PI4A 4CPKA 4NK3A 1MBLA 3IF5A 4RX2A 5IS1A 1CI9A 4ME4A 3BWLA 4QB8A 4R0QA 1KOUA 3LIAA 2O0YA 3UE0A 1JWZA 4WYYA 1BSGA 1IKGA 1Q2QA 5HPIA 1VB6A 3Q82A 5I5LA 4KENB 4PKYG 1ES5A 4PM6A 3HJKA 5JYOA 4WL9A 2ZL1B 3PTEA 4EW7A 4GLQA 4E3OA 4R1GA 1YLTA 4LRYC 3A3EA 4K0WA 5E2GA 1NLZA 4KZBA 2W3HA 2V1AA 3MMHA 5CECA 4UA9A 4EESA 3BJNA 2Y2LA 2RCXA 2MJ6A 2Q0OA 1GSWA 4Z1WA 4KZ7A 4YFMA 3TG9A 2EWWA 4G3WA 1T19A 2IWBA 2XDMA 2ZQ8A 2ZLYA 1T1CA 4E3JA 2Y2KA 3ZG7B 4OQ0A 1IYPA 3LYXA 4C6YA 1TS8A 1XJ4A 3OBFA 3E2KA 2V9AA 1AXBA 2HPBA 3Q7ZA 3LUQA 1JTDA 3P7NA 4LV3A 4IHQA 1FIKA 1H3QA 2QJ5A 2NUPC 3TW8A 4L9EA 1P97A 1H5XA 3H82B 5EVIB 2IWDA 4M4XA 3S4XA 4GW9A 2EFUA 3PBRA 1CF0A 4E3LA 1PWCA 3A3FA 4LV1A 2OWHA 5IHVA 5CHMA 3IWIA 3HLDA 4UAAA 2BTFP 1W63Q 1LSXA 3UE1A 4OH0A 4ZJ1A 1XJ3A 1NZOA 2R9WA 4I39A 5EM1A 4Y2FA 2GNXA 4NXGA 4HP9A 4WF0A 2JKRM 4HBTA 3B3XA 2EXAA 5EPHA 3LICA 1GA9A 4ID4A 3G4PA 5CEBA 1RGZA 5HAIA 4CLCD 5KSCA 2WK0A 1XKZA 3BRMA 1K4EA 3LCEA 2W3FA 4ZJ2A 4JGRA 3IH9A 3MFXA 4GHIB 5EVIA 2Y59A 2JC7A 4PMAA 3E4PA 5CGWA 4YNRA 3PYPA 3K3CA 4UA6A 3TJZC 5TBMA 3MJQA 3R7WB 1W79A 4L9FA 4X68A 3LFVA 3VP0A 4LRZE 4FOFA 4LLOB 5DTKA 1K6RA 2WAEA 1S6RA 3E2LA 1DJBA 4HJ4A 4RQ9A 1F5MA 4FUWA 4EUVA 3OZHA 4ZRRA 1K55C 5DVAA 2VA0A 3S7PA 4XUXA 2G2WA 4R3BA 3G35A 3ITAA 2V8FA 5FI7A 1PZPA 3HUMA 2Z6DA 4GDNA 1IYOA 1DP9A 2J9PA 2WKHA 2XD1A 5L09A 1G6OA 4MNRA 3EQUA 3ICYA 1XFQA 5DF7A 3UN7A 3BFEA 4KQDA 3QP1A 1YLPA 3C4PA 3QP8A 1Q2PA 1PIOA 4JF4A 5AVEA 3NY4A 3FG8A 1M40A 3SS5A 2XA7M 2UV0E 3GR2A 4Y13A 5G4ZA 3BLSA 4ARZA 2Y2QA 1HD8A 3B47A 4G3VA 3MQOA 2XRNA 1K25A 1PNEA 3VV4A 5D3OA 5EVIC 1V9ZA 2ZMAA 2H28A 3DAVA 3JPUA 1L0DA 3S1YA 3G34A 4HIAA 5DKLA 4PKYA 3AGDA 3E4QA 4CLCB 4MBFA 2P04A 3D3OA 3DTMA 2JKTM 3CI6A 2VJWA 3G32A 2QYBA 3IWOA 1EROA 5CERA 4GD6A 2Y2JA 2ZQAA 2OSUA 2PDRA 3ZG5A 1P9RA 3DTIA 1BLCA 4BMWA 3IX3A 3ZNTA 2HZ5A 5F69A 1O7EA 4K08A 3S7QA 2VV8A 3GSGA 4KZ8A 1UWNX 3IHAA 1EI5A 2KOIA 1LL8A 3M6HA 4GKUA 3G2ZA 3G6OA 1J9MA 3KO6A 2O9CA 3BECA 2Y2IA 3T1XA 1YLZA 1ERMA 5FQQA 3CAXA 4Q8IA 4EQ1A 4Y3IA 2IWCA 4LGWA 5HPFA 3LGOA 4Y7PA 4KZ3A 3ZDJA 3UMEA 1VEUA 5G18A 3EEAA 5HL1A 2GDNA 4OP5A 4B93A 1FR1A 5FDSA 1PFLA 3FV7A 3GDIA 1K54A 4I5SA 2FFFB 2XF3A 1C3BA 1JWVA 1E3UD 1YSQA 5EVLA 1PWGA 1YPRA
chains in the Genus database with same CATH topology
2BASA 3CWFA 2NUTC 1GSXA 5HZHA 3KSFA 3K3DA 1N9LA 4I3JA 2K31A 3T4QA 3LR4A 4BJPA 2CMNA 1TF1A 2YKFA 3PBTA 2V0WA 4E04A 4YWZA 3BQAA 3W2ZA 4L9GA 4MMNA 3OLOA 3LR5A 5FL3A 3UMDA 3EWKA 4CQHA 2IA2A 2ZOHA 4L0LA 5DFXA 3BQ8A 1OJGA 1MZUA 3C8CA 1H8MA 5F5YA 3HCYA 4B9OA 1DRMA 4ETXA 4MN7A 3OCNA 5HD3A 3A0VA 5MC7A 2GZAA 3S7OA 4I38A 3V67A 1OTAA 3LR0A 5L8MA 4GS9A 3MQ0A 5C5KA 2K7SA 3GECA 4HH3A 1V9YA 1WA9A 1S4SA 5HDCA 4NKPA 1S1YA 4R3AA 1UWPX 3DBAA 5IS1A 3EOIA 4O8GA 4ME4A 2W1TB 3BWLA 1JNUA 2JKRI 4EEUA 1MC0A 2YKHA 1KOUA 2W1RA 2VEAA 3LIAA 1OT9A 2B18A 2O0YA 1BYWA 3PXPA 2FH5A 3ZYTA 3E98A 4JGOA 4O0PA 1OJ5A 2QKPA 3P01A 5HPIA 1VB6A 3T4JA 3UE3A 1IOUA 5AJGA 5I5LA 4Q0IA 4PKYG 1W63M 2P08A 3BY9A 5DKKA 2LB5A 2PR6A 3HJKA 3CLOA 3T4SA 3T4TA 4WL9A 1D7EA 4DJ3A 2J3TC 4DN0A 2VGLM 4F3LB 1P0ZA 5HDDA 4EW7A 1OT6A 4GLQA 4R70A 1Y28A 4WEJA 4R6LA 2M7UA 2KX6A 1STZA 2P7JA 4LRYC 2PD7A 2XROA 2LB9A 1DP6A 4UQIS 1EW0A 3JVVA 3ZQ5A 2Z6CA 5F6AA 4I3AA 1NLZA 4OOLA 2W3HA 2V1AA 3MMHA 3EGXC 4EESA 3BJNA 3E0YA 5F68A 1X0OA 3HJIA 4DMZA 3F1PB 2MJ6A 3IS2A 5DFYA 3C38A 5TBMB 1GSWA 4Z1WA 4WEKA 3R7WA 4IUKA 3UB9A 3PBNA 3OC2A 3O5YA 2EWWA 4G3WA 3IBRA 1T19A 2PYPA 4IUHA 2VGLS 2VLGA 2VV7A 1MKMA 2HGVA 2V1BA 4R38A 1T1CA 4LRXC 2HJEA 1OTDA 4BBTA 1XJ2A 3NOPC 4UQIM 4H6JB 5HWWA 3LYXA 1TS8A 4BBUA 4EU0A 1XJ4A 3T4LA 2O9BA 4MN5A 2L4RA 3OBFA 2V9AA 3LUQA 3BY8A 4GJ4A 3P7NA 4O01A 3MQQA 1NWZA 2HJ9C 4IHQA 3LIDA 1H3QA 3NHQA 2QJ5A 4JGPA 4EERA 1GSVA 3PHYA 2NUPC 3TW8A 2G7UA 4CLCA 2ZMFA 4L9EA 1P97A 1DP8A 4NXFA 4HY8A 4NXEA 3H82B 4M4XA 4GW9A 2EA9A 3PBRA 3R4KA 2ZMVA 4HH2A 1ZHHB 3UB7A 2J3WA 5CX7A 5G4YA 3NOUC 2OWHA 4CLCC 3KYZA 1LSVA 1W63Q 2PHYA 1LSXA 3IBJA 1T1BA 4GCZA 1TS0A 3NOTC 5J4EA 1XJ3A 4HI4A 1G28A 1VHMA 4NXBA 3S7NA 4HJ3A 1F9IA 4I39A 4Y2FA 4GHIA 2PR5A 2GNXA 4G3KA 4NXGA 4HP9A 2WKQA 2DMWA 1S66L 2L0WA 2JKTI 4WF0A 2JKRM 2KLIA 3H82A 4YOFA 3VOLA 2W0NA 4EEPA 3OOVA 4PAUA 3LICA 5DJUA 2D01A 1N9NA 3F1PA 2OAQ1 5HWTA 2K2NA 1NRJA 4II7A 2PYRA 5HDSA 3VE3A 4DJ2A 4CLCD 2WKRA 3A0SA 4UEYA 4GS9B 4WUJA 3JVUA 2W27A 4HOIA 3LI9A 2W3FA 4EETB 4JGRA 1S4RA 2WKPA 3MFXA 4GHIB 2PT7A 2XA7S 3E4PA 1UGUA 4YNRA 3PYPA 3K3CA 3TJZC 2Y8HA 5TBMA 3MJQA 2PD8A 3R7WB 2VV6A 4L9FA 3E4OA 3LFVA 1OTBA 4HP4A 1S1ZA 4FOFA 4LLOB 4LRZE 1LT0A 3FPVA 3EQVA 3RH8B 1OTIA 2W3DA 4MN6A 2A24A 2J80A 4HJ4A 2I9VA 4Q0JA 1F5MA 4RQ9A 3RFBA 2QWSA 4EUVA 1OTEA 1TS7A 5HWVA 4ZRRA 1D06A 2M7VA 2OAP1 2W1TA 2VA0A 3PBSA 3T4OA 3S7PA 2HF6A 1TD5A 2INWA 2J3TD 5HSQA 3A0RA 2A24B 2QHKA 4HQAA 1YSPA 5DJTA 3RTYA 4CLCE 2Z6DA 1DP9A 4XT2A 1XJ6A 3MXQA 3F1OB 1T18A 5HD5A 3UB6A 1G6OA 1YKDA 4WELA 2HV1A 3EQUA 3KSIA 3ICYA 1XFQA 3LIBA 1XFNA 4JGQA 2O9AA 2VZWA 3U2AA 4BWIA 1P9WA 3PBOA 4ARZB 4KQDA 2FZ0A 4MDZA 4F3LA 1F98A 5AVEA 3FG8A 3KSHA 2XA7M 4I3IA 5G4ZA 4KUOA 4ARZA 2JN7A 3B47A 2W3GA 4G3VA 3TE8A 3SW1A 3NJAA 3MQOA 2XRNA 5J7EA 3VV4A 4BBVA 4WN5A 1V9ZA 4WLAA 4Y5FA 2H28A 3BW6A 2A2LA 4LPZA 3CUEA 2L1MA 4HIAA 5DKLA 4PKYA 2QJ7A 3E4QA 4CLCB 2P04A 1LSWA 1YAXA 2XSSA 3T4KA 3D3OA 2W3EA 3MF0A 5HL6A 2JKTM 2D02A 5EFWA 3PR6A 5AVFA 3EEHA 3CI6A 4FSFA 2VJWA 3C2WA 2VX8A 2QYBA 4XT2B 3T50A 4KUKA 3UB8A 3F1OA 3UE6A 3C30A 4AFIA 5DF9A 1ZTUA 2KDKA 3B42A 2PDRA 3F1NA 4IJGA 1P9RA 3LIEA 3CITA 5K5BA 4BMWA 3KX0X 3FC7A 4H6JA 5KSHA 4HNBA 1NLYA 5F69A 3PBQA 2ZBBA 1TS6A 4K08A 1OPXA 3S7QA 2VV8A 5J3WA 3H7WA 4P6ZM 1UWNX 2GX5A 4PHTA 4NEED 3IS2B 4Q0HA 2KOIA 4EXOA 3MR0A 1N9OA 1LL8A 1S67L 3KSGA 4QPRA 2OOLA 2GJ3A 3G6OA 4KQOA 3FPWA 3TRCA 2ZOIA 4MCWA 2JHEA 3KO6A 3OCLA 3H7WB 2O9CA 5IT5A 1IFQA 3LR3A 2OWJA 1ODVA 2EWVA 3B33A 3ULFA 2O99A 3KYQA 3F1NB 5LBRA 2R78A 3CAXA 3CUEC 5A8BA 2B02A 4ETZA 4OOMA 3EGDC 3D72A 3LIFA 2V0UA 3VE4A 4EQ1A 4Y3IA 4P6ZS 5HPFA 2VKSA 3LI8A 3UMEA 4HJ6A 5IU1A 2Y79A 3EEAA 4B93A 2M1CA 3K2NA 3GDIA 4I5SA 3H9WA 4HHDA 5KIZA 1T1AA 1YSQA 5TJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EES A;  3A0S A;  5F68 A;  4GS9 B;  1X0O A;  2BAS A;  3CWF A;  4LPZ A;  1GSX A;  4WUJ A;  3HJI A;  2W27 A;  5HZH A;  2L1M A;  3F1P B;  3K3D A;  4HIA A;  2QJ7 A;  3E4Q A;  3IS2 A;  3LI9 A;  1N9L A;  4HOI A;  4PKY A;  5TBM B;  1GSW A;  4I3J A;  4EET B;  1LSW A;  4JGR A;  1S4R A;  2WKP A;  3UB9 A;  2CMN A;  3MFX A;  2YKF A;  4GHI B;  2D02 A;  2V0W A;  1T19 A;  2PYP A;  3E4P A;  3IBR A;  5EFW A;  4YWZ A;  4E04 A;  2VLG A;  2VV7 A;  1UGU A;  2V1B A;  3EEH A;  3PYP A;  3K3C A;  5AVF A;  4R38 A;  4L9G A;  1T1C A;  3OLO A;  3C2W A;  4LRX C;  5TBM A;  3MJQ A;  2PD8 A;  3EWK A;  2VV6 A;  4XT2 B;  1OTD A;  4KUK A;  1XJ2 A;  3F1O A;  3NOP C;  2ZOH A;  4L9F A;  3T50 A;  3UB8 A;  3E4O A;  4H6J B;  3UE6 A;  5DKL A;  3LYX A;  5HWW A;  1TS8 A;  4BBU A;  1OTB A;  4HP4 A;  5HD3 A;  1OJG A;  1S1Z A;  1XJ4 A;  2KDK A;  2PDR A;  4LLO B;  1MZU A;  4LRZ E;  3C8C A;  1LT0 A;  3F1N A;  2L4R A;  4MN5 A;  5F5Y A;  3RH8 B;  2V9A A;  4B9O A;  1DRM A;  1OTI A;  3LIE A;  3LUQ A;  4MN6 A;  3BY8 A;  2A24 A;  2J80 A;  3A0V A;  2I9V A;  3FC7 A;  3KX0 X;  3P7N A;  4H6J A;  4HJ4 A;  4RQ9 A;  2QWS A;  1OTE A;  1TS7 A;  4HNB A;  5HWV A;  4I38 A;  1D06 A;  5F69 A;  3MQQ A;  1NWZ A;  1TS6 A;  1OTA A;  2ZBB A;  3LID A;  3NHQ A;  4GS9 A;  4K08 A;  2QJ5 A;  2VV8 A;  4JGP A;  4EER A;  5J3W A;  3H7W A;  1GSV A;  2K7S A;  3PHY A;  3GEC A;  1UWN X;  3IS2 B;  4HH3 A;  1V9Y A;  1WA9 A;  2INW A;  4EXO A;  5HSQ A;  4L9E A;  1P97 A;  1S4S A;  5HDC A;  1DP8 A;  1N9O A;  3MR0 A;  1LL8 A;  1S67 L;  2A24 B;  1S1Y A;  2QHK A;  2OOL A;  3A0R A;  2GJ3 A;  4HQA A;  4HY8 A;  3H82 B;  4NXE A;  4R3A A;  1UWP X;  3G6O A;  4M4X A;  5DJT A;  5IS1 A;  4GW9 A;  2EA9 A;  3RTY A;  3BWL A;  2ZOI A;  2JHE A;  1JNU A;  4HH2 A;  3H7W B;  4EEU A;  2Z6D A;  3UB7 A;  2YKH A;  1KOU A;  1DP9 A;  1ODV A;  2OWJ A;  2VEA A;  4XT2 A;  1XJ6 A;  3LIA A;  1OT9 A;  3B33 A;  3F1O B;  3MXQ A;  1T18 A;  2OWH A;  1BYW A;  3NOU C;  5G4Y A;  5HD5 A;  3UB6 A;  4DJ2 A;  2HV1 A;  4JGO A;  1OJ5 A;  2QKP A;  1LSV A;  2PHY A;  1LSX A;  3ULF A;  1VB6 A;  3ICY A;  1XFQ A;  1XFN A;  3LIB A;  4JGQ A;  1T1B A;  4GCZ A;  1TS0 A;  3F1N B;  2R78 A;  3NOT C;  5J4E A;  1XJ3 A;  4HI4 A;  1G28 A;  3CAX A;  4KQD A;  4NXB A;  5I5L A;  2B02 A;  4PKY G;  5A8B A;  4HJ3 A;  1F9I A;  4F3L A;  3D72 A;  4BBT A;  4I39 A;  3LIF A;  1F98 A;  2V0U A;  3BY9 A;  5AVE A;  3FG8 A;  2PR6 A;  3HJK A;  4GHI A;  3CLO A;  5DKK A;  3VE4 A;  4EQ1 A;  2PR5 A;  4NXG A;  3LI8 A;  4HP9 A;  3UME A;  2WKQ A;  4I3I A;  4WL9 A;  1D7E A;  5G4Z A;  4KUO A;  1S66 L;  4DJ3 A;  2L0W A;  4HJ6 A;  4F3L B;  1P0Z A;  5IU1 A;  5HDD A;  4WF0 A;  4EW7 A;  1OT6 A;  2JN7 A;  4R70 A;  3H82 A;  1Y28 A;  4EEP A;  3VOL A;  2W0N A;  4R6L A;  2KX6 A;  2M1C A;  3LIC A;  3UMD A;  5DJU A;  2D01 A;  3SW1 A;  2P7J A;  3MQO A;  3GDI A;  3NJA A;  4LRY C;  2PD7 A;  4NXF A;  1N9N A;  4I5S A;  3F1P A;  3H9W A;  4HHD A;  5J7E A;  1DP6 A;  5HWT A;  1EW0 A;  3ZQ5 A;  4BBV A;  2Z6C A;  4WN5 A;  5F6A A;  4I3A A;  5KIZ A;  1T1A A;  1V9Z A;  2PYR A;  4WLA A;  5HDS A;  2H28 A;  2V1A A;  3VE3 A;  2WKR A; 
#chains in the Genus database with same CATH topology
 5FDH A;  3FWL A;  3QP4 A;  2A3U A;  1GSX A;  3IWQ A;  1YLJ A;  3KSF A;  1N9L A;  3IF6 B;  4XXR A;  2K31 A;  3LR4 A;  2X01 A;  4S2O A;  3PBT A;  2C6W B;  4P85 A;  4L9G A;  3OLO A;  3KYE A;  2ZOH A;  3ISG A;  1NYY A;  1MZU A;  3N6I A;  4MN7 A;  5HD3 A;  5DF8 A;  3UDX A;  1CEG A;  3V67 A;  4EWF A;  4GZB A;  1VEU B;  3FZC A;  2J8Y A;  5HDC A;  4KZ9 A;  3DBA A;  3HRE A;  1MWS A;  3EOI A;  2OLV A;  4C3Q A;  2JKR I;  1HZO A;  3WS5 A;  3ZFZ A;  3HL9 A;  5BOH A;  4LCL A;  3ZYT A;  2JCH A;  4O0P A;  5EM0 A;  2QKP A;  3V5M A;  3T4J A;  5CHU A;  3UE3 A;  1BUL A;  1KE3 A;  2WGV A;  2P08 A;  5FQJ A;  5A91 A;  3WS2 A;  1ES3 A;  3T4S A;  1FSY A;  2J3T C;  2VGL M;  4OPZ A;  5HDD A;  3MSH A;  4GNU A;  3O3V A;  2M7U A;  1VET B;  2B95 A;  3T1R A;  1YLY A;  4S2N C;  2PU4 A;  2Y91 A;  2PD7 A;  3VSK A;  2LB9 A;  1EW0 A;  2Z6C A;  5F6A A;  4OOL A;  2BG1 A;  1X0O A;  2V8C A;  3HJI A;  3RXX A;  4DMZ A;  1H8Z A;  5EE8 A;  3UB9 A;  3OC2 A;  3PBN A;  2OV5 A;  3IBR A;  3DWK A;  1BLP A;  1TVF A;  2HGV A;  4R38 A;  2HJE A;  4UQI M;  5CTM A;  5E2H A;  4RX3 A;  3CPT A;  4BBU A;  4EU0 A;  1L0G A;  3W4O A;  4OPY A;  3T4L A;  4MN5 A;  2L4R A;  4YIN A;  4S2M A;  2PAV P;  4OQG A;  3BY8 A;  1CJF A;  4QWO A;  4EBP A;  2HJ9 C;  4MBK A;  3L9K A;  4JXG A;  4NXF A;  1EWZ A;  4N9L A;  3GQZ A;  4S2P A;  1IEL A;  2QMI A;  5FQK A;  5FI6 A;  5EVI D;  3NOU C;  4U0X A;  1LL9 A;  4GCZ A;  5J4E A;  4HI4 A;  4NXB A;  1VHM A;  2JBF A;  3P09 A;  4HJ3 A;  5DTS A;  1F9I A;  1LL5 A;  4GHI A;  1VET A;  3PAG A;  5F1F A;  4G3K A;  3UDF A;  4BD1 A;  4IBX A;  1Z6F A;  2JKT I;  5GHZ A;  5A93 A;  4QY6 A;  2KLI A;  3HLC A;  4EEP A;  3VOL A;  5L07 A;  3OOV A;  3GTC A;  2OAQ 1;  5TGF A;  3IXG A;  5HDS A;  2PYR A;  5M1A A;  3VE3 A;  5GL9 A;  5HAQ A;  3A0S A;  1I2W A;  3JVU A;  1DJA A;  2FFY A;  3LI9 A;  4EET B;  1ZG6 A;  2WKP A;  1XP4 A;  4LFU A;  4JKT A;  1M6K A;  2PT7 A;  2XA7 S;  4HEF A;  4DRT A;  2PRF A;  5FEF A;  1PWD A;  4S2N A;  5HW3 A;  3UNW A;  1S1Z A;  4P0M A;  4NET A;  3VOZ A;  1LLB A;  1LT0 A;  3FPV A;  4RVA A;  2W3D A;  2VGK A;  5E2E A;  1ESI A;  2QWS A;  1OTE A;  3PBS A;  2HF6 A;  2EX2 A;  5HSQ A;  4BLM A;  5KMW A;  1ONG A;  2A24 B;  5JYP A;  1WYC A;  3MBZ A;  1NXY A;  2Z2L B;  3RTY A;  1TDL A;  3RXW A;  1XA7 A;  4FH2 A;  3UPN A;  3ZG0 A;  4WEL A;  3V3S A;  4B88 A;  2O9A A;  5GLD A;  4GB7 A;  4F3L A;  3UPP A;  1F98 A;  3W4P A;  3KSH A;  1JTG A;  4C75 A;  4IVK A;  4I3I A;  1MWT A;  3NIA A;  4GDB A;  2EX6 A;  2JN7 A;  1PYY A;  2W3G A;  4S2J A;  3TE8 A;  1H8Y A;  4DE0 A;  2ZD8 A;  5AQB A;  4WN5 A;  2HP6 A;  1CEF A;  3IH8 A;  4MBH A;  4KZ5 A;  3BFF A;  5FAO A;  3CUE A;  4QJG A;  1L2S A;  1N4O A;  4Y0O A;  1LSW A;  3IQA A;  2XSS A;  3T4K A;  2W3E A;  5HL6 A;  3D9Y A;  1PW1 A;  3PR6 A;  3C4O A;  5AVF A;  4X6T A;  3WS4 A;  4R4R A;  4LV0 A;  3G31 A;  5DF9 A;  1PRQ A;  3MKE A;  1J3W A;  3B42 A;  5A90 A;  3LIE A;  3CIT A;  1KGF A;  5TR7 A;  3FC7 A;  4HNB A;  1NLY A;  2ZBB A;  1TS6 A;  3C7V A;  5J3W A;  2GX5 A;  1RCJ A;  1MPL A;  3L7H A;  4Q0H A;  3KSG A;  1KDW A;  2GJ3 A;  4Z9Q A;  4LEN A;  4KQO A;  3MXS A;  3TRC A;  2ZOI A;  3SZT A;  3H7W B;  2EX9 A;  3HVF A;  3LR3 A;  2OWJ A;  3CJM A;  4KZ6 A;  3SH9 A;  4B4X A;  3B33 A;  3ZHH A;  4EQI A;  1ACF A;  5DTT A;  3F1N B;  2B02 A;  4OOY A;  3D72 A;  3RJU A;  2WGW B;  3LIF A;  4B4Z A;  3CZD A;  1CQA A;  3HUO A;  4R3J A;  4HJ6 A;  3BFD A;  4O7D A;  3ZG8 B;  2ZC5 B;  1XPB A;  4HHD A;  1FQG A;  3ZVT A;  5F83 A;  5TJJ A;  4OKP A;  3K3D A;  1KGG A;  4I3J A;  1MKI A;  2CMN A;  1OME A;  1ONH A;  5FQM A;  4E04 A;  3BQA A;  3W2Z A;  4S2K A;  1ZC2 A;  3QP6 A;  2B5R A;  2CC1 A;  5DFX A;  3BQ8 A;  1YMS A;  2V20 A;  5F5Y A;  2Y4A A;  4B9O A;  1DRM A;  5EOE A;  3VSL A;  5MC7 A;  4JXV A;  3S7O A;  2Y2N A;  3LR0 A;  5L8M A;  1VQQ A;  2K7S A;  2A49 A;  4HH3 A;  5CXW A;  1V9Y A;  1S4S A;  4WMC D;  4E6X A;  1S1Y A;  3BFG A;  5E43 A;  4R3A A;  1UWP X;  3SOI A;  4IVI A;  3N8R A;  1K57 A;  1JNU A;  3NDG A;  4EEU A;  1MC0 A;  2W1R A;  3A3I A;  2VEA A;  3P98 A;  1OT9 A;  1BYW A;  4JGO A;  1TEM A;  1FIL A;  1MWU A;  2G2U A;  4Y15 A;  5AJG A;  4S2I A;  4E3N A;  1Y4O A;  4Q0I A;  5J8X A;  3BY9 A;  5DKK A;  2LB5 A;  4BEN A;  4R23 A;  3T4T A;  1D7E A;  3IX8 A;  2ZQC A;  5CRF A;  1AWI A;  4F3L B;  3HLW A;  4R70 A;  1Y28 A;  4WEJ A;  1K0K A;  4R6L A;  4KZ4 A;  1STZ A;  2P9V B;  2XQZ A;  3W8K A;  5CTN A;  4UQI S;  3ZQ5 A;  1Z09 A;  2ZC4 B;  4I3A A;  1ES4 A;  3NBL A;  4JBF A;  3EGX C;  3TSG A;  2Y2O A;  4WMC A;  5F68 A;  4D2O A;  1BT5 A;  2EXB A;  3N8L A;  3F1P B;  3IS2 A;  5DFY A;  3C38 A;  4WEK A;  4IUK A;  1E3U A;  2PYP A;  2VLG A;  1MKM A;  4N92 A;  3VP1 A;  3V3R A;  4LRX C;  4EBN A;  1OTD A;  4BBT A;  3DTK A;  4H6J B;  2P74 A;  4PM7 A;  2ZC6 B;  4H8R A;  4N1X A;  1PW8 A;  2HP5 A;  3HBR A;  3NHQ A;  1LI0 A;  5FAS A;  3OPR A;  1GSV A;  2G7U A;  4CLC A;  2ZMF A;  1DP8 A;  3N7W A;  4E3K A;  2QZ6 A;  3IHB A;  4NXE A;  3ITB A;  3IXB A;  2EA9 A;  3R4K A;  3NCK A;  1ZHH B;  3IF6 C;  1BLH A;  5AQ7 A;  2WKI A;  2PU2 A;  2E8I A;  1LSV A;  2PHY A;  1TS0 A;  4ZTK A;  2X71 A;  3S7N A;  1ESU A;  3IT9 A;  4X53 A;  3ZGA B;  4DDS A;  1U60 A;  3O88 A;  2H0T A;  3FKV A;  2DMW A;  2L0W A;  1ZKJ A;  2ZQ7 A;  1G68 A;  4KG5 A;  4PAU A;  1N9N A;  1W5D A;  3F1P A;  1W7F A;  2K2N A;  2Y2P A;  4OLG A;  4HES A;  4II7 A;  4DJ2 A;  1IEM A;  2J9O A;  1GCE A;  4MLL A;  4UEY A;  4GS9 B;  2ZC7 A;  3BFC A;  3SH8 A;  4ZBE A;  4DXC A;  2ZL1 A;  4UHU A;  4MEZ A;  3E4O A;  2XFS A;  3DTE A;  4EV4 A;  3CHW P;  4PM5 A;  1JWP A;  3PAE A;  3RH8 B;  5AQA A;  1TDG A;  1GA0 A;  2J80 A;  4Q0J A;  2I9V A;  3M2K A;  3CPT B;  5EVE A;  1D06 A;  2W1T A;  3QP5 A;  4LV2 A;  1TD5 A;  2INW A;  2J3T D;  4IED A;  3A0R A;  2QHK A;  4N1H A;  3MZD A;  5GHY A;  5DJT A;  5HAR A;  3Q1F A;  3WS0 A;  1KVM A;  3MS6 A;  4LCM A;  1K54 C;  1XJ6 A;  4PM9 A;  5FI2 A;  3F1O B;  1T18 A;  5HD5 A;  1YKD A;  4P6B A;  4R4S A;  3KSI A;  4BWI A;  4DE3 A;  3VOY A;  2DNS A;  2WAD A;  3U2A A;  3WS1 A;  3WWX A;  1P9W A;  3PBO A;  4ARZ B;  3S22 A;  1K57 C;  4QU3 A;  5E2F A;  1K38 A;  2FZ0 A;  3VP2 A;  4K0X A;  1YQS A;  2VGJ A;  4OLD A;  2XK1 A;  1IYQ A;  2XR0 A;  3SW1 A;  2HDQ A;  1D1J A;  2H10 A;  5F82 A;  4BBV A;  1FSW A;  3V50 A;  4WLA A;  4U0T A;  5FEG A;  4OVD A;  3BW6 A;  4DE2 A;  4WM9 A;  4IBR A;  2A2L A;  1YM1 A;  4LPZ A;  4U3T A;  3M2J A;  1FOF A;  5FAT A;  2L1M A;  4HBU A;  1SDE A;  5A92 A;  5TFQ A;  1E25 A;  2QPN A;  2ZQD A;  3MF0 A;  5EFW A;  1CI8 A;  2V1Z A;  2DRW A;  3EEH A;  3U4L P;  2Y55 A;  2XFT A;  3T50 A;  4ZAM A;  3C7U A;  3F1O A;  4AFI A;  1ZTU A;  4OQI A;  4WZ5 C;  5FQI A;  3F1N A;  1FCN A;  4IJG A;  4KQR A;  1DJC A;  1I2S A;  5GLB A;  4H6J A;  5KSH A;  1NYM A;  3PBQ A;  1KGE A;  1OPX A;  5EOO A;  1I5Q A;  4Y0U A;  5CGS A;  4EXO A;  1LI9 A;  1Y54 A;  3MR0 A;  5AQ9 A;  1S67 L;  4QPR A;  3BLM A;  4E3M A;  3GRJ A;  5GLA A;  4OQH A;  3UPO A;  5EUA A;  4OON A;  3NDE A;  2EWV A;  5I94 A;  1N9B A;  3BEB A;  1L0E A;  3KYQ A;  5LBR A;  2R78 A;  3CUE C;  5A8B A;  4ETZ A;  4S2L A;  5EV0 A;  2V0U A;  4P6Z S;  1H0M A;  2VKS A;  4UA7 A;  4CJN A;  2ZC3 B;  1O07 A;  4XUZ A;  3HLG A;  3V39 A;  3H9W A;  1K4F A;  4ZJ3 A;  1T1A A;  1YLW A;  3HLE A;  4A5R A;  4Y17 A;  4BQM A;  4EUZ A;  3LO7 A;  2BAS A;  3CWF A;  2NUT C;  4DXB A;  4E3I A;  4P87 A;  4KZA A;  1MY8 A;  4WZ4 A;  5GLC A;  4X25 A;  2AVX A;  3BM6 A;  4MMN A;  5HAP A;  3LR5 A;  5EEC A;  1NJ4 A;  4CQH A;  2HP9 A;  2Y2M A;  1OJG A;  2ACG A;  3T1S A;  1H8M A;  4X69 A;  4ETX A;  3OCN A;  3A0V A;  2GZA A;  3AGF A;  3QHY A;  2I72 A;  1PZO A;  5C5K A;  1A0K A;  1WA9 A;  4NKP A;  4FH4 A;  2WZZ A;  4RYE A;  3OPL A;  4O8G A;  2W1T B;  3ZG9 B;  3DWZ A;  2YKH A;  3OPP A;  1LHY A;  2B18 A;  3PXP A;  2FH5 A;  4ESP A;  2H0Y A;  3E98 A;  4JXS A;  1OJ5 A;  1SKO B;  2Y2H A;  3P01 A;  3UY6 A;  5M18 A;  1IOU A;  1SHV A;  3AGE A;  2R9X A;  3VP3 A;  1W63 M;  1IKI A;  2PR6 A;  3CLO A;  3CMZ A;  4OPR A;  1DY6 A;  4QHC A;  1MWR A;  4DJ3 A;  4DN0 A;  2XLN A;  1P0Z A;  2WAF A;  1OT6 A;  1K56 A;  1QME A;  2KX6 A;  2P7J A;  4PM8 A;  2XRO A;  1ZG4 A;  1DP6 A;  3JVV A;  1HLU P;  2RL3 A;  5HFO A;  3TOI A;  3E0Y A;  4K91 A;  4DF6 A;  3N8S A;  4DDY A;  1KE4 A;  1K56 D;  1SCW A;  4JLF A;  5TBM B;  3R7W A;  3O5Y A;  1SZV A;  3O86 A;  4IUH A;  4RA7 A;  4FD8 A;  2VGL S;  2VV7 A;  2V1B A;  1IYS A;  3UO9 A;  1XJ2 A;  5FA7 A;  3NOP C;  5HWW A;  1FCM A;  4ZDX A;  2O9B A;  3FYZ A;  2ZM2 A;  3GV9 A;  3OPH A;  4GN2 A;  4GJ4 A;  3WRZ A;  4O01 A;  3NI9 A;  3MQQ A;  1NWZ A;  1RGY A;  3LID A;  4JGP A;  4EER A;  3PHY A;  5HX9 A;  1KE0 A;  2ZM0 A;  3CG5 A;  1FCO A;  3DW0 A;  4HY8 A;  5GHX A;  2ZMV A;  4HH2 A;  3UB7 A;  2J3W A;  5CX7 A;  5G4Y A;  4CLC C;  3A3D A;  1WE4 A;  5CHJ A;  3KYZ A;  2Z2M B;  3IBJ A;  1T1B A;  2Y2G A;  3NOT C;  1G28 A;  4KQQ A;  3IF6 A;  1SKF A;  4EBL A;  1L3L A;  2PR5 A;  4BL2 A;  2WKQ A;  1S66 L;  2EX8 A;  1BTL A;  2ZM8 A;  3G30 A;  2HDS A;  4BL3 A;  3H82 A;  4YOF A;  1XGJ A;  2W0N A;  2PBD P;  4KG6 A;  5DJU A;  2D01 A;  5HWT A;  3IXD A;  2XH9 A;  1NRJ A;  1YT4 A;  3SS3 A;  2WKR A;  4FTX A;  2VK3 A;  4GOG A;  3LY4 A;  4WUJ A;  2W27 A;  4DE1 A;  4FCF A;  4HOI A;  1G6A A;  3A3J A;  3O87 A;  1S4R A;  4M3K A;  5CGX A;  3Q81 A;  1GHI A;  3VFH A;  4OPQ A;  4X1L A;  1E4D A;  1UGU A;  3LEZ A;  2Y8H A;  1ALQ A;  2PD8 A;  2VV6 A;  3UDI A;  1OTB A;  4HP4 A;  2Q9N A;  2WKE A;  4JXW A;  2DCF A;  1FR6 A;  4Y0T A;  3EQV A;  2WUQ A;  3MFD A;  1OTI A;  3FKW A;  4MN6 A;  4QY5 A;  2A24 A;  3RFB A;  1W8Y A;  3JYI A;  1TS7 A;  4X56 A;  5HWV A;  2C5W B;  2M7V A;  2OAP 1;  1NRF A;  2JKF A;  3T4O A;  2WZX A;  1MXO A;  1L0F A;  2XEP A;  1PI5 A;  4HQA A;  1YSP A;  1KVL A;  2EFX A;  4CLC E;  4PPR A;  3Q07 A;  2JE5 A;  4XT2 A;  3MXQ A;  3UB6 A;  1W8Q A;  2ZJ9 A;  3QNC A;  1QMF A;  2HV1 A;  4JGQ A;  1XFN A;  3LIB A;  2VZW A;  3LY3 A;  3GVB A;  4MDZ A;  2Q9M A;  2J7V A;  2UWX A;  1XX2 A;  2ZQ9 A;  2PBY A;  1ERQ A;  5L10 A;  1HTZ A;  3NC8 A;  4KUO A;  1GHP A;  3HUN A;  4X1M A;  3M6B A;  3MKF A;  5FAQ A;  3VMA A;  3Q7V B;  1RP5 A;  2HDU A;  3NJA A;  5FQ9 A;  4WZ5 A;  1CK3 A;  5J7E A;  3G2Y A;  4Y5F A;  2XD5 A;  2QJ7 A;  2OLU A;  1YAX A;  2D02 A;  4FSF A;  1HVB A;  2E8J A;  3C2W A;  2VX8 A;  4XT2 B;  4KUK A;  3UB8 A;  3UE6 A;  3GMW A;  1SDN A;  3C30 A;  4KG2 A;  1XXM A;  4WBG A;  3IXH A;  2KDK A;  2P9V A;  5L2F A;  4X55 A;  4F94 A;  3MZF A;  5K5B A;  1S0W A;  3ZCZ A;  1JVJ A;  3KX0 X;  3NUL A;  3UB5 P;  2WGI A;  4E6W A;  3H7W A;  4P6Z M;  4PHT A;  4NEE D;  3IS2 B;  4OP8 A;  1N9O A;  1XGI A;  2OOL A;  3FPW A;  4MCW A;  2JHE A;  3OCL A;  1K55 A;  5IT5 A;  1IFQ A;  1YMX A;  2XGN A;  3HLF A;  1ODV A;  3MXR A;  1G5U A;  1BLS A;  3ULF A;  1KDS A;  5FAP A;  3VFF A;  4BD0 A;  2O99 A;  1WYB A;  1BZA A;  2X02 A;  1NZU A;  4OOM A;  3EGD C;  2HDR A;  3C5A A;  3MZE A;  3I7J A;  3VE4 A;  1K6S A;  3T1Q B;  3Q7V A;  3LI8 A;  3T12 B;  3LEQ A;  3ZNY A;  5IU1 A;  1BUE A;  2Y79 A;  3HLB A;  2WGW A;  2M1C A;  3K2N A;  4D60 A;  3N4I A;  4JPM A;  3SS4 A;  4NG2 A;  4JF5 A;  3SH7 A;  4DKI A;  5KIZ A;  2BLS A;  3BYD A;  5KZH A;  2V2F F;  5HZH A;  2WYX A;  4QD4 A;  3ZVW A;  3QNB A;  3W4Q A;  3T4Q A;  4BJP A;  1TF1 A;  2YKF A;  4GD8 A;  2V0W A;  4YWZ A;  5U47 A;  3NEC A;  5FL3 A;  3UMD A;  3EWK A;  1VM1 A;  2IA2 A;  4L0L A;  3WRT A;  1XA1 A;  1SKO A;  5FSR A;  3C8C A;  4N9K A;  3HCY A;  3D4F A;  1GHM A;  1ES2 A;  3QP2 A;  1F2K A;  1NY0 A;  3VP4 A;  2JKG A;  4JF6 A;  2H5S A;  4I38 A;  1OTA A;  4GS9 A;  3MQ0 A;  5F1G A;  5M19 A;  3GEC A;  3IX4 A;  5CED A;  1PI4 A;  4CPK A;  4NK3 A;  1MBL A;  3IF5 A;  4RX2 A;  5IS1 A;  1CI9 A;  4ME4 A;  3BWL A;  4QB8 A;  4R0Q A;  1KOU A;  3LIA A;  2O0Y A;  3UE0 A;  1JWZ A;  4WYY A;  1BSG A;  1IKG A;  1Q2Q A;  5HPI A;  1VB6 A;  3Q82 A;  5I5L A;  4KEN B;  4PKY G;  1ES5 A;  4PM6 A;  3HJK A;  5JYO A;  4WL9 A;  2ZL1 B;  3PTE A;  4EW7 A;  4GLQ A;  4E3O A;  4R1G A;  1YLT A;  4LRY C;  3A3E A;  4K0W A;  5E2G A;  1NLZ A;  4KZB A;  2W3H A;  2V1A A;  3MMH A;  5CEC A;  4UA9 A;  4EES A;  3BJN A;  2Y2L A;  2RCX A;  2MJ6 A;  2Q0O A;  1GSW A;  4Z1W A;  4KZ7 A;  4YFM A;  3TG9 A;  2EWW A;  4G3W A;  1T19 A;  2IWB A;  2XDM A;  2ZQ8 A;  2ZLY A;  1T1C A;  4E3J A;  2Y2K A;  3ZG7 B;  4OQ0 A;  1IYP A;  3LYX A;  4C6Y A;  1TS8 A;  1XJ4 A;  3OBF A;  3E2K A;  2V9A A;  1AXB A;  2HPB A;  3Q7Z A;  3LUQ A;  1JTD A;  3P7N A;  4LV3 A;  4IHQ A;  1FIK A;  1H3Q A;  2QJ5 A;  2NUP C;  3TW8 A;  4L9E A;  1P97 A;  1H5X A;  3H82 B;  5EVI B;  2IWD A;  4M4X A;  3S4X A;  4GW9 A;  2EFU A;  3PBR A;  1CF0 A;  4E3L A;  1PWC A;  3A3F A;  4LV1 A;  2OWH A;  5IHV A;  5CHM A;  3IWI A;  3HLD A;  4UAA A;  2BTF P;  1W63 Q;  1LSX A;  3UE1 A;  4OH0 A;  4ZJ1 A;  1XJ3 A;  1NZO A;  2R9W A;  4I39 A;  5EM1 A;  4Y2F A;  2GNX A;  4NXG A;  4HP9 A;  4WF0 A;  2JKR M;  4HBT A;  3B3X A;  2EXA A;  5EPH A;  3LIC A;  1GA9 A;  4ID4 A;  3G4P A;  5CEB A;  1RGZ A;  5HAI A;  4CLC D;  5KSC A;  2WK0 A;  1XKZ A;  3BRM A;  1K4E A;  3LCE A;  2W3F A;  4ZJ2 A;  4JGR A;  3IH9 A;  3MFX A;  4GHI B;  5EVI A;  2Y59 A;  2JC7 A;  4PMA A;  3E4P A;  5CGW A;  4YNR A;  3PYP A;  3K3C A;  4UA6 A;  3TJZ C;  5TBM A;  3MJQ A;  3R7W B;  1W79 A;  4L9F A;  4X68 A;  3LFV A;  3VP0 A;  4LRZ E;  4FOF A;  4LLO B;  5DTK A;  1K6R A;  2WAE A;  1S6R A;  3E2L A;  1DJB A;  4HJ4 A;  4RQ9 A;  1F5M A;  4FUW A;  4EUV A;  3OZH A;  4ZRR A;  1K55 C;  5DVA A;  2VA0 A;  3S7P A;  4XUX A;  2G2W A;  4R3B A;  3G35 A;  3ITA A;  2V8F A;  5FI7 A;  1PZP A;  3HUM A;  2Z6D A;  4GDN A;  1IYO A;  1DP9 A;  2J9P A;  2WKH A;  2XD1 A;  5L09 A;  1G6O A;  4MNR A;  3EQU A;  3ICY A;  1XFQ A;  5DF7 A;  3UN7 A;  3BFE A;  4KQD A;  3QP1 A;  1YLP A;  3C4P A;  3QP8 A;  1Q2P A;  1PIO A;  4JF4 A;  5AVE A;  3NY4 A;  3FG8 A;  1M40 A;  3SS5 A;  2XA7 M;  2UV0 E;  3GR2 A;  4Y13 A;  5G4Z A;  3BLS A;  4ARZ A;  2Y2Q A;  1HD8 A;  3B47 A;  4G3V A;  3MQO A;  2XRN A;  1K25 A;  1PNE A;  3VV4 A;  5D3O A;  5EVI C;  1V9Z A;  2ZMA A;  2H28 A;  3DAV A;  3JPU A;  1L0D A;  3S1Y A;  3G34 A;  4HIA A;  5DKL A;  4PKY A;  3AGD A;  3E4Q A;  4CLC B;  4MBF A;  2P04 A;  3D3O A;  3DTM A;  2JKT M;  3CI6 A;  2VJW A;  3G32 A;  2QYB A;  3IWO A;  1ERO A;  5CER A;  4GD6 A;  2Y2J A;  2ZQA A;  2OSU A;  2PDR A;  3ZG5 A;  1P9R A;  3DTI A;  1BLC A;  4BMW A;  3IX3 A;  3ZNT A;  2HZ5 A;  5F69 A;  1O7E A;  4K08 A;  3S7Q A;  2VV8 A;  3GSG A;  4KZ8 A;  1UWN X;  3IHA A;  1EI5 A;  2KOI A;  1LL8 A;  3M6H A;  4GKU A;  3G2Z A;  3G6O A;  1J9M A;  3KO6 A;  2O9C A;  3BEC A;  2Y2I A;  3T1X A;  1YLZ A;  1ERM A;  5FQQ A;  3CAX A;  4Q8I A;  4EQ1 A;  4Y3I A;  2IWC A;  4LGW A;  5HPF A;  3LGO A;  4Y7P A;  4KZ3 A;  3ZDJ A;  3UME A;  1VEU A;  5G18 A;  3EEA A;  5HL1 A;  2GDN A;  4OP5 A;  4B93 A;  1FR1 A;  5FDS A;  1PFL A;  3FV7 A;  3GDI A;  1K54 A;  4I5S A;  2FFF B;  2XF3 A;  1C3B A;  1JWV A;  1E3U D;  1YSQ A;  5EVL A;  1PWG A;  1YPR A; 
#chains in the Genus database with same CATH homology
 2BAS A;  3CWF A;  2NUT C;  1GSX A;  5HZH A;  3KSF A;  3K3D A;  1N9L A;  4I3J A;  2K31 A;  3T4Q A;  3LR4 A;  4BJP A;  2CMN A;  1TF1 A;  2YKF A;  3PBT A;  2V0W A;  4E04 A;  4YWZ A;  3BQA A;  3W2Z A;  4L9G A;  4MMN A;  3OLO A;  3LR5 A;  5FL3 A;  3UMD A;  3EWK A;  4CQH A;  2IA2 A;  2ZOH A;  4L0L A;  5DFX A;  3BQ8 A;  1OJG A;  1MZU A;  3C8C A;  1H8M A;  5F5Y A;  3HCY A;  4B9O A;  1DRM A;  4ETX A;  4MN7 A;  3OCN A;  5HD3 A;  3A0V A;  5MC7 A;  2GZA A;  3S7O A;  4I38 A;  3V67 A;  1OTA A;  3LR0 A;  5L8M A;  4GS9 A;  3MQ0 A;  5C5K A;  2K7S A;  3GEC A;  4HH3 A;  1V9Y A;  1WA9 A;  1S4S A;  5HDC A;  4NKP A;  1S1Y A;  4R3A A;  1UWP X;  3DBA A;  5IS1 A;  3EOI A;  4O8G A;  4ME4 A;  2W1T B;  3BWL A;  1JNU A;  2JKR I;  4EEU A;  1MC0 A;  2YKH A;  1KOU A;  2W1R A;  2VEA A;  3LIA A;  1OT9 A;  2B18 A;  2O0Y A;  1BYW A;  3PXP A;  2FH5 A;  3ZYT A;  3E98 A;  4JGO A;  4O0P A;  1OJ5 A;  2QKP A;  3P01 A;  5HPI A;  1VB6 A;  3T4J A;  3UE3 A;  1IOU A;  5AJG A;  5I5L A;  4Q0I A;  4PKY G;  1W63 M;  2P08 A;  3BY9 A;  5DKK A;  2LB5 A;  2PR6 A;  3HJK A;  3CLO A;  3T4S A;  3T4T A;  4WL9 A;  1D7E A;  4DJ3 A;  2J3T C;  4DN0 A;  2VGL M;  4F3L B;  1P0Z A;  5HDD A;  4EW7 A;  1OT6 A;  4GLQ A;  4R70 A;  1Y28 A;  4WEJ A;  4R6L A;  2M7U A;  2KX6 A;  1STZ A;  2P7J A;  4LRY C;  2PD7 A;  2XRO A;  2LB9 A;  1DP6 A;  4UQI S;  1EW0 A;  3JVV A;  3ZQ5 A;  2Z6C A;  5F6A A;  4I3A A;  1NLZ A;  4OOL A;  2W3H A;  2V1A A;  3MMH A;  3EGX C;  4EES A;  3BJN A;  3E0Y A;  5F68 A;  1X0O A;  3HJI A;  4DMZ A;  3F1P B;  2MJ6 A;  3IS2 A;  5DFY A;  3C38 A;  5TBM B;  1GSW A;  4Z1W A;  4WEK A;  3R7W A;  4IUK A;  3UB9 A;  3PBN A;  3OC2 A;  3O5Y A;  2EWW A;  4G3W A;  3IBR A;  1T19 A;  2PYP A;  4IUH A;  2VGL S;  2VLG A;  2VV7 A;  1MKM A;  2HGV A;  2V1B A;  4R38 A;  1T1C A;  4LRX C;  2HJE A;  1OTD A;  4BBT A;  1XJ2 A;  3NOP C;  4UQI M;  4H6J B;  5HWW A;  3LYX A;  1TS8 A;  4BBU A;  4EU0 A;  1XJ4 A;  3T4L A;  2O9B A;  4MN5 A;  2L4R A;  3OBF A;  2V9A A;  3LUQ A;  3BY8 A;  4GJ4 A;  3P7N A;  4O01 A;  3MQQ A;  1NWZ A;  2HJ9 C;  4IHQ A;  3LID A;  1H3Q A;  3NHQ A;  2QJ5 A;  4JGP A;  4EER A;  1GSV A;  3PHY A;  2NUP C;  3TW8 A;  2G7U A;  4CLC A;  2ZMF A;  4L9E A;  1P97 A;  1DP8 A;  4NXF A;  4HY8 A;  4NXE A;  3H82 B;  4M4X A;  4GW9 A;  2EA9 A;  3PBR A;  3R4K A;  2ZMV A;  4HH2 A;  1ZHH B;  3UB7 A;  2J3W A;  5CX7 A;  5G4Y A;  3NOU C;  2OWH A;  4CLC C;  3KYZ A;  1LSV A;  1W63 Q;  2PHY A;  1LSX A;  3IBJ A;  1T1B A;  4GCZ A;  1TS0 A;  3NOT C;  5J4E A;  1XJ3 A;  4HI4 A;  1G28 A;  1VHM A;  4NXB A;  3S7N A;  4HJ3 A;  1F9I A;  4I39 A;  4Y2F A;  4GHI A;  2PR5 A;  2GNX A;  4G3K A;  4NXG A;  4HP9 A;  2WKQ A;  2DMW A;  1S66 L;  2L0W A;  2JKT I;  4WF0 A;  2JKR M;  2KLI A;  3H82 A;  4YOF A;  3VOL A;  2W0N A;  4EEP A;  3OOV A;  4PAU A;  3LIC A;  5DJU A;  2D01 A;  1N9N A;  3F1P A;  2OAQ 1;  5HWT A;  2K2N A;  1NRJ A;  4II7 A;  2PYR A;  5HDS A;  3VE3 A;  4DJ2 A;  4CLC D;  2WKR A;  3A0S A;  4UEY A;  4GS9 B;  4WUJ A;  3JVU A;  2W27 A;  4HOI A;  3LI9 A;  2W3F A;  4EET B;  4JGR A;  1S4R A;  2WKP A;  3MFX A;  4GHI B;  2PT7 A;  2XA7 S;  3E4P A;  1UGU A;  4YNR A;  3PYP A;  3K3C A;  3TJZ C;  2Y8H A;  5TBM A;  3MJQ A;  2PD8 A;  3R7W B;  2VV6 A;  4L9F A;  3E4O A;  3LFV A;  1OTB A;  4HP4 A;  1S1Z A;  4FOF A;  4LLO B;  4LRZ E;  1LT0 A;  3FPV A;  3EQV A;  3RH8 B;  1OTI A;  2W3D A;  4MN6 A;  2A24 A;  2J80 A;  4HJ4 A;  2I9V A;  4Q0J A;  1F5M A;  4RQ9 A;  3RFB A;  2QWS A;  4EUV A;  1OTE A;  1TS7 A;  5HWV A;  4ZRR A;  1D06 A;  2M7V A;  2OAP 1;  2W1T A;  2VA0 A;  3PBS A;  3T4O A;  3S7P A;  2HF6 A;  1TD5 A;  2INW A;  2J3T D;  5HSQ A;  3A0R A;  2A24 B;  2QHK A;  4HQA A;  1YSP A;  5DJT A;  3RTY A;  4CLC E;  2Z6D A;  1DP9 A;  4XT2 A;  1XJ6 A;  3MXQ A;  3F1O B;  1T18 A;  5HD5 A;  3UB6 A;  1G6O A;  1YKD A;  4WEL A;  2HV1 A;  3EQU A;  3KSI A;  3ICY A;  1XFQ A;  3LIB A;  1XFN A;  4JGQ A;  2O9A A;  2VZW A;  3U2A A;  4BWI A;  1P9W A;  3PBO A;  4ARZ B;  4KQD A;  2FZ0 A;  4MDZ A;  4F3L A;  1F98 A;  5AVE A;  3FG8 A;  3KSH A;  2XA7 M;  4I3I A;  5G4Z A;  4KUO A;  4ARZ A;  2JN7 A;  3B47 A;  2W3G A;  4G3V A;  3TE8 A;  3SW1 A;  3NJA A;  3MQO A;  2XRN A;  5J7E A;  3VV4 A;  4BBV A;  4WN5 A;  1V9Z A;  4WLA A;  4Y5F A;  2H28 A;  3BW6 A;  2A2L A;  4LPZ A;  3CUE A;  2L1M A;  4HIA A;  5DKL A;  4PKY A;  2QJ7 A;  3E4Q A;  4CLC B;  2P04 A;  1LSW A;  1YAX A;  2XSS A;  3T4K A;  3D3O A;  2W3E A;  3MF0 A;  5HL6 A;  2JKT M;  2D02 A;  5EFW A;  3PR6 A;  5AVF A;  3EEH A;  3CI6 A;  4FSF A;  2VJW A;  3C2W A;  2VX8 A;  2QYB A;  4XT2 B;  3T50 A;  4KUK A;  3UB8 A;  3F1O A;  3UE6 A;  3C30 A;  4AFI A;  5DF9 A;  1ZTU A;  2KDK A;  3B42 A;  2PDR A;  3F1N A;  4IJG A;  1P9R A;  3LIE A;  3CIT A;  5K5B A;  4BMW A;  3KX0 X;  3FC7 A;  4H6J A;  5KSH A;  4HNB A;  1NLY A;  5F69 A;  3PBQ A;  2ZBB A;  1TS6 A;  4K08 A;  1OPX A;  3S7Q A;  2VV8 A;  5J3W A;  3H7W A;  4P6Z M;  1UWN X;  2GX5 A;  4PHT A;  4NEE D;  3IS2 B;  4Q0H A;  2KOI A;  4EXO A;  3MR0 A;  1N9O A;  1LL8 A;  1S67 L;  3KSG A;  4QPR A;  2OOL A;  2GJ3 A;  3G6O A;  4KQO A;  3FPW A;  3TRC A;  2ZOI A;  4MCW A;  2JHE A;  3KO6 A;  3OCL A;  3H7W B;  2O9C A;  5IT5 A;  1IFQ A;  3LR3 A;  2OWJ A;  1ODV A;  2EWV A;  3B33 A;  3ULF A;  2O99 A;  3KYQ A;  3F1N B;  5LBR A;  2R78 A;  3CAX A;  3CUE C;  5A8B A;  2B02 A;  4ETZ A;  4OOM A;  3EGD C;  3D72 A;  3LIF A;  2V0U A;  3VE4 A;  4EQ1 A;  4Y3I A;  4P6Z S;  5HPF A;  2VKS A;  3LI8 A;  3UME A;  4HJ6 A;  5IU1 A;  2Y79 A;  3EEA A;  4B93 A;  2M1C A;  3K2N A;  3GDI A;  4I5S A;  3H9W A;  4HHD A;  5KIZ A;  1T1A A;  1YSQ A;  5TJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...