3BY9A

Crystal structure of the v. cholerae histidine kinase dctb sensor domain
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
259
structure length
259
Chain Sequence
b'MRFQYQALLNEHQSQLDRFSSHIVATLDKYAHIPHLISKDKELVDALLSAQNSAQIDITNRYLEQVNEVIQAADTYLIDRFGNTIASSNWNLDRSFIGRNFAWRPYFYLSIAGQKSQYFALGSTSGQRGYYYAYPVIYAAEILGVIVVKMDLSAIEQGWQNKSSYFVATDDHQVVFMSSQPAWLFHSVADLSPAQLNDIRQSQQYLDSPIPSLGWQGDLQAEQSEWRKPEKHWLQDDYIVSSRPLPELALTIRVLSPKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein
publication title Crystal Structures of C4-Dicarboxylate Ligand Complexes with Sensor Domains of Histidine Kinases DcuS and DctB.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transferase
total genus 84
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3by9A02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3by9A01
4HH3A 2WKQA 1ODVA 2W27A 4HH2A 4EERA 3IBRA 4MN5A 1DP8A 4KQDA 3VE4A 4LRYC 4JGQA 5HWVA 1T18A 1XJ4A 1UWPX 2M1CA 5HWWA 1MZUA 4WF0A 4I3IA 2A24A 2EA9A 1XFQA 1DRMA 4I3JA 3E4OA 4B9OA 3H82B 3H9WA 4WLAA 2J80A 4WUJA 1D06A 1T1BA 4M4XA 2PYPA 4R70A 4I3AA 3CWFA 4L9FA 4BBUA 4BBVA 2CMNA 2V9AA 1N9OA 3ULFA 3LIEA 1BYWA 3SW1A 3F1NA 3ZQ5A 5DJTA 3EWKA 3UE6A 4EETB 2D02A 4R6LA 5G4YA 2D01A 3NJAA 2PD8A 2WKPA 4GHIA 1XFNA 3K3CA 4I38A 3GECA 5KIZA 4LRZE 3LI8A 1UWNX 3CAXA 3HJKA 3F1PA 3HJIA 5DJUA 1UGUA 3E4PA 2PD7A 3BY8A 5IU1A 2VLGA 1EW0A 5G4ZA 3NOUC 3RH8B 1V9YA 3LICA 1KOUA 2PYRA 4HQAA 3GDIA 4L9EA 1VB6A 1GSWA 3F1OB 1LL8A 2L0WA 5HD5A 2WKRA 4HY8A 4F3LB 4GCZA 4XT2B 4NXGA 2QKPA 4WL9A 2GJ3A 4RQ9A 5HDSA 1JNUA 3FC7A 2P7JA 1F9IA 2PDRA 3UMEA 1DP6A 1GSXA 4KUKA 3MJQA 4BBTA 1LSVA 3MFXA 5AVFA 2V0UA 5HDDA 1TS6A 1OTBA 1XJ3A 4R38A 2W0NA 4KUOA 4L9GA 3MQQA 1Y28A 4DJ3A 1TS7A 4PKYG 4GW9A 4H6JB 4NXBA 3LI9A 4PKYA 1NWZA 5F5YA 4EQ1A 3A0RA 5HWTA 3UB6A 3OLOA 2H28A 5TBMB 1XJ6A 5J3WA 4GS9B 1D7EA 4HIAA 5IS1A 1N9LA 1S1YA 5J4EA 2YKFA 1XJ2A 3H82A 4NXEA 4YWZA 5DKKA 3LIFA 4HP9A 1N9NA 3D72A 4I5SA 4MN6A 4E04A 3MXQA 2VEAA 1OT6A 4HOIA 1S66L 1GSVA 3PHYA 4R3AA 1OTDA 3H7WB 4EESA 5EFWA 1T19A 4LPZA 4LLOB 1LT0A 2B02A 2V1AA 4EXOA 3CLOA 2VV6A 2OWJA 1T1CA 3UMDA 1G28A 3IS2B 2Z6DA 1S1ZA 2QJ5A 3KX0X 5HD3A 4HP4A 4JGOA 3A0VA 2VV7A 4LRXC 2QJ7A 1OJGA 2V1BA 2KX6A 2ZBBA 3LIBA 2JN7A 5HSQA 1TS8A 5J7EA 2INWA 1X0OA 1DP9A 3E4QA 1S4RA 4HHDA 4HNBA 3F1OA 2ZOIA 2OOLA 4WN5A 2A24B 5DKLA 4F3LA 4XT2A 3ICYA 1S67L 3FG8A 1LSWA 3UB9A 4HJ4A 2R78A 2V0WA 2L1MA 2VV8A 4JGPA 2QHKA 5F68A 3EEHA 5F6AA 2ZOHA 3MR0A 4HJ3A 3F1NB 3A0SA 1OT9A 4JGRA 5I5LA 2L4RA 3K3DA 2BASA 3UB7A 3B33A 2K7SA 3T50A 4HI4A 4H6JA 3G6OA 4GHIB 1P0ZA 5HDCA 3P7NA 2QWSA 4EEUA 5AVEA 1WA9A 3LIAA 5TBMA 4EEPA 4NXFA 3F1PB 4K08A 3MQOA 1P97A 4GS9A 2OWHA 1T1AA 3PYPA 2HV1A 3BY9A 1OTAA 3LIDA 2PR6A 3NOPC 4I39A 2JHEA 2KDKA 1LSXA 4DJ2A 5F69A 4EW7A 3NHQA 1V9ZA 3C8CA 2PR5A 2YKHA 3H7WA 3LYXA 3BWLA 5A8BA 5HZHA 1S4SA 2Z6CA 3VOLA 4HJ6A 3LUQA 1OTIA 2PHYA 1OJ5A 1F98A 3IS2A 3NOTC 2I9VA 3VE3A 1OTEA 3UB8A 1TS0A 3C2WA 3RTYA
chains in the Genus database with same CATH superfamily
3T4TA 4HH3A 1JVJA 1ODVA 3EQVA 1GA9A 4BL3A 3OBFA 4KQDA 3VE4A 1YMSA 2B18A 5BOHA 2GNXA 4GDBA 4R3JA 5KSCA 4Y0TA 1K57A 1HVBA 2Q9MA 3G32A 4WF0A 5FQKA 3RJUA 5CX7A 4I3IA 2A24A 3B3XA 2EWVA 2EA9A 3OZHA 1DRMA 4I3JA 1P9WA 3CHWP 3NULA 4XUXA 2XA7S 4WLAA 2J80A 5HL1A 3VMAA 2PYPA 2OAP1 5AQBA 3A3DA 3CWFA 4X6TA 4KG5A 4BBVA 2CMNA 4WM9A 1N9OA 1IELA 1DY6A 1H5XA 3F1NA 1VHMA 5TFQA 4K0WA 1LI9A 5GL9A 1CI8A 4JXVA 3VP2A 1XKZA 4EETB 2D02A 4IEDA 5FQJA 1FIKA 2D01A 2P74A 4HBUA 1SZVA 1XFNA 4I38A 1YPRA 1EWZA 3LI8A 4N1HA 2QZ6A 4JXWA 3HJKA 1RGYA 3PBQA 3MXSA 3HJIA 5FSRA 2ACGA 4ETXA 3IWQA 1SDNA 1W8QA 1ES4A 3BY8A 2VLGA 2HP9A 4QPRA 4PAUA 3ZVWA 1V9YA 1E3UA 2VZWA 4Q0HA 2ZQ9A 4B4ZA 1NJ4A 1PWGA 1PWCA 3BLMA 1MWRA 4E3JA 3CITA 1FILA 2Y2OA 2X02A 5CTMA 5L10A 5F1GA 4L9EA 2L0WA 1ESUA 5HD5A 1NRJA 3MXRA 1ONGA 4P0MA 3NDGA 4HY8A 2V8FA 4CPKA 2GJ3A 2R9XA 3UO9A 2Y55A 5HDSA 1JNUA 4P6BA 2A3UA 3Q81A 3DTIA 4P6ZM 1EROA 3WS0A 2HF6A 1EI5A 1MY8A 1PYYA 3MZFA 4KENB 1FCMA 1JWZA 5CERA 4CLCC 4LV3A 1DJAA 4NEED 2Y2NA 2DRWA 1MWSA 1LSVA 3NIAA 2V0UA 1TS6A 1NRFA 1OTBA 3WS1A 4WYYA 2Y2MA 4L9GA 3LO7A 5FDSA 4DJ3A 3Q07A 4KZ6A 5FI6A 5L07A 1JWPA 4IHQA 5DTSA 3LI9A 3HLFA 5F5YA 4LCLA 3CPTB 4H8RA 4GZBA 3UB6A 2ZQ8A 1YLWA 3PBTA 4OQGA 2ZC7A 3L9KA 1L0GA 1IYSA 2IWBA 3IHBA 3O86A 2YKFA 3H82A 2V1ZA 4NXEA 3UN7A 4JKTA 2HP6A 1NZOA 2Y79A 4DE2A 1YLYA 5HL6A 2ZM0A 3T1SA 3W4QA 3SOIA 3MXQA 2WZZA 4HOIA 1S66L 1CF0A 1OMEA 1GSVA 1BULA 5FQQA 1FCNA 2ZQCA 5EFWA 4YFMA 4LPZA 1MKIA 1H0MA 1LT0A 4OH0A 4LFUA 1KGEA 2V1AA 3UPPA 3CLOA 2VKSA 1K4EA 4IUKA 1LL5A 1FCOA 3E0YA 4WMCA 3G2YA 4G3VA 3ZHHA 1S1ZA 4DDSA 3S1YA 2QJ7A 1O07A 1K6RA 1OJGA 3V39A 5M18A 2R9WA 2JN7A 3QP5A 5D3OA 5G18A 3ITAA 4N92A 4RYEA 3GVBA 2Y2KA 3PAEA 4FTXA 3O88A 2EX8A 3E4QA 1DP9A 3GR2A 3Q7VA 4HHDA 4E3MA 4DE1A 3F1OA 4Y7PA 2ZOIA 3UDXA 2A24B 5DKLA 3ZFZA 3KSHA 1LSWA 1NYYA 1ZTUA 3MQ0A 2PU2A 5FI2A 4BL2A 3FPWA 3SS5A 4YINA 4KQRA 4C6YA 3EEHA 4WBGA 5F6AA 1STZA 5CXWA 3F1NB 1OT9A 3TRCA 1L3LA 1K56D 1WYCA 1FOFA 1YLTA 4JGRA 3OC2A 3A3FA 3HUOA 5KMWA 2W3FA 2ZD8A 3K3DA 2BASA 3WWXA 5AQ9A 1CJFA 1ERMA 4WELA 4MCWA 2QYBA 4UA9A 2OLUA 2Y59A 3QNCA 4JXGA 4KG6A 4H6JA 5HDCA 2EFUA 3G31A 2G7UA 4N9LA 3LIAA 3SS4A 4PM5A 2Z2LB 1PI5A 3CJMA 5AQ7A 4F94A 3EGDC 3MZDA 3D4FA 3SH9A 3IWIA 1KGFA 3L7HA 3TG9A 1IOUA 2WADA 1YMXA 4EUZA 3KSGA 5CHUA 2JHEA 3AGDA 1ACFA 4DJ2A 3DBAA 1P9RA 2V20A 3QP1A 3WS5A 4DF6A 2PR5A 3LYXA 5HZHA 3E98A 4DXCA 4HJ6A 2J9OA 2WGVA 1BLPA 5K5BA 1O7EA 4O01A 3IS2A 2EX2A 3GTCA 1F5MA 3VOZA 3KSFA 3C2WA 3FPVA 4LV2A 2JKRI 5U47A 4DXBA 4ZTKA 2E8IA 2WKQA 3QP4A 3IF6C 2A49A 3E2LA 4HH2A 4EERA 4KZ4A 5CGWA 3QNBA 5EOEA 1DP8A 3HUMA 4LRYC 1AXBA 3NCKA 3FKWA 3OCNA 1T18A 5FASA 1UWPX 2ZC3B 4JBFA 3VOYA 5CEDA 1MZUA 3HLGA 4S2NC 2XRNA 3IF5A 2XEPA 4A5RA 3G34A 5AJGA 2Y2JA 1PRQA 4FSFA 1YAXA 3KYZA 1XFQA 2ZC6B 3C4PA 4ZAMA 3H82B 3H9WA 2HDQA 1T1BA 4AFIA 5GLDA 4MEZA 4R70A 4YNRA 4EV4A 4LENA 4L0LA 5FAQA 4DN0A 4FH2A 2V9AA 4UQIM 3ULFA 4GB7A 3LIEA 3OPPA 3SW1A 4FUWA 3OPHA 2XFSA 1XP4A 3N8SA 3W8KA 3ZQ5A 1PIOA 3EWKA 2DMWA 5HAPA 3UE6A 1TVFA 2VGLS 4XXRA 2OLVA 2WKPA 2J9PA 5CGSA 3GECA 4E3IA 4HBTA 2EX9A 1PWDA 3PBSA 2JKRM 2K31A 3F1PA 4WMCD 2KLIA 5MC7A 2JC7A 5GHYA 4ME4A 5EVID 3LCEA 1BLHA 3PAGA 2XQZA 4UEYA 4S2JA 3S7QA 1BT5A 4HQAA 1N4OA 4GOGA 3Q7VB 3GDIA 1VB6A 3VP4A 3F1OB 4CLCA 3VP3A 3JPUA 4GCZA 3SS3A 3CZDA 4LV0A 1I2SA 1H8ZA 3HBRA 5A90A 3FC7A 1GA0A 2Y91A 1BUEA 4ZBEA 5DF9A 2W1TA 4ZJ3A 1KE3A 1F9IA 1E4DA 3UMEA 4D60A 1DP6A 3ISGA 4ID4A 2HP5A 3V67A 3MJQA 4MLLA 3S7NA 1TDLA 1L2SA 2XFTA 3MFXA 2V2FF 3TSGA 5F1FA 3MQQA 4EUVA 2ZM2A 1BZAA 1QMEA 4O7DA 4H6JB 2H5SA 2O9CA 2P08A 2J8YA 5HWTA 3OLOA 3W4PA 3NI9A 3PXPA 1H8YA 5J3WA 2JCHA 1N9LA 1S1YA 4S2OA 1XJ2A 4OP5A 4YWZA 3G30A 1ONHA 4HP9A 3HLDA 3AGFA 2MJ6A 1BSGA 4KQOA 3BFEA 4E04A 1VEUA 2WAEA 4OPZA 4BJPA 2O99A 2OSUA 2OV5A 2P9VA 2BG1A 1MKMA 4U0XA 3LR0A 5E2GA 3ZDJA 1OTDA 3OPRA 3E2KA 5HAQA 1T19A 3WRTA 4X68A 1K38A 2B02A 4EXOA 3ZG9B 4S2KA 2HDRA 1NYMA 1T1CA 3IS2B 4YOFA 1TDGA 2XF3A 3ZVTA 1MWUA 3KX0X 3O5YA 4FD8A 4JGOA 3A0VA 3TOIA 3IX4A 3HLCA 3TW8A 1Q2PA 2ZBBA 1K54A 3LIBA 5A92A 3VV4A 4K0XA 1MWTA 3KO6A 1IKGA 1M6KA 1DJBA 1MXOA 5J7EA 2INWA 1RCJA 2PRFA 1JTDA 3WS2A 4QD4A 1W7FA 3MF0A 3LR3A 5IHVA 3LEQA 4F3LA 4XT2A 2M7UA 1S67L 1FR6A 3IBJA 4X1LA 5DTKA 3T4JA 3C5AA 1YLPA 2R78A 4DE3A 3B47A 5CRFA 4KZ7A 2FFFB 3U4LP 2L1MA 4JF5A 4ZRRA 5F68A 4Y5FA 1PW8A 3MR0A 1QMFA 4CQHA 4HJ3A 1VETA 4PM7A 3N6IA 5EM1A 3W4OA 2X01A 4QU3A 5A93A 3HVFA 4RX3A 2GDNA 3DAVA 3PBNA 4EU0A 5CEBA 4B93A 5FQMA 4OOMA 3I7JA 1ZC2A 3R7WA 3PR6A 4HI4A 1HD8A 1CEFA 1P0ZA 3CI6A 3P7NA 2Q9NA 5M1AA 1BLCA 1FQGA 4NXFA 4EEPA 3F1PB 3MQOA 3BRMA 5IT5A 4GLQA 4GS9A 2EX6A 2W3GA 3EQUA 2VX8A 4UAAA 3OCLA 4HESA 2HPBA 2HJ9C 2V8CA 2G2UA 4PPRA 3ITBA 5C5KA 2ZMAA 2JBFA 5M19A 2Y2PA 4R3BA 2PAVP 3LIDA 3BQAA 1I2WA 1L0EA 2KDKA 3NHQA 5HPFA 2O9BA 3D9YA 3KSIA 4CLCD 2IA2A 4ZDXA 2NUTC 4CLCB 1MBLA 3H7WA 2PBYA 4P87A 1S4SA 3Q7ZA 4FH4A 3SH7A 3T4LA 3VOLA 1G6OA 3LUQA 2PHYA 2WYXA 3IF6A 1W63M 1S0WA 5GHZA 2J7VA 2W1RA 1OJ5A 4JF4A 4PMAA 1KDSA 2CC1A 2W1TB 4BQMA 5DFXA 4IVIA 1Y54A 3RFBA 2I9VA 2W3HA 1GCEA 2UWXA 5DVAA 4QJGA 4GD8A 1TS0A 4S2NA 1K54C 3ZNYA 1Q2QA 4OP8A 1N9BA 2IWCA 3IBRA 4MN5A 3C4OA 4QWOA 1ZHHB 3Q82A 2KOIA 4WEJA 2M1CA 5HWWA 4BD0A 2UV0E 4KQQA 3P98A 4BMWA 2FFYA 1PZOA 3QHYA 3VP0A 3IX8A 1D06A 1LL9A 4G3KA 4OLDA 3HREA 1GHPA 3T12B 4PHTA 3OPLA 5EUAA 1BYWA 1VEUB 4WEKA 2P9VB 3VFFA 4K91A 4Y13A 2EXAA 1HTZA 4UHUA 3A3IA 3BYDA 2O0YA 1TF1A 1BLSA 4GNUA 4E3LA 5G4YA 2PD8A 3UE3A 4GD6A 3B42A 4EBLA 4GHIA 4ARZA 3K3CA 5EOOA 4KZ9A 4LRZE 1E3UD 1UWNX 1PNEA 1I5QA 5LBRA 3IH8A 2GX5A 3MMHA 3LY3A 2HJEA 3G2ZA 2PD7A 2ZMFA 1CQAA 5IU1A 4DMZA 4Q8IA 5HPIA 2ZL1A 4DRTA 3RH8B 4DKIA 4S2MA 2PYRA 2W3DA 2GZAA 3DTEA 1S6RA 3MKFA 4MBFA 4EBNA 5FEGA 2JE5A 1MPLA 2J3TC 4BWIA 2WKRA 4N9KA 1SKFA 2X71A 4F3LB 4XT2B 4X55A 1K25A 4JF6A 4NXGA 2QKPA 4WL9A 1XPBA 3QP8A 3GRJA 2Z2MB 3SH8A 3T4QA 1XGJA 2P7JA 3CUEC 1W8YA 3PTEA 4MNRA 5JYPA 2PDRA 1HZOA 5EVIC 3LFVA 4X53A 3ZG8B 4II7A 1NLYA 1VETB 1GSXA 3N8LA 4KUKA 2WGWB 3ZGAB 5CTNA 3G4PA 5AVFA 2AVXA 2K2NA 4KUOA 5L2FA 1Y28A 1XGIA 2O9AA 3BFGA 2WKHA 1ES5A 3R7WB 5E2HA 4GW9A 4ZJ1A 4PKYA 1NWZA 1ERQA 4EQ1A 3JYIA 2VGJA 4JXSA 3GSGA 4WZ5C 5CECA 1TD5A 1XJ6A 4Y2FA 4GS9B 1D7EA 4HIAA 3T4KA 5IS1A 5J4EA 4LGWA 4OOLA 5KSHA 4E3NA 2WK0A 3LIFA 5DF7A 3BFFA 3DTMA 3C7VA 3GV9A 4I5SA 1J9MA 1CEGA 3ZG7B 1GHIA 3CG5A 4QB8A 1YM1A 3Q1FA 1IFQA 3KYEA 3HUNA 4MN7A 3UPOA 3IX3A 4EWFA 3ZYTA 1FSYA 2M7VA 2ZQDA 3PHYA 3WRZA 1NXYA 2ZQAA 3H7WB 2WAFA 3QP6A 2XA7M 3N7WA 3IF6B 4ETZA 3BFDA 3G35A 1CK3A 5TR7A 4G3WA 1XX2A 1G28A 4KG2A 4LCMA 5F83A 2VGKA 2ZQ7A 3N8RA 2VV7A 4LRXC 4LV1A 3SZTA 3VFHA 2V1BA 2Y4AA 2XDMA 2XLNA 4C75A 2H10A 5HSQA 4UQIS 5DF8A 1X0OA 2VK3A 2VJWA 1PI4A 2WGIA 4HNBA 1ESIA 3A3JA 3IWOA 4IBRA 1CI9A 2OOLA 3DW0A 3EEAA 3M2JA 3ICYA 5EPHA 3W2ZA 3UB9A 1ES3A 3NY4A 4Q0JA 4GDNA 2XD5A 2V0WA 4PM9A 3DWZA 4X1MA 2B5RA 4B4XA 2BLSA 1WYBA 4OQ0A 2VV8A 3S7OA 2QHKA 2EFXA 2ZOHA 5HARA 1KVMA 3T1XA 4IBXA 3S7PA 5E43A 3IHAA 2HZ5A 5HX9A 2J3WA 1LI0A 2L4RA 3UB7A 1VM1A 2IWDA 1IEMA 3B33A 2K7SA 4X56A 1K6SA 3G6OA 4GHIB 2WKIA 4ARZB 3EGXC 3FYZA 2QWSA 4EEUA 4B88A 5AVEA 4BD1A 3GMWA 1H8MA 5TBMA 3BQ8A 3C7UA 3VP1A 1K56A 2XGNA 1P97A 4OKPA 1ES2A 4PM6A 2C6WB 5FQIA 1OPXA 3N4IA 5GHXA 2HV1A 4E3KA 4GKUA 2PBDP 1LLBA 1Z6FA 2DNSA 4R1GA 4JPMA 4NG2A 1JWVA 2ZL1B 1OTAA 4KZAA 4PM8A 3LGOA 2H0YA 2PR6A 5DTTA 4I39A 3AGEA 3BEBA 3OOVA 1E25A 2EWWA 1ZKJA 4GJ4A 4XUZA 4EW7A 5GLBA 4OPRA 3CMZA 5J8XA 1V9ZA 4OPQA 4QY5A 3LR5A 5A8BA 1PW1A 2Z6CA 4R4SA 3UPNA 1OTIA 4S2LA 1Y4OA 2Y2QA 3UY6A 2XD1A 4MDZA 4KZBA 2OAQ1 3VE3A 3R4KA 2C5WB 1OTEA 2Y2HA 3M6BA 5FAPA 2WZXA 2PU4A 1FR1A 1YQSA 5CGXA 4UA6A 3UB5P 5FAOA 1L0FA 1XA7A 2W27A 2XH9A 4IJGA 1HLUP 1MC0A 4JGQA 5F82A 5HWVA 1SKOA 2ZJ9A 4ESPA 3UDFA 1XJ4A 2HDSA 4M3KA 1FSWA 2WGWA 1NLZA 1L0DA 1Z09A 3E4OA 4B9OA 4WUJA 4KZ3A 4M4XA 4RX2A 4I3AA 2E8JA 3RXXA 1XA1A 3IXHA 4L9FA 3MZEA 3IXDA 5CHMA 4BBUA 5CHJA 4Z1WA 1K57C 1KDWA 3ZG0A 2PT7A 4NETA 4FCFA 3D3OA 4KZ8A 4S2PA 4O0PA 3T1RA 1DJCA 5DJTA 3BJNA 2BTFP 4C3QA 4R6LA 3NJAA 4N1XA 1RGZA 3NDEA 4MMNA 4WZ4A 5KIZA 4P6ZS 5EM0A 1GHMA 3CAXA 3O87A 5DJUA 3FWLA 5FATA 1UGUA 1NY0A 2A2LA 1KE4A 5TGFA 3E4PA 1K4FA 3C30A 5FL3A 1K55A 1EW0A 3FZCA 3BLSA 5G4ZA 5GLAA 3NOUC 4O8GA 2Y2LA 1TEMA 1KE0A 3LICA 1KOUA 5L8MA 3A3EA 3P01A 3EOIA 2XSSA 4BLMA 1ZG6A 3CUEA 2LB5A 1GSWA 3BECA 4D2OA 5EVIA 1LL8A 4UA7A 4OPYA 3V3SA 3BFCA 1U60A 2W3EA 5EVLA 3ZNTA 1ZG4A 3T1QB 4RA7A 4RQ9A 1WE4A 2FZ0A 3MFDA 2QMIA 4FOFA 3UE1A 1W63Q 1BTLA 3NC8A 2ZMVA 3U2AA 4Y17A 3TE8A 3MBZA 4Y15A 3HLBA 2JKFA 3DTKA 4NKPA 3KYQA 5DFYA 1PFLA 3PBOA 4WZ5A 3TJZC 4BBTA 1PZPA 4OLGA 4DDYA 5HDDA 1YLZA 1XJ3A 3HLEA 2JKTI 4R38A 2W0NA 1TS7A 1ALQA 4PKYG 1VQQA 3LR4A 4NXBA 4CLCE 1H3QA 2ZC5B 3NECA 5TJJA 3A0RA 4OQHA 1IKIA 1NZUA 3T4SA 2H28A 2XR0A 5TBMB 3K2NA 4QHCA 2DCFA 5FQ9A 5FEFA 5KZHA 3T4OA 2Y8HA 4OOYA 3M2KA 2P04A 5DKKA 3PBRA 4R0QA 4OVDA 3LEZA 1N9NA 3HCYA 3MSHA 5EVEA 3WS4A 1G5UA 3D72A 4MN6A 2Y2GA 3QP2A 2QPNA 2VEAA 1OT6A 5E2EA 3HLWA 1IYPA 3IT9A 4Z9QA 2HDUA 4GN2A 1SCWA 4R3AA 4EESA 3DWKA 4CJNA 4BENA 4LLOB 3UDIA 2NUPC 1YSQA 1RP5A 1YSPA 5GLCA 2VV6A 2OWJA 2XK1A 3UMDA 3BW6A 2Z6DA 4MBHA 2Y2IA 3LY4A 4P85A 3S4XA 2JKTM 3RXWA 2LB9A 2QJ5A 3P09A 4X25A 3ZG5A 4ZJ2A 5HD3A 4HP4A 1D1JA 2KX6A 1K55C 2RCXA 2G2WA 2VGLM 4R23A 4IUHA 1YKDA 5JYOA 1TS8A 4E6XA 2WUQA 5L09A 1M40A 3IH9A 2EXBA 1SKOB 4Q0IA 1S4RA 1SDEA 2FH5A 2XROA 1IYOA 1KGGA 5AQAA 4WN5A 1XXMA 3FG8A 4EQIA 5FDHA 5E2FA 1YLJA 4HJ4A 3UNWA 1KVLA 2Q0OA 3V3RA 4R4RA 4OONA 1G68A 4JGPA 5FA7A 1F2KA 3A0SA 5I5LA 4MBKA 3FKVA 1YT4A 1W79A 2WKEA 3T50A 3JVUA 2H0TA 2ZLYA 3M6HA 2I72A 5HW3A 5EV0A 3IXGA 1J3WA 3CPTA 4HEFA 4KZ5A 1W5DA 1WA9A 3O3VA 4Y0OA 3S22A 5HFOA 5EECA 4OQIA 4S2IA 4K08A 4E3OA 5EE8A 3NBLA 3UE0A 3MKEA 3ZCZA 2OWHA 1LHYA 2VA0A 1T1AA 4U0TA 4Y3IA 3IQAA 3PYPA 3BY9A 3V5MA 2J3TD 2JKGA 4JLFA 5FI7A 2ZC4B 3IXBA 3V50A 5I94A 3GQZA 3VSKA 4E6WA 5A91A 1K0KA 3NOPC 4U3TA 1LSXA 5F69A 3VSLA 1SHVA 3C8CA 1C3BA 5HAIA 5EVIB 1AWIA 4DE0A 2YKHA 4RVAA 3BWLA 2B95A 4IVKA 3MS6A 4EBPA 4NK3A 1G6AA 1IYQA 3BM6A 3C38A 2ZM8A 2RL3A 2HGVA 1F98A 4Y0UA 3HL9A 3NOTC 3JVVA 3FV7A 1JTGA 3UB8A 4QY6A 1A0KA 3RTYA 4X69A
chains in the Genus database with same CATH topology
3T4TA 4HH3A 2WKQA 1ODVA 3EQVA 2W27A 4HH2A 4EERA 3IBRA 4MN5A 3OBFA 1DP8A 4KQDA 4IJGA 3VE4A 2B18A 4LRYC 1MC0A 1ZHHB 4JGQA 2KOIA 3OCNA 2GNXA 5HWVA 1T18A 1XJ4A 4WEJA 1UWPX 2M1CA 5HWWA 1MZUA 4WF0A 2XRNA 5CX7A 4I3IA 5AJGA 4FSFA 2A24A 1YAXA 3KYZA 4BMWA 1NLZA 2EWVA 2EA9A 1XFQA 1DRMA 4I3JA 3E4OA 1P9WA 4B9OA 3H82B 2XA7S 3H9WA 4WLAA 2J80A 4WUJA 1D06A 1T1BA 4M4XA 4AFIA 2PYPA 2OAP1 4G3KA 4R70A 4I3AA 4YNRA 3CWFA 4L9FA 4L0LA 4BBUA 4BBVA 4Z1WA 4DN0A 2CMNA 2V9AA 1N9OA 4UQIM 3ULFA 4PHTA 2PT7A 3LIEA 3D3OA 1BYWA 3SW1A 4O0PA 3F1NA 1VHMA 4WEKA 3ZQ5A 5DJTA 3EWKA 2DMWA 3UE6A 2O0YA 1TF1A 3BJNA 4EETB 2D02A 2VGLS 4R6LA 5G4YA 2D01A 3NJAA 2PD8A 3UE3A 2WKPA 3B42A 4GHIA 4ARZA 1XFNA 4MMNA 3K3CA 4I38A 3GECA 5KIZA 4P6ZS 4LRZE 3LI8A 3PBSA 1UWNX 2JKRM 3CAXA 2K31A 3HJKA 5LBRA 3PBQA 3F1PA 3HJIA 2GX5A 5DJUA 2KLIA 1UGUA 5MC7A 3MMHA 4ME4A 2A2LA 2HJEA 4ETXA 3E4PA 2PD7A 3C30A 2ZMFA 3BY8A 5FL3A 5IU1A 4DMZA 2VLGA 1EW0A 5G4ZA 3NOUC 4O8GA 4QPRA 5HPIA 3RH8B 4PAUA 1V9YA 3LICA 1KOUA 2VZWA 4UEYA 5L8MA 4Q0HA 3S7QA 3P01A 3EOIA 3CITA 2PYRA 2XSSA 2W3DA 2GZAA 4HQAA 3CUEA 3GDIA 4L9EA 1VB6A 2LB5A 1GSWA 3F1OB 1LL8A 2L0WA 4CLCA 5HD5A 2J3TC 4BWIA 2WKRA 1NRJA 4HY8A 4F3LB 4GCZA 4XT2B 2W3EA 4NXGA 2QKPA 4WL9A 2GJ3A 4RQ9A 2FZ0A 4FOFA 5HDSA 1JNUA 3FC7A 1W63Q 3T4QA 2ZMVA 4P6ZM 3U2AA 5DF9A 2W1TA 2HF6A 2P7JA 3CUEC 1F9IA 3TE8A 2PDRA 3UMEA 1DP6A 3LFVA 4CLCC 4II7A 1NLYA 4NKPA 1GSXA 4NEED 3V67A 4KUKA 3MJQA 3KYQA 5DFYA 3S7NA 3PBOA 1LSVA 3TJZC 4BBTA 3MFXA 5AVFA 2V0UA 5HDDA 1TS6A 1OTBA 1XJ3A 2JKTI 4R38A 2K2NA 2W0NA 4KUOA 4L9GA 3MQQA 1Y28A 2O9AA 4DJ3A 4EUVA 1TS7A 4PKYG 3R7WB 3LR4A 4GW9A 4H6JB 4NXBA 4CLCE 1H3QA 4IHQA 2O9CA 3LI9A 2P08A 4PKYA 1NWZA 5TJJA 5F5YA 4EQ1A 3A0RA 5HWTA 3UB6A 3OLOA 3T4SA 2H28A 3PXPA 5TBMB 3K2NA 3PBTA 1TD5A 1XJ6A 5J3WA 4Y2FA 4GS9B 1D7EA 4HIAA 3T4KA 5IS1A 1N9LA 1S1YA 3T4OA 5J4EA 2Y8HA 2YKFA 1XJ2A 3H82A 2P04A 4NXEA 4OOLA 4YWZA 5KSHA 5DKKA 3LIFA 3PBRA 4HP9A 1N9NA 2Y79A 3HCYA 5HL6A 2MJ6A 4KQOA 3D72A 4I5SA 4MN6A 4E04A 4BJPA 3MXQA 2VEAA 2O99A 1IFQA 1OT6A 1MKMA 4HOIA 4MN7A 1S66L 3LR0A 3ZYTA 1GSVA 2M7VA 3PHYA 4R3AA 1OTDA 3H7WB 4EESA 5EFWA 1T19A 4LPZA 4LLOB 1LT0A 1YSQA 2NUPC 2XA7M 2B02A 2V1AA 1YSPA 4EXOA 4ETZA 3CLOA 2VKSA 2VV6A 2OWJA 4G3WA 1T1CA 3UMDA 3BW6A 4IUKA 1G28A 3IS2B 2Z6DA 3E0YA 4YOFA 2JKTM 4G3VA 2LB9A 1S1ZA 2QJ5A 3KX0X 5HD3A 3O5YA 4HP4A 4JGOA 3A0VA 2VV7A 4LRXC 2QJ7A 1OJGA 2V1BA 3TW8A 2KX6A 2ZBBA 3LIBA 2JN7A 3VV4A 5HSQA 2VGLM 3KO6A 4IUHA 1YKDA 4UQIS 1TS8A 5J7EA 2INWA 1X0OA 1DP9A 3E4QA 4Q0IA 2VJWA 1S4RA 4HHDA 4HNBA 3F1OA 2FH5A 3MF0A 2XROA 3LR3A 2ZOIA 2OOLA 4WN5A 2A24B 5DKLA 4F3LA 3EEAA 4XT2A 3ICYA 2M7UA 1S67L 3KSHA 3FG8A 3IBJA 3W2ZA 1LSWA 3UB9A 3T4JA 4Q0JA 1ZTUA 3MQ0A 4HJ4A 2R78A 2V0WA 3B47A 2L1MA 3S7OA 2VV8A 3FPWA 4JGPA 2QHKA 4ZRRA 5F68A 3EEHA 4Y5FA 5F6AA 1STZA 2ZOHA 3MR0A 4CQHA 4HJ3A 3F1NB 3A0SA 1OT9A 3TRCA 4JGRA 3S7PA 5I5LA 3OC2A 3PBNA 4EU0A 2J3WA 2L4RA 2W3FA 3K3DA 2BASA 3UB7A 4B93A 4WELA 4MCWA 3B33A 2K7SA 2QYBA 3T50A 4OOMA 3R7WA 3PR6A 3JVUA 4HI4A 4H6JA 3G6OA 4GHIB 4ARZB 1P0ZA 5HDCA 3CI6A 3P7NA 3EGXC 2G7UA 2QWSA 4EEUA 5AVEA 1WA9A 3LIAA 1H8MA 5TBMA 3BQ8A 4EEPA 4NXFA 3F1PB 4K08A 3MQOA 5IT5A 3EGDC 4GLQA 1P97A 4GS9A 2OWHA 2W3GA 3EQUA 2VA0A 2VX8A 1T1AA 3OCLA 1OPXA 4Y3IA 3PYPA 2HV1A 3BY9A 1IOUA 2HJ9C 2J3TD 5C5KA 3KSGA 1OTAA 3LIDA 2PR6A 3NOPC 3BQAA 4I39A 2JHEA 3OOVA 2EWWA 2KDKA 1LSXA 4GJ4A 3DBAA 5F69A 1P9RA 4DJ2A 4EW7A 3NHQA 1V9ZA 3C8CA 5HPFA 2O9BA 3KSIA 2PR5A 4CLCD 2IA2A 2NUTC 4CLCB 2YKHA 3H7WA 3LR5A 3LYXA 3BWLA 5A8BA 5HZHA 1S4SA 3E98A 2Z6CA 3T4LA 3VOLA 1G6OA 4HJ6A 3LUQA 1OTIA 2PHYA 1W63M 2W1RA 3C38A 5K5BA 4O01A 1OJ5A 2HGVA 1F98A 2W1TB 3IS2A 5DFXA 3NOTC 4MDZA 3JVVA 3RFBA 2I9VA 2OAQ1 3VE3A 3R4KA 1OTEA 2W3HA 3UB8A 1F5MA 1TS0A 3KSFA 3C2WA 3FPVA 3RTYA 2JKRI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HH3 A;  2WKQ A;  1ODV A;  2W27 A;  4HH2 A;  4EER A;  3IBR A;  4MN5 A;  1DP8 A;  4KQD A;  3VE4 A;  4LRY C;  4JGQ A;  5HWV A;  1T18 A;  1XJ4 A;  1UWP X;  2M1C A;  5HWW A;  1MZU A;  4WF0 A;  4I3I A;  2A24 A;  2EA9 A;  1XFQ A;  1DRM A;  4I3J A;  3E4O A;  4B9O A;  3H82 B;  3H9W A;  4WLA A;  2J80 A;  4WUJ A;  1D06 A;  1T1B A;  4M4X A;  2PYP A;  4R70 A;  4I3A A;  3CWF A;  4L9F A;  4BBU A;  4BBV A;  2CMN A;  2V9A A;  1N9O A;  3ULF A;  3LIE A;  1BYW A;  3SW1 A;  3F1N A;  3ZQ5 A;  5DJT A;  3EWK A;  3UE6 A;  4EET B;  2D02 A;  4R6L A;  5G4Y A;  2D01 A;  3NJA A;  2PD8 A;  2WKP A;  4GHI A;  1XFN A;  3K3C A;  4I38 A;  3GEC A;  5KIZ A;  4LRZ E;  3LI8 A;  1UWN X;  3CAX A;  3HJK A;  3F1P A;  3HJI A;  5DJU A;  1UGU A;  3E4P A;  2PD7 A;  3BY8 A;  5IU1 A;  2VLG A;  1EW0 A;  5G4Z A;  3NOU C;  3RH8 B;  1V9Y A;  3LIC A;  1KOU A;  2PYR A;  4HQA A;  3GDI A;  4L9E A;  1VB6 A;  1GSW A;  3F1O B;  1LL8 A;  2L0W A;  5HD5 A;  2WKR A;  4HY8 A;  4F3L B;  4GCZ A;  4XT2 B;  4NXG A;  2QKP A;  4WL9 A;  2GJ3 A;  4RQ9 A;  5HDS A;  1JNU A;  3FC7 A;  2P7J A;  1F9I A;  2PDR A;  3UME A;  1DP6 A;  1GSX A;  4KUK A;  3MJQ A;  4BBT A;  1LSV A;  3MFX A;  5AVF A;  2V0U A;  5HDD A;  1TS6 A;  1OTB A;  1XJ3 A;  4R38 A;  2W0N A;  4KUO A;  4L9G A;  3MQQ A;  1Y28 A;  4DJ3 A;  1TS7 A;  4PKY G;  4GW9 A;  4H6J B;  4NXB A;  3LI9 A;  4PKY A;  1NWZ A;  5F5Y A;  4EQ1 A;  3A0R A;  5HWT A;  3UB6 A;  3OLO A;  2H28 A;  5TBM B;  1XJ6 A;  5J3W A;  4GS9 B;  1D7E A;  4HIA A;  5IS1 A;  1N9L A;  1S1Y A;  5J4E A;  2YKF A;  1XJ2 A;  3H82 A;  4NXE A;  4YWZ A;  5DKK A;  3LIF A;  4HP9 A;  1N9N A;  3D72 A;  4I5S A;  4MN6 A;  4E04 A;  3MXQ A;  2VEA A;  1OT6 A;  4HOI A;  1S66 L;  1GSV A;  3PHY A;  4R3A A;  1OTD A;  3H7W B;  4EES A;  5EFW A;  1T19 A;  4LPZ A;  4LLO B;  1LT0 A;  2B02 A;  2V1A A;  4EXO A;  3CLO A;  2VV6 A;  2OWJ A;  1T1C A;  3UMD A;  1G28 A;  3IS2 B;  2Z6D A;  1S1Z A;  2QJ5 A;  3KX0 X;  5HD3 A;  4HP4 A;  4JGO A;  3A0V A;  2VV7 A;  4LRX C;  2QJ7 A;  1OJG A;  2V1B A;  2KX6 A;  2ZBB A;  3LIB A;  2JN7 A;  5HSQ A;  1TS8 A;  5J7E A;  2INW A;  1X0O A;  1DP9 A;  3E4Q A;  1S4R A;  4HHD A;  4HNB A;  3F1O A;  2ZOI A;  2OOL A;  4WN5 A;  2A24 B;  5DKL A;  4F3L A;  4XT2 A;  3ICY A;  1S67 L;  3FG8 A;  1LSW A;  3UB9 A;  4HJ4 A;  2R78 A;  2V0W A;  2L1M A;  2VV8 A;  4JGP A;  2QHK A;  5F68 A;  3EEH A;  5F6A A;  2ZOH A;  3MR0 A;  4HJ3 A;  3F1N B;  3A0S A;  1OT9 A;  4JGR A;  5I5L A;  2L4R A;  3K3D A;  2BAS A;  3UB7 A;  3B33 A;  2K7S A;  3T50 A;  4HI4 A;  4H6J A;  3G6O A;  4GHI B;  1P0Z A;  5HDC A;  3P7N A;  2QWS A;  4EEU A;  5AVE A;  1WA9 A;  3LIA A;  5TBM A;  4EEP A;  4NXF A;  3F1P B;  4K08 A;  3MQO A;  1P97 A;  4GS9 A;  2OWH A;  1T1A A;  3PYP A;  2HV1 A;  3BY9 A;  1OTA A;  3LID A;  2PR6 A;  3NOP C;  4I39 A;  2JHE A;  2KDK A;  1LSX A;  4DJ2 A;  5F69 A;  4EW7 A;  3NHQ A;  1V9Z A;  3C8C A;  2PR5 A;  2YKH A;  3H7W A;  3LYX A;  3BWL A;  5A8B A;  5HZH A;  1S4S A;  2Z6C A;  3VOL A;  4HJ6 A;  3LUQ A;  1OTI A;  2PHY A;  1OJ5 A;  1F98 A;  3IS2 A;  3NOT C;  2I9V A;  3VE3 A;  1OTE A;  3UB8 A;  1TS0 A;  3C2W A;  3RTY A; 
#chains in the Genus database with same CATH topology
 3T4T A;  4HH3 A;  1JVJ A;  1ODV A;  3EQV A;  1GA9 A;  4BL3 A;  3OBF A;  4KQD A;  3VE4 A;  1YMS A;  2B18 A;  5BOH A;  2GNX A;  4GDB A;  4R3J A;  5KSC A;  4Y0T A;  1K57 A;  1HVB A;  2Q9M A;  3G32 A;  4WF0 A;  5FQK A;  3RJU A;  5CX7 A;  4I3I A;  2A24 A;  3B3X A;  2EWV A;  2EA9 A;  3OZH A;  1DRM A;  4I3J A;  1P9W A;  3CHW P;  3NUL A;  4XUX A;  2XA7 S;  4WLA A;  2J80 A;  5HL1 A;  3VMA A;  2PYP A;  2OAP 1;  5AQB A;  3A3D A;  3CWF A;  4X6T A;  4KG5 A;  4BBV A;  2CMN A;  4WM9 A;  1N9O A;  1IEL A;  1DY6 A;  1H5X A;  3F1N A;  1VHM A;  5TFQ A;  4K0W A;  1LI9 A;  5GL9 A;  1CI8 A;  4JXV A;  3VP2 A;  1XKZ A;  4EET B;  2D02 A;  4IED A;  5FQJ A;  1FIK A;  2D01 A;  2P74 A;  4HBU A;  1SZV A;  1XFN A;  4I38 A;  1YPR A;  1EWZ A;  3LI8 A;  4N1H A;  2QZ6 A;  4JXW A;  3HJK A;  1RGY A;  3PBQ A;  3MXS A;  3HJI A;  5FSR A;  2ACG A;  4ETX A;  3IWQ A;  1SDN A;  1W8Q A;  1ES4 A;  3BY8 A;  2VLG A;  2HP9 A;  4QPR A;  4PAU A;  3ZVW A;  1V9Y A;  1E3U A;  2VZW A;  4Q0H A;  2ZQ9 A;  4B4Z A;  1NJ4 A;  1PWG A;  1PWC A;  3BLM A;  1MWR A;  4E3J A;  3CIT A;  1FIL A;  2Y2O A;  2X02 A;  5CTM A;  5L10 A;  5F1G A;  4L9E A;  2L0W A;  1ESU A;  5HD5 A;  1NRJ A;  3MXR A;  1ONG A;  4P0M A;  3NDG A;  4HY8 A;  2V8F A;  4CPK A;  2GJ3 A;  2R9X A;  3UO9 A;  2Y55 A;  5HDS A;  1JNU A;  4P6B A;  2A3U A;  3Q81 A;  3DTI A;  4P6Z M;  1ERO A;  3WS0 A;  2HF6 A;  1EI5 A;  1MY8 A;  1PYY A;  3MZF A;  4KEN B;  1FCM A;  1JWZ A;  5CER A;  4CLC C;  4LV3 A;  1DJA A;  4NEE D;  2Y2N A;  2DRW A;  1MWS A;  1LSV A;  3NIA A;  2V0U A;  1TS6 A;  1NRF A;  1OTB A;  3WS1 A;  4WYY A;  2Y2M A;  4L9G A;  3LO7 A;  5FDS A;  4DJ3 A;  3Q07 A;  4KZ6 A;  5FI6 A;  5L07 A;  1JWP A;  4IHQ A;  5DTS A;  3LI9 A;  3HLF A;  5F5Y A;  4LCL A;  3CPT B;  4H8R A;  4GZB A;  3UB6 A;  2ZQ8 A;  1YLW A;  3PBT A;  4OQG A;  2ZC7 A;  3L9K A;  1L0G A;  1IYS A;  2IWB A;  3IHB A;  3O86 A;  2YKF A;  3H82 A;  2V1Z A;  4NXE A;  3UN7 A;  4JKT A;  2HP6 A;  1NZO A;  2Y79 A;  4DE2 A;  1YLY A;  5HL6 A;  2ZM0 A;  3T1S A;  3W4Q A;  3SOI A;  3MXQ A;  2WZZ A;  4HOI A;  1S66 L;  1CF0 A;  1OME A;  1GSV A;  1BUL A;  5FQQ A;  1FCN A;  2ZQC A;  5EFW A;  4YFM A;  4LPZ A;  1MKI A;  1H0M A;  1LT0 A;  4OH0 A;  4LFU A;  1KGE A;  2V1A A;  3UPP A;  3CLO A;  2VKS A;  1K4E A;  4IUK A;  1LL5 A;  1FCO A;  3E0Y A;  4WMC A;  3G2Y A;  4G3V A;  3ZHH A;  1S1Z A;  4DDS A;  3S1Y A;  2QJ7 A;  1O07 A;  1K6R A;  1OJG A;  3V39 A;  5M18 A;  2R9W A;  2JN7 A;  3QP5 A;  5D3O A;  5G18 A;  3ITA A;  4N92 A;  4RYE A;  3GVB A;  2Y2K A;  3PAE A;  4FTX A;  3O88 A;  2EX8 A;  3E4Q A;  1DP9 A;  3GR2 A;  3Q7V A;  4HHD A;  4E3M A;  4DE1 A;  3F1O A;  4Y7P A;  2ZOI A;  3UDX A;  2A24 B;  5DKL A;  3ZFZ A;  3KSH A;  1LSW A;  1NYY A;  1ZTU A;  3MQ0 A;  2PU2 A;  5FI2 A;  4BL2 A;  3FPW A;  3SS5 A;  4YIN A;  4KQR A;  4C6Y A;  3EEH A;  4WBG A;  5F6A A;  1STZ A;  5CXW A;  3F1N B;  1OT9 A;  3TRC A;  1L3L A;  1K56 D;  1WYC A;  1FOF A;  1YLT A;  4JGR A;  3OC2 A;  3A3F A;  3HUO A;  5KMW A;  2W3F A;  2ZD8 A;  3K3D A;  2BAS A;  3WWX A;  5AQ9 A;  1CJF A;  1ERM A;  4WEL A;  4MCW A;  2QYB A;  4UA9 A;  2OLU A;  2Y59 A;  3QNC A;  4JXG A;  4KG6 A;  4H6J A;  5HDC A;  2EFU A;  3G31 A;  2G7U A;  4N9L A;  3LIA A;  3SS4 A;  4PM5 A;  2Z2L B;  1PI5 A;  3CJM A;  5AQ7 A;  4F94 A;  3EGD C;  3MZD A;  3D4F A;  3SH9 A;  3IWI A;  1KGF A;  3L7H A;  3TG9 A;  1IOU A;  2WAD A;  1YMX A;  4EUZ A;  3KSG A;  5CHU A;  2JHE A;  3AGD A;  1ACF A;  4DJ2 A;  3DBA A;  1P9R A;  2V20 A;  3QP1 A;  3WS5 A;  4DF6 A;  2PR5 A;  3LYX A;  5HZH A;  3E98 A;  4DXC A;  4HJ6 A;  2J9O A;  2WGV A;  1BLP A;  5K5B A;  1O7E A;  4O01 A;  3IS2 A;  2EX2 A;  3GTC A;  1F5M A;  3VOZ A;  3KSF A;  3C2W A;  3FPV A;  4LV2 A;  2JKR I;  5U47 A;  4DXB A;  4ZTK A;  2E8I A;  2WKQ A;  3QP4 A;  3IF6 C;  2A49 A;  3E2L A;  4HH2 A;  4EER A;  4KZ4 A;  5CGW A;  3QNB A;  5EOE A;  1DP8 A;  3HUM A;  4LRY C;  1AXB A;  3NCK A;  3FKW A;  3OCN A;  1T18 A;  5FAS A;  1UWP X;  2ZC3 B;  4JBF A;  3VOY A;  5CED A;  1MZU A;  3HLG A;  4S2N C;  2XRN A;  3IF5 A;  2XEP A;  4A5R A;  3G34 A;  5AJG A;  2Y2J A;  1PRQ A;  4FSF A;  1YAX A;  3KYZ A;  1XFQ A;  2ZC6 B;  3C4P A;  4ZAM A;  3H82 B;  3H9W A;  2HDQ A;  1T1B A;  4AFI A;  5GLD A;  4MEZ A;  4R70 A;  4YNR A;  4EV4 A;  4LEN A;  4L0L A;  5FAQ A;  4DN0 A;  4FH2 A;  2V9A A;  4UQI M;  3ULF A;  4GB7 A;  3LIE A;  3OPP A;  3SW1 A;  4FUW A;  3OPH A;  2XFS A;  1XP4 A;  3N8S A;  3W8K A;  3ZQ5 A;  1PIO A;  3EWK A;  2DMW A;  5HAP A;  3UE6 A;  1TVF A;  2VGL S;  4XXR A;  2OLV A;  2WKP A;  2J9P A;  5CGS A;  3GEC A;  4E3I A;  4HBT A;  2EX9 A;  1PWD A;  3PBS A;  2JKR M;  2K31 A;  3F1P A;  4WMC D;  2KLI A;  5MC7 A;  2JC7 A;  5GHY A;  4ME4 A;  5EVI D;  3LCE A;  1BLH A;  3PAG A;  2XQZ A;  4UEY A;  4S2J A;  3S7Q A;  1BT5 A;  4HQA A;  1N4O A;  4GOG A;  3Q7V B;  3GDI A;  1VB6 A;  3VP4 A;  3F1O B;  4CLC A;  3VP3 A;  3JPU A;  4GCZ A;  3SS3 A;  3CZD A;  4LV0 A;  1I2S A;  1H8Z A;  3HBR A;  5A90 A;  3FC7 A;  1GA0 A;  2Y91 A;  1BUE A;  4ZBE A;  5DF9 A;  2W1T A;  4ZJ3 A;  1KE3 A;  1F9I A;  1E4D A;  3UME A;  4D60 A;  1DP6 A;  3ISG A;  4ID4 A;  2HP5 A;  3V67 A;  3MJQ A;  4MLL A;  3S7N A;  1TDL A;  1L2S A;  2XFT A;  3MFX A;  2V2F F;  3TSG A;  5F1F A;  3MQQ A;  4EUV A;  2ZM2 A;  1BZA A;  1QME A;  4O7D A;  4H6J B;  2H5S A;  2O9C A;  2P08 A;  2J8Y A;  5HWT A;  3OLO A;  3W4P A;  3NI9 A;  3PXP A;  1H8Y A;  5J3W A;  2JCH A;  1N9L A;  1S1Y A;  4S2O A;  1XJ2 A;  4OP5 A;  4YWZ A;  3G30 A;  1ONH A;  4HP9 A;  3HLD A;  3AGF A;  2MJ6 A;  1BSG A;  4KQO A;  3BFE A;  4E04 A;  1VEU A;  2WAE A;  4OPZ A;  4BJP A;  2O99 A;  2OSU A;  2OV5 A;  2P9V A;  2BG1 A;  1MKM A;  4U0X A;  3LR0 A;  5E2G A;  3ZDJ A;  1OTD A;  3OPR A;  3E2K A;  5HAQ A;  1T19 A;  3WRT A;  4X68 A;  1K38 A;  2B02 A;  4EXO A;  3ZG9 B;  4S2K A;  2HDR A;  1NYM A;  1T1C A;  3IS2 B;  4YOF A;  1TDG A;  2XF3 A;  3ZVT A;  1MWU A;  3KX0 X;  3O5Y A;  4FD8 A;  4JGO A;  3A0V A;  3TOI A;  3IX4 A;  3HLC A;  3TW8 A;  1Q2P A;  2ZBB A;  1K54 A;  3LIB A;  5A92 A;  3VV4 A;  4K0X A;  1MWT A;  3KO6 A;  1IKG A;  1M6K A;  1DJB A;  1MXO A;  5J7E A;  2INW A;  1RCJ A;  2PRF A;  1JTD A;  3WS2 A;  4QD4 A;  1W7F A;  3MF0 A;  3LR3 A;  5IHV A;  3LEQ A;  4F3L A;  4XT2 A;  2M7U A;  1S67 L;  1FR6 A;  3IBJ A;  4X1L A;  5DTK A;  3T4J A;  3C5A A;  1YLP A;  2R78 A;  4DE3 A;  3B47 A;  5CRF A;  4KZ7 A;  2FFF B;  3U4L P;  2L1M A;  4JF5 A;  4ZRR A;  5F68 A;  4Y5F A;  1PW8 A;  3MR0 A;  1QMF A;  4CQH A;  4HJ3 A;  1VET A;  4PM7 A;  3N6I A;  5EM1 A;  3W4O A;  2X01 A;  4QU3 A;  5A93 A;  3HVF A;  4RX3 A;  2GDN A;  3DAV A;  3PBN A;  4EU0 A;  5CEB A;  4B93 A;  5FQM A;  4OOM A;  3I7J A;  1ZC2 A;  3R7W A;  3PR6 A;  4HI4 A;  1HD8 A;  1CEF A;  1P0Z A;  3CI6 A;  3P7N A;  2Q9N A;  5M1A A;  1BLC A;  1FQG A;  4NXF A;  4EEP A;  3F1P B;  3MQO A;  3BRM A;  5IT5 A;  4GLQ A;  4GS9 A;  2EX6 A;  2W3G A;  3EQU A;  2VX8 A;  4UAA A;  3OCL A;  4HES A;  2HPB A;  2HJ9 C;  2V8C A;  2G2U A;  4PPR A;  3ITB A;  5C5K A;  2ZMA A;  2JBF A;  5M19 A;  2Y2P A;  4R3B A;  2PAV P;  3LID A;  3BQA A;  1I2W A;  1L0E A;  2KDK A;  3NHQ A;  5HPF A;  2O9B A;  3D9Y A;  3KSI A;  4CLC D;  2IA2 A;  4ZDX A;  2NUT C;  4CLC B;  1MBL A;  3H7W A;  2PBY A;  4P87 A;  1S4S A;  3Q7Z A;  4FH4 A;  3SH7 A;  3T4L A;  3VOL A;  1G6O A;  3LUQ A;  2PHY A;  2WYX A;  3IF6 A;  1W63 M;  1S0W A;  5GHZ A;  2J7V A;  2W1R A;  1OJ5 A;  4JF4 A;  4PMA A;  1KDS A;  2CC1 A;  2W1T B;  4BQM A;  5DFX A;  4IVI A;  1Y54 A;  3RFB A;  2I9V A;  2W3H A;  1GCE A;  2UWX A;  5DVA A;  4QJG A;  4GD8 A;  1TS0 A;  4S2N A;  1K54 C;  3ZNY A;  1Q2Q A;  4OP8 A;  1N9B A;  2IWC A;  3IBR A;  4MN5 A;  3C4O A;  4QWO A;  1ZHH B;  3Q82 A;  2KOI A;  4WEJ A;  2M1C A;  5HWW A;  4BD0 A;  2UV0 E;  4KQQ A;  3P98 A;  4BMW A;  2FFY A;  1PZO A;  3QHY A;  3VP0 A;  3IX8 A;  1D06 A;  1LL9 A;  4G3K A;  4OLD A;  3HRE A;  1GHP A;  3T12 B;  4PHT A;  3OPL A;  5EUA A;  1BYW A;  1VEU B;  4WEK A;  2P9V B;  3VFF A;  4K91 A;  4Y13 A;  2EXA A;  1HTZ A;  4UHU A;  3A3I A;  3BYD A;  2O0Y A;  1TF1 A;  1BLS A;  4GNU A;  4E3L A;  5G4Y A;  2PD8 A;  3UE3 A;  4GD6 A;  3B42 A;  4EBL A;  4GHI A;  4ARZ A;  3K3C A;  5EOO A;  4KZ9 A;  4LRZ E;  1E3U D;  1UWN X;  1PNE A;  1I5Q A;  5LBR A;  3IH8 A;  2GX5 A;  3MMH A;  3LY3 A;  2HJE A;  3G2Z A;  2PD7 A;  2ZMF A;  1CQA A;  5IU1 A;  4DMZ A;  4Q8I A;  5HPI A;  2ZL1 A;  4DRT A;  3RH8 B;  4DKI A;  4S2M A;  2PYR A;  2W3D A;  2GZA A;  3DTE A;  1S6R A;  3MKF A;  4MBF A;  4EBN A;  5FEG A;  2JE5 A;  1MPL A;  2J3T C;  4BWI A;  2WKR A;  4N9K A;  1SKF A;  2X71 A;  4F3L B;  4XT2 B;  4X55 A;  1K25 A;  4JF6 A;  4NXG A;  2QKP A;  4WL9 A;  1XPB A;  3QP8 A;  3GRJ A;  2Z2M B;  3SH8 A;  3T4Q A;  1XGJ A;  2P7J A;  3CUE C;  1W8Y A;  3PTE A;  4MNR A;  5JYP A;  2PDR A;  1HZO A;  5EVI C;  3LFV A;  4X53 A;  3ZG8 B;  4II7 A;  1NLY A;  1VET B;  1GSX A;  3N8L A;  4KUK A;  2WGW B;  3ZGA B;  5CTN A;  3G4P A;  5AVF A;  2AVX A;  2K2N A;  4KUO A;  5L2F A;  1Y28 A;  1XGI A;  2O9A A;  3BFG A;  2WKH A;  1ES5 A;  3R7W B;  5E2H A;  4GW9 A;  4ZJ1 A;  4PKY A;  1NWZ A;  1ERQ A;  4EQ1 A;  3JYI A;  2VGJ A;  4JXS A;  3GSG A;  4WZ5 C;  5CEC A;  1TD5 A;  1XJ6 A;  4Y2F A;  4GS9 B;  1D7E A;  4HIA A;  3T4K A;  5IS1 A;  5J4E A;  4LGW A;  4OOL A;  5KSH A;  4E3N A;  2WK0 A;  3LIF A;  5DF7 A;  3BFF A;  3DTM A;  3C7V A;  3GV9 A;  4I5S A;  1J9M A;  1CEG A;  3ZG7 B;  1GHI A;  3CG5 A;  4QB8 A;  1YM1 A;  3Q1F A;  1IFQ A;  3KYE A;  3HUN A;  4MN7 A;  3UPO A;  3IX3 A;  4EWF A;  3ZYT A;  1FSY A;  2M7V A;  2ZQD A;  3PHY A;  3WRZ A;  1NXY A;  2ZQA A;  3H7W B;  2WAF A;  3QP6 A;  2XA7 M;  3N7W A;  3IF6 B;  4ETZ A;  3BFD A;  3G35 A;  1CK3 A;  5TR7 A;  4G3W A;  1XX2 A;  1G28 A;  4KG2 A;  4LCM A;  5F83 A;  2VGK A;  2ZQ7 A;  3N8R A;  2VV7 A;  4LRX C;  4LV1 A;  3SZT A;  3VFH A;  2V1B A;  2Y4A A;  2XDM A;  2XLN A;  4C75 A;  2H10 A;  5HSQ A;  4UQI S;  5DF8 A;  1X0O A;  2VK3 A;  2VJW A;  1PI4 A;  2WGI A;  4HNB A;  1ESI A;  3A3J A;  3IWO A;  4IBR A;  1CI9 A;  2OOL A;  3DW0 A;  3EEA A;  3M2J A;  3ICY A;  5EPH A;  3W2Z A;  3UB9 A;  1ES3 A;  3NY4 A;  4Q0J A;  4GDN A;  2XD5 A;  2V0W A;  4PM9 A;  3DWZ A;  4X1M A;  2B5R A;  4B4X A;  2BLS A;  1WYB A;  4OQ0 A;  2VV8 A;  3S7O A;  2QHK A;  2EFX A;  2ZOH A;  5HAR A;  1KVM A;  3T1X A;  4IBX A;  3S7P A;  5E43 A;  3IHA A;  2HZ5 A;  5HX9 A;  2J3W A;  1LI0 A;  2L4R A;  3UB7 A;  1VM1 A;  2IWD A;  1IEM A;  3B33 A;  2K7S A;  4X56 A;  1K6S A;  3G6O A;  4GHI B;  2WKI A;  4ARZ B;  3EGX C;  3FYZ A;  2QWS A;  4EEU A;  4B88 A;  5AVE A;  4BD1 A;  3GMW A;  1H8M A;  5TBM A;  3BQ8 A;  3C7U A;  3VP1 A;  1K56 A;  2XGN A;  1P97 A;  4OKP A;  1ES2 A;  4PM6 A;  2C6W B;  5FQI A;  1OPX A;  3N4I A;  5GHX A;  2HV1 A;  4E3K A;  4GKU A;  2PBD P;  1LLB A;  1Z6F A;  2DNS A;  4R1G A;  4JPM A;  4NG2 A;  1JWV A;  2ZL1 B;  1OTA A;  4KZA A;  4PM8 A;  3LGO A;  2H0Y A;  2PR6 A;  5DTT A;  4I39 A;  3AGE A;  3BEB A;  3OOV A;  1E25 A;  2EWW A;  1ZKJ A;  4GJ4 A;  4XUZ A;  4EW7 A;  5GLB A;  4OPR A;  3CMZ A;  5J8X A;  1V9Z A;  4OPQ A;  4QY5 A;  3LR5 A;  5A8B A;  1PW1 A;  2Z6C A;  4R4S A;  3UPN A;  1OTI A;  4S2L A;  1Y4O A;  2Y2Q A;  3UY6 A;  2XD1 A;  4MDZ A;  4KZB A;  2OAQ 1;  3VE3 A;  3R4K A;  2C5W B;  1OTE A;  2Y2H A;  3M6B A;  5FAP A;  2WZX A;  2PU4 A;  1FR1 A;  1YQS A;  5CGX A;  4UA6 A;  3UB5 P;  5FAO A;  1L0F A;  1XA7 A;  2W27 A;  2XH9 A;  4IJG A;  1HLU P;  1MC0 A;  4JGQ A;  5F82 A;  5HWV A;  1SKO A;  2ZJ9 A;  4ESP A;  3UDF A;  1XJ4 A;  2HDS A;  4M3K A;  1FSW A;  2WGW A;  1NLZ A;  1L0D A;  1Z09 A;  3E4O A;  4B9O A;  4WUJ A;  4KZ3 A;  4M4X A;  4RX2 A;  4I3A A;  2E8J A;  3RXX A;  1XA1 A;  3IXH A;  4L9F A;  3MZE A;  3IXD A;  5CHM A;  4BBU A;  5CHJ A;  4Z1W A;  1K57 C;  1KDW A;  3ZG0 A;  2PT7 A;  4NET A;  4FCF A;  3D3O A;  4KZ8 A;  4S2P A;  4O0P A;  3T1R A;  1DJC A;  5DJT A;  3BJN A;  2BTF P;  4C3Q A;  4R6L A;  3NJA A;  4N1X A;  1RGZ A;  3NDE A;  4MMN A;  4WZ4 A;  5KIZ A;  4P6Z S;  5EM0 A;  1GHM A;  3CAX A;  3O87 A;  5DJU A;  3FWL A;  5FAT A;  1UGU A;  1NY0 A;  2A2L A;  1KE4 A;  5TGF A;  3E4P A;  1K4F A;  3C30 A;  5FL3 A;  1K55 A;  1EW0 A;  3FZC A;  3BLS A;  5G4Z A;  5GLA A;  3NOU C;  4O8G A;  2Y2L A;  1TEM A;  1KE0 A;  3LIC A;  1KOU A;  5L8M A;  3A3E A;  3P01 A;  3EOI A;  2XSS A;  4BLM A;  1ZG6 A;  3CUE A;  2LB5 A;  1GSW A;  3BEC A;  4D2O A;  5EVI A;  1LL8 A;  4UA7 A;  4OPY A;  3V3S A;  3BFC A;  1U60 A;  2W3E A;  5EVL A;  3ZNT A;  1ZG4 A;  3T1Q B;  4RA7 A;  4RQ9 A;  1WE4 A;  2FZ0 A;  3MFD A;  2QMI A;  4FOF A;  3UE1 A;  1W63 Q;  1BTL A;  3NC8 A;  2ZMV A;  3U2A A;  4Y17 A;  3TE8 A;  3MBZ A;  4Y15 A;  3HLB A;  2JKF A;  3DTK A;  4NKP A;  3KYQ A;  5DFY A;  1PFL A;  3PBO A;  4WZ5 A;  3TJZ C;  4BBT A;  1PZP A;  4OLG A;  4DDY A;  5HDD A;  1YLZ A;  1XJ3 A;  3HLE A;  2JKT I;  4R38 A;  2W0N A;  1TS7 A;  1ALQ A;  4PKY G;  1VQQ A;  3LR4 A;  4NXB A;  4CLC E;  1H3Q A;  2ZC5 B;  3NEC A;  5TJJ A;  3A0R A;  4OQH A;  1IKI A;  1NZU A;  3T4S A;  2H28 A;  2XR0 A;  5TBM B;  3K2N A;  4QHC A;  2DCF A;  5FQ9 A;  5FEF A;  5KZH A;  3T4O A;  2Y8H A;  4OOY A;  3M2K A;  2P04 A;  5DKK A;  3PBR A;  4R0Q A;  4OVD A;  3LEZ A;  1N9N A;  3HCY A;  3MSH A;  5EVE A;  3WS4 A;  1G5U A;  3D72 A;  4MN6 A;  2Y2G A;  3QP2 A;  2QPN A;  2VEA A;  1OT6 A;  5E2E A;  3HLW A;  1IYP A;  3IT9 A;  4Z9Q A;  2HDU A;  4GN2 A;  1SCW A;  4R3A A;  4EES A;  3DWK A;  4CJN A;  4BEN A;  4LLO B;  3UDI A;  2NUP C;  1YSQ A;  1RP5 A;  1YSP A;  5GLC A;  2VV6 A;  2OWJ A;  2XK1 A;  3UMD A;  3BW6 A;  2Z6D A;  4MBH A;  2Y2I A;  3LY4 A;  4P85 A;  3S4X A;  2JKT M;  3RXW A;  2LB9 A;  2QJ5 A;  3P09 A;  4X25 A;  3ZG5 A;  4ZJ2 A;  5HD3 A;  4HP4 A;  1D1J A;  2KX6 A;  1K55 C;  2RCX A;  2G2W A;  2VGL M;  4R23 A;  4IUH A;  1YKD A;  5JYO A;  1TS8 A;  4E6X A;  2WUQ A;  5L09 A;  1M40 A;  3IH9 A;  2EXB A;  1SKO B;  4Q0I A;  1S4R A;  1SDE A;  2FH5 A;  2XRO A;  1IYO A;  1KGG A;  5AQA A;  4WN5 A;  1XXM A;  3FG8 A;  4EQI A;  5FDH A;  5E2F A;  1YLJ A;  4HJ4 A;  3UNW A;  1KVL A;  2Q0O A;  3V3R A;  4R4R A;  4OON A;  1G68 A;  4JGP A;  5FA7 A;  1F2K A;  3A0S A;  5I5L A;  4MBK A;  3FKV A;  1YT4 A;  1W79 A;  2WKE A;  3T50 A;  3JVU A;  2H0T A;  2ZLY A;  3M6H A;  2I72 A;  5HW3 A;  5EV0 A;  3IXG A;  1J3W A;  3CPT A;  4HEF A;  4KZ5 A;  1W5D A;  1WA9 A;  3O3V A;  4Y0O A;  3S22 A;  5HFO A;  5EEC A;  4OQI A;  4S2I A;  4K08 A;  4E3O A;  5EE8 A;  3NBL A;  3UE0 A;  3MKE A;  3ZCZ A;  2OWH A;  1LHY A;  2VA0 A;  1T1A A;  4U0T A;  4Y3I A;  3IQA A;  3PYP A;  3BY9 A;  3V5M A;  2J3T D;  2JKG A;  4JLF A;  5FI7 A;  2ZC4 B;  3IXB A;  3V50 A;  5I94 A;  3GQZ A;  3VSK A;  4E6W A;  5A91 A;  1K0K A;  3NOP C;  4U3T A;  1LSX A;  5F69 A;  3VSL A;  1SHV A;  3C8C A;  1C3B A;  5HAI A;  5EVI B;  1AWI A;  4DE0 A;  2YKH A;  4RVA A;  3BWL A;  2B95 A;  4IVK A;  3MS6 A;  4EBP A;  4NK3 A;  1G6A A;  1IYQ A;  3BM6 A;  3C38 A;  2ZM8 A;  2RL3 A;  2HGV A;  1F98 A;  4Y0U A;  3HL9 A;  3NOT C;  3JVV A;  3FV7 A;  1JTG A;  3UB8 A;  4QY6 A;  1A0K A;  3RTY A;  4X69 A; 
#chains in the Genus database with same CATH homology
 3T4T A;  4HH3 A;  2WKQ A;  1ODV A;  3EQV A;  2W27 A;  4HH2 A;  4EER A;  3IBR A;  4MN5 A;  3OBF A;  1DP8 A;  4KQD A;  4IJG A;  3VE4 A;  2B18 A;  4LRY C;  1MC0 A;  1ZHH B;  4JGQ A;  2KOI A;  3OCN A;  2GNX A;  5HWV A;  1T18 A;  1XJ4 A;  4WEJ A;  1UWP X;  2M1C A;  5HWW A;  1MZU A;  4WF0 A;  2XRN A;  5CX7 A;  4I3I A;  5AJG A;  4FSF A;  2A24 A;  1YAX A;  3KYZ A;  4BMW A;  1NLZ A;  2EWV A;  2EA9 A;  1XFQ A;  1DRM A;  4I3J A;  3E4O A;  1P9W A;  4B9O A;  3H82 B;  2XA7 S;  3H9W A;  4WLA A;  2J80 A;  4WUJ A;  1D06 A;  1T1B A;  4M4X A;  4AFI A;  2PYP A;  2OAP 1;  4G3K A;  4R70 A;  4I3A A;  4YNR A;  3CWF A;  4L9F A;  4L0L A;  4BBU A;  4BBV A;  4Z1W A;  4DN0 A;  2CMN A;  2V9A A;  1N9O A;  4UQI M;  3ULF A;  4PHT A;  2PT7 A;  3LIE A;  3D3O A;  1BYW A;  3SW1 A;  4O0P A;  3F1N A;  1VHM A;  4WEK A;  3ZQ5 A;  5DJT A;  3EWK A;  2DMW A;  3UE6 A;  2O0Y A;  1TF1 A;  3BJN A;  4EET B;  2D02 A;  2VGL S;  4R6L A;  5G4Y A;  2D01 A;  3NJA A;  2PD8 A;  3UE3 A;  2WKP A;  3B42 A;  4GHI A;  4ARZ A;  1XFN A;  4MMN A;  3K3C A;  4I38 A;  3GEC A;  5KIZ A;  4P6Z S;  4LRZ E;  3LI8 A;  3PBS A;  1UWN X;  2JKR M;  3CAX A;  2K31 A;  3HJK A;  5LBR A;  3PBQ A;  3F1P A;  3HJI A;  2GX5 A;  5DJU A;  2KLI A;  1UGU A;  5MC7 A;  3MMH A;  4ME4 A;  2A2L A;  2HJE A;  4ETX A;  3E4P A;  2PD7 A;  3C30 A;  2ZMF A;  3BY8 A;  5FL3 A;  5IU1 A;  4DMZ A;  2VLG A;  1EW0 A;  5G4Z A;  3NOU C;  4O8G A;  4QPR A;  5HPI A;  3RH8 B;  4PAU A;  1V9Y A;  3LIC A;  1KOU A;  2VZW A;  4UEY A;  5L8M A;  4Q0H A;  3S7Q A;  3P01 A;  3EOI A;  3CIT A;  2PYR A;  2XSS A;  2W3D A;  2GZA A;  4HQA A;  3CUE A;  3GDI A;  4L9E A;  1VB6 A;  2LB5 A;  1GSW A;  3F1O B;  1LL8 A;  2L0W A;  4CLC A;  5HD5 A;  2J3T C;  4BWI A;  2WKR A;  1NRJ A;  4HY8 A;  4F3L B;  4GCZ A;  4XT2 B;  2W3E A;  4NXG A;  2QKP A;  4WL9 A;  2GJ3 A;  4RQ9 A;  2FZ0 A;  4FOF A;  5HDS A;  1JNU A;  3FC7 A;  1W63 Q;  3T4Q A;  2ZMV A;  4P6Z M;  3U2A A;  5DF9 A;  2W1T A;  2HF6 A;  2P7J A;  3CUE C;  1F9I A;  3TE8 A;  2PDR A;  3UME A;  1DP6 A;  3LFV A;  4CLC C;  4II7 A;  1NLY A;  4NKP A;  1GSX A;  4NEE D;  3V67 A;  4KUK A;  3MJQ A;  3KYQ A;  5DFY A;  3S7N A;  3PBO A;  1LSV A;  3TJZ C;  4BBT A;  3MFX A;  5AVF A;  2V0U A;  5HDD A;  1TS6 A;  1OTB A;  1XJ3 A;  2JKT I;  4R38 A;  2K2N A;  2W0N A;  4KUO A;  4L9G A;  3MQQ A;  1Y28 A;  2O9A A;  4DJ3 A;  4EUV A;  1TS7 A;  4PKY G;  3R7W B;  3LR4 A;  4GW9 A;  4H6J B;  4NXB A;  4CLC E;  1H3Q A;  4IHQ A;  2O9C A;  3LI9 A;  2P08 A;  4PKY A;  1NWZ A;  5TJJ A;  5F5Y A;  4EQ1 A;  3A0R A;  5HWT A;  3UB6 A;  3OLO A;  3T4S A;  2H28 A;  3PXP A;  5TBM B;  3K2N A;  3PBT A;  1TD5 A;  1XJ6 A;  5J3W A;  4Y2F A;  4GS9 B;  1D7E A;  4HIA A;  3T4K A;  5IS1 A;  1N9L A;  1S1Y A;  3T4O A;  5J4E A;  2Y8H A;  2YKF A;  1XJ2 A;  3H82 A;  2P04 A;  4NXE A;  4OOL A;  4YWZ A;  5KSH A;  5DKK A;  3LIF A;  3PBR A;  4HP9 A;  1N9N A;  2Y79 A;  3HCY A;  5HL6 A;  2MJ6 A;  4KQO A;  3D72 A;  4I5S A;  4MN6 A;  4E04 A;  4BJP A;  3MXQ A;  2VEA A;  2O99 A;  1IFQ A;  1OT6 A;  1MKM A;  4HOI A;  4MN7 A;  1S66 L;  3LR0 A;  3ZYT A;  1GSV A;  2M7V A;  3PHY A;  4R3A A;  1OTD A;  3H7W B;  4EES A;  5EFW A;  1T19 A;  4LPZ A;  4LLO B;  1LT0 A;  1YSQ A;  2NUP C;  2XA7 M;  2B02 A;  2V1A A;  1YSP A;  4EXO A;  4ETZ A;  3CLO A;  2VKS A;  2VV6 A;  2OWJ A;  4G3W A;  1T1C A;  3UMD A;  3BW6 A;  4IUK A;  1G28 A;  3IS2 B;  2Z6D A;  3E0Y A;  4YOF A;  2JKT M;  4G3V A;  2LB9 A;  1S1Z A;  2QJ5 A;  3KX0 X;  5HD3 A;  3O5Y A;  4HP4 A;  4JGO A;  3A0V A;  2VV7 A;  4LRX C;  2QJ7 A;  1OJG A;  2V1B A;  3TW8 A;  2KX6 A;  2ZBB A;  3LIB A;  2JN7 A;  3VV4 A;  5HSQ A;  2VGL M;  3KO6 A;  4IUH A;  1YKD A;  4UQI S;  1TS8 A;  5J7E A;  2INW A;  1X0O A;  1DP9 A;  3E4Q A;  4Q0I A;  2VJW A;  1S4R A;  4HHD A;  4HNB A;  3F1O A;  2FH5 A;  3MF0 A;  2XRO A;  3LR3 A;  2ZOI A;  2OOL A;  4WN5 A;  2A24 B;  5DKL A;  4F3L A;  3EEA A;  4XT2 A;  3ICY A;  2M7U A;  1S67 L;  3KSH A;  3FG8 A;  3IBJ A;  3W2Z A;  1LSW A;  3UB9 A;  3T4J A;  4Q0J A;  1ZTU A;  3MQ0 A;  4HJ4 A;  2R78 A;  2V0W A;  3B47 A;  2L1M A;  3S7O A;  2VV8 A;  3FPW A;  4JGP A;  2QHK A;  4ZRR A;  5F68 A;  3EEH A;  4Y5F A;  5F6A A;  1STZ A;  2ZOH A;  3MR0 A;  4CQH A;  4HJ3 A;  3F1N B;  3A0S A;  1OT9 A;  3TRC A;  4JGR A;  3S7P A;  5I5L A;  3OC2 A;  3PBN A;  4EU0 A;  2J3W A;  2L4R A;  2W3F A;  3K3D A;  2BAS A;  3UB7 A;  4B93 A;  4WEL A;  4MCW A;  3B33 A;  2K7S A;  2QYB A;  3T50 A;  4OOM A;  3R7W A;  3PR6 A;  3JVU A;  4HI4 A;  4H6J A;  3G6O A;  4GHI B;  4ARZ B;  1P0Z A;  5HDC A;  3CI6 A;  3P7N A;  3EGX C;  2G7U A;  2QWS A;  4EEU A;  5AVE A;  1WA9 A;  3LIA A;  1H8M A;  5TBM A;  3BQ8 A;  4EEP A;  4NXF A;  3F1P B;  4K08 A;  3MQO A;  5IT5 A;  3EGD C;  4GLQ A;  1P97 A;  4GS9 A;  2OWH A;  2W3G A;  3EQU A;  2VA0 A;  2VX8 A;  1T1A A;  3OCL A;  1OPX A;  4Y3I A;  3PYP A;  2HV1 A;  3BY9 A;  1IOU A;  2HJ9 C;  2J3T D;  5C5K A;  3KSG A;  1OTA A;  3LID A;  2PR6 A;  3NOP C;  3BQA A;  4I39 A;  2JHE A;  3OOV A;  2EWW A;  2KDK A;  1LSX A;  4GJ4 A;  3DBA A;  5F69 A;  1P9R A;  4DJ2 A;  4EW7 A;  3NHQ A;  1V9Z A;  3C8C A;  5HPF A;  2O9B A;  3KSI A;  2PR5 A;  4CLC D;  2IA2 A;  2NUT C;  4CLC B;  2YKH A;  3H7W A;  3LR5 A;  3LYX A;  3BWL A;  5A8B A;  5HZH A;  1S4S A;  3E98 A;  2Z6C A;  3T4L A;  3VOL A;  1G6O A;  4HJ6 A;  3LUQ A;  1OTI A;  2PHY A;  1W63 M;  2W1R A;  3C38 A;  5K5B A;  4O01 A;  1OJ5 A;  2HGV A;  1F98 A;  2W1T B;  3IS2 A;  5DFX A;  3NOT C;  4MDZ A;  3JVV A;  3RFB A;  2I9V A;  2OAQ 1;  3VE3 A;  3R4K A;  1OTE A;  2W3H A;  3UB8 A;  1F5M A;  1TS0 A;  3KSF A;  3C2W A;  3FPV A;  3RTY A;  2JKR I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...