3BY9A

Crystal structure of the v. cholerae histidine kinase dctb sensor domain
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
259
structure length
259
Chain Sequence
MRFQYQALLNEHQSQLDRFSSHIVATLDKYAHIPHLISKDKELVDALLSAQNSAQIDITNRYLEQVNEVIQAADTYLIDRFGNTIASSNWNLDRSFIGRNFAWRPYFYLSIAGQKSQYFALGSTSGQRGYYYAYPVIYAAEILGVIVVKMDLSAIEQGWQNKSSYFVATDDHQVVFMSSQPAWLFHSVADLSPAQLNDIRQSQQYLDSPIPSLGWQGDLQAEQSEWRKPEKHWLQDDYIVSSRPLPELALTIRVLSPKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein
publication title Crystal Structures of C4-Dicarboxylate Ligand Complexes with Sensor Domains of Histidine Kinases DcuS and DctB.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transferase
total genus 84
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3by9A02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3by9A01
2PD8A 4WUJA 2I9VA 3PYPA 2R78A 2A24B 4H6JA 3H9WA 1XJ3A 2L0WA 4HJ3A 1N9NA 3CAXA 1T1CA 1S4SA 4GCZA 3E4OA 3NOUC 3F1PA 1GSWA 2PR6A 1MZUA 3B33A 4RQ9A 2YKHA 5HWVA 5AVFA 3H7WB 1VB6A 2KDKA 3LIEA 2WKQA 3PHYA 1D7EA 2WKRA 3VE3A 5HSQA 1NWZA 3HJKA 4I39A 5KIZA 1XJ4A 1OTDA 1LSXA 4HQAA 3P7NA 3SW1A 1UWNX 3UB9A 4BBTA 1GSVA 3OLOA 4R3AA 3NJAA 5IU1A 4H6JB 3D72A 1BYWA 4WLAA 2V1BA 3H82B 4LRYC 2PD7A 2VV7A 2QWSA 3E4QA 4KUOA 1XFQA 3ZQ5A 2QJ7A 4NXFA 4I5SA 1LSVA 4WL9A 3VE4A 4HH3A 1XJ2A 1DP9A 4KQDA 5HD5A 3NOPC 1TS8A 3MR0A 2V0WA 4LPZA 3GECA 3HJIA 3CLOA 4HOIA 4EESA 2W27A 3LI9A 4WF0A 2OOLA 3MQOA 3RH8B 3UB7A 3LIAA 2V9AA 2K7SA 2OWHA 1JNUA 3F1NA 4GHIA 2B02A 2ZOHA 1UWPX 5DKKA 4HIAA 3H82A 4EQ1A 4DJ2A 1DP6A 4R6LA 2W0NA 3LIDA 2D01A 5A8BA 1OTEA 1T1BA 3C2WA 1XFNA 4HJ4A 3LIBA 4L9GA 1LT0A 1KOUA 2J80A 5DJUA 4B9OA 4WN5A 4GS9A 4E04A 5HWTA 2INWA 2WKPA 3BY9A 1EW0A 1S4RA 5HZHA 4LLOB 5AVEA 3FC7A 5F5YA 2CMNA 1LL8A 1G28A 3F1NB 4GHIB 1S1YA 4F3LB 3A0SA 5DJTA 1T1AA 4EXOA 1S67L 1T18A 5J7EA 2VLGA 4I3IA 1T19A 4DJ3A 2YKFA 4EERA 2VV8A 3UE6A 4L9EA 3KX0X 2L4RA 2PYPA 4YWZA 5DKLA 1N9OA 4I38A 1GSXA 2PR5A 2PDRA 2BASA 1OTAA 5I5LA 3LICA 3A0RA 3UB6A 4K08A 4GS9B 3BWLA 1UGUA 2PYRA 4LRXC 2VV6A 5J3WA 5HDDA 2ZBBA 2OWJA 3A0VA 5F6AA 4NXEA 3UMDA 4KUKA 3LYXA 5HDCA 5HDSA 3UMEA 2JHEA 4M4XA 1OTIA 3BY8A 3E4PA 4XT2B 1XJ6A 1Y28A 5TBMB 5IS1A 5J4EA 4PKYG 1DP8A 4JGQA 4NXGA 4F3LA 4BBUA 4JGOA 3EWKA 4EEPA 3T50A 1S66L 2QHKA 4HJ6A 4JGRA 2Z6DA 1P97A 1X0OA 4HNBA 2V1AA 2P7JA 1S1ZA 2V0UA 3IS2B 2QJ5A 3LIFA 3MJQA 4EEUA 2L1MA 2GJ3A 1TS6A 2KX6A 4HI4A 1OJGA 4HP9A 4I3JA 3FG8A 4LRZE 2HV1A 3MQQA 3F1OA 4MN5A 2QKPA 2Z6CA 4GW9A 4XT2A 5TBMA 1N9LA 1OT9A 3ULFA 4JGPA 1OTBA 1WA9A 1TS7A 2M1CA 4MN6A 3CWFA 4NXBA 3RTYA 3EEHA 4BBVA 3MFXA 4I3AA 2D02A 3IBRA 3LUQA 5F68A 3LI8A 4HY8A 1F9IA 5G4ZA 3MXQA 3F1PB 2PHYA 3K3DA 1P0ZA 3NOTC 2A24A 1V9ZA 4L9FA 3IS2A 5G4YA 2EA9A 1OJ5A 3GDIA 3G6OA 4HHDA 3VOLA 3F1OB 4HH2A 5F69A 4EW7A 2ZOIA 2VEAA 1V9YA 1OT6A 1TS0A 1ODVA 3UB8A 3C8CA 3H7WA 5HWWA 4PKYA 4R38A 1LSWA 3K3CA 5EFWA 1DRMA 4HP4A 5HD3A 4EETB 2JN7A 3NHQA 1D06A 4R70A 1F98A 3ICYA 2H28A
chains in the Genus database with same CATH superfamily
4WZ5C 1IYQA 5TGFA 4YINA 4IUHA 1K55A 2EX9A 4DXBA 4OPQA 1XJ3A 4HJ3A 1K38A 5JYOA 1S4SA 1K57C 1NJ4A 1FSYA 3N8RA 2Y2MA 1GSWA 2ZQAA 2PR6A 1MZUA 1YQSA 4QY5A 5HWVA 3NDGA 2KDKA 4B4XA 3PBOA 4WEKA 2WKIA 1OMEA 2LB9A 3VE3A 5CHJA 3UE0A 3UB5P 5KIZA 5IT5A 1ES2A 3VFHA 3UE3A 4OOYA 5L2FA 2MJ6A 4Y15A 4KENB 5EM0A 1YAXA 5F1GA 1M6KA 1XGJA 3IHAA 3ZDJA 2LB5A 1K6SA 2XK1A 1HTZA 3LR4A 2V20A 2VV7A 1YSQA 3ZQ5A 4OKPA 5L07A 4NXFA 4HBTA 3V3RA 3E98A 4ID4A 4BMWA 2BLSA 3BECA 4HH3A 1G68A 1XA7A 1DP9A 4JF6A 5HD5A 3NOPC 3HUNA 3MF0A 5IHVA 4BQMA 1TS8A 2JKRM 5DFYA 4E6XA 4CLCD 1NLZA 4JF4A 3P01A 1I5QA 2OAQ1 3W4QA 5FI2A 3Q7VA 1LHYA 1JTGA 4X25A 3A3EA 1KDWA 1MPLA 3S7OA 4NKPA 4WF0A 1BTLA 4MBHA 1H8ZA 1ZTUA 2XROA 3LGOA 1JNUA 3PBNA 3UO9A 1CK3A 1YLPA 3G32A 5KSHA 1FSWA 3B3XA 1SCWA 1HLUP 4R0QA 3UPOA 4MEZA 2Y4AA 1L0GA 1YM1A 4RYEA 1PI5A 3E2KA 1DJAA 4K91A 4KZ7A 1F2KA 3D3OA 3H82A 5FA7A 3UPNA 4L0LA 1MWRA 2J9PA 1DP6A 4HEFA 1XXMA 1MKMA 2H0YA 2W0NA 3OPPA 4RX2A 2D01A 3G2ZA 5A8BA 1G5UA 3C2WA 2WUQA 5F82A 4B9OA 3JPUA 2HGVA 3BLMA 3K2NA 5HWTA 1KGGA 2WKPA 1D1JA 2W3EA 4EV4A 1PZOA 5A92A 4MN7A 3VP0A 1SKOB 4LCLA 1JVJA 3PBRA 3F1NB 4R3JA 4GLQA 1C3BA 2ZL1B 3ITBA 3AGDA 2RL3A 5FSRA 4EERA 3CPTA 4X53A 3E2LA 4XXRA 2FFYA 2PU2A 2PYPA 3HUMA 4I38A 1IEMA 4QU3A 4KZAA 2BASA 2P08A 2JBFA 5EVIA 4K08A 4GS9B 5EVLA 5DF8A 1UGUA 2C6WB 2VV6A 3T4QA 1NXYA 5HDDA 2J9OA 2OWJA 3A0VA 4CJNA 4RA7A 4ZJ3A 5F6AA 5CTNA 2HPBA 1AXBA 4KZ4A 1PRQA 2VZWA 4E3LA 3G31A 3LYXA 4C3QA 3DTIA 2H10A 1MWTA 3RXXA 2HJEA 3IXBA 3GSGA 4X6TA 1Y28A 3RJUA 4E3MA 3ISGA 1G6AA 1E3UD 3SS3A 4KQRA 3CJMA 1PW1A 3ZCZA 4IJGA 1PFLA 4JGOA 4P6ZM 3Q7ZA 4ZBEA 1H0MA 4XUZA 2Z6DA 1J9MA 3A3DA 1MWUA 4RX3A 2H0TA 4GNUA 4Q0HA 1KE4A 2EX6A 2X01A 1J3WA 1NRFA 1K56D 4Y2FA 1K0KA 5M19A 3LY4A 5AQ7A 3IH8A 1ONHA 1DJBA 5EUAA 2J3TD 4EEUA 2L1MA 3SOIA 1FOFA 2GJ3A 2ZD8A 4LENA 2WGIA 3EQUA 2XQZA 5DVAA 5U47A 4DE2A 2PU4A 3VOYA 1OJGA 3KSIA 3Q82A 4UAAA 4JXWA 4LRZE 1A0KA 2XFTA 4WMCA 3MZEA 3MQQA 3F1OA 4MN5A 4GN2A 4BENA 1N9LA 4BWIA 4PM8A 4E3NA 2XF3A 4FTXA 1WA9A 4MN6A 2FZ0A 4P6ZS 5F1FA 3S1YA 3W4PA 3RTYA 3IF6B 3AGFA 3NY4A 1XPBA 4EUZA 5EV0A 2D02A 3LUQA 5F68A 5GHZA 4LV1A 3NCKA 5HAQA 1EROA 1KGFA 2PHYA 2VKSA 3MXSA 3QP1A 3NOTC 3JYIA 1N4OA 2PT7A 3BFCA 1PWDA 5G4YA 3N8SA 1TD5A 5HAPA 1IYOA 4LV3A 4FOFA 1TS0A 4YOFA 4ME4A 3SH9A 3UB8A 4D60A 3HLGA 5CHUA 1RGYA 3BYDA 1KE3A 2V1ZA 2WGWB 3K3CA 1RP5A 3N6IA 4FUWA 5AJGA 2XEPA 1SDEA 4R1GA 4WM9A 4QJGA 2G7UA 2JN7A 3IX4A 1PI4A 3VFFA 4DRTA 4IVKA 3CUEA 3UDFA 4QY6A 5HAIA 1TDLA 3I7JA 1K6RA 2A2LA 4IVIA 1K54A 1NY0A 4GD6A 3UDXA 2EWVA 3H9WA 2JCHA 1T1CA 4JLFA 4N1HA 2VA0A 4D2OA 2OLVA 3QNCA 2OSUA 2ZQ8A 1MBLA 1LLBA 2FFFB 2WYXA 3R7WB 4OQIA 2V8CA 5FQ9A 5AVFA 3HCYA 3G30A 3NC8A 1GHPA 1D7EA 3FPWA 3IWOA 4A5RA 5DF7A 4WZ4A 4H8RA 5HSQA 1NWZA 2XLNA 4I39A 4O01A 3T4OA 1OTDA 3IQAA 1LSXA 3P7NA 2ZMAA 5GLBA 3SW1A 1P9RA 2OAP1 2Y59A 2Z2MB 2PBYA 1GSVA 3OLOA 4MBKA 5LBRA 4O0PA 3LR3A 1KGEA 2W1TB 4H6JB 1N9BA 3D72A 1BYWA 3SH8A 2Y79A 3MQ0A 3LFVA 2ZJ9A 3BFFA 4KUOA 4QWOA 5CTMA 1H3QA 4I5SA 4ZJ1A 1LSVA 3KSHA 1PNEA 1RCJA 1ZKJA 4HBUA 3R4KA 4UA6A 4Y0UA 3MR0A 3SS4A 1W8QA 3NIAA 5CERA 1FQGA 4LPZA 3HJIA 4WEJA 4E3JA 3ZHHA 3UN7A 2ZQ7A 4JXSA 1ONGA 1JWPA 4HOIA 4EESA 2W27A 4EQIA 3T4SA 3T4LA 3LIAA 5KMWA 3QP2A 3KSFA 1SZVA 2V9AA 2OWHA 3ITAA 3F1NA 3OOVA 1STZA 5CGWA 4Z9QA 5DTTA 2B02A 4KG6A 1UWPX 1ESIA 4R3BA 2X02A 2VGJA 4S2LA 4OLDA 2G2UA 3T1QB 4N1XA 3DAVA 4DJ2A 4DDYA 2P9VA 1DY6A 4IUKA 1MY8A 4B93A 1T1BA 5D3OA 5AQBA 5L10A 3T1RA 3Q07A 5HFOA 2AVXA 3V67A 2Y2HA 1LT0A 5DJUA 3JVVA 3O88A 4X56A 4S2KA 4WN5A 4GS9A 3S4XA 1S4RA 5FL3A 5BOHA 2P04A 1I2SA 2JE5A 3P09A 4KQQA 1CI9A 5C5KA 3T1XA 2OV5A 1ES5A 4DN0A 3EGDC 1VETA 4LFUA 1G28A 1VEUB 2Y2GA 3GMWA 5E43A 5J8XA 2R9WA 5CXWA 4Q0JA 4GDBA 5FQIA 1BT5A 1BZAA 1S67L 4I3IA 3MBZA 4DJ3A 4FH2A 3VOZA 2YKFA 3AGEA 4GKUA 2KLIA 3IXHA 1ZC2A 4EUVA 1HZOA 3U2AA 3KX0X 4S2NA 4ARZB 4P0MA 5DKLA 2Y2QA 4IBRA 3C4OA 3BFGA 1GCEA 1K55C 2PDRA 3OPHA 4FCFA 3UB6A 1L2SA 3S7QA 1IYSA 3BWLA 1H8YA 1XX2A 4LRXC 5J3WA 5EVEA 2HDUA 2ZBBA 2O0YA 1L0EA 4IHQA 1KVLA 4NXEA 2QMIA 3UMDA 5DTSA 4ZJ2A 2ZM2A 3WS2A 5HDSA 3PBQA 1MXOA 3UMEA 2XA7M 3GRJA 4M4XA 4BL3A 2QZ6A 3HVFA 4LGWA 4XT2B 1XJ6A 2ZQCA 4S2JA 5HL6A 5IS1A 3L9KA 4JGQA 4F3LA 3IF5A 4R23A 4BBUA 2O9BA 3FPVA 3T50A 3BQ8A 2QHKA 1XKZA 4HJ6A 4EBPA 2EX2A 2K2NA 4BL2A 4GZBA 4S2NC 1X0OA 4B4ZA 3HREA 2UV0E 4KZ3A 2V1AA 1FCOA 4BD0A 2Z2LB 4JXVA 2PAVP 3IS2B 3BM6A 3DWKA 2ZC5B 3GV9A 4X69A 2QJ5A 2O9CA 4Y5FA 4OQ0A 3N8LA 2Y91A 4HI4A 3N7WA 3MSHA 2C5WB 4HP9A 1E25A 2Y2NA 4I3JA 2W1RA 3Q81A 4OP5A 2XA7S 3A3IA 5TBMA 4DXCA 3ULFA 4QPRA 2R9XA 4JGPA 2W3DA 2ACGA 4OONA 2WGVA 3NI9A 3CWFA 3PBTA 4OPZA 1RGZA 5GLAA 5GL9A 1MWSA 3KO6A 1TEMA 3S7PA 4BLMA 3P98A 3LI8A 4Y0OA 2EFXA 2WAFA 3HL9A 4KQOA 3K3DA 2Y2PA 1E4DA 1H5XA 2X71A 5E2FA 1GA0A 2JKGA 5FAQA 4JF5A 2HF6A 3TW8A 3M6BA 4MCWA 4UQIM 3G6OA 4FH4A 4HH2A 3Q1FA 4FSFA 4EW7A 4OPYA 3ZG5A 1ODVA 3R7WA 3W2ZA 3C8CA 3MMHA 1NYYA 3GVBA 5FATA 1DRMA 3DTKA 4HP4A 3B47A 2A3UA 5HD3A 2E8JA 5GLCA 5FDHA 3NHQA 1OPXA 4R70A 1NLYA 3HBRA 5HL1A 3MFDA 2H28A 1FR6A 5M1AA 2PD8A 1NZUA 2A24B 1O7EA 1NRJA 2JKFA 4H6JA 2DMWA 5HX9A 1N9NA 3WRTA 4DF6A 3E0YA 5EVIC 3CHWP 4GCZA 3E4OA 2HP5A 5KZHA 1ZG4A 4JBFA 1K4EA 2W3GA 4ZDXA 3F1PA 3PR6A 2YKHA 3UY6A 3HLCA 4S2OA 1IKGA 1VB6A 4UQIS 3LIEA 2WKQA 2XD5A 3C7UA 2ZM8A 3QHYA 1PWGA 3CMZA 1GHMA 3C38A 3D4FA 3ZG0A 2JC7A 3HJKA 5M18A 1BLHA 4CLCA 4GOGA 1Q2QA 4OP8A 1XJ4A 4UHUA 4HQAA 1W79A 1UWNX 2J8YA 4BBTA 4R3AA 1W8YA 2WAEA 1YMXA 3FZCA 4U0TA 3BQAA 3RFBA 1XGIA 3ZVTA 5KSCA 5IU1A 4S2PA 4WLAA 3H82B 4LRYC 3KYZA 3RXWA 2V8FA 3E4QA 2FH5A 4FD8A 4QB8A 3VE4A 4ZAMA 4MNRA 1XJ2A 4KQDA 3IHBA 2NUPC 5DTKA 2V0WA 5FAOA 2WADA 1W63M 3C4PA 2Y2IA 3ZG7B 5FQMA 3TSGA 1ZHHB 2QPNA 2EFUA 3BJNA 5FQJA 4NK3A 3LO7A 3RH8B 3UB7A 3VP2A 5HW3A 5E2GA 3KYEA 2EXBA 4G3VA 2K7SA 3O3VA 4OOMA 5MC7A 1SHVA 3CPTB 1VEUA 4P87A 4KZBA 2ZOHA 3DW0A 2GNXA 3VP1A 2QYBA 3DTMA 2B18A 4E3IA 4O8GA 5DKKA 3O86A 1BULA 3HLEA 4Z1WA 4HIAA 5FI6A 4EQ1A 3IBJA 3LEQA 4ZTKA 4R6LA 5F83A 3LIDA 4O7DA 1XFNA 4NG2A 3FYZA 3M2KA 3LIBA 5FQKA 3TOIA 4L9GA 1KOUA 2J80A 3S22A 4DKIA 1Y4OA 5AQ9A 1XP4A 2ZC7A 3CI6A 2VK3A 2INWA 3BY9A 1EW0A 3WWXA 5F5YA 2KOIA 2CMNA 4E3KA 1LL8A 2B95A 4GHIB 5DJTA 4X1MA 1ESUA 2DRWA 4DE3A 2I72A 2O9AA 5FASA 3UNWA 3NDEA 2IWCA 4PHTA 3VSLA 2VV8A 3UE6A 3MZFA 3CUEC 2L4RA 4YWZA 1GSXA 3BFDA 4WZ5A 3FKVA 2PR5A 3VP4A 1K54C 5I5LA 3A3FA 2NUTC 3A0RA 4F94A 1L3LA 1BLCA 3PTEA 4YNRA 2PYRA 3BEBA 4AFIA 4EU0A 1Z6FA 4KUKA 2HZ5A 3ZYTA 5E2HA 1ES3A 2G2WA 1K56A 1CEGA 1KDSA 1YLJA 1PW8A 3IH9A 3E4PA 1L0FA 2PBDP 1SKOA 1FIKA 4PKYG 3MKEA 1DP8A 4X68A 2ZL1A 4NXGA 1YLWA 3EWKA 4EEPA 5EVID 1KE0A 1S66L 1TDGA 3HUOA 4U3TA 2H5SA 4GJ4A 1M40A 3SH7A 1P97A 4Y0TA 2P74A 4OPRA 1U60A 2HP6A 1BUEA 3UPPA 5HPIA 4Y13A 3WS1A 2P7JA 1S1ZA 4Q8IA 5G18A 3T4KA 1H8MA 2V0UA 4OLGA 3LIFA 3MJQA 2Q9MA 1SKFA 2O99A 3N4IA 3OZHA 1VQQA 5DF9A 2KX6A 2VGLM 3WS5A 4PM5A 2JKTI 4C6YA 2CC1A 2Y2OA 2QKPA 2Z6CA 2J3TC 2HJ9C 2Y55A 4U0XA 1BLSA 3ZG8B 1CF0A 4N9LA 1JWVA 2GX5A 3NULA 1YLTA 4JXGA 1OTBA 3IX3A 1S6RA 1TS7A 4KZ5A 2B5RA 1FCNA 3WRZA 4NXBA 5FEGA 3PAGA 3TE8A 4DE0A 1TF1A 1AWIA 3FWLA 3L7HA 4K0XA 3VV4A 4OVDA 5FAPA 3EOIA 1IOUA 3BFEA 5G4ZA 3FKWA 3MXQA 2VGKA 2DNSA 5EOOA 2HDQA 4BD1A 2A24A 3PAEA 4L9FA 4WMCD 3G4PA 4OQGA 4B88A 1PZPA 2WZXA 1OJ5A 3GDIA 3VMAA 1GHIA 2Y2JA 4JPMA 2J3WA 4HHDA 4XUXA 2GZAA 5F69A 2IWDA 2VEAA 1ERMA 1V9YA 1OT6A 2XRNA 1HD8A 3V3SA 3UDIA 1W5DA 1Z09A 4MLLA 2UWXA 2VGLS 2XGNA 5FDSA 5HWWA 4PKYA 2WZZA 4LCMA 4R38A 2M7UA 3C5AA 1LSWA 2ZC3B 5EFWA 2OLUA 3MKFA 1LI0A 1YLZA 4PPRA 1CQAA 3EEAA 1IYPA 4PM9A 4MMNA 3UE1A 1LI9A 2BG1A 3QP6A 3VP3A 3ZG9B 1WE4A 3IWQA 1ALQA 4P6BA 4WUJA 3IF6A 2I9VA 3PYPA 2R78A 4GB7A 5A91A 2HDRA 3G34A 2L0WA 3GTCA 4X55A 1Q2PA 3CAXA 5HARA 3TRCA 3NOUC 1I2WA 3S7NA 1O07A 4LV2A 3IXGA 3B33A 1VM1A 2ZMVA 3ZNYA 4RQ9A 1CEFA 4YFMA 5FQQA 1L0DA 3H7WB 3WS4A 3PHYA 4WYYA 4E3OA 3MS6A 2WKRA 4CQHA 3HLFA 4E6WA 4KG2A 1CJFA 1IKIA 3CZDA 1W63Q 3IWIA 4UA9A 1DJCA 1JWZA 1YLYA 2WGWA 3BW6A 3UB9A 3QNBA 2Q0OA 1MKIA 3NJAA 2ZC6B 2V1BA 1YPRA 2PD7A 1ES4A 3BRMA 1PYYA 2QWSA 1PIOA 1XFQA 1FCMA 2QJ7A 3M6HA 2P9VB 4PM7A 1Y54A 5CECA 3DBAA 3IXDA 1NZOA 4MDZA 4OH0A 3IF6C 4WL9A 5A93A 1NYMA 4OOLA 2WKEA 4PMAA 1BLPA 3OPRA 4NETA 2ZM0A 1CI8A 3PBSA 2J7VA 4IBXA 4HESA 4R4RA 3GECA 4UA7A 3SZTA 1EWZA 3CLOA 1VETB 5CRFA 4Y3IA 2IA2A 4K0WA 1F5MA 3LI9A 3O87A 3BLSA 2OOLA 3MQOA 3HLWA 4P85A 3LCEA 4R4SA 2K31A 2XR0A 2VX8A 1W7FA 5FEFA 1FILA 1IELA 3LEZA 5I94A 2RCXA 4GHIA 1WYCA 2Y2LA 3GR2A 4C75A 1GA9A 2PRFA 5CX7A 4G3KA 2WK0A 3T4TA 2V2FF 2W1TA 1IFQA 4Q0IA 5L09A 3OPLA 4OQHA 4Y7PA 5EECA 2A49A 4PM6A 3GQZA 1OTEA 2M7VA 3KSGA 4HJ4A 2ZMFA 3O5YA 2EXAA 2EX8A 1XA1A 2BTFP 2GDNA 2XD1A 3Q7VB 3W8KA 4JKTA 5TR7A 5A90A 4E04A 3ZNTA 3HLDA 4X1LA 5HZHA 4EWFA 2XFSA 3FV7A 4LLOB 5K5BA 5AVEA 3FC7A 3EQVA 3G35A 5E2EA 1K25A 3C7VA 3OBFA 1S1YA 4F3LB 3A0SA 4WELA 1T1AA 2JKTM 4EXOA 1T18A 5J7EA 2VLGA 1T19A 5CEDA 3HLBA 2Y8HA 4ETXA 1QMEA 1YMSA 1QMFA 4L9EA 3CG5A 3PXPA 3T4JA 1N9OA 5CGXA 3ZGAB 4RVAA 2ZC4B 3JVUA 2Y2KA 5GHXA 1OTAA 4PAUA 3LICA 5CHMA 2JKRI 5JYPA 1BSGA 4QD4A 4NEED 3VSKA 1PWCA 5AQAA 2DCFA 4KZ9A 1ZG6A 1EI5A 4KG5A 1YT4A 3IT9A 3OCLA 3LR0A 3NECA 3ZVWA 5HDCA 3T12B 4M3KA 4ESPA 3EGXC 3M2JA 3QP5A 2JHEA 4EBNA 3OCNA 1MC0A 1OTIA 3BY8A 3V39A 5TBMB 3DTEA 4CLCC 5J4EA 4LV0A 3MZDA 4N9KA 4DDSA 3DWZA 4G3WA 3OC2A 4WBGA 5HPFA 4DMZA 5EPHA 3QP8A 3W4OA 3KYQA 2WKHA 5L8MA 1TVFA 4JGRA 3LY3A 1ACFA 5EVIB 4GD8A 4ARZA 2XH9A 2HP9A 2XDMA 4UEYA 1LL9A 4N92A 4HNBA 2VJWA 3LR5A 4BJPA 5TFQA 1VHMA 3G2YA 5EOEA 5CGSA 1FR1A 5EE8A 1K4FA 1SDNA 3U4LP 4QHCA 3TG9A 1P9WA 1S0WA 4IEDA 4MBFA 1TS6A 3WS0A 4EBLA 5GHYA 3CITA 3V5MA 3IX8A 1YKDA 2ZLYA 3FG8A 2HV1A 5CEBA 1WYBA 2HDSA 3SS5A 3NBLA 4GW9A 4XT2A 4CPKA 1OT9A 4II7A 4ETZA 4ZRRA 2Q9NA 4S2MA 2M1CA 3A3JA 1HVBA 3EEHA 1E3UA 4BBVA 3MFXA 4I3AA 3V50A 3IBRA 3ZFZA 2IWBA 2E8IA 1JTDA 5FI7A 4CLCE 3D9YA 4HY8A 1K57A 2W3FA 3B42A 1F9IA 3F1PB 2EWWA 2ZQDA 5DFXA 1P0ZA 5EM1A 1V9ZA 3IS2A 2EA9A 5TJJA 3VOLA 3F1OB 2ZOIA 2ZQ9A 1YSPA 4GDNA 4S2IA 1KVMA 4CLCB 5GLDA 4DE1A 1G6OA 3H7WA 2XSSA 4Y17A 3T1SA 3C30A 3MXRA 4KZ6A 1LL5A 4KZ8A 4EETB 3QP4A 3TJZC 1D06A 2W3HA 1F98A 3ICYA 1ERQA
chains in the Genus database with same CATH topology
2PD8A 2A2LA 4WUJA 2I9VA 3PYPA 2R78A 4IUHA 2A24B 1NRJA 4H6JA 2DMWA 2EWVA 1XJ3A 2L0WA 3H9WA 4HJ3A 1N9NA 3E0YA 3CAXA 1T1CA 1S4SA 4GCZA 3E4OA 3TRCA 3NOUC 2W3GA 2VA0A 3F1PA 3S7NA 1GSWA 2PR6A 1MZUA 3B33A 3R7WB 2ZMVA 3PR6A 4RQ9A 2YKHA 5HWVA 5AVFA 3HCYA 3H7WB 1VB6A 2KDKA 4UQIS 3PBOA 3LIEA 2WKQA 4WEKA 3PHYA 1D7EA 3FPWA 2WKRA 2LB9A 3VE3A 4CQHA 3C38A 5HSQA 1NWZA 3HJKA 4I39A 5KIZA 5IT5A 4O01A 4CLCA 1W63Q 3T4OA 3UE3A 1XJ4A 1OTDA 1LSXA 4HQAA 3P7NA 3SW1A 1P9RA 2MJ6A 1UWNX 2OAP1 3BW6A 3UB9A 4BBTA 1YAXA 1GSVA 3OLOA 4R3AA 5LBRA 4O0PA 3BQAA 3RFBA 3LR3A 3NJAA 5IU1A 2LB5A 2W1TB 4H6JB 3D72A 1BYWA 3LR4A 4WLAA 2Y79A 2V1BA 3H82B 3MQ0A 2PD7A 3LFVA 4LRYC 3KYZA 2VV7A 1YSQA 2QWSA 3E4QA 4KUOA 1XFQA 3ZQ5A 2FH5A 1H3QA 2QJ7A 4NXFA 3DBAA 4I5SA 4MDZA 1LSVA 3E98A 4BMWA 4WL9A 3VE4A 3KSHA 4OOLA 4HH3A 1XJ2A 1DP9A 4KQDA 5HD5A 3NOPC 3MF0A 1TS8A 2JKRM 3R4KA 5DFYA 3PBSA 2NUPC 3MR0A 2V0WA 4CLCD 1NLZA 3P01A 1W63M 4LPZA 3GECA 3HJIA 4WEJA 2OAQ1 3CLOA 4HOIA 4EESA 4Y3IA 1ZHHB 2IA2A 1F5MA 2W27A 3LI9A 3S7OA 3T4SA 4NKPA 3BJNA 2OOLA 4WF0A 3MQOA 3T4LA 3RH8B 1ZTUA 3UB7A 3LIAA 2XROA 3KSFA 2K31A 2V9AA 4G3VA 2VX8A 2K7SA 2OWHA 1JNUA 3PBNA 4OOMA 5MC7A 5KSHA 3F1NA 3OOVA 1STZA 4GHIA 2B02A 2ZOHA 1UWPX 2GNXA 2QYBA 5CX7A 2B18A 4O8GA 5DKKA 4G3KA 3T4TA 4Z1WA 2W1TA 1IFQA 4HIAA 4Q0IA 3D3OA 3H82A 4L0LA 4EQ1A 4DJ2A 3IBJA 1DP6A 4R6LA 1MKMA 2W0NA 3LIDA 2D01A 4IUKA 5A8BA 4B93A 1OTEA 1T1BA 3C2WA 3KSGA 2M7VA 1XFNA 4HJ4A 2ZMFA 3LIBA 3O5YA 4L9GA 3V67A 1LT0A 1KOUA 2J80A 3JVVA 5DJUA 4B9OA 2HGVA 4WN5A 4GS9A 4E04A 3K2NA 5HWTA 3CI6A 2INWA 2WKPA 3BY9A 1EW0A 2W3EA 1S4RA 5FL3A 5HZHA 2P04A 4LLOB 5C5KA 5AVEA 5K5BA 3FC7A 3EQVA 4DN0A 4MN7A 5F5YA 2KOIA 2CMNA 3EGDC 1LL8A 1G28A 3PBRA 3F1NB 3OBFA 4GLQA 4GHIB 1S1YA 4F3LB 3A0SA 4WELA 4Q0JA 5DJTA 1T1AA 2JKTM 4EXOA 1S67L 1T18A 5J7EA 2VLGA 4I3IA 1T19A 2O9AA 4DJ3A 2YKFA 4EERA 2Y8HA 4ETXA 2KLIA 4PHTA 2VV8A 3UE6A 4EUVA 3U2AA 3CUEC 4L9EA 3KX0X 3PXPA 3T4JA 2L4RA 2PYPA 4ARZB 4YWZA 5DKLA 1N9OA 4I38A 1GSXA 3JVUA 2PR5A 2PDRA 2BASA 1OTAA 4PAUA 5I5LA 2NUTC 3LICA 2JKRI 3A0RA 2P08A 3UB6A 4K08A 4NEED 4GS9B 3S7QA 4YNRA 3BWLA 1UGUA 2PYRA 4LRXC 2VV6A 3T4QA 5J3WA 5HDDA 2ZBBA 2O0YA 2OWJA 4AFIA 3A0VA 4IHQA 3OCLA 5F6AA 3LR0A 4NXEA 3UMDA 4EU0A 2VZWA 4KUKA 3LYXA 3ZYTA 5HDCA 3EGXC 5HDSA 3PBQA 2HJEA 3UMEA 2JHEA 2XA7M 3OCNA 1MC0A 4M4XA 1OTIA 3BY8A 3E4PA 4XT2B 1XJ6A 1Y28A 5HL6A 5TBMB 4CLCC 5IS1A 5J4EA 4G3WA 3OC2A 4PKYG 5HPFA 1DP8A 4DMZA 4JGQA 4NXGA 4F3LA 4IJGA 4BBUA 4JGOA 2O9BA 4P6ZM 3KYQA 3EWKA 3FPVA 4EEPA 3T50A 1S66L 3BQ8A 5L8MA 2QHKA 4HJ6A 4JGRA 2Z6DA 4GJ4A 1P97A 2K2NA 1X0OA 4ARZA 4UEYA 4Q0HA 4HNBA 2V1AA 5HPIA 2P7JA 2VJWA 3LR5A 4BJPA 1S1ZA 1VHMA 4Y2FA 3T4KA 1H8MA 2V0UA 3IS2B 2J3TD 2QJ5A 3LIFA 3MJQA 4EEUA 2O9CA 4Y5FA 2L1MA 2O99A 1P9WA 2GJ3A 3EQUA 1TS6A 5DF9A 2KX6A 2VGLM 3CITA 4HI4A 1OJGA 1YKDA 3KSIA 2JKTI 4HP9A 4I3JA 3FG8A 4LRZE 2W1RA 2HV1A 3MQQA 3F1OA 4MN5A 2QKPA 2XA7S 2Z6CA 4GW9A 4XT2A 2J3TC 2HJ9C 5TBMA 1N9LA 1OT9A 3ULFA 4BWIA 4II7A 4QPRA 4JGPA 4ETZA 4ZRRA 2GX5A 2W3DA 1OTBA 1WA9A 1TS7A 2M1CA 4MN6A 2FZ0A 3CWFA 3PBTA 4P6ZS 4NXBA 3RTYA 3EEHA 4BBVA 3TE8A 3KO6A 3MFXA 4I3AA 1TF1A 2D02A 3IBRA 3LUQA 5F68A 3S7PA 3VV4A 3LI8A 4CLCE 3EOIA 4HY8A 1IOUA 3B42A 2W3FA 1F9IA 5G4ZA 3MXQA 4KQOA 3F1PB 2PHYA 3K3DA 2EWWA 5DFXA 1P0ZA 2VKSA 3NOTC 2A24A 2PT7A 1V9ZA 4L9FA 3IS2A 2HF6A 3TW8A 4MCWA 5G4YA 4UQIM 2EA9A 1OJ5A 3GDIA 1TD5A 3G6OA 2J3WA 5TJJA 4HHDA 3VOLA 2GZAA 3F1OB 4HH2A 5F69A 4FSFA 4EW7A 2ZOIA 2VEAA 4FOFA 1V9YA 1YSPA 1OT6A 1TS0A 2XRNA 4YOFA 1ODVA 4ME4A 3R7WA 3W2ZA 4CLCB 3UB8A 3C8CA 3MMHA 1G6OA 2VGLS 3H7WA 2XSSA 5HWWA 4PKYA 4R38A 2M7UA 1LSWA 3K3CA 5EFWA 1DRMA 5AJGA 3C30A 4HP4A 3B47A 5HD3A 3EEAA 4EETB 2G7UA 2JN7A 4MMNA 3TJZC 3NHQA 1D06A 1OPXA 2W3HA 4R70A 1F98A 1NLYA 3CUEA 3ICYA 2H28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PD8 A;  4WUJ A;  2I9V A;  3PYP A;  2R78 A;  2A24 B;  4H6J A;  3H9W A;  1XJ3 A;  2L0W A;  4HJ3 A;  1N9N A;  3CAX A;  1T1C A;  1S4S A;  4GCZ A;  3E4O A;  3NOU C;  3F1P A;  1GSW A;  2PR6 A;  1MZU A;  3B33 A;  4RQ9 A;  2YKH A;  5HWV A;  5AVF A;  3H7W B;  1VB6 A;  2KDK A;  3LIE A;  2WKQ A;  3PHY A;  1D7E A;  2WKR A;  3VE3 A;  5HSQ A;  1NWZ A;  3HJK A;  4I39 A;  5KIZ A;  1XJ4 A;  1OTD A;  1LSX A;  4HQA A;  3P7N A;  3SW1 A;  1UWN X;  3UB9 A;  4BBT A;  1GSV A;  3OLO A;  4R3A A;  3NJA A;  5IU1 A;  4H6J B;  3D72 A;  1BYW A;  4WLA A;  2V1B A;  3H82 B;  4LRY C;  2PD7 A;  2VV7 A;  2QWS A;  3E4Q A;  4KUO A;  1XFQ A;  3ZQ5 A;  2QJ7 A;  4NXF A;  4I5S A;  1LSV A;  4WL9 A;  3VE4 A;  4HH3 A;  1XJ2 A;  1DP9 A;  4KQD A;  5HD5 A;  3NOP C;  1TS8 A;  3MR0 A;  2V0W A;  4LPZ A;  3GEC A;  3HJI A;  3CLO A;  4HOI A;  4EES A;  2W27 A;  3LI9 A;  4WF0 A;  2OOL A;  3MQO A;  3RH8 B;  3UB7 A;  3LIA A;  2V9A A;  2K7S A;  2OWH A;  1JNU A;  3F1N A;  4GHI A;  2B02 A;  2ZOH A;  1UWP X;  5DKK A;  4HIA A;  3H82 A;  4EQ1 A;  4DJ2 A;  1DP6 A;  4R6L A;  2W0N A;  3LID A;  2D01 A;  5A8B A;  1OTE A;  1T1B A;  3C2W A;  1XFN A;  4HJ4 A;  3LIB A;  4L9G A;  1LT0 A;  1KOU A;  2J80 A;  5DJU A;  4B9O A;  4WN5 A;  4GS9 A;  4E04 A;  5HWT A;  2INW A;  2WKP A;  3BY9 A;  1EW0 A;  1S4R A;  5HZH A;  4LLO B;  5AVE A;  3FC7 A;  5F5Y A;  2CMN A;  1LL8 A;  1G28 A;  3F1N B;  4GHI B;  1S1Y A;  4F3L B;  3A0S A;  5DJT A;  1T1A A;  4EXO A;  1S67 L;  1T18 A;  5J7E A;  2VLG A;  4I3I A;  1T19 A;  4DJ3 A;  2YKF A;  4EER A;  2VV8 A;  3UE6 A;  4L9E A;  3KX0 X;  2L4R A;  2PYP A;  4YWZ A;  5DKL A;  1N9O A;  4I38 A;  1GSX A;  2PR5 A;  2PDR A;  2BAS A;  1OTA A;  5I5L A;  3LIC A;  3A0R A;  3UB6 A;  4K08 A;  4GS9 B;  3BWL A;  1UGU A;  2PYR A;  4LRX C;  2VV6 A;  5J3W A;  5HDD A;  2ZBB A;  2OWJ A;  3A0V A;  5F6A A;  4NXE A;  3UMD A;  4KUK A;  3LYX A;  5HDC A;  5HDS A;  3UME A;  2JHE A;  4M4X A;  1OTI A;  3BY8 A;  3E4P A;  4XT2 B;  1XJ6 A;  1Y28 A;  5TBM B;  5IS1 A;  5J4E A;  4PKY G;  1DP8 A;  4JGQ A;  4NXG A;  4F3L A;  4BBU A;  4JGO A;  3EWK A;  4EEP A;  3T50 A;  1S66 L;  2QHK A;  4HJ6 A;  4JGR A;  2Z6D A;  1P97 A;  1X0O A;  4HNB A;  2V1A A;  2P7J A;  1S1Z A;  2V0U A;  3IS2 B;  2QJ5 A;  3LIF A;  3MJQ A;  4EEU A;  2L1M A;  2GJ3 A;  1TS6 A;  2KX6 A;  4HI4 A;  1OJG A;  4HP9 A;  4I3J A;  3FG8 A;  4LRZ E;  2HV1 A;  3MQQ A;  3F1O A;  4MN5 A;  2QKP A;  2Z6C A;  4GW9 A;  4XT2 A;  5TBM A;  1N9L A;  1OT9 A;  3ULF A;  4JGP A;  1OTB A;  1WA9 A;  1TS7 A;  2M1C A;  4MN6 A;  3CWF A;  4NXB A;  3RTY A;  3EEH A;  4BBV A;  3MFX A;  4I3A A;  2D02 A;  3IBR A;  3LUQ A;  5F68 A;  3LI8 A;  4HY8 A;  1F9I A;  5G4Z A;  3MXQ A;  3F1P B;  2PHY A;  3K3D A;  1P0Z A;  3NOT C;  2A24 A;  1V9Z A;  4L9F A;  3IS2 A;  5G4Y A;  2EA9 A;  1OJ5 A;  3GDI A;  3G6O A;  4HHD A;  3VOL A;  3F1O B;  4HH2 A;  5F69 A;  4EW7 A;  2ZOI A;  2VEA A;  1V9Y A;  1OT6 A;  1TS0 A;  1ODV A;  3UB8 A;  3C8C A;  3H7W A;  5HWW A;  4PKY A;  4R38 A;  1LSW A;  3K3C A;  5EFW A;  1DRM A;  4HP4 A;  5HD3 A;  4EET B;  2JN7 A;  3NHQ A;  1D06 A;  4R70 A;  1F98 A;  3ICY A;  2H28 A; 
#chains in the Genus database with same CATH topology
 4WZ5 C;  1IYQ A;  5TGF A;  4YIN A;  4IUH A;  1K55 A;  2EX9 A;  4DXB A;  4OPQ A;  1XJ3 A;  4HJ3 A;  1K38 A;  5JYO A;  1S4S A;  1K57 C;  1NJ4 A;  1FSY A;  3N8R A;  2Y2M A;  1GSW A;  2ZQA A;  2PR6 A;  1MZU A;  1YQS A;  4QY5 A;  5HWV A;  3NDG A;  2KDK A;  4B4X A;  3PBO A;  4WEK A;  2WKI A;  1OME A;  2LB9 A;  3VE3 A;  5CHJ A;  3UE0 A;  3UB5 P;  5KIZ A;  5IT5 A;  1ES2 A;  3VFH A;  3UE3 A;  4OOY A;  5L2F A;  2MJ6 A;  4Y15 A;  4KEN B;  5EM0 A;  1YAX A;  5F1G A;  1M6K A;  1XGJ A;  3IHA A;  3ZDJ A;  2LB5 A;  1K6S A;  2XK1 A;  1HTZ A;  3LR4 A;  2V20 A;  2VV7 A;  1YSQ A;  3ZQ5 A;  4OKP A;  5L07 A;  4NXF A;  4HBT A;  3V3R A;  3E98 A;  4ID4 A;  4BMW A;  2BLS A;  3BEC A;  4HH3 A;  1G68 A;  1XA7 A;  1DP9 A;  4JF6 A;  5HD5 A;  3NOP C;  3HUN A;  3MF0 A;  5IHV A;  4BQM A;  1TS8 A;  2JKR M;  5DFY A;  4E6X A;  4CLC D;  1NLZ A;  4JF4 A;  3P01 A;  1I5Q A;  2OAQ 1;  3W4Q A;  5FI2 A;  3Q7V A;  1LHY A;  1JTG A;  4X25 A;  3A3E A;  1KDW A;  1MPL A;  3S7O A;  4NKP A;  4WF0 A;  1BTL A;  4MBH A;  1H8Z A;  1ZTU A;  2XRO A;  3LGO A;  1JNU A;  3PBN A;  3UO9 A;  1CK3 A;  1YLP A;  3G32 A;  5KSH A;  1FSW A;  3B3X A;  1SCW A;  1HLU P;  4R0Q A;  3UPO A;  4MEZ A;  2Y4A A;  1L0G A;  1YM1 A;  4RYE A;  1PI5 A;  3E2K A;  1DJA A;  4K91 A;  4KZ7 A;  1F2K A;  3D3O A;  3H82 A;  5FA7 A;  3UPN A;  4L0L A;  1MWR A;  2J9P A;  1DP6 A;  4HEF A;  1XXM A;  1MKM A;  2H0Y A;  2W0N A;  3OPP A;  4RX2 A;  2D01 A;  3G2Z A;  5A8B A;  1G5U A;  3C2W A;  2WUQ A;  5F82 A;  4B9O A;  3JPU A;  2HGV A;  3BLM A;  3K2N A;  5HWT A;  1KGG A;  2WKP A;  1D1J A;  2W3E A;  4EV4 A;  1PZO A;  5A92 A;  4MN7 A;  3VP0 A;  1SKO B;  4LCL A;  1JVJ A;  3PBR A;  3F1N B;  4R3J A;  4GLQ A;  1C3B A;  2ZL1 B;  3ITB A;  3AGD A;  2RL3 A;  5FSR A;  4EER A;  3CPT A;  4X53 A;  3E2L A;  4XXR A;  2FFY A;  2PU2 A;  2PYP A;  3HUM A;  4I38 A;  1IEM A;  4QU3 A;  4KZA A;  2BAS A;  2P08 A;  2JBF A;  5EVI A;  4K08 A;  4GS9 B;  5EVL A;  5DF8 A;  1UGU A;  2C6W B;  2VV6 A;  3T4Q A;  1NXY A;  5HDD A;  2J9O A;  2OWJ A;  3A0V A;  4CJN A;  4RA7 A;  4ZJ3 A;  5F6A A;  5CTN A;  2HPB A;  1AXB A;  4KZ4 A;  1PRQ A;  2VZW A;  4E3L A;  3G31 A;  3LYX A;  4C3Q A;  3DTI A;  2H10 A;  1MWT A;  3RXX A;  2HJE A;  3IXB A;  3GSG A;  4X6T A;  1Y28 A;  3RJU A;  4E3M A;  3ISG A;  1G6A A;  1E3U D;  3SS3 A;  4KQR A;  3CJM A;  1PW1 A;  3ZCZ A;  4IJG A;  1PFL A;  4JGO A;  4P6Z M;  3Q7Z A;  4ZBE A;  1H0M A;  4XUZ A;  2Z6D A;  1J9M A;  3A3D A;  1MWU A;  4RX3 A;  2H0T A;  4GNU A;  4Q0H A;  1KE4 A;  2EX6 A;  2X01 A;  1J3W A;  1NRF A;  1K56 D;  4Y2F A;  1K0K A;  5M19 A;  3LY4 A;  5AQ7 A;  3IH8 A;  1ONH A;  1DJB A;  5EUA A;  2J3T D;  4EEU A;  2L1M A;  3SOI A;  1FOF A;  2GJ3 A;  2ZD8 A;  4LEN A;  2WGI A;  3EQU A;  2XQZ A;  5DVA A;  5U47 A;  4DE2 A;  2PU4 A;  3VOY A;  1OJG A;  3KSI A;  3Q82 A;  4UAA A;  4JXW A;  4LRZ E;  1A0K A;  2XFT A;  4WMC A;  3MZE A;  3MQQ A;  3F1O A;  4MN5 A;  4GN2 A;  4BEN A;  1N9L A;  4BWI A;  4PM8 A;  4E3N A;  2XF3 A;  4FTX A;  1WA9 A;  4MN6 A;  2FZ0 A;  4P6Z S;  5F1F A;  3S1Y A;  3W4P A;  3RTY A;  3IF6 B;  3AGF A;  3NY4 A;  1XPB A;  4EUZ A;  5EV0 A;  2D02 A;  3LUQ A;  5F68 A;  5GHZ A;  4LV1 A;  3NCK A;  5HAQ A;  1ERO A;  1KGF A;  2PHY A;  2VKS A;  3MXS A;  3QP1 A;  3NOT C;  3JYI A;  1N4O A;  2PT7 A;  3BFC A;  1PWD A;  5G4Y A;  3N8S A;  1TD5 A;  5HAP A;  1IYO A;  4LV3 A;  4FOF A;  1TS0 A;  4YOF A;  4ME4 A;  3SH9 A;  3UB8 A;  4D60 A;  3HLG A;  5CHU A;  1RGY A;  3BYD A;  1KE3 A;  2V1Z A;  2WGW B;  3K3C A;  1RP5 A;  3N6I A;  4FUW A;  5AJG A;  2XEP A;  1SDE A;  4R1G A;  4WM9 A;  4QJG A;  2G7U A;  2JN7 A;  3IX4 A;  1PI4 A;  3VFF A;  4DRT A;  4IVK A;  3CUE A;  3UDF A;  4QY6 A;  5HAI A;  1TDL A;  3I7J A;  1K6R A;  2A2L A;  4IVI A;  1K54 A;  1NY0 A;  4GD6 A;  3UDX A;  2EWV A;  3H9W A;  2JCH A;  1T1C A;  4JLF A;  4N1H A;  2VA0 A;  4D2O A;  2OLV A;  3QNC A;  2OSU A;  2ZQ8 A;  1MBL A;  1LLB A;  2FFF B;  2WYX A;  3R7W B;  4OQI A;  2V8C A;  5FQ9 A;  5AVF A;  3HCY A;  3G30 A;  3NC8 A;  1GHP A;  1D7E A;  3FPW A;  3IWO A;  4A5R A;  5DF7 A;  4WZ4 A;  4H8R A;  5HSQ A;  1NWZ A;  2XLN A;  4I39 A;  4O01 A;  3T4O A;  1OTD A;  3IQA A;  1LSX A;  3P7N A;  2ZMA A;  5GLB A;  3SW1 A;  1P9R A;  2OAP 1;  2Y59 A;  2Z2M B;  2PBY A;  1GSV A;  3OLO A;  4MBK A;  5LBR A;  4O0P A;  3LR3 A;  1KGE A;  2W1T B;  4H6J B;  1N9B A;  3D72 A;  1BYW A;  3SH8 A;  2Y79 A;  3MQ0 A;  3LFV A;  2ZJ9 A;  3BFF A;  4KUO A;  4QWO A;  5CTM A;  1H3Q A;  4I5S A;  4ZJ1 A;  1LSV A;  3KSH A;  1PNE A;  1RCJ A;  1ZKJ A;  4HBU A;  3R4K A;  4UA6 A;  4Y0U A;  3MR0 A;  3SS4 A;  1W8Q A;  3NIA A;  5CER A;  1FQG A;  4LPZ A;  3HJI A;  4WEJ A;  4E3J A;  3ZHH A;  3UN7 A;  2ZQ7 A;  4JXS A;  1ONG A;  1JWP A;  4HOI A;  4EES A;  2W27 A;  4EQI A;  3T4S A;  3T4L A;  3LIA A;  5KMW A;  3QP2 A;  3KSF A;  1SZV A;  2V9A A;  2OWH A;  3ITA A;  3F1N A;  3OOV A;  1STZ A;  5CGW A;  4Z9Q A;  5DTT A;  2B02 A;  4KG6 A;  1UWP X;  1ESI A;  4R3B A;  2X02 A;  2VGJ A;  4S2L A;  4OLD A;  2G2U A;  3T1Q B;  4N1X A;  3DAV A;  4DJ2 A;  4DDY A;  2P9V A;  1DY6 A;  4IUK A;  1MY8 A;  4B93 A;  1T1B A;  5D3O A;  5AQB A;  5L10 A;  3T1R A;  3Q07 A;  5HFO A;  2AVX A;  3V67 A;  2Y2H A;  1LT0 A;  5DJU A;  3JVV A;  3O88 A;  4X56 A;  4S2K A;  4WN5 A;  4GS9 A;  3S4X A;  1S4R A;  5FL3 A;  5BOH A;  2P04 A;  1I2S A;  2JE5 A;  3P09 A;  4KQQ A;  1CI9 A;  5C5K A;  3T1X A;  2OV5 A;  1ES5 A;  4DN0 A;  3EGD C;  1VET A;  4LFU A;  1G28 A;  1VEU B;  2Y2G A;  3GMW A;  5E43 A;  5J8X A;  2R9W A;  5CXW A;  4Q0J A;  4GDB A;  5FQI A;  1BT5 A;  1BZA A;  1S67 L;  4I3I A;  3MBZ A;  4DJ3 A;  4FH2 A;  3VOZ A;  2YKF A;  3AGE A;  4GKU A;  2KLI A;  3IXH A;  1ZC2 A;  4EUV A;  1HZO A;  3U2A A;  3KX0 X;  4S2N A;  4ARZ B;  4P0M A;  5DKL A;  2Y2Q A;  4IBR A;  3C4O A;  3BFG A;  1GCE A;  1K55 C;  2PDR A;  3OPH A;  4FCF A;  3UB6 A;  1L2S A;  3S7Q A;  1IYS A;  3BWL A;  1H8Y A;  1XX2 A;  4LRX C;  5J3W A;  5EVE A;  2HDU A;  2ZBB A;  2O0Y A;  1L0E A;  4IHQ A;  1KVL A;  4NXE A;  2QMI A;  3UMD A;  5DTS A;  4ZJ2 A;  2ZM2 A;  3WS2 A;  5HDS A;  3PBQ A;  1MXO A;  3UME A;  2XA7 M;  3GRJ A;  4M4X A;  4BL3 A;  2QZ6 A;  3HVF A;  4LGW A;  4XT2 B;  1XJ6 A;  2ZQC A;  4S2J A;  5HL6 A;  5IS1 A;  3L9K A;  4JGQ A;  4F3L A;  3IF5 A;  4R23 A;  4BBU A;  2O9B A;  3FPV A;  3T50 A;  3BQ8 A;  2QHK A;  1XKZ A;  4HJ6 A;  4EBP A;  2EX2 A;  2K2N A;  4BL2 A;  4GZB A;  4S2N C;  1X0O A;  4B4Z A;  3HRE A;  2UV0 E;  4KZ3 A;  2V1A A;  1FCO A;  4BD0 A;  2Z2L B;  4JXV A;  2PAV P;  3IS2 B;  3BM6 A;  3DWK A;  2ZC5 B;  3GV9 A;  4X69 A;  2QJ5 A;  2O9C A;  4Y5F A;  4OQ0 A;  3N8L A;  2Y91 A;  4HI4 A;  3N7W A;  3MSH A;  2C5W B;  4HP9 A;  1E25 A;  2Y2N A;  4I3J A;  2W1R A;  3Q81 A;  4OP5 A;  2XA7 S;  3A3I A;  5TBM A;  4DXC A;  3ULF A;  4QPR A;  2R9X A;  4JGP A;  2W3D A;  2ACG A;  4OON A;  2WGV A;  3NI9 A;  3CWF A;  3PBT A;  4OPZ A;  1RGZ A;  5GLA A;  5GL9 A;  1MWS A;  3KO6 A;  1TEM A;  3S7P A;  4BLM A;  3P98 A;  3LI8 A;  4Y0O A;  2EFX A;  2WAF A;  3HL9 A;  4KQO A;  3K3D A;  2Y2P A;  1E4D A;  1H5X A;  2X71 A;  5E2F A;  1GA0 A;  2JKG A;  5FAQ A;  4JF5 A;  2HF6 A;  3TW8 A;  3M6B A;  4MCW A;  4UQI M;  3G6O A;  4FH4 A;  4HH2 A;  3Q1F A;  4FSF A;  4EW7 A;  4OPY A;  3ZG5 A;  1ODV A;  3R7W A;  3W2Z A;  3C8C A;  3MMH A;  1NYY A;  3GVB A;  5FAT A;  1DRM A;  3DTK A;  4HP4 A;  3B47 A;  2A3U A;  5HD3 A;  2E8J A;  5GLC A;  5FDH A;  3NHQ A;  1OPX A;  4R70 A;  1NLY A;  3HBR A;  5HL1 A;  3MFD A;  2H28 A;  1FR6 A;  5M1A A;  2PD8 A;  1NZU A;  2A24 B;  1O7E A;  1NRJ A;  2JKF A;  4H6J A;  2DMW A;  5HX9 A;  1N9N A;  3WRT A;  4DF6 A;  3E0Y A;  5EVI C;  3CHW P;  4GCZ A;  3E4O A;  2HP5 A;  5KZH A;  1ZG4 A;  4JBF A;  1K4E A;  2W3G A;  4ZDX A;  3F1P A;  3PR6 A;  2YKH A;  3UY6 A;  3HLC A;  4S2O A;  1IKG A;  1VB6 A;  4UQI S;  3LIE A;  2WKQ A;  2XD5 A;  3C7U A;  2ZM8 A;  3QHY A;  1PWG A;  3CMZ A;  1GHM A;  3C38 A;  3D4F A;  3ZG0 A;  2JC7 A;  3HJK A;  5M18 A;  1BLH A;  4CLC A;  4GOG A;  1Q2Q A;  4OP8 A;  1XJ4 A;  4UHU A;  4HQA A;  1W79 A;  1UWN X;  2J8Y A;  4BBT A;  4R3A A;  1W8Y A;  2WAE A;  1YMX A;  3FZC A;  4U0T A;  3BQA A;  3RFB A;  1XGI A;  3ZVT A;  5KSC A;  5IU1 A;  4S2P A;  4WLA A;  3H82 B;  4LRY C;  3KYZ A;  3RXW A;  2V8F A;  3E4Q A;  2FH5 A;  4FD8 A;  4QB8 A;  3VE4 A;  4ZAM A;  4MNR A;  1XJ2 A;  4KQD A;  3IHB A;  2NUP C;  5DTK A;  2V0W A;  5FAO A;  2WAD A;  1W63 M;  3C4P A;  2Y2I A;  3ZG7 B;  5FQM A;  3TSG A;  1ZHH B;  2QPN A;  2EFU A;  3BJN A;  5FQJ A;  4NK3 A;  3LO7 A;  3RH8 B;  3UB7 A;  3VP2 A;  5HW3 A;  5E2G A;  3KYE A;  2EXB A;  4G3V A;  2K7S A;  3O3V A;  4OOM A;  5MC7 A;  1SHV A;  3CPT B;  1VEU A;  4P87 A;  4KZB A;  2ZOH A;  3DW0 A;  2GNX A;  3VP1 A;  2QYB A;  3DTM A;  2B18 A;  4E3I A;  4O8G A;  5DKK A;  3O86 A;  1BUL A;  3HLE A;  4Z1W A;  4HIA A;  5FI6 A;  4EQ1 A;  3IBJ A;  3LEQ A;  4ZTK A;  4R6L A;  5F83 A;  3LID A;  4O7D A;  1XFN A;  4NG2 A;  3FYZ A;  3M2K A;  3LIB A;  5FQK A;  3TOI A;  4L9G A;  1KOU A;  2J80 A;  3S22 A;  4DKI A;  1Y4O A;  5AQ9 A;  1XP4 A;  2ZC7 A;  3CI6 A;  2VK3 A;  2INW A;  3BY9 A;  1EW0 A;  3WWX A;  5F5Y A;  2KOI A;  2CMN A;  4E3K A;  1LL8 A;  2B95 A;  4GHI B;  5DJT A;  4X1M A;  1ESU A;  2DRW A;  4DE3 A;  2I72 A;  2O9A A;  5FAS A;  3UNW A;  3NDE A;  2IWC A;  4PHT A;  3VSL A;  2VV8 A;  3UE6 A;  3MZF A;  3CUE C;  2L4R A;  4YWZ A;  1GSX A;  3BFD A;  4WZ5 A;  3FKV A;  2PR5 A;  3VP4 A;  1K54 C;  5I5L A;  3A3F A;  2NUT C;  3A0R A;  4F94 A;  1L3L A;  1BLC A;  3PTE A;  4YNR A;  2PYR A;  3BEB A;  4AFI A;  4EU0 A;  1Z6F A;  4KUK A;  2HZ5 A;  3ZYT A;  5E2H A;  1ES3 A;  2G2W A;  1K56 A;  1CEG A;  1KDS A;  1YLJ A;  1PW8 A;  3IH9 A;  3E4P A;  1L0F A;  2PBD P;  1SKO A;  1FIK A;  4PKY G;  3MKE A;  1DP8 A;  4X68 A;  2ZL1 A;  4NXG A;  1YLW A;  3EWK A;  4EEP A;  5EVI D;  1KE0 A;  1S66 L;  1TDG A;  3HUO A;  4U3T A;  2H5S A;  4GJ4 A;  1M40 A;  3SH7 A;  1P97 A;  4Y0T A;  2P74 A;  4OPR A;  1U60 A;  2HP6 A;  1BUE A;  3UPP A;  5HPI A;  4Y13 A;  3WS1 A;  2P7J A;  1S1Z A;  4Q8I A;  5G18 A;  3T4K A;  1H8M A;  2V0U A;  4OLG A;  3LIF A;  3MJQ A;  2Q9M A;  1SKF A;  2O99 A;  3N4I A;  3OZH A;  1VQQ A;  5DF9 A;  2KX6 A;  2VGL M;  3WS5 A;  4PM5 A;  2JKT I;  4C6Y A;  2CC1 A;  2Y2O A;  2QKP A;  2Z6C A;  2J3T C;  2HJ9 C;  2Y55 A;  4U0X A;  1BLS A;  3ZG8 B;  1CF0 A;  4N9L A;  1JWV A;  2GX5 A;  3NUL A;  1YLT A;  4JXG A;  1OTB A;  3IX3 A;  1S6R A;  1TS7 A;  4KZ5 A;  2B5R A;  1FCN A;  3WRZ A;  4NXB A;  5FEG A;  3PAG A;  3TE8 A;  4DE0 A;  1TF1 A;  1AWI A;  3FWL A;  3L7H A;  4K0X A;  3VV4 A;  4OVD A;  5FAP A;  3EOI A;  1IOU A;  3BFE A;  5G4Z A;  3FKW A;  3MXQ A;  2VGK A;  2DNS A;  5EOO A;  2HDQ A;  4BD1 A;  2A24 A;  3PAE A;  4L9F A;  4WMC D;  3G4P A;  4OQG A;  4B88 A;  1PZP A;  2WZX A;  1OJ5 A;  3GDI A;  3VMA A;  1GHI A;  2Y2J A;  4JPM A;  2J3W A;  4HHD A;  4XUX A;  2GZA A;  5F69 A;  2IWD A;  2VEA A;  1ERM A;  1V9Y A;  1OT6 A;  2XRN A;  1HD8 A;  3V3S A;  3UDI A;  1W5D A;  1Z09 A;  4MLL A;  2UWX A;  2VGL S;  2XGN A;  5FDS A;  5HWW A;  4PKY A;  2WZZ A;  4LCM A;  4R38 A;  2M7U A;  3C5A A;  1LSW A;  2ZC3 B;  5EFW A;  2OLU A;  3MKF A;  1LI0 A;  1YLZ A;  4PPR A;  1CQA A;  3EEA A;  1IYP A;  4PM9 A;  4MMN A;  3UE1 A;  1LI9 A;  2BG1 A;  3QP6 A;  3VP3 A;  3ZG9 B;  1WE4 A;  3IWQ A;  1ALQ A;  4P6B A;  4WUJ A;  3IF6 A;  2I9V A;  3PYP A;  2R78 A;  4GB7 A;  5A91 A;  2HDR A;  3G34 A;  2L0W A;  3GTC A;  4X55 A;  1Q2P A;  3CAX A;  5HAR A;  3TRC A;  3NOU C;  1I2W A;  3S7N A;  1O07 A;  4LV2 A;  3IXG A;  3B33 A;  1VM1 A;  2ZMV A;  3ZNY A;  4RQ9 A;  1CEF A;  4YFM A;  5FQQ A;  1L0D A;  3H7W B;  3WS4 A;  3PHY A;  4WYY A;  4E3O A;  3MS6 A;  2WKR A;  4CQH A;  3HLF A;  4E6W A;  4KG2 A;  1CJF A;  1IKI A;  3CZD A;  1W63 Q;  3IWI A;  4UA9 A;  1DJC A;  1JWZ A;  1YLY A;  2WGW A;  3BW6 A;  3UB9 A;  3QNB A;  2Q0O A;  1MKI A;  3NJA A;  2ZC6 B;  2V1B A;  1YPR A;  2PD7 A;  1ES4 A;  3BRM A;  1PYY A;  2QWS A;  1PIO A;  1XFQ A;  1FCM A;  2QJ7 A;  3M6H A;  2P9V B;  4PM7 A;  1Y54 A;  5CEC A;  3DBA A;  3IXD A;  1NZO A;  4MDZ A;  4OH0 A;  3IF6 C;  4WL9 A;  5A93 A;  1NYM A;  4OOL A;  2WKE A;  4PMA A;  1BLP A;  3OPR A;  4NET A;  2ZM0 A;  1CI8 A;  3PBS A;  2J7V A;  4IBX A;  4HES A;  4R4R A;  3GEC A;  4UA7 A;  3SZT A;  1EWZ A;  3CLO A;  1VET B;  5CRF A;  4Y3I A;  2IA2 A;  4K0W A;  1F5M A;  3LI9 A;  3O87 A;  3BLS A;  2OOL A;  3MQO A;  3HLW A;  4P85 A;  3LCE A;  4R4S A;  2K31 A;  2XR0 A;  2VX8 A;  1W7F A;  5FEF A;  1FIL A;  1IEL A;  3LEZ A;  5I94 A;  2RCX A;  4GHI A;  1WYC A;  2Y2L A;  3GR2 A;  4C75 A;  1GA9 A;  2PRF A;  5CX7 A;  4G3K A;  2WK0 A;  3T4T A;  2V2F F;  2W1T A;  1IFQ A;  4Q0I A;  5L09 A;  3OPL A;  4OQH A;  4Y7P A;  5EEC A;  2A49 A;  4PM6 A;  3GQZ A;  1OTE A;  2M7V A;  3KSG A;  4HJ4 A;  2ZMF A;  3O5Y A;  2EXA A;  2EX8 A;  1XA1 A;  2BTF P;  2GDN A;  2XD1 A;  3Q7V B;  3W8K A;  4JKT A;  5TR7 A;  5A90 A;  4E04 A;  3ZNT A;  3HLD A;  4X1L A;  5HZH A;  4EWF A;  2XFS A;  3FV7 A;  4LLO B;  5K5B A;  5AVE A;  3FC7 A;  3EQV A;  3G35 A;  5E2E A;  1K25 A;  3C7V A;  3OBF A;  1S1Y A;  4F3L B;  3A0S A;  4WEL A;  1T1A A;  2JKT M;  4EXO A;  1T18 A;  5J7E A;  2VLG A;  1T19 A;  5CED A;  3HLB A;  2Y8H A;  4ETX A;  1QME A;  1YMS A;  1QMF A;  4L9E A;  3CG5 A;  3PXP A;  3T4J A;  1N9O A;  5CGX A;  3ZGA B;  4RVA A;  2ZC4 B;  3JVU A;  2Y2K A;  5GHX A;  1OTA A;  4PAU A;  3LIC A;  5CHM A;  2JKR I;  5JYP A;  1BSG A;  4QD4 A;  4NEE D;  3VSK A;  1PWC A;  5AQA A;  2DCF A;  4KZ9 A;  1ZG6 A;  1EI5 A;  4KG5 A;  1YT4 A;  3IT9 A;  3OCL A;  3LR0 A;  3NEC A;  3ZVW A;  5HDC A;  3T12 B;  4M3K A;  4ESP A;  3EGX C;  3M2J A;  3QP5 A;  2JHE A;  4EBN A;  3OCN A;  1MC0 A;  1OTI A;  3BY8 A;  3V39 A;  5TBM B;  3DTE A;  4CLC C;  5J4E A;  4LV0 A;  3MZD A;  4N9K A;  4DDS A;  3DWZ A;  4G3W A;  3OC2 A;  4WBG A;  5HPF A;  4DMZ A;  5EPH A;  3QP8 A;  3W4O A;  3KYQ A;  2WKH A;  5L8M A;  1TVF A;  4JGR A;  3LY3 A;  1ACF A;  5EVI B;  4GD8 A;  4ARZ A;  2XH9 A;  2HP9 A;  2XDM A;  4UEY A;  1LL9 A;  4N92 A;  4HNB A;  2VJW A;  3LR5 A;  4BJP A;  5TFQ A;  1VHM A;  3G2Y A;  5EOE A;  5CGS A;  1FR1 A;  5EE8 A;  1K4F A;  1SDN A;  3U4L P;  4QHC A;  3TG9 A;  1P9W A;  1S0W A;  4IED A;  4MBF A;  1TS6 A;  3WS0 A;  4EBL A;  5GHY A;  3CIT A;  3V5M A;  3IX8 A;  1YKD A;  2ZLY A;  3FG8 A;  2HV1 A;  5CEB A;  1WYB A;  2HDS A;  3SS5 A;  3NBL A;  4GW9 A;  4XT2 A;  4CPK A;  1OT9 A;  4II7 A;  4ETZ A;  4ZRR A;  2Q9N A;  4S2M A;  2M1C A;  3A3J A;  1HVB A;  3EEH A;  1E3U A;  4BBV A;  3MFX A;  4I3A A;  3V50 A;  3IBR A;  3ZFZ A;  2IWB A;  2E8I A;  1JTD A;  5FI7 A;  4CLC E;  3D9Y A;  4HY8 A;  1K57 A;  2W3F A;  3B42 A;  1F9I A;  3F1P B;  2EWW A;  2ZQD A;  5DFX A;  1P0Z A;  5EM1 A;  1V9Z A;  3IS2 A;  2EA9 A;  5TJJ A;  3VOL A;  3F1O B;  2ZOI A;  2ZQ9 A;  1YSP A;  4GDN A;  4S2I A;  1KVM A;  4CLC B;  5GLD A;  4DE1 A;  1G6O A;  3H7W A;  2XSS A;  4Y17 A;  3T1S A;  3C30 A;  3MXR A;  4KZ6 A;  1LL5 A;  4KZ8 A;  4EET B;  3QP4 A;  3TJZ C;  1D06 A;  2W3H A;  1F98 A;  3ICY A;  1ERQ A; 
#chains in the Genus database with same CATH homology
 2PD8 A;  2A2L A;  4WUJ A;  2I9V A;  3PYP A;  2R78 A;  4IUH A;  2A24 B;  1NRJ A;  4H6J A;  2DMW A;  2EWV A;  1XJ3 A;  2L0W A;  3H9W A;  4HJ3 A;  1N9N A;  3E0Y A;  3CAX A;  1T1C A;  1S4S A;  4GCZ A;  3E4O A;  3TRC A;  3NOU C;  2W3G A;  2VA0 A;  3F1P A;  3S7N A;  1GSW A;  2PR6 A;  1MZU A;  3B33 A;  3R7W B;  2ZMV A;  3PR6 A;  4RQ9 A;  2YKH A;  5HWV A;  5AVF A;  3HCY A;  3H7W B;  1VB6 A;  2KDK A;  4UQI S;  3PBO A;  3LIE A;  2WKQ A;  4WEK A;  3PHY A;  1D7E A;  3FPW A;  2WKR A;  2LB9 A;  3VE3 A;  4CQH A;  3C38 A;  5HSQ A;  1NWZ A;  3HJK A;  4I39 A;  5KIZ A;  5IT5 A;  4O01 A;  4CLC A;  1W63 Q;  3T4O A;  3UE3 A;  1XJ4 A;  1OTD A;  1LSX A;  4HQA A;  3P7N A;  3SW1 A;  1P9R A;  2MJ6 A;  1UWN X;  2OAP 1;  3BW6 A;  3UB9 A;  4BBT A;  1YAX A;  1GSV A;  3OLO A;  4R3A A;  5LBR A;  4O0P A;  3BQA A;  3RFB A;  3LR3 A;  3NJA A;  5IU1 A;  2LB5 A;  2W1T B;  4H6J B;  3D72 A;  1BYW A;  3LR4 A;  4WLA A;  2Y79 A;  2V1B A;  3H82 B;  3MQ0 A;  2PD7 A;  3LFV A;  4LRY C;  3KYZ A;  2VV7 A;  1YSQ A;  2QWS A;  3E4Q A;  4KUO A;  1XFQ A;  3ZQ5 A;  2FH5 A;  1H3Q A;  2QJ7 A;  4NXF A;  3DBA A;  4I5S A;  4MDZ A;  1LSV A;  3E98 A;  4BMW A;  4WL9 A;  3VE4 A;  3KSH A;  4OOL A;  4HH3 A;  1XJ2 A;  1DP9 A;  4KQD A;  5HD5 A;  3NOP C;  3MF0 A;  1TS8 A;  2JKR M;  3R4K A;  5DFY A;  3PBS A;  2NUP C;  3MR0 A;  2V0W A;  4CLC D;  1NLZ A;  3P01 A;  1W63 M;  4LPZ A;  3GEC A;  3HJI A;  4WEJ A;  2OAQ 1;  3CLO A;  4HOI A;  4EES A;  4Y3I A;  1ZHH B;  2IA2 A;  1F5M A;  2W27 A;  3LI9 A;  3S7O A;  3T4S A;  4NKP A;  3BJN A;  2OOL A;  4WF0 A;  3MQO A;  3T4L A;  3RH8 B;  1ZTU A;  3UB7 A;  3LIA A;  2XRO A;  3KSF A;  2K31 A;  2V9A A;  4G3V A;  2VX8 A;  2K7S A;  2OWH A;  1JNU A;  3PBN A;  4OOM A;  5MC7 A;  5KSH A;  3F1N A;  3OOV A;  1STZ A;  4GHI A;  2B02 A;  2ZOH A;  1UWP X;  2GNX A;  2QYB A;  5CX7 A;  2B18 A;  4O8G A;  5DKK A;  4G3K A;  3T4T A;  4Z1W A;  2W1T A;  1IFQ A;  4HIA A;  4Q0I A;  3D3O A;  3H82 A;  4L0L A;  4EQ1 A;  4DJ2 A;  3IBJ A;  1DP6 A;  4R6L A;  1MKM A;  2W0N A;  3LID A;  2D01 A;  4IUK A;  5A8B A;  4B93 A;  1OTE A;  1T1B A;  3C2W A;  3KSG A;  2M7V A;  1XFN A;  4HJ4 A;  2ZMF A;  3LIB A;  3O5Y A;  4L9G A;  3V67 A;  1LT0 A;  1KOU A;  2J80 A;  3JVV A;  5DJU A;  4B9O A;  2HGV A;  4WN5 A;  4GS9 A;  4E04 A;  3K2N A;  5HWT A;  3CI6 A;  2INW A;  2WKP A;  3BY9 A;  1EW0 A;  2W3E A;  1S4R A;  5FL3 A;  5HZH A;  2P04 A;  4LLO B;  5C5K A;  5AVE A;  5K5B A;  3FC7 A;  3EQV A;  4DN0 A;  4MN7 A;  5F5Y A;  2KOI A;  2CMN A;  3EGD C;  1LL8 A;  1G28 A;  3PBR A;  3F1N B;  3OBF A;  4GLQ A;  4GHI B;  1S1Y A;  4F3L B;  3A0S A;  4WEL A;  4Q0J A;  5DJT A;  1T1A A;  2JKT M;  4EXO A;  1S67 L;  1T18 A;  5J7E A;  2VLG A;  4I3I A;  1T19 A;  2O9A A;  4DJ3 A;  2YKF A;  4EER A;  2Y8H A;  4ETX A;  2KLI A;  4PHT A;  2VV8 A;  3UE6 A;  4EUV A;  3U2A A;  3CUE C;  4L9E A;  3KX0 X;  3PXP A;  3T4J A;  2L4R A;  2PYP A;  4ARZ B;  4YWZ A;  5DKL A;  1N9O A;  4I38 A;  1GSX A;  3JVU A;  2PR5 A;  2PDR A;  2BAS A;  1OTA A;  4PAU A;  5I5L A;  2NUT C;  3LIC A;  2JKR I;  3A0R A;  2P08 A;  3UB6 A;  4K08 A;  4NEE D;  4GS9 B;  3S7Q A;  4YNR A;  3BWL A;  1UGU A;  2PYR A;  4LRX C;  2VV6 A;  3T4Q A;  5J3W A;  5HDD A;  2ZBB A;  2O0Y A;  2OWJ A;  4AFI A;  3A0V A;  4IHQ A;  3OCL A;  5F6A A;  3LR0 A;  4NXE A;  3UMD A;  4EU0 A;  2VZW A;  4KUK A;  3LYX A;  3ZYT A;  5HDC A;  3EGX C;  5HDS A;  3PBQ A;  2HJE A;  3UME A;  2JHE A;  2XA7 M;  3OCN A;  1MC0 A;  4M4X A;  1OTI A;  3BY8 A;  3E4P A;  4XT2 B;  1XJ6 A;  1Y28 A;  5HL6 A;  5TBM B;  4CLC C;  5IS1 A;  5J4E A;  4G3W A;  3OC2 A;  4PKY G;  5HPF A;  1DP8 A;  4DMZ A;  4JGQ A;  4NXG A;  4F3L A;  4IJG A;  4BBU A;  4JGO A;  2O9B A;  4P6Z M;  3KYQ A;  3EWK A;  3FPV A;  4EEP A;  3T50 A;  1S66 L;  3BQ8 A;  5L8M A;  2QHK A;  4HJ6 A;  4JGR A;  2Z6D A;  4GJ4 A;  1P97 A;  2K2N A;  1X0O A;  4ARZ A;  4UEY A;  4Q0H A;  4HNB A;  2V1A A;  5HPI A;  2P7J A;  2VJW A;  3LR5 A;  4BJP A;  1S1Z A;  1VHM A;  4Y2F A;  3T4K A;  1H8M A;  2V0U A;  3IS2 B;  2J3T D;  2QJ5 A;  3LIF A;  3MJQ A;  4EEU A;  2O9C A;  4Y5F A;  2L1M A;  2O99 A;  1P9W A;  2GJ3 A;  3EQU A;  1TS6 A;  5DF9 A;  2KX6 A;  2VGL M;  3CIT A;  4HI4 A;  1OJG A;  1YKD A;  3KSI A;  2JKT I;  4HP9 A;  4I3J A;  3FG8 A;  4LRZ E;  2W1R A;  2HV1 A;  3MQQ A;  3F1O A;  4MN5 A;  2QKP A;  2XA7 S;  2Z6C A;  4GW9 A;  4XT2 A;  2J3T C;  2HJ9 C;  5TBM A;  1N9L A;  1OT9 A;  3ULF A;  4BWI A;  4II7 A;  4QPR A;  4JGP A;  4ETZ A;  4ZRR A;  2GX5 A;  2W3D A;  1OTB A;  1WA9 A;  1TS7 A;  2M1C A;  4MN6 A;  2FZ0 A;  3CWF A;  3PBT A;  4P6Z S;  4NXB A;  3RTY A;  3EEH A;  4BBV A;  3TE8 A;  3KO6 A;  3MFX A;  4I3A A;  1TF1 A;  2D02 A;  3IBR A;  3LUQ A;  5F68 A;  3S7P A;  3VV4 A;  3LI8 A;  4CLC E;  3EOI A;  4HY8 A;  1IOU A;  3B42 A;  2W3F A;  1F9I A;  5G4Z A;  3MXQ A;  4KQO A;  3F1P B;  2PHY A;  3K3D A;  2EWW A;  5DFX A;  1P0Z A;  2VKS A;  3NOT C;  2A24 A;  2PT7 A;  1V9Z A;  4L9F A;  3IS2 A;  2HF6 A;  3TW8 A;  4MCW A;  5G4Y A;  4UQI M;  2EA9 A;  1OJ5 A;  3GDI A;  1TD5 A;  3G6O A;  2J3W A;  5TJJ A;  4HHD A;  3VOL A;  2GZA A;  3F1O B;  4HH2 A;  5F69 A;  4FSF A;  4EW7 A;  2ZOI A;  2VEA A;  4FOF A;  1V9Y A;  1YSP A;  1OT6 A;  1TS0 A;  2XRN A;  4YOF A;  1ODV A;  4ME4 A;  3R7W A;  3W2Z A;  4CLC B;  3UB8 A;  3C8C A;  3MMH A;  1G6O A;  2VGL S;  3H7W A;  2XSS A;  5HWW A;  4PKY A;  4R38 A;  2M7U A;  1LSW A;  3K3C A;  5EFW A;  1DRM A;  5AJG A;  3C30 A;  4HP4 A;  3B47 A;  5HD3 A;  3EEA A;  4EET B;  2G7U A;  2JN7 A;  4MMN A;  3TJZ C;  3NHQ A;  1D06 A;  1OPX A;  2W3H A;  4R70 A;  1F98 A;  1NLY A;  3CUE A;  3ICY A;  2H28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...