3BQAA

Crystal structure of an e.coli phoq sensor domain mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
146
structure length
146
Chain Sequence
SFDKTTFRLLRGESNLFYTLAKWENNKLHVELPENIDKQSPTMTLIYDENGQLLWAQRDVPWLMKMIQPDWLKSNGFHEIEADVNDTSLLLSGDHSIQQQLQEVRQNNNNAQMTHSVAVNVYPATSRMPKLTIVVVDTIPVELKSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein, transferase
molecule keywords Sensor protein phoQ
publication title Crystal Structure of a Functional Dimer of the PhoQ Sensor Domain.
pubmed doi rcsb
source organism Escherichia coli
total genus 35
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2007-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.140 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3bqaA00
3BQAA 1YAXA 3BQ8A 4UEYA
chains in the Genus database with same CATH superfamily
2VGKA 3BQAA 3F1NA 3Q82A 4EWFA 2XEPA 3OCLA 5GLDA 1JWZA 3GTCA 1ZG4A 5EM1A 5EPHA 3A0RA 4L9EA 1K0KA 2ACGA 2W1RA 3CMZA 5DF9A 2JKTI 2OLVA 1MZUA 3H7WB 2J8YA 4P0MA 4MBKA 5HL1A 2Y2KA 3T1QB 4UEYA 1E4DA 1CI9A 5FI7A 4OOYA 2PR6A 3IWIA 4R1GA 3E4OA 4DE0A 5CEDA 5M1AA 3SS5A 4HJ3A 3K3DA 2H0TA 4G3KA 4QY6A 2GX5A 2W1TB 3ZG8B 5CHMA 5EVIA 3O88A 2IA2A 3E98A 2FH5A 3KO6A 2XD5A 5G18A 2D01A 3WS5A 5IU1A 2XFTA 3UE3A 5DJUA 4EETB 5HAQA 5DJTA 4UAAA 2RL3A 2XRNA 3IBRA 4LRXC 1KOUA 4BBTA 3N7WA 2O9AA 4H8RA 4P85A 3S7OA 3PBRA 3SS4A 3R7WA 3LIDA 5HAIA 5DTKA 4N1XA 3FV7A 3W4QA 2VJWA 5HDSA 1IKIA 1CF0A 2K31A 4HP4A 2PBYA 1TDLA 4HJ4A 2ZC3B 2XD1A 3N8LA 2BTFP 3UB6A 5TBMA 2HDRA 3D72A 4MBHA 2QMIA 4X1LA 4ZAMA 1VHMA 5FAPA 5CTNA 1OTIA 3IWOA 4Q0HA 5HL6A 1S4SA 4KQDA 1Z6FA 2INWA 2XSSA 3UO9A 3T4SA 1XFQA 3VP4A 3S22A 2WKHA 4ZDXA 3BJNA 3GQZA 1IOUA 1K54C 3AGDA 3CZDA 4JF4A 1H8YA 4DDSA 4E3IA 5FQKA 1L0FA 4FH2A 1OT6A 4R38A 1FCOA 1FR6A 5HZHA 1OJ5A 2MJ6A 4MBFA 4UQIS 4KQOA 1YMXA 1ESUA 3CHWP 1NYYA 4JLFA 4QPRA 4C3QA 3FPVA 2R9WA 3IXBA 4B4XA 1E3UA 1S0WA 3N8SA 3V39A 4P6ZS 3IHAA 2P9VB 5F83A 4Y2FA 1KVLA 5FDSA 4S2NA 3E4QA 1LSXA 3IQAA 2K7SA 3HUMA 3HLGA 5FASA 2HP9A 2UV0E 3LR4A 2WKQA 2ZQCA 4PKYA 3MFDA 1ALQA 4Q0JA 2EX9A 3HLBA 5CECA 1H5XA 4II7A 4Z1WA 2I9VA 3HUOA 4XUZA 2W3EA 4JGQA 1ESIA 1MC0A 2WUQA 4FSFA 3K3CA 1BT5A 3G31A 2XFSA 5JYOA 1NYMA 3FWLA 1S66L 1QMEA 1WYCA 2ZMVA 3OBFA 5J8XA 4OQIA 2VZWA 3PBNA 5AJGA 2HP6A 4JXGA 5FEGA 3ZG5A 1BLSA 4KQRA 3KYQA 3SW1A 2HJEA 3LI9A 3P01A 4I3IA 2XQZA 2ZBBA 3B42A 4DKIA 2ZD8A 3ITBA 4IUHA 5FAOA 2HDUA 5FATA 3MSHA 3IXGA 3ZDJA 4EUVA 1XA1A 1Y28A 5F69A 5F1FA 3AGFA 2DRWA 2IWBA 3NOTC 4GHIB 3C38A 4EESA 3MXSA 4FTXA 3ZHHA 4N1HA 1VETA 3TRCA 2FFYA 3LO7A 5DVAA 1YLZA 4IVKA 4WELA 4EQ1A 1VEUB 2WK0A 2Z2MB 1LL8A 1FSYA 1P9WA 4JKTA 5HARA 5CHUA 3GV9A 5A92A 5HSQA 3LIEA 2ZJ9A 1G28A 1GSXA 1OT9A 4XUXA 2EXBA 5EM0A 5EUAA 2ZC7A 1TDGA 2OWHA 5MC7A 3A3IA 4ZRRA 5FQIA 3VP1A 3NC8A 5IS1A 3M6BA 1XKZA 3CUEA 4WZ5C 1ES2A 4NEED 1E3UD 2VGLM 2LB9A 2IWCA 3BFCA 4GDBA 1D1JA 1BTLA 1KE3A 1TD5A 3UPOA 1SKOB 3BFDA 2EA9A 1ES3A 2A24B 2XR0A 2Y55A 5DFYA 1SZVA 3MQOA 5CEBA 2GNXA 3K2NA 4OLGA 2IWDA 5A90A 2O9CA 4ARZB 4E3MA 2EX8A 1BLHA 4H6JA 3MZEA 5J3WA 3LR3A 3L7HA 3ZQ5A 4U0TA 1CI8A 2B02A 2V8FA 3DWKA 3D3OA 2W3FA 4OPYA 1N9OA 5TGFA 3OPLA 1JNUA 3NDGA 4DXBA 3CI6A 5FQMA 1VB6A 1BLPA 2LB5A 1MWSA 4CQHA 3UB9A 3A3EA 3IXDA 4S2PA 5AQAA 3Q81A 4F3LA 3KYEA 3KSFA 5EOOA 4GHIA 3P98A 2V9AA 5J4EA 2O99A 4DE1A 3T4KA 1BUEA 4B9OA 1YLJA 4PM6A 3ZYTA 2WKEA 3F1PB 3C4PA 4KQQA 3C7VA 4KZ4A 3EQUA 3MR0A 3MMHA 2H5SA 1OTAA 1MXOA 3DAVA 1L0EA 5L09A 2ZM2A 4GD6A 5F68A 5FL3A 5FDHA 2PHYA 4IBRA 4NXBA 4Y7PA 3OPPA 1NLZA 5AQ9A 1F98A 2OLUA 3M6HA 3UE0A 1RCJA 5I94A 1PZPA 3FG8A 3QP4A 5LBRA 4ZBEA 5EVEA 2EFXA 2ZL1A 4NXGA 5L07A 3FKWA 4YFMA 3V67A 1NXYA 3MBZA 1P9RA 1S4RA 4RA7A 2PR5A 4F94A 1NZUA 3ZNYA 3H82B 4GLQA 4GZBA 1MY8A 4X53A 2B5RA 3IS2A 2PBDP 1MKMA 4YINA 3HLWA 5HX9A 1NY0A 1PYYA 5E2FA 2YKFA 1GA9A 5HD5A 3JYIA 4EW7A 4IHQA 5GHYA 1T1BA 4BMWA 4BQMA 1EWZA 1Z09A 4MDZA 4FOFA 1CEFA 1OMEA 3TJZC 1O07A 1PIOA 2Q9MA 1MPLA 3D4FA 1IEMA 2J3TD 1K6RA 4P6BA 1XJ3A 3JVUA 2AVXA 4R0QA 5KSCA 3UNWA 4NXEA 4EU0A 1GSWA 2P08A 3OCNA 3EGXC 3Q07A 1NRJA 4C75A 1Q2QA 5BOHA 4O01A 3HLEA 1ZHHB 4Y0TA 4DXCA 5D3OA 2PT7A 5KSHA 2Y4AA 3KSHA 4KZBA 1L2SA 1F2KA 2M7VA 4HIAA 1O7EA 1TS6A 2E8IA 2XA7S 3VSLA 2Y2IA 2P7JA 2OAQ1 4BL2A 5A8BA 4NK3A 1HZOA 3W2ZA 5F1GA 4S2MA 1W8QA 2ZQAA 4HH2A 2KOIA 4FH4A 1NJ4A 5I5LA 3O86A 4ME4A 2EX2A 5CRFA 2JE5A 4KG6A 4EBNA 3PBTA 3MS6A 4CLCC 3A3DA 2PD8A 3IX3A 4PKYG 1TS0A 1ZC2A 3GVBA 3S7NA 3NCKA 2PD7A 1RGYA 3G32A 4QU3A 3KYZA 2B18A 5DKLA 4KZ8A 4RVAA 5EVIC 3DBAA 1F9IA 2GDNA 2Y2PA 1V9ZA 2L0WA 3NOPC 3KSGA 4O7DA 3RXWA 4LV2A 1XPBA 2V0UA 4N9KA 1KE0A 2ZQDA 3UDIA 1W79A 4OVDA 4O0PA 4R4RA 3UB8A 3IHBA 3PHYA 5HPIA 1A0KA 5HDCA 3EQVA 3IF6C 5G4YA 2PU2A 2PYPA 4Y15A 3LUQA 3CWFA 4IUKA 2YKHA 4BBUA 2PU4A 2QYBA 1ODVA 3BYDA 2P74A 4P87A 1KDWA 2VK3A 1YPRA 2ZLYA 3NECA 4UA9A 1FCMA 5FEFA 3F1OB 2EWWA 3BFGA 3LCEA 4YNRA 3MXRA 4ZJ1A 1DJBA 1S6RA 3DTMA 3BM6A 5GLCA 2QHKA 4E3OA 1TS7A 1P97A 4X6TA 1J3WA 3H7WA 3QP2A 2XF3A 2Y59A 4KZ5A 3SH8A 1FOFA 2Y91A 1CJFA 3HCYA 3BRMA 4X56A 3PYPA 1G6OA 1K56A 1EW0A 5CTMA 4JF6A 1ES4A 1SDEA 2HPBA 5HWVA 3IX4A 3GDIA 1CK3A 3VE4A 1XJ2A 2W1TA 3AGEA 4KG5A 3FZCA 5HPFA 1K54A 4KUOA 4D60A 4XXRA 3OZHA 5E2GA 2ZC4B 3WS4A 5L10A 4N92A 3GR2A 4HI4A 1RGZA 4E6WA 3CG5A 1PRQA 1F5MA 2L1MA 4OP8A 4S2NC 4Y0UA 2V8CA 3CPTB 5E43A 3UB7A 4DRTA 4HBTA 3OC2A 4OPZA 4DF6A 4K08A 3NDEA 3W8KA 3QP8A 4EERA 3VSKA 1FR1A 4I3AA 3N8RA 4NG2A 2HDSA 2J7VA 5CXWA 1JWVA 4N9LA 3HVFA 4GDNA 1YLPA 3WS0A 1K6SA 3QNBA 5GHZA 1GHIA 2VX8A 1SCWA 2JHEA 3DW0A 5EVLA 3S4XA 4EUZA 4Y0OA 3PBSA 5GL9A 2A49A 2WGWB 2OWJA 5CGSA 4S2OA 4R3AA 3A3FA 4G3VA 4PM5A 1OPXA 4M3KA 4FUWA 4HOIA 3M2KA 1HTZA 4WBGA 2WKIA 3B3XA 4IVIA 1PWGA 4L0LA 2VLGA 2ZOIA 2X71A 4HEFA 2WAFA 3TE8A 3LY3A 3MXQA 1XJ6A 3CITA 4DN0A 2Z6DA 2Y2MA 3HBRA 3KX0X 1XXMA 1X0OA 2G7UA 4WL9A 1ONGA 5TFQA 4L9FA 4UA7A 3HLDA 3BECA 5CX7A 1S1ZA 5HWTA 4PMAA 1N9BA 2P9VA 4GKUA 3O87A 2DMWA 5F82A 4E6XA 2WKPA 5AVFA 5HDDA 4R3JA 1ZKJA 2V20A 1XFNA 5EECA 5CGWA 1K56D 3OPHA 1SKFA 1YSPA 1BZAA 3EOIA 3LIAA 1DJAA 4HHDA 4UQIM 3VV4A 2K2NA 4WM9A 3ZG7B 2J80A 2ZMAA 4Q0IA 1YAXA 2E8JA 2V2FF 1YKDA 3GECA 4EEUA 3CUEC 4HP9A 3HUNA 2I72A 3T4LA 3BQ8A 2BASA 4P6ZM 5FQJA 4X55A 1PW8A 1FSWA 1UWNX 4JGRA 3UY6A 4WZ5A 4WN5A 1MBLA 3IBJA 2P04A 3TG9A 4GS9B 2J9OA 2DCFA 3ZG9B 3T4OA 2FFFB 2R78A 4DJ3A 4EEPA 2Y2NA 1ZG6A 4ETZA 3PAGA 1W63M 4PPRA 1W7FA 3OLOA 3MKFA 4CJNA 3LFVA 4X68A 5GLAA 4GB7A 2Y2OA 3QP1A 3DTKA 4O8GA 4E3JA 3FKVA 4A5RA 4LV3A 1K4FA 4BENA 3VE3A 5U47A 4EXOA 1K25A 5IHVA 3LIBA 4I5SA 1BYWA 3HLFA 1IYOA 2H28A 4U3TA 3MZFA 4MN7A 3NBLA 2PDRA 1N4OA 1GA0A 1S1YA 3LEQA 3C5AA 4UHUA 3LEZA 3UPPA 4R23A 3DTIA 5EV0A 1VEUA 1N9LA 3SZTA 4KZ7A 3ZG0A 5F6AA 4WEKA 3ULFA 2VV7A 2PRFA 5M19A 3JVVA 1K55C 1T1AA 2ZC5B 2X02A 3DTEA 3ZGAB 1BLCA 5L8MA 4K0WA 2PAVP 3WWXA 4XT2B 3LYXA 4LLOB 3UB5P 4JGPA 4R6LA 1H0MA 3VOYA 1SKOA 3IH9A 5KIZA 4OPRA 1ES5A 2A24A 4LPZA 4OH0A 4RYEA 4HQAA 4Z9QA 3OOVA 5EE8A 4ARZA 1GHMA 1LI0A 2B95A 4KZ3A 2Y2LA 3F1NB 2WKRA 1IFQA 1C3BA 1TEMA 3NULA 1M6KA 1KE4A 4OLDA 1GCEA 4BJPA 4KZ9A 2J3WA 1K57A 3T50A 2ZMFA 2G2UA 3TOIA 3E2KA 4OQGA 2EWVA 3UDXA 4JBFA 1U60A 2V1ZA 4DJ2A 3HREA 3MFXA 1GSVA 3UDFA 4B88A 4CLCB 1LI9A 4OQHA 3OPRA 3E0YA 3WRZA 2WZXA 1HD8A 4ETXA 5FA7A 2HF6A 3GMWA 3V3SA 3F1PA 1KGEA 5FSRA 2W3DA 3T1RA 3T4JA 4I38A 4GCZA 5EVIB 5TR7A 1PI5A 1STZA 4ZJ2A 4K0XA 4L9GA 4JXWA 3UE1A 3IF5A 2BG1A 3VFFA 1IKGA 3CAXA 4KG2A 3ZFZA 3G30A 4G3WA 4LENA 2Y2HA 4S2KA 3Q7VB 4X25A 4MNRA 1W63Q 4OOMA 4I3JA 4GOGA 3C30A 1NWZA 1WA9A 3ITAA 4HJ6A 3R7WB 4E04A 3LIFA 3IF6B 5FQ9A 2HGVA 3FPWA 3BY9A 1JTDA 1M40A 5FI2A 4BBVA 3QHYA 3MZDA 4CLCE 5A93A 2M1CA 1S67L 3H82A 5DTSA 1NRFA 3PXPA 2G2WA 1DRMA 4MLLA 5TBMB 2Z2LB 3RJUA 2WZZA 2NUTC 5F5YA 3NJAA 3NY4A 4GD8A 3FC7A 1PFLA 1MWUA 2Y79A 3R4KA 5G4ZA 4MCWA 1KGGA 4PHTA 3T4TA 3SH7A 4LFUA 5IT5A 3ZVWA 3NHQA 2O0YA 4JGOA 4KZ6A 2JKGA 3T12B 4JXVA 4ZTKA 4CLCA 1LHYA 3RFBA 3VP0A 2JCHA 3IH8A 4KENB 2CMNA 3WRTA 4JXSA 1YT4A 4QWOA 3HL9A 4E3KA 4OONA 2V1BA 4BWIA 1N9NA 2L4RA 1D06A 2Q9NA 4RX3A 2A2LA 5AQBA 4B4ZA 1Q2PA 3B47A 4S2LA 4R70A 4IEDA 1HLUP 2XROA 1KGFA 1TVFA 3ZNTA 1ONHA 2WGIA 1VQQA 1W5DA 3N6IA 4EBLA 3Q7VA 1LSVA 4RQ9A 3A3JA 5HD3A 4IJGA 1Y54A 2QKPA 4KZAA 4M4XA 3IF6A 3RXXA 3C4OA 3LR0A 2OSUA 3I7JA 3MQQA 5E2HA 3U2AA 4QHCA 3U4LP 4WLAA 2HZ5A 3WS2A 1CEGA 4MN6A 2GJ3A 3FYZA 5DKKA 3S7QA 5FAQA 1I5QA 1UWPX 1AWIA 1LL9A 4R3BA 1XX2A 1YLWA 2VEAA 3MQ0A 1UGUA 4LGWA 1PWCA 1RP5A 2JKRM 1PWDA 4DMZA 2Y8HA 3A0SA 2H10A 1PI4A 5J7EA 3HJKA 1DJCA 4BD0A 4EBPA 2XA7M 4UA6A 3GSGA 3QP5A 3UPNA 3B33A 3L9KA 4BL3A 4LV1A 4QY5A 3MJQA 5EOEA 3SH9A 3CJMA 3BWLA 4GW9A 2NUPC 1KDSA 3H9WA 5HWWA 5JYPA 4QD4A 2Z6CA 1XJ4A 2D02A 4PM9A 4AFIA 1ERQA 2FZ0A 1TF1A 3O3VA 1GHPA 4DDYA 3IT9A 1E25A 3RTYA 1P0ZA 4NXFA 4WUJA 5GLBA 5HW3A 1YSQA 3C7UA 2VGLS 4JF5A 4Y5FA 5DF7A 5AVEA 3T1SA 1NZOA 4HESA 3W4PA 2Y2GA 1VETB 2XDMA 2GZAA 4EQIA 2JN7A 2ZM8A 4CLCD 1L0DA 3F1OA 2XH9A 4C6YA 2WGVA 1MWTA 1CQAA 1YLTA 1ZTUA 3DWZA 1SHVA 4GJ4A 2VV6A 2QJ7A 2WYXA 3ZVTA 5EVID 3LY4A 2ZQ9A 1OTDA 2EFUA 4OKPA 4DE2A 2ZQ8A 1EROA 1SDNA 3C8CA 2XK1A 1LSWA 1K4EA 3PBQA 3LICA 2XGNA 4QJGA 1YQSA 1G6AA 3MF0A 1AXBA 2JKRI 5DTTA 2W3GA 4WMCA 4E3LA 4H6JB 3EEAA 2V1AA 1FILA 3LR5A 3T4QA 3SOIA 3VOLA 3HJIA 5L2FA 4D2OA 1WE4A 4WZ4A 3Q1FA 4HH3A 3S7PA 2JC7A 2OAP1 1Y4OA 2W0NA 4WF0A 1OTEA 3CPTA 1T18A 4F3LB 3E4PA 1JTGA 1PW1A 3PR6A 4MEZA 4LCLA 2QPNA 4RX2A 2UWXA 3O5YA 2KDKA 2ZM0A 2RCXA 3Q7ZA 4ID4A 3TSGA 5CERA 2HV1A 2HP5A 3ZCZA 4FCFA 4NETA 4LRZE 3EGDC 1JWPA 3IWQA 2WGWA 2Y2JA 2J9PA 5M18A 4DE3A 1OJGA 5HAPA 4HY8A 2QZ6A 3V3RA 2VA0A 3NOUC 2VKSA 1BSGA 4Y13A 5C5KA 3UN7A 5TJJA 2ZOHA 3RH8B 1IELA 2BLSA 2J3TC 4GN2A 2KLIA 4CPKA 1K38A 1H3QA 1VM1A 4S2IA 4LCMA 2ZL1B 3QNCA 5CGXA 4BD1A 2W3HA 5FI6A 2DNSA 4PM7A 1LLBA 1HVBA 1I2SA 3GRJA 4HBUA 3G34A 2VGJA 3MKEA 4Y17A 3T1XA 4QB8A 2QWSA 2XLNA 3LI8A 2QJ5A 3UE6A 1KVMA 3ICYA 2PYRA 3IS2B 5E2EA 1YLYA 3BY8A 4ZJ3A 1YMSA 1XGIA 3M2JA 4LRYC 3HLCA 3NIAA 3SS3A 3IX8A 3CLOA 5AQ7A 3G4PA 2C5WB 2JKFA 4OPQA 1FCNA 1MWRA 5DF8A 5K5BA 2OOLA 3S1YA 1L3LA 1DP8A 2HJ9C 4Q8IA 1IYSA 2V0WA 5CHJA 3BLSA 1T19A 4OQ0A 4JPMA 3BFFA 3VFHA 4FD8A 1H8MA 4OP5A 4PM8A 3V50A 4Y3IA 1DP9A 4WMCD 3EEHA 3N4IA 1J9MA 4EV4A 3V5MA 1D7EA 4WEJA 2OV5A 2M7UA 4YOFA 2EX6A 2VV8A 4ESPA 4I39A 3VP3A 1ERMA 1XA7A 1K55A 5KZHA 5EFWA 4S2JA 3G35A 2EXAA 3P7NA 5A91A 3G2ZA 4OOLA 4E3NA 3TW8A 3UMEA 1V9YA 1DY6A 1LL5A 4GS9A 1XP4A 1TS8A 1XGJA 3G2YA 4WYYA 2KX6A 1EI5A 2JBFA 2WAEA 1PZOA 2JKTM 1IYQA 1K57C 3JPUA 3EWKA 4IBXA 1W8YA 5HFOA 2A3UA 3BFEA 1G68A 3VOZA 1ACFA 5DFXA 3BEBA 2ZC6B 4KUKA 1L0GA 1IYPA 4PAUA 3G6OA 1JVJA 2H0YA 3BLMA 3W4OA 4HNBA 2X01A 1YM1A 4R4SA 3ISGA 3UMDA 1PNEA 2O9BA 3WS1A 1OTBA 1G5UA 2Q0OA 3QP6A 1QMFA 4X69A 1T1CA 1BULA 1FIKA 4MN5A 5GHXA 1NLYA 4LV0A 4K91A 1LT0A 3A0VA 3PAEA 4MMNA 1MKIA 4BLMA 1H8ZA 2HDQA 2WADA 4GNUA 3KSIA 2ZQ7A 4YWZA 3VMAA 4XT2A 3P09A 5FQQA 2C6WB 4NKPA 4U0XA 3IXHA 3PBOA 1I2WA 1DP6A 3PTEA 3NI9A 3VP2A 3D9YA 4B93A 5KMWA 2CC1A 3BW6A 3LGOA 3C2WA 1WYBA 4X1MA 1FQGA 2W27A 2Y2QA 3E2LA 2R9XA
chains in the Genus database with same CATH topology
5HWTA 1OTAA 3BQAA 3F1NA 5J7EA 3HJKA 3OCLA 2XA7M 5F68A 5FL3A 2DMWA 3A0RA 3B33A 2PHYA 4L9EA 4NXBA 1NLZA 3MJQA 2WKPA 1F98A 3BWLA 5AVFA 5HDDA 1XFNA 2W1RA 4GW9A 5DF9A 2NUPC 2JKTI 3H9WA 5HWWA 1MZUA 2Z6CA 1XJ4A 2D02A 4AFIA 3FG8A 3H7WB 5LBRA 2FZ0A 1TF1A 1YSPA 4UEYA 4NXGA 3RTYA 1P0ZA 3EOIA 3LIAA 4NXFA 4WUJA 2PR6A 3V67A 4HHDA 4UQIM 3VV4A 2K2NA 1YSQA 1P9RA 3E4OA 2J80A 4Q0IA 1S4RA 2VGLS 1YAXA 4Y5FA 2PR5A 1YKDA 3GECA 5AVEA 4EEUA 3CUEC 4HP9A 3H82B 4HJ3A 3K3DA 4GLQA 3T4LA 4G3KA 2GX5A 3BQ8A 2GZAA 2W1TB 2BASA 4P6ZM 2JN7A 3IS2A 2IA2A 3E98A 4CLCD 2FH5A 3KO6A 1UWNX 1MKMA 2D01A 4JGRA 5IU1A 4WN5A 3UE3A 3F1OA 5DJUA 3IBJA 4EETB 2P04A 2YKFA 4GS9B 5HD5A 5DJTA 4EW7A 4IHQA 1T1BA 4BMWA 1ZTUA 3T4OA 4GJ4A 2VV6A 2R78A 2QJ7A 2XRNA 4DJ3A 3IBRA 4LRXC 4EEPA 4MDZA 1KOUA 4FOFA 4BBTA 4ETZA 1W63M 2O9AA 3TJZC 3S7OA 3PBRA 3OLOA 1OTDA 3LFVA 3R7WA 2J3TD 3LIDA 4O8GA 1XJ3A 3JVUA 3C8CA 1LSWA 4NXEA 4EU0A 3PBQA 1GSWA 2P08A 3VE3A 2VJWA 3OCNA 3LICA 3EGXC 1NRJA 5HDSA 4EXOA 2K31A 4HP4A 3LIBA 4HJ4A 4O01A 1ZHHB 3MF0A 2JKRI 4I5SA 3UB6A 2W3GA 1BYWA 2H28A 5TBMA 2PT7A 4H6JB 3D72A 4MN7A 5KSHA 2PDRA 3EEAA 1S1YA 1VHMA 3KSHA 2M7VA 2V1AA 1OTIA 4Q0HA 3LR5A 3T4QA 5HL6A 3VOLA 1N9LA 1S4SA 4HIAA 1TS6A 4KQDA 3HJIA 2XA7S 2INWA 2XSSA 4HH3A 3T4SA 2P7JA 2OAQ1 1XFQA 5F6AA 4WEKA 5A8BA 3S7PA 2OAP1 3ULFA 2VV7A 2W0NA 3JVVA 1T1AA 4WF0A 1OTEA 3W2ZA 3BJNA 1IOUA 1T18A 4F3LB 3E4PA 3PR6A 4HH2A 2KOIA 5I5LA 5L8MA 4ME4A 1OT6A 4R38A 4XT2B 3LYXA 5HZHA 4LLOB 1OJ5A 2MJ6A 2KDKA 3O5YA 4UQIS 4KQOA 4JGPA 4R6LA 4QPRA 3PBTA 5KIZA 2HV1A 3MMHA 4CLCC 2A24A 2PD8A 4LRZE 3EGDC 4LPZA 4PKYG 3FPVA 4HQAA 1TS0A 3OOVA 4ARZA 3S7NA 3F1NB 2WKRA 1OJGA 4P6ZS 1IFQA 2PD7A 4HY8A 4Y2FA 3KYZA 2B18A 2VA0A 3NOUC 2VKSA 5DKLA 3E4QA 1LSXA 4BJPA 3DBAA 1F9IA 2K7SA 2J3WA 5C5KA 1V9ZA 3T50A 5TJJA 2ZOHA 3RH8B 2ZMFA 2L0WA 3NOPC 2J3TC 2KLIA 3LR4A 3KSGA 1H3QA 2WKQA 2EWVA 4PKYA 2V0UA 4DJ2A 4Q0JA 3MFXA 1GSVA 2W3HA 4CLCB 4II7A 4Z1WA 2I9VA 2W3EA 3E0YA 4O0PA 3UB8A 4JGQA 1MC0A 3PHYA 2QWSA 4FSFA 3K3CA 3LI8A 2QJ5A 5HPIA 4ETXA 2HF6A 3UE6A 5HDCA 3EQVA 5G4YA 2PYPA 3F1PA 3LUQA 3ICYA 3CWFA 2W3DA 3T4JA 4IUKA 2PYRA 4I38A 2YKHA 4GCZA 4BBUA 2QYBA 3IS2B 1ODVA 1S66L 1STZA 3BY8A 4L9GA 2ZMVA 4LRYC 3F1OB 3OBFA 2EWWA 3CAXA 2VZWA 3CLOA 3PBNA 4YNRA 5AJGA 4G3WA 5K5BA 2OOLA 3KYQA 3SW1A 1W63Q 2QHKA 2HJEA 3LI9A 1DP8A 2HJ9C 3P01A 4OOMA 1TS7A 4I3JA 4I3IA 2V0WA 2ZBBA 3B42A 1P97A 1T19A 4IUHA 3H7WA 1H8MA 3C30A 1NWZA 1WA9A 4Y3IA 4HJ6A 1DP9A 3R7WB 4EUVA 3EEHA 4E04A 3LIFA 2HGVA 3FPWA 1Y28A 3BY9A 3HCYA 5F69A 1D7EA 4WEJA 4BBVA 3NOTC 3PYPA 2M7UA 4YOFA 1G6OA 4CLCE 1EW0A 4GHIB 2M1CA 2VV8A 3C38A 1S67L 3H82A 4EESA 5HWVA 4I39A 3PXPA 1DRMA 5TBMB 5EFWA 3TRCA 3GDIA 3VE4A 1XJ2A 2NUTC 2W1TA 5F5YA 3NJAA 5HPFA 3P7NA 4KUOA 3FC7A 4WELA 4OOLA 4EQ1A 2Y79A 3TW8A 3UMEA 3R4KA 5G4ZA 1V9YA 4MCWA 1LL8A 4PHTA 3T4TA 1P9WA 4GS9A 1TS8A 5IT5A 3NHQA 5HSQA 2O0YA 4HI4A 2KX6A 3LIEA 4JGOA 1G28A 1GSXA 1OT9A 1F5MA 2L1MA 3UB7A 4CLCA 2OWHA 5MC7A 2JKTM 3OC2A 3RFBA 4K08A 4ZRRA 5IS1A 4EERA 2CMNA 4I3AA 3CUEA 3EWKA 4NEED 2V1BA 2VGLM 4BWIA 2LB9A 1N9NA 2L4RA 1D06A 2A2LA 5DFXA 1TD5A 4KUKA 3B47A 2EA9A 4PAUA 3G6OA 2A24B 2JHEA 2VX8A 4R70A 5DFYA 2XROA 3MQOA 2GNXA 3K2NA 3PBSA 4HNBA 2O9CA 4ARZB 2OWJA 4H6JA 5J3WA 3LR3A 4R3AA 3UMDA 1LSVA 4RQ9A 2O9BA 1OTBA 3ZQ5A 2B02A 4G3VA 5HD3A 1OPXA 2W3FA 3D3OA 1T1CA 4IJGA 1N9OA 4HOIA 4MN5A 1JNUA 2QKPA 1NLYA 3CI6A 1VB6A 1LT0A 2LB5A 3A0VA 4M4XA 4MMNA 4CQHA 3UB9A 3LR0A 4L0LA 2VLGA 2ZOIA 4F3LA 3MQQA 3U2AA 3KSFA 4WLAA 3KSIA 4GHIA 3TE8A 3MXQA 1XJ6A 3CITA 4YWZA 4DN0A 2V9AA 2Z6DA 5J4EA 4XT2A 2O99A 4MN6A 3T4KA 2GJ3A 4NKPA 3KX0X 3PBOA 5DKKA 4B9OA 3S7QA 1DP6A 1UWPX 1X0OA 3ZYTA 4B93A 2G7UA 3F1PB 4WL9A 2VEAA 3BW6A 3MQ0A 3C2WA 4L9FA 1UGUA 3EQUA 2JKRM 5CX7A 2W27A 1S1ZA 4DMZA 2Y8HA 3MR0A 3A0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BQA A;  1YAX A;  3BQ8 A;  4UEY A; 
#chains in the Genus database with same CATH topology
 2VGK A;  3BQA A;  3F1N A;  3Q82 A;  4EWF A;  2XEP A;  3OCL A;  5GLD A;  1JWZ A;  3GTC A;  1ZG4 A;  5EM1 A;  5EPH A;  3A0R A;  4L9E A;  1K0K A;  2ACG A;  2W1R A;  3CMZ A;  5DF9 A;  2JKT I;  2OLV A;  1MZU A;  3H7W B;  2J8Y A;  4P0M A;  4MBK A;  5HL1 A;  2Y2K A;  3T1Q B;  4UEY A;  1E4D A;  1CI9 A;  5FI7 A;  4OOY A;  2PR6 A;  3IWI A;  4R1G A;  3E4O A;  4DE0 A;  5CED A;  5M1A A;  3SS5 A;  4HJ3 A;  3K3D A;  2H0T A;  4G3K A;  4QY6 A;  2GX5 A;  2W1T B;  3ZG8 B;  5CHM A;  5EVI A;  3O88 A;  2IA2 A;  3E98 A;  2FH5 A;  3KO6 A;  2XD5 A;  5G18 A;  2D01 A;  3WS5 A;  5IU1 A;  2XFT A;  3UE3 A;  5DJU A;  4EET B;  5HAQ A;  5DJT A;  4UAA A;  2RL3 A;  2XRN A;  3IBR A;  4LRX C;  1KOU A;  4BBT A;  3N7W A;  2O9A A;  4H8R A;  4P85 A;  3S7O A;  3PBR A;  3SS4 A;  3R7W A;  3LID A;  5HAI A;  5DTK A;  4N1X A;  3FV7 A;  3W4Q A;  2VJW A;  5HDS A;  1IKI A;  1CF0 A;  2K31 A;  4HP4 A;  2PBY A;  1TDL A;  4HJ4 A;  2ZC3 B;  2XD1 A;  3N8L A;  2BTF P;  3UB6 A;  5TBM A;  2HDR A;  3D72 A;  4MBH A;  2QMI A;  4X1L A;  4ZAM A;  1VHM A;  5FAP A;  5CTN A;  1OTI A;  3IWO A;  4Q0H A;  5HL6 A;  1S4S A;  4KQD A;  1Z6F A;  2INW A;  2XSS A;  3UO9 A;  3T4S A;  1XFQ A;  3VP4 A;  3S22 A;  2WKH A;  4ZDX A;  3BJN A;  3GQZ A;  1IOU A;  1K54 C;  3AGD A;  3CZD A;  4JF4 A;  1H8Y A;  4DDS A;  4E3I A;  5FQK A;  1L0F A;  4FH2 A;  1OT6 A;  4R38 A;  1FCO A;  1FR6 A;  5HZH A;  1OJ5 A;  2MJ6 A;  4MBF A;  4UQI S;  4KQO A;  1YMX A;  1ESU A;  3CHW P;  1NYY A;  4JLF A;  4QPR A;  4C3Q A;  3FPV A;  2R9W A;  3IXB A;  4B4X A;  1E3U A;  1S0W A;  3N8S A;  3V39 A;  4P6Z S;  3IHA A;  2P9V B;  5F83 A;  4Y2F A;  1KVL A;  5FDS A;  4S2N A;  3E4Q A;  1LSX A;  3IQA A;  2K7S A;  3HUM A;  3HLG A;  5FAS A;  2HP9 A;  2UV0 E;  3LR4 A;  2WKQ A;  2ZQC A;  4PKY A;  3MFD A;  1ALQ A;  4Q0J A;  2EX9 A;  3HLB A;  5CEC A;  1H5X A;  4II7 A;  4Z1W A;  2I9V A;  3HUO A;  4XUZ A;  2W3E A;  4JGQ A;  1ESI A;  1MC0 A;  2WUQ A;  4FSF A;  3K3C A;  1BT5 A;  3G31 A;  2XFS A;  5JYO A;  1NYM A;  3FWL A;  1S66 L;  1QME A;  1WYC A;  2ZMV A;  3OBF A;  5J8X A;  4OQI A;  2VZW A;  3PBN A;  5AJG A;  2HP6 A;  4JXG A;  5FEG A;  3ZG5 A;  1BLS A;  4KQR A;  3KYQ A;  3SW1 A;  2HJE A;  3LI9 A;  3P01 A;  4I3I A;  2XQZ A;  2ZBB A;  3B42 A;  4DKI A;  2ZD8 A;  3ITB A;  4IUH A;  5FAO A;  2HDU A;  5FAT A;  3MSH A;  3IXG A;  3ZDJ A;  4EUV A;  1XA1 A;  1Y28 A;  5F69 A;  5F1F A;  3AGF A;  2DRW A;  2IWB A;  3NOT C;  4GHI B;  3C38 A;  4EES A;  3MXS A;  4FTX A;  3ZHH A;  4N1H A;  1VET A;  3TRC A;  2FFY A;  3LO7 A;  5DVA A;  1YLZ A;  4IVK A;  4WEL A;  4EQ1 A;  1VEU B;  2WK0 A;  2Z2M B;  1LL8 A;  1FSY A;  1P9W A;  4JKT A;  5HAR A;  5CHU A;  3GV9 A;  5A92 A;  5HSQ A;  3LIE A;  2ZJ9 A;  1G28 A;  1GSX A;  1OT9 A;  4XUX A;  2EXB A;  5EM0 A;  5EUA A;  2ZC7 A;  1TDG A;  2OWH A;  5MC7 A;  3A3I A;  4ZRR A;  5FQI A;  3VP1 A;  3NC8 A;  5IS1 A;  3M6B A;  1XKZ A;  3CUE A;  4WZ5 C;  1ES2 A;  4NEE D;  1E3U D;  2VGL M;  2LB9 A;  2IWC A;  3BFC A;  4GDB A;  1D1J A;  1BTL A;  1KE3 A;  1TD5 A;  3UPO A;  1SKO B;  3BFD A;  2EA9 A;  1ES3 A;  2A24 B;  2XR0 A;  2Y55 A;  5DFY A;  1SZV A;  3MQO A;  5CEB A;  2GNX A;  3K2N A;  4OLG A;  2IWD A;  5A90 A;  2O9C A;  4ARZ B;  4E3M A;  2EX8 A;  1BLH A;  4H6J A;  3MZE A;  5J3W A;  3LR3 A;  3L7H A;  3ZQ5 A;  4U0T A;  1CI8 A;  2B02 A;  2V8F A;  3DWK A;  3D3O A;  2W3F A;  4OPY A;  1N9O A;  5TGF A;  3OPL A;  1JNU A;  3NDG A;  4DXB A;  3CI6 A;  5FQM A;  1VB6 A;  1BLP A;  2LB5 A;  1MWS A;  4CQH A;  3UB9 A;  3A3E A;  3IXD A;  4S2P A;  5AQA A;  3Q81 A;  4F3L A;  3KYE A;  3KSF A;  5EOO A;  4GHI A;  3P98 A;  2V9A A;  5J4E A;  2O99 A;  4DE1 A;  3T4K A;  1BUE A;  4B9O A;  1YLJ A;  4PM6 A;  3ZYT A;  2WKE A;  3F1P B;  3C4P A;  4KQQ A;  3C7V A;  4KZ4 A;  3EQU A;  3MR0 A;  3MMH A;  2H5S A;  1OTA A;  1MXO A;  3DAV A;  1L0E A;  5L09 A;  2ZM2 A;  4GD6 A;  5F68 A;  5FL3 A;  5FDH A;  2PHY A;  4IBR A;  4NXB A;  4Y7P A;  3OPP A;  1NLZ A;  5AQ9 A;  1F98 A;  2OLU A;  3M6H A;  3UE0 A;  1RCJ A;  5I94 A;  1PZP A;  3FG8 A;  3QP4 A;  5LBR A;  4ZBE A;  5EVE A;  2EFX A;  2ZL1 A;  4NXG A;  5L07 A;  3FKW A;  4YFM A;  3V67 A;  1NXY A;  3MBZ A;  1P9R A;  1S4R A;  4RA7 A;  2PR5 A;  4F94 A;  1NZU A;  3ZNY A;  3H82 B;  4GLQ A;  4GZB A;  1MY8 A;  4X53 A;  2B5R A;  3IS2 A;  2PBD P;  1MKM A;  4YIN A;  3HLW A;  5HX9 A;  1NY0 A;  1PYY A;  5E2F A;  2YKF A;  1GA9 A;  5HD5 A;  3JYI A;  4EW7 A;  4IHQ A;  5GHY A;  1T1B A;  4BMW A;  4BQM A;  1EWZ A;  1Z09 A;  4MDZ A;  4FOF A;  1CEF A;  1OME A;  3TJZ C;  1O07 A;  1PIO A;  2Q9M A;  1MPL A;  3D4F A;  1IEM A;  2J3T D;  1K6R A;  4P6B A;  1XJ3 A;  3JVU A;  2AVX A;  4R0Q A;  5KSC A;  3UNW A;  4NXE A;  4EU0 A;  1GSW A;  2P08 A;  3OCN A;  3EGX C;  3Q07 A;  1NRJ A;  4C75 A;  1Q2Q A;  5BOH A;  4O01 A;  3HLE A;  1ZHH B;  4Y0T A;  4DXC A;  5D3O A;  2PT7 A;  5KSH A;  2Y4A A;  3KSH A;  4KZB A;  1L2S A;  1F2K A;  2M7V A;  4HIA A;  1O7E A;  1TS6 A;  2E8I A;  2XA7 S;  3VSL A;  2Y2I A;  2P7J A;  2OAQ 1;  4BL2 A;  5A8B A;  4NK3 A;  1HZO A;  3W2Z A;  5F1G A;  4S2M A;  1W8Q A;  2ZQA A;  4HH2 A;  2KOI A;  4FH4 A;  1NJ4 A;  5I5L A;  3O86 A;  4ME4 A;  2EX2 A;  5CRF A;  2JE5 A;  4KG6 A;  4EBN A;  3PBT A;  3MS6 A;  4CLC C;  3A3D A;  2PD8 A;  3IX3 A;  4PKY G;  1TS0 A;  1ZC2 A;  3GVB A;  3S7N A;  3NCK A;  2PD7 A;  1RGY A;  3G32 A;  4QU3 A;  3KYZ A;  2B18 A;  5DKL A;  4KZ8 A;  4RVA A;  5EVI C;  3DBA A;  1F9I A;  2GDN A;  2Y2P A;  1V9Z A;  2L0W A;  3NOP C;  3KSG A;  4O7D A;  3RXW A;  4LV2 A;  1XPB A;  2V0U A;  4N9K A;  1KE0 A;  2ZQD A;  3UDI A;  1W79 A;  4OVD A;  4O0P A;  4R4R A;  3UB8 A;  3IHB A;  3PHY A;  5HPI A;  1A0K A;  5HDC A;  3EQV A;  3IF6 C;  5G4Y A;  2PU2 A;  2PYP A;  4Y15 A;  3LUQ A;  3CWF A;  4IUK A;  2YKH A;  4BBU A;  2PU4 A;  2QYB A;  1ODV A;  3BYD A;  2P74 A;  4P87 A;  1KDW A;  2VK3 A;  1YPR A;  2ZLY A;  3NEC A;  4UA9 A;  1FCM A;  5FEF A;  3F1O B;  2EWW A;  3BFG A;  3LCE A;  4YNR A;  3MXR A;  4ZJ1 A;  1DJB A;  1S6R A;  3DTM A;  3BM6 A;  5GLC A;  2QHK A;  4E3O A;  1TS7 A;  1P97 A;  4X6T A;  1J3W A;  3H7W A;  3QP2 A;  2XF3 A;  2Y59 A;  4KZ5 A;  3SH8 A;  1FOF A;  2Y91 A;  1CJF A;  3HCY A;  3BRM A;  4X56 A;  3PYP A;  1G6O A;  1K56 A;  1EW0 A;  5CTM A;  4JF6 A;  1ES4 A;  1SDE A;  2HPB A;  5HWV A;  3IX4 A;  3GDI A;  1CK3 A;  3VE4 A;  1XJ2 A;  2W1T A;  3AGE A;  4KG5 A;  3FZC A;  5HPF A;  1K54 A;  4KUO A;  4D60 A;  4XXR A;  3OZH A;  5E2G A;  2ZC4 B;  3WS4 A;  5L10 A;  4N92 A;  3GR2 A;  4HI4 A;  1RGZ A;  4E6W A;  3CG5 A;  1PRQ A;  1F5M A;  2L1M A;  4OP8 A;  4S2N C;  4Y0U A;  2V8C A;  3CPT B;  5E43 A;  3UB7 A;  4DRT A;  4HBT A;  3OC2 A;  4OPZ A;  4DF6 A;  4K08 A;  3NDE A;  3W8K A;  3QP8 A;  4EER A;  3VSK A;  1FR1 A;  4I3A A;  3N8R A;  4NG2 A;  2HDS A;  2J7V A;  5CXW A;  1JWV A;  4N9L A;  3HVF A;  4GDN A;  1YLP A;  3WS0 A;  1K6S A;  3QNB A;  5GHZ A;  1GHI A;  2VX8 A;  1SCW A;  2JHE A;  3DW0 A;  5EVL A;  3S4X A;  4EUZ A;  4Y0O A;  3PBS A;  5GL9 A;  2A49 A;  2WGW B;  2OWJ A;  5CGS A;  4S2O A;  4R3A A;  3A3F A;  4G3V A;  4PM5 A;  1OPX A;  4M3K A;  4FUW A;  4HOI A;  3M2K A;  1HTZ A;  4WBG A;  2WKI A;  3B3X A;  4IVI A;  1PWG A;  4L0L A;  2VLG A;  2ZOI A;  2X71 A;  4HEF A;  2WAF A;  3TE8 A;  3LY3 A;  3MXQ A;  1XJ6 A;  3CIT A;  4DN0 A;  2Z6D A;  2Y2M A;  3HBR A;  3KX0 X;  1XXM A;  1X0O A;  2G7U A;  4WL9 A;  1ONG A;  5TFQ A;  4L9F A;  4UA7 A;  3HLD A;  3BEC A;  5CX7 A;  1S1Z A;  5HWT A;  4PMA A;  1N9B A;  2P9V A;  4GKU A;  3O87 A;  2DMW A;  5F82 A;  4E6X A;  2WKP A;  5AVF A;  5HDD A;  4R3J A;  1ZKJ A;  2V20 A;  1XFN A;  5EEC A;  5CGW A;  1K56 D;  3OPH A;  1SKF A;  1YSP A;  1BZA A;  3EOI A;  3LIA A;  1DJA A;  4HHD A;  4UQI M;  3VV4 A;  2K2N A;  4WM9 A;  3ZG7 B;  2J80 A;  2ZMA A;  4Q0I A;  1YAX A;  2E8J A;  2V2F F;  1YKD A;  3GEC A;  4EEU A;  3CUE C;  4HP9 A;  3HUN A;  2I72 A;  3T4L A;  3BQ8 A;  2BAS A;  4P6Z M;  5FQJ A;  4X55 A;  1PW8 A;  1FSW A;  1UWN X;  4JGR A;  3UY6 A;  4WZ5 A;  4WN5 A;  1MBL A;  3IBJ A;  2P04 A;  3TG9 A;  4GS9 B;  2J9O A;  2DCF A;  3ZG9 B;  3T4O A;  2FFF B;  2R78 A;  4DJ3 A;  4EEP A;  2Y2N A;  1ZG6 A;  4ETZ A;  3PAG A;  1W63 M;  4PPR A;  1W7F A;  3OLO A;  3MKF A;  4CJN A;  3LFV A;  4X68 A;  5GLA A;  4GB7 A;  2Y2O A;  3QP1 A;  3DTK A;  4O8G A;  4E3J A;  3FKV A;  4A5R A;  4LV3 A;  1K4F A;  4BEN A;  3VE3 A;  5U47 A;  4EXO A;  1K25 A;  5IHV A;  3LIB A;  4I5S A;  1BYW A;  3HLF A;  1IYO A;  2H28 A;  4U3T A;  3MZF A;  4MN7 A;  3NBL A;  2PDR A;  1N4O A;  1GA0 A;  1S1Y A;  3LEQ A;  3C5A A;  4UHU A;  3LEZ A;  3UPP A;  4R23 A;  3DTI A;  5EV0 A;  1VEU A;  1N9L A;  3SZT A;  4KZ7 A;  3ZG0 A;  5F6A A;  4WEK A;  3ULF A;  2VV7 A;  2PRF A;  5M19 A;  3JVV A;  1K55 C;  1T1A A;  2ZC5 B;  2X02 A;  3DTE A;  3ZGA B;  1BLC A;  5L8M A;  4K0W A;  2PAV P;  3WWX A;  4XT2 B;  3LYX A;  4LLO B;  3UB5 P;  4JGP A;  4R6L A;  1H0M A;  3VOY A;  1SKO A;  3IH9 A;  5KIZ A;  4OPR A;  1ES5 A;  2A24 A;  4LPZ A;  4OH0 A;  4RYE A;  4HQA A;  4Z9Q A;  3OOV A;  5EE8 A;  4ARZ A;  1GHM A;  1LI0 A;  2B95 A;  4KZ3 A;  2Y2L A;  3F1N B;  2WKR A;  1IFQ A;  1C3B A;  1TEM A;  3NUL A;  1M6K A;  1KE4 A;  4OLD A;  1GCE A;  4BJP A;  4KZ9 A;  2J3W A;  1K57 A;  3T50 A;  2ZMF A;  2G2U A;  3TOI A;  3E2K A;  4OQG A;  2EWV A;  3UDX A;  4JBF A;  1U60 A;  2V1Z A;  4DJ2 A;  3HRE A;  3MFX A;  1GSV A;  3UDF A;  4B88 A;  4CLC B;  1LI9 A;  4OQH A;  3OPR A;  3E0Y A;  3WRZ A;  2WZX A;  1HD8 A;  4ETX A;  5FA7 A;  2HF6 A;  3GMW A;  3V3S A;  3F1P A;  1KGE A;  5FSR A;  2W3D A;  3T1R A;  3T4J A;  4I38 A;  4GCZ A;  5EVI B;  5TR7 A;  1PI5 A;  1STZ A;  4ZJ2 A;  4K0X A;  4L9G A;  4JXW A;  3UE1 A;  3IF5 A;  2BG1 A;  3VFF A;  1IKG A;  3CAX A;  4KG2 A;  3ZFZ A;  3G30 A;  4G3W A;  4LEN A;  2Y2H A;  4S2K A;  3Q7V B;  4X25 A;  4MNR A;  1W63 Q;  4OOM A;  4I3J A;  4GOG A;  3C30 A;  1NWZ A;  1WA9 A;  3ITA A;  4HJ6 A;  3R7W B;  4E04 A;  3LIF A;  3IF6 B;  5FQ9 A;  2HGV A;  3FPW A;  3BY9 A;  1JTD A;  1M40 A;  5FI2 A;  4BBV A;  3QHY A;  3MZD A;  4CLC E;  5A93 A;  2M1C A;  1S67 L;  3H82 A;  5DTS A;  1NRF A;  3PXP A;  2G2W A;  1DRM A;  4MLL A;  5TBM B;  2Z2L B;  3RJU A;  2WZZ A;  2NUT C;  5F5Y A;  3NJA A;  3NY4 A;  4GD8 A;  3FC7 A;  1PFL A;  1MWU A;  2Y79 A;  3R4K A;  5G4Z A;  4MCW A;  1KGG A;  4PHT A;  3T4T A;  3SH7 A;  4LFU A;  5IT5 A;  3ZVW A;  3NHQ A;  2O0Y A;  4JGO A;  4KZ6 A;  2JKG A;  3T12 B;  4JXV A;  4ZTK A;  4CLC A;  1LHY A;  3RFB A;  3VP0 A;  2JCH A;  3IH8 A;  4KEN B;  2CMN A;  3WRT A;  4JXS A;  1YT4 A;  4QWO A;  3HL9 A;  4E3K A;  4OON A;  2V1B A;  4BWI A;  1N9N A;  2L4R A;  1D06 A;  2Q9N A;  4RX3 A;  2A2L A;  5AQB A;  4B4Z A;  1Q2P A;  3B47 A;  4S2L A;  4R70 A;  4IED A;  1HLU P;  2XRO A;  1KGF A;  1TVF A;  3ZNT A;  1ONH A;  2WGI A;  1VQQ A;  1W5D A;  3N6I A;  4EBL A;  3Q7V A;  1LSV A;  4RQ9 A;  3A3J A;  5HD3 A;  4IJG A;  1Y54 A;  2QKP A;  4KZA A;  4M4X A;  3IF6 A;  3RXX A;  3C4O A;  3LR0 A;  2OSU A;  3I7J A;  3MQQ A;  5E2H A;  3U2A A;  4QHC A;  3U4L P;  4WLA A;  2HZ5 A;  3WS2 A;  1CEG A;  4MN6 A;  2GJ3 A;  3FYZ A;  5DKK A;  3S7Q A;  5FAQ A;  1I5Q A;  1UWP X;  1AWI A;  1LL9 A;  4R3B A;  1XX2 A;  1YLW A;  2VEA A;  3MQ0 A;  1UGU A;  4LGW A;  1PWC A;  1RP5 A;  2JKR M;  1PWD A;  4DMZ A;  2Y8H A;  3A0S A;  2H10 A;  1PI4 A;  5J7E A;  3HJK A;  1DJC A;  4BD0 A;  4EBP A;  2XA7 M;  4UA6 A;  3GSG A;  3QP5 A;  3UPN A;  3B33 A;  3L9K A;  4BL3 A;  4LV1 A;  4QY5 A;  3MJQ A;  5EOE A;  3SH9 A;  3CJM A;  3BWL A;  4GW9 A;  2NUP C;  1KDS A;  3H9W A;  5HWW A;  5JYP A;  4QD4 A;  2Z6C A;  1XJ4 A;  2D02 A;  4PM9 A;  4AFI A;  1ERQ A;  2FZ0 A;  1TF1 A;  3O3V A;  1GHP A;  4DDY A;  3IT9 A;  1E25 A;  3RTY A;  1P0Z A;  4NXF A;  4WUJ A;  5GLB A;  5HW3 A;  1YSQ A;  3C7U A;  2VGL S;  4JF5 A;  4Y5F A;  5DF7 A;  5AVE A;  3T1S A;  1NZO A;  4HES A;  3W4P A;  2Y2G A;  1VET B;  2XDM A;  2GZA A;  4EQI A;  2JN7 A;  2ZM8 A;  4CLC D;  1L0D A;  3F1O A;  2XH9 A;  4C6Y A;  2WGV A;  1MWT A;  1CQA A;  1YLT A;  1ZTU A;  3DWZ A;  1SHV A;  4GJ4 A;  2VV6 A;  2QJ7 A;  2WYX A;  3ZVT A;  5EVI D;  3LY4 A;  2ZQ9 A;  1OTD A;  2EFU A;  4OKP A;  4DE2 A;  2ZQ8 A;  1ERO A;  1SDN A;  3C8C A;  2XK1 A;  1LSW A;  1K4E A;  3PBQ A;  3LIC A;  2XGN A;  4QJG A;  1YQS A;  1G6A A;  3MF0 A;  1AXB A;  2JKR I;  5DTT A;  2W3G A;  4WMC A;  4E3L A;  4H6J B;  3EEA A;  2V1A A;  1FIL A;  3LR5 A;  3T4Q A;  3SOI A;  3VOL A;  3HJI A;  5L2F A;  4D2O A;  1WE4 A;  4WZ4 A;  3Q1F A;  4HH3 A;  3S7P A;  2JC7 A;  2OAP 1;  1Y4O A;  2W0N A;  4WF0 A;  1OTE A;  3CPT A;  1T18 A;  4F3L B;  3E4P A;  1JTG A;  1PW1 A;  3PR6 A;  4MEZ A;  4LCL A;  2QPN A;  4RX2 A;  2UWX A;  3O5Y A;  2KDK A;  2ZM0 A;  2RCX A;  3Q7Z A;  4ID4 A;  3TSG A;  5CER A;  2HV1 A;  2HP5 A;  3ZCZ A;  4FCF A;  4NET A;  4LRZ E;  3EGD C;  1JWP A;  3IWQ A;  2WGW A;  2Y2J A;  2J9P A;  5M18 A;  4DE3 A;  1OJG A;  5HAP A;  4HY8 A;  2QZ6 A;  3V3R A;  2VA0 A;  3NOU C;  2VKS A;  1BSG A;  4Y13 A;  5C5K A;  3UN7 A;  5TJJ A;  2ZOH A;  3RH8 B;  1IEL A;  2BLS A;  2J3T C;  4GN2 A;  2KLI A;  4CPK A;  1K38 A;  1H3Q A;  1VM1 A;  4S2I A;  4LCM A;  2ZL1 B;  3QNC A;  5CGX A;  4BD1 A;  2W3H A;  5FI6 A;  2DNS A;  4PM7 A;  1LLB A;  1HVB A;  1I2S A;  3GRJ A;  4HBU A;  3G34 A;  2VGJ A;  3MKE A;  4Y17 A;  3T1X A;  4QB8 A;  2QWS A;  2XLN A;  3LI8 A;  2QJ5 A;  3UE6 A;  1KVM A;  3ICY A;  2PYR A;  3IS2 B;  5E2E A;  1YLY A;  3BY8 A;  4ZJ3 A;  1YMS A;  1XGI A;  3M2J A;  4LRY C;  3HLC A;  3NIA A;  3SS3 A;  3IX8 A;  3CLO A;  5AQ7 A;  3G4P A;  2C5W B;  2JKF A;  4OPQ A;  1FCN A;  1MWR A;  5DF8 A;  5K5B A;  2OOL A;  3S1Y A;  1L3L A;  1DP8 A;  2HJ9 C;  4Q8I A;  1IYS A;  2V0W A;  5CHJ A;  3BLS A;  1T19 A;  4OQ0 A;  4JPM A;  3BFF A;  3VFH A;  4FD8 A;  1H8M A;  4OP5 A;  4PM8 A;  3V50 A;  4Y3I A;  1DP9 A;  4WMC D;  3EEH A;  3N4I A;  1J9M A;  4EV4 A;  3V5M A;  1D7E A;  4WEJ A;  2OV5 A;  2M7U A;  4YOF A;  2EX6 A;  2VV8 A;  4ESP A;  4I39 A;  3VP3 A;  1ERM A;  1XA7 A;  1K55 A;  5KZH A;  5EFW A;  4S2J A;  3G35 A;  2EXA A;  3P7N A;  5A91 A;  3G2Z A;  4OOL A;  4E3N A;  3TW8 A;  3UME A;  1V9Y A;  1DY6 A;  1LL5 A;  4GS9 A;  1XP4 A;  1TS8 A;  1XGJ A;  3G2Y A;  4WYY A;  2KX6 A;  1EI5 A;  2JBF A;  2WAE A;  1PZO A;  2JKT M;  1IYQ A;  1K57 C;  3JPU A;  3EWK A;  4IBX A;  1W8Y A;  5HFO A;  2A3U A;  3BFE A;  1G68 A;  3VOZ A;  1ACF A;  5DFX A;  3BEB A;  2ZC6 B;  4KUK A;  1L0G A;  1IYP A;  4PAU A;  3G6O A;  1JVJ A;  2H0Y A;  3BLM A;  3W4O A;  4HNB A;  2X01 A;  1YM1 A;  4R4S A;  3ISG A;  3UMD A;  1PNE A;  2O9B A;  3WS1 A;  1OTB A;  1G5U A;  2Q0O A;  3QP6 A;  1QMF A;  4X69 A;  1T1C A;  1BUL A;  1FIK A;  4MN5 A;  5GHX A;  1NLY A;  4LV0 A;  4K91 A;  1LT0 A;  3A0V A;  3PAE A;  4MMN A;  1MKI A;  4BLM A;  1H8Z A;  2HDQ A;  2WAD A;  4GNU A;  3KSI A;  2ZQ7 A;  4YWZ A;  3VMA A;  4XT2 A;  3P09 A;  5FQQ A;  2C6W B;  4NKP A;  4U0X A;  3IXH A;  3PBO A;  1I2W A;  1DP6 A;  3PTE A;  3NI9 A;  3VP2 A;  3D9Y A;  4B93 A;  5KMW A;  2CC1 A;  3BW6 A;  3LGO A;  3C2W A;  1WYB A;  4X1M A;  1FQG A;  2W27 A;  2Y2Q A;  3E2L A;  2R9X A; 
#chains in the Genus database with same CATH homology
 5HWT A;  1OTA A;  3BQA A;  3F1N A;  5J7E A;  3HJK A;  3OCL A;  2XA7 M;  5F68 A;  5FL3 A;  2DMW A;  3A0R A;  3B33 A;  2PHY A;  4L9E A;  4NXB A;  1NLZ A;  3MJQ A;  2WKP A;  1F98 A;  3BWL A;  5AVF A;  5HDD A;  1XFN A;  2W1R A;  4GW9 A;  5DF9 A;  2NUP C;  2JKT I;  3H9W A;  5HWW A;  1MZU A;  2Z6C A;  1XJ4 A;  2D02 A;  4AFI A;  3FG8 A;  3H7W B;  5LBR A;  2FZ0 A;  1TF1 A;  1YSP A;  4UEY A;  4NXG A;  3RTY A;  1P0Z A;  3EOI A;  3LIA A;  4NXF A;  4WUJ A;  2PR6 A;  3V67 A;  4HHD A;  4UQI M;  3VV4 A;  2K2N A;  1YSQ A;  1P9R A;  3E4O A;  2J80 A;  4Q0I A;  1S4R A;  2VGL S;  1YAX A;  4Y5F A;  2PR5 A;  1YKD A;  3GEC A;  5AVE A;  4EEU A;  3CUE C;  4HP9 A;  3H82 B;  4HJ3 A;  3K3D A;  4GLQ A;  3T4L A;  4G3K A;  2GX5 A;  3BQ8 A;  2GZA A;  2W1T B;  2BAS A;  4P6Z M;  2JN7 A;  3IS2 A;  2IA2 A;  3E98 A;  4CLC D;  2FH5 A;  3KO6 A;  1UWN X;  1MKM A;  2D01 A;  4JGR A;  5IU1 A;  4WN5 A;  3UE3 A;  3F1O A;  5DJU A;  3IBJ A;  4EET B;  2P04 A;  2YKF A;  4GS9 B;  5HD5 A;  5DJT A;  4EW7 A;  4IHQ A;  1T1B A;  4BMW A;  1ZTU A;  3T4O A;  4GJ4 A;  2VV6 A;  2R78 A;  2QJ7 A;  2XRN A;  4DJ3 A;  3IBR A;  4LRX C;  4EEP A;  4MDZ A;  1KOU A;  4FOF A;  4BBT A;  4ETZ A;  1W63 M;  2O9A A;  3TJZ C;  3S7O A;  3PBR A;  3OLO A;  1OTD A;  3LFV A;  3R7W A;  2J3T D;  3LID A;  4O8G A;  1XJ3 A;  3JVU A;  3C8C A;  1LSW A;  4NXE A;  4EU0 A;  3PBQ A;  1GSW A;  2P08 A;  3VE3 A;  2VJW A;  3OCN A;  3LIC A;  3EGX C;  1NRJ A;  5HDS A;  4EXO A;  2K31 A;  4HP4 A;  3LIB A;  4HJ4 A;  4O01 A;  1ZHH B;  3MF0 A;  2JKR I;  4I5S A;  3UB6 A;  2W3G A;  1BYW A;  2H28 A;  5TBM A;  2PT7 A;  4H6J B;  3D72 A;  4MN7 A;  5KSH A;  2PDR A;  3EEA A;  1S1Y A;  1VHM A;  3KSH A;  2M7V A;  2V1A A;  1OTI A;  4Q0H A;  3LR5 A;  3T4Q A;  5HL6 A;  3VOL A;  1N9L A;  1S4S A;  4HIA A;  1TS6 A;  4KQD A;  3HJI A;  2XA7 S;  2INW A;  2XSS A;  4HH3 A;  3T4S A;  2P7J A;  2OAQ 1;  1XFQ A;  5F6A A;  4WEK A;  5A8B A;  3S7P A;  2OAP 1;  3ULF A;  2VV7 A;  2W0N A;  3JVV A;  1T1A A;  4WF0 A;  1OTE A;  3W2Z A;  3BJN A;  1IOU A;  1T18 A;  4F3L B;  3E4P A;  3PR6 A;  4HH2 A;  2KOI A;  5I5L A;  5L8M A;  4ME4 A;  1OT6 A;  4R38 A;  4XT2 B;  3LYX A;  5HZH A;  4LLO B;  1OJ5 A;  2MJ6 A;  2KDK A;  3O5Y A;  4UQI S;  4KQO A;  4JGP A;  4R6L A;  4QPR A;  3PBT A;  5KIZ A;  2HV1 A;  3MMH A;  4CLC C;  2A24 A;  2PD8 A;  4LRZ E;  3EGD C;  4LPZ A;  4PKY G;  3FPV A;  4HQA A;  1TS0 A;  3OOV A;  4ARZ A;  3S7N A;  3F1N B;  2WKR A;  1OJG A;  4P6Z S;  1IFQ A;  2PD7 A;  4HY8 A;  4Y2F A;  3KYZ A;  2B18 A;  2VA0 A;  3NOU C;  2VKS A;  5DKL A;  3E4Q A;  1LSX A;  4BJP A;  3DBA A;  1F9I A;  2K7S A;  2J3W A;  5C5K A;  1V9Z A;  3T50 A;  5TJJ A;  2ZOH A;  3RH8 B;  2ZMF A;  2L0W A;  3NOP C;  2J3T C;  2KLI A;  3LR4 A;  3KSG A;  1H3Q A;  2WKQ A;  2EWV A;  4PKY A;  2V0U A;  4DJ2 A;  4Q0J A;  3MFX A;  1GSV A;  2W3H A;  4CLC B;  4II7 A;  4Z1W A;  2I9V A;  2W3E A;  3E0Y A;  4O0P A;  3UB8 A;  4JGQ A;  1MC0 A;  3PHY A;  2QWS A;  4FSF A;  3K3C A;  3LI8 A;  2QJ5 A;  5HPI A;  4ETX A;  2HF6 A;  3UE6 A;  5HDC A;  3EQV A;  5G4Y A;  2PYP A;  3F1P A;  3LUQ A;  3ICY A;  3CWF A;  2W3D A;  3T4J A;  4IUK A;  2PYR A;  4I38 A;  2YKH A;  4GCZ A;  4BBU A;  2QYB A;  3IS2 B;  1ODV A;  1S66 L;  1STZ A;  3BY8 A;  4L9G A;  2ZMV A;  4LRY C;  3F1O B;  3OBF A;  2EWW A;  3CAX A;  2VZW A;  3CLO A;  3PBN A;  4YNR A;  5AJG A;  4G3W A;  5K5B A;  2OOL A;  3KYQ A;  3SW1 A;  1W63 Q;  2QHK A;  2HJE A;  3LI9 A;  1DP8 A;  2HJ9 C;  3P01 A;  4OOM A;  1TS7 A;  4I3J A;  4I3I A;  2V0W A;  2ZBB A;  3B42 A;  1P97 A;  1T19 A;  4IUH A;  3H7W A;  1H8M A;  3C30 A;  1NWZ A;  1WA9 A;  4Y3I A;  4HJ6 A;  1DP9 A;  3R7W B;  4EUV A;  3EEH A;  4E04 A;  3LIF A;  2HGV A;  3FPW A;  1Y28 A;  3BY9 A;  3HCY A;  5F69 A;  1D7E A;  4WEJ A;  4BBV A;  3NOT C;  3PYP A;  2M7U A;  4YOF A;  1G6O A;  4CLC E;  1EW0 A;  4GHI B;  2M1C A;  2VV8 A;  3C38 A;  1S67 L;  3H82 A;  4EES A;  5HWV A;  4I39 A;  3PXP A;  1DRM A;  5TBM B;  5EFW A;  3TRC A;  3GDI A;  3VE4 A;  1XJ2 A;  2NUT C;  2W1T A;  5F5Y A;  3NJA A;  5HPF A;  3P7N A;  4KUO A;  3FC7 A;  4WEL A;  4OOL A;  4EQ1 A;  2Y79 A;  3TW8 A;  3UME A;  3R4K A;  5G4Z A;  1V9Y A;  4MCW A;  1LL8 A;  4PHT A;  3T4T A;  1P9W A;  4GS9 A;  1TS8 A;  5IT5 A;  3NHQ A;  5HSQ A;  2O0Y A;  4HI4 A;  2KX6 A;  3LIE A;  4JGO A;  1G28 A;  1GSX A;  1OT9 A;  1F5M A;  2L1M A;  3UB7 A;  4CLC A;  2OWH A;  5MC7 A;  2JKT M;  3OC2 A;  3RFB A;  4K08 A;  4ZRR A;  5IS1 A;  4EER A;  2CMN A;  4I3A A;  3CUE A;  3EWK A;  4NEE D;  2V1B A;  2VGL M;  4BWI A;  2LB9 A;  1N9N A;  2L4R A;  1D06 A;  2A2L A;  5DFX A;  1TD5 A;  4KUK A;  3B47 A;  2EA9 A;  4PAU A;  3G6O A;  2A24 B;  2JHE A;  2VX8 A;  4R70 A;  5DFY A;  2XRO A;  3MQO A;  2GNX A;  3K2N A;  3PBS A;  4HNB A;  2O9C A;  4ARZ B;  2OWJ A;  4H6J A;  5J3W A;  3LR3 A;  4R3A A;  3UMD A;  1LSV A;  4RQ9 A;  2O9B A;  1OTB A;  3ZQ5 A;  2B02 A;  4G3V A;  5HD3 A;  1OPX A;  2W3F A;  3D3O A;  1T1C A;  4IJG A;  1N9O A;  4HOI A;  4MN5 A;  1JNU A;  2QKP A;  1NLY A;  3CI6 A;  1VB6 A;  1LT0 A;  2LB5 A;  3A0V A;  4M4X A;  4MMN A;  4CQH A;  3UB9 A;  3LR0 A;  4L0L A;  2VLG A;  2ZOI A;  4F3L A;  3MQQ A;  3U2A A;  3KSF A;  4WLA A;  3KSI A;  4GHI A;  3TE8 A;  3MXQ A;  1XJ6 A;  3CIT A;  4YWZ A;  4DN0 A;  2V9A A;  2Z6D A;  5J4E A;  4XT2 A;  2O99 A;  4MN6 A;  3T4K A;  2GJ3 A;  4NKP A;  3KX0 X;  3PBO A;  5DKK A;  4B9O A;  3S7Q A;  1DP6 A;  1UWP X;  1X0O A;  3ZYT A;  4B93 A;  2G7U A;  3F1P B;  4WL9 A;  2VEA A;  3BW6 A;  3MQ0 A;  3C2W A;  4L9F A;  1UGU A;  3EQU A;  2JKR M;  5CX7 A;  2W27 A;  1S1Z A;  4DMZ A;  2Y8H A;  3MR0 A;  3A0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...