3BQAA

Crystal structure of an e.coli phoq sensor domain mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
146
structure length
146
Chain Sequence
SFDKTTFRLLRGESNLFYTLAKWENNKLHVELPENIDKQSPTMTLIYDENGQLLWAQRDVPWLMKMIQPDWLKSNGFHEIEADVNDTSLLLSGDHSIQQQLQEVRQNNNNAQMTHSVAVNVYPATSRMPKLTIVVVDTIPVELKSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein phoQ
publication title Crystal Structure of a Functional Dimer of the PhoQ Sensor Domain.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein, transferase
total genus 35
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2007-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.140 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3bqaA00
1YAXA 3BQAA 3BQ8A 4UEYA
chains in the Genus database with same CATH superfamily
4KZ6A 1IEMA 1X0OA 4ETZA 3VP3A 5TJJA 3QP6A 2OV5A 2A49A 4QJGA 3NC8A 3G2ZA 2WK0A 1K54C 3A0VA 5CEDA 4CLCD 3B42A 1HTZA 2L1MA 1OT6A 4KZ3A 3NIAA 4Y0TA 3ITBA 3LUQA 4XUXA 2W0NA 3T4SA 3PBTA 4EBPA 4BL3A 1L2SA 3T4QA 1DRMA 1UWNX 3GECA 4O8GA 4JPMA 4P87A 3E4QA 4E3MA 3S22A 1N9OA 3RH8B 3UDXA 2X01A 3FG8A 4P6ZS 3NHQA 2GJ3A 4OPYA 3RXXA 5G4ZA 3PYPA 4N1XA 4BBUA 4PKYA 1PZOA 4MBFA 1BZAA 5AQAA 2R9XA 3QP5A 1JWZA 1WYBA 3NULA 1XPBA 4E04A 3FZCA 2OWJA 2OWHA 1NXYA 5EECA 1W63Q 2OAP1 5FASA 3HLBA 3W8KA 3CJMA 3W2ZA 1K6RA 3BFDA 4WUJA 3LO7A 3H9WA 3IH8A 3G2YA 4G3WA 4EBLA 1TS7A 5FQJA 4HESA 2P7JA 4GD8A 1OJ5A 4YOFA 3E4OA 4ZJ2A 1S67L 2EFXA 4X25A 5F69A 5GLCA 3T1SA 4R70A 3W4PA 3DWKA 1E3UA 3UE1A 2XR0A 3CAXA 3ISGA 3PBQA 2VLGA 2XGNA 5AJGA 2W1RA 4R1GA 4IVKA 5EUAA 3H7WB 1TDLA 2VGJA 3G35A 3WS1A 2V0WA 4RX2A 5TBMB 4HJ6A 4O0PA 3IF5A 3IT9A 3NOPC 3WRTA 2IWCA 3KSIA 4DDYA 1E3UD 1SDNA 4X68A 2IWDA 2VGLS 2WYXA 4EQIA 2OLVA 5EM1A 5CGXA 5CHJA 1W8QA 4HBTA 4B4XA 1VETA 2WKHA 1PW1A 3ULFA 4UA6A 2RCXA 2VV8A 3R7WB 2MJ6A 4O01A 4PKYG 3O3VA 1CEGA 2QHKA 5EV0A 2CC1A 3DW0A 4O7DA 4F3LA 1IKGA 2ZQ7A 3QNCA 1ES3A 4S2PA 4Q0HA 1ZG6A 1JVJA 1E25A 1ZC2A 2JKTI 2L0WA 1T18A 5IU1A 4E3KA 2Z6DA 4U0TA 2QMIA 4QD4A 1KDSA 2L4RA 5FEFA 3OPHA 2W3GA 3UPNA 3FWLA 1P9WA 1ZG4A 3SS4A 2C5WB 2JE5A 3T12B 3Q7VA 1IYSA 5EVLA 4DXBA 4LCLA 1MPLA 1NY0A 3D4FA 4Q0JA 3UNWA 3BQAA 4LPZA 5HARA 2QKPA 2UWXA 2ZBBA 4PM7A 4R3AA 2DMWA 4U0XA 3ZCZA 2VK3A 3ZVTA 1S1ZA 5G18A 4HBUA 2Q0OA 3NJAA 4OH0A 3SW1A 2ZQCA 4KUKA 1BUEA 1WA9A 4UAAA 5FA7A 4JGPA 1J9MA 3ZG9B 3RTYA 1G5UA 2PR6A 1LSWA 4FH2A 1TS8A 3T1XA 3HUNA 2LB5A 1L0GA 2H0TA 1YSQA 2J8YA 3HUMA 4WELA 2V9AA 4ARZB 2PBDP 1KVLA 2OAQ1 1S6RA 3DBAA 3NECA 4QB8A 4JXWA 3UB9A 1MXOA 1I2SA 3PBSA 2H28A 1BYWA 1VHMA 1UWPX 2XH9A 2Z2MB 5DKLA 4DMZA 3MZFA 1YSPA 1NLYA 1LI9A 4LCMA 3A0RA 1CQAA 2J80A 3C7UA 4B93A 5D3OA 2OOLA 5KSCA 3B3XA 2PHYA 2A3UA 1FOFA 4U3TA 3C2WA 3DTEA 2Y2IA 3O88A 2VZWA 3P01A 4MDZA 3SS5A 4UA7A 4N9KA 3CLOA 4EEUA 4Y13A 4R6LA 4WM9A 3IXHA 2EWVA 2GZAA 2Q9NA 2ZQ8A 1PWDA 4YNRA 4EV4A 4PM9A 1T1AA 5JYPA 2QYBA 3N4IA 4KZ9A 4ZJ1A 3HBRA 1FCMA 2G2UA 4ZTKA 3LR0A 1T1BA 3V3RA 2JBFA 2K2NA 4D2OA 3G34A 3TJZC 1W79A 5M1AA 3W4OA 1FSWA 3VV4A 4OQGA 3BLSA 1NRFA 1Q2QA 2QZ6A 3D3OA 4RYEA 3T4KA 2PT7A 1BT5A 2QJ5A 1YLJA 3OBFA 1RCJA 1P97A 2R9WA 3VSLA 2J7VA 2PYPA 4N1HA 3C4PA 1XJ6A 1ALQA 2PR5A 3LGOA 4NETA 3SH9A 3LIEA 1S66L 1PWGA 4OP5A 5L10A 3H7WA 1T19A 1YLPA 2VEAA 1XJ3A 1N9BA 2WGWA 1IYOA 3N6IA 1NRJA 4QWOA 3HREA 1UGUA 5TBMA 1PWCA 2XROA 5HL1A 3TRCA 2Y91A 5FL3A 2PD7A 1M6KA 4ESPA 3IQAA 3BFCA 4OKPA 4FUWA 3VMAA 3HLCA 3MXSA 2V8CA 4H8RA 1KDWA 1Z6FA 3BY8A 1JWPA 3R7WA 3NI9A 4S2NC 2QWSA 4OQ0A 5G4YA 3PTEA 4B88A 2Y2KA 4MN5A 1V9ZA 3C8CA 2ZM0A 1QMFA 4OP8A 4QY5A 3HLEA 3S7QA 3UMEA 2WAEA 4MCWA 1D06A 1KE4A 1C3BA 2ACGA 1SKFA 3C7VA 3QP2A 1L0EA 2XD1A 1H8YA 3IWOA 4WL9A 4GN2A 3GSGA 2ZOIA 4OPRA 3ZG7B 1YMSA 3DAVA 1CI9A 1TDGA 4K91A 2JCHA 5FQKA 2JKTM 1VETB 5HSQA 3LR5A 5EOOA 5FI7A 4ZAMA 2Y2HA 2WZZA 3VP2A 2M7UA 3CPTB 2J3WA 2Y79A 4I39A 3SZTA 1P9RA 5L07A 3FPVA 3CUEC 1W7FA 3D9YA 5CERA 1F9IA 3LY4A 1F98A 3TW8A 4XT2A 2WKRA 4R0QA 3I7JA 3MQQA 2W3HA 4BBVA 5CHUA 4KZAA 1XJ2A 3BWLA 3C38A 4JBFA 3Q7VB 2H5SA 1GSXA 1ODVA 1HVBA 1RGZA 1ZHHB 1XGJA 1RP5A 1LLBA 3C30A 3HLDA 5HDDA 1BLCA 5AQ9A 1SKOB 1IELA 5FEGA 3M2JA 1E4DA 3FPWA 4OONA 5GLDA 5KMWA 4IEDA 1MY8A 1NZOA 4BD0A 1MC0A 3KYQA 4G3KA 5HPIA 1Z09A 3BECA 5J7EA 5F83A 4WN5A 4MEZA 4NKPA 2O0YA 3LY3A 2WAFA 2YKHA 5HX9A 4DF6A 4Y2FA 4BD1A 3KX0X 4GCZA 5GHZA 4DE1A 3H82B 4E3LA 4S2KA 4FSFA 4ME4A 1TS6A 3BJNA 4P6BA 3B33A 1K6SA 2GX5A 2Y2JA 3BM6A 3MQOA 5JYOA 4CLCE 3HVFA 3IHAA 4PHTA 3SH8A 1MZUA 1JWVA 1LSXA 3QP1A 4EEPA 1MWUA 3MMHA 2JKGA 3MZEA 3ZDJA 1NYYA 2PU2A 1K55C 3LR3A 4QPRA 1FIKA 4Y17A 3FV7A 3T1RA 1GA0A 4GDNA 3JPUA 4OOYA 3F1OB 3GR2A 2J9PA 2HP5A 4UA9A 2DCFA 3L9KA 4KG2A 2DRWA 1O07A 2M7VA 1W63M 1BULA 3ITAA 2ZQDA 4EQ1A 2B95A 2HDQA 3E98A 3HCYA 3WWXA 1XP4A 4JF5A 3SH7A 3PBNA 4LFUA 3ZVWA 2ZMVA 3MFXA 4FH4A 4ZDXA 3O5YA 1HD8A 3MXQA 2C6WB 3KSGA 4JF6A 5TR7A 5EVEA 1OMEA 3BRMA 3OPPA 5E2GA 4GOGA 5EE8A 4JXVA 1VQQA 5HD3A 4HEFA 1XA1A 1TF1A 5F68A 2FH5A 2WGWB 2EX8A 3PAGA 3MZDA 1PI4A 3IXDA 5AQ7A 1GHPA 3E2KA 1AXBA 1XKZA 4DDSA 2VJWA 3Q82A 3LI8A 3WS0A 3WS4A 1L3LA 1MKIA 1SHVA 2KDKA 4XUZA 1EI5A 4CQHA 3B47A 3LFVA 4D60A 2VKSA 4N9LA 3G4PA 4ZBEA 2EX2A 4FOFA 3LYXA 2E8JA 3LEQA 3GDIA 3CPTA 3N8SA 1YLZA 3NDEA 3EQVA 4RQ9A 5M19A 4BL2A 4BBTA 1FQGA 2V2FF 1N4OA 2Y2PA 5CXWA 2P08A 3L7HA 4YFMA 3ZHHA 5TGFA 4RX3A 1DJAA 2EXAA 1LHYA 4OOMA 3VFHA 1YLWA 1PIOA 1GHMA 4JF4A 4EETB 4X53A 5HWVA 4EXOA 3BFFA 4DE2A 4HHDA 4JGQA 1EWZA 5EVIC 2Y2LA 3FKWA 3UO9A 3MQ0A 3N8LA 4LV0A 5L09A 1G68A 2OSUA 4KZ7A 1SKOA 5CGWA 5GHXA 2JKFA 2WKQA 2H0YA 2CMNA 4UHUA 5DFXA 4M4XA 5DJUA 1YKDA 1IKIA 5F5YA 1ZTUA 4IJGA 5DF7A 3JYIA 4YINA 2XA7M 2HPBA 3K2NA 4NXEA 2KLIA 2NUPC 1JTDA 1K4FA 5HDSA 1OT9A 2X02A 1ZKJA 4L9FA 2WKPA 1XJ4A 1KE3A 2V1AA 3NCKA 4E6WA 4XT2B 5HWWA 3H82A 4BQMA 2HDUA 4C3QA 5IS1A 3S7PA 1EROA 1FCOA 4Y0UA 5GLAA 3VE3A 1S1YA 4HOIA 2XLNA 5F82A 2XD5A 2XFSA 3M6BA 1OTIA 3IX3A 3FKVA 5CEBA 1WYCA 1SDEA 1LL9A 3G30A 4Z1WA 4DKIA 5KIZA 4Y5FA 3F1NA 3T4LA 4I5SA 1K4EA 3CZDA 1A0KA 4XXRA 5I5LA 1NYMA 3CG5A 2WKIA 1ES5A 4HIAA 4LV1A 2WGVA 3A3JA 3NY4A 3GV9A 3EEAA 5FAQA 3F1OA 2ZQAA 4ZJ3A 2FZ0A 3GTCA 1G6OA 4R3BA 2V20A 5EM0A 5CX7A 1KOUA 1F5MA 3P09A 3MKFA 5A93A 5MC7A 3IWQA 1S4RA 2D01A 1LT0A 2V8FA 3KYEA 4MLLA 4ZRRA 1MKMA 1H3QA 4PMAA 1ESUA 2ZQ9A 4GW9A 3IF6C 4H6JB 4S2NA 4K0XA 4JXSA 2V1ZA 4IVIA 3IS2B 2HJ9C 5F1GA 3S7NA 1G28A 5FAPA 2FFFB 2WADA 3IBJA 3M6HA 4OPQA 4E3JA 1PYYA 4WZ5C 5A91A 2ZJ9A 3QP4A 4BENA 1CK3A 3TOIA 1JTGA 4MMNA 4UQIM 2RL3A 3G32A 3Q1FA 1GCEA 3ZYTA 3V67A 1ES2A 4LRYC 4GHIA 4GKUA 3VP1A 1GHIA 5DTSA 3A3EA 1LL5A 4BMWA 2Z6CA 4OLGA 2Y2OA 2A2LA 5GLBA 2V1BA 3WS5A 1SCWA 3R4KA 1W5DA 5FQMA 1HLUP 3CITA 2Y2QA 5HDCA 4II7A 2G7UA 4CPKA 1FR1A 1K57A 1XXMA 3A3FA 2J9OA 1L0FA 2HZ5A 4Q8IA 1K56A 5F6AA 3JVVA 5J4EA 3HL9A 5C5KA 3V5MA 2ZD8A 3IXBA 2PBYA 5DJTA 1YM1A 1NLZA 4S2LA 2JKRI 3GRJA 3ICYA 2HP9A 3CUEA 3HJIA 3T1QB 3UN7A 3GMWA 3UDIA 4EW7A 4DE0A 1OTDA 3BYDA 1JNUA 1VB6A 1SZVA 3BLMA 4KUOA 2EWWA 2WUQA 3IH9A 4R23A 3T4OA 3EWKA 4GJ4A 1F2KA 4HH2A 3Q81A 2HDRA 1XX2A 3HJKA 5EVIB 1CF0A 5HAPA 3OPRA 1K56D 1PW8A 4RA7A 3SS3A 5FATA 4WMCA 3OCNA 4PAUA 1K57C 2Y8HA 3FC7A 4X1LA 5K5BA 4PPRA 4F94A 4NXFA 5DFYA 3VP0A 5KZHA 1EW0A 2HP6A 2EX9A 4L9EA 3ZG5A 4HH3A 1J3WA 1IYQA 5A90A 3PHYA 1S4SA 1XGIA 4ID4A 4BJPA 1MWRA 3EGDC 4JKTA 2BTFP 3SOIA 5FQIA 2R78A 4WBGA 4DN0A 2XEPA 5GHYA 2J3TC 3AGDA 3BW6A 1GSWA 3MBZA 4Y7PA 4GD6A 3U2AA 3HLGA 2A24B 4IHQA 5DTTA 4BWIA 3UY6A 1AWIA 4WMCD 1IFQA 5CHMA 2UV0E 4DRTA 3PAEA 3O87A 5L8MA 1LL8A 1WE4A 5EPHA 4EU0A 4E3OA 2XK1A 3C5AA 4HJ3A 1OPXA 1QMEA 1KGEA 3LIFA 4DJ2A 2XF3A 4GNUA 4OQIA 1OTEA 5FQ9A 1OJGA 2X71A 1LI0A 5CTMA 3EOIA 4NXBA 1VEUB 5F1FA 1ES4A 3IWIA 1ONHA 2ZM2A 3LCEA 1K55A 4B9OA 2W27A 4B4ZA 2Z2LB 4EERA 4FTXA 1TEMA 1M40A 2HGVA 5TFQA 4NK3A 2O9AA 5LBRA 2Y2MA 1DJBA 4GS9B 3QNBA 1CEFA 2BLSA 3UE3A 4P85A 3BFEA 5IT5A 3K3DA 2M1CA 3UE0A 2EFUA 3E0YA 4E3IA 4H6JA 1FSYA 3DTKA 4KZ4A 3NDGA 3W4QA 3DWZA 4R4SA 3IHBA 4QU3A 3IF6B 2EXBA 4WLAA 3IS2A 4WEKA 2YKFA 4HJ4A 4CLCC 1YLYA 4ETXA 3F1NB 3DTMA 2XSSA 4R4RA 4OVDA 3EEHA 4S2IA 1BLPA 3AGEA 3EQUA 3MF0A 1DY6A 4M3KA 2HDSA 3OC2A 1VM1A 4I38A 4Y0OA 3MS6A 5DKKA 1TVFA 1ESIA 3T4TA 2Y2GA 4HI4A 3IX4A 4KG5A 2PD8A 4X56A 4UQIS 3V3SA 1XFQA 1DP6A 3A3DA 4HQAA 3N7WA 1Q2PA 2P9VB 3Q07A 4IBRA 2QJ7A 4C75A 4I3JA 4JGRA 1Y4OA 5FI6A 4GLQA 2WKEA 2W1TA 1CI8A 2HJEA 4JGOA 4L9GA 2EX6A 2E8IA 3PBRA 4UEYA 3NOUC 3BY9A 1NWZA 3F1PA 2ZC5B 4YWZA 3KYZA 4IBXA 1YLTA 1BLHA 2XFTA 3UB8A 2HV1A 3D72A 4EWFA 2WZXA 1MWTA 5L2FA 1PZPA 2W3DA 5HFOA 4LENA 4Y3IA 4C6YA 5BOHA 3WS2A 1ACFA 4LRZE 5KSHA 3E4PA 1PI5A 3CMZA 4N92A 1V9YA 2BASA 3ZGAB 4KQDA 3UB7A 2PYRA 1YAXA 4GHIB 2OLUA 2BG1A 3O86A 5EVIA 2JKRM 5IHVA 2PAVP 5AVEA 2HF6A 4LLOB 1H8MA 3PBOA 2DNSA 1BTLA 4K08A 1YQSA 3A3IA 1W8YA 2P04A 2WGIA 3ZNTA 3QHYA 3LI9A 4IUHA 4NG2A 1IOUA 4X69A 2Y4AA 4Y15A 2ZC4B 3FYZA 3U4LP 3VOLA 5EVID 3Q7ZA 2V0UA 1U60A 3JVUA 2B02A 4A5RA 2A24A 4NEED 3MFDA 2XDMA 1KGFA 4OOLA 1CJFA 5AVFA 3UDFA 4MN6A 5HPFA 1K0KA 4X1MA 4DJ3A 3OLOA 4WF0A 1OTAA 1YPRA 4KENB 5CGSA 3UB6A 3KSFA 4WEJA 2ZL1B 1H8ZA 4GDBA 5U47A 3UMDA 3A0SA 1TS0A 4GZBA 4MNRA 3T4JA 3RJUA 3MR0A 5E43A 1PFLA 1VEUA 5E2EA 4EBNA 2XRNA 4KQOA 4P0MA 1DP8A 5I94A 3T50A 3PXPA 3LIBA 1MWSA 3CHWP 2W3FA 1PRQA 3TE8A 1I2WA 1KVMA 4I3AA 5EOEA 1YMXA 2XQZA 1ERMA 4EUVA 3UPOA 1XFNA 2O99A 4GS9A 3OZHA 2VV6A 3WRZA 4FD8A 4FCFA 2NUTC 5GL9A 5FAOA 3ZG0A 3LEZA 2I9VA 4MBKA 5HW3A 3LIDA 2VA0A 4QY6A 1I5QA 4OLDA 4PM8A 3IF6A 3OOVA 3TSGA 4R3JA 4EUZA 2ZLYA 1TD5A 4S2JA 3BEBA 3HUOA 2INWA 4E6XA 4CLCB 2VGKA 2FFYA 3CWFA 4JXGA 3K3CA 4DXCA 2AVXA 4DE3A 1IYPA 1D1JA 4WZ5A 5FDSA 1ERQA 1GA9A 4MBHA 2VV7A 4HY8A 5J8XA 3MXRA 3UE6A 5HD5A 2P74A 1XA7A 2P9VA 2GDNA 5EFWA 5DF8A 1NJ4A 2K7SA 3PR6A 3UB5P 5HAIA 4S2MA 2JHEA 4G3VA 4OQHA 1N9NA 1FR6A 5HL6A 1D7EA 3AGFA 2GNXA 1Y54A 5M18A 4KQRA 2IWBA 4MN7A 3OCLA 4WZ4A 3S4XA 4RVAA 4KQQA 4P6ZM 2I72A 1BLSA 5DF9A 1T1CA 3BQ8A 1OTBA 3NBLA 1H0MA 3OPLA 3VFFA 3IXGA 3VOZA 4E3NA 2PU4A 2PRFA 4LV3A 2PDRA 1P0ZA 1L0DA 3TG9A 2Y55A 1S0WA 4HNBA 5CRFA 1ONGA 1KGGA 2JN7A 3N8RA 3DTIA 2B5RA 3S7OA 5HZHA 3S1YA 3LR4A 5E2HA 4L0LA 4PM6A 1G6AA 2O9CA 3V39A 4X55A 5FSRA 1FILA 4I3IA 5FDHA 1LSVA 4CJNA 5CTNA 4Q0IA 3EGXC 3P7NA 5DTKA 3GVBA 2Y2NA 2W1TB 4Z9QA 4HP4A 3ZG8B 4EESA 3F1PB 2IA2A 2ZM8A 3G31A 1DP9A 2JC7A 3ZNYA 5A92A 4KZ8A 2ZC6B 3IBRA 1NZUA 5J3WA 2QPNA 2LB9A 4BLMA 5A8BA 2G2WA 1K38A 4LV2A 3C4OA 5HWTA 3LIAA 3BFGA 3IX8A 4HP9A 3M2KA 3NOTC 4KG6A 1N9LA 3HLWA 2KOIA 3VSKA 4WYYA 2ZC7A 3E2LA 1O7EA 2ZL1A 1Y28A 4R38A 5FI2A 3VP4A 3KO6A 3QP8A 2VGLM 3MKEA 4IUKA 4QHCA 3V50A 3RXWA 5E2FA 3ZQ5A 1YT4A 2B18A 2J3TD 2ZC3B 3LICA 2XA7S 2EA9A 2ZMAA 3P98A 3ZFZA 4K0WA 3CI6A 5AQBA 1BSGA 2K31A 1PNEA 3G6OA 4KZ5A 4GB7A 4LRXC 4AFIA 1GSVA 2KX6A 4PM5A 4NXGA 5DVAA 3VOYA 2O9BA 1STZA 2H10A 2VX8A 4JLFA 4OPZA 4F3LB 1H5XA 1HZOA 5HAQA 4LGWA 1KE0A 2D02A 1K54A 1RGYA 1FCNA 2Y59A 1K25A 4S2OA 2ZOHA 3MJQA 4ARZA 3KSHA 5FQQA 3HLFA 3GQZA 5CECA 2W3EA 3VE4A 2Q9MA 4CLCA 3RFBA 3UPPA 1MBLA 2ZMFA 4KZBA 3MSHA 1DJCA 4X6TA
chains in the Genus database with same CATH topology
2BASA 3BY8A 4KQDA 3R7WA 3UB7A 3VE3A 2PYRA 1S1YA 2QWSA 4HOIA 5G4YA 1X0OA 1YAXA 4MN5A 1V9ZA 4GHIB 3C8CA 4ETZA 1OTIA 5TJJA 3S7QA 3UMEA 2JKRM 4MCWA 1D06A 4Z1WA 5KIZA 5AVEA 2HF6A 4LLOB 1H8MA 3PBOA 4Y5FA 3A0VA 4K08A 3F1NA 3T4LA 4I5SA 4CLCD 3B42A 5I5LA 2P04A 2L1MA 1OT6A 4HIAA 3LUQA 3T4SA 2W0NA 3PBTA 4WL9A 3LI9A 4IUHA 3EEAA 3T4QA 1DRMA 1IOUA 1UWNX 2ZOIA 3F1OA 3GECA 4O8GA 2FZ0A 1G6OA 3E4QA 5CX7A 1N9OA 3VOLA 1KOUA 1F5MA 3RH8B 5MC7A 3FG8A 2V0UA 4P6ZS 3NHQA 2GJ3A 2JKTM 3JVUA 2B02A 5G4ZA 1S4RA 2A24A 1LT0A 2D01A 3PYPA 4NEED 4ZRRA 4BBUA 4PKYA 1MKMA 1H3QA 5HSQA 4OOLA 5AVFA 4MN6A 5HPFA 4GW9A 4DJ3A 4H6JB 3OLOA 4E04A 3LR5A 4WF0A 1OTAA 2OWJA 2OWHA 1W63Q 2OAP1 2M7UA 3UB6A 3KSFA 4WEJA 3W2ZA 2J3WA 3IS2B 2HJ9C 2Y79A 4I39A 4WUJA 3UMDA 3A0SA 1P9RA 3FPVA 1TS0A 3S7NA 1G28A 3CUEC 3T4JA 3H9WA 3MR0A 3IBJA 4G3WA 1F9IA 3TW8A 1F98A 1TS7A 4XT2A 2WKRA 2P7JA 2XRNA 4KQOA 1OJ5A 4YOFA 1DP8A 3MQQA 2W3HA 4BBVA 3E4OA 3T50A 4MMNA 3PXPA 1S67L 3LIBA 1XJ2A 3BWLA 3C38A 5F69A 1GSXA 1ODVA 2W3FA 4UQIM 3TE8A 4R70A 4I3AA 3ZYTA 3V67A 4GHIA 4LRYC 4EUVA 1ZHHB 1XFNA 2O99A 4GS9A 2VV6A 3C30A 4BMWA 2Z6CA 2NUTC 3CAXA 5HDDA 3PBQA 2A2LA 2VLGA 2V1BA 3R4KA 2I9VA 2W1RA 5AJGA 3FPWA 3CITA 5HDCA 3H7WB 3LIDA 4II7A 2V0WA 2G7UA 2VA0A 1MC0A 3KYQA 3OOVA 4G3KA 5HPIA 5J7EA 1TD5A 5TBMB 4WN5A 4HJ6A 4O0PA 4NKPA 5F6AA 2O0YA 3JVVA 5J4EA 5C5KA 2YKHA 2INWA 3NOPC 5DJTA 4CLCB 1NLZA 2JKRI 3KSIA 3CWFA 3ICYA 4Y2FA 3K3CA 3CUEA 3HJIA 3KX0X 4GCZA 2VGLS 3H82B 4EW7A 1OTDA 1JNUA 2VV7A 4FSFA 4HY8A 1VB6A 4ME4A 1TS6A 3BJNA 4KUOA 3B33A 3ULFA 2EWWA 2GX5A 2VV8A 3R7WB 3T4OA 3EWKA 4GJ4A 3MQOA 3UE6A 2MJ6A 4O01A 4PKYG 4HH2A 5HD5A 4CLCE 3HJKA 5EFWA 4PHTA 1MZUA 2QHKA 4F3LA 1LSXA 4EEPA 4Q0HA 3MMHA 2K7SA 3PR6A 2JKTI 3OCNA 2L0WA 4PAUA 1T18A 2JHEA 2Y8HA 5IU1A 3FC7A 2Z6DA 5K5BA 4G3VA 4NXFA 3LR3A 5DFYA 1N9NA 1EW0A 5HL6A 1D7EA 4QPRA 2L4RA 4L9EA 2GNXA 4HH3A 2W3GA 1P9WA 3PHYA 1S4SA 4MN7A 3OCLA 4BJPA 4Q0JA 3F1OB 3EGDC 3BQAA 4LPZA 2R78A 4DN0A 2QKPA 4P6ZM 1T1CA 2ZBBA 3BQ8A 1OTBA 2J3TC 3BW6A 5DF9A 2M7VA 1GSWA 1W63M 4EQ1A 3U2AA 2PDRA 4R3AA 2DMWA 3E98A 3HCYA 1P0ZA 2A24B 4IHQA 1S1ZA 3PBNA 4HNBA 2JN7A 3S7OA 4BWIA 5HZHA 3NJAA 3SW1A 1IFQA 2ZMVA 3MFXA 3LR4A 4L0LA 5L8MA 4KUKA 1LL8A 1WA9A 3O5YA 3MXQA 2O9CA 3KSGA 4I3IA 4JGPA 1LSVA 4EU0A 4Q0IA 4HJ3A 3EGXC 3P7NA 1OPXA 3LIFA 5HD3A 3RTYA 2PR6A 1TF1A 5F68A 4DJ2A 1LSWA 2FH5A 2W1TB 1OTEA 4HP4A 1OJGA 1TS8A 2LB5A 1YSQA 3EOIA 4EESA 4WELA 4NXBA 2V9AA 4ARZB 2OAQ1 4B9OA 2W27A 3F1PB 4EERA 3DBAA 2IA2A 3UB9A 1DP9A 3PBSA 2H28A 1BYWA 2HGVA 2VJWA 1VHMA 1UWPX 3IBRA 5DKLA 5J3WA 2O9AA 5LBRA 4DMZA 2LB9A 3LI8A 4GS9B 1YSPA 1NLYA 3UE3A 2KDKA 3A0RA 2J80A 4CQHA 5A8BA 4B93A 3B47A 3LFVA 5IT5A 3K3DA 2VKSA 2M1CA 2OOLA 5HWTA 3LIAA 2PHYA 4HP9A 3E0YA 3NOTC 3C2WA 4FOFA 1N9LA 4H6JA 3LYXA 2KOIA 2VZWA 3P01A 4MDZA 3CLOA 4EEUA 3GDIA 4R6LA 4WLAA 3IS2A 4WEKA 1Y28A 2EWVA 2GZAA 4R38A 2YKFA 4HJ4A 3EQVA 4RQ9A 4CLCC 3KO6A 4ETXA 4BBTA 3F1NB 4YNRA 2XSSA 3EEHA 2P08A 1T1AA 2VGLM 2QYBA 3EQUA 4IUKA 3MF0A 4OOMA 3LR0A 3OC2A 1T1BA 3ZQ5A 4I38A 2B18A 2J3TD 3LICA 2XA7S 2K2NA 2EA9A 5DKKA 4EETB 3CI6A 5HWVA 3TJZC 4EXOA 2K31A 3G6OA 3T4TA 4HI4A 3VV4A 4LRXC 4HHDA 4JGQA 4AFIA 2PD8A 1GSVA 4UQIS 1XFQA 2KX6A 3D3OA 1DP6A 4NXGA 3T4KA 4HQAA 2PT7A 3MQ0A 2O9BA 1STZA 2QJ5A 2VX8A 3OBFA 1P97A 2QJ7A 2PYPA 4I3JA 2WKQA 1XJ6A 2CMNA 2PR5A 5DFXA 4F3LB 4JGRA 4M4XA 5DJUA 1YKDA 1S66L 3LIEA 4GLQA 3H7WA 2D02A 2W1TA 1T19A 5F5YA 1ZTUA 2VEAA 1XJ3A 4IJGA 2HJEA 4JGOA 1NRJA 4L9GA 3PBRA 2ZOHA 2XA7M 3K2NA 3MJQA 4NXEA 4ARZA 4UEYA 3NOUC 3BY9A 2KLIA 1NWZA 3F1PA 1UGUA 3KSHA 5TBMA 4YWZA 3KYZA 2NUPC 2XROA 5HDSA 3UB8A 2W3EA 2HV1A 3D72A 1OT9A 3TRCA 3VE4A 4L9FA 5FL3A 4CLCA 2WKPA 2PD7A 3RFBA 1XJ4A 2ZMFA 2V1AA 2W3DA 4XT2B 5HWWA 3H82A 4Y3IA 4LRZE 5KSHA 3E4PA 5IS1A 3S7PA 1V9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YAX A;  3BQA A;  3BQ8 A;  4UEY A; 
#chains in the Genus database with same CATH topology
 4KZ6 A;  1IEM A;  1X0O A;  4ETZ A;  3VP3 A;  5TJJ A;  3QP6 A;  2OV5 A;  2A49 A;  4QJG A;  3NC8 A;  3G2Z A;  2WK0 A;  1K54 C;  3A0V A;  5CED A;  4CLC D;  3B42 A;  1HTZ A;  2L1M A;  1OT6 A;  4KZ3 A;  3NIA A;  4Y0T A;  3ITB A;  3LUQ A;  4XUX A;  2W0N A;  3T4S A;  3PBT A;  4EBP A;  4BL3 A;  1L2S A;  3T4Q A;  1DRM A;  1UWN X;  3GEC A;  4O8G A;  4JPM A;  4P87 A;  3E4Q A;  4E3M A;  3S22 A;  1N9O A;  3RH8 B;  3UDX A;  2X01 A;  3FG8 A;  4P6Z S;  3NHQ A;  2GJ3 A;  4OPY A;  3RXX A;  5G4Z A;  3PYP A;  4N1X A;  4BBU A;  4PKY A;  1PZO A;  4MBF A;  1BZA A;  5AQA A;  2R9X A;  3QP5 A;  1JWZ A;  1WYB A;  3NUL A;  1XPB A;  4E04 A;  3FZC A;  2OWJ A;  2OWH A;  1NXY A;  5EEC A;  1W63 Q;  2OAP 1;  5FAS A;  3HLB A;  3W8K A;  3CJM A;  3W2Z A;  1K6R A;  3BFD A;  4WUJ A;  3LO7 A;  3H9W A;  3IH8 A;  3G2Y A;  4G3W A;  4EBL A;  1TS7 A;  5FQJ A;  4HES A;  2P7J A;  4GD8 A;  1OJ5 A;  4YOF A;  3E4O A;  4ZJ2 A;  1S67 L;  2EFX A;  4X25 A;  5F69 A;  5GLC A;  3T1S A;  4R70 A;  3W4P A;  3DWK A;  1E3U A;  3UE1 A;  2XR0 A;  3CAX A;  3ISG A;  3PBQ A;  2VLG A;  2XGN A;  5AJG A;  2W1R A;  4R1G A;  4IVK A;  5EUA A;  3H7W B;  1TDL A;  2VGJ A;  3G35 A;  3WS1 A;  2V0W A;  4RX2 A;  5TBM B;  4HJ6 A;  4O0P A;  3IF5 A;  3IT9 A;  3NOP C;  3WRT A;  2IWC A;  3KSI A;  4DDY A;  1E3U D;  1SDN A;  4X68 A;  2IWD A;  2VGL S;  2WYX A;  4EQI A;  2OLV A;  5EM1 A;  5CGX A;  5CHJ A;  1W8Q A;  4HBT A;  4B4X A;  1VET A;  2WKH A;  1PW1 A;  3ULF A;  4UA6 A;  2RCX A;  2VV8 A;  3R7W B;  2MJ6 A;  4O01 A;  4PKY G;  3O3V A;  1CEG A;  2QHK A;  5EV0 A;  2CC1 A;  3DW0 A;  4O7D A;  4F3L A;  1IKG A;  2ZQ7 A;  3QNC A;  1ES3 A;  4S2P A;  4Q0H A;  1ZG6 A;  1JVJ A;  1E25 A;  1ZC2 A;  2JKT I;  2L0W A;  1T18 A;  5IU1 A;  4E3K A;  2Z6D A;  4U0T A;  2QMI A;  4QD4 A;  1KDS A;  2L4R A;  5FEF A;  3OPH A;  2W3G A;  3UPN A;  3FWL A;  1P9W A;  1ZG4 A;  3SS4 A;  2C5W B;  2JE5 A;  3T12 B;  3Q7V A;  1IYS A;  5EVL A;  4DXB A;  4LCL A;  1MPL A;  1NY0 A;  3D4F A;  4Q0J A;  3UNW A;  3BQA A;  4LPZ A;  5HAR A;  2QKP A;  2UWX A;  2ZBB A;  4PM7 A;  4R3A A;  2DMW A;  4U0X A;  3ZCZ A;  2VK3 A;  3ZVT A;  1S1Z A;  5G18 A;  4HBU A;  2Q0O A;  3NJA A;  4OH0 A;  3SW1 A;  2ZQC A;  4KUK A;  1BUE A;  1WA9 A;  4UAA A;  5FA7 A;  4JGP A;  1J9M A;  3ZG9 B;  3RTY A;  1G5U A;  2PR6 A;  1LSW A;  4FH2 A;  1TS8 A;  3T1X A;  3HUN A;  2LB5 A;  1L0G A;  2H0T A;  1YSQ A;  2J8Y A;  3HUM A;  4WEL A;  2V9A A;  4ARZ B;  2PBD P;  1KVL A;  2OAQ 1;  1S6R A;  3DBA A;  3NEC A;  4QB8 A;  4JXW A;  3UB9 A;  1MXO A;  1I2S A;  3PBS A;  2H28 A;  1BYW A;  1VHM A;  1UWP X;  2XH9 A;  2Z2M B;  5DKL A;  4DMZ A;  3MZF A;  1YSP A;  1NLY A;  1LI9 A;  4LCM A;  3A0R A;  1CQA A;  2J80 A;  3C7U A;  4B93 A;  5D3O A;  2OOL A;  5KSC A;  3B3X A;  2PHY A;  2A3U A;  1FOF A;  4U3T A;  3C2W A;  3DTE A;  2Y2I A;  3O88 A;  2VZW A;  3P01 A;  4MDZ A;  3SS5 A;  4UA7 A;  4N9K A;  3CLO A;  4EEU A;  4Y13 A;  4R6L A;  4WM9 A;  3IXH A;  2EWV A;  2GZA A;  2Q9N A;  2ZQ8 A;  1PWD A;  4YNR A;  4EV4 A;  4PM9 A;  1T1A A;  5JYP A;  2QYB A;  3N4I A;  4KZ9 A;  4ZJ1 A;  3HBR A;  1FCM A;  2G2U A;  4ZTK A;  3LR0 A;  1T1B A;  3V3R A;  2JBF A;  2K2N A;  4D2O A;  3G34 A;  3TJZ C;  1W79 A;  5M1A A;  3W4O A;  1FSW A;  3VV4 A;  4OQG A;  3BLS A;  1NRF A;  1Q2Q A;  2QZ6 A;  3D3O A;  4RYE A;  3T4K A;  2PT7 A;  1BT5 A;  2QJ5 A;  1YLJ A;  3OBF A;  1RCJ A;  1P97 A;  2R9W A;  3VSL A;  2J7V A;  2PYP A;  4N1H A;  3C4P A;  1XJ6 A;  1ALQ A;  2PR5 A;  3LGO A;  4NET A;  3SH9 A;  3LIE A;  1S66 L;  1PWG A;  4OP5 A;  5L10 A;  3H7W A;  1T19 A;  1YLP A;  2VEA A;  1XJ3 A;  1N9B A;  2WGW A;  1IYO A;  3N6I A;  1NRJ A;  4QWO A;  3HRE A;  1UGU A;  5TBM A;  1PWC A;  2XRO A;  5HL1 A;  3TRC A;  2Y91 A;  5FL3 A;  2PD7 A;  1M6K A;  4ESP A;  3IQA A;  3BFC A;  4OKP A;  4FUW A;  3VMA A;  3HLC A;  3MXS A;  2V8C A;  4H8R A;  1KDW A;  1Z6F A;  3BY8 A;  1JWP A;  3R7W A;  3NI9 A;  4S2N C;  2QWS A;  4OQ0 A;  5G4Y A;  3PTE A;  4B88 A;  2Y2K A;  4MN5 A;  1V9Z A;  3C8C A;  2ZM0 A;  1QMF A;  4OP8 A;  4QY5 A;  3HLE A;  3S7Q A;  3UME A;  2WAE A;  4MCW A;  1D06 A;  1KE4 A;  1C3B A;  2ACG A;  1SKF A;  3C7V A;  3QP2 A;  1L0E A;  2XD1 A;  1H8Y A;  3IWO A;  4WL9 A;  4GN2 A;  3GSG A;  2ZOI A;  4OPR A;  3ZG7 B;  1YMS A;  3DAV A;  1CI9 A;  1TDG A;  4K91 A;  2JCH A;  5FQK A;  2JKT M;  1VET B;  5HSQ A;  3LR5 A;  5EOO A;  5FI7 A;  4ZAM A;  2Y2H A;  2WZZ A;  3VP2 A;  2M7U A;  3CPT B;  2J3W A;  2Y79 A;  4I39 A;  3SZT A;  1P9R A;  5L07 A;  3FPV A;  3CUE C;  1W7F A;  3D9Y A;  5CER A;  1F9I A;  3LY4 A;  1F98 A;  3TW8 A;  4XT2 A;  2WKR A;  4R0Q A;  3I7J A;  3MQQ A;  2W3H A;  4BBV A;  5CHU A;  4KZA A;  1XJ2 A;  3BWL A;  3C38 A;  4JBF A;  3Q7V B;  2H5S A;  1GSX A;  1ODV A;  1HVB A;  1RGZ A;  1ZHH B;  1XGJ A;  1RP5 A;  1LLB A;  3C30 A;  3HLD A;  5HDD A;  1BLC A;  5AQ9 A;  1SKO B;  1IEL A;  5FEG A;  3M2J A;  1E4D A;  3FPW A;  4OON A;  5GLD A;  5KMW A;  4IED A;  1MY8 A;  1NZO A;  4BD0 A;  1MC0 A;  3KYQ A;  4G3K A;  5HPI A;  1Z09 A;  3BEC A;  5J7E A;  5F83 A;  4WN5 A;  4MEZ A;  4NKP A;  2O0Y A;  3LY3 A;  2WAF A;  2YKH A;  5HX9 A;  4DF6 A;  4Y2F A;  4BD1 A;  3KX0 X;  4GCZ A;  5GHZ A;  4DE1 A;  3H82 B;  4E3L A;  4S2K A;  4FSF A;  4ME4 A;  1TS6 A;  3BJN A;  4P6B A;  3B33 A;  1K6S A;  2GX5 A;  2Y2J A;  3BM6 A;  3MQO A;  5JYO A;  4CLC E;  3HVF A;  3IHA A;  4PHT A;  3SH8 A;  1MZU A;  1JWV A;  1LSX A;  3QP1 A;  4EEP A;  1MWU A;  3MMH A;  2JKG A;  3MZE A;  3ZDJ A;  1NYY A;  2PU2 A;  1K55 C;  3LR3 A;  4QPR A;  1FIK A;  4Y17 A;  3FV7 A;  3T1R A;  1GA0 A;  4GDN A;  3JPU A;  4OOY A;  3F1O B;  3GR2 A;  2J9P A;  2HP5 A;  4UA9 A;  2DCF A;  3L9K A;  4KG2 A;  2DRW A;  1O07 A;  2M7V A;  1W63 M;  1BUL A;  3ITA A;  2ZQD A;  4EQ1 A;  2B95 A;  2HDQ A;  3E98 A;  3HCY A;  3WWX A;  1XP4 A;  4JF5 A;  3SH7 A;  3PBN A;  4LFU A;  3ZVW A;  2ZMV A;  3MFX A;  4FH4 A;  4ZDX A;  3O5Y A;  1HD8 A;  3MXQ A;  2C6W B;  3KSG A;  4JF6 A;  5TR7 A;  5EVE A;  1OME A;  3BRM A;  3OPP A;  5E2G A;  4GOG A;  5EE8 A;  4JXV A;  1VQQ A;  5HD3 A;  4HEF A;  1XA1 A;  1TF1 A;  5F68 A;  2FH5 A;  2WGW B;  2EX8 A;  3PAG A;  3MZD A;  1PI4 A;  3IXD A;  5AQ7 A;  1GHP A;  3E2K A;  1AXB A;  1XKZ A;  4DDS A;  2VJW A;  3Q82 A;  3LI8 A;  3WS0 A;  3WS4 A;  1L3L A;  1MKI A;  1SHV A;  2KDK A;  4XUZ A;  1EI5 A;  4CQH A;  3B47 A;  3LFV A;  4D60 A;  2VKS A;  4N9L A;  3G4P A;  4ZBE A;  2EX2 A;  4FOF A;  3LYX A;  2E8J A;  3LEQ A;  3GDI A;  3CPT A;  3N8S A;  1YLZ A;  3NDE A;  3EQV A;  4RQ9 A;  5M19 A;  4BL2 A;  4BBT A;  1FQG A;  2V2F F;  1N4O A;  2Y2P A;  5CXW A;  2P08 A;  3L7H A;  4YFM A;  3ZHH A;  5TGF A;  4RX3 A;  1DJA A;  2EXA A;  1LHY A;  4OOM A;  3VFH A;  1YLW A;  1PIO A;  1GHM A;  4JF4 A;  4EET B;  4X53 A;  5HWV A;  4EXO A;  3BFF A;  4DE2 A;  4HHD A;  4JGQ A;  1EWZ A;  5EVI C;  2Y2L A;  3FKW A;  3UO9 A;  3MQ0 A;  3N8L A;  4LV0 A;  5L09 A;  1G68 A;  2OSU A;  4KZ7 A;  1SKO A;  5CGW A;  5GHX A;  2JKF A;  2WKQ A;  2H0Y A;  2CMN A;  4UHU A;  5DFX A;  4M4X A;  5DJU A;  1YKD A;  1IKI A;  5F5Y A;  1ZTU A;  4IJG A;  5DF7 A;  3JYI A;  4YIN A;  2XA7 M;  2HPB A;  3K2N A;  4NXE A;  2KLI A;  2NUP C;  1JTD A;  1K4F A;  5HDS A;  1OT9 A;  2X02 A;  1ZKJ A;  4L9F A;  2WKP A;  1XJ4 A;  1KE3 A;  2V1A A;  3NCK A;  4E6W A;  4XT2 B;  5HWW A;  3H82 A;  4BQM A;  2HDU A;  4C3Q A;  5IS1 A;  3S7P A;  1ERO A;  1FCO A;  4Y0U A;  5GLA A;  3VE3 A;  1S1Y A;  4HOI A;  2XLN A;  5F82 A;  2XD5 A;  2XFS A;  3M6B A;  1OTI A;  3IX3 A;  3FKV A;  5CEB A;  1WYC A;  1SDE A;  1LL9 A;  3G30 A;  4Z1W A;  4DKI A;  5KIZ A;  4Y5F A;  3F1N A;  3T4L A;  4I5S A;  1K4E A;  3CZD A;  1A0K A;  4XXR A;  5I5L A;  1NYM A;  3CG5 A;  2WKI A;  1ES5 A;  4HIA A;  4LV1 A;  2WGV A;  3A3J A;  3NY4 A;  3GV9 A;  3EEA A;  5FAQ A;  3F1O A;  2ZQA A;  4ZJ3 A;  2FZ0 A;  3GTC A;  1G6O A;  4R3B A;  2V20 A;  5EM0 A;  5CX7 A;  1KOU A;  1F5M A;  3P09 A;  3MKF A;  5A93 A;  5MC7 A;  3IWQ A;  1S4R A;  2D01 A;  1LT0 A;  2V8F A;  3KYE A;  4MLL A;  4ZRR A;  1MKM A;  1H3Q A;  4PMA A;  1ESU A;  2ZQ9 A;  4GW9 A;  3IF6 C;  4H6J B;  4S2N A;  4K0X A;  4JXS A;  2V1Z A;  4IVI A;  3IS2 B;  2HJ9 C;  5F1G A;  3S7N A;  1G28 A;  5FAP A;  2FFF B;  2WAD A;  3IBJ A;  3M6H A;  4OPQ A;  4E3J A;  1PYY A;  4WZ5 C;  5A91 A;  2ZJ9 A;  3QP4 A;  4BEN A;  1CK3 A;  3TOI A;  1JTG A;  4MMN A;  4UQI M;  2RL3 A;  3G32 A;  3Q1F A;  1GCE A;  3ZYT A;  3V67 A;  1ES2 A;  4LRY C;  4GHI A;  4GKU A;  3VP1 A;  1GHI A;  5DTS A;  3A3E A;  1LL5 A;  4BMW A;  2Z6C A;  4OLG A;  2Y2O A;  2A2L A;  5GLB A;  2V1B A;  3WS5 A;  1SCW A;  3R4K A;  1W5D A;  5FQM A;  1HLU P;  3CIT A;  2Y2Q A;  5HDC A;  4II7 A;  2G7U A;  4CPK A;  1FR1 A;  1K57 A;  1XXM A;  3A3F A;  2J9O A;  1L0F A;  2HZ5 A;  4Q8I A;  1K56 A;  5F6A A;  3JVV A;  5J4E A;  3HL9 A;  5C5K A;  3V5M A;  2ZD8 A;  3IXB A;  2PBY A;  5DJT A;  1YM1 A;  1NLZ A;  4S2L A;  2JKR I;  3GRJ A;  3ICY A;  2HP9 A;  3CUE A;  3HJI A;  3T1Q B;  3UN7 A;  3GMW A;  3UDI A;  4EW7 A;  4DE0 A;  1OTD A;  3BYD A;  1JNU A;  1VB6 A;  1SZV A;  3BLM A;  4KUO A;  2EWW A;  2WUQ A;  3IH9 A;  4R23 A;  3T4O A;  3EWK A;  4GJ4 A;  1F2K A;  4HH2 A;  3Q81 A;  2HDR A;  1XX2 A;  3HJK A;  5EVI B;  1CF0 A;  5HAP A;  3OPR A;  1K56 D;  1PW8 A;  4RA7 A;  3SS3 A;  5FAT A;  4WMC A;  3OCN A;  4PAU A;  1K57 C;  2Y8H A;  3FC7 A;  4X1L A;  5K5B A;  4PPR A;  4F94 A;  4NXF A;  5DFY A;  3VP0 A;  5KZH A;  1EW0 A;  2HP6 A;  2EX9 A;  4L9E A;  3ZG5 A;  4HH3 A;  1J3W A;  1IYQ A;  5A90 A;  3PHY A;  1S4S A;  1XGI A;  4ID4 A;  4BJP A;  1MWR A;  3EGD C;  4JKT A;  2BTF P;  3SOI A;  5FQI A;  2R78 A;  4WBG A;  4DN0 A;  2XEP A;  5GHY A;  2J3T C;  3AGD A;  3BW6 A;  1GSW A;  3MBZ A;  4Y7P A;  4GD6 A;  3U2A A;  3HLG A;  2A24 B;  4IHQ A;  5DTT A;  4BWI A;  3UY6 A;  1AWI A;  4WMC D;  1IFQ A;  5CHM A;  2UV0 E;  4DRT A;  3PAE A;  3O87 A;  5L8M A;  1LL8 A;  1WE4 A;  5EPH A;  4EU0 A;  4E3O A;  2XK1 A;  3C5A A;  4HJ3 A;  1OPX A;  1QME A;  1KGE A;  3LIF A;  4DJ2 A;  2XF3 A;  4GNU A;  4OQI A;  1OTE A;  5FQ9 A;  1OJG A;  2X71 A;  1LI0 A;  5CTM A;  3EOI A;  4NXB A;  1VEU B;  5F1F A;  1ES4 A;  3IWI A;  1ONH A;  2ZM2 A;  3LCE A;  1K55 A;  4B9O A;  2W27 A;  4B4Z A;  2Z2L B;  4EER A;  4FTX A;  1TEM A;  1M40 A;  2HGV A;  5TFQ A;  4NK3 A;  2O9A A;  5LBR A;  2Y2M A;  1DJB A;  4GS9 B;  3QNB A;  1CEF A;  2BLS A;  3UE3 A;  4P85 A;  3BFE A;  5IT5 A;  3K3D A;  2M1C A;  3UE0 A;  2EFU A;  3E0Y A;  4E3I A;  4H6J A;  1FSY A;  3DTK A;  4KZ4 A;  3NDG A;  3W4Q A;  3DWZ A;  4R4S A;  3IHB A;  4QU3 A;  3IF6 B;  2EXB A;  4WLA A;  3IS2 A;  4WEK A;  2YKF A;  4HJ4 A;  4CLC C;  1YLY A;  4ETX A;  3F1N B;  3DTM A;  2XSS A;  4R4R A;  4OVD A;  3EEH A;  4S2I A;  1BLP A;  3AGE A;  3EQU A;  3MF0 A;  1DY6 A;  4M3K A;  2HDS A;  3OC2 A;  1VM1 A;  4I38 A;  4Y0O A;  3MS6 A;  5DKK A;  1TVF A;  1ESI A;  3T4T A;  2Y2G A;  4HI4 A;  3IX4 A;  4KG5 A;  2PD8 A;  4X56 A;  4UQI S;  3V3S A;  1XFQ A;  1DP6 A;  3A3D A;  4HQA A;  3N7W A;  1Q2P A;  2P9V B;  3Q07 A;  4IBR A;  2QJ7 A;  4C75 A;  4I3J A;  4JGR A;  1Y4O A;  5FI6 A;  4GLQ A;  2WKE A;  2W1T A;  1CI8 A;  2HJE A;  4JGO A;  4L9G A;  2EX6 A;  2E8I A;  3PBR A;  4UEY A;  3NOU C;  3BY9 A;  1NWZ A;  3F1P A;  2ZC5 B;  4YWZ A;  3KYZ A;  4IBX A;  1YLT A;  1BLH A;  2XFT A;  3UB8 A;  2HV1 A;  3D72 A;  4EWF A;  2WZX A;  1MWT A;  5L2F A;  1PZP A;  2W3D A;  5HFO A;  4LEN A;  4Y3I A;  4C6Y A;  5BOH A;  3WS2 A;  1ACF A;  4LRZ E;  5KSH A;  3E4P A;  1PI5 A;  3CMZ A;  4N92 A;  1V9Y A;  2BAS A;  3ZGA B;  4KQD A;  3UB7 A;  2PYR A;  1YAX A;  4GHI B;  2OLU A;  2BG1 A;  3O86 A;  5EVI A;  2JKR M;  5IHV A;  2PAV P;  5AVE A;  2HF6 A;  4LLO B;  1H8M A;  3PBO A;  2DNS A;  1BTL A;  4K08 A;  1YQS A;  3A3I A;  1W8Y A;  2P04 A;  2WGI A;  3ZNT A;  3QHY A;  3LI9 A;  4IUH A;  4NG2 A;  1IOU A;  4X69 A;  2Y4A A;  4Y15 A;  2ZC4 B;  3FYZ A;  3U4L P;  3VOL A;  5EVI D;  3Q7Z A;  2V0U A;  1U60 A;  3JVU A;  2B02 A;  4A5R A;  2A24 A;  4NEE D;  3MFD A;  2XDM A;  1KGF A;  4OOL A;  1CJF A;  5AVF A;  3UDF A;  4MN6 A;  5HPF A;  1K0K A;  4X1M A;  4DJ3 A;  3OLO A;  4WF0 A;  1OTA A;  1YPR A;  4KEN B;  5CGS A;  3UB6 A;  3KSF A;  4WEJ A;  2ZL1 B;  1H8Z A;  4GDB A;  5U47 A;  3UMD A;  3A0S A;  1TS0 A;  4GZB A;  4MNR A;  3T4J A;  3RJU A;  3MR0 A;  5E43 A;  1PFL A;  1VEU A;  5E2E A;  4EBN A;  2XRN A;  4KQO A;  4P0M A;  1DP8 A;  5I94 A;  3T50 A;  3PXP A;  3LIB A;  1MWS A;  3CHW P;  2W3F A;  1PRQ A;  3TE8 A;  1I2W A;  1KVM A;  4I3A A;  5EOE A;  1YMX A;  2XQZ A;  1ERM A;  4EUV A;  3UPO A;  1XFN A;  2O99 A;  4GS9 A;  3OZH A;  2VV6 A;  3WRZ A;  4FD8 A;  4FCF A;  2NUT C;  5GL9 A;  5FAO A;  3ZG0 A;  3LEZ A;  2I9V A;  4MBK A;  5HW3 A;  3LID A;  2VA0 A;  4QY6 A;  1I5Q A;  4OLD A;  4PM8 A;  3IF6 A;  3OOV A;  3TSG A;  4R3J A;  4EUZ A;  2ZLY A;  1TD5 A;  4S2J A;  3BEB A;  3HUO A;  2INW A;  4E6X A;  4CLC B;  2VGK A;  2FFY A;  3CWF A;  4JXG A;  3K3C A;  4DXC A;  2AVX A;  4DE3 A;  1IYP A;  1D1J A;  4WZ5 A;  5FDS A;  1ERQ A;  1GA9 A;  4MBH A;  2VV7 A;  4HY8 A;  5J8X A;  3MXR A;  3UE6 A;  5HD5 A;  2P74 A;  1XA7 A;  2P9V A;  2GDN A;  5EFW A;  5DF8 A;  1NJ4 A;  2K7S A;  3PR6 A;  3UB5 P;  5HAI A;  4S2M A;  2JHE A;  4G3V A;  4OQH A;  1N9N A;  1FR6 A;  5HL6 A;  1D7E A;  3AGF A;  2GNX A;  1Y54 A;  5M18 A;  4KQR A;  2IWB A;  4MN7 A;  3OCL A;  4WZ4 A;  3S4X A;  4RVA A;  4KQQ A;  4P6Z M;  2I72 A;  1BLS A;  5DF9 A;  1T1C A;  3BQ8 A;  1OTB A;  3NBL A;  1H0M A;  3OPL A;  3VFF A;  3IXG A;  3VOZ A;  4E3N A;  2PU4 A;  2PRF A;  4LV3 A;  2PDR A;  1P0Z A;  1L0D A;  3TG9 A;  2Y55 A;  1S0W A;  4HNB A;  5CRF A;  1ONG A;  1KGG A;  2JN7 A;  3N8R A;  3DTI A;  2B5R A;  3S7O A;  5HZH A;  3S1Y A;  3LR4 A;  5E2H A;  4L0L A;  4PM6 A;  1G6A A;  2O9C A;  3V39 A;  4X55 A;  5FSR A;  1FIL A;  4I3I A;  5FDH A;  1LSV A;  4CJN A;  5CTN A;  4Q0I A;  3EGX C;  3P7N A;  5DTK A;  3GVB A;  2Y2N A;  2W1T B;  4Z9Q A;  4HP4 A;  3ZG8 B;  4EES A;  3F1P B;  2IA2 A;  2ZM8 A;  3G31 A;  1DP9 A;  2JC7 A;  3ZNY A;  5A92 A;  4KZ8 A;  2ZC6 B;  3IBR A;  1NZU A;  5J3W A;  2QPN A;  2LB9 A;  4BLM A;  5A8B A;  2G2W A;  1K38 A;  4LV2 A;  3C4O A;  5HWT A;  3LIA A;  3BFG A;  3IX8 A;  4HP9 A;  3M2K A;  3NOT C;  4KG6 A;  1N9L A;  3HLW A;  2KOI A;  3VSK A;  4WYY A;  2ZC7 A;  3E2L A;  1O7E A;  2ZL1 A;  1Y28 A;  4R38 A;  5FI2 A;  3VP4 A;  3KO6 A;  3QP8 A;  2VGL M;  3MKE A;  4IUK A;  4QHC A;  3V50 A;  3RXW A;  5E2F A;  3ZQ5 A;  1YT4 A;  2B18 A;  2J3T D;  2ZC3 B;  3LIC A;  2XA7 S;  2EA9 A;  2ZMA A;  3P98 A;  3ZFZ A;  4K0W A;  3CI6 A;  5AQB A;  1BSG A;  2K31 A;  1PNE A;  3G6O A;  4KZ5 A;  4GB7 A;  4LRX C;  4AFI A;  1GSV A;  2KX6 A;  4PM5 A;  4NXG A;  5DVA A;  3VOY A;  2O9B A;  1STZ A;  2H10 A;  2VX8 A;  4JLF A;  4OPZ A;  4F3L B;  1H5X A;  1HZO A;  5HAQ A;  4LGW A;  1KE0 A;  2D02 A;  1K54 A;  1RGY A;  1FCN A;  2Y59 A;  1K25 A;  4S2O A;  2ZOH A;  3MJQ A;  4ARZ A;  3KSH A;  5FQQ A;  3HLF A;  3GQZ A;  5CEC A;  2W3E A;  3VE4 A;  2Q9M A;  4CLC A;  3RFB A;  3UPP A;  1MBL A;  2ZMF A;  4KZB A;  3MSH A;  1DJC A;  4X6T A; 
#chains in the Genus database with same CATH homology
 2BAS A;  3BY8 A;  4KQD A;  3R7W A;  3UB7 A;  3VE3 A;  2PYR A;  1S1Y A;  2QWS A;  4HOI A;  5G4Y A;  1X0O A;  1YAX A;  4MN5 A;  1V9Z A;  4GHI B;  3C8C A;  4ETZ A;  1OTI A;  5TJJ A;  3S7Q A;  3UME A;  2JKR M;  4MCW A;  1D06 A;  4Z1W A;  5KIZ A;  5AVE A;  2HF6 A;  4LLO B;  1H8M A;  3PBO A;  4Y5F A;  3A0V A;  4K08 A;  3F1N A;  3T4L A;  4I5S A;  4CLC D;  3B42 A;  5I5L A;  2P04 A;  2L1M A;  1OT6 A;  4HIA A;  3LUQ A;  3T4S A;  2W0N A;  3PBT A;  4WL9 A;  3LI9 A;  4IUH A;  3EEA A;  3T4Q A;  1DRM A;  1IOU A;  1UWN X;  2ZOI A;  3F1O A;  3GEC A;  4O8G A;  2FZ0 A;  1G6O A;  3E4Q A;  5CX7 A;  1N9O A;  3VOL A;  1KOU A;  1F5M A;  3RH8 B;  5MC7 A;  3FG8 A;  2V0U A;  4P6Z S;  3NHQ A;  2GJ3 A;  2JKT M;  3JVU A;  2B02 A;  5G4Z A;  1S4R A;  2A24 A;  1LT0 A;  2D01 A;  3PYP A;  4NEE D;  4ZRR A;  4BBU A;  4PKY A;  1MKM A;  1H3Q A;  5HSQ A;  4OOL A;  5AVF A;  4MN6 A;  5HPF A;  4GW9 A;  4DJ3 A;  4H6J B;  3OLO A;  4E04 A;  3LR5 A;  4WF0 A;  1OTA A;  2OWJ A;  2OWH A;  1W63 Q;  2OAP 1;  2M7U A;  3UB6 A;  3KSF A;  4WEJ A;  3W2Z A;  2J3W A;  3IS2 B;  2HJ9 C;  2Y79 A;  4I39 A;  4WUJ A;  3UMD A;  3A0S A;  1P9R A;  3FPV A;  1TS0 A;  3S7N A;  1G28 A;  3CUE C;  3T4J A;  3H9W A;  3MR0 A;  3IBJ A;  4G3W A;  1F9I A;  3TW8 A;  1F98 A;  1TS7 A;  4XT2 A;  2WKR A;  2P7J A;  2XRN A;  4KQO A;  1OJ5 A;  4YOF A;  1DP8 A;  3MQQ A;  2W3H A;  4BBV A;  3E4O A;  3T50 A;  4MMN A;  3PXP A;  1S67 L;  3LIB A;  1XJ2 A;  3BWL A;  3C38 A;  5F69 A;  1GSX A;  1ODV A;  2W3F A;  4UQI M;  3TE8 A;  4R70 A;  4I3A A;  3ZYT A;  3V67 A;  4GHI A;  4LRY C;  4EUV A;  1ZHH B;  1XFN A;  2O99 A;  4GS9 A;  2VV6 A;  3C30 A;  4BMW A;  2Z6C A;  2NUT C;  3CAX A;  5HDD A;  3PBQ A;  2A2L A;  2VLG A;  2V1B A;  3R4K A;  2I9V A;  2W1R A;  5AJG A;  3FPW A;  3CIT A;  5HDC A;  3H7W B;  3LID A;  4II7 A;  2V0W A;  2G7U A;  2VA0 A;  1MC0 A;  3KYQ A;  3OOV A;  4G3K A;  5HPI A;  5J7E A;  1TD5 A;  5TBM B;  4WN5 A;  4HJ6 A;  4O0P A;  4NKP A;  5F6A A;  2O0Y A;  3JVV A;  5J4E A;  5C5K A;  2YKH A;  2INW A;  3NOP C;  5DJT A;  4CLC B;  1NLZ A;  2JKR I;  3KSI A;  3CWF A;  3ICY A;  4Y2F A;  3K3C A;  3CUE A;  3HJI A;  3KX0 X;  4GCZ A;  2VGL S;  3H82 B;  4EW7 A;  1OTD A;  1JNU A;  2VV7 A;  4FSF A;  4HY8 A;  1VB6 A;  4ME4 A;  1TS6 A;  3BJN A;  4KUO A;  3B33 A;  3ULF A;  2EWW A;  2GX5 A;  2VV8 A;  3R7W B;  3T4O A;  3EWK A;  4GJ4 A;  3MQO A;  3UE6 A;  2MJ6 A;  4O01 A;  4PKY G;  4HH2 A;  5HD5 A;  4CLC E;  3HJK A;  5EFW A;  4PHT A;  1MZU A;  2QHK A;  4F3L A;  1LSX A;  4EEP A;  4Q0H A;  3MMH A;  2K7S A;  3PR6 A;  2JKT I;  3OCN A;  2L0W A;  4PAU A;  1T18 A;  2JHE A;  2Y8H A;  5IU1 A;  3FC7 A;  2Z6D A;  5K5B A;  4G3V A;  4NXF A;  3LR3 A;  5DFY A;  1N9N A;  1EW0 A;  5HL6 A;  1D7E A;  4QPR A;  2L4R A;  4L9E A;  2GNX A;  4HH3 A;  2W3G A;  1P9W A;  3PHY A;  1S4S A;  4MN7 A;  3OCL A;  4BJP A;  4Q0J A;  3F1O B;  3EGD C;  3BQA A;  4LPZ A;  2R78 A;  4DN0 A;  2QKP A;  4P6Z M;  1T1C A;  2ZBB A;  3BQ8 A;  1OTB A;  2J3T C;  3BW6 A;  5DF9 A;  2M7V A;  1GSW A;  1W63 M;  4EQ1 A;  3U2A A;  2PDR A;  4R3A A;  2DMW A;  3E98 A;  3HCY A;  1P0Z A;  2A24 B;  4IHQ A;  1S1Z A;  3PBN A;  4HNB A;  2JN7 A;  3S7O A;  4BWI A;  5HZH A;  3NJA A;  3SW1 A;  1IFQ A;  2ZMV A;  3MFX A;  3LR4 A;  4L0L A;  5L8M A;  4KUK A;  1LL8 A;  1WA9 A;  3O5Y A;  3MXQ A;  2O9C A;  3KSG A;  4I3I A;  4JGP A;  1LSV A;  4EU0 A;  4Q0I A;  4HJ3 A;  3EGX C;  3P7N A;  1OPX A;  3LIF A;  5HD3 A;  3RTY A;  2PR6 A;  1TF1 A;  5F68 A;  4DJ2 A;  1LSW A;  2FH5 A;  2W1T B;  1OTE A;  4HP4 A;  1OJG A;  1TS8 A;  2LB5 A;  1YSQ A;  3EOI A;  4EES A;  4WEL A;  4NXB A;  2V9A A;  4ARZ B;  2OAQ 1;  4B9O A;  2W27 A;  3F1P B;  4EER A;  3DBA A;  2IA2 A;  3UB9 A;  1DP9 A;  3PBS A;  2H28 A;  1BYW A;  2HGV A;  2VJW A;  1VHM A;  1UWP X;  3IBR A;  5DKL A;  5J3W A;  2O9A A;  5LBR A;  4DMZ A;  2LB9 A;  3LI8 A;  4GS9 B;  1YSP A;  1NLY A;  3UE3 A;  2KDK A;  3A0R A;  2J80 A;  4CQH A;  5A8B A;  4B93 A;  3B47 A;  3LFV A;  5IT5 A;  3K3D A;  2VKS A;  2M1C A;  2OOL A;  5HWT A;  3LIA A;  2PHY A;  4HP9 A;  3E0Y A;  3NOT C;  3C2W A;  4FOF A;  1N9L A;  4H6J A;  3LYX A;  2KOI A;  2VZW A;  3P01 A;  4MDZ A;  3CLO A;  4EEU A;  3GDI A;  4R6L A;  4WLA A;  3IS2 A;  4WEK A;  1Y28 A;  2EWV A;  2GZA A;  4R38 A;  2YKF A;  4HJ4 A;  3EQV A;  4RQ9 A;  4CLC C;  3KO6 A;  4ETX A;  4BBT A;  3F1N B;  4YNR A;  2XSS A;  3EEH A;  2P08 A;  1T1A A;  2VGL M;  2QYB A;  3EQU A;  4IUK A;  3MF0 A;  4OOM A;  3LR0 A;  3OC2 A;  1T1B A;  3ZQ5 A;  4I38 A;  2B18 A;  2J3T D;  3LIC A;  2XA7 S;  2K2N A;  2EA9 A;  5DKK A;  4EET B;  3CI6 A;  5HWV A;  3TJZ C;  4EXO A;  2K31 A;  3G6O A;  3T4T A;  4HI4 A;  3VV4 A;  4LRX C;  4HHD A;  4JGQ A;  4AFI A;  2PD8 A;  1GSV A;  4UQI S;  1XFQ A;  2KX6 A;  3D3O A;  1DP6 A;  4NXG A;  3T4K A;  4HQA A;  2PT7 A;  3MQ0 A;  2O9B A;  1STZ A;  2QJ5 A;  2VX8 A;  3OBF A;  1P97 A;  2QJ7 A;  2PYP A;  4I3J A;  2WKQ A;  1XJ6 A;  2CMN A;  2PR5 A;  5DFX A;  4F3L B;  4JGR A;  4M4X A;  5DJU A;  1YKD A;  1S66 L;  3LIE A;  4GLQ A;  3H7W A;  2D02 A;  2W1T A;  1T19 A;  5F5Y A;  1ZTU A;  2VEA A;  1XJ3 A;  4IJG A;  2HJE A;  4JGO A;  1NRJ A;  4L9G A;  3PBR A;  2ZOH A;  2XA7 M;  3K2N A;  3MJQ A;  4NXE A;  4ARZ A;  4UEY A;  3NOU C;  3BY9 A;  2KLI A;  1NWZ A;  3F1P A;  1UGU A;  3KSH A;  5TBM A;  4YWZ A;  3KYZ A;  2NUP C;  2XRO A;  5HDS A;  3UB8 A;  2W3E A;  2HV1 A;  3D72 A;  1OT9 A;  3TRC A;  3VE4 A;  4L9F A;  5FL3 A;  4CLC A;  2WKP A;  2PD7 A;  3RFB A;  1XJ4 A;  2ZMF A;  2V1A A;  2W3D A;  4XT2 B;  5HWW A;  3H82 A;  4Y3I A;  4LRZ E;  5KSH A;  3E4P A;  5IS1 A;  3S7P A;  1V9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...