3BQAA

Crystal structure of an e.coli phoq sensor domain mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
146
structure length
146
Chain Sequence
SFDKTTFRLLRGESNLFYTLAKWENNKLHVELPENIDKQSPTMTLIYDENGQLLWAQRDVPWLMKMIQPDWLKSNGFHEIEADVNDTSLLLSGDHSIQQQLQEVRQNNNNAQMTHSVAVNVYPATSRMPKLTIVVVDTIPVELKSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein phoQ
publication title Crystal Structure of a Functional Dimer of the PhoQ Sensor Domain.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein, transferase
total genus 35
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2007-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.140 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3bqaA00
3BQAA 3BQ8A 1YAXA 4UEYA
chains in the Genus database with same CATH superfamily
1GHIA 3HUMA 4R4RA 2BLSA 1OJ5A 3JPUA 3GV9A 4WMCD 2JC7A 2W1RA 3M6BA 1EW0A 4NXFA 4KZ4A 2WKPA 3SS4A 3D3OA 3LIFA 2V9AA 4R38A 5FEFA 5A91A 4HI4A 4WZ5C 3HREA 4HJ3A 4S2LA 4HNBA 3VSLA 3M2KA 3K2NA 2QYBA 1DJAA 5FATA 2WK0A 1NYMA 3OOVA 4OH0A 3T1XA 2EFUA 2M1CA 2PD8A 3GSGA 3LUQA 4GNUA 5FI6A 1H8ZA 4KQQA 4JLFA 2OLVA 2BG1A 3LIBA 4ZJ3A 1PWDA 2ZC3B 1ODVA 3SZTA 3T4OA 3LEZA 1NLYA 3BJNA 3EQVA 1O7EA 3UE0A 3Q81A 1JWZA 1XGIA 4IBRA 1UWPX 1NJ4A 4NKPA 2W1TA 1JTGA 1TD5A 1GHMA 2IWCA 3G30A 2PU4A 1T1AA 4XUXA 5LBRA 3NULA 4ETXA 3P7NA 3PBRA 3H7WA 2A24B 1YLPA 3PBTA 1ALQA 5HPIA 4EUZA 5HAPA 4P0MA 3IWOA 4Q0JA 3DTEA 4PKYG 5HSQA 2PDRA 4LPZA 4DDYA 3HVFA 3MXRA 2EX8A 2VV8A 4R3JA 2O9BA 1IEMA 4RQ9A 4IUHA 1S0WA 5K5BA 4GZBA 3PHYA 5JYPA 4JBFA 4PHTA 2ZQAA 1RGZA 1LHYA 1XJ3A 1PFLA 3V3SA 5EPHA 3KYEA 4GHIB 1GHPA 3N8RA 2Y91A 4Q0IA 3MR0A 4D2OA 3KYQA 5J3WA 4HY8A 3CG5A 2R9XA 4FCFA 3PBOA 1LL5A 4ZDXA 3OC2A 3RTYA 2KOIA 3O3VA 1CEFA 2H10A 2WKIA 2P04A 3ZQ5A 4JGOA 1XJ4A 3VMAA 4DE3A 4ARZB 1SZVA 3IBRA 3OPPA 1I2WA 1TEMA 3ZG7B 4UA6A 3H82B 3T50A 1U60A 4DN0A 3QNCA 1YLJA 1T1BA 4UAAA 5BOHA 3NECA 1K56A 1Y28A 4ME4A 1PYYA 5AVEA 3WS4A 3T4SA 4B4XA 1DY6A 3NHQA 5DF9A 3C38A 2HGVA 3W2ZA 4BL3A 3IX3A 3WS1A 1FQGA 4IUKA 5FA7A 5GHYA 2DCFA 3FC7A 2GZAA 4KZ9A 2WADA 2VGLS 4JGQA 2KLIA 1OTEA 2RL3A 2ZM2A 3KX0X 3BECA 2Z2MB 4KG2A 1YSQA 3LR3A 4LCLA 4CQHA 3R7WA 5EVIA 3CJMA 3BFDA 4ZJ2A 1T18A 4PM5A 2QWSA 2WKEA 3S7PA 5AQ7A 1WE4A 1MBLA 4HH2A 4BQMA 4R1GA 1L0EA 1TVFA 4N1XA 1EWZA 2Y2KA 4OQGA 4HP9A 4CLCD 1DJBA 5HD3A 5E2HA 4BD0A 1MC0A 1D1JA 2IA2A 2Y2IA 3PYPA 4GN2A 3VE4A 5A92A 2HDSA 1W8YA 4R3BA 4HBTA 4PAUA 4P85A 4KQOA 4E3LA 2EFXA 4LRZE 2V1ZA 5JYOA 3O88A 3BFEA 4X55A 1KVLA 4OPRA 3KSHA 3DWZA 3U2AA 2JBFA 3Q1FA 3T12B 4Y0UA 3V67A 4DE0A 4HP4A 3DTMA 4MN5A 5F6AA 4DJ2A 1LI0A 3EQUA 5A8BA 4UQIS 4GCZA 3LR4A 3T4KA 3DW0A 5F68A 4C75A 2K31A 1MWSA 3RH8B 3BFGA 4EBPA 4MBFA 1X0OA 5J4EA 2P9VA 1G28A 3IS2B 5EFWA 3ZG8B 3P09A 4MNRA 2LB5A 4WEJA 5EOEA 2ZQ7A 4KUOA 4LV1A 1PIOA 1SDEA 5FQ9A 2X71A 4IVKA 3W4OA 2RCXA 3LEQA 1T1CA 2CC1A 3IF6C 5C5KA 1L3LA 2V1AA 3C5AA 5A90A 1ES4A 3FZCA 5DFYA 5GLCA 1FCOA 3LIEA 2ZQCA 3RXWA 3NCKA 5F83A 4EW7A 5CX7A 5TJJA 1GA0A 5CTNA 4PM7A 2XFSA 1NZOA 3UNWA 5EVID 2V8FA 2YKFA 2XR0A 5EVEA 3BM6A 2A49A 4UEYA 3IHAA 1IOUA 2Z6CA 2V0UA 2WAEA 4R0QA 1H3QA 3G6OA 4ZBEA 1E3UA 1W79A 1K25A 3LIDA 1LSWA 4LFUA 2M7VA 1OTBA 3VOZA 4WF0A 3HLDA 2WKQA 2OLUA 1FR6A 4I5SA 2Y2PA 5GLDA 1S4SA 4FSFA 3PXPA 3DTKA 5CEDA 5J7EA 3CITA 2PT7A 5FL3A 2PR5A 3TE8A 4QWOA 4S2PA 1S66L 5G4YA 3IH9A 3T4LA 3N4IA 5CGWA 3S4XA 1F9IA 2W3GA 4B4ZA 3T4TA 4GDNA 3G2YA 3EGDC 2W1TB 1ERQA 3BW6A 3ZNTA 4IHQA 1K54C 4WUJA 4OP5A 3WRZA 4WMCA 5F5YA 2Y2GA 4B9OA 3H7WB 4CLCE 1FCNA 3OZHA 4NXGA 4IJGA 1BULA 2HF6A 3T4QA 4OPQA 3E98A 1TS7A 3QP6A 4AFIA 3ZDJA 3AGDA 2PBDP 2HJEA 3UY6A 2UV0E 5EECA 4MN6A 3RFBA 3F1NA 2WAFA 3L9KA 3WWXA 3E4QA 3G35A 4RYEA 5CHMA 2J9PA 2OWJA 1TF1A 1KGEA 2X01A 3UMDA 5FQKA 5HWVA 1MZUA 4JXSA 2QJ7A 3LR0A 3UB6A 2Z2LB 1Z6FA 1S6RA 3L7HA 4WZ5A 3GTCA 3EOIA 1TDGA 1E3UD 3HLFA 3WS0A 4GS9A 5HARA 1DP6A 1P0ZA 4O8GA 4EEPA 2Y59A 2KX6A 5FQQA 1K57A 5TBMA 3BFFA 5IT5A 1KVMA 2ZC6B 4JXWA 3VFHA 3D4FA 1S1YA 3UO9A 4H8RA 2Q9MA 3UPPA 3UB8A 3PBNA 4KG6A 1JNUA 1BSGA 2OV5A 1RGYA 2ZL1B 3GDIA 4G3VA 4M3KA 3LIAA 1ZC2A 4PM9A 1GCEA 2HJ9C 5TR7A 5F1FA 1L0GA 4FUWA 1N9NA 1ES2A 1YLTA 3DWKA 3LO7A 3JVUA 1PWCA 3QP5A 2XA7S 2WGIA 1L2SA 2K2NA 5HZHA 4LENA 5CGXA 1QMFA 2VV7A 1OT9A 4GJ4A 4QHCA 4IVIA 1J9MA 4KZAA 2Y2OA 2WGWA 3N7WA 4P6ZM 5L07A 4KZ5A 3UB5P 4XT2A 1ERMA 4G3WA 1ZHHB 4LLOB 2QKPA 1VETB 3NJAA 1XFNA 2GJ3A 1OTIA 5I5LA 1ACFA 3G4PA 4MEZA 3OCNA 3KO6A 4Z9QA 1IYOA 3T1SA 4B88A 1XA1A 4WLAA 3NOUC 3D72A 1G68A 2VLGA 1NY0A 4OPYA 2HP6A 5FI2A 3C8CA 3PBQA 1Z09A 1AWIA 1MPLA 1G6AA 3BQ8A 2V20A 3BRMA 3MXQA 4EBLA 3NI9A 1N4OA 3JYIA 3QP4A 4E3JA 3IX8A 3I7JA 3C7VA 4EERA 4ZAMA 3U4LP 4GW9A 2ZMFA 3HJKA 3E2LA 2O0YA 3TRCA 4WN5A 3JVVA 3P01A 3BY9A 3IWQA 3ITBA 3V50A 2W3DA 2HDUA 3LICA 3IF5A 2E8JA 3MFDA 3GMWA 4PM8A 3N8SA 2XROA 3IWIA 4ESPA 1KGFA 1PZOA 4GKUA 2P9VB 3KSGA 2NUTC 2VGLM 2QPNA 3H9WA 1XA7A 1G6OA 4XUZA 4CLCA 4H6JA 4WZ4A 2GNXA 1PW1A 1KE0A 3FKVA 2I9VA 1K4EA 2P74A 3ITAA 4NK3A 1SKFA 3B33A 4JGPA 1H0MA 4UHUA 4RX3A 4BJPA 3KSFA 4B93A 3IT9A 2FFFB 3NOTC 3Q7ZA 3ZG0A 5DTKA 3C4OA 1E25A 4GD6A 4JKTA 5KSHA 2VK3A 4L0LA 2VGJA 1V9ZA 1VEUA 2JKTM 1H8MA 4N92A 4U0XA 4OVDA 4GD8A 2WZXA 2V1BA 1KGGA 3D9YA 2EXAA 4C3QA 3ZYTA 2LB9A 1F2KA 1J3WA 4LRYC 5HDDA 3VP0A 3VE3A 4I3AA 1BLPA 3HCYA 5TFQA 1SKOA 3M2JA 5HD5A 1HTZA 3VOYA 2VV6A 4K91A 4E3IA 3SS5A 4KENB 4FH2A 1ESIA 1FILA 2JKRM 4KQRA 4ZRRA 4DE2A 1YLZA 1SHVA 2Y2JA 4Y15A 4G3KA 4OOYA 3LGOA 2OOLA 4QY5A 2X02A 1FOFA 4EQIA 5FQIA 1W5DA 2O9AA 5L10A 1P9RA 5HAQA 1ES3A 5HL1A 4EWFA 5A93A 3OCLA 1S67L 3CWFA 4MN7A 2B18A 1N9OA 2VEAA 4KQDA 1CI8A 4KG5A 1C3BA 4FOFA 5G18A 2EX2A 1E4DA 2W0NA 4WELA 3LYXA 1NZUA 2XK1A 5J8XA 3IF6A 1W7FA 1IELA 4S2MA 4UA9A 2WUQA 4CPKA 4HOIA 4I3JA 4HBUA 4K0XA 1P97A 3F1NB 2I72A 3VOLA 3UDFA 5HWWA 1JWPA 1XJ2A 2ZBBA 4BWIA 3UE3A 5DF8A 1OTAA 1ESUA 1S1ZA 3CPTB 3BY8A 4GOGA 1IFQA 3UB7A 1BYWA 3NDGA 1NXYA 4II7A 4M4XA 2Y2NA 5CHUA 3HUNA 1ONHA 5EM0A 4E6WA 1BLSA 2VX8A 3KSIA 4DKIA 4DXBA 4P87A 2EXBA 2H0YA 4ZJ1A 1OPXA 2W3EA 4DJ3A 2XEPA 2ACGA 1JTDA 2O99A 1FCMA 4S2NC 2ZQ8A 5FI7A 3N6IA 1NYYA 2B02A 3QP1A 4GDBA 1MWRA 3FPVA 2J9OA 4OOLA 5F69A 2XF3A 2J3TC 4S2JA 2WYXA 3Q07A 5EM1A 5L2FA 4OQIA 4CJNA 5AQAA 4N9LA 5FAOA 2PU2A 3EGXC 2PHYA 3EEAA 3A3EA 5M18A 3VFFA 1K54A 1VQQA 5GL9A 3LY3A 4EXOA 1CK3A 2CMNA 4HHDA 1Y54A 4OKPA 2M7UA 3UDIA 1YQSA 3IH8A 1XX2A 2WGWB 5FAQA 4U3TA 1PI5A 3LI9A 3HBRA 1L0DA 2Q9NA 4HH3A 4XT2B 3ZHHA 3ZCZA 1NLZA 3MZFA 2VKSA 4R23A 4JF5A 4YOFA 2INWA 1D7EA 5HWTA 2P08A 2ZQDA 4OLGA 4E3KA 2A3UA 1FSYA 2L4RA 3SH7A 1GSXA 1KE3A 2ZOIA 4E3NA 1N9BA 4EU0A 3QNBA 4ARZA 1Q2QA 2Q0OA 2W27A 4NETA 1ZTUA 3ISGA 3H82A 1K0KA 5KIZA 2HZ5A 1OJGA 1F5MA 2ZC5B 4GB7A 2EWVA 1NRJA 1DP9A 3ZVTA 1IYSA 1K55A 4EEUA 2H28A 3MKFA 5DFXA 1WYCA 3V5MA 1CI9A 1TS6A 3BQAA 3TW8A 2VA0A 4R6LA 1YMXA 4S2IA 1LL8A 1QMEA 3VV4A 5E43A 4X69A 3W4QA 3ZG5A 4NXBA 3FG8A 3F1OA 3O86A 1I5QA 3FPWA 5AQBA 3Q7VA 3HLCA 4OLDA 2PAVP 3GR2A 1FR1A 5FAPA 2HV1A 5CECA 2E8IA 2ZC4B 3UMEA 5FQJA 1EROA 2HP5A 4RX2A 2C6WB 1W8QA 3G32A 4DMZA 2W3FA 3IXDA 4WL9A 2J8YA 3A3JA 2J7VA 1IYPA 4CLCB 4H6JB 3C4PA 3PBSA 3BEBA 2WKRA 2MJ6A 2QHKA 1XP4A 3CAXA 4L9EA 4LV0A 1BT5A 3NBLA 4HESA 1O07A 5DJTA 4DRTA 4S2KA 4L9FA 5U47A 2L0WA 3MBZA 5AQ9A 2V2FF 5DJUA 5EVLA 3CMZA 4BENA 4EQ1A 4ID4A 4YINA 3DBAA 3TJZC 1VEUB 2Y79A 2Y2MA 5HW3A 1KE4A 3OLOA 1SCWA 3WS2A 3E0YA 5D3OA 4ZTKA 1RCJA 3ZFZA 2QZ6A 2B5RA 4HJ6A 3MFXA 4ETZA 1SKOB 5GLAA 1UGUA 1DP8A 5CXWA 5F1GA 2PYRA 4OOMA 2ZM8A 3O5YA 1CEGA 2H0TA 3MKEA 4PPRA 5KSCA 1NRFA 3QP8A 3T1QB 3FYZA 3SS3A 4I3IA 3VP1A 2Y2HA 4WM9A 4X1MA 2HDQA 4IBXA 3IXGA 1BZAA 5DKKA 1ZKJA 3NC8A 4LV2A 3GQZA 2R78A 2W3HA 1FSWA 5HL6A 4A5RA 3A0SA 5DVAA 5TGFA 4JGRA 2WKHA 3UPNA 5FASA 2YKHA 4WBGA 3P98A 3Q82A 3R7WB 1YAXA 1ZG4A 3VP4A 5EVIB 1YPRA 1MWUA 3S7QA 4BLMA 3NDEA 3VP2A 5GLBA 2Y4AA 3BFCA 3E2KA 3IX4A 4OPZA 3IF6B 5E2EA 5AJGA 3AGFA 1KOUA 4HJ4A 1GSVA 1PRQA 2EWWA 2JN7A 1N9LA 4Q8IA 4X68A 2XRNA 5CGSA 3W8KA 2PBYA 3K3DA 1FIKA 3BLMA 1K57C 3V3RA 3OPHA 1VB6A 5HAIA 4FTXA 2PYPA 3A3DA 1P9WA 4LCMA 4NG2A 4Y0TA 5HX9A 3S1YA 4MBHA 1K6RA 1G5UA 5KZHA 4C6YA 3A0VA 1LT0A 1LSVA 4OP8A 5DKLA 4U0TA 1XPBA 1PW8A 4HEFA 4OONA 4KUKA 2PR6A 4QY6A 3CUEC 1YSPA 1XFQA 3E4OA 4FD8A 3F1PA 2D02A 1PWGA 3C30A 1SDNA 4RVAA 1D06A 3HLBA 3SW1A 3ZNYA 1XGJA 2O9CA 3MQQA 2XFTA 5E2FA 4QB8A 2JKGA 3MXSA 2H5SA 2ZJ9A 4P6ZS 1VHMA 5EV0A 1ONGA 5HPFA 2IWDA 3GECA 3CHWP 3FWLA 1V9YA 1KDWA 3VP3A 4BD1A 1CQAA 4F3LA 4GLQA 2KDKA 2BTFP 1CJFA 4PM6A 3ZVWA 3B3XA 3NIAA 5FSRA 3HL9A 3CZDA 2G2UA 5L8MA 3NOPC 4D60A 2AVXA 1MXOA 2OSUA 1PI4A 3IXHA 4R4SA 3LCEA 2V8CA 3NY4A 1XXMA 5KMWA 2P7JA 5CERA 2Y2QA 4UQIM 1YM1A 2ZM0A 4OQHA 3MF0A 5G4ZA 3WS5A 2VGKA 2ZL1A 3UPOA 2PD7A 3CI6A 1EI5A 1L0FA 4DF6A 2NUPC 1OMEA 2ZMAA 1GA9A 2WZZA 5HDCA 1BUEA 2J80A 3CLOA 4WYYA 4S2NA 1IKGA 4NEED 2EX9A 3PTEA 5FDHA 1VM1A 4K0WA 3MQOA 4KZ8A 1H5XA 3LY4A 2G7UA 1MKMA 4CLCC 4JF6A 1HZOA 3F1OB 2OAP1 3RJUA 4JXVA 2HPBA 4MMNA 1VETA 3Q7VB 4RA7A 4EUVA 4FH4A 4N9KA 1T19A 4Y7PA 3SOIA 5EOOA 5M19A 2L1MA 1HLUP 4EETB 3MS6A 4L9GA 5IS1A 4KZ7A 1MKIA 3A0RA 4O0PA 4X56A 2ZQ9A 5EUAA 2FH5A 4YNRA 1IKIA 3LFVA 1XJ6A 1ZG6A 3UDXA 3ZGAB 3QP2A 4KZBA 4X6TA 4HIAA 4QD4A 3LR5A 2GDNA 2ZD8A 3C7UA 4MBKA 5FQMA 4Y3IA 3S7NA 1M6KA 1PZPA 5DF7A 1Y4OA 5DTTA 1JWVA 4GS9B 4Y5FA 4EBNA 1YT4A 5DTSA 5F82A 2GX5A 3MZEA 4WEKA 5TBMB 4KZ3A 1DRMA 1TS0A 2A24A 4YFMA 3GRJA 3IXBA 5HDSA 4O01A 4NXEA 5GHZA 3OBFA 3ULFA 3ZG9B 2DRWA 1S4RA 3B47A 1K56D 1LSXA 2XD1A 3BYDA 4QU3A 2ZC7A 3MQ0A 2JKTI 2JKFA 2ZLYA 1GSWA 1K38A 1STZA 2WGVA 1ES5A 5EVIC 3TOIA 4JXGA 3RXXA 3TSGA 5M1AA 2XLNA 4P6BA 4Q0HA 1RP5A 4KZ6A 1F98A 2XDMA 4GHIA 2K7SA 3DTIA 2VJWA 3HLEA 3T4JA 4OQ0A 4LRXC 2PRFA 2J3TD 1YLWA 3IBJA 3G34A 1TS8A 3EWKA 5CEBA 2JKRI 4K08A 5AVFA 1A0KA 1PNEA 3ICYA 4PKYA 1HD8A 4LGWA 4X1LA 3HUOA 1Q2PA 3FKWA 5MC7A 5EE8A 3S7OA 4BBVA 2XD5A 4MLLA 1NWZA 5IHVA 4E3OA 3E4PA 2JCHA 3MMHA 1MY8A 4PMAA 4X53A 4BMWA 4JPMA 1IYQA 2V0WA 4QPRA 3HLWA 3PAEA 3TG9A 3UB9A 3AGEA 1W63Q 4S2OA 4LV3A 2OWHA 4DDSA 4YWZA 3MJQA 3C2WA 3T1RA 3WRTA 2HDRA 5E2GA 3PAGA 3R4KA 2BASA 4F94A 3QHYA 4BL2A 3UE1A 4UA7A 5GHXA 3OPLA 4QJGA 4MCWA 2DMWA 4DE1A 3BLSA 2Y8HA 4BBUA 2HP9A 2DNSA 3A3IA 5FDSA 1LL9A 2XA7M 2C5WB 5FEGA 2XH9A 3N8LA 1I2SA 2R9WA 3F1PB 2ZOHA 1KDSA 2J3WA 3IHBA 3HJIA 3V39A 1CF0A 3PR6A 1AXBA 5CRFA 2XGNA 1TDLA 5HFOA 4Y13A 2QMIA 1UWNX 3VSKA 5I94A 2A2LA 3O87A 1LI9A 4E04A 4E6XA 1K4FA 3SH9A 3KYZA 1YKDA 3B42A 3LI8A 1BLCA 2XQZA 4HQAA 2D01A 4MDZA 4I38A 3M6HA 4O7DA 3UE6A 1BLHA 3MZDA 3IQAA 1OTDA 1OT6A 1XKZA 4F3LB 3CPTA 2EA9A 4Y0OA 2ZMVA 3EEHA 1MWTA 4I39A 3G2ZA 2FFYA 3W4PA 4N1HA 1H8YA 5L09A 1K55C 4E3MA 2QJ5A 1W63M 4EESA 1LLBA 2JHEA 1YMSA 3DAVA 3S22A 1DJCA 2G2WA 4Z1WA 5CHJA 1WA9A 4BBTA 3UN7A 5IU1A 2VZWA 1K6SA 3IS2A 2Y55A 2B95A 2FZ0A 2JE5A 4IEDA 2Y2LA 4R70A 1BTLA 1YLYA 5CTMA 2OAQ1 2IWBA 4X25A 4JF4A 3FV7A 2EX6A 3OPRA 4Y2FA 3SH8A 4EV4A 1M40A 2XSSA 3MSHA 4DXCA 4R3AA 2Z6DA 3BWLA 3K3CA 1JVJA 4XXRA 4Y17A 3G31A 3A3FA 1HVBA 1WYBA 3CUEA 2UWXA 3HLGA 3GVBA
chains in the Genus database with same CATH topology
4F3LA 1F9IA 1IFQA 3UB7A 2W3GA 4GLQA 1OJ5A 1BYWA 2KDKA 4II7A 4M4XA 3T4TA 3EGDC 2W1TB 2W1RA 1EW0A 2VX8A 3KSIA 4NXFA 3BW6A 2WKPA 5L8MA 4IHQA 1OPXA 4WUJA 3NOPC 2W3EA 4DJ3A 5F5YA 4B9OA 3H7WB 4CLCE 2O99A 3D3OA 3LIFA 2V9AA 4R38A 4NXGA 4IJGA 4HI4A 2B02A 2HF6A 3T4QA 4HJ3A 4HNBA 3E98A 1TS7A 4AFIA 3K2NA 2QYBA 3FPVA 2HJEA 3OOVA 2P7JA 4OOLA 4UQIM 5F69A 2M1CA 2J3TC 5G4ZA 3MF0A 4MN6A 3RFBA 3F1NA 2PD8A 3LUQA 3E4QA 2PD7A 3CI6A 3LIBA 3EGXC 2PHYA 2NUPC 3EEAA 1ODVA 2OWJA 1TF1A 3T4OA 3UMDA 5HDCA 4EXOA 5HWVA 2CMNA 1MZUA 4HHDA 1NLYA 2QJ7A 2J80A 3CLOA 3BJNA 3LR0A 3UB6A 3EQVA 4NEED 2M7UA 1UWPX 4NKPA 3MQOA 3LI9A 2W1TA 1TD5A 4HH3A 4XT2B 3EOIA 1T1AA 1NLZA 5LBRA 2G7UA 1MKMA 4CLCC 2VKSA 4ETXA 4GS9A 3P7NA 3F1OB 2OAP1 4YOFA 1DP6A 1P0ZA 4O8GA 3PBRA 2INWA 1D7EA 4MMNA 3H7WA 2A24B 4EEPA 3PBTA 2KX6A 2P08A 5HWTA 5TBMA 4EUVA 5IT5A 5HPIA 2L4RA 1GSXA 2ZOIA 4Q0JA 4EU0A 1S1YA 4ARZA 2W27A 1T19A 1ZTUA 3UB8A 4PKYG 5HSQA 2PDRA 4LPZA 3PBNA 1JNUA 2L1MA 4EETB 3H82A 2VV8A 3GDIA 4L9GA 5IS1A 3A0RA 2O9BA 4O0PA 4G3VA 3LIAA 5KIZA 4RQ9A 2FH5A 4IUHA 4YNRA 2HJ9C 3LFVA 1XJ6A 1OJGA 1F5MA 5K5BA 1N9NA 2EWVA 1NRJA 3PHYA 1DP9A 3JVUA 4HIAA 4PHTA 2XA7S 4EEUA 2H28A 2K2NA 5DFXA 5HZHA 3LR5A 1XJ3A 2VV7A 1TS6A 3BQAA 1OT9A 4GHIB 4GJ4A 3TW8A 2VA0A 4R6LA 4Q0IA 3MR0A 4Y3IA 1LL8A 3S7NA 4P6ZM 3VV4A 3KYQA 5J3WA 4HY8A 4GS9B 4XT2A 4Y5FA 3PBOA 4G3WA 1ZHHB 4NXBA 2GX5A 3OC2A 3RTYA 3FG8A 4LLOB 2QKPA 2KOIA 3F1OA 4WEKA 5TBMB 3NJAA 3FPWA 1XFNA 1DRMA 1TS0A 2A24A 2GJ3A 2P04A 3ZQ5A 1OTIA 5I5LA 4JGOA 5HDSA 1XJ4A 3OCNA 3KO6A 4O01A 4NXEA 4ARZB 3IBRA 2HV1A 3OBFA 3ULFA 3UMEA 4WLAA 3H82B 1S4RA 3NOUC 3B47A 1LSXA 3T50A 3D72A 3MQ0A 4DMZA 2VLGA 2JKTI 4DN0A 2W3FA 1GSWA 4WL9A 1STZA 1T1BA 3C8CA 3PBQA 4CLCB 4H6JB 1Y28A 3PBSA 4ME4A 2WKRA 2MJ6A 3BQ8A 5AVEA 2QHKA 3CAXA 3MXQA 4L9EA 4Q0HA 3T4SA 3NHQA 5DF9A 3C38A 1F98A 2HGVA 4GHIA 2K7SA 3W2ZA 2VJWA 3T4JA 5DJTA 4IUKA 4LRXC 4EERA 2J3TD 3IBJA 4L9FA 1TS8A 3EWKA 3FC7A 4GW9A 2ZMFA 2L0WA 3HJKA 2GZAA 2JKRI 4K08A 5AVFA 2O0YA 5DJUA 2VGLS 4WN5A 4JGQA 3TRCA 2KLIA 4PKYA 3ICYA 4EQ1A 1OTEA 3KX0X 3JVVA 3P01A 3BY9A 3DBAA 1YSQA 2W3DA 3TJZC 3LR3A 2Y79A 4CQHA 3R7WA 5MC7A 3LICA 3OLOA 3S7OA 4BBVA 1NWZA 3E4PA 1T18A 3E0YA 2QWSA 3S7PA 2XROA 3MMHA 4HH2A 4BMWA 2V0WA 4QPRA 4CLCD 4HP9A 4HJ6A 3MFXA 3KSGA 4ETZA 5HD3A 3UB9A 1UGUA 1W63Q 1DP8A 2NUTC 2VGLM 3H9WA 2PYRA 4OOMA 2OWHA 1MC0A 4YWZA 1G6OA 3O5YA 2IA2A 3PYPA 4CLCA 3MJQA 3C2WA 4H6JA 3VE4A 2GNXA 3R4KA 2BASA 4PAUA 4I3IA 4KQOA 2I9VA 3B33A 4JGPA 4LRZE 4MCWA 4BJPA 5DKKA 3KSFA 2DMWA 4B93A 2R78A 2Y8HA 2W3HA 5HL6A 3KSHA 3A0SA 3NOTC 4BBUA 3U2AA 4JGRA 2YKHA 5KSHA 3V67A 4HP4A 2XA7M 4MN5A 5F6AA 4L0LA 4DJ2A 3R7WB 3EQUA 1V9ZA 1YAXA 5A8BA 2JKTM 1H8MA 4UQIS 3S7QA 4GCZA 3LR4A 3T4KA 2V1BA 3F1PB 2ZOHA 5F68A 2J3WA 3HJIA 2K31A 3RH8B 5AJGA 3PR6A 3ZYTA 2LB9A 1X0OA 4LRYC 1KOUA 5J4EA 5HDDA 4HJ4A 1G28A 4I3AA 3IS2B 3VE3A 1GSVA 3HCYA 2EWWA 5EFWA 2JN7A 1N9LA 5HD5A 2XRNA 1UWNX 2LB5A 4WEJA 2A2LA 3K3DA 4E04A 2VV6A 4KUOA 3KYZA 1YKDA 1T1CA 3B42A 5C5KA 3LI8A 2V1AA 1VB6A 2JKRM 4HQAA 4ZRRA 2D01A 5DFYA 4MDZA 2PYPA 3LIEA 4I38A 4G3KA 1P9WA 4EW7A 2OOLA 5CX7A 3UE6A 5TJJA 1OTDA 1OT6A 4F3LB 2O9AA 1P9RA 2EA9A 2YKFA 3A0VA 1LT0A 1LSVA 3OCLA 1S67L 3CWFA 4MN7A 2ZMVA 3EEHA 5DKLA 2B18A 4I39A 4KUKA 1N9OA 2VEAA 4KQDA 4UEYA 2PR6A 4FOFA 3CUEC 1YSPA 1XFQA 1IOUA 2Z6CA 2V0UA 2QJ5A 1W63M 3E4OA 4WELA 2W0NA 4EESA 3LYXA 3F1PA 2JHEA 2D02A 3C30A 1H3QA 3G6OA 4Z1WA 3LIDA 1LSWA 2M7VA 1WA9A 1OTBA 4BBTA 4WF0A 1D06A 5IU1A 2VZWA 3IS2A 2WKQA 3SW1A 4HOIA 4I3JA 4I5SA 2FZ0A 2O9CA 3MQQA 1S4SA 4R70A 4FSFA 4P6ZS 1P97A 2OAQ1 1VHMA 3PXPA 5J7EA 3CITA 2PT7A 3F1NB 4Y2FA 5HPFA 2XSSA 3VOLA 5FL3A 5HWWA 2PR5A 4R3AA 3GECA 3TE8A 2Z6DA 3BWLA 3K3CA 1S66L 1XJ2A 1V9YA 2ZBBA 4BWIA 5G4YA 3UE3A 3T4LA 3CUEA 1OTAA 1S1ZA 3BY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BQA A;  3BQ8 A;  1YAX A;  4UEY A; 
#chains in the Genus database with same CATH topology
 1GHI A;  3HUM A;  4R4R A;  2BLS A;  1OJ5 A;  3JPU A;  3GV9 A;  4WMC D;  2JC7 A;  2W1R A;  3M6B A;  1EW0 A;  4NXF A;  4KZ4 A;  2WKP A;  3SS4 A;  3D3O A;  3LIF A;  2V9A A;  4R38 A;  5FEF A;  5A91 A;  4HI4 A;  4WZ5 C;  3HRE A;  4HJ3 A;  4S2L A;  4HNB A;  3VSL A;  3M2K A;  3K2N A;  2QYB A;  1DJA A;  5FAT A;  2WK0 A;  1NYM A;  3OOV A;  4OH0 A;  3T1X A;  2EFU A;  2M1C A;  2PD8 A;  3GSG A;  3LUQ A;  4GNU A;  5FI6 A;  1H8Z A;  4KQQ A;  4JLF A;  2OLV A;  2BG1 A;  3LIB A;  4ZJ3 A;  1PWD A;  2ZC3 B;  1ODV A;  3SZT A;  3T4O A;  3LEZ A;  1NLY A;  3BJN A;  3EQV A;  1O7E A;  3UE0 A;  3Q81 A;  1JWZ A;  1XGI A;  4IBR A;  1UWP X;  1NJ4 A;  4NKP A;  2W1T A;  1JTG A;  1TD5 A;  1GHM A;  2IWC A;  3G30 A;  2PU4 A;  1T1A A;  4XUX A;  5LBR A;  3NUL A;  4ETX A;  3P7N A;  3PBR A;  3H7W A;  2A24 B;  1YLP A;  3PBT A;  1ALQ A;  5HPI A;  4EUZ A;  5HAP A;  4P0M A;  3IWO A;  4Q0J A;  3DTE A;  4PKY G;  5HSQ A;  2PDR A;  4LPZ A;  4DDY A;  3HVF A;  3MXR A;  2EX8 A;  2VV8 A;  4R3J A;  2O9B A;  1IEM A;  4RQ9 A;  4IUH A;  1S0W A;  5K5B A;  4GZB A;  3PHY A;  5JYP A;  4JBF A;  4PHT A;  2ZQA A;  1RGZ A;  1LHY A;  1XJ3 A;  1PFL A;  3V3S A;  5EPH A;  3KYE A;  4GHI B;  1GHP A;  3N8R A;  2Y91 A;  4Q0I A;  3MR0 A;  4D2O A;  3KYQ A;  5J3W A;  4HY8 A;  3CG5 A;  2R9X A;  4FCF A;  3PBO A;  1LL5 A;  4ZDX A;  3OC2 A;  3RTY A;  2KOI A;  3O3V A;  1CEF A;  2H10 A;  2WKI A;  2P04 A;  3ZQ5 A;  4JGO A;  1XJ4 A;  3VMA A;  4DE3 A;  4ARZ B;  1SZV A;  3IBR A;  3OPP A;  1I2W A;  1TEM A;  3ZG7 B;  4UA6 A;  3H82 B;  3T50 A;  1U60 A;  4DN0 A;  3QNC A;  1YLJ A;  1T1B A;  4UAA A;  5BOH A;  3NEC A;  1K56 A;  1Y28 A;  4ME4 A;  1PYY A;  5AVE A;  3WS4 A;  3T4S A;  4B4X A;  1DY6 A;  3NHQ A;  5DF9 A;  3C38 A;  2HGV A;  3W2Z A;  4BL3 A;  3IX3 A;  3WS1 A;  1FQG A;  4IUK A;  5FA7 A;  5GHY A;  2DCF A;  3FC7 A;  2GZA A;  4KZ9 A;  2WAD A;  2VGL S;  4JGQ A;  2KLI A;  1OTE A;  2RL3 A;  2ZM2 A;  3KX0 X;  3BEC A;  2Z2M B;  4KG2 A;  1YSQ A;  3LR3 A;  4LCL A;  4CQH A;  3R7W A;  5EVI A;  3CJM A;  3BFD A;  4ZJ2 A;  1T18 A;  4PM5 A;  2QWS A;  2WKE A;  3S7P A;  5AQ7 A;  1WE4 A;  1MBL A;  4HH2 A;  4BQM A;  4R1G A;  1L0E A;  1TVF A;  4N1X A;  1EWZ A;  2Y2K A;  4OQG A;  4HP9 A;  4CLC D;  1DJB A;  5HD3 A;  5E2H A;  4BD0 A;  1MC0 A;  1D1J A;  2IA2 A;  2Y2I A;  3PYP A;  4GN2 A;  3VE4 A;  5A92 A;  2HDS A;  1W8Y A;  4R3B A;  4HBT A;  4PAU A;  4P85 A;  4KQO A;  4E3L A;  2EFX A;  4LRZ E;  2V1Z A;  5JYO A;  3O88 A;  3BFE A;  4X55 A;  1KVL A;  4OPR A;  3KSH A;  3DWZ A;  3U2A A;  2JBF A;  3Q1F A;  3T12 B;  4Y0U A;  3V67 A;  4DE0 A;  4HP4 A;  3DTM A;  4MN5 A;  5F6A A;  4DJ2 A;  1LI0 A;  3EQU A;  5A8B A;  4UQI S;  4GCZ A;  3LR4 A;  3T4K A;  3DW0 A;  5F68 A;  4C75 A;  2K31 A;  1MWS A;  3RH8 B;  3BFG A;  4EBP A;  4MBF A;  1X0O A;  5J4E A;  2P9V A;  1G28 A;  3IS2 B;  5EFW A;  3ZG8 B;  3P09 A;  4MNR A;  2LB5 A;  4WEJ A;  5EOE A;  2ZQ7 A;  4KUO A;  4LV1 A;  1PIO A;  1SDE A;  5FQ9 A;  2X71 A;  4IVK A;  3W4O A;  2RCX A;  3LEQ A;  1T1C A;  2CC1 A;  3IF6 C;  5C5K A;  1L3L A;  2V1A A;  3C5A A;  5A90 A;  1ES4 A;  3FZC A;  5DFY A;  5GLC A;  1FCO A;  3LIE A;  2ZQC A;  3RXW A;  3NCK A;  5F83 A;  4EW7 A;  5CX7 A;  5TJJ A;  1GA0 A;  5CTN A;  4PM7 A;  2XFS A;  1NZO A;  3UNW A;  5EVI D;  2V8F A;  2YKF A;  2XR0 A;  5EVE A;  3BM6 A;  2A49 A;  4UEY A;  3IHA A;  1IOU A;  2Z6C A;  2V0U A;  2WAE A;  4R0Q A;  1H3Q A;  3G6O A;  4ZBE A;  1E3U A;  1W79 A;  1K25 A;  3LID A;  1LSW A;  4LFU A;  2M7V A;  1OTB A;  3VOZ A;  4WF0 A;  3HLD A;  2WKQ A;  2OLU A;  1FR6 A;  4I5S A;  2Y2P A;  5GLD A;  1S4S A;  4FSF A;  3PXP A;  3DTK A;  5CED A;  5J7E A;  3CIT A;  2PT7 A;  5FL3 A;  2PR5 A;  3TE8 A;  4QWO A;  4S2P A;  1S66 L;  5G4Y A;  3IH9 A;  3T4L A;  3N4I A;  5CGW A;  3S4X A;  1F9I A;  2W3G A;  4B4Z A;  3T4T A;  4GDN A;  3G2Y A;  3EGD C;  2W1T B;  1ERQ A;  3BW6 A;  3ZNT A;  4IHQ A;  1K54 C;  4WUJ A;  4OP5 A;  3WRZ A;  4WMC A;  5F5Y A;  2Y2G A;  4B9O A;  3H7W B;  4CLC E;  1FCN A;  3OZH A;  4NXG A;  4IJG A;  1BUL A;  2HF6 A;  3T4Q A;  4OPQ A;  3E98 A;  1TS7 A;  3QP6 A;  4AFI A;  3ZDJ A;  3AGD A;  2PBD P;  2HJE A;  3UY6 A;  2UV0 E;  5EEC A;  4MN6 A;  3RFB A;  3F1N A;  2WAF A;  3L9K A;  3WWX A;  3E4Q A;  3G35 A;  4RYE A;  5CHM A;  2J9P A;  2OWJ A;  1TF1 A;  1KGE A;  2X01 A;  3UMD A;  5FQK A;  5HWV A;  1MZU A;  4JXS A;  2QJ7 A;  3LR0 A;  3UB6 A;  2Z2L B;  1Z6F A;  1S6R A;  3L7H A;  4WZ5 A;  3GTC A;  3EOI A;  1TDG A;  1E3U D;  3HLF A;  3WS0 A;  4GS9 A;  5HAR A;  1DP6 A;  1P0Z A;  4O8G A;  4EEP A;  2Y59 A;  2KX6 A;  5FQQ A;  1K57 A;  5TBM A;  3BFF A;  5IT5 A;  1KVM A;  2ZC6 B;  4JXW A;  3VFH A;  3D4F A;  1S1Y A;  3UO9 A;  4H8R A;  2Q9M A;  3UPP A;  3UB8 A;  3PBN A;  4KG6 A;  1JNU A;  1BSG A;  2OV5 A;  1RGY A;  2ZL1 B;  3GDI A;  4G3V A;  4M3K A;  3LIA A;  1ZC2 A;  4PM9 A;  1GCE A;  2HJ9 C;  5TR7 A;  5F1F A;  1L0G A;  4FUW A;  1N9N A;  1ES2 A;  1YLT A;  3DWK A;  3LO7 A;  3JVU A;  1PWC A;  3QP5 A;  2XA7 S;  2WGI A;  1L2S A;  2K2N A;  5HZH A;  4LEN A;  5CGX A;  1QMF A;  2VV7 A;  1OT9 A;  4GJ4 A;  4QHC A;  4IVI A;  1J9M A;  4KZA A;  2Y2O A;  2WGW A;  3N7W A;  4P6Z M;  5L07 A;  4KZ5 A;  3UB5 P;  4XT2 A;  1ERM A;  4G3W A;  1ZHH B;  4LLO B;  2QKP A;  1VET B;  3NJA A;  1XFN A;  2GJ3 A;  1OTI A;  5I5L A;  1ACF A;  3G4P A;  4MEZ A;  3OCN A;  3KO6 A;  4Z9Q A;  1IYO A;  3T1S A;  4B88 A;  1XA1 A;  4WLA A;  3NOU C;  3D72 A;  1G68 A;  2VLG A;  1NY0 A;  4OPY A;  2HP6 A;  5FI2 A;  3C8C A;  3PBQ A;  1Z09 A;  1AWI A;  1MPL A;  1G6A A;  3BQ8 A;  2V20 A;  3BRM A;  3MXQ A;  4EBL A;  3NI9 A;  1N4O A;  3JYI A;  3QP4 A;  4E3J A;  3IX8 A;  3I7J A;  3C7V A;  4EER A;  4ZAM A;  3U4L P;  4GW9 A;  2ZMF A;  3HJK A;  3E2L A;  2O0Y A;  3TRC A;  4WN5 A;  3JVV A;  3P01 A;  3BY9 A;  3IWQ A;  3ITB A;  3V50 A;  2W3D A;  2HDU A;  3LIC A;  3IF5 A;  2E8J A;  3MFD A;  3GMW A;  4PM8 A;  3N8S A;  2XRO A;  3IWI A;  4ESP A;  1KGF A;  1PZO A;  4GKU A;  2P9V B;  3KSG A;  2NUT C;  2VGL M;  2QPN A;  3H9W A;  1XA7 A;  1G6O A;  4XUZ A;  4CLC A;  4H6J A;  4WZ4 A;  2GNX A;  1PW1 A;  1KE0 A;  3FKV A;  2I9V A;  1K4E A;  2P74 A;  3ITA A;  4NK3 A;  1SKF A;  3B33 A;  4JGP A;  1H0M A;  4UHU A;  4RX3 A;  4BJP A;  3KSF A;  4B93 A;  3IT9 A;  2FFF B;  3NOT C;  3Q7Z A;  3ZG0 A;  5DTK A;  3C4O A;  1E25 A;  4GD6 A;  4JKT A;  5KSH A;  2VK3 A;  4L0L A;  2VGJ A;  1V9Z A;  1VEU A;  2JKT M;  1H8M A;  4N92 A;  4U0X A;  4OVD A;  4GD8 A;  2WZX A;  2V1B A;  1KGG A;  3D9Y A;  2EXA A;  4C3Q A;  3ZYT A;  2LB9 A;  1F2K A;  1J3W A;  4LRY C;  5HDD A;  3VP0 A;  3VE3 A;  4I3A A;  1BLP A;  3HCY A;  5TFQ A;  1SKO A;  3M2J A;  5HD5 A;  1HTZ A;  3VOY A;  2VV6 A;  4K91 A;  4E3I A;  3SS5 A;  4KEN B;  4FH2 A;  1ESI A;  1FIL A;  2JKR M;  4KQR A;  4ZRR A;  4DE2 A;  1YLZ A;  1SHV A;  2Y2J A;  4Y15 A;  4G3K A;  4OOY A;  3LGO A;  2OOL A;  4QY5 A;  2X02 A;  1FOF A;  4EQI A;  5FQI A;  1W5D A;  2O9A A;  5L10 A;  1P9R A;  5HAQ A;  1ES3 A;  5HL1 A;  4EWF A;  5A93 A;  3OCL A;  1S67 L;  3CWF A;  4MN7 A;  2B18 A;  1N9O A;  2VEA A;  4KQD A;  1CI8 A;  4KG5 A;  1C3B A;  4FOF A;  5G18 A;  2EX2 A;  1E4D A;  2W0N A;  4WEL A;  3LYX A;  1NZU A;  2XK1 A;  5J8X A;  3IF6 A;  1W7F A;  1IEL A;  4S2M A;  4UA9 A;  2WUQ A;  4CPK A;  4HOI A;  4I3J A;  4HBU A;  4K0X A;  1P97 A;  3F1N B;  2I72 A;  3VOL A;  3UDF A;  5HWW A;  1JWP A;  1XJ2 A;  2ZBB A;  4BWI A;  3UE3 A;  5DF8 A;  1OTA A;  1ESU A;  1S1Z A;  3CPT B;  3BY8 A;  4GOG A;  1IFQ A;  3UB7 A;  1BYW A;  3NDG A;  1NXY A;  4II7 A;  4M4X A;  2Y2N A;  5CHU A;  3HUN A;  1ONH A;  5EM0 A;  4E6W A;  1BLS A;  2VX8 A;  3KSI A;  4DKI A;  4DXB A;  4P87 A;  2EXB A;  2H0Y A;  4ZJ1 A;  1OPX A;  2W3E A;  4DJ3 A;  2XEP A;  2ACG A;  1JTD A;  2O99 A;  1FCM A;  4S2N C;  2ZQ8 A;  5FI7 A;  3N6I A;  1NYY A;  2B02 A;  3QP1 A;  4GDB A;  1MWR A;  3FPV A;  2J9O A;  4OOL A;  5F69 A;  2XF3 A;  2J3T C;  4S2J A;  2WYX A;  3Q07 A;  5EM1 A;  5L2F A;  4OQI A;  4CJN A;  5AQA A;  4N9L A;  5FAO A;  2PU2 A;  3EGX C;  2PHY A;  3EEA A;  3A3E A;  5M18 A;  3VFF A;  1K54 A;  1VQQ A;  5GL9 A;  3LY3 A;  4EXO A;  1CK3 A;  2CMN A;  4HHD A;  1Y54 A;  4OKP A;  2M7U A;  3UDI A;  1YQS A;  3IH8 A;  1XX2 A;  2WGW B;  5FAQ A;  4U3T A;  1PI5 A;  3LI9 A;  3HBR A;  1L0D A;  2Q9N A;  4HH3 A;  4XT2 B;  3ZHH A;  3ZCZ A;  1NLZ A;  3MZF A;  2VKS A;  4R23 A;  4JF5 A;  4YOF A;  2INW A;  1D7E A;  5HWT A;  2P08 A;  2ZQD A;  4OLG A;  4E3K A;  2A3U A;  1FSY A;  2L4R A;  3SH7 A;  1GSX A;  1KE3 A;  2ZOI A;  4E3N A;  1N9B A;  4EU0 A;  3QNB A;  4ARZ A;  1Q2Q A;  2Q0O A;  2W27 A;  4NET A;  1ZTU A;  3ISG A;  3H82 A;  1K0K A;  5KIZ A;  2HZ5 A;  1OJG A;  1F5M A;  2ZC5 B;  4GB7 A;  2EWV A;  1NRJ A;  1DP9 A;  3ZVT A;  1IYS A;  1K55 A;  4EEU A;  2H28 A;  3MKF A;  5DFX A;  1WYC A;  3V5M A;  1CI9 A;  1TS6 A;  3BQA A;  3TW8 A;  2VA0 A;  4R6L A;  1YMX A;  4S2I A;  1LL8 A;  1QME A;  3VV4 A;  5E43 A;  4X69 A;  3W4Q A;  3ZG5 A;  4NXB A;  3FG8 A;  3F1O A;  3O86 A;  1I5Q A;  3FPW A;  5AQB A;  3Q7V A;  3HLC A;  4OLD A;  2PAV P;  3GR2 A;  1FR1 A;  5FAP A;  2HV1 A;  5CEC A;  2E8I A;  2ZC4 B;  3UME A;  5FQJ A;  1ERO A;  2HP5 A;  4RX2 A;  2C6W B;  1W8Q A;  3G32 A;  4DMZ A;  2W3F A;  3IXD A;  4WL9 A;  2J8Y A;  3A3J A;  2J7V A;  1IYP A;  4CLC B;  4H6J B;  3C4P A;  3PBS A;  3BEB A;  2WKR A;  2MJ6 A;  2QHK A;  1XP4 A;  3CAX A;  4L9E A;  4LV0 A;  1BT5 A;  3NBL A;  4HES A;  1O07 A;  5DJT A;  4DRT A;  4S2K A;  4L9F A;  5U47 A;  2L0W A;  3MBZ A;  5AQ9 A;  2V2F F;  5DJU A;  5EVL A;  3CMZ A;  4BEN A;  4EQ1 A;  4ID4 A;  4YIN A;  3DBA A;  3TJZ C;  1VEU B;  2Y79 A;  2Y2M A;  5HW3 A;  1KE4 A;  3OLO A;  1SCW A;  3WS2 A;  3E0Y A;  5D3O A;  4ZTK A;  1RCJ A;  3ZFZ A;  2QZ6 A;  2B5R A;  4HJ6 A;  3MFX A;  4ETZ A;  1SKO B;  5GLA A;  1UGU A;  1DP8 A;  5CXW A;  5F1G A;  2PYR A;  4OOM A;  2ZM8 A;  3O5Y A;  1CEG A;  2H0T A;  3MKE A;  4PPR A;  5KSC A;  1NRF A;  3QP8 A;  3T1Q B;  3FYZ A;  3SS3 A;  4I3I A;  3VP1 A;  2Y2H A;  4WM9 A;  4X1M A;  2HDQ A;  4IBX A;  3IXG A;  1BZA A;  5DKK A;  1ZKJ A;  3NC8 A;  4LV2 A;  3GQZ A;  2R78 A;  2W3H A;  1FSW A;  5HL6 A;  4A5R A;  3A0S A;  5DVA A;  5TGF A;  4JGR A;  2WKH A;  3UPN A;  5FAS A;  2YKH A;  4WBG A;  3P98 A;  3Q82 A;  3R7W B;  1YAX A;  1ZG4 A;  3VP4 A;  5EVI B;  1YPR A;  1MWU A;  3S7Q A;  4BLM A;  3NDE A;  3VP2 A;  5GLB A;  2Y4A A;  3BFC A;  3E2K A;  3IX4 A;  4OPZ A;  3IF6 B;  5E2E A;  5AJG A;  3AGF A;  1KOU A;  4HJ4 A;  1GSV A;  1PRQ A;  2EWW A;  2JN7 A;  1N9L A;  4Q8I A;  4X68 A;  2XRN A;  5CGS A;  3W8K A;  2PBY A;  3K3D A;  1FIK A;  3BLM A;  1K57 C;  3V3R A;  3OPH A;  1VB6 A;  5HAI A;  4FTX A;  2PYP A;  3A3D A;  1P9W A;  4LCM A;  4NG2 A;  4Y0T A;  5HX9 A;  3S1Y A;  4MBH A;  1K6R A;  1G5U A;  5KZH A;  4C6Y A;  3A0V A;  1LT0 A;  1LSV A;  4OP8 A;  5DKL A;  4U0T A;  1XPB A;  1PW8 A;  4HEF A;  4OON A;  4KUK A;  2PR6 A;  4QY6 A;  3CUE C;  1YSP A;  1XFQ A;  3E4O A;  4FD8 A;  3F1P A;  2D02 A;  1PWG A;  3C30 A;  1SDN A;  4RVA A;  1D06 A;  3HLB A;  3SW1 A;  3ZNY A;  1XGJ A;  2O9C A;  3MQQ A;  2XFT A;  5E2F A;  4QB8 A;  2JKG A;  3MXS A;  2H5S A;  2ZJ9 A;  4P6Z S;  1VHM A;  5EV0 A;  1ONG A;  5HPF A;  2IWD A;  3GEC A;  3CHW P;  3FWL A;  1V9Y A;  1KDW A;  3VP3 A;  4BD1 A;  1CQA A;  4F3L A;  4GLQ A;  2KDK A;  2BTF P;  1CJF A;  4PM6 A;  3ZVW A;  3B3X A;  3NIA A;  5FSR A;  3HL9 A;  3CZD A;  2G2U A;  5L8M A;  3NOP C;  4D60 A;  2AVX A;  1MXO A;  2OSU A;  1PI4 A;  3IXH A;  4R4S A;  3LCE A;  2V8C A;  3NY4 A;  1XXM A;  5KMW A;  2P7J A;  5CER A;  2Y2Q A;  4UQI M;  1YM1 A;  2ZM0 A;  4OQH A;  3MF0 A;  5G4Z A;  3WS5 A;  2VGK A;  2ZL1 A;  3UPO A;  2PD7 A;  3CI6 A;  1EI5 A;  1L0F A;  4DF6 A;  2NUP C;  1OME A;  2ZMA A;  1GA9 A;  2WZZ A;  5HDC A;  1BUE A;  2J80 A;  3CLO A;  4WYY A;  4S2N A;  1IKG A;  4NEE D;  2EX9 A;  3PTE A;  5FDH A;  1VM1 A;  4K0W A;  3MQO A;  4KZ8 A;  1H5X A;  3LY4 A;  2G7U A;  1MKM A;  4CLC C;  4JF6 A;  1HZO A;  3F1O B;  2OAP 1;  3RJU A;  4JXV A;  2HPB A;  4MMN A;  1VET A;  3Q7V B;  4RA7 A;  4EUV A;  4FH4 A;  4N9K A;  1T19 A;  4Y7P A;  3SOI A;  5EOO A;  5M19 A;  2L1M A;  1HLU P;  4EET B;  3MS6 A;  4L9G A;  5IS1 A;  4KZ7 A;  1MKI A;  3A0R A;  4O0P A;  4X56 A;  2ZQ9 A;  5EUA A;  2FH5 A;  4YNR A;  1IKI A;  3LFV A;  1XJ6 A;  1ZG6 A;  3UDX A;  3ZGA B;  3QP2 A;  4KZB A;  4X6T A;  4HIA A;  4QD4 A;  3LR5 A;  2GDN A;  2ZD8 A;  3C7U A;  4MBK A;  5FQM A;  4Y3I A;  3S7N A;  1M6K A;  1PZP A;  5DF7 A;  1Y4O A;  5DTT A;  1JWV A;  4GS9 B;  4Y5F A;  4EBN A;  1YT4 A;  5DTS A;  5F82 A;  2GX5 A;  3MZE A;  4WEK A;  5TBM B;  4KZ3 A;  1DRM A;  1TS0 A;  2A24 A;  4YFM A;  3GRJ A;  3IXB A;  5HDS A;  4O01 A;  4NXE A;  5GHZ A;  3OBF A;  3ULF A;  3ZG9 B;  2DRW A;  1S4R A;  3B47 A;  1K56 D;  1LSX A;  2XD1 A;  3BYD A;  4QU3 A;  2ZC7 A;  3MQ0 A;  2JKT I;  2JKF A;  2ZLY A;  1GSW A;  1K38 A;  1STZ A;  2WGV A;  1ES5 A;  5EVI C;  3TOI A;  4JXG A;  3RXX A;  3TSG A;  5M1A A;  2XLN A;  4P6B A;  4Q0H A;  1RP5 A;  4KZ6 A;  1F98 A;  2XDM A;  4GHI A;  2K7S A;  3DTI A;  2VJW A;  3HLE A;  3T4J A;  4OQ0 A;  4LRX C;  2PRF A;  2J3T D;  1YLW A;  3IBJ A;  3G34 A;  1TS8 A;  3EWK A;  5CEB A;  2JKR I;  4K08 A;  5AVF A;  1A0K A;  1PNE A;  3ICY A;  4PKY A;  1HD8 A;  4LGW A;  4X1L A;  3HUO A;  1Q2P A;  3FKW A;  5MC7 A;  5EE8 A;  3S7O A;  4BBV A;  2XD5 A;  4MLL A;  1NWZ A;  5IHV A;  4E3O A;  3E4P A;  2JCH A;  3MMH A;  1MY8 A;  4PMA A;  4X53 A;  4BMW A;  4JPM A;  1IYQ A;  2V0W A;  4QPR A;  3HLW A;  3PAE A;  3TG9 A;  3UB9 A;  3AGE A;  1W63 Q;  4S2O A;  4LV3 A;  2OWH A;  4DDS A;  4YWZ A;  3MJQ A;  3C2W A;  3T1R A;  3WRT A;  2HDR A;  5E2G A;  3PAG A;  3R4K A;  2BAS A;  4F94 A;  3QHY A;  4BL2 A;  3UE1 A;  4UA7 A;  5GHX A;  3OPL A;  4QJG A;  4MCW A;  2DMW A;  4DE1 A;  3BLS A;  2Y8H A;  4BBU A;  2HP9 A;  2DNS A;  3A3I A;  5FDS A;  1LL9 A;  2XA7 M;  2C5W B;  5FEG A;  2XH9 A;  3N8L A;  1I2S A;  2R9W A;  3F1P B;  2ZOH A;  1KDS A;  2J3W A;  3IHB A;  3HJI A;  3V39 A;  1CF0 A;  3PR6 A;  1AXB A;  5CRF A;  2XGN A;  1TDL A;  5HFO A;  4Y13 A;  2QMI A;  1UWN X;  3VSK A;  5I94 A;  2A2L A;  3O87 A;  1LI9 A;  4E04 A;  4E6X A;  1K4F A;  3SH9 A;  3KYZ A;  1YKD A;  3B42 A;  3LI8 A;  1BLC A;  2XQZ A;  4HQA A;  2D01 A;  4MDZ A;  4I38 A;  3M6H A;  4O7D A;  3UE6 A;  1BLH A;  3MZD A;  3IQA A;  1OTD A;  1OT6 A;  1XKZ A;  4F3L B;  3CPT A;  2EA9 A;  4Y0O A;  2ZMV A;  3EEH A;  1MWT A;  4I39 A;  3G2Z A;  2FFY A;  3W4P A;  4N1H A;  1H8Y A;  5L09 A;  1K55 C;  4E3M A;  2QJ5 A;  1W63 M;  4EES A;  1LLB A;  2JHE A;  1YMS A;  3DAV A;  3S22 A;  1DJC A;  2G2W A;  4Z1W A;  5CHJ A;  1WA9 A;  4BBT A;  3UN7 A;  5IU1 A;  2VZW A;  1K6S A;  3IS2 A;  2Y55 A;  2B95 A;  2FZ0 A;  2JE5 A;  4IED A;  2Y2L A;  4R70 A;  1BTL A;  1YLY A;  5CTM A;  2OAQ 1;  2IWB A;  4X25 A;  4JF4 A;  3FV7 A;  2EX6 A;  3OPR A;  4Y2F A;  3SH8 A;  4EV4 A;  1M40 A;  2XSS A;  3MSH A;  4DXC A;  4R3A A;  2Z6D A;  3BWL A;  3K3C A;  1JVJ A;  4XXR A;  4Y17 A;  3G31 A;  3A3F A;  1HVB A;  1WYB A;  3CUE A;  2UWX A;  3HLG A;  3GVB A; 
#chains in the Genus database with same CATH homology
 4F3L A;  1F9I A;  1IFQ A;  3UB7 A;  2W3G A;  4GLQ A;  1OJ5 A;  1BYW A;  2KDK A;  4II7 A;  4M4X A;  3T4T A;  3EGD C;  2W1T B;  2W1R A;  1EW0 A;  2VX8 A;  3KSI A;  4NXF A;  3BW6 A;  2WKP A;  5L8M A;  4IHQ A;  1OPX A;  4WUJ A;  3NOP C;  2W3E A;  4DJ3 A;  5F5Y A;  4B9O A;  3H7W B;  4CLC E;  2O99 A;  3D3O A;  3LIF A;  2V9A A;  4R38 A;  4NXG A;  4IJG A;  4HI4 A;  2B02 A;  2HF6 A;  3T4Q A;  4HJ3 A;  4HNB A;  3E98 A;  1TS7 A;  4AFI A;  3K2N A;  2QYB A;  3FPV A;  2HJE A;  3OOV A;  2P7J A;  4OOL A;  4UQI M;  5F69 A;  2M1C A;  2J3T C;  5G4Z A;  3MF0 A;  4MN6 A;  3RFB A;  3F1N A;  2PD8 A;  3LUQ A;  3E4Q A;  2PD7 A;  3CI6 A;  3LIB A;  3EGX C;  2PHY A;  2NUP C;  3EEA A;  1ODV A;  2OWJ A;  1TF1 A;  3T4O A;  3UMD A;  5HDC A;  4EXO A;  5HWV A;  2CMN A;  1MZU A;  4HHD A;  1NLY A;  2QJ7 A;  2J80 A;  3CLO A;  3BJN A;  3LR0 A;  3UB6 A;  3EQV A;  4NEE D;  2M7U A;  1UWP X;  4NKP A;  3MQO A;  3LI9 A;  2W1T A;  1TD5 A;  4HH3 A;  4XT2 B;  3EOI A;  1T1A A;  1NLZ A;  5LBR A;  2G7U A;  1MKM A;  4CLC C;  2VKS A;  4ETX A;  4GS9 A;  3P7N A;  3F1O B;  2OAP 1;  4YOF A;  1DP6 A;  1P0Z A;  4O8G A;  3PBR A;  2INW A;  1D7E A;  4MMN A;  3H7W A;  2A24 B;  4EEP A;  3PBT A;  2KX6 A;  2P08 A;  5HWT A;  5TBM A;  4EUV A;  5IT5 A;  5HPI A;  2L4R A;  1GSX A;  2ZOI A;  4Q0J A;  4EU0 A;  1S1Y A;  4ARZ A;  2W27 A;  1T19 A;  1ZTU A;  3UB8 A;  4PKY G;  5HSQ A;  2PDR A;  4LPZ A;  3PBN A;  1JNU A;  2L1M A;  4EET B;  3H82 A;  2VV8 A;  3GDI A;  4L9G A;  5IS1 A;  3A0R A;  2O9B A;  4O0P A;  4G3V A;  3LIA A;  5KIZ A;  4RQ9 A;  2FH5 A;  4IUH A;  4YNR A;  2HJ9 C;  3LFV A;  1XJ6 A;  1OJG A;  1F5M A;  5K5B A;  1N9N A;  2EWV A;  1NRJ A;  3PHY A;  1DP9 A;  3JVU A;  4HIA A;  4PHT A;  2XA7 S;  4EEU A;  2H28 A;  2K2N A;  5DFX A;  5HZH A;  3LR5 A;  1XJ3 A;  2VV7 A;  1TS6 A;  3BQA A;  1OT9 A;  4GHI B;  4GJ4 A;  3TW8 A;  2VA0 A;  4R6L A;  4Q0I A;  3MR0 A;  4Y3I A;  1LL8 A;  3S7N A;  4P6Z M;  3VV4 A;  3KYQ A;  5J3W A;  4HY8 A;  4GS9 B;  4XT2 A;  4Y5F A;  3PBO A;  4G3W A;  1ZHH B;  4NXB A;  2GX5 A;  3OC2 A;  3RTY A;  3FG8 A;  4LLO B;  2QKP A;  2KOI A;  3F1O A;  4WEK A;  5TBM B;  3NJA A;  3FPW A;  1XFN A;  1DRM A;  1TS0 A;  2A24 A;  2GJ3 A;  2P04 A;  3ZQ5 A;  1OTI A;  5I5L A;  4JGO A;  5HDS A;  1XJ4 A;  3OCN A;  3KO6 A;  4O01 A;  4NXE A;  4ARZ B;  3IBR A;  2HV1 A;  3OBF A;  3ULF A;  3UME A;  4WLA A;  3H82 B;  1S4R A;  3NOU C;  3B47 A;  1LSX A;  3T50 A;  3D72 A;  3MQ0 A;  4DMZ A;  2VLG A;  2JKT I;  4DN0 A;  2W3F A;  1GSW A;  4WL9 A;  1STZ A;  1T1B A;  3C8C A;  3PBQ A;  4CLC B;  4H6J B;  1Y28 A;  3PBS A;  4ME4 A;  2WKR A;  2MJ6 A;  3BQ8 A;  5AVE A;  2QHK A;  3CAX A;  3MXQ A;  4L9E A;  4Q0H A;  3T4S A;  3NHQ A;  5DF9 A;  3C38 A;  1F98 A;  2HGV A;  4GHI A;  2K7S A;  3W2Z A;  2VJW A;  3T4J A;  5DJT A;  4IUK A;  4LRX C;  4EER A;  2J3T D;  3IBJ A;  4L9F A;  1TS8 A;  3EWK A;  3FC7 A;  4GW9 A;  2ZMF A;  2L0W A;  3HJK A;  2GZA A;  2JKR I;  4K08 A;  5AVF A;  2O0Y A;  5DJU A;  2VGL S;  4WN5 A;  4JGQ A;  3TRC A;  2KLI A;  4PKY A;  3ICY A;  4EQ1 A;  1OTE A;  3KX0 X;  3JVV A;  3P01 A;  3BY9 A;  3DBA A;  1YSQ A;  2W3D A;  3TJZ C;  3LR3 A;  2Y79 A;  4CQH A;  3R7W A;  5MC7 A;  3LIC A;  3OLO A;  3S7O A;  4BBV A;  1NWZ A;  3E4P A;  1T18 A;  3E0Y A;  2QWS A;  3S7P A;  2XRO A;  3MMH A;  4HH2 A;  4BMW A;  2V0W A;  4QPR A;  4CLC D;  4HP9 A;  4HJ6 A;  3MFX A;  3KSG A;  4ETZ A;  5HD3 A;  3UB9 A;  1UGU A;  1W63 Q;  1DP8 A;  2NUT C;  2VGL M;  3H9W A;  2PYR A;  4OOM A;  2OWH A;  1MC0 A;  4YWZ A;  1G6O A;  3O5Y A;  2IA2 A;  3PYP A;  4CLC A;  3MJQ A;  3C2W A;  4H6J A;  3VE4 A;  2GNX A;  3R4K A;  2BAS A;  4PAU A;  4I3I A;  4KQO A;  2I9V A;  3B33 A;  4JGP A;  4LRZ E;  4MCW A;  4BJP A;  5DKK A;  3KSF A;  2DMW A;  4B93 A;  2R78 A;  2Y8H A;  2W3H A;  5HL6 A;  3KSH A;  3A0S A;  3NOT C;  4BBU A;  3U2A A;  4JGR A;  2YKH A;  5KSH A;  3V67 A;  4HP4 A;  2XA7 M;  4MN5 A;  5F6A A;  4L0L A;  4DJ2 A;  3R7W B;  3EQU A;  1V9Z A;  1YAX A;  5A8B A;  2JKT M;  1H8M A;  4UQI S;  3S7Q A;  4GCZ A;  3LR4 A;  3T4K A;  2V1B A;  3F1P B;  2ZOH A;  5F68 A;  2J3W A;  3HJI A;  2K31 A;  3RH8 B;  5AJG A;  3PR6 A;  3ZYT A;  2LB9 A;  1X0O A;  4LRY C;  1KOU A;  5J4E A;  5HDD A;  4HJ4 A;  1G28 A;  4I3A A;  3IS2 B;  3VE3 A;  1GSV A;  3HCY A;  2EWW A;  5EFW A;  2JN7 A;  1N9L A;  5HD5 A;  2XRN A;  1UWN X;  2LB5 A;  4WEJ A;  2A2L A;  3K3D A;  4E04 A;  2VV6 A;  4KUO A;  3KYZ A;  1YKD A;  1T1C A;  3B42 A;  5C5K A;  3LI8 A;  2V1A A;  1VB6 A;  2JKR M;  4HQA A;  4ZRR A;  2D01 A;  5DFY A;  4MDZ A;  2PYP A;  3LIE A;  4I38 A;  4G3K A;  1P9W A;  4EW7 A;  2OOL A;  5CX7 A;  3UE6 A;  5TJJ A;  1OTD A;  1OT6 A;  4F3L B;  2O9A A;  1P9R A;  2EA9 A;  2YKF A;  3A0V A;  1LT0 A;  1LSV A;  3OCL A;  1S67 L;  3CWF A;  4MN7 A;  2ZMV A;  3EEH A;  5DKL A;  2B18 A;  4I39 A;  4KUK A;  1N9O A;  2VEA A;  4KQD A;  4UEY A;  2PR6 A;  4FOF A;  3CUE C;  1YSP A;  1XFQ A;  1IOU A;  2Z6C A;  2V0U A;  2QJ5 A;  1W63 M;  3E4O A;  4WEL A;  2W0N A;  4EES A;  3LYX A;  3F1P A;  2JHE A;  2D02 A;  3C30 A;  1H3Q A;  3G6O A;  4Z1W A;  3LID A;  1LSW A;  2M7V A;  1WA9 A;  1OTB A;  4BBT A;  4WF0 A;  1D06 A;  5IU1 A;  2VZW A;  3IS2 A;  2WKQ A;  3SW1 A;  4HOI A;  4I3J A;  4I5S A;  2FZ0 A;  2O9C A;  3MQQ A;  1S4S A;  4R70 A;  4FSF A;  4P6Z S;  1P97 A;  2OAQ 1;  1VHM A;  3PXP A;  5J7E A;  3CIT A;  2PT7 A;  3F1N B;  4Y2F A;  5HPF A;  2XSS A;  3VOL A;  5FL3 A;  5HWW A;  2PR5 A;  4R3A A;  3GEC A;  3TE8 A;  2Z6D A;  3BWL A;  3K3C A;  1S66 L;  1XJ2 A;  1V9Y A;  2ZBB A;  4BWI A;  5G4Y A;  3UE3 A;  3T4L A;  3CUE A;  1OTA A;  1S1Z A;  3BY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...