1CK3A

N276d mutant of escherichia coli tem-1 beta-lactamase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERDRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE
publication title X-ray structure of the Asn276Asp variant of the Escherichia coli TEM-1 beta-lactamase: direct observation of electrostatic modulation in resistance to inactivation by clavulanic acid.
pubmed doi rcsb
source organism Escherichia coli
total genus 95
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1999-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ck3A00
3WS1A 1XX2A 1ZKJA 2Y2OA 3HUNA 4OOMA 4MLLA 2HDQA 4QY5A 4R4SA 3BFGA 3WRZA 1BTLA 2P9VA 4HBTA 3ZG8B 5EVIB 5CHUA 3O86A 4DKIA 4NK3A 4N1XA 1IYOA 3RXWA 3V3SA 4ZDXA 1WYCA 3MZEA 2EX6A 5M18A 1RGYA 1SHVA 3W8KA 3ZHHA 1EWZA 3UPNA 5CERA 3BLSA 2ZMAA 4GDNA 1FSWA 3M6HA 4WEKA 3HLCA 3HLBA 1JWVA 2E8IA 4JKTA 4ZAMA 2B5RA 4JLFA 3BFFA 1K6RA 3A3IA 3ITBA 1K6SA 5L2FA 1XXMA 2WGWB 4N92A 3D4FA 2HDSA 3AGEA 3OCNA 3VFFA 5FI7A 1M40A 3WRTA 3WS2A 1FCNA 1K55A 2A3UA 3GRJA 2C5WB 1K38A 4BL3A 3M2KA 4U3TA 4O7DA 3ZG5A 2ZC4B 4KENB 3HL9A 3VP3A 3AGDA 5EUAA 4S2LA 3FZCA 1Q2PA 1YT4A 3BM6A 4JBFA 1TVFA 2P9VB 3JYIA 5FQMA 2V1ZA 5GHYA 3IWOA 4CPKA 4E3IA 1GCEA 4DXCA 1NJ4A 3FV7A 4JXSA 2C6WB 1RCJA 4BENA 1TDLA 1YLPA 1HTZA 4NETA 2V2FF 2ZD8A 4HEFA 2XD1A 2ZM8A 4GB7A 4OOLA 1I2SA 4OPZA 5HX9A 3ZVTA 5F1FA 2XR0A 4UAAA 4MBHA 1RGZA 2DNSA 4X69A 5DF9A 3SS3A 5TFQA 5F83A 1K25A 4H8RA 4K91A 4WYYA 1BLSA 5M19A 4OH0A 3OPHA 4S2IA 2G2UA 1CEFA 3NY4A 2WAEA 4UA9A 1SKFA 3UE1A 1O07A 2FFFB 1H5XA 2PU2A 2Y2IA 3IXGA 3G30A 4EV4A 3DWKA 4X53A 4DDSA 1ES5A 3GVBA 1YMSA 4MEZA 4U0XA 4UHUA 5F1GA 1C3BA 3VOZA 3IT9A 3LEZA 4ZTKA 3NCKA 3CJMA 4KZ4A 4Q8IA 1IYSA 5FASA 2ZC6B 3UN7A 3SH7A 3HUMA 1FCMA 1S0WA 4PM7A 3IXDA 3C4PA 4IBXA 2VGKA 2Y2PA 4P6BA 1PIOA 4KZ9A 4FH4A 4B4ZA 3PBOA 4PM9A 3GTCA 3P98A 3EQUA 3SH9A 3W4PA 3WWXA 4WZ5C 4KZ8A 3ZFZA 4D2OA 1E3UA 4E3KA 4WZ5A 3FKVA 3I7JA 3NIAA 1U60A 5CTNA 5FI2A 3VOYA 2XFSA 5A91A 4DRTA 4OVDA 3ZNTA 2OV5A 3A3DA 1PWDA 3E2LA 2CC1A 4GOGA 4JF6A 3PBRA 4P0MA 3GMWA 3N8LA 1GA0A 5AQAA 2I72A 4KG2A 1K54C 5IHVA 2H0YA 5HARA 2EXAA 3UE0A 1IKIA 1KDSA 4E3NA 3GQZA 1K54A 4DE1A 3MBZA 5EPHA 4K0XA 1RP5A 1YM1A 2WKEA 2X71A 4JXVA 3ZVWA 1K4EA 1ZG4A 1ESIA 3ZG9B 1DJAA 4X56A 5A93A 3TG9A 2QMIA 1KGFA 1FQGA 3HBRA 3UE3A 4QJGA 1CK3A 2J9OA 1BLCA 4WBGA 3CMZA 1K4FA 2J7VA 2VGJA 3ZNYA 3S22A 5DTSA 1W7FA 4OPYA 3QNBA 3Q1FA 4Y0OA 4KQOA 1MWTA 4R4RA 3AGFA 3O88A 3W4QA 5HAPA 4GDBA 4FD8A 4BQMA 1PW1A 2ZQ9A 3BRMA 3NBLA 2ZC5B 2EXBA 5E2EA 4P85A 2R9XA 4DE3A 2A49A 4X6TA 5E2HA 1K56D 3RXXA 5EOEA 1MWSA 2FFYA 1QMEA 3ISGA 3B3XA 4ZJ1A 3C7UA 3UNWA 2JBFA 5CHJA 2ZQCA 3ZG7B 1XGIA 4BLMA 3N8SA 2DCFA 3SOIA 2X02A 1ONHA 2XD5A 4IBRA 5FA7A 3IXHA 3EQVA 2ZLYA 3LCEA 5DTKA 4N1HA 3VP2A 4E6WA 4DXBA 2Y55A 3DTMA 1K55C 1TDGA 3V5MA 1GHPA 5CGSA 1LI9A 5FQJA 4EWFA 3OPRA 5CHMA 4S2NA 5EECA 1JWPA 2X01A 1ES2A 1TEMA 3UPPA 4ZBEA 1J9MA 5KZHA 1IYPA 4OLDA 1L0DA 1SDEA 2HDUA 4MNRA 3DW0A 2P74A 2BLSA 1EI5A 4KZ5A 1KVLA 2EX8A 1ONGA 4OQ0A 3ZCZA 3Q81A 4PMAA 2RCXA 1YLYA 3OPLA 4LV2A 5CGWA 5TR7A 2G2WA 4KZAA 1BLHA 4KZ7A 4DDYA 2H5SA 2RL3A 4LV1A 2XDMA 1MY8A 2XQZA 5EVID 3N6IA 2HP9A 4CJNA 4QD4A 1XPBA 5A90A 1OMEA 4PM5A 1DY6A 4YFMA 1LL9A 3NC8A 3IXBA 4FH2A 3LY3A 3Q07A 3G35A 4UA7A 1GHMA 1O7EA 2WZXA 1SCWA 4RX2A 3V3RA 1M6KA 1PWCA 5FATA 3G31A 4GN2A 1MKIA 2ZQDA 3PAEA 4Y0TA 4WMCD 3S4XA 3IF5A 4C6YA 4OKPA 1BSGA 4OQIA 3OCLA 2ZQ7A 2WGVA 4EBNA 2Y2QA 4PM6A 3A3FA 3HUOA 1DJBA 4JXWA 5HFOA 2QPNA 5FSRA 4GD8A 3Q7VA 1BLPA 3HLDA 4BD1A 2Y2GA 2ZQAA 1CEGA 3C4OA 4EBPA 1ESUA 5EOOA 3BFDA 4JPMA 4C75A 4DE2A 5GLBA 1G6AA 2OLUA 3UDFA 3M2JA 5GLAA 2BG1A 3G2YA 3HLGA 4E3OA 4E3LA 1DJCA 3UO9A 2JC7A 4BD0A 4JF5A 2ZJ9A 4EQIA 3WS4A 3M6BA 4FSFA 2Y2JA 4QB8A 2EX9A 4XXRA 2WKIA 5AQ7A 4EBLA 4WZ4A 5JYOA 3SS5A 1L0EA 3VP1A 5GHZA 2Y2NA 3FYZA 3IH9A 4B88A 4ZJ2A 2HPBA 3IWIA 1GA9A 3PBQA 4R3BA 1KGGA 2IWCA 1JTGA 2R9WA 1KGEA 1ERQA 2WYXA 2Y4AA 3MXSA 4ID4A 4OPRA 1L0GA 1PZPA 1XA1A 1HZOA 1ZG6A 3HVFA 1FOFA 1BUEA 1XGJA 3HREA 3O3VA 4ZJ3A 3VSKA 3FKWA 4R1GA 5E2GA 1IEMA 5BOHA 2Z2MB 3A3JA 1BULA 3Q7VB 4HESA 5AQBA 1YLJA 3LY4A 3ZGAB 1YLTA 4JXGA 3O87A 4LV0A 3SH8A 5DTTA 3CZDA 1ERMA 3RJUA 4WELA 4DE0A 5CEDA 3S1YA 4XUZA 4WMCA 4PM8A 4C3QA 4OQGA 3IF6C 1QMFA 4KZ6A 3HLWA 5DF7A 1PI4A 3ITAA 2HP5A 3GV9A 3IF6A 1NRFA 3IHAA 4RX3A 4XUXA 2J8YA 3IH8A 3OPPA 1PYYA 3PBSA 4FCFA 4M3KA 4LCLA 1NY0A 5GLCA 3MFDA 1NXYA 4UA6A 4EUZA 3C5AA 1WE4A 3MKFA 2XGNA 4IEDA 1N9BA 2WADA 1KE3A 5KMWA 2Y2LA 5FDHA 4OPQA 5DVAA 3V39A 2UWXA 3W4OA 4QU3A 1IELA 1YQSA 3C7VA 3N4IA 1GHIA 5CXWA 5FQIA 4KG6A 4OP8A 3A3EA 4S2NC 1NYMA 4S2OA 4Y0UA 3BECA 2Y2KA 1MWRA 3ZDJA 5A92A 2J9PA 1LLBA 4JF4A 2EFXA 1MWUA 4X55A 1H8YA 2PBYA 4QY6A 1S6RA 4RA7A 4GZBA 4GKUA 4X68A 5FAPA 5CEBA 2WUQA 1ALQA 1L2SA 5AQ9A 2Z2LB 4LCMA 5FAQA 5M1AA 2Y2HA 4B4XA 4P87A 4F94A 5J8XA 1LHYA 3NDEA 3PBTA 5CECA 1CI8A 3IHBA 4OP5A 1E4DA 5HAQA 2WZZA 2ZQ8A 1I2WA 3BFEA 1CI9A 4BJPA 4E3MA 1PW8A 3V50A 3DWZA 1Y54A 2ZM0A 4OONA 2Y2MA 3IF6B 4GNUA 4HBUA 4N9KA 5HW3A 4KQQA 5GLDA 3PTEA 4GD6A 3WS5A 1XP4A 2IWBA 3BYDA 3VP0A 3CG5A 3OZHA 4DF6A 1E3UD 4LENA 4KZBA 4RVAA 4WEJA 1PI5A 1VM1A 1KE0A 1Q2QA 4PPRA 1AXBA 2XEPA 1ES3A 5KSHA 1BZAA 1YLZA 5CTMA 1FSYA 4KG5A 2XH9A 4S2JA 4WM9A 4R3JA 3BFCA 3IQAA 2GDNA 1JTDA 1SDNA 5FAOA 3NI9A 5FQ9A 1K56A 4R0QA 4IVKA 4Y7PA 3HLFA 4N9LA 3LO7A 5HL1A 4OLGA 1IKGA 3GSGA 1JWZA 1W8YA 2HDRA 3VSLA 5E2FA 3PBNA 2EFUA 2JCHA 3BEBA 5D3OA 2JE5A 3TSGA 4R23A 2OSUA 1YLWA 4LV3A 3VP4A 5DF8A 1G68A 1KE4A 2ZC3B 5U47A 1PWGA 5GL9A 2H10A 4S2MA 5GHXA 4OQHA 1LI0A 1NZOA 3P09A 1VQQA 5G18A 1NYYA 2H0TA 3GR2A 4QHCA 1ZC2A 1FCOA 1XA7A 1E25A 2Y91A 4KZ3A 3ZG0A 3E2KA 1PZOA 1NZUA 1BT5A 2DRWA 1EROA 3G4PA 3OC2A 1KDWA 3UY6A 5F82A 3MZFA 5CGXA 3QHYA 2WAFA 2HP6A 2WGIA 3QNCA 4YINA 2WK0A 5EVIC 1XKZA 2OLVA 2Q9NA 3N8RA 1H8ZA 3UPOA 2V20A 2WKHA 5EVIA 1LL5A 2PU4A 4S2KA 3MZDA 3SS4A 1FR6A 1MPLA 3G34A 4U0TA 5EVLA 5E43A 1L0FA 4S2PA 3NDGA 4RYEA 3UDIA 2ZC7A 1ES4A 2Y59A 3IWQA 2XLNA 5FQKA 3G2ZA 2XF3A 5HAIA 3WS0A 4OOYA 4E3JA 5JYPA 5CRFA 3TOIA 4BL2A 5FQQA 3HLEA 5I94A 2IWDA 4L0LA 1HVBA 3UDXA 1K57C 3G32A 4IVIA 3MXRA 1W5DA 4MBFA 5TGFA 2QZ6A 3Q7ZA 3N7WA 1K57A 2Q9MA 1W8QA 5FI6A 1MBLA 1JVJA 1MXOA 1WYBA 3VMAA 3MKEA 2WGWA 4A5RA 4MBKA 3Q82A 3VFHA 1KVMA 1I5QA 1Z6FA 3PAGA 2XFTA 4E6XA 4Z9QA 1W79A 1HD8A 1YMXA 1FR1A 3FWLA 3BLMA 1N4OA 1IYQA 2EX2A 2XK1A 4K0WA 5EE8A 2ZM2A 5KSCA 4KQRA
chains in the Genus database with same CATH superfamily
2Y2OA 4MLLA 2HDQA 3BFGA 1UGUA 2HV1A 4R3AA 1K0KA 1LSWA 2ZL1A 3O86A 4N1XA 3MMHA 3LEQA 1DP8A 2EX6A 1RGYA 3ZHHA 3LGOA 3EEAA 5HWTA 3MQQA 2WKPA 4GDNA 1FSWA 3LFVA 4WEKA 3HLCA 4HJ4A 1NLYA 3L9KA 3BFFA 1XXMA 1Y4OA 3R7WA 3G6OA 3WRTA 2A3UA 2C5WB 2VGLS 3MR0A 3ZG5A 3AGDA 3BM6A 4JBFA 3IWOA 4EQ1A 3CUEC 2W3EA 5FEGA 1YKDA 1TDLA 4I38A 1YLPA 1HTZA 4NETA 2V2FF 5F1FA 4GB7A 4OOLA 1I2SA 5HX9A 4YWZA 4MBHA 1RGZA 1S4SA 4X69A 5DF9A 3SS3A 4EETB 1K25A 4K91A 1VEUA 4Y3IA 1CEFA 4QPRA 3DTEA 3UE1A 3SW1A 4BBUA 4DDSA 4U0XA 3CJMA 3SH7A 1S0WA 1ZHHB 4IBXA 2VGKA 4B4ZA 4PM9A 3LIBA 3W4PA 3EQUA 3SH9A 5F5YA 4WZ5A 5HZHA 4QWOA 5CTNA 5FI2A 2V1BA 2XFSA 5A91A 3VOYA 3ICYA 3ZNTA 2Z6CA 3PBRA 4P0MA 2BASA 2H0YA 3UE0A 4DE1A 4JXVA 4ARZB 3ZVWA 1ESIA 5A93A 1FQGA 4LGWA 4H6JB 1OPXA 3MQOA 2XRNA 3QNBA 4R4RA 3O88A 5HAPA 4GS9A 4GDBA 4HJ3A 4L9EA 4BQMA 3BRMA 3F1NB 3NBLA 2EXBA 4EEUA 4X6TA 3NECA 1K56D 2V0WA 5DFYA 3LR3A 3UNWA 4BLMA 3DTIA 1LSVA 4N1HA 1PFLA 1TDGA 2NUTC 4Q0JA 1GHPA 5CGSA 4ETZA 5EECA 2X01A 1TEMA 2YKHA 4ZBEA 2P04A 1L0DA 5J3WA 2P74A 4KZ5A 2EX8A 5L07A 1VHMA 4B93A 1UWNX 1YLYA 3OPLA 4LV2A 5DFXA 2H5SA 1TS8A 4D60A 1MY8A 5IU1A 4QD4A 5A90A 1OMEA 1DY6A 2UV0E 4FH2A 5HSQA 2E8JA 4UA7A 1GHMA 1O7EA 1SCWA 4LFUA 1M6KA 1PWCA 3H82B 4JGPA 2VKSA 3IX3A 3U4LP 3IBRA 3PAEA 3IF5A 4OKPA 2WGVA 2Y2QA 1DJBA 2PD7A 1DRMA 5HFOA 4JGOA 5EOOA 2ZMVA 2W1RA 3BFDA 4JPMA 3T4TA 5GLBA 4LRXC 3BQAA 5L10A 4E3OA 4E3LA 3H7WA 1S67L 2WKQA 4XXRA 1EW0A 2WKIA 3SS5A 5GHZA 3FYZA 2HPBA 3IWIA 1GA9A 3PBQA 3ZQ5A 1JTGA 2R9WA 1ERQA 4I3JA 3MXSA 4ID4A 4G3WA 1PZPA 3KSGA 1XGJA 3HREA 2PRFA 3O3VA 3FKWA 5E2GA 1BULA 3Q7VB 5AQBA 3LY4A 3ZGAB 3O87A 4LV0A 3SH8A 4HNBA 4WELA 3S1YA 3EWKA 4WMCA 2W27A 1QMFA 5DF7A 3ITAA 2VV8A 4RX3A 2V9AA 3PBSA 4M3KA 2AVXA 5GLCA 4EUZA 1N9BA 2WADA 4OPQA 3V39A 3MQ0A 1GHIA 5CXWA 2IA2A 4KG6A 1S6RA 1L2SA 5J8XA 3PBTA 3NDEA 5CECA 4OP5A 2PYRA 1E4DA 2PD8A 3BFEA 1I2WA 1CI9A 1PW8A 3V50A 5FEFA 3TRCA 4OONA 5HW3A 1VETB 3PTEA 4GD6A 4ESPA 1XP4A 2IWBA 3BYDA 3CG5A 1S66L 2O9AA 2O0YA 1OJ5A 1PI5A 1Q2QA 1TF1A 4PPRA 3T1RA 2ZMFA 3RFBA 2XH9A 2HZ5A 3IQAA 3QP6A 2GDNA 2W0NA 5FAOA 3NI9A 4DJ3A 2QWSA 4Y7PA 4N9LA 3PBNA 2JCHA 4BBTA 2QJ7A 2HGVA 4BWIA 1OT9A 4EEPA 3T1XA 1T1AA 5GHXA 4F3LB 3P09A 2BTFP 1N9LA 4GHIA 1ACFA 1KDWA 3MZFA 3QHYA 2LB9A 2HP6A 2WK0A 1XKZA 2V20A 2WKHA 4R70A 4U0TA 3NDGA 3LIAA 3KSFA 2ZC7A 4Z1WA 2Y59A 3IWQA 5EVEA 5FQKA 5HAIA 4E3JA 4BL2A 5FQQA 2IWDA 4IVIA 3TE8A 2Q9MA 4MCWA 1JVJA 3MKEA 4A5RA 2J3WA 2XROA 3PHYA 4WUJA 1Z6FA 3T1SA 1D06A 4Z9QA 1YMXA 3FWLA 1P0ZA 1P9WA 3K3DA 4KQRA 3WS1A 1ZKJA 4QY5A 2VV7A 1OT6A 2G7UA 3OBFA 4DN0A 3V3SA 2P7JA 5M18A 2K2NA 1PNEA 2ZMAA 3M6HA 3DAVA 5G4ZA 1JWVA 2B5RA 4WLAA 1K6RA 3ITBA 5L2FA 2WGWB 4KUKA 3VFFA 5FI7A 3WS2A 5AVEA 1FCNA 4L9GA 1K38A 4U3TA 4KENB 3HL9A 4FTXA 5EUAA 4P6ZS 4S2LA 5GHYA 2ACGA 3IX4A 3JYIA 1LT0A 4DXCA 4CPKA 1GCEA 1NJ4A 2D02A 1RCJA 4KQDA 2ZM8A 4OPZA 3T12B 1BLSA 1TS6A 4S2IA 3OPHA 1SKFA 2FFFB 2PU2A 3F1OB 3G30A 4EV4A 3DWKA 4XT2B 1ES5A 1XJ3A 4UHUA 5F1GA 1C3BA 3LEZA 4ZTKA 3NCKA 4GLQA 1IYSA 4ARZA 5FASA 5CX7A 1SZVA 3IBJA 1BYWA 4H6JA 2QKPA 1PIOA 2JKTI 1OTDA 2VLGA 4UQIS 3P98A 4WZ5C 1XFNA 1SKOB 3F1NA 4E3KA 4BMWA 3I7JA 4WN5A 2J3TD 2Y8HA 3S7QA 4HP4A 1S1ZA 3N8LA 5AQAA 2I72A 4KG2A 5IHVA 4E3NA 1K54A 3MBZA 5EPHA 2XA7M 4K0XA 2HF6A 1G5UA 1K4EA 3ZG9B 3S7NA 4Q0HA 2PDRA 3ZNYA 2J9OA 2J7VA 3S22A 5DTSA 3AGFA 1MC0A 4FD8A 1FILA 5E2EA 4GW9A 4P85A 4MN7A 5E2HA 2FFYA 1QMEA 2JBFA 2VA0A 3N8SA 2DCFA 3SOIA 3O5YA 2XD5A 5FA7A 3H82A 4E6WA 2Y55A 1K55C 1LI9A 1F98A 4EWFA 4S2NA 1JWPA 1MKMA 1ES2A 4HOIA 1J9MA 2Y79A 1T1BA 2BLSA 4WF0A 3BWLA 4HI4A 4KZAA 1AWIA 3CHWP 2RL3A 5HPIA 4LV1A 4CJNA 1XPBA 4YFMA 5F69A 3IXBA 3G35A 3V3RA 2WZXA 3G31A 1T19A 5G4YA 3U2AA 4EW7A 4X1LA 2ZQDA 4C6YA 1BSGA 2QHKA 4OQIA 3OCLA 2ZQ7A 3QP2A 2QPNA 3IX8A 5FSRA 3Q7VA 1BLPA 3C30A 5TBMB 1ESUA 1NRJA 3UDFA 4L9FA 4Y5FA 3HLGA 1DJCA 3UO9A 2ZJ9A 3D3OA 3MSHA 3WS4A 2VV6A 4FSFA 2Y2JA 1L0EA 4R3BA 2IWCA 2WYXA 3FPWA 3P7NA 3HVFA 1FOFA 2EWVA 1IEMA 5BOHA 3A3JA 3MF0A 4HESA 3NJAA 1YLTA 1ERMA 3UB9A 4XUZA 2I9VA 4PM8A 4OQGA 3HLWA 1PI4A 2WKRA 2PR5A 2HP5A 1NRFA 4RQ9A 2J8YA 4CLCB 1VETA 5HL6A 3EGDC 5FDSA 4UA6A 3C5AA 4IEDA 2XGNA 3NHQA 2UWXA 4IUKA 1IELA 3C7VA 3B47A 4I3AA 3A3EA 4DJ2A 2J3TC 1NYMA 2Y2KA 1LLBA 4QY6A 5CEBA 5FAPA 3IS2B 2WUQA 1ALQA 3K3CA 2OOLA 2Z2LB 5FAQA 5M1AA 1OTEA 2Y2HA 1LHYA 2V8CA 5FL3A 2K7SA 3IHBA 5HAQA 2ZQ8A 4BJPA 1L3LA 2Y2MA 3IF6B 5EM0A 4N9KA 4F3LA 3WS5A 3UMEA 5J7EA 4DF6A 4KZBA 4WEJA 5KSHA 5CTMA 1FSYA 4KG5A 3BFCA 3CUEA 2L1MA 5EFWA 2O9CA 3LO7A 3LR0A 3FC7A 3A0RA 4M4XA 3FG8A 5E2FA 3CAXA 2OSUA 1D7EA 2ZC3B 4LLOB 3MXQA 5DKLA 2B18A 2OAQ1 1VQQA 3GR2A 4MN5A 4HHDA 3BY8A 3BY9A 2H28A 4KZ3A 3VOLA 2CMNA 1S1YA 1PZOA 1BT5A 1EROA 1XJ2A 5F82A 5CGXA 3EOIA 2OLVA 4GJ4A 1H8ZA 2PU4A 5E43A 4S2PA 1ES4A 3NOTC 2XF3A 3WS0A 5JYPA 3TOIA 3HLEA 4L0LA 3UDXA 1W5DA 1K57A 2J80A 5FI6A 1MXOA 4HIAA 1WYBA 2WGWA 4MBKA 3TW8A 3VFHA 1W79A 2EWWA 1N4OA 5EE8A 3DW0A 5KSCA 1G6OA 3VE4A 4OOMA 4R4SA 3WRZA 1BTLA 4HBTA 5EVIB 5CHUA 1IYOA 3RXWA 2ZOIA 4EERA 1SHVA 3KSIA 3UPNA 4Y15A 5CERA 2B95A 4JKTA 4ZAMA 3CPTB 4JLFA 3A3IA 1K6SA 3F1OA 4N92A 3D4FA 3T4JA 2HDSA 2V8FA 3OCNA 4XT2A 1M40A 5LBRA 2JHEA 4NG2A 1F9IA 1NLZA 3FZCA 2P9VB 4E3IA 3A0VA 3FV7A 3MS6A 3UMDA 1JNUA 3UB7A 4HEFA 2XD1A 3ZVTA 1SKOA 4NEED 2XR0A 4UAAA 2DNSA 5M19A 3NY4A 1H5XA 2Y2IA 3IXGA 3ZYTA 4CLCE 4X53A 3GVBA 1YMSA 4MEZA 2FZ0A 1IFQA 3VOZA 3IT9A 4Q8IA 1VB6A 2B02A 3HJKA 1D1JA 1FCMA 3C4PA 2JKRM 4FH4A 3GTCA 3B33A 4HQAA 2VX8A 3PXPA 1H3QA 4KZ8A 3ZFZA 4E04A 2M7UA 1J3WA 2KX6A 1E3UA 3FKVA 3NIAA 2A2LA 4MMNA 2LB5A 4OVDA 2PBDP 2CC1A 4JF6A 3GMWA 4DMZA 1OJGA 1P97A 1K54C 3UB5P 5HARA 1IKIA 1KDSA 5MC7A 1RP5A 5IS1A 2X71A 2WKEA 3NOUC 3LYXA 3OOVA 5HPFA 4X56A 2QMIA 1KGFA 3UE3A 4QJGA 4BENA 4WBGA 3CMZA 1K4FA 2VGJA 1W7FA 4Y0OA 3Q1FA 3V67A 4IUHA 4LRYC 3W4QA 4FUWA 4HP9A 2ZQ9A 5DJTA 1CQAA 2R9XA 1YSQA 4Y2FA 3PR6A 3RXXA 3ISGA 3B3XA 3C7UA 3KYZA 2ZQCA 1LL8A 2X02A 4IBRA 2ZLYA 3EGXC 3VP2A 4DXBA 1DP6A 3LR5A 3V5MA 5FQJA 5CHMA 2O9BA 3LI8A 5KZHA 1IYPA 2GJ3A 4OLDA 3GDIA 4MNRA 1EI5A 2M1CA 5TBMA 4OQ0A 3Q81A 4PMAA 2RCXA 5CGWA 1YPRA 5TR7A 3LIEA 4DDYA 3NULA 2XDMA 3N6IA 1LL9A 3NC8A 4ETXA 3LY3A 3Q07A 4RX2A 2V0UA 5FATA 3T4SA 4GN2A 1T1CA 4O8GA 3QP5A 4WMCD 4EBNA 1MZUA 3A3FA 3HUOA 4JXWA 4GD8A 3HLDA 4BD1A 2Y2GA 2ZQAA 4EBPA 5L09A 4DE2A 1G6AA 3KSHA 2BG1A 5GLAA 4R6LA 2JC7A 4BD0A 4EQIA 4YNRA 4QB8A 3LIDA 4CLCA 4EBLA 4WZ4A 2XA7S 3RTYA 2Y2NA 3IH9A 4ZJ2A 2OWJA 1T18A 4MN6A 1KGEA 2Y4AA 4I3IA 4OPRA 3RH8B 1HZOA 1ZG6A 4O0PA 1YLJA 3IS2A 3LUQA 3RJUA 4PHTA 1GSXA 4DE0A 1H8MA 4LPZA 4I5SA 4KZ6A 2OAP1 3IF6A 3IHAA 4XUXA 3OPPA 4LCLA 4PAUA 1NY0A 5I5LA 4HH2A 3MKFA 3QP1A 2NUPC 4NXFA 1KE3A 5FDHA 4MDZA 2W1TB 2JKGA 3F1PB 4Y0UA 3BECA 1MWRA 2INWA 4JF4A 1OTIA 2EFXA 4X55A 1H8YA 2PBYA 2A24B 4B4XA 4P87A 4F94A 1CI8A 2WZZA 3T50A 4E3MA 3DWZA 2VJWA 1Y54A 4GNUA 2QYBA 5GLDA 2VEAA 2VZWA 1W63Q 3OZHA 1E3UD 4RVAA 3L7HA 4G3KA 1AXBA 2XEPA 1ES3A 3HJIA 1N9NA 4S2JA 4WM9A 1XJ6A 2VGLM 5AJGA 4R0QA 4IVKA 2HJEA 5HL1A 4OLGA 1IKGA 3GSGA 1JWZA 2HDRA 3VSLA 2EFUA 5D3OA 5KIZA 4PKYA 4R23A 1XFQA 5EV0A 3VP4A 5DF8A 1G68A 1KE4A 4ZRRA 3E98A 5HWWA 5U47A 5AVFA 5GL9A 1YAXA 1LI0A 3T4OA 1NZOA 2FH5A 2H0TA 1ODVA 1XA7A 1E25A 2JN7A 3ZG0A 4EXOA 2D01A 3UY6A 1PRQA 2WAFA 3KX0X 4YINA 2Q9NA 3UPOA 5EVIA 3MZDA 3SS4A 2W3HA 1FR6A 1MPLA 5EVLA 3T4QA 1L0FA 3A0SA 1OTAA 3G2ZA 5F68A 5HDSA 5I94A 1HVBA 1K57C 5TGFA 3QP8A 3CPTA 1MBLA 3VMAA 3Q82A 1KVMA 1I5QA 4EESA 4E6XA 1IYQA 4FOFA 2EX2A 4K0WA 5JYOA 2ZM2A 1XX2A 3HUNA 2O99A 4NXGA 2P9VA 3ZG8B 4DKIA 3OLOA 4NK3A 2R78A 4ZDXA 1WYCA 3MZEA 2W3GA 3W8KA 3BQ8A 1EWZA 3BLSA 3D9YA 1V9ZA 3HLBA 2E8IA 4BBVA 5EM1A 2L4RA 1DP9A 3JVVA 3AGEA 4Y13A 3KYQA 1K55A 3GRJA 4BL3A 3M2KA 4CQHA 4O7DA 2ZC4B 4CLCD 3S7OA 3VP3A 1CF0A 1Q2PA 1YT4A 1TVFA 5FQMA 2V1ZA 2ZL1B 1LSXA 2Z6DA 4JXSA 4UEYA 2C6WB 5HWVA 1Z09A 3MFXA 2ZD8A 5TFQA 5F83A 4H8RA 2L0WA 4WYYA 4OH0A 2G2UA 4UA9A 2WAEA 1O07A 3R7WB 4EUVA 2PR6A 3LICA 4KZ4A 4PKYG 2ZC6B 3UN7A 3HUMA 4PM7A 3IXDA 2Y2PA 4P6BA 5L8MA 4KZ9A 3PBOA 4Q0IA 3WWXA 1FIKA 4D2OA 4LRZE 1U60A 4DRTA 1VEUB 4HH3A 3LI9A 2KDKA 2OV5A 3A3DA 1PWDA 3E2LA 4GOGA 3T4LA 1GA0A 2EXAA 3GQZA 3UB6A 4K08A 1F5MA 4HJ6A 1YM1A 3JPUA 1ZG4A 1DJAA 1STZA 5HDCA 3TG9A 3HBRA 1CK3A 1P9RA 1BLCA 4ME4A 4OPYA 3CI6A 4KQOA 1MWTA 2K31A 2JKFA 1IOUA 1X0OA 2QJ5A 1TD5A 1PW1A 1HLUP 2ZC5B 3C38A 4DE3A 2A49A 2PAVP 4JGRA 5EOEA 1MWSA 3E0YA 4ZJ1A 5CHJA 2XSSA 3ZG7B 1XGIA 2EA9A 5HDDA 5TJJA 3CLOA 2KOIA 1ONHA 3IXHA 3EQVA 3LCEA 5DTKA 3DTMA 3OPRA 3R4KA 1OTBA 3UPPA 1CJFA 1SDEA 2HDUA 4O01A 3BW6A 1KVLA 3JVUA 2KLIA 1N9OA 1ONGA 4GS9B 3ZCZA 3DBAA 2G2WA 1BLHA 4KZ7A 1TS0A 3UB8A 2XQZA 5EVID 2HP9A 4PM5A 3QP4A 2P08A 5F6AA 1MKIA 4Y0TA 3S4XA 1S4RA 3MJQA 3S7PA 4PM6A 1G28A 3GECA 1GSWA 1CEGA 3C4OA 3HCYA 4C75A 4AFIA 2OLUA 3M2JA 3G2YA 4IHQA 4JF5A 1V9YA 4KUOA 4CLCC 3M6BA 2EX9A 5AQ7A 3VP1A 4B88A 1KGGA 3VE3A 3E4QA 1L0GA 2VK3A 2V1AA 3KO6A 1XA1A 4NXBA 2W1TA 5K5BA 1BUEA 4ZJ3A 1GSVA 3VSKA 4B9OA 3PYPA 4R1GA 3FPVA 2Z2MB 1YSPA 3F1PA 1WA9A 4JXGA 3SZTA 4X25A 3LR4A 3UE6A 5J4EA 2A24A 5DTTA 2OWHA 3VV4A 3CZDA 5CEDA 2W3DA 4WL9A 3H7WB 4C3QA 3IF6C 3GV9A 2PYPA 3IH8A 3CITA 1PYYA 4FCFA 4YOFA 2PHYA 3MFDA 1NXYA 4X1MA 1WE4A 2JKRI 1TS7A 2HJ9C 5KMWA 2Y2LA 3D72A 3C2WA 5DVAA 1KOUA 3W4OA 4QU3A 1YQSA 3N4IA 3E4OA 5FQIA 1XJ4A 4OP8A 4S2NC 3ULFA 4S2OA 3ZDJA 5A92A 2J9PA 1MWUA 4RA7A 4X68A 4GZBA 2Q0OA 4GKUA 4NXEA 1A0KA 5AQ9A 4LCMA 4Y17A 4NKPA 2JKTM 2GX5A 2ZM0A 4EU0A 4HBUA 4KQQA 1H0MA 3VP0A 4LENA 1W63M 4GCZA 1VM1A 1KE0A 1BZAA 1Y28A 1YLZA 5HD5A 4R3JA 5DKKA 2M7VA 1JTDA 1SDNA 5FQ9A 1K56A 4R38A 3HLFA 4P6ZM 1W8YA 4G3VA 4HY8A 3TJZC 3BEBA 4II7A 2JE5A 3TSGA 4LV3A 1YLWA 3CWFA 3NOPC 3BJNA 1PWGA 2H10A 4S2MA 3W2ZA 4JGQA 4OQHA 5G18A 1NYYA 4QHCA 5A8BA 2YKFA 1ZC2A 1ZTUA 1FCOA 2Y91A 1F2KA 3E2KA 3DTKA 1NZUA 2ZOHA 2DRWA 3G4PA 3OC2A 2PT7A 5DJUA 3K2NA 2WGIA 3EEHA 3QNCA 5EVIC 3N8RA 2MJ6A 1LL5A 1NWZA 4IJGA 4S2KA 3KYEA 5HD3A 3G34A 5IT5A 1UWPX 4RYEA 3UDIA 3LIFA 2DMWA 2XLNA 3C8CA 4I39A 4UQIM 4OOYA 5CRFA 5C5KA 3T1QB 3E4PA 3G32A 4MBFA 3MXRA 2GNXA 3P01A 2QZ6A 3Q7ZA 3N7WA 2GZAA 3B42A 1W8QA 3H9WA 4GHIB 3PAGA 2XFTA 2W3FA 3T4KA 1HD8A 2ZBBA 1FR1A 3BLMA 2XK1A
chains in the Genus database with same CATH topology
3WS1A 1XX2A 1ZKJA 2Y2OA 3HUNA 4OOMA 4MLLA 2HDQA 4QY5A 4R4SA 3BFGA 3WRZA 1BTLA 2P9VA 4HBTA 3ZG8B 5EVIB 5CHUA 3O86A 4DKIA 4NK3A 4N1XA 1IYOA 3RXWA 3V3SA 4ZDXA 1WYCA 3MZEA 2EX6A 5M18A 1RGYA 1SHVA 3W8KA 3ZHHA 1EWZA 3UPNA 5CERA 3BLSA 2ZMAA 4GDNA 1FSWA 3M6HA 4WEKA 3HLCA 3HLBA 1JWVA 2E8IA 4JKTA 4ZAMA 2B5RA 4JLFA 3BFFA 1K6RA 3A3IA 3ITBA 1K6SA 5L2FA 1XXMA 2WGWB 4N92A 3D4FA 2HDSA 3AGEA 3OCNA 3VFFA 5FI7A 1M40A 3WRTA 3WS2A 1FCNA 1K55A 2A3UA 3GRJA 2C5WB 1K38A 4BL3A 3M2KA 4U3TA 4O7DA 3ZG5A 2ZC4B 4KENB 3HL9A 3VP3A 3AGDA 5EUAA 4S2LA 3FZCA 1Q2PA 1YT4A 3BM6A 4JBFA 1TVFA 2P9VB 3JYIA 5FQMA 2V1ZA 5GHYA 3IWOA 4CPKA 4E3IA 1GCEA 4DXCA 1NJ4A 3FV7A 4JXSA 2C6WB 1RCJA 4BENA 1TDLA 1YLPA 1HTZA 4NETA 2V2FF 2ZD8A 4HEFA 2XD1A 2ZM8A 4GB7A 4OOLA 1I2SA 4OPZA 5HX9A 3ZVTA 5F1FA 2XR0A 4UAAA 4MBHA 1RGZA 2DNSA 4X69A 5DF9A 3SS3A 5TFQA 5F83A 1K25A 4H8RA 4K91A 4WYYA 1BLSA 5M19A 4OH0A 3OPHA 4S2IA 2G2UA 1CEFA 3NY4A 2WAEA 4UA9A 1SKFA 3UE1A 1O07A 2FFFB 1H5XA 2PU2A 2Y2IA 3IXGA 3G30A 4EV4A 3DWKA 4X53A 4DDSA 1ES5A 3GVBA 1YMSA 4MEZA 4U0XA 4UHUA 5F1GA 1C3BA 3VOZA 3IT9A 3LEZA 4ZTKA 3NCKA 3CJMA 4KZ4A 4Q8IA 1IYSA 5FASA 2ZC6B 3UN7A 3SH7A 3HUMA 1FCMA 1S0WA 4PM7A 3IXDA 3C4PA 4IBXA 2VGKA 2Y2PA 4P6BA 1PIOA 4KZ9A 4FH4A 4B4ZA 3PBOA 4PM9A 3GTCA 3P98A 3EQUA 3SH9A 3W4PA 3WWXA 4WZ5C 4KZ8A 3ZFZA 4D2OA 1E3UA 4E3KA 4WZ5A 3FKVA 3I7JA 3NIAA 1U60A 5CTNA 5FI2A 3VOYA 2XFSA 5A91A 4DRTA 4OVDA 3ZNTA 2OV5A 3A3DA 1PWDA 3E2LA 2CC1A 4GOGA 4JF6A 3PBRA 4P0MA 3GMWA 3N8LA 1GA0A 5AQAA 2I72A 4KG2A 1K54C 5IHVA 2H0YA 5HARA 2EXAA 3UE0A 1IKIA 1KDSA 4E3NA 3GQZA 1K54A 4DE1A 3MBZA 5EPHA 4K0XA 1RP5A 1YM1A 2WKEA 2X71A 4JXVA 3ZVWA 1K4EA 1ZG4A 1ESIA 3ZG9B 1DJAA 4X56A 5A93A 3TG9A 2QMIA 1KGFA 1FQGA 3HBRA 3UE3A 4QJGA 1CK3A 2J9OA 1BLCA 4WBGA 3CMZA 1K4FA 2J7VA 2VGJA 3ZNYA 3S22A 5DTSA 1W7FA 4OPYA 3QNBA 3Q1FA 4Y0OA 4KQOA 1MWTA 4R4RA 3AGFA 3O88A 3W4QA 5HAPA 4GDBA 4FD8A 4BQMA 1PW1A 2ZQ9A 3BRMA 3NBLA 2ZC5B 2EXBA 5E2EA 4P85A 2R9XA 4DE3A 2A49A 4X6TA 5E2HA 1K56D 3RXXA 5EOEA 1MWSA 2FFYA 1QMEA 3ISGA 3B3XA 4ZJ1A 3C7UA 3UNWA 2JBFA 5CHJA 2ZQCA 3ZG7B 1XGIA 4BLMA 3N8SA 2DCFA 3SOIA 2X02A 1ONHA 2XD5A 4IBRA 5FA7A 3IXHA 3EQVA 2ZLYA 3LCEA 5DTKA 4N1HA 3VP2A 4E6WA 4DXBA 2Y55A 3DTMA 1K55C 1TDGA 3V5MA 1GHPA 5CGSA 1LI9A 5FQJA 4EWFA 3OPRA 5CHMA 4S2NA 5EECA 1JWPA 2X01A 1ES2A 1TEMA 3UPPA 4ZBEA 1J9MA 5KZHA 1IYPA 4OLDA 1L0DA 1SDEA 2HDUA 4MNRA 3DW0A 2P74A 2BLSA 1EI5A 4KZ5A 1KVLA 2EX8A 1ONGA 4OQ0A 3ZCZA 3Q81A 4PMAA 2RCXA 1YLYA 3OPLA 4LV2A 5CGWA 5TR7A 2G2WA 4KZAA 1BLHA 4KZ7A 4DDYA 2H5SA 2RL3A 4LV1A 2XDMA 1MY8A 2XQZA 5EVID 3N6IA 2HP9A 4CJNA 4QD4A 1XPBA 5A90A 1OMEA 4PM5A 1DY6A 4YFMA 1LL9A 3NC8A 3IXBA 4FH2A 3LY3A 3Q07A 3G35A 4UA7A 1GHMA 1O7EA 2WZXA 1SCWA 4RX2A 3V3RA 1M6KA 1PWCA 5FATA 3G31A 4GN2A 1MKIA 2ZQDA 3PAEA 4Y0TA 4WMCD 3S4XA 3IF5A 4C6YA 4OKPA 1BSGA 4OQIA 3OCLA 2ZQ7A 2WGVA 4EBNA 2Y2QA 4PM6A 3A3FA 3HUOA 1DJBA 4JXWA 5HFOA 2QPNA 5FSRA 4GD8A 3Q7VA 1BLPA 3HLDA 4BD1A 2Y2GA 2ZQAA 1CEGA 3C4OA 4EBPA 1ESUA 5EOOA 3BFDA 4JPMA 4C75A 4DE2A 5GLBA 1G6AA 2OLUA 3UDFA 3M2JA 5GLAA 2BG1A 3G2YA 3HLGA 4E3OA 4E3LA 1DJCA 3UO9A 2JC7A 4BD0A 4JF5A 2ZJ9A 4EQIA 3WS4A 3M6BA 4FSFA 2Y2JA 4QB8A 2EX9A 4XXRA 2WKIA 5AQ7A 4EBLA 4WZ4A 5JYOA 3SS5A 1L0EA 3VP1A 5GHZA 2Y2NA 3FYZA 3IH9A 4B88A 4ZJ2A 2HPBA 3IWIA 1GA9A 3PBQA 4R3BA 1KGGA 2IWCA 1JTGA 2R9WA 1KGEA 1ERQA 2WYXA 2Y4AA 3MXSA 4ID4A 4OPRA 1L0GA 1PZPA 1XA1A 1HZOA 1ZG6A 3HVFA 1FOFA 1BUEA 1XGJA 3HREA 3O3VA 4ZJ3A 3VSKA 3FKWA 4R1GA 5E2GA 1IEMA 5BOHA 2Z2MB 3A3JA 1BULA 3Q7VB 4HESA 5AQBA 1YLJA 3LY4A 3ZGAB 1YLTA 4JXGA 3O87A 4LV0A 3SH8A 5DTTA 3CZDA 1ERMA 3RJUA 4WELA 4DE0A 5CEDA 3S1YA 4XUZA 4WMCA 4PM8A 4C3QA 4OQGA 3IF6C 1QMFA 4KZ6A 3HLWA 5DF7A 1PI4A 3ITAA 2HP5A 3GV9A 3IF6A 1NRFA 3IHAA 4RX3A 4XUXA 2J8YA 3IH8A 3OPPA 1PYYA 3PBSA 4FCFA 4M3KA 4LCLA 1NY0A 5GLCA 3MFDA 1NXYA 4UA6A 4EUZA 3C5AA 1WE4A 3MKFA 2XGNA 4IEDA 1N9BA 2WADA 1KE3A 5KMWA 2Y2LA 5FDHA 4OPQA 5DVAA 3V39A 2UWXA 3W4OA 4QU3A 1IELA 1YQSA 3C7VA 3N4IA 1GHIA 5CXWA 5FQIA 4KG6A 4OP8A 3A3EA 4S2NC 1NYMA 4S2OA 4Y0UA 3BECA 2Y2KA 1MWRA 3ZDJA 5A92A 2J9PA 1LLBA 4JF4A 2EFXA 1MWUA 4X55A 1H8YA 2PBYA 4QY6A 1S6RA 4RA7A 4GZBA 4GKUA 4X68A 5FAPA 5CEBA 2WUQA 1ALQA 1L2SA 5AQ9A 2Z2LB 4LCMA 5FAQA 5M1AA 2Y2HA 4B4XA 4P87A 4F94A 5J8XA 1LHYA 3NDEA 3PBTA 5CECA 1CI8A 3IHBA 4OP5A 1E4DA 5HAQA 2WZZA 2ZQ8A 1I2WA 3BFEA 1CI9A 4BJPA 4E3MA 1PW8A 3V50A 3DWZA 1Y54A 2ZM0A 4OONA 2Y2MA 3IF6B 4GNUA 4HBUA 4N9KA 5HW3A 4KQQA 5GLDA 3PTEA 4GD6A 3WS5A 1XP4A 2IWBA 3BYDA 3VP0A 3CG5A 3OZHA 4DF6A 1E3UD 4LENA 4KZBA 4RVAA 4WEJA 1PI5A 1VM1A 1KE0A 1Q2QA 4PPRA 1AXBA 2XEPA 1ES3A 5KSHA 1BZAA 1YLZA 5CTMA 1FSYA 4KG5A 2XH9A 4S2JA 4WM9A 4R3JA 3BFCA 3IQAA 2GDNA 1JTDA 1SDNA 5FAOA 3NI9A 5FQ9A 1K56A 4R0QA 4IVKA 4Y7PA 3HLFA 4N9LA 3LO7A 5HL1A 4OLGA 1IKGA 3GSGA 1JWZA 1W8YA 2HDRA 3VSLA 5E2FA 3PBNA 2EFUA 2JCHA 3BEBA 5D3OA 2JE5A 3TSGA 4R23A 2OSUA 1YLWA 4LV3A 3VP4A 5DF8A 1G68A 1KE4A 2ZC3B 5U47A 1PWGA 5GL9A 2H10A 4S2MA 5GHXA 4OQHA 1LI0A 1NZOA 3P09A 1VQQA 5G18A 1NYYA 2H0TA 3GR2A 4QHCA 1ZC2A 1FCOA 1XA7A 1E25A 2Y91A 4KZ3A 3ZG0A 3E2KA 1PZOA 1NZUA 1BT5A 2DRWA 1EROA 3G4PA 3OC2A 1KDWA 3UY6A 5F82A 3MZFA 5CGXA 3QHYA 2WAFA 2HP6A 2WGIA 3QNCA 4YINA 2WK0A 5EVIC 1XKZA 2OLVA 2Q9NA 3N8RA 1H8ZA 3UPOA 2V20A 2WKHA 5EVIA 1LL5A 2PU4A 4S2KA 3MZDA 3SS4A 1FR6A 1MPLA 3G34A 4U0TA 5EVLA 5E43A 1L0FA 4S2PA 3NDGA 4RYEA 3UDIA 2ZC7A 1ES4A 2Y59A 3IWQA 2XLNA 5FQKA 3G2ZA 2XF3A 5HAIA 3WS0A 4OOYA 4E3JA 5JYPA 5CRFA 3TOIA 4BL2A 5FQQA 3HLEA 5I94A 2IWDA 4L0LA 1HVBA 3UDXA 1K57C 3G32A 4IVIA 3MXRA 1W5DA 4MBFA 5TGFA 2QZ6A 3Q7ZA 3N7WA 1K57A 2Q9MA 1W8QA 5FI6A 1MBLA 1JVJA 1MXOA 1WYBA 3VMAA 3MKEA 2WGWA 4A5RA 4MBKA 3Q82A 3VFHA 1KVMA 1I5QA 1Z6FA 3PAGA 2XFTA 4E6XA 4Z9QA 1W79A 1HD8A 1YMXA 1FR1A 3FWLA 3BLMA 1N4OA 1IYQA 2EX2A 2XK1A 4K0WA 5EE8A 2ZM2A 5KSCA 4KQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WS1 A;  1XX2 A;  1ZKJ A;  2Y2O A;  3HUN A;  4OOM A;  4MLL A;  2HDQ A;  4QY5 A;  4R4S A;  3BFG A;  3WRZ A;  1BTL A;  2P9V A;  4HBT A;  3ZG8 B;  5EVI B;  5CHU A;  3O86 A;  4DKI A;  4NK3 A;  4N1X A;  1IYO A;  3RXW A;  3V3S A;  4ZDX A;  1WYC A;  3MZE A;  2EX6 A;  5M18 A;  1RGY A;  1SHV A;  3W8K A;  3ZHH A;  1EWZ A;  3UPN A;  5CER A;  3BLS A;  2ZMA A;  4GDN A;  1FSW A;  3M6H A;  4WEK A;  3HLC A;  3HLB A;  1JWV A;  2E8I A;  4JKT A;  4ZAM A;  2B5R A;  4JLF A;  3BFF A;  1K6R A;  3A3I A;  3ITB A;  1K6S A;  5L2F A;  1XXM A;  2WGW B;  4N92 A;  3D4F A;  2HDS A;  3AGE A;  3OCN A;  3VFF A;  5FI7 A;  1M40 A;  3WRT A;  3WS2 A;  1FCN A;  1K55 A;  2A3U A;  3GRJ A;  2C5W B;  1K38 A;  4BL3 A;  3M2K A;  4U3T A;  4O7D A;  3ZG5 A;  2ZC4 B;  4KEN B;  3HL9 A;  3VP3 A;  3AGD A;  5EUA A;  4S2L A;  3FZC A;  1Q2P A;  1YT4 A;  3BM6 A;  4JBF A;  1TVF A;  2P9V B;  3JYI A;  5FQM A;  2V1Z A;  5GHY A;  3IWO A;  4CPK A;  4E3I A;  1GCE A;  4DXC A;  1NJ4 A;  3FV7 A;  4JXS A;  2C6W B;  1RCJ A;  4BEN A;  1TDL A;  1YLP A;  1HTZ A;  4NET A;  2V2F F;  2ZD8 A;  4HEF A;  2XD1 A;  2ZM8 A;  4GB7 A;  4OOL A;  1I2S A;  4OPZ A;  5HX9 A;  3ZVT A;  5F1F A;  2XR0 A;  4UAA A;  4MBH A;  1RGZ A;  2DNS A;  4X69 A;  5DF9 A;  3SS3 A;  5TFQ A;  5F83 A;  1K25 A;  4H8R A;  4K91 A;  4WYY A;  1BLS A;  5M19 A;  4OH0 A;  3OPH A;  4S2I A;  2G2U A;  1CEF A;  3NY4 A;  2WAE A;  4UA9 A;  1SKF A;  3UE1 A;  1O07 A;  2FFF B;  1H5X A;  2PU2 A;  2Y2I A;  3IXG A;  3G30 A;  4EV4 A;  3DWK A;  4X53 A;  4DDS A;  1ES5 A;  3GVB A;  1YMS A;  4MEZ A;  4U0X A;  4UHU A;  5F1G A;  1C3B A;  3VOZ A;  3IT9 A;  3LEZ A;  4ZTK A;  3NCK A;  3CJM A;  4KZ4 A;  4Q8I A;  1IYS A;  5FAS A;  2ZC6 B;  3UN7 A;  3SH7 A;  3HUM A;  1FCM A;  1S0W A;  4PM7 A;  3IXD A;  3C4P A;  4IBX A;  2VGK A;  2Y2P A;  4P6B A;  1PIO A;  4KZ9 A;  4FH4 A;  4B4Z A;  3PBO A;  4PM9 A;  3GTC A;  3P98 A;  3EQU A;  3SH9 A;  3W4P A;  3WWX A;  4WZ5 C;  4KZ8 A;  3ZFZ A;  4D2O A;  1E3U A;  4E3K A;  4WZ5 A;  3FKV A;  3I7J A;  3NIA A;  1U60 A;  5CTN A;  5FI2 A;  3VOY A;  2XFS A;  5A91 A;  4DRT A;  4OVD A;  3ZNT A;  2OV5 A;  3A3D A;  1PWD A;  3E2L A;  2CC1 A;  4GOG A;  4JF6 A;  3PBR A;  4P0M A;  3GMW A;  3N8L A;  1GA0 A;  5AQA A;  2I72 A;  4KG2 A;  1K54 C;  5IHV A;  2H0Y A;  5HAR A;  2EXA A;  3UE0 A;  1IKI A;  1KDS A;  4E3N A;  3GQZ A;  1K54 A;  4DE1 A;  3MBZ A;  5EPH A;  4K0X A;  1RP5 A;  1YM1 A;  2WKE A;  2X71 A;  4JXV A;  3ZVW A;  1K4E A;  1ZG4 A;  1ESI A;  3ZG9 B;  1DJA A;  4X56 A;  5A93 A;  3TG9 A;  2QMI A;  1KGF A;  1FQG A;  3HBR A;  3UE3 A;  4QJG A;  1CK3 A;  2J9O A;  1BLC A;  4WBG A;  3CMZ A;  1K4F A;  2J7V A;  2VGJ A;  3ZNY A;  3S22 A;  5DTS A;  1W7F A;  4OPY A;  3QNB A;  3Q1F A;  4Y0O A;  4KQO A;  1MWT A;  4R4R A;  3AGF A;  3O88 A;  3W4Q A;  5HAP A;  4GDB A;  4FD8 A;  4BQM A;  1PW1 A;  2ZQ9 A;  3BRM A;  3NBL A;  2ZC5 B;  2EXB A;  5E2E A;  4P85 A;  2R9X A;  4DE3 A;  2A49 A;  4X6T A;  5E2H A;  1K56 D;  3RXX A;  5EOE A;  1MWS A;  2FFY A;  1QME A;  3ISG A;  3B3X A;  4ZJ1 A;  3C7U A;  3UNW A;  2JBF A;  5CHJ A;  2ZQC A;  3ZG7 B;  1XGI A;  4BLM A;  3N8S A;  2DCF A;  3SOI A;  2X02 A;  1ONH A;  2XD5 A;  4IBR A;  5FA7 A;  3IXH A;  3EQV A;  2ZLY A;  3LCE A;  5DTK A;  4N1H A;  3VP2 A;  4E6W A;  4DXB A;  2Y55 A;  3DTM A;  1K55 C;  1TDG A;  3V5M A;  1GHP A;  5CGS A;  1LI9 A;  5FQJ A;  4EWF A;  3OPR A;  5CHM A;  4S2N A;  5EEC A;  1JWP A;  2X01 A;  1ES2 A;  1TEM A;  3UPP A;  4ZBE A;  1J9M A;  5KZH A;  1IYP A;  4OLD A;  1L0D A;  1SDE A;  2HDU A;  4MNR A;  3DW0 A;  2P74 A;  2BLS A;  1EI5 A;  4KZ5 A;  1KVL A;  2EX8 A;  1ONG A;  4OQ0 A;  3ZCZ A;  3Q81 A;  4PMA A;  2RCX A;  1YLY A;  3OPL A;  4LV2 A;  5CGW A;  5TR7 A;  2G2W A;  4KZA A;  1BLH A;  4KZ7 A;  4DDY A;  2H5S A;  2RL3 A;  4LV1 A;  2XDM A;  1MY8 A;  2XQZ A;  5EVI D;  3N6I A;  2HP9 A;  4CJN A;  4QD4 A;  1XPB A;  5A90 A;  1OME A;  4PM5 A;  1DY6 A;  4YFM A;  1LL9 A;  3NC8 A;  3IXB A;  4FH2 A;  3LY3 A;  3Q07 A;  3G35 A;  4UA7 A;  1GHM A;  1O7E A;  2WZX A;  1SCW A;  4RX2 A;  3V3R A;  1M6K A;  1PWC A;  5FAT A;  3G31 A;  4GN2 A;  1MKI A;  2ZQD A;  3PAE A;  4Y0T A;  4WMC D;  3S4X A;  3IF5 A;  4C6Y A;  4OKP A;  1BSG A;  4OQI A;  3OCL A;  2ZQ7 A;  2WGV A;  4EBN A;  2Y2Q A;  4PM6 A;  3A3F A;  3HUO A;  1DJB A;  4JXW A;  5HFO A;  2QPN A;  5FSR A;  4GD8 A;  3Q7V A;  1BLP A;  3HLD A;  4BD1 A;  2Y2G A;  2ZQA A;  1CEG A;  3C4O A;  4EBP A;  1ESU A;  5EOO A;  3BFD A;  4JPM A;  4C75 A;  4DE2 A;  5GLB A;  1G6A A;  2OLU A;  3UDF A;  3M2J A;  5GLA A;  2BG1 A;  3G2Y A;  3HLG A;  4E3O A;  4E3L A;  1DJC A;  3UO9 A;  2JC7 A;  4BD0 A;  4JF5 A;  2ZJ9 A;  4EQI A;  3WS4 A;  3M6B A;  4FSF A;  2Y2J A;  4QB8 A;  2EX9 A;  4XXR A;  2WKI A;  5AQ7 A;  4EBL A;  4WZ4 A;  5JYO A;  3SS5 A;  1L0E A;  3VP1 A;  5GHZ A;  2Y2N A;  3FYZ A;  3IH9 A;  4B88 A;  4ZJ2 A;  2HPB A;  3IWI A;  1GA9 A;  3PBQ A;  4R3B A;  1KGG A;  2IWC A;  1JTG A;  2R9W A;  1KGE A;  1ERQ A;  2WYX A;  2Y4A A;  3MXS A;  4ID4 A;  4OPR A;  1L0G A;  1PZP A;  1XA1 A;  1HZO A;  1ZG6 A;  3HVF A;  1FOF A;  1BUE A;  1XGJ A;  3HRE A;  3O3V A;  4ZJ3 A;  3VSK A;  3FKW A;  4R1G A;  5E2G A;  1IEM A;  5BOH A;  2Z2M B;  3A3J A;  1BUL A;  3Q7V B;  4HES A;  5AQB A;  1YLJ A;  3LY4 A;  3ZGA B;  1YLT A;  4JXG A;  3O87 A;  4LV0 A;  3SH8 A;  5DTT A;  3CZD A;  1ERM A;  3RJU A;  4WEL A;  4DE0 A;  5CED A;  3S1Y A;  4XUZ A;  4WMC A;  4PM8 A;  4C3Q A;  4OQG A;  3IF6 C;  1QMF A;  4KZ6 A;  3HLW A;  5DF7 A;  1PI4 A;  3ITA A;  2HP5 A;  3GV9 A;  3IF6 A;  1NRF A;  3IHA A;  4RX3 A;  4XUX A;  2J8Y A;  3IH8 A;  3OPP A;  1PYY A;  3PBS A;  4FCF A;  4M3K A;  4LCL A;  1NY0 A;  5GLC A;  3MFD A;  1NXY A;  4UA6 A;  4EUZ A;  3C5A A;  1WE4 A;  3MKF A;  2XGN A;  4IED A;  1N9B A;  2WAD A;  1KE3 A;  5KMW A;  2Y2L A;  5FDH A;  4OPQ A;  5DVA A;  3V39 A;  2UWX A;  3W4O A;  4QU3 A;  1IEL A;  1YQS A;  3C7V A;  3N4I A;  1GHI A;  5CXW A;  5FQI A;  4KG6 A;  4OP8 A;  3A3E A;  4S2N C;  1NYM A;  4S2O A;  4Y0U A;  3BEC A;  2Y2K A;  1MWR A;  3ZDJ A;  5A92 A;  2J9P A;  1LLB A;  4JF4 A;  2EFX A;  1MWU A;  4X55 A;  1H8Y A;  2PBY A;  4QY6 A;  1S6R A;  4RA7 A;  4GZB A;  4GKU A;  4X68 A;  5FAP A;  5CEB A;  2WUQ A;  1ALQ A;  1L2S A;  5AQ9 A;  2Z2L B;  4LCM A;  5FAQ A;  5M1A A;  2Y2H A;  4B4X A;  4P87 A;  4F94 A;  5J8X A;  1LHY A;  3NDE A;  3PBT A;  5CEC A;  1CI8 A;  3IHB A;  4OP5 A;  1E4D A;  5HAQ A;  2WZZ A;  2ZQ8 A;  1I2W A;  3BFE A;  1CI9 A;  4BJP A;  4E3M A;  1PW8 A;  3V50 A;  3DWZ A;  1Y54 A;  2ZM0 A;  4OON A;  2Y2M A;  3IF6 B;  4GNU A;  4HBU A;  4N9K A;  5HW3 A;  4KQQ A;  5GLD A;  3PTE A;  4GD6 A;  3WS5 A;  1XP4 A;  2IWB A;  3BYD A;  3VP0 A;  3CG5 A;  3OZH A;  4DF6 A;  1E3U D;  4LEN A;  4KZB A;  4RVA A;  4WEJ A;  1PI5 A;  1VM1 A;  1KE0 A;  1Q2Q A;  4PPR A;  1AXB A;  2XEP A;  1ES3 A;  5KSH A;  1BZA A;  1YLZ A;  5CTM A;  1FSY A;  4KG5 A;  2XH9 A;  4S2J A;  4WM9 A;  4R3J A;  3BFC A;  3IQA A;  2GDN A;  1JTD A;  1SDN A;  5FAO A;  3NI9 A;  5FQ9 A;  1K56 A;  4R0Q A;  4IVK A;  4Y7P A;  3HLF A;  4N9L A;  3LO7 A;  5HL1 A;  4OLG A;  1IKG A;  3GSG A;  1JWZ A;  1W8Y A;  2HDR A;  3VSL A;  5E2F A;  3PBN A;  2EFU A;  2JCH A;  3BEB A;  5D3O A;  2JE5 A;  3TSG A;  4R23 A;  2OSU A;  1YLW A;  4LV3 A;  3VP4 A;  5DF8 A;  1G68 A;  1KE4 A;  2ZC3 B;  5U47 A;  1PWG A;  5GL9 A;  2H10 A;  4S2M A;  5GHX A;  4OQH A;  1LI0 A;  1NZO A;  3P09 A;  1VQQ A;  5G18 A;  1NYY A;  2H0T A;  3GR2 A;  4QHC A;  1ZC2 A;  1FCO A;  1XA7 A;  1E25 A;  2Y91 A;  4KZ3 A;  3ZG0 A;  3E2K A;  1PZO A;  1NZU A;  1BT5 A;  2DRW A;  1ERO A;  3G4P A;  3OC2 A;  1KDW A;  3UY6 A;  5F82 A;  3MZF A;  5CGX A;  3QHY A;  2WAF A;  2HP6 A;  2WGI A;  3QNC A;  4YIN A;  2WK0 A;  5EVI C;  1XKZ A;  2OLV A;  2Q9N A;  3N8R A;  1H8Z A;  3UPO A;  2V20 A;  2WKH A;  5EVI A;  1LL5 A;  2PU4 A;  4S2K A;  3MZD A;  3SS4 A;  1FR6 A;  1MPL A;  3G34 A;  4U0T A;  5EVL A;  5E43 A;  1L0F A;  4S2P A;  3NDG A;  4RYE A;  3UDI A;  2ZC7 A;  1ES4 A;  2Y59 A;  3IWQ A;  2XLN A;  5FQK A;  3G2Z A;  2XF3 A;  5HAI A;  3WS0 A;  4OOY A;  4E3J A;  5JYP A;  5CRF A;  3TOI A;  4BL2 A;  5FQQ A;  3HLE A;  5I94 A;  2IWD A;  4L0L A;  1HVB A;  3UDX A;  1K57 C;  3G32 A;  4IVI A;  3MXR A;  1W5D A;  4MBF A;  5TGF A;  2QZ6 A;  3Q7Z A;  3N7W A;  1K57 A;  2Q9M A;  1W8Q A;  5FI6 A;  1MBL A;  1JVJ A;  1MXO A;  1WYB A;  3VMA A;  3MKE A;  2WGW A;  4A5R A;  4MBK A;  3Q82 A;  3VFH A;  1KVM A;  1I5Q A;  1Z6F A;  3PAG A;  2XFT A;  4E6X A;  4Z9Q A;  1W79 A;  1HD8 A;  1YMX A;  1FR1 A;  3FWL A;  3BLM A;  1N4O A;  1IYQ A;  2EX2 A;  2XK1 A;  4K0W A;  5EE8 A;  2ZM2 A;  5KSC A;  4KQR A; 
#chains in the Genus database with same CATH topology
 2Y2O A;  4MLL A;  2HDQ A;  3BFG A;  1UGU A;  2HV1 A;  4R3A A;  1K0K A;  1LSW A;  2ZL1 A;  3O86 A;  4N1X A;  3MMH A;  3LEQ A;  1DP8 A;  2EX6 A;  1RGY A;  3ZHH A;  3LGO A;  3EEA A;  5HWT A;  3MQQ A;  2WKP A;  4GDN A;  1FSW A;  3LFV A;  4WEK A;  3HLC A;  4HJ4 A;  1NLY A;  3L9K A;  3BFF A;  1XXM A;  1Y4O A;  3R7W A;  3G6O A;  3WRT A;  2A3U A;  2C5W B;  2VGL S;  3MR0 A;  3ZG5 A;  3AGD A;  3BM6 A;  4JBF A;  3IWO A;  4EQ1 A;  3CUE C;  2W3E A;  5FEG A;  1YKD A;  1TDL A;  4I38 A;  1YLP A;  1HTZ A;  4NET A;  2V2F F;  5F1F A;  4GB7 A;  4OOL A;  1I2S A;  5HX9 A;  4YWZ A;  4MBH A;  1RGZ A;  1S4S A;  4X69 A;  5DF9 A;  3SS3 A;  4EET B;  1K25 A;  4K91 A;  1VEU A;  4Y3I A;  1CEF A;  4QPR A;  3DTE A;  3UE1 A;  3SW1 A;  4BBU A;  4DDS A;  4U0X A;  3CJM A;  3SH7 A;  1S0W A;  1ZHH B;  4IBX A;  2VGK A;  4B4Z A;  4PM9 A;  3LIB A;  3W4P A;  3EQU A;  3SH9 A;  5F5Y A;  4WZ5 A;  5HZH A;  4QWO A;  5CTN A;  5FI2 A;  2V1B A;  2XFS A;  5A91 A;  3VOY A;  3ICY A;  3ZNT A;  2Z6C A;  3PBR A;  4P0M A;  2BAS A;  2H0Y A;  3UE0 A;  4DE1 A;  4JXV A;  4ARZ B;  3ZVW A;  1ESI A;  5A93 A;  1FQG A;  4LGW A;  4H6J B;  1OPX A;  3MQO A;  2XRN A;  3QNB A;  4R4R A;  3O88 A;  5HAP A;  4GS9 A;  4GDB A;  4HJ3 A;  4L9E A;  4BQM A;  3BRM A;  3F1N B;  3NBL A;  2EXB A;  4EEU A;  4X6T A;  3NEC A;  1K56 D;  2V0W A;  5DFY A;  3LR3 A;  3UNW A;  4BLM A;  3DTI A;  1LSV A;  4N1H A;  1PFL A;  1TDG A;  2NUT C;  4Q0J A;  1GHP A;  5CGS A;  4ETZ A;  5EEC A;  2X01 A;  1TEM A;  2YKH A;  4ZBE A;  2P04 A;  1L0D A;  5J3W A;  2P74 A;  4KZ5 A;  2EX8 A;  5L07 A;  1VHM A;  4B93 A;  1UWN X;  1YLY A;  3OPL A;  4LV2 A;  5DFX A;  2H5S A;  1TS8 A;  4D60 A;  1MY8 A;  5IU1 A;  4QD4 A;  5A90 A;  1OME A;  1DY6 A;  2UV0 E;  4FH2 A;  5HSQ A;  2E8J A;  4UA7 A;  1GHM A;  1O7E A;  1SCW A;  4LFU A;  1M6K A;  1PWC A;  3H82 B;  4JGP A;  2VKS A;  3IX3 A;  3U4L P;  3IBR A;  3PAE A;  3IF5 A;  4OKP A;  2WGV A;  2Y2Q A;  1DJB A;  2PD7 A;  1DRM A;  5HFO A;  4JGO A;  5EOO A;  2ZMV A;  2W1R A;  3BFD A;  4JPM A;  3T4T A;  5GLB A;  4LRX C;  3BQA A;  5L10 A;  4E3O A;  4E3L A;  3H7W A;  1S67 L;  2WKQ A;  4XXR A;  1EW0 A;  2WKI A;  3SS5 A;  5GHZ A;  3FYZ A;  2HPB A;  3IWI A;  1GA9 A;  3PBQ A;  3ZQ5 A;  1JTG A;  2R9W A;  1ERQ A;  4I3J A;  3MXS A;  4ID4 A;  4G3W A;  1PZP A;  3KSG A;  1XGJ A;  3HRE A;  2PRF A;  3O3V A;  3FKW A;  5E2G A;  1BUL A;  3Q7V B;  5AQB A;  3LY4 A;  3ZGA B;  3O87 A;  4LV0 A;  3SH8 A;  4HNB A;  4WEL A;  3S1Y A;  3EWK A;  4WMC A;  2W27 A;  1QMF A;  5DF7 A;  3ITA A;  2VV8 A;  4RX3 A;  2V9A A;  3PBS A;  4M3K A;  2AVX A;  5GLC A;  4EUZ A;  1N9B A;  2WAD A;  4OPQ A;  3V39 A;  3MQ0 A;  1GHI A;  5CXW A;  2IA2 A;  4KG6 A;  1S6R A;  1L2S A;  5J8X A;  3PBT A;  3NDE A;  5CEC A;  4OP5 A;  2PYR A;  1E4D A;  2PD8 A;  3BFE A;  1I2W A;  1CI9 A;  1PW8 A;  3V50 A;  5FEF A;  3TRC A;  4OON A;  5HW3 A;  1VET B;  3PTE A;  4GD6 A;  4ESP A;  1XP4 A;  2IWB A;  3BYD A;  3CG5 A;  1S66 L;  2O9A A;  2O0Y A;  1OJ5 A;  1PI5 A;  1Q2Q A;  1TF1 A;  4PPR A;  3T1R A;  2ZMF A;  3RFB A;  2XH9 A;  2HZ5 A;  3IQA A;  3QP6 A;  2GDN A;  2W0N A;  5FAO A;  3NI9 A;  4DJ3 A;  2QWS A;  4Y7P A;  4N9L A;  3PBN A;  2JCH A;  4BBT A;  2QJ7 A;  2HGV A;  4BWI A;  1OT9 A;  4EEP A;  3T1X A;  1T1A A;  5GHX A;  4F3L B;  3P09 A;  2BTF P;  1N9L A;  4GHI A;  1ACF A;  1KDW A;  3MZF A;  3QHY A;  2LB9 A;  2HP6 A;  2WK0 A;  1XKZ A;  2V20 A;  2WKH A;  4R70 A;  4U0T A;  3NDG A;  3LIA A;  3KSF A;  2ZC7 A;  4Z1W A;  2Y59 A;  3IWQ A;  5EVE A;  5FQK A;  5HAI A;  4E3J A;  4BL2 A;  5FQQ A;  2IWD A;  4IVI A;  3TE8 A;  2Q9M A;  4MCW A;  1JVJ A;  3MKE A;  4A5R A;  2J3W A;  2XRO A;  3PHY A;  4WUJ A;  1Z6F A;  3T1S A;  1D06 A;  4Z9Q A;  1YMX A;  3FWL A;  1P0Z A;  1P9W A;  3K3D A;  4KQR A;  3WS1 A;  1ZKJ A;  4QY5 A;  2VV7 A;  1OT6 A;  2G7U A;  3OBF A;  4DN0 A;  3V3S A;  2P7J A;  5M18 A;  2K2N A;  1PNE A;  2ZMA A;  3M6H A;  3DAV A;  5G4Z A;  1JWV A;  2B5R A;  4WLA A;  1K6R A;  3ITB A;  5L2F A;  2WGW B;  4KUK A;  3VFF A;  5FI7 A;  3WS2 A;  5AVE A;  1FCN A;  4L9G A;  1K38 A;  4U3T A;  4KEN B;  3HL9 A;  4FTX A;  5EUA A;  4P6Z S;  4S2L A;  5GHY A;  2ACG A;  3IX4 A;  3JYI A;  1LT0 A;  4DXC A;  4CPK A;  1GCE A;  1NJ4 A;  2D02 A;  1RCJ A;  4KQD A;  2ZM8 A;  4OPZ A;  3T12 B;  1BLS A;  1TS6 A;  4S2I A;  3OPH A;  1SKF A;  2FFF B;  2PU2 A;  3F1O B;  3G30 A;  4EV4 A;  3DWK A;  4XT2 B;  1ES5 A;  1XJ3 A;  4UHU A;  5F1G A;  1C3B A;  3LEZ A;  4ZTK A;  3NCK A;  4GLQ A;  1IYS A;  4ARZ A;  5FAS A;  5CX7 A;  1SZV A;  3IBJ A;  1BYW A;  4H6J A;  2QKP A;  1PIO A;  2JKT I;  1OTD A;  2VLG A;  4UQI S;  3P98 A;  4WZ5 C;  1XFN A;  1SKO B;  3F1N A;  4E3K A;  4BMW A;  3I7J A;  4WN5 A;  2J3T D;  2Y8H A;  3S7Q A;  4HP4 A;  1S1Z A;  3N8L A;  5AQA A;  2I72 A;  4KG2 A;  5IHV A;  4E3N A;  1K54 A;  3MBZ A;  5EPH A;  2XA7 M;  4K0X A;  2HF6 A;  1G5U A;  1K4E A;  3ZG9 B;  3S7N A;  4Q0H A;  2PDR A;  3ZNY A;  2J9O A;  2J7V A;  3S22 A;  5DTS A;  3AGF A;  1MC0 A;  4FD8 A;  1FIL A;  5E2E A;  4GW9 A;  4P85 A;  4MN7 A;  5E2H A;  2FFY A;  1QME A;  2JBF A;  2VA0 A;  3N8S A;  2DCF A;  3SOI A;  3O5Y A;  2XD5 A;  5FA7 A;  3H82 A;  4E6W A;  2Y55 A;  1K55 C;  1LI9 A;  1F98 A;  4EWF A;  4S2N A;  1JWP A;  1MKM A;  1ES2 A;  4HOI A;  1J9M A;  2Y79 A;  1T1B A;  2BLS A;  4WF0 A;  3BWL A;  4HI4 A;  4KZA A;  1AWI A;  3CHW P;  2RL3 A;  5HPI A;  4LV1 A;  4CJN A;  1XPB A;  4YFM A;  5F69 A;  3IXB A;  3G35 A;  3V3R A;  2WZX A;  3G31 A;  1T19 A;  5G4Y A;  3U2A A;  4EW7 A;  4X1L A;  2ZQD A;  4C6Y A;  1BSG A;  2QHK A;  4OQI A;  3OCL A;  2ZQ7 A;  3QP2 A;  2QPN A;  3IX8 A;  5FSR A;  3Q7V A;  1BLP A;  3C30 A;  5TBM B;  1ESU A;  1NRJ A;  3UDF A;  4L9F A;  4Y5F A;  3HLG A;  1DJC A;  3UO9 A;  2ZJ9 A;  3D3O A;  3MSH A;  3WS4 A;  2VV6 A;  4FSF A;  2Y2J A;  1L0E A;  4R3B A;  2IWC A;  2WYX A;  3FPW A;  3P7N A;  3HVF A;  1FOF A;  2EWV A;  1IEM A;  5BOH A;  3A3J A;  3MF0 A;  4HES A;  3NJA A;  1YLT A;  1ERM A;  3UB9 A;  4XUZ A;  2I9V A;  4PM8 A;  4OQG A;  3HLW A;  1PI4 A;  2WKR A;  2PR5 A;  2HP5 A;  1NRF A;  4RQ9 A;  2J8Y A;  4CLC B;  1VET A;  5HL6 A;  3EGD C;  5FDS A;  4UA6 A;  3C5A A;  4IED A;  2XGN A;  3NHQ A;  2UWX A;  4IUK A;  1IEL A;  3C7V A;  3B47 A;  4I3A A;  3A3E A;  4DJ2 A;  2J3T C;  1NYM A;  2Y2K A;  1LLB A;  4QY6 A;  5CEB A;  5FAP A;  3IS2 B;  2WUQ A;  1ALQ A;  3K3C A;  2OOL A;  2Z2L B;  5FAQ A;  5M1A A;  1OTE A;  2Y2H A;  1LHY A;  2V8C A;  5FL3 A;  2K7S A;  3IHB A;  5HAQ A;  2ZQ8 A;  4BJP A;  1L3L A;  2Y2M A;  3IF6 B;  5EM0 A;  4N9K A;  4F3L A;  3WS5 A;  3UME A;  5J7E A;  4DF6 A;  4KZB A;  4WEJ A;  5KSH A;  5CTM A;  1FSY A;  4KG5 A;  3BFC A;  3CUE A;  2L1M A;  5EFW A;  2O9C A;  3LO7 A;  3LR0 A;  3FC7 A;  3A0R A;  4M4X A;  3FG8 A;  5E2F A;  3CAX A;  2OSU A;  1D7E A;  2ZC3 B;  4LLO B;  3MXQ A;  5DKL A;  2B18 A;  2OAQ 1;  1VQQ A;  3GR2 A;  4MN5 A;  4HHD A;  3BY8 A;  3BY9 A;  2H28 A;  4KZ3 A;  3VOL A;  2CMN A;  1S1Y A;  1PZO A;  1BT5 A;  1ERO A;  1XJ2 A;  5F82 A;  5CGX A;  3EOI A;  2OLV A;  4GJ4 A;  1H8Z A;  2PU4 A;  5E43 A;  4S2P A;  1ES4 A;  3NOT C;  2XF3 A;  3WS0 A;  5JYP A;  3TOI A;  3HLE A;  4L0L A;  3UDX A;  1W5D A;  1K57 A;  2J80 A;  5FI6 A;  1MXO A;  4HIA A;  1WYB A;  2WGW A;  4MBK A;  3TW8 A;  3VFH A;  1W79 A;  2EWW A;  1N4O A;  5EE8 A;  3DW0 A;  5KSC A;  1G6O A;  3VE4 A;  4OOM A;  4R4S A;  3WRZ A;  1BTL A;  4HBT A;  5EVI B;  5CHU A;  1IYO A;  3RXW A;  2ZOI A;  4EER A;  1SHV A;  3KSI A;  3UPN A;  4Y15 A;  5CER A;  2B95 A;  4JKT A;  4ZAM A;  3CPT B;  4JLF A;  3A3I A;  1K6S A;  3F1O A;  4N92 A;  3D4F A;  3T4J A;  2HDS A;  2V8F A;  3OCN A;  4XT2 A;  1M40 A;  5LBR A;  2JHE A;  4NG2 A;  1F9I A;  1NLZ A;  3FZC A;  2P9V B;  4E3I A;  3A0V A;  3FV7 A;  3MS6 A;  3UMD A;  1JNU A;  3UB7 A;  4HEF A;  2XD1 A;  3ZVT A;  1SKO A;  4NEE D;  2XR0 A;  4UAA A;  2DNS A;  5M19 A;  3NY4 A;  1H5X A;  2Y2I A;  3IXG A;  3ZYT A;  4CLC E;  4X53 A;  3GVB A;  1YMS A;  4MEZ A;  2FZ0 A;  1IFQ A;  3VOZ A;  3IT9 A;  4Q8I A;  1VB6 A;  2B02 A;  3HJK A;  1D1J A;  1FCM A;  3C4P A;  2JKR M;  4FH4 A;  3GTC A;  3B33 A;  4HQA A;  2VX8 A;  3PXP A;  1H3Q A;  4KZ8 A;  3ZFZ A;  4E04 A;  2M7U A;  1J3W A;  2KX6 A;  1E3U A;  3FKV A;  3NIA A;  2A2L A;  4MMN A;  2LB5 A;  4OVD A;  2PBD P;  2CC1 A;  4JF6 A;  3GMW A;  4DMZ A;  1OJG A;  1P97 A;  1K54 C;  3UB5 P;  5HAR A;  1IKI A;  1KDS A;  5MC7 A;  1RP5 A;  5IS1 A;  2X71 A;  2WKE A;  3NOU C;  3LYX A;  3OOV A;  5HPF A;  4X56 A;  2QMI A;  1KGF A;  3UE3 A;  4QJG A;  4BEN A;  4WBG A;  3CMZ A;  1K4F A;  2VGJ A;  1W7F A;  4Y0O A;  3Q1F A;  3V67 A;  4IUH A;  4LRY C;  3W4Q A;  4FUW A;  4HP9 A;  2ZQ9 A;  5DJT A;  1CQA A;  2R9X A;  1YSQ A;  4Y2F A;  3PR6 A;  3RXX A;  3ISG A;  3B3X A;  3C7U A;  3KYZ A;  2ZQC A;  1LL8 A;  2X02 A;  4IBR A;  2ZLY A;  3EGX C;  3VP2 A;  4DXB A;  1DP6 A;  3LR5 A;  3V5M A;  5FQJ A;  5CHM A;  2O9B A;  3LI8 A;  5KZH A;  1IYP A;  2GJ3 A;  4OLD A;  3GDI A;  4MNR A;  1EI5 A;  2M1C A;  5TBM A;  4OQ0 A;  3Q81 A;  4PMA A;  2RCX A;  5CGW A;  1YPR A;  5TR7 A;  3LIE A;  4DDY A;  3NUL A;  2XDM A;  3N6I A;  1LL9 A;  3NC8 A;  4ETX A;  3LY3 A;  3Q07 A;  4RX2 A;  2V0U A;  5FAT A;  3T4S A;  4GN2 A;  1T1C A;  4O8G A;  3QP5 A;  4WMC D;  4EBN A;  1MZU A;  3A3F A;  3HUO A;  4JXW A;  4GD8 A;  3HLD A;  4BD1 A;  2Y2G A;  2ZQA A;  4EBP A;  5L09 A;  4DE2 A;  1G6A A;  3KSH A;  2BG1 A;  5GLA A;  4R6L A;  2JC7 A;  4BD0 A;  4EQI A;  4YNR A;  4QB8 A;  3LID A;  4CLC A;  4EBL A;  4WZ4 A;  2XA7 S;  3RTY A;  2Y2N A;  3IH9 A;  4ZJ2 A;  2OWJ A;  1T18 A;  4MN6 A;  1KGE A;  2Y4A A;  4I3I A;  4OPR A;  3RH8 B;  1HZO A;  1ZG6 A;  4O0P A;  1YLJ A;  3IS2 A;  3LUQ A;  3RJU A;  4PHT A;  1GSX A;  4DE0 A;  1H8M A;  4LPZ A;  4I5S A;  4KZ6 A;  2OAP 1;  3IF6 A;  3IHA A;  4XUX A;  3OPP A;  4LCL A;  4PAU A;  1NY0 A;  5I5L A;  4HH2 A;  3MKF A;  3QP1 A;  2NUP C;  4NXF A;  1KE3 A;  5FDH A;  4MDZ A;  2W1T B;  2JKG A;  3F1P B;  4Y0U A;  3BEC A;  1MWR A;  2INW A;  4JF4 A;  1OTI A;  2EFX A;  4X55 A;  1H8Y A;  2PBY A;  2A24 B;  4B4X A;  4P87 A;  4F94 A;  1CI8 A;  2WZZ A;  3T50 A;  4E3M A;  3DWZ A;  2VJW A;  1Y54 A;  4GNU A;  2QYB A;  5GLD A;  2VEA A;  2VZW A;  1W63 Q;  3OZH A;  1E3U D;  4RVA A;  3L7H A;  4G3K A;  1AXB A;  2XEP A;  1ES3 A;  3HJI A;  1N9N A;  4S2J A;  4WM9 A;  1XJ6 A;  2VGL M;  5AJG A;  4R0Q A;  4IVK A;  2HJE A;  5HL1 A;  4OLG A;  1IKG A;  3GSG A;  1JWZ A;  2HDR A;  3VSL A;  2EFU A;  5D3O A;  5KIZ A;  4PKY A;  4R23 A;  1XFQ A;  5EV0 A;  3VP4 A;  5DF8 A;  1G68 A;  1KE4 A;  4ZRR A;  3E98 A;  5HWW A;  5U47 A;  5AVF A;  5GL9 A;  1YAX A;  1LI0 A;  3T4O A;  1NZO A;  2FH5 A;  2H0T A;  1ODV A;  1XA7 A;  1E25 A;  2JN7 A;  3ZG0 A;  4EXO A;  2D01 A;  3UY6 A;  1PRQ A;  2WAF A;  3KX0 X;  4YIN A;  2Q9N A;  3UPO A;  5EVI A;  3MZD A;  3SS4 A;  2W3H A;  1FR6 A;  1MPL A;  5EVL A;  3T4Q A;  1L0F A;  3A0S A;  1OTA A;  3G2Z A;  5F68 A;  5HDS A;  5I94 A;  1HVB A;  1K57 C;  5TGF A;  3QP8 A;  3CPT A;  1MBL A;  3VMA A;  3Q82 A;  1KVM A;  1I5Q A;  4EES A;  4E6X A;  1IYQ A;  4FOF A;  2EX2 A;  4K0W A;  5JYO A;  2ZM2 A;  1XX2 A;  3HUN A;  2O99 A;  4NXG A;  2P9V A;  3ZG8 B;  4DKI A;  3OLO A;  4NK3 A;  2R78 A;  4ZDX A;  1WYC A;  3MZE A;  2W3G A;  3W8K A;  3BQ8 A;  1EWZ A;  3BLS A;  3D9Y A;  1V9Z A;  3HLB A;  2E8I A;  4BBV A;  5EM1 A;  2L4R A;  1DP9 A;  3JVV A;  3AGE A;  4Y13 A;  3KYQ A;  1K55 A;  3GRJ A;  4BL3 A;  3M2K A;  4CQH A;  4O7D A;  2ZC4 B;  4CLC D;  3S7O A;  3VP3 A;  1CF0 A;  1Q2P A;  1YT4 A;  1TVF A;  5FQM A;  2V1Z A;  2ZL1 B;  1LSX A;  2Z6D A;  4JXS A;  4UEY A;  2C6W B;  5HWV A;  1Z09 A;  3MFX A;  2ZD8 A;  5TFQ A;  5F83 A;  4H8R A;  2L0W A;  4WYY A;  4OH0 A;  2G2U A;  4UA9 A;  2WAE A;  1O07 A;  3R7W B;  4EUV A;  2PR6 A;  3LIC A;  4KZ4 A;  4PKY G;  2ZC6 B;  3UN7 A;  3HUM A;  4PM7 A;  3IXD A;  2Y2P A;  4P6B A;  5L8M A;  4KZ9 A;  3PBO A;  4Q0I A;  3WWX A;  1FIK A;  4D2O A;  4LRZ E;  1U60 A;  4DRT A;  1VEU B;  4HH3 A;  3LI9 A;  2KDK A;  2OV5 A;  3A3D A;  1PWD A;  3E2L A;  4GOG A;  3T4L A;  1GA0 A;  2EXA A;  3GQZ A;  3UB6 A;  4K08 A;  1F5M A;  4HJ6 A;  1YM1 A;  3JPU A;  1ZG4 A;  1DJA A;  1STZ A;  5HDC A;  3TG9 A;  3HBR A;  1CK3 A;  1P9R A;  1BLC A;  4ME4 A;  4OPY A;  3CI6 A;  4KQO A;  1MWT A;  2K31 A;  2JKF A;  1IOU A;  1X0O A;  2QJ5 A;  1TD5 A;  1PW1 A;  1HLU P;  2ZC5 B;  3C38 A;  4DE3 A;  2A49 A;  2PAV P;  4JGR A;  5EOE A;  1MWS A;  3E0Y A;  4ZJ1 A;  5CHJ A;  2XSS A;  3ZG7 B;  1XGI A;  2EA9 A;  5HDD A;  5TJJ A;  3CLO A;  2KOI A;  1ONH A;  3IXH A;  3EQV A;  3LCE A;  5DTK A;  3DTM A;  3OPR A;  3R4K A;  1OTB A;  3UPP A;  1CJF A;  1SDE A;  2HDU A;  4O01 A;  3BW6 A;  1KVL A;  3JVU A;  2KLI A;  1N9O A;  1ONG A;  4GS9 B;  3ZCZ A;  3DBA A;  2G2W A;  1BLH A;  4KZ7 A;  1TS0 A;  3UB8 A;  2XQZ A;  5EVI D;  2HP9 A;  4PM5 A;  3QP4 A;  2P08 A;  5F6A A;  1MKI A;  4Y0T A;  3S4X A;  1S4R A;  3MJQ A;  3S7P A;  4PM6 A;  1G28 A;  3GEC A;  1GSW A;  1CEG A;  3C4O A;  3HCY A;  4C75 A;  4AFI A;  2OLU A;  3M2J A;  3G2Y A;  4IHQ A;  4JF5 A;  1V9Y A;  4KUO A;  4CLC C;  3M6B A;  2EX9 A;  5AQ7 A;  3VP1 A;  4B88 A;  1KGG A;  3VE3 A;  3E4Q A;  1L0G A;  2VK3 A;  2V1A A;  3KO6 A;  1XA1 A;  4NXB A;  2W1T A;  5K5B A;  1BUE A;  4ZJ3 A;  1GSV A;  3VSK A;  4B9O A;  3PYP A;  4R1G A;  3FPV A;  2Z2M B;  1YSP A;  3F1P A;  1WA9 A;  4JXG A;  3SZT A;  4X25 A;  3LR4 A;  3UE6 A;  5J4E A;  2A24 A;  5DTT A;  2OWH A;  3VV4 A;  3CZD A;  5CED A;  2W3D A;  4WL9 A;  3H7W B;  4C3Q A;  3IF6 C;  3GV9 A;  2PYP A;  3IH8 A;  3CIT A;  1PYY A;  4FCF A;  4YOF A;  2PHY A;  3MFD A;  1NXY A;  4X1M A;  1WE4 A;  2JKR I;  1TS7 A;  2HJ9 C;  5KMW A;  2Y2L A;  3D72 A;  3C2W A;  5DVA A;  1KOU A;  3W4O A;  4QU3 A;  1YQS A;  3N4I A;  3E4O A;  5FQI A;  1XJ4 A;  4OP8 A;  4S2N C;  3ULF A;  4S2O A;  3ZDJ A;  5A92 A;  2J9P A;  1MWU A;  4RA7 A;  4X68 A;  4GZB A;  2Q0O A;  4GKU A;  4NXE A;  1A0K A;  5AQ9 A;  4LCM A;  4Y17 A;  4NKP A;  2JKT M;  2GX5 A;  2ZM0 A;  4EU0 A;  4HBU A;  4KQQ A;  1H0M A;  3VP0 A;  4LEN A;  1W63 M;  4GCZ A;  1VM1 A;  1KE0 A;  1BZA A;  1Y28 A;  1YLZ A;  5HD5 A;  4R3J A;  5DKK A;  2M7V A;  1JTD A;  1SDN A;  5FQ9 A;  1K56 A;  4R38 A;  3HLF A;  4P6Z M;  1W8Y A;  4G3V A;  4HY8 A;  3TJZ C;  3BEB A;  4II7 A;  2JE5 A;  3TSG A;  4LV3 A;  1YLW A;  3CWF A;  3NOP C;  3BJN A;  1PWG A;  2H10 A;  4S2M A;  3W2Z A;  4JGQ A;  4OQH A;  5G18 A;  1NYY A;  4QHC A;  5A8B A;  2YKF A;  1ZC2 A;  1ZTU A;  1FCO A;  2Y91 A;  1F2K A;  3E2K A;  3DTK A;  1NZU A;  2ZOH A;  2DRW A;  3G4P A;  3OC2 A;  2PT7 A;  5DJU A;  3K2N A;  2WGI A;  3EEH A;  3QNC A;  5EVI C;  3N8R A;  2MJ6 A;  1LL5 A;  1NWZ A;  4IJG A;  4S2K A;  3KYE A;  5HD3 A;  3G34 A;  5IT5 A;  1UWP X;  4RYE A;  3UDI A;  3LIF A;  2DMW A;  2XLN A;  3C8C A;  4I39 A;  4UQI M;  4OOY A;  5CRF A;  5C5K A;  3T1Q B;  3E4P A;  3G32 A;  4MBF A;  3MXR A;  2GNX A;  3P01 A;  2QZ6 A;  3Q7Z A;  3N7W A;  2GZA A;  3B42 A;  1W8Q A;  3H9W A;  4GHI B;  3PAG A;  2XFT A;  2W3F A;  3T4K A;  1HD8 A;  2ZBB A;  1FR1 A;  3BLM A;  2XK1 A; 
#chains in the Genus database with same CATH homology
 3WS1 A;  1XX2 A;  1ZKJ A;  2Y2O A;  3HUN A;  4OOM A;  4MLL A;  2HDQ A;  4QY5 A;  4R4S A;  3BFG A;  3WRZ A;  1BTL A;  2P9V A;  4HBT A;  3ZG8 B;  5EVI B;  5CHU A;  3O86 A;  4DKI A;  4NK3 A;  4N1X A;  1IYO A;  3RXW A;  3V3S A;  4ZDX A;  1WYC A;  3MZE A;  2EX6 A;  5M18 A;  1RGY A;  1SHV A;  3W8K A;  3ZHH A;  1EWZ A;  3UPN A;  5CER A;  3BLS A;  2ZMA A;  4GDN A;  1FSW A;  3M6H A;  4WEK A;  3HLC A;  3HLB A;  1JWV A;  2E8I A;  4JKT A;  4ZAM A;  2B5R A;  4JLF A;  3BFF A;  1K6R A;  3A3I A;  3ITB A;  1K6S A;  5L2F A;  1XXM A;  2WGW B;  4N92 A;  3D4F A;  2HDS A;  3AGE A;  3OCN A;  3VFF A;  5FI7 A;  1M40 A;  3WRT A;  3WS2 A;  1FCN A;  1K55 A;  2A3U A;  3GRJ A;  2C5W B;  1K38 A;  4BL3 A;  3M2K A;  4U3T A;  4O7D A;  3ZG5 A;  2ZC4 B;  4KEN B;  3HL9 A;  3VP3 A;  3AGD A;  5EUA A;  4S2L A;  3FZC A;  1Q2P A;  1YT4 A;  3BM6 A;  4JBF A;  1TVF A;  2P9V B;  3JYI A;  5FQM A;  2V1Z A;  5GHY A;  3IWO A;  4CPK A;  4E3I A;  1GCE A;  4DXC A;  1NJ4 A;  3FV7 A;  4JXS A;  2C6W B;  1RCJ A;  4BEN A;  1TDL A;  1YLP A;  1HTZ A;  4NET A;  2V2F F;  2ZD8 A;  4HEF A;  2XD1 A;  2ZM8 A;  4GB7 A;  4OOL A;  1I2S A;  4OPZ A;  5HX9 A;  3ZVT A;  5F1F A;  2XR0 A;  4UAA A;  4MBH A;  1RGZ A;  2DNS A;  4X69 A;  5DF9 A;  3SS3 A;  5TFQ A;  5F83 A;  1K25 A;  4H8R A;  4K91 A;  4WYY A;  1BLS A;  5M19 A;  4OH0 A;  3OPH A;  4S2I A;  2G2U A;  1CEF A;  3NY4 A;  2WAE A;  4UA9 A;  1SKF A;  3UE1 A;  1O07 A;  2FFF B;  1H5X A;  2PU2 A;  2Y2I A;  3IXG A;  3G30 A;  4EV4 A;  3DWK A;  4X53 A;  4DDS A;  1ES5 A;  3GVB A;  1YMS A;  4MEZ A;  4U0X A;  4UHU A;  5F1G A;  1C3B A;  3VOZ A;  3IT9 A;  3LEZ A;  4ZTK A;  3NCK A;  3CJM A;  4KZ4 A;  4Q8I A;  1IYS A;  5FAS A;  2ZC6 B;  3UN7 A;  3SH7 A;  3HUM A;  1FCM A;  1S0W A;  4PM7 A;  3IXD A;  3C4P A;  4IBX A;  2VGK A;  2Y2P A;  4P6B A;  1PIO A;  4KZ9 A;  4FH4 A;  4B4Z A;  3PBO A;  4PM9 A;  3GTC A;  3P98 A;  3EQU A;  3SH9 A;  3W4P A;  3WWX A;  4WZ5 C;  4KZ8 A;  3ZFZ A;  4D2O A;  1E3U A;  4E3K A;  4WZ5 A;  3FKV A;  3I7J A;  3NIA A;  1U60 A;  5CTN A;  5FI2 A;  3VOY A;  2XFS A;  5A91 A;  4DRT A;  4OVD A;  3ZNT A;  2OV5 A;  3A3D A;  1PWD A;  3E2L A;  2CC1 A;  4GOG A;  4JF6 A;  3PBR A;  4P0M A;  3GMW A;  3N8L A;  1GA0 A;  5AQA A;  2I72 A;  4KG2 A;  1K54 C;  5IHV A;  2H0Y A;  5HAR A;  2EXA A;  3UE0 A;  1IKI A;  1KDS A;  4E3N A;  3GQZ A;  1K54 A;  4DE1 A;  3MBZ A;  5EPH A;  4K0X A;  1RP5 A;  1YM1 A;  2WKE A;  2X71 A;  4JXV A;  3ZVW A;  1K4E A;  1ZG4 A;  1ESI A;  3ZG9 B;  1DJA A;  4X56 A;  5A93 A;  3TG9 A;  2QMI A;  1KGF A;  1FQG A;  3HBR A;  3UE3 A;  4QJG A;  1CK3 A;  2J9O A;  1BLC A;  4WBG A;  3CMZ A;  1K4F A;  2J7V A;  2VGJ A;  3ZNY A;  3S22 A;  5DTS A;  1W7F A;  4OPY A;  3QNB A;  3Q1F A;  4Y0O A;  4KQO A;  1MWT A;  4R4R A;  3AGF A;  3O88 A;  3W4Q A;  5HAP A;  4GDB A;  4FD8 A;  4BQM A;  1PW1 A;  2ZQ9 A;  3BRM A;  3NBL A;  2ZC5 B;  2EXB A;  5E2E A;  4P85 A;  2R9X A;  4DE3 A;  2A49 A;  4X6T A;  5E2H A;  1K56 D;  3RXX A;  5EOE A;  1MWS A;  2FFY A;  1QME A;  3ISG A;  3B3X A;  4ZJ1 A;  3C7U A;  3UNW A;  2JBF A;  5CHJ A;  2ZQC A;  3ZG7 B;  1XGI A;  4BLM A;  3N8S A;  2DCF A;  3SOI A;  2X02 A;  1ONH A;  2XD5 A;  4IBR A;  5FA7 A;  3IXH A;  3EQV A;  2ZLY A;  3LCE A;  5DTK A;  4N1H A;  3VP2 A;  4E6W A;  4DXB A;  2Y55 A;  3DTM A;  1K55 C;  1TDG A;  3V5M A;  1GHP A;  5CGS A;  1LI9 A;  5FQJ A;  4EWF A;  3OPR A;  5CHM A;  4S2N A;  5EEC A;  1JWP A;  2X01 A;  1ES2 A;  1TEM A;  3UPP A;  4ZBE A;  1J9M A;  5KZH A;  1IYP A;  4OLD A;  1L0D A;  1SDE A;  2HDU A;  4MNR A;  3DW0 A;  2P74 A;  2BLS A;  1EI5 A;  4KZ5 A;  1KVL A;  2EX8 A;  1ONG A;  4OQ0 A;  3ZCZ A;  3Q81 A;  4PMA A;  2RCX A;  1YLY A;  3OPL A;  4LV2 A;  5CGW A;  5TR7 A;  2G2W A;  4KZA A;  1BLH A;  4KZ7 A;  4DDY A;  2H5S A;  2RL3 A;  4LV1 A;  2XDM A;  1MY8 A;  2XQZ A;  5EVI D;  3N6I A;  2HP9 A;  4CJN A;  4QD4 A;  1XPB A;  5A90 A;  1OME A;  4PM5 A;  1DY6 A;  4YFM A;  1LL9 A;  3NC8 A;  3IXB A;  4FH2 A;  3LY3 A;  3Q07 A;  3G35 A;  4UA7 A;  1GHM A;  1O7E A;  2WZX A;  1SCW A;  4RX2 A;  3V3R A;  1M6K A;  1PWC A;  5FAT A;  3G31 A;  4GN2 A;  1MKI A;  2ZQD A;  3PAE A;  4Y0T A;  4WMC D;  3S4X A;  3IF5 A;  4C6Y A;  4OKP A;  1BSG A;  4OQI A;  3OCL A;  2ZQ7 A;  2WGV A;  4EBN A;  2Y2Q A;  4PM6 A;  3A3F A;  3HUO A;  1DJB A;  4JXW A;  5HFO A;  2QPN A;  5FSR A;  4GD8 A;  3Q7V A;  1BLP A;  3HLD A;  4BD1 A;  2Y2G A;  2ZQA A;  1CEG A;  3C4O A;  4EBP A;  1ESU A;  5EOO A;  3BFD A;  4JPM A;  4C75 A;  4DE2 A;  5GLB A;  1G6A A;  2OLU A;  3UDF A;  3M2J A;  5GLA A;  2BG1 A;  3G2Y A;  3HLG A;  4E3O A;  4E3L A;  1DJC A;  3UO9 A;  2JC7 A;  4BD0 A;  4JF5 A;  2ZJ9 A;  4EQI A;  3WS4 A;  3M6B A;  4FSF A;  2Y2J A;  4QB8 A;  2EX9 A;  4XXR A;  2WKI A;  5AQ7 A;  4EBL A;  4WZ4 A;  5JYO A;  3SS5 A;  1L0E A;  3VP1 A;  5GHZ A;  2Y2N A;  3FYZ A;  3IH9 A;  4B88 A;  4ZJ2 A;  2HPB A;  3IWI A;  1GA9 A;  3PBQ A;  4R3B A;  1KGG A;  2IWC A;  1JTG A;  2R9W A;  1KGE A;  1ERQ A;  2WYX A;  2Y4A A;  3MXS A;  4ID4 A;  4OPR A;  1L0G A;  1PZP A;  1XA1 A;  1HZO A;  1ZG6 A;  3HVF A;  1FOF A;  1BUE A;  1XGJ A;  3HRE A;  3O3V A;  4ZJ3 A;  3VSK A;  3FKW A;  4R1G A;  5E2G A;  1IEM A;  5BOH A;  2Z2M B;  3A3J A;  1BUL A;  3Q7V B;  4HES A;  5AQB A;  1YLJ A;  3LY4 A;  3ZGA B;  1YLT A;  4JXG A;  3O87 A;  4LV0 A;  3SH8 A;  5DTT A;  3CZD A;  1ERM A;  3RJU A;  4WEL A;  4DE0 A;  5CED A;  3S1Y A;  4XUZ A;  4WMC A;  4PM8 A;  4C3Q A;  4OQG A;  3IF6 C;  1QMF A;  4KZ6 A;  3HLW A;  5DF7 A;  1PI4 A;  3ITA A;  2HP5 A;  3GV9 A;  3IF6 A;  1NRF A;  3IHA A;  4RX3 A;  4XUX A;  2J8Y A;  3IH8 A;  3OPP A;  1PYY A;  3PBS A;  4FCF A;  4M3K A;  4LCL A;  1NY0 A;  5GLC A;  3MFD A;  1NXY A;  4UA6 A;  4EUZ A;  3C5A A;  1WE4 A;  3MKF A;  2XGN A;  4IED A;  1N9B A;  2WAD A;  1KE3 A;  5KMW A;  2Y2L A;  5FDH A;  4OPQ A;  5DVA A;  3V39 A;  2UWX A;  3W4O A;  4QU3 A;  1IEL A;  1YQS A;  3C7V A;  3N4I A;  1GHI A;  5CXW A;  5FQI A;  4KG6 A;  4OP8 A;  3A3E A;  4S2N C;  1NYM A;  4S2O A;  4Y0U A;  3BEC A;  2Y2K A;  1MWR A;  3ZDJ A;  5A92 A;  2J9P A;  1LLB A;  4JF4 A;  2EFX A;  1MWU A;  4X55 A;  1H8Y A;  2PBY A;  4QY6 A;  1S6R A;  4RA7 A;  4GZB A;  4GKU A;  4X68 A;  5FAP A;  5CEB A;  2WUQ A;  1ALQ A;  1L2S A;  5AQ9 A;  2Z2L B;  4LCM A;  5FAQ A;  5M1A A;  2Y2H A;  4B4X A;  4P87 A;  4F94 A;  5J8X A;  1LHY A;  3NDE A;  3PBT A;  5CEC A;  1CI8 A;  3IHB A;  4OP5 A;  1E4D A;  5HAQ A;  2WZZ A;  2ZQ8 A;  1I2W A;  3BFE A;  1CI9 A;  4BJP A;  4E3M A;  1PW8 A;  3V50 A;  3DWZ A;  1Y54 A;  2ZM0 A;  4OON A;  2Y2M A;  3IF6 B;  4GNU A;  4HBU A;  4N9K A;  5HW3 A;  4KQQ A;  5GLD A;  3PTE A;  4GD6 A;  3WS5 A;  1XP4 A;  2IWB A;  3BYD A;  3VP0 A;  3CG5 A;  3OZH A;  4DF6 A;  1E3U D;  4LEN A;  4KZB A;  4RVA A;  4WEJ A;  1PI5 A;  1VM1 A;  1KE0 A;  1Q2Q A;  4PPR A;  1AXB A;  2XEP A;  1ES3 A;  5KSH A;  1BZA A;  1YLZ A;  5CTM A;  1FSY A;  4KG5 A;  2XH9 A;  4S2J A;  4WM9 A;  4R3J A;  3BFC A;  3IQA A;  2GDN A;  1JTD A;  1SDN A;  5FAO A;  3NI9 A;  5FQ9 A;  1K56 A;  4R0Q A;  4IVK A;  4Y7P A;  3HLF A;  4N9L A;  3LO7 A;  5HL1 A;  4OLG A;  1IKG A;  3GSG A;  1JWZ A;  1W8Y A;  2HDR A;  3VSL A;  5E2F A;  3PBN A;  2EFU A;  2JCH A;  3BEB A;  5D3O A;  2JE5 A;  3TSG A;  4R23 A;  2OSU A;  1YLW A;  4LV3 A;  3VP4 A;  5DF8 A;  1G68 A;  1KE4 A;  2ZC3 B;  5U47 A;  1PWG A;  5GL9 A;  2H10 A;  4S2M A;  5GHX A;  4OQH A;  1LI0 A;  1NZO A;  3P09 A;  1VQQ A;  5G18 A;  1NYY A;  2H0T A;  3GR2 A;  4QHC A;  1ZC2 A;  1FCO A;  1XA7 A;  1E25 A;  2Y91 A;  4KZ3 A;  3ZG0 A;  3E2K A;  1PZO A;  1NZU A;  1BT5 A;  2DRW A;  1ERO A;  3G4P A;  3OC2 A;  1KDW A;  3UY6 A;  5F82 A;  3MZF A;  5CGX A;  3QHY A;  2WAF A;  2HP6 A;  2WGI A;  3QNC A;  4YIN A;  2WK0 A;  5EVI C;  1XKZ A;  2OLV A;  2Q9N A;  3N8R A;  1H8Z A;  3UPO A;  2V20 A;  2WKH A;  5EVI A;  1LL5 A;  2PU4 A;  4S2K A;  3MZD A;  3SS4 A;  1FR6 A;  1MPL A;  3G34 A;  4U0T A;  5EVL A;  5E43 A;  1L0F A;  4S2P A;  3NDG A;  4RYE A;  3UDI A;  2ZC7 A;  1ES4 A;  2Y59 A;  3IWQ A;  2XLN A;  5FQK A;  3G2Z A;  2XF3 A;  5HAI A;  3WS0 A;  4OOY A;  4E3J A;  5JYP A;  5CRF A;  3TOI A;  4BL2 A;  5FQQ A;  3HLE A;  5I94 A;  2IWD A;  4L0L A;  1HVB A;  3UDX A;  1K57 C;  3G32 A;  4IVI A;  3MXR A;  1W5D A;  4MBF A;  5TGF A;  2QZ6 A;  3Q7Z A;  3N7W A;  1K57 A;  2Q9M A;  1W8Q A;  5FI6 A;  1MBL A;  1JVJ A;  1MXO A;  1WYB A;  3VMA A;  3MKE A;  2WGW A;  4A5R A;  4MBK A;  3Q82 A;  3VFH A;  1KVM A;  1I5Q A;  1Z6F A;  3PAG A;  2XFT A;  4E6X A;  4Z9Q A;  1W79 A;  1HD8 A;  1YMX A;  1FR1 A;  3FWL A;  3BLM A;  1N4O A;  1IYQ A;  2EX2 A;  2XK1 A;  4K0W A;  5EE8 A;  2ZM2 A;  5KSC A;  4KQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...