1CK3A

N276d mutant of escherichia coli tem-1 beta-lactamase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERDRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title X-ray structure of the Asn276Asp variant of the Escherichia coli TEM-1 beta-lactamase: direct observation of electrostatic modulation in resistance to inactivation by clavulanic acid.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 95
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1999-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ck3A00
2ZQCA 4X53A 5A92A 2PBYA 3IHBA 3FYZA 3MZFA 4WELA 4IVKA 5FQIA 5GLBA 3W4OA 4GDBA 4L0LA 4BD1A 5KZHA 4S2JA 1QMFA 3IT9A 4E3LA 2EX6A 2ZQAA 3OCNA 4H8RA 4RX2A 4BQMA 4Y0TA 2Y2OA 3RXWA 2R9XA 3RJUA 3VP0A 5CHJA 1DJCA 5HFOA 3FWLA 4GNUA 1Q2QA 4N1XA 3D4FA 1FOFA 4BENA 2ZC5B 1Y54A 2XDMA 4BL2A 4FSFA 3MBZA 4KG6A 4UA7A 2ZQ7A 1K54C 4UA6A 2FFFB 5E2EA 3N8SA 2XLNA 4P85A 4GD6A 1YMXA 3SOIA 3UPNA 2EX8A 4OQGA 5F83A 1RP5A 2OSUA 2A3UA 4S2IA 1BULA 1KVMA 1NRFA 3Q07A 4KZBA 3QNCA 4QHCA 4PM8A 4QB8A 4OPYA 4LCLA 5FQMA 2ZC4B 1BUEA 2VGKA 3ZG7B 2HDRA 2JE5A 3PAEA 4JXSA 1L0GA 3V3RA 4OQ0A 2V1ZA 2WZXA 1NXYA 4N9LA 2XFTA 2Z2MB 2WKEA 1E3UA 1KVLA 5CTNA 1KGEA 5TGFA 3UPPA 3DTMA 3BFGA 1K56D 3UE3A 5FI7A 5FAQA 4XXRA 3ZG9B 5E2HA 4HBTA 5F1GA 4EBNA 1VM1A 1I2SA 1SDEA 1XP4A 5GHZA 1C3BA 1CI8A 3BECA 3HLWA 4WEJA 3GV9A 2RL3A 3O87A 4EQIA 1GCEA 3BFEA 3SH8A 2HP5A 3AGDA 5CECA 4OQIA 1BLCA 3ITBA 1EI5A 3IXHA 4RYEA 5FATA 4K91A 4QJGA 3G4PA 4LENA 3HREA 4ZBEA 3GR2A 3MZEA 3UDFA 1FQGA 1SHVA 1W5DA 2IWCA 3IHAA 3N7WA 3E2LA 5GLDA 1BT5A 4UHUA 2EXBA 3C7VA 2WAFA 1PZPA 3C4OA 2VGJA 3HLCA 2DNSA 2C6WB 1ESUA 3FKWA 4X55A 4OOLA 2IWBA 3C4PA 4CJNA 1YLZA 2Y55A 1CEFA 3B3XA 3Q82A 2EFUA 4JPMA 1MWUA 1OMEA 5DF9A 2ZM2A 4UAAA 5FQQA 3WS1A 1L0DA 2V20A 4S2PA 5JYPA 3ZNYA 1MPLA 3Q7ZA 4ZJ1A 2H10A 1GA9A 1LLBA 3CZDA 3UPOA 1CI9A 1MWRA 5HL1A 2IWDA 1BTLA 1M6KA 2A49A 1NZOA 3BRMA 3BYDA 3P09A 1FCOA 5GLCA 4MBKA 1IYQA 3C5AA 5IHVA 3VOZA 4PM6A 3OPLA 1N4OA 4KG2A 3BFFA 4R0QA 3WRTA 3HBRA 1M40A 3ZG8B 1NYMA 5CHUA 4C6YA 5G18A 1E3UD 3HUOA 3V50A 4O7DA 2G2WA 3E2KA 2WKIA 2ZJ9A 1KGGA 3G31A 1TVFA 3LY4A 4XUXA 1JWPA 1I2WA 3N6IA 5EOOA 3OZHA 4FH4A 1IEMA 4E3KA 1RCJA 5FQJA 3EQUA 4FH2A 1K56A 2PU4A 2Q9MA 2XFSA 4OLGA 3IWQA 3TG9A 3UNWA 3IF6B 5CTMA 3ISGA 1MY8A 4E6WA 4RVAA 1LL9A 5A91A 1JWVA 1ONGA 1YQSA 1Q2PA 1FSWA 2WGWB 1E25A 1K6RA 2BG1A 3IWIA 4ZTKA 5FDHA 4C3QA 3QNBA 2EX2A 3FZCA 4GD8A 1ZG6A 5CGXA 1ZKJA 1QMEA 2ZM8A 3OCLA 4PM5A 4OP8A 4MBFA 2J7VA 1JTDA 3S1YA 5FI6A 2ZLYA 4OPZA 3IH8A 4KZ3A 3A3DA 3G32A 4R1GA 2EFXA 5M1AA 1NY0A 4RX3A 1XX2A 4Y0OA 4BLMA 1XGJA 4DXCA 1IKIA 4OVDA 1L0EA 2P9VB 4R4RA 4IBRA 2I72A 3S4XA 3JYIA 4JF5A 4S2OA 4DE0A 3BEBA 3BFDA 3UDIA 1I5QA 4DE2A 1H5XA 3GRJA 2XGNA 4GB7A 4OQHA 3PBSA 3MKEA 2ZC6B 4C75A 3PBOA 1NJ4A 3SS4A 3V5MA 2CC1A 3ZG0A 1BLPA 1FR6A 5J8XA 1J9MA 1PI4A 1W7FA 4X69A 4R4SA 4S2NA 5CGSA 5EE8A 3WS5A 1DJAA 1HZOA 5CERA 1K38A 4N92A 5TR7A 1LI9A 3ZG5A 3UY6A 2Y2MA 4EV4A 3G35A 1RGYA 3A3EA 3AGEA 1IKGA 4OOMA 3ZCZA 1K4EA 3IXBA 4FD8A 1MXOA 1FSYA 3O86A 1W8QA 4WM9A 1PZOA 5GHXA 3DW0A 1XA1A 4NETA 3MZDA 1EWZA 5EVIB 1IELA 1NYYA 1PWDA 2PU2A 5U47A 5FSRA 1BSGA 3HUNA 3M2KA 4Y0UA 4HBUA 4LCMA 5E2GA 5F1FA 3O88A 1N9BA 4HESA 2WZZA 3LY3A 1GHPA 4F94A 4YFMA 5EPHA 1WYBA 3W8KA 2XD5A 1H8YA 3IXDA 4KZAA 5F82A 3A3IA 3UE0A 2ZM0A 4WYYA 3NBLA 3G30A 4LV0A 5EOEA 2X01A 2RCXA 2H0YA 3LO7A 4XUZA 1CK3A 3HLEA 3MFDA 5GL9A 1MBLA 3P98A 3ZHHA 3MKFA 3V3SA 3VOYA 5KMWA 2Q9NA 3ZVWA 2OV5A 2Y2PA 1PW8A 4DKIA 3M6HA 3PTEA 2XF3A 5I94A 5AQ9A 1NZUA 4KZ4A 5FAPA 4Y7PA 2DRWA 2XEPA 2ZQ9A 3OC2A 1YM1A 3CJMA 4R23A 5EVID 4EBPA 3DWZA 4R3BA 4QY6A 2J8YA 1SDNA 4JBFA 1DY6A 3BLSA 1ALQA 5E43A 2Y2NA 3IF6A 1Z6FA 3HLBA 4D2OA 5M18A 4JXGA 1K55A 2JC7A 4S2NC 1ONHA 1GA0A 1U60A 5EECA 3NCKA 4ZDXA 5DTSA 3VMAA 3NC8A 2HP6A 3ZGAB 4WBGA 5E2FA 1XA7A 5FAOA 4E3OA 2XK1A 1JVJA 2HPBA 3OPPA 1LI0A 1TDLA 5EUAA 1ES5A 1XPBA 3BLMA 4MEZA 3UO9A 1ES2A 4BD0A 1MKIA 4GZBA 1HVBA 1S0WA 1BLHA 1GHMA 1XKZA 2Y2QA 1YMSA 1AXBA 3FV7A 4K0XA 5AQBA 4OP5A 5HARA 2P9VA 3SH9A 4K0WA 1ES3A 5FQ9A 2C5WB 2ZQ8A 4ZJ2A 5DTKA 3OPRA 3PBRA 1BZAA 1XGIA 1ZG4A 2WAEA 2Y4AA 4DE1A 4QY5A 1ESIA 4WMCD 1G68A 3EQVA 4CPKA 4X6TA 5AQAA 3NDEA 4Q8IA 4MNRA 3IXGA 1MWSA 2XH9A 3RXXA 4LV1A 2XD1A 3HUMA 1ERQA 2WGIA 5CRFA 3SS5A 4GOGA 1YLWA 4DE3A 5JYOA 1PW1A 2B5RA 1KDSA 4OPRA 4ZJ3A 1SCWA 1K57A 1KDWA 1H8ZA 5GHYA 3TOIA 5HAPA 1KE3A 3UDXA 3IH9A 4ZAMA 3WS0A 1W79A 4X56A 1MWTA 3VSLA 3C7UA 3ZDJA 5GLAA 2ZD8A 3WS4A 4U0XA 5EVIA 4YINA 2WYXA 4KQOA 1YLTA 3IF6C 4FCFA 1BLSA 2JCHA 1LL5A 2WK0A 1K55C 5DF8A 5BOHA 5FA7A 4DRTA 3HLGA 5HW3A 4JF6A 3WRZA 3AGFA 3M2JA 3NI9A 2QZ6A 4IBXA 3Q7VB 3TSGA 4QU3A 3VP2A 1ES4A 1IYOA 1HD8A 4E3JA 1FR1A 2Y2GA 4OLDA 4U3TA 1PWCA 3UE1A 5FASA 1EROA 2H0TA 3I7JA 3OPHA 4A5RA 4M3KA 4RA7A 5CHMA 4BJPA 1O07A 3VP3A 4PMAA 3IWOA 2JBFA 3UN7A 4OKPA 5KSHA 4U0TA 5L2FA 1PI5A 5A90A 4WZ5A 4Z9QA 1IYSA 1TEMA 4N9KA 1KE4A 3PBQA 4QD4A 3DWKA 4KZ8A 3A3JA 2OLUA 3GQZA 4P6BA 1PWGA 4EWFA 4OH0A 1PIOA 5FQKA 2ZQDA 4MLLA 5HAQA 3N4IA 2P74A 3GVBA 1L0FA 3CG5A 1TDGA 3QHYA 4LV3A 4E3MA 1G6AA 1WYCA 2V2FF 2Z2LB 2HDSA 4B88A 1YLPA 4BL3A 2J9OA 4KZ9A 2ZMAA 1E4DA 4NK3A 4WMCA 2HDUA 3V39A 1YT4A 1K57C 1ERMA 3FKVA 1FCNA 3PBNA 4S2LA 4OONA 4E3NA 5D3OA 5CEDA 3G2YA 4PM9A 4KQQA 4WZ4A 1W8YA 4E3IA 4JXVA 1YLYA 4KZ6A 4P87A 4X68A 5DF7A 5FI2A 5A93A 3MXRA 2XQZA 2QPNA 4KENB 4S2MA 5DTTA 5EVIC 3NY4A 3ITAA 3MXSA 3VSKA 1GHIA 1K6SA 5HAIA 3G2ZA 1O7EA 1LHYA 4IVIA 4PPRA 5CXWA 2Y91A 3Q1FA 4N1HA 5TFQA 1VQQA 2X71A 1FCMA 1JWZA 2UWXA 3HLFA 1ZC2A 3IF5A 3PBTA 3G34A 2X02A 2E8IA 2XR0A 4GDNA 3ZFZA 1PYYA 2WGWA 4EUZA 3LCEA 2EXAA 3N8LA 3SH7A 4DDSA 4DDYA 2EX9A 3ZNTA 3NIAA 3PAGA 4GKUA 3VFFA 3CMZA 4KZ7A 4KQRA 5M19A 4OPQA 3WWXA 3HLDA 4HEFA 1S6RA 3SS3A 1WE4A 3LEZA 3W4QA 2DCFA 3VP4A 1K54A 3M6BA 3HVFA 3VP1A 5EVLA 3ZVTA 1L2SA 3GMWA 3N8RA 3O3VA 4JXWA 4JKTA 4S2KA 4WZ5C 3NDGA 4ID4A 1DJBA 5CEBA 2WGVA 4LV2A 5DVAA 4DXBA 2OLVA 1YLJA 5AQ7A 4JF4A 2QMIA 4E6XA 4DF6A 2BLSA 1HTZA 2Y2LA 2HP9A 2Y59A 3GTCA 4KG5A 3BM6A 4EBLA 4GN2A 2R9WA 3GSGA 4JLFA 4B4XA 4WEKA 3Q81A 4B4ZA 1RGZA 2Y2JA 4UA9A 3A3FA 2G2UA 1SKFA 2WKHA 3BFCA 4P0MA 5KSCA 3IQAA 4PM7A 3S22A 1CEGA 3W4PA 1KGFA 4R3JA 1KE0A 2Y2IA 2WADA 2ZC7A 2ZC3B 4IEDA 4OOYA 2H5SA 3Q7VA 5CGWA 3VFHA 2FFYA 1IYPA 1XXMA 1JTGA 1K25A 2Y2HA 1K4FA 4MBHA 5HX9A 2HDQA 2Y2KA 3WS2A 2J9PA 2GDNA 2WUQA 3HL9A 4KZ5A
chains in the Genus database with same CATH superfamily
2PRFA 4HOIA 3W4OA 5FEFA 4S2JA 2ZQAA 1STZA 3RJUA 4EXOA 1VEUB 4N1XA 1Y54A 3F1NB 3NOPC 4FSFA 4KG6A 4UA7A 5E2EA 2XLNA 4DJ2A 1YMXA 4L9FA 3Q07A 1SKOB 2JHEA 3QNCA 4PM8A 2PBDP 5IT5A 2ZC4B 3ZG7B 1L0GA 1LT0A 2V1ZA 2WZXA 1NXYA 2WKEA 3UPPA 2K7SA 3BFGA 1K56D 3DTMA 5FI7A 3H9WA 3GV9A 4EQIA 4KQDA 1PFLA 3B33A 3CITA 3DBAA 5HD3A 1BLCA 4RYEA 5FATA 4K91A 3UB7A 3G4PA 3MZEA 2IWCA 1SHVA 1W5DA 3N7WA 3TE8A 2WAFA 3CUEA 3LIEA 3LIFA 4CLCE 1UWNX 4OOLA 4LPZA 2DMWA 5FQQA 1LSWA 4UAAA 1L0DA 3NECA 3ZNYA 1MPLA 2H10A 2QJ5A 2NUTC 4HJ4A 2ZMFA 3P09A 3ULFA 1T19A 3C5AA 5IHVA 2YKHA 4PM6A 4JGPA 3WRTA 2W0NA 3HBRA 2ZL1B 3S7QA 1NWZA 5DJUA 5G18A 3HUOA 2Y79A 4ZRRA 2G2WA 1MZUA 3G31A 2Q0OA 1TVFA 3LY4A 1JWPA 3LICA 3EQUA 5F68A 3UNWA 3S7OA 3GECA 4E6WA 2V8FA 1K6RA 3KSGA 5FDHA 4C3QA 2EX2A 3OLOA 3LR3A 1K0KA 4MCWA 1N9LA 4Y2FA 1JTDA 3CHWP 2NUPC 4I38A 4OPZA 3G32A 4R1GA 2XSSA 1OTAA 1CQAA 1NY0A 4RX3A 1XX2A 4OVDA 1OTIA 5LBRA 4IBRA 5DKLA 3QP5A 4JF5A 4H6JA 4S2OA 4DE0A 4UEYA 1EW0A 3UDIA 4OQHA 3PBSA 3MKEA 3KO6A 4I39A 3PBOA 1NJ4A 2CC1A 1OJGA 3WS5A 5EE8A 5CERA 3T4KA 4N92A 4ME4A 2PD8A 3ZG5A 1XJ4A 3A3EA 3C38A 4OOMA 4PAUA 3O86A 4WM9A 1XA1A 3MZDA 1NYYA 4I3JA 3O88A 3LY3A 4P6ZS 1OPXA 2J3TC 1H8YA 5F82A 4GJ4A 3UE0A 2ZM0A 4WYYA 1BYWA 1OTDA 2RCXA 3ZQ5A 1CK3A 3HLEA 3MFDA 4EESA 3MKFA 3E4QA 4NEED 5AQ9A 3OC2A 3CLOA 4R23A 3IS2A 4QY6A 4JBFA 3HLBA 3LI9A 2HZ5A 2JC7A 3NCKA 4I3AA 4WBGA 2WKPA 1JVJA 2HPBA 3OPPA 5TJJA 5EUAA 1ES5A 3BLMA 3HJKA 4PHTA 4BD0A 4QPRA 1XKZA 3FV7A 4K0XA 5HARA 5AQBA 4Y17A 4K0WA 1ES3A 3OOVA 5DTKA 3OPRA 3FG8A 3PBRA 1BZAA 1XGIA 1ZG4A 2WAEA 4DE1A 5AQAA 3NDEA 4R38A 3RXXA 2XH9A 4LV1A 3HUMA 5CRFA 3T4TA 1YLWA 5JYOA 1ACFA 4CLCC 4OPRA 2VLGA 4ZJ3A 4FOFA 3LR0A 1KE3A 4EEUA 4X56A 2PT7A 3ZDJA 4IHQA 1LL5A 2WK0A 5FA7A 4DRTA 3LI8A 3LEQA 3NI9A 3Q7VB 4X25A 1HD8A 1J3WA 4E3JA 1FR1A 3OPHA 4M3KA 1TF1A 5A90A 4WZ5A 4EUVA 1H8MA 4HQAA 3DWKA 2QKPA 4WN5A 5FQKA 4MLLA 3GVBA 1VETA 3QHYA 1WYCA 4Y3IA 2HDSA 5DJTA 1NLYA 3LIBA 3UMDA 4NK3A 5FEGA 2W3HA 1YT4A 1OJ5A 3G2YA 4PM9A 4KQQA 1W8YA 2OOLA 1X0OA 5DF7A 3MS6A 5FI2A 3MXRA 4UQIM 5DTTA 4HJ3A 5EVIC 3NY4A 3ITAA 4I3IA 5CXWA 3QP2A 5TFQA 1FCMA 1IOUA 2UWXA 4GLQA 4GDNA 2WGWA 4BBTA 4DDYA 4KQRA 2G7UA 4HEFA 3LEZA 2W1TA 3A0RA 3PXPA 1K54A 3M6BA 3ZVTA 3T1SA 3GMWA 3NOUC 3F1PB 5CEBA 3IX3A 3K3DA 1XFQA 3TRCA 1NLZA 2PYPA 4DF6A 1HTZA 4ARZA 4CLCB 2EWVA 3QP6A 4B4ZA 3MQOA 3T4JA 1RGZA 4UA9A 3BFCA 1KE0A 2Y2IA 2WADA 4MN7A 2H5SA 3VFHA 2JKRI 2FFYA 2XA7M 1IYPA 1D7EA 1JTGA 2M7VA 3WS2A 3RFBA 4HI4A 2EA9A 3FYZA 1LSVA 4WELA 4IVKA 5GLBA 4ESPA 4BD1A 1JNUA 1YAXA 3OCNA 4RX2A 4BQMA 3VP0A 5HFOA 3FWLA 2VV8A 2XDMA 4BL2A 3E4PA 2FFFB 3N8SA 3SOIA 2Z6CA 4GD6A 4LRXC 3UPNA 2EX8A 1RP5A 2A3UA 1T1CA 1KVMA 1NRFA 4KZBA 2QWSA 4OPYA 5FQMA 2VGKA 4XT2A 2JE5A 3V3RA 4MDZA 1KVLA 5TGFA 3T4OA 5E2HA 3ZG9B 2VEAA 5F1GA 3S7NA 1VM1A 4LLOB 4WEJA 1CI8A 3HLWA 3IBJA 5EM1A 2RL3A 2J3TD 4F3LB 3BFEA 2HP5A 3AGDA 5CECA 4OQIA 1EI5A 3TJZC 3IXHA 5J3WA 4QJGA 4FUWA 3UDFA 1FQGA 5GLDA 1BT5A 1ZHHB 2EXBA 3C4OA 3HLCA 2DNSA 3FKWA 2IWBA 2VX8A 3H7WA 4CJNA 3Q82A 4B9OA 4K08A 2V20A 3UB5P 1MKMA 3RTYA 3R4KA 3BRMA 1NZOA 3SZTA 3VOZA 4G3WA 3OPLA 4R0QA 2JKTI 3S7PA 1NYMA 4C6YA 1TS6A 3KYQA 2WKIA 1VHMA 3VE4A 5EOOA 3N6IA 4FH4A 2O9BA 5MC7A 1RCJA 3BQAA 2JKRM 2XFSA 4IUHA 3IF6B 5CTMA 3ISGA 4RVAA 3H82B 1TD5A 1ONGA 1FSWA 2WKRA 1VEUA 2M1CA 1E25A 2BG1A 5CX7A 3EGDC 3F1NA 3FZCA 4GD8A 5CGXA 1QMEA 2ZM8A 3OCLA 4BBUA 3CUEC 4MBFA 2J7VA 5FI6A 2ZLYA 4YOFA 1SKOA 3T50A 4CLCD 4HNBA 3UE6A 5M1AA 4B93A 4BLMA 4GW9A 1IKIA 1UWPX 2P9VB 4WF0A 3S4XA 2B95A 3BEBA 3BFDA 1I5QA 4RQ9A 2HF6A 1G28A 3SS4A 1FR6A 2XROA 4S2NA 2QYBA 2BASA 1HZOA 2A24A 3BQ8A 1LI9A 3UY6A 2Y2MA 5L10A 3G35A 1IKGA 3IXBA 1TS8A 1IELA 5FSRA 3HUNA 4Y0UA 3BY8A 2HV1A 1DP6A 1GHPA 4D60A 5EPHA 4KZAA 1P9RA 1Z09A 3NBLA 1S67L 4O01A 2X01A 4XUZA 1MBLA 5KMWA 3ZHHA 3V3SA 4NXGA 2ZL1A 2Y2PA 1PW8A 4GHIA 2XF3A 5I94A 1NZUA 4Y7PA 2DRWA 1OTEA 5EVID 1N9OA 1XJ3A 4EBPA 3MF0A 2JKTM 3SW1A 4R6LA 4R3BA 1SDNA 1Z6FA 5M18A 4X1LA 2XRNA 1OT6A 3QP8A 3HCYA 2PHYA 1ONHA 1U60A 3NULA 3NC8A 2HP6A 5HDDA 5E2FA 5IU1A 1XA7A 5FAOA 4HHDA 4E3OA 4YWZA 1LI0A 1XPBA 4MEZA 4GZBA 1HVBA 2GX5A 2WKQA 5J7EA 1S66L 4OP5A 2VJWA 5FQ9A 2C5WB 3E4OA 3MMHA 3BJNA 1G68A 4X6TA 2D01A 3SS5A 1TS0A 3T1XA 4DE3A 4DMZA 2INWA 1H8ZA 3IH9A 3L9KA 3T4LA 1W79A 1MWTA 1S1YA 2L0WA 4GCZA 2VK3A 4P6ZM 2V0UA 5HSQA 3WRZA 4IBXA 3TSGA 3B47A 1ES4A 2Y2GA 2L4RA 1PWCA 1O07A 3VP3A 4PMAA 2JBFA 5HDSA 5AVFA 1YSPA 4M4XA 4E04A 1XJ2A 4Z9QA 1KE4A 3EEHA 3A3JA 1PWGA 1N9NA 5F5YA 2ZQDA 5HAQA 3N4IA 3CG5A 2Z2LB 4BL3A 1ODVA 1E4DA 4WMCA 2QJ7A 1FCNA 4OONA 5CEDA 3BW6A 4JXVA 5L8MA 4KZ6A 4P87A 3MQQA 2V8CA 5HAIA 5DFYA 4NXBA 3IBRA 1LHYA 1VQQA 2X71A 3IF5A 3G34A 1PYYA 4DDSA 3A0SA 3ZNTA 4GKUA 3VFFA 4KZ7A 5EFWA 5M19A 1S6RA 1WE4A 2DCFA 5EVLA 3N8RA 4WZ5C 4S2KA 3NDGA 4ID4A 4DXBA 2VV6A 1F9IA 4JF4A 3F1OA 4NG2A 3BM6A 2HJEA 2ZMVA 4B4XA 2AVXA 3U2AA 2Y2JA 4P0MA 3S22A 1KGFA 4R3JA 5K5BA 4IEDA 4OOYA 3Q7VA 1ZTUA 1K4FA 3HL9A 3KX0X 4X53A 2PBYA 1FILA 3MZFA 2MJ6A 5KZHA 4GDBA 4L0LA 1QMFA 1T1BA 4H8RA 3RXWA 2R9XA 3EEAA 5HD5A 1DJCA 3UB8A 1Q2QA 1FOFA 3T1QB 2ZC5B 3D9YA 3MBZA 1K54C 4S2IA 1BULA 4LCLA 1BUEA 2QHKA 3PAEA 4HIAA 2FH5A 5CTNA 3UE3A 4HBTA 4LRYC 1SDEA 4HH2A 5GHZA 1C3BA 3BECA 1V9ZA 1GCEA 4CQHA 1DRMA 3V67A 4KUKA 4LENA 3HREA 4G3VA 3DTEA 4UHUA 3F1PA 3C7VA 1PZPA 2C6WB 1ESUA 1XFNA 3C4PA 4PKYA 2M7UA 1CEFA 2EFUA 1MWUA 5DF9A 1H3QA 2J3WA 3WS1A 5TBMA 5JYPA 2P7JA 1GA9A 3UPOA 1CI9A 5HL1A 2IWDA 4R3AA 1A0KA 3BFFA 3C2WA 2VZWA 3T4SA 4ETZA 3E98A 1E3UD 4O7DA 3E2KA 3BY9A 1LL8A 4XUXA 1I2WA 3OZHA 5FQJA 4FH2A 1K56A 1HLUP 4OLGA 3TG9A 3IWQA 4HH3A 1LL9A 5A91A 2WGWB 3IWIA 4ZTKA 4L9EA 4OP8A 1NRJA 2D02A 3IH8A 4KZ3A 3PR6A 1XGJA 3VE3A 3MXQA 2I72A 3JYIA 4DE2A 1H5XA 3GRJA 2XGNA 4GB7A 3LIDA 5EV0A 4C75A 2ZC6B 4BBVA 1D06A 3ZG0A 4F3LA 5J8XA 5HDCA 3EWKA 4WUJA 4X69A 5CGSA 5TR7A 2OWJA 3C8CA 3CPTB 1GSVA 3AGEA 3ZCZA 4AFIA 3G6OA 1MXOA 1W8QA 2VGLS 4Q0JA 1PZOA 2GZAA 3GDIA 4EQ1A 3DW0A 4NETA 5EVIB 1EWZA 4GS9B 5U47A 3M2KA 5E2GA 4HBUA 2VA0A 4LCMA 4EEPA 3R7WA 3CAXA 4HESA 2WZZA 4YFMA 2XD5A 3IXDA 4LV0A 5EOEA 5HL6A 3LO7A 2PDRA 3B42A 2W3DA 4DKIA 3M6HA 3JPUA 4KZ4A 5FAPA 2XEPA 3JVUA 1YM1A 3CJMA 1SZVA 5EM0A 2VV7A 4NKPA 3W2ZA 2J8YA 2V1BA 1ALQA 2Y2NA 3IF6A 4D2OA 1K55A 3H82A 4S2NC 5EECA 2ACGA 4ZDXA 1DP8A 3VMAA 3ZGAB 2HGVA 2B02A 5FDSA 1TDLA 1T1AA 4I5SA 2P08A 3LR4A 3UO9A 1ES2A 1MKIA 1W63Q 3LYXA 2J80A 1H0MA 3H7WB 4II7A 3D3OA 2HJ9C 2P9VA 3SH9A 2Z6DA 2ZQ8A 3PYPA 1AWIA 4LFUA 4CPKA 1V9YA 4MNRA 1MWSA 2XD1A 1ERQA 4GOGA 3LGOA 1KDSA 5EVEA 4YNRA 1K57A 3UB6A 1KDWA 5GHYA 3TOIA 5HAPA 3WS0A 3C7UA 3CI6A 3WS4A 4KQOA 1YLTA 2W3GA 4FCFA 1W63M 1BLSA 2JCHA 5DF8A 5BOHA 3HLGA 4JF6A 1XJ6A 3M2JA 2QZ6A 4QU3A 3VP2A 1IYOA 3UE1A 1EROA 4A5RA 3T12B 1T18A 3UN7A 3KSFA 5KSHA 5L2FA 1PI5A 1IYSA 4N9KA 3PBQA 4KZ8A 2OLUA 1Y4OA 3GQZA 4ETXA 4EWFA 1LSXA 3EGXC 1G5UA 4MN6A 4LV3A 4E3MA 1G6AA 2V2FF 4B88A 1MC0A 2K31A 3KSHA 5KIZA 4KZ9A 2KDKA 5HPFA 3V39A 3IX4A 4FTXA 4S2LA 4Y15A 5D3OA 4NXEA 5F69A 2JN7A 2A24B 4Q0HA 1YLYA 4X68A 2XQZA 1F5MA 4KENB 4S2MA 4NXFA 3NHQA 3G2ZA 4IVIA 4PPRA 4O8GA 1JWZA 3PBTA 2E8IA 3ZFZA 3LCEA 2EXAA 3SH7A 3PAGA 5G4YA 3CMZA 3WWXA 2KLIA 1F2KA 4BMWA 3HVFA 4JKTA 1DJBA 2WGVA 4LV2A 5AJGA 2OLVA 3MQ0A 4GHIB 2QMIA 2PD7A 2BTFP 4E6XA 4MMNA 2O9CA 2PAVP 4EBLA 4GN2A 3GSGA 4WEKA 3ICYA 3A3FA 2WKHA 5KSCA 4Z1WA 1CEGA 2ZC7A 5DKKA 1D1JA 2A2LA 5C5KA 1YPRA 2Y2HA 5HX9A 4MBHA 2HDQA 2Y2KA 2J9PA 3JVVA 2YKFA 2WUQA 3FPWA 4KZ5A 2P04A 2KOIA 5IS1A 2ZQCA 5A92A 3IHBA 3U4LP 5FQIA 1VB6A 3IT9A 4E3LA 2EX6A 4Y0TA 2Y2OA 3RH8B 1L3LA 5CHJA 5A8BA 4GNUA 3D4FA 4G3KA 4BENA 2ZQ7A 4UA6A 3T1RA 2ZOIA 4P85A 4OQGA 5F83A 2OSUA 1OT9A 1S4SA 4QHCA 3BWLA 4QB8A 2HDRA 4JXSA 1UGUA 4OQ0A 5DFXA 4N9LA 2XFTA 2Z2MB 3P01A 1E3UA 3KSIA 1KGEA 3A0VA 3KYZA 3HJIA 5FAQA 2GJ3A 2GNXA 4XXRA 3UB9A 4H6JB 4EBNA 4HJ6A 1I2SA 1XP4A 2H28A 3O87A 3SH8A 1WA9A 2KX6A 3ITBA 3VOLA 4KUOA 4ZBEA 1F98A 4JGRA 3GR2A 3LR5A 2Y8HA 3IHAA 3K2NA 3E2LA 2VGJA 4X55A 4EW7A 1YLZA 2Y55A 3B3XA 4JPMA 1OMEA 2ZM2A 4S2PA 4ZJ1A 3Q7ZA 1YKDA 3KYEA 1OTBA 3UMEA 1LLBA 3CZDA 3ZYTA 1MWRA 1BTLA 1M6KA 2A49A 3BYDA 1DP9A 1FCOA 5GLCA 4MBKA 1Y28A 1IYQA 2W27A 2V1AA 4LGWA 1PNEA 1N4OA 4KG2A 1M40A 1P97A 3ZG8B 5CHUA 3V50A 2ZJ9A 1KGGA 4PKYG 3IS2B 2FZ0A 1IEMA 3P7NA 4E3KA 3EOIA 2PU4A 2Q9MA 1MY8A 3LUQA 1JWVA 3O5YA 1YQSA 1Q2PA 3QNBA 1GSWA 3MJQA 3L7HA 1ZG6A 4DN0A 1ZKJA 3IX8A 4PM5A 5G4ZA 3S1YA 1CJFA 3A3DA 4R70A 2EFXA 3E0YA 3MFXA 2B18A 4Y0OA 4DXCA 3F1OB 1L0EA 4R4RA 4WL9A 2JKFA 2I9VA 2E8JA 2V0WA 3V5MA 2W1RA 1BLPA 1J9MA 1PI4A 1W7FA 4R4SA 1DJAA 4X1MA 1K38A 4EV4A 3D72A 1RGYA 1K4EA 4FD8A 1FSYA 2LB9A 5GHXA 1PWDA 2PU2A 4O0PA 3VV4A 1BSGA 1P9WA 5F1FA 2PR5A 2PYRA 1N9BA 4DJ3A 4F94A 1WYBA 5I5LA 3W8KA 3QP1A 3PHYA 2L1MA 1TS7A 3A3IA 3G30A 3CWFA 2VKSA 2H0YA 3FC7A 5GL9A 3P98A 3FPVA 3VOYA 2Q9NA 4HY8A 3ZVWA 2OV5A 3PTEA 2ZQ9A 4CLCA 3DTKA 2O99A 5L09A 3T4QA 3DWZA 4EERA 1VETB 1DY6A 3BLSA 2LB5A 5E43A 1CF0A 1FIKA 4JXGA 1GA0A 4QWOA 5DTSA 2EWWA 2CMNA 2XK1A 2R78A 3LFVA 4UQIS 2UV0E 3C30A 3QP4A 5HPIA 1S0WA 1BLHA 1GHMA 1PRQA 2Y2QA 1YMSA 1AXBA 4Y5FA 3DAVA 5TBMB 4ZJ2A 2Y4AA 4LRZE 4QY5A 1ESIA 4WMCD 3EQVA 1KOUA 2O9AA 2W1TB 4Q8IA 3IXGA 2WGIA 4MN5A 4HP9A 1PW1A 3K3CA 2B5RA 1S4RA 1SCWA 2VGLM 3CPTA 3UDXA 4ZAMA 4ARZB 3VSLA 5GLAA 2ZD8A 4U0XA 5EVIA 4GS9A 4YINA 2WYXA 2OAQ1 3IF6C 1K55C 2OWHA 4EU0A 5HW3A 3AGFA 3NOTC 4U3TA 4OLDA 5F6AA 5FASA 2H0TA 3I7JA 3MSHA 4RA7A 1G6OA 5CHMA 4BJPA 2XA7S 4Q0IA 4JGOA 3IWOA 5HWVA 4OKPA 4U0TA 1P0ZA 3NJAA 1TEMA 4QD4A 3OBFA 4P6BA 4OH0A 1PIOA 3DTIA 2P74A 4BWIA 1L0FA 1TDGA 1GSXA 5L07A 1YLPA 2J9OA 2ZMAA 2ZBBA 2HDUA 4HP4A 1K57C 1ERMA 3FKVA 3PBNA 4E3NA 4XT2B 4Y13A 4WZ4A 2W3EA 4L9GA 4E3IA 5J4EA 5A93A 2QPNA 4EETB 3MXSA 3VSKA 1GHIA 1K6SA 1O7EA 2V9AA 4WLAA 5HWWA 2PR6A 2Y91A 3Q1FA 4N1HA 3HLFA 1ZC2A 2X02A 2XR0A 3R7WB 4EUZA 2K2NA 2OAP1 3N8LA 2EX9A 3NIAA 4IUKA 4OPQA 3HLDA 1IFQA 3SS3A 2IA2A 3W4QA 3VP4A 2JKGA 2O0YA 3VP1A 1L2SA 3O3VA 4JXWA 5DVAA 1YLJA 4IJGA 5AQ7A 4JGQA 2ZOHA 2BLSA 1S1ZA 2Y2LA 2HP9A 2Y59A 3GTCA 3TW8A 4KG5A 4JLFA 2R9WA 5HWTA 5HZHA 3Q81A 2G2UA 1SKFA 3IQAA 4PM7A 5FL3A 1YSQA 3W4PA 3MR0A 2ZC3B 5AVEA 5CGWA 1XXMA 1K25A 3LIAA 2GDNA 2W3FA
chains in the Genus database with same CATH topology
2ZQCA 4X53A 5A92A 2PBYA 3IHBA 3FYZA 3MZFA 4WELA 4IVKA 5FQIA 5GLBA 3W4OA 4GDBA 4L0LA 4BD1A 5KZHA 4S2JA 1QMFA 3IT9A 4E3LA 2EX6A 2ZQAA 3OCNA 4H8RA 4RX2A 4BQMA 4Y0TA 2Y2OA 3RXWA 2R9XA 3RJUA 3VP0A 5CHJA 1DJCA 5HFOA 3FWLA 4GNUA 1Q2QA 4N1XA 3D4FA 1FOFA 4BENA 2ZC5B 1Y54A 2XDMA 4BL2A 4FSFA 3MBZA 4KG6A 4UA7A 2ZQ7A 1K54C 4UA6A 2FFFB 5E2EA 3N8SA 2XLNA 4P85A 4GD6A 1YMXA 3SOIA 3UPNA 2EX8A 4OQGA 5F83A 1RP5A 2OSUA 2A3UA 4S2IA 1BULA 1KVMA 1NRFA 3Q07A 4KZBA 3QNCA 4QHCA 4PM8A 4QB8A 4OPYA 4LCLA 5FQMA 2ZC4B 1BUEA 2VGKA 3ZG7B 2HDRA 2JE5A 3PAEA 4JXSA 1L0GA 3V3RA 4OQ0A 2V1ZA 2WZXA 1NXYA 4N9LA 2XFTA 2Z2MB 2WKEA 1E3UA 1KVLA 5CTNA 1KGEA 5TGFA 3UPPA 3DTMA 3BFGA 1K56D 3UE3A 5FI7A 5FAQA 4XXRA 3ZG9B 5E2HA 4HBTA 5F1GA 4EBNA 1VM1A 1I2SA 1SDEA 1XP4A 5GHZA 1C3BA 1CI8A 3BECA 3HLWA 4WEJA 3GV9A 2RL3A 3O87A 4EQIA 1GCEA 3BFEA 3SH8A 2HP5A 3AGDA 5CECA 4OQIA 1BLCA 3ITBA 1EI5A 3IXHA 4RYEA 5FATA 4K91A 4QJGA 3G4PA 4LENA 3HREA 4ZBEA 3GR2A 3MZEA 3UDFA 1FQGA 1SHVA 1W5DA 2IWCA 3IHAA 3N7WA 3E2LA 5GLDA 1BT5A 4UHUA 2EXBA 3C7VA 2WAFA 1PZPA 3C4OA 2VGJA 3HLCA 2DNSA 2C6WB 1ESUA 3FKWA 4X55A 4OOLA 2IWBA 3C4PA 4CJNA 1YLZA 2Y55A 1CEFA 3B3XA 3Q82A 2EFUA 4JPMA 1MWUA 1OMEA 5DF9A 2ZM2A 4UAAA 5FQQA 3WS1A 1L0DA 2V20A 4S2PA 5JYPA 3ZNYA 1MPLA 3Q7ZA 4ZJ1A 2H10A 1GA9A 1LLBA 3CZDA 3UPOA 1CI9A 1MWRA 5HL1A 2IWDA 1BTLA 1M6KA 2A49A 1NZOA 3BRMA 3BYDA 3P09A 1FCOA 5GLCA 4MBKA 1IYQA 3C5AA 5IHVA 3VOZA 4PM6A 3OPLA 1N4OA 4KG2A 3BFFA 4R0QA 3WRTA 3HBRA 1M40A 3ZG8B 1NYMA 5CHUA 4C6YA 5G18A 1E3UD 3HUOA 3V50A 4O7DA 2G2WA 3E2KA 2WKIA 2ZJ9A 1KGGA 3G31A 1TVFA 3LY4A 4XUXA 1JWPA 1I2WA 3N6IA 5EOOA 3OZHA 4FH4A 1IEMA 4E3KA 1RCJA 5FQJA 3EQUA 4FH2A 1K56A 2PU4A 2Q9MA 2XFSA 4OLGA 3IWQA 3TG9A 3UNWA 3IF6B 5CTMA 3ISGA 1MY8A 4E6WA 4RVAA 1LL9A 5A91A 1JWVA 1ONGA 1YQSA 1Q2PA 1FSWA 2WGWB 1E25A 1K6RA 2BG1A 3IWIA 4ZTKA 5FDHA 4C3QA 3QNBA 2EX2A 3FZCA 4GD8A 1ZG6A 5CGXA 1ZKJA 1QMEA 2ZM8A 3OCLA 4PM5A 4OP8A 4MBFA 2J7VA 1JTDA 3S1YA 5FI6A 2ZLYA 4OPZA 3IH8A 4KZ3A 3A3DA 3G32A 4R1GA 2EFXA 5M1AA 1NY0A 4RX3A 1XX2A 4Y0OA 4BLMA 1XGJA 4DXCA 1IKIA 4OVDA 1L0EA 2P9VB 4R4RA 4IBRA 2I72A 3S4XA 3JYIA 4JF5A 4S2OA 4DE0A 3BEBA 3BFDA 3UDIA 1I5QA 4DE2A 1H5XA 3GRJA 2XGNA 4GB7A 4OQHA 3PBSA 3MKEA 2ZC6B 4C75A 3PBOA 1NJ4A 3SS4A 3V5MA 2CC1A 3ZG0A 1BLPA 1FR6A 5J8XA 1J9MA 1PI4A 1W7FA 4X69A 4R4SA 4S2NA 5CGSA 5EE8A 3WS5A 1DJAA 1HZOA 5CERA 1K38A 4N92A 5TR7A 1LI9A 3ZG5A 3UY6A 2Y2MA 4EV4A 3G35A 1RGYA 3A3EA 3AGEA 1IKGA 4OOMA 3ZCZA 1K4EA 3IXBA 4FD8A 1MXOA 1FSYA 3O86A 1W8QA 4WM9A 1PZOA 5GHXA 3DW0A 1XA1A 4NETA 3MZDA 1EWZA 5EVIB 1IELA 1NYYA 1PWDA 2PU2A 5U47A 5FSRA 1BSGA 3HUNA 3M2KA 4Y0UA 4HBUA 4LCMA 5E2GA 5F1FA 3O88A 1N9BA 4HESA 2WZZA 3LY3A 1GHPA 4F94A 4YFMA 5EPHA 1WYBA 3W8KA 2XD5A 1H8YA 3IXDA 4KZAA 5F82A 3A3IA 3UE0A 2ZM0A 4WYYA 3NBLA 3G30A 4LV0A 5EOEA 2X01A 2RCXA 2H0YA 3LO7A 4XUZA 1CK3A 3HLEA 3MFDA 5GL9A 1MBLA 3P98A 3ZHHA 3MKFA 3V3SA 3VOYA 5KMWA 2Q9NA 3ZVWA 2OV5A 2Y2PA 1PW8A 4DKIA 3M6HA 3PTEA 2XF3A 5I94A 5AQ9A 1NZUA 4KZ4A 5FAPA 4Y7PA 2DRWA 2XEPA 2ZQ9A 3OC2A 1YM1A 3CJMA 4R23A 5EVID 4EBPA 3DWZA 4R3BA 4QY6A 2J8YA 1SDNA 4JBFA 1DY6A 3BLSA 1ALQA 5E43A 2Y2NA 3IF6A 1Z6FA 3HLBA 4D2OA 5M18A 4JXGA 1K55A 2JC7A 4S2NC 1ONHA 1GA0A 1U60A 5EECA 3NCKA 4ZDXA 5DTSA 3VMAA 3NC8A 2HP6A 3ZGAB 4WBGA 5E2FA 1XA7A 5FAOA 4E3OA 2XK1A 1JVJA 2HPBA 3OPPA 1LI0A 1TDLA 5EUAA 1ES5A 1XPBA 3BLMA 4MEZA 3UO9A 1ES2A 4BD0A 1MKIA 4GZBA 1HVBA 1S0WA 1BLHA 1GHMA 1XKZA 2Y2QA 1YMSA 1AXBA 3FV7A 4K0XA 5AQBA 4OP5A 5HARA 2P9VA 3SH9A 4K0WA 1ES3A 5FQ9A 2C5WB 2ZQ8A 4ZJ2A 5DTKA 3OPRA 3PBRA 1BZAA 1XGIA 1ZG4A 2WAEA 2Y4AA 4DE1A 4QY5A 1ESIA 4WMCD 1G68A 3EQVA 4CPKA 4X6TA 5AQAA 3NDEA 4Q8IA 4MNRA 3IXGA 1MWSA 2XH9A 3RXXA 4LV1A 2XD1A 3HUMA 1ERQA 2WGIA 5CRFA 3SS5A 4GOGA 1YLWA 4DE3A 5JYOA 1PW1A 2B5RA 1KDSA 4OPRA 4ZJ3A 1SCWA 1K57A 1KDWA 1H8ZA 5GHYA 3TOIA 5HAPA 1KE3A 3UDXA 3IH9A 4ZAMA 3WS0A 1W79A 4X56A 1MWTA 3VSLA 3C7UA 3ZDJA 5GLAA 2ZD8A 3WS4A 4U0XA 5EVIA 4YINA 2WYXA 4KQOA 1YLTA 3IF6C 4FCFA 1BLSA 2JCHA 1LL5A 2WK0A 1K55C 5DF8A 5BOHA 5FA7A 4DRTA 3HLGA 5HW3A 4JF6A 3WRZA 3AGFA 3M2JA 3NI9A 2QZ6A 4IBXA 3Q7VB 3TSGA 4QU3A 3VP2A 1ES4A 1IYOA 1HD8A 4E3JA 1FR1A 2Y2GA 4OLDA 4U3TA 1PWCA 3UE1A 5FASA 1EROA 2H0TA 3I7JA 3OPHA 4A5RA 4M3KA 4RA7A 5CHMA 4BJPA 1O07A 3VP3A 4PMAA 3IWOA 2JBFA 3UN7A 4OKPA 5KSHA 4U0TA 5L2FA 1PI5A 5A90A 4WZ5A 4Z9QA 1IYSA 1TEMA 4N9KA 1KE4A 3PBQA 4QD4A 3DWKA 4KZ8A 3A3JA 2OLUA 3GQZA 4P6BA 1PWGA 4EWFA 4OH0A 1PIOA 5FQKA 2ZQDA 4MLLA 5HAQA 3N4IA 2P74A 3GVBA 1L0FA 3CG5A 1TDGA 3QHYA 4LV3A 4E3MA 1G6AA 1WYCA 2V2FF 2Z2LB 2HDSA 4B88A 1YLPA 4BL3A 2J9OA 4KZ9A 2ZMAA 1E4DA 4NK3A 4WMCA 2HDUA 3V39A 1YT4A 1K57C 1ERMA 3FKVA 1FCNA 3PBNA 4S2LA 4OONA 4E3NA 5D3OA 5CEDA 3G2YA 4PM9A 4KQQA 4WZ4A 1W8YA 4E3IA 4JXVA 1YLYA 4KZ6A 4P87A 4X68A 5DF7A 5FI2A 5A93A 3MXRA 2XQZA 2QPNA 4KENB 4S2MA 5DTTA 5EVIC 3NY4A 3ITAA 3MXSA 3VSKA 1GHIA 1K6SA 5HAIA 3G2ZA 1O7EA 1LHYA 4IVIA 4PPRA 5CXWA 2Y91A 3Q1FA 4N1HA 5TFQA 1VQQA 2X71A 1FCMA 1JWZA 2UWXA 3HLFA 1ZC2A 3IF5A 3PBTA 3G34A 2X02A 2E8IA 2XR0A 4GDNA 3ZFZA 1PYYA 2WGWA 4EUZA 3LCEA 2EXAA 3N8LA 3SH7A 4DDSA 4DDYA 2EX9A 3ZNTA 3NIAA 3PAGA 4GKUA 3VFFA 3CMZA 4KZ7A 4KQRA 5M19A 4OPQA 3WWXA 3HLDA 4HEFA 1S6RA 3SS3A 1WE4A 3LEZA 3W4QA 2DCFA 3VP4A 1K54A 3M6BA 3HVFA 3VP1A 5EVLA 3ZVTA 1L2SA 3GMWA 3N8RA 3O3VA 4JXWA 4JKTA 4S2KA 4WZ5C 3NDGA 4ID4A 1DJBA 5CEBA 2WGVA 4LV2A 5DVAA 4DXBA 2OLVA 1YLJA 5AQ7A 4JF4A 2QMIA 4E6XA 4DF6A 2BLSA 1HTZA 2Y2LA 2HP9A 2Y59A 3GTCA 4KG5A 3BM6A 4EBLA 4GN2A 2R9WA 3GSGA 4JLFA 4B4XA 4WEKA 3Q81A 4B4ZA 1RGZA 2Y2JA 4UA9A 3A3FA 2G2UA 1SKFA 2WKHA 3BFCA 4P0MA 5KSCA 3IQAA 4PM7A 3S22A 1CEGA 3W4PA 1KGFA 4R3JA 1KE0A 2Y2IA 2WADA 2ZC7A 2ZC3B 4IEDA 4OOYA 2H5SA 3Q7VA 5CGWA 3VFHA 2FFYA 1IYPA 1XXMA 1JTGA 1K25A 2Y2HA 1K4FA 4MBHA 5HX9A 2HDQA 2Y2KA 3WS2A 2J9PA 2GDNA 2WUQA 3HL9A 4KZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZQC A;  4X53 A;  5A92 A;  2PBY A;  3IHB A;  3FYZ A;  3MZF A;  4WEL A;  4IVK A;  5FQI A;  5GLB A;  3W4O A;  4GDB A;  4L0L A;  4BD1 A;  5KZH A;  4S2J A;  1QMF A;  3IT9 A;  4E3L A;  2EX6 A;  2ZQA A;  3OCN A;  4H8R A;  4RX2 A;  4BQM A;  4Y0T A;  2Y2O A;  3RXW A;  2R9X A;  3RJU A;  3VP0 A;  5CHJ A;  1DJC A;  5HFO A;  3FWL A;  4GNU A;  1Q2Q A;  4N1X A;  3D4F A;  1FOF A;  4BEN A;  2ZC5 B;  1Y54 A;  2XDM A;  4BL2 A;  4FSF A;  3MBZ A;  4KG6 A;  4UA7 A;  2ZQ7 A;  1K54 C;  4UA6 A;  2FFF B;  5E2E A;  3N8S A;  2XLN A;  4P85 A;  4GD6 A;  1YMX A;  3SOI A;  3UPN A;  2EX8 A;  4OQG A;  5F83 A;  1RP5 A;  2OSU A;  2A3U A;  4S2I A;  1BUL A;  1KVM A;  1NRF A;  3Q07 A;  4KZB A;  3QNC A;  4QHC A;  4PM8 A;  4QB8 A;  4OPY A;  4LCL A;  5FQM A;  2ZC4 B;  1BUE A;  2VGK A;  3ZG7 B;  2HDR A;  2JE5 A;  3PAE A;  4JXS A;  1L0G A;  3V3R A;  4OQ0 A;  2V1Z A;  2WZX A;  1NXY A;  4N9L A;  2XFT A;  2Z2M B;  2WKE A;  1E3U A;  1KVL A;  5CTN A;  1KGE A;  5TGF A;  3UPP A;  3DTM A;  3BFG A;  1K56 D;  3UE3 A;  5FI7 A;  5FAQ A;  4XXR A;  3ZG9 B;  5E2H A;  4HBT A;  5F1G A;  4EBN A;  1VM1 A;  1I2S A;  1SDE A;  1XP4 A;  5GHZ A;  1C3B A;  1CI8 A;  3BEC A;  3HLW A;  4WEJ A;  3GV9 A;  2RL3 A;  3O87 A;  4EQI A;  1GCE A;  3BFE A;  3SH8 A;  2HP5 A;  3AGD A;  5CEC A;  4OQI A;  1BLC A;  3ITB A;  1EI5 A;  3IXH A;  4RYE A;  5FAT A;  4K91 A;  4QJG A;  3G4P A;  4LEN A;  3HRE A;  4ZBE A;  3GR2 A;  3MZE A;  3UDF A;  1FQG A;  1SHV A;  1W5D A;  2IWC A;  3IHA A;  3N7W A;  3E2L A;  5GLD A;  1BT5 A;  4UHU A;  2EXB A;  3C7V A;  2WAF A;  1PZP A;  3C4O A;  2VGJ A;  3HLC A;  2DNS A;  2C6W B;  1ESU A;  3FKW A;  4X55 A;  4OOL A;  2IWB A;  3C4P A;  4CJN A;  1YLZ A;  2Y55 A;  1CEF A;  3B3X A;  3Q82 A;  2EFU A;  4JPM A;  1MWU A;  1OME A;  5DF9 A;  2ZM2 A;  4UAA A;  5FQQ A;  3WS1 A;  1L0D A;  2V20 A;  4S2P A;  5JYP A;  3ZNY A;  1MPL A;  3Q7Z A;  4ZJ1 A;  2H10 A;  1GA9 A;  1LLB A;  3CZD A;  3UPO A;  1CI9 A;  1MWR A;  5HL1 A;  2IWD A;  1BTL A;  1M6K A;  2A49 A;  1NZO A;  3BRM A;  3BYD A;  3P09 A;  1FCO A;  5GLC A;  4MBK A;  1IYQ A;  3C5A A;  5IHV A;  3VOZ A;  4PM6 A;  3OPL A;  1N4O A;  4KG2 A;  3BFF A;  4R0Q A;  3WRT A;  3HBR A;  1M40 A;  3ZG8 B;  1NYM A;  5CHU A;  4C6Y A;  5G18 A;  1E3U D;  3HUO A;  3V50 A;  4O7D A;  2G2W A;  3E2K A;  2WKI A;  2ZJ9 A;  1KGG A;  3G31 A;  1TVF A;  3LY4 A;  4XUX A;  1JWP A;  1I2W A;  3N6I A;  5EOO A;  3OZH A;  4FH4 A;  1IEM A;  4E3K A;  1RCJ A;  5FQJ A;  3EQU A;  4FH2 A;  1K56 A;  2PU4 A;  2Q9M A;  2XFS A;  4OLG A;  3IWQ A;  3TG9 A;  3UNW A;  3IF6 B;  5CTM A;  3ISG A;  1MY8 A;  4E6W A;  4RVA A;  1LL9 A;  5A91 A;  1JWV A;  1ONG A;  1YQS A;  1Q2P A;  1FSW A;  2WGW B;  1E25 A;  1K6R A;  2BG1 A;  3IWI A;  4ZTK A;  5FDH A;  4C3Q A;  3QNB A;  2EX2 A;  3FZC A;  4GD8 A;  1ZG6 A;  5CGX A;  1ZKJ A;  1QME A;  2ZM8 A;  3OCL A;  4PM5 A;  4OP8 A;  4MBF A;  2J7V A;  1JTD A;  3S1Y A;  5FI6 A;  2ZLY A;  4OPZ A;  3IH8 A;  4KZ3 A;  3A3D A;  3G32 A;  4R1G A;  2EFX A;  5M1A A;  1NY0 A;  4RX3 A;  1XX2 A;  4Y0O A;  4BLM A;  1XGJ A;  4DXC A;  1IKI A;  4OVD A;  1L0E A;  2P9V B;  4R4R A;  4IBR A;  2I72 A;  3S4X A;  3JYI A;  4JF5 A;  4S2O A;  4DE0 A;  3BEB A;  3BFD A;  3UDI A;  1I5Q A;  4DE2 A;  1H5X A;  3GRJ A;  2XGN A;  4GB7 A;  4OQH A;  3PBS A;  3MKE A;  2ZC6 B;  4C75 A;  3PBO A;  1NJ4 A;  3SS4 A;  3V5M A;  2CC1 A;  3ZG0 A;  1BLP A;  1FR6 A;  5J8X A;  1J9M A;  1PI4 A;  1W7F A;  4X69 A;  4R4S A;  4S2N A;  5CGS A;  5EE8 A;  3WS5 A;  1DJA A;  1HZO A;  5CER A;  1K38 A;  4N92 A;  5TR7 A;  1LI9 A;  3ZG5 A;  3UY6 A;  2Y2M A;  4EV4 A;  3G35 A;  1RGY A;  3A3E A;  3AGE A;  1IKG A;  4OOM A;  3ZCZ A;  1K4E A;  3IXB A;  4FD8 A;  1MXO A;  1FSY A;  3O86 A;  1W8Q A;  4WM9 A;  1PZO A;  5GHX A;  3DW0 A;  1XA1 A;  4NET A;  3MZD A;  1EWZ A;  5EVI B;  1IEL A;  1NYY A;  1PWD A;  2PU2 A;  5U47 A;  5FSR A;  1BSG A;  3HUN A;  3M2K A;  4Y0U A;  4HBU A;  4LCM A;  5E2G A;  5F1F A;  3O88 A;  1N9B A;  4HES A;  2WZZ A;  3LY3 A;  1GHP A;  4F94 A;  4YFM A;  5EPH A;  1WYB A;  3W8K A;  2XD5 A;  1H8Y A;  3IXD A;  4KZA A;  5F82 A;  3A3I A;  3UE0 A;  2ZM0 A;  4WYY A;  3NBL A;  3G30 A;  4LV0 A;  5EOE A;  2X01 A;  2RCX A;  2H0Y A;  3LO7 A;  4XUZ A;  1CK3 A;  3HLE A;  3MFD A;  5GL9 A;  1MBL A;  3P98 A;  3ZHH A;  3MKF A;  3V3S A;  3VOY A;  5KMW A;  2Q9N A;  3ZVW A;  2OV5 A;  2Y2P A;  1PW8 A;  4DKI A;  3M6H A;  3PTE A;  2XF3 A;  5I94 A;  5AQ9 A;  1NZU A;  4KZ4 A;  5FAP A;  4Y7P A;  2DRW A;  2XEP A;  2ZQ9 A;  3OC2 A;  1YM1 A;  3CJM A;  4R23 A;  5EVI D;  4EBP A;  3DWZ A;  4R3B A;  4QY6 A;  2J8Y A;  1SDN A;  4JBF A;  1DY6 A;  3BLS A;  1ALQ A;  5E43 A;  2Y2N A;  3IF6 A;  1Z6F A;  3HLB A;  4D2O A;  5M18 A;  4JXG A;  1K55 A;  2JC7 A;  4S2N C;  1ONH A;  1GA0 A;  1U60 A;  5EEC A;  3NCK A;  4ZDX A;  5DTS A;  3VMA A;  3NC8 A;  2HP6 A;  3ZGA B;  4WBG A;  5E2F A;  1XA7 A;  5FAO A;  4E3O A;  2XK1 A;  1JVJ A;  2HPB A;  3OPP A;  1LI0 A;  1TDL A;  5EUA A;  1ES5 A;  1XPB A;  3BLM A;  4MEZ A;  3UO9 A;  1ES2 A;  4BD0 A;  1MKI A;  4GZB A;  1HVB A;  1S0W A;  1BLH A;  1GHM A;  1XKZ A;  2Y2Q A;  1YMS A;  1AXB A;  3FV7 A;  4K0X A;  5AQB A;  4OP5 A;  5HAR A;  2P9V A;  3SH9 A;  4K0W A;  1ES3 A;  5FQ9 A;  2C5W B;  2ZQ8 A;  4ZJ2 A;  5DTK A;  3OPR A;  3PBR A;  1BZA A;  1XGI A;  1ZG4 A;  2WAE A;  2Y4A A;  4DE1 A;  4QY5 A;  1ESI A;  4WMC D;  1G68 A;  3EQV A;  4CPK A;  4X6T A;  5AQA A;  3NDE A;  4Q8I A;  4MNR A;  3IXG A;  1MWS A;  2XH9 A;  3RXX A;  4LV1 A;  2XD1 A;  3HUM A;  1ERQ A;  2WGI A;  5CRF A;  3SS5 A;  4GOG A;  1YLW A;  4DE3 A;  5JYO A;  1PW1 A;  2B5R A;  1KDS A;  4OPR A;  4ZJ3 A;  1SCW A;  1K57 A;  1KDW A;  1H8Z A;  5GHY A;  3TOI A;  5HAP A;  1KE3 A;  3UDX A;  3IH9 A;  4ZAM A;  3WS0 A;  1W79 A;  4X56 A;  1MWT A;  3VSL A;  3C7U A;  3ZDJ A;  5GLA A;  2ZD8 A;  3WS4 A;  4U0X A;  5EVI A;  4YIN A;  2WYX A;  4KQO A;  1YLT A;  3IF6 C;  4FCF A;  1BLS A;  2JCH A;  1LL5 A;  2WK0 A;  1K55 C;  5DF8 A;  5BOH A;  5FA7 A;  4DRT A;  3HLG A;  5HW3 A;  4JF6 A;  3WRZ A;  3AGF A;  3M2J A;  3NI9 A;  2QZ6 A;  4IBX A;  3Q7V B;  3TSG A;  4QU3 A;  3VP2 A;  1ES4 A;  1IYO A;  1HD8 A;  4E3J A;  1FR1 A;  2Y2G A;  4OLD A;  4U3T A;  1PWC A;  3UE1 A;  5FAS A;  1ERO A;  2H0T A;  3I7J A;  3OPH A;  4A5R A;  4M3K A;  4RA7 A;  5CHM A;  4BJP A;  1O07 A;  3VP3 A;  4PMA A;  3IWO A;  2JBF A;  3UN7 A;  4OKP A;  5KSH A;  4U0T A;  5L2F A;  1PI5 A;  5A90 A;  4WZ5 A;  4Z9Q A;  1IYS A;  1TEM A;  4N9K A;  1KE4 A;  3PBQ A;  4QD4 A;  3DWK A;  4KZ8 A;  3A3J A;  2OLU A;  3GQZ A;  4P6B A;  1PWG A;  4EWF A;  4OH0 A;  1PIO A;  5FQK A;  2ZQD A;  4MLL A;  5HAQ A;  3N4I A;  2P74 A;  3GVB A;  1L0F A;  3CG5 A;  1TDG A;  3QHY A;  4LV3 A;  4E3M A;  1G6A A;  1WYC A;  2V2F F;  2Z2L B;  2HDS A;  4B88 A;  1YLP A;  4BL3 A;  2J9O A;  4KZ9 A;  2ZMA A;  1E4D A;  4NK3 A;  4WMC A;  2HDU A;  3V39 A;  1YT4 A;  1K57 C;  1ERM A;  3FKV A;  1FCN A;  3PBN A;  4S2L A;  4OON A;  4E3N A;  5D3O A;  5CED A;  3G2Y A;  4PM9 A;  4KQQ A;  4WZ4 A;  1W8Y A;  4E3I A;  4JXV A;  1YLY A;  4KZ6 A;  4P87 A;  4X68 A;  5DF7 A;  5FI2 A;  5A93 A;  3MXR A;  2XQZ A;  2QPN A;  4KEN B;  4S2M A;  5DTT A;  5EVI C;  3NY4 A;  3ITA A;  3MXS A;  3VSK A;  1GHI A;  1K6S A;  5HAI A;  3G2Z A;  1O7E A;  1LHY A;  4IVI A;  4PPR A;  5CXW A;  2Y91 A;  3Q1F A;  4N1H A;  5TFQ A;  1VQQ A;  2X71 A;  1FCM A;  1JWZ A;  2UWX A;  3HLF A;  1ZC2 A;  3IF5 A;  3PBT A;  3G34 A;  2X02 A;  2E8I A;  2XR0 A;  4GDN A;  3ZFZ A;  1PYY A;  2WGW A;  4EUZ A;  3LCE A;  2EXA A;  3N8L A;  3SH7 A;  4DDS A;  4DDY A;  2EX9 A;  3ZNT A;  3NIA A;  3PAG A;  4GKU A;  3VFF A;  3CMZ A;  4KZ7 A;  4KQR A;  5M19 A;  4OPQ A;  3WWX A;  3HLD A;  4HEF A;  1S6R A;  3SS3 A;  1WE4 A;  3LEZ A;  3W4Q A;  2DCF A;  3VP4 A;  1K54 A;  3M6B A;  3HVF A;  3VP1 A;  5EVL A;  3ZVT A;  1L2S A;  3GMW A;  3N8R A;  3O3V A;  4JXW A;  4JKT A;  4S2K A;  4WZ5 C;  3NDG A;  4ID4 A;  1DJB A;  5CEB A;  2WGV A;  4LV2 A;  5DVA A;  4DXB A;  2OLV A;  1YLJ A;  5AQ7 A;  4JF4 A;  2QMI A;  4E6X A;  4DF6 A;  2BLS A;  1HTZ A;  2Y2L A;  2HP9 A;  2Y59 A;  3GTC A;  4KG5 A;  3BM6 A;  4EBL A;  4GN2 A;  2R9W A;  3GSG A;  4JLF A;  4B4X A;  4WEK A;  3Q81 A;  4B4Z A;  1RGZ A;  2Y2J A;  4UA9 A;  3A3F A;  2G2U A;  1SKF A;  2WKH A;  3BFC A;  4P0M A;  5KSC A;  3IQA A;  4PM7 A;  3S22 A;  1CEG A;  3W4P A;  1KGF A;  4R3J A;  1KE0 A;  2Y2I A;  2WAD A;  2ZC7 A;  2ZC3 B;  4IED A;  4OOY A;  2H5S A;  3Q7V A;  5CGW A;  3VFH A;  2FFY A;  1IYP A;  1XXM A;  1JTG A;  1K25 A;  2Y2H A;  1K4F A;  4MBH A;  5HX9 A;  2HDQ A;  2Y2K A;  3WS2 A;  2J9P A;  2GDN A;  2WUQ A;  3HL9 A;  4KZ5 A; 
#chains in the Genus database with same CATH topology
 2PRF A;  4HOI A;  3W4O A;  5FEF A;  4S2J A;  2ZQA A;  1STZ A;  3RJU A;  4EXO A;  1VEU B;  4N1X A;  1Y54 A;  3F1N B;  3NOP C;  4FSF A;  4KG6 A;  4UA7 A;  5E2E A;  2XLN A;  4DJ2 A;  1YMX A;  4L9F A;  3Q07 A;  1SKO B;  2JHE A;  3QNC A;  4PM8 A;  2PBD P;  5IT5 A;  2ZC4 B;  3ZG7 B;  1L0G A;  1LT0 A;  2V1Z A;  2WZX A;  1NXY A;  2WKE A;  3UPP A;  2K7S A;  3BFG A;  1K56 D;  3DTM A;  5FI7 A;  3H9W A;  3GV9 A;  4EQI A;  4KQD A;  1PFL A;  3B33 A;  3CIT A;  3DBA A;  5HD3 A;  1BLC A;  4RYE A;  5FAT A;  4K91 A;  3UB7 A;  3G4P A;  3MZE A;  2IWC A;  1SHV A;  1W5D A;  3N7W A;  3TE8 A;  2WAF A;  3CUE A;  3LIE A;  3LIF A;  4CLC E;  1UWN X;  4OOL A;  4LPZ A;  2DMW A;  5FQQ A;  1LSW A;  4UAA A;  1L0D A;  3NEC A;  3ZNY A;  1MPL A;  2H10 A;  2QJ5 A;  2NUT C;  4HJ4 A;  2ZMF A;  3P09 A;  3ULF A;  1T19 A;  3C5A A;  5IHV A;  2YKH A;  4PM6 A;  4JGP A;  3WRT A;  2W0N A;  3HBR A;  2ZL1 B;  3S7Q A;  1NWZ A;  5DJU A;  5G18 A;  3HUO A;  2Y79 A;  4ZRR A;  2G2W A;  1MZU A;  3G31 A;  2Q0O A;  1TVF A;  3LY4 A;  1JWP A;  3LIC A;  3EQU A;  5F68 A;  3UNW A;  3S7O A;  3GEC A;  4E6W A;  2V8F A;  1K6R A;  3KSG A;  5FDH A;  4C3Q A;  2EX2 A;  3OLO A;  3LR3 A;  1K0K A;  4MCW A;  1N9L A;  4Y2F A;  1JTD A;  3CHW P;  2NUP C;  4I38 A;  4OPZ A;  3G32 A;  4R1G A;  2XSS A;  1OTA A;  1CQA A;  1NY0 A;  4RX3 A;  1XX2 A;  4OVD A;  1OTI A;  5LBR A;  4IBR A;  5DKL A;  3QP5 A;  4JF5 A;  4H6J A;  4S2O A;  4DE0 A;  4UEY A;  1EW0 A;  3UDI A;  4OQH A;  3PBS A;  3MKE A;  3KO6 A;  4I39 A;  3PBO A;  1NJ4 A;  2CC1 A;  1OJG A;  3WS5 A;  5EE8 A;  5CER A;  3T4K A;  4N92 A;  4ME4 A;  2PD8 A;  3ZG5 A;  1XJ4 A;  3A3E A;  3C38 A;  4OOM A;  4PAU A;  3O86 A;  4WM9 A;  1XA1 A;  3MZD A;  1NYY A;  4I3J A;  3O88 A;  3LY3 A;  4P6Z S;  1OPX A;  2J3T C;  1H8Y A;  5F82 A;  4GJ4 A;  3UE0 A;  2ZM0 A;  4WYY A;  1BYW A;  1OTD A;  2RCX A;  3ZQ5 A;  1CK3 A;  3HLE A;  3MFD A;  4EES A;  3MKF A;  3E4Q A;  4NEE D;  5AQ9 A;  3OC2 A;  3CLO A;  4R23 A;  3IS2 A;  4QY6 A;  4JBF A;  3HLB A;  3LI9 A;  2HZ5 A;  2JC7 A;  3NCK A;  4I3A A;  4WBG A;  2WKP A;  1JVJ A;  2HPB A;  3OPP A;  5TJJ A;  5EUA A;  1ES5 A;  3BLM A;  3HJK A;  4PHT A;  4BD0 A;  4QPR A;  1XKZ A;  3FV7 A;  4K0X A;  5HAR A;  5AQB A;  4Y17 A;  4K0W A;  1ES3 A;  3OOV A;  5DTK A;  3OPR A;  3FG8 A;  3PBR A;  1BZA A;  1XGI A;  1ZG4 A;  2WAE A;  4DE1 A;  5AQA A;  3NDE A;  4R38 A;  3RXX A;  2XH9 A;  4LV1 A;  3HUM A;  5CRF A;  3T4T A;  1YLW A;  5JYO A;  1ACF A;  4CLC C;  4OPR A;  2VLG A;  4ZJ3 A;  4FOF A;  3LR0 A;  1KE3 A;  4EEU A;  4X56 A;  2PT7 A;  3ZDJ A;  4IHQ A;  1LL5 A;  2WK0 A;  5FA7 A;  4DRT A;  3LI8 A;  3LEQ A;  3NI9 A;  3Q7V B;  4X25 A;  1HD8 A;  1J3W A;  4E3J A;  1FR1 A;  3OPH A;  4M3K A;  1TF1 A;  5A90 A;  4WZ5 A;  4EUV A;  1H8M A;  4HQA A;  3DWK A;  2QKP A;  4WN5 A;  5FQK A;  4MLL A;  3GVB A;  1VET A;  3QHY A;  1WYC A;  4Y3I A;  2HDS A;  5DJT A;  1NLY A;  3LIB A;  3UMD A;  4NK3 A;  5FEG A;  2W3H A;  1YT4 A;  1OJ5 A;  3G2Y A;  4PM9 A;  4KQQ A;  1W8Y A;  2OOL A;  1X0O A;  5DF7 A;  3MS6 A;  5FI2 A;  3MXR A;  4UQI M;  5DTT A;  4HJ3 A;  5EVI C;  3NY4 A;  3ITA A;  4I3I A;  5CXW A;  3QP2 A;  5TFQ A;  1FCM A;  1IOU A;  2UWX A;  4GLQ A;  4GDN A;  2WGW A;  4BBT A;  4DDY A;  4KQR A;  2G7U A;  4HEF A;  3LEZ A;  2W1T A;  3A0R A;  3PXP A;  1K54 A;  3M6B A;  3ZVT A;  3T1S A;  3GMW A;  3NOU C;  3F1P B;  5CEB A;  3IX3 A;  3K3D A;  1XFQ A;  3TRC A;  1NLZ A;  2PYP A;  4DF6 A;  1HTZ A;  4ARZ A;  4CLC B;  2EWV A;  3QP6 A;  4B4Z A;  3MQO A;  3T4J A;  1RGZ A;  4UA9 A;  3BFC A;  1KE0 A;  2Y2I A;  2WAD A;  4MN7 A;  2H5S A;  3VFH A;  2JKR I;  2FFY A;  2XA7 M;  1IYP A;  1D7E A;  1JTG A;  2M7V A;  3WS2 A;  3RFB A;  4HI4 A;  2EA9 A;  3FYZ A;  1LSV A;  4WEL A;  4IVK A;  5GLB A;  4ESP A;  4BD1 A;  1JNU A;  1YAX A;  3OCN A;  4RX2 A;  4BQM A;  3VP0 A;  5HFO A;  3FWL A;  2VV8 A;  2XDM A;  4BL2 A;  3E4P A;  2FFF B;  3N8S A;  3SOI A;  2Z6C A;  4GD6 A;  4LRX C;  3UPN A;  2EX8 A;  1RP5 A;  2A3U A;  1T1C A;  1KVM A;  1NRF A;  4KZB A;  2QWS A;  4OPY A;  5FQM A;  2VGK A;  4XT2 A;  2JE5 A;  3V3R A;  4MDZ A;  1KVL A;  5TGF A;  3T4O A;  5E2H A;  3ZG9 B;  2VEA A;  5F1G A;  3S7N A;  1VM1 A;  4LLO B;  4WEJ A;  1CI8 A;  3HLW A;  3IBJ A;  5EM1 A;  2RL3 A;  2J3T D;  4F3L B;  3BFE A;  2HP5 A;  3AGD A;  5CEC A;  4OQI A;  1EI5 A;  3TJZ C;  3IXH A;  5J3W A;  4QJG A;  4FUW A;  3UDF A;  1FQG A;  5GLD A;  1BT5 A;  1ZHH B;  2EXB A;  3C4O A;  3HLC A;  2DNS A;  3FKW A;  2IWB A;  2VX8 A;  3H7W A;  4CJN A;  3Q82 A;  4B9O A;  4K08 A;  2V20 A;  3UB5 P;  1MKM A;  3RTY A;  3R4K A;  3BRM A;  1NZO A;  3SZT A;  3VOZ A;  4G3W A;  3OPL A;  4R0Q A;  2JKT I;  3S7P A;  1NYM A;  4C6Y A;  1TS6 A;  3KYQ A;  2WKI A;  1VHM A;  3VE4 A;  5EOO A;  3N6I A;  4FH4 A;  2O9B A;  5MC7 A;  1RCJ A;  3BQA A;  2JKR M;  2XFS A;  4IUH A;  3IF6 B;  5CTM A;  3ISG A;  4RVA A;  3H82 B;  1TD5 A;  1ONG A;  1FSW A;  2WKR A;  1VEU A;  2M1C A;  1E25 A;  2BG1 A;  5CX7 A;  3EGD C;  3F1N A;  3FZC A;  4GD8 A;  5CGX A;  1QME A;  2ZM8 A;  3OCL A;  4BBU A;  3CUE C;  4MBF A;  2J7V A;  5FI6 A;  2ZLY A;  4YOF A;  1SKO A;  3T50 A;  4CLC D;  4HNB A;  3UE6 A;  5M1A A;  4B93 A;  4BLM A;  4GW9 A;  1IKI A;  1UWP X;  2P9V B;  4WF0 A;  3S4X A;  2B95 A;  3BEB A;  3BFD A;  1I5Q A;  4RQ9 A;  2HF6 A;  1G28 A;  3SS4 A;  1FR6 A;  2XRO A;  4S2N A;  2QYB A;  2BAS A;  1HZO A;  2A24 A;  3BQ8 A;  1LI9 A;  3UY6 A;  2Y2M A;  5L10 A;  3G35 A;  1IKG A;  3IXB A;  1TS8 A;  1IEL A;  5FSR A;  3HUN A;  4Y0U A;  3BY8 A;  2HV1 A;  1DP6 A;  1GHP A;  4D60 A;  5EPH A;  4KZA A;  1P9R A;  1Z09 A;  3NBL A;  1S67 L;  4O01 A;  2X01 A;  4XUZ A;  1MBL A;  5KMW A;  3ZHH A;  3V3S A;  4NXG A;  2ZL1 A;  2Y2P A;  1PW8 A;  4GHI A;  2XF3 A;  5I94 A;  1NZU A;  4Y7P A;  2DRW A;  1OTE A;  5EVI D;  1N9O A;  1XJ3 A;  4EBP A;  3MF0 A;  2JKT M;  3SW1 A;  4R6L A;  4R3B A;  1SDN A;  1Z6F A;  5M18 A;  4X1L A;  2XRN A;  1OT6 A;  3QP8 A;  3HCY A;  2PHY A;  1ONH A;  1U60 A;  3NUL A;  3NC8 A;  2HP6 A;  5HDD A;  5E2F A;  5IU1 A;  1XA7 A;  5FAO A;  4HHD A;  4E3O A;  4YWZ A;  1LI0 A;  1XPB A;  4MEZ A;  4GZB A;  1HVB A;  2GX5 A;  2WKQ A;  5J7E A;  1S66 L;  4OP5 A;  2VJW A;  5FQ9 A;  2C5W B;  3E4O A;  3MMH A;  3BJN A;  1G68 A;  4X6T A;  2D01 A;  3SS5 A;  1TS0 A;  3T1X A;  4DE3 A;  4DMZ A;  2INW A;  1H8Z A;  3IH9 A;  3L9K A;  3T4L A;  1W79 A;  1MWT A;  1S1Y A;  2L0W A;  4GCZ A;  2VK3 A;  4P6Z M;  2V0U A;  5HSQ A;  3WRZ A;  4IBX A;  3TSG A;  3B47 A;  1ES4 A;  2Y2G A;  2L4R A;  1PWC A;  1O07 A;  3VP3 A;  4PMA A;  2JBF A;  5HDS A;  5AVF A;  1YSP A;  4M4X A;  4E04 A;  1XJ2 A;  4Z9Q A;  1KE4 A;  3EEH A;  3A3J A;  1PWG A;  1N9N A;  5F5Y A;  2ZQD A;  5HAQ A;  3N4I A;  3CG5 A;  2Z2L B;  4BL3 A;  1ODV A;  1E4D A;  4WMC A;  2QJ7 A;  1FCN A;  4OON A;  5CED A;  3BW6 A;  4JXV A;  5L8M A;  4KZ6 A;  4P87 A;  3MQQ A;  2V8C A;  5HAI A;  5DFY A;  4NXB A;  3IBR A;  1LHY A;  1VQQ A;  2X71 A;  3IF5 A;  3G34 A;  1PYY A;  4DDS A;  3A0S A;  3ZNT A;  4GKU A;  3VFF A;  4KZ7 A;  5EFW A;  5M19 A;  1S6R A;  1WE4 A;  2DCF A;  5EVL A;  3N8R A;  4WZ5 C;  4S2K A;  3NDG A;  4ID4 A;  4DXB A;  2VV6 A;  1F9I A;  4JF4 A;  3F1O A;  4NG2 A;  3BM6 A;  2HJE A;  2ZMV A;  4B4X A;  2AVX A;  3U2A A;  2Y2J A;  4P0M A;  3S22 A;  1KGF A;  4R3J A;  5K5B A;  4IED A;  4OOY A;  3Q7V A;  1ZTU A;  1K4F A;  3HL9 A;  3KX0 X;  4X53 A;  2PBY A;  1FIL A;  3MZF A;  2MJ6 A;  5KZH A;  4GDB A;  4L0L A;  1QMF A;  1T1B A;  4H8R A;  3RXW A;  2R9X A;  3EEA A;  5HD5 A;  1DJC A;  3UB8 A;  1Q2Q A;  1FOF A;  3T1Q B;  2ZC5 B;  3D9Y A;  3MBZ A;  1K54 C;  4S2I A;  1BUL A;  4LCL A;  1BUE A;  2QHK A;  3PAE A;  4HIA A;  2FH5 A;  5CTN A;  3UE3 A;  4HBT A;  4LRY C;  1SDE A;  4HH2 A;  5GHZ A;  1C3B A;  3BEC A;  1V9Z A;  1GCE A;  4CQH A;  1DRM A;  3V67 A;  4KUK A;  4LEN A;  3HRE A;  4G3V A;  3DTE A;  4UHU A;  3F1P A;  3C7V A;  1PZP A;  2C6W B;  1ESU A;  1XFN A;  3C4P A;  4PKY A;  2M7U A;  1CEF A;  2EFU A;  1MWU A;  5DF9 A;  1H3Q A;  2J3W A;  3WS1 A;  5TBM A;  5JYP A;  2P7J A;  1GA9 A;  3UPO A;  1CI9 A;  5HL1 A;  2IWD A;  4R3A A;  1A0K A;  3BFF A;  3C2W A;  2VZW A;  3T4S A;  4ETZ A;  3E98 A;  1E3U D;  4O7D A;  3E2K A;  3BY9 A;  1LL8 A;  4XUX A;  1I2W A;  3OZH A;  5FQJ A;  4FH2 A;  1K56 A;  1HLU P;  4OLG A;  3TG9 A;  3IWQ A;  4HH3 A;  1LL9 A;  5A91 A;  2WGW B;  3IWI A;  4ZTK A;  4L9E A;  4OP8 A;  1NRJ A;  2D02 A;  3IH8 A;  4KZ3 A;  3PR6 A;  1XGJ A;  3VE3 A;  3MXQ A;  2I72 A;  3JYI A;  4DE2 A;  1H5X A;  3GRJ A;  2XGN A;  4GB7 A;  3LID A;  5EV0 A;  4C75 A;  2ZC6 B;  4BBV A;  1D06 A;  3ZG0 A;  4F3L A;  5J8X A;  5HDC A;  3EWK A;  4WUJ A;  4X69 A;  5CGS A;  5TR7 A;  2OWJ A;  3C8C A;  3CPT B;  1GSV A;  3AGE A;  3ZCZ A;  4AFI A;  3G6O A;  1MXO A;  1W8Q A;  2VGL S;  4Q0J A;  1PZO A;  2GZA A;  3GDI A;  4EQ1 A;  3DW0 A;  4NET A;  5EVI B;  1EWZ A;  4GS9 B;  5U47 A;  3M2K A;  5E2G A;  4HBU A;  2VA0 A;  4LCM A;  4EEP A;  3R7W A;  3CAX A;  4HES A;  2WZZ A;  4YFM A;  2XD5 A;  3IXD A;  4LV0 A;  5EOE A;  5HL6 A;  3LO7 A;  2PDR A;  3B42 A;  2W3D A;  4DKI A;  3M6H A;  3JPU A;  4KZ4 A;  5FAP A;  2XEP A;  3JVU A;  1YM1 A;  3CJM A;  1SZV A;  5EM0 A;  2VV7 A;  4NKP A;  3W2Z A;  2J8Y A;  2V1B A;  1ALQ A;  2Y2N A;  3IF6 A;  4D2O A;  1K55 A;  3H82 A;  4S2N C;  5EEC A;  2ACG A;  4ZDX A;  1DP8 A;  3VMA A;  3ZGA B;  2HGV A;  2B02 A;  5FDS A;  1TDL A;  1T1A A;  4I5S A;  2P08 A;  3LR4 A;  3UO9 A;  1ES2 A;  1MKI A;  1W63 Q;  3LYX A;  2J80 A;  1H0M A;  3H7W B;  4II7 A;  3D3O A;  2HJ9 C;  2P9V A;  3SH9 A;  2Z6D A;  2ZQ8 A;  3PYP A;  1AWI A;  4LFU A;  4CPK A;  1V9Y A;  4MNR A;  1MWS A;  2XD1 A;  1ERQ A;  4GOG A;  3LGO A;  1KDS A;  5EVE A;  4YNR A;  1K57 A;  3UB6 A;  1KDW A;  5GHY A;  3TOI A;  5HAP A;  3WS0 A;  3C7U A;  3CI6 A;  3WS4 A;  4KQO A;  1YLT A;  2W3G A;  4FCF A;  1W63 M;  1BLS A;  2JCH A;  5DF8 A;  5BOH A;  3HLG A;  4JF6 A;  1XJ6 A;  3M2J A;  2QZ6 A;  4QU3 A;  3VP2 A;  1IYO A;  3UE1 A;  1ERO A;  4A5R A;  3T12 B;  1T18 A;  3UN7 A;  3KSF A;  5KSH A;  5L2F A;  1PI5 A;  1IYS A;  4N9K A;  3PBQ A;  4KZ8 A;  2OLU A;  1Y4O A;  3GQZ A;  4ETX A;  4EWF A;  1LSX A;  3EGX C;  1G5U A;  4MN6 A;  4LV3 A;  4E3M A;  1G6A A;  2V2F F;  4B88 A;  1MC0 A;  2K31 A;  3KSH A;  5KIZ A;  4KZ9 A;  2KDK A;  5HPF A;  3V39 A;  3IX4 A;  4FTX A;  4S2L A;  4Y15 A;  5D3O A;  4NXE A;  5F69 A;  2JN7 A;  2A24 B;  4Q0H A;  1YLY A;  4X68 A;  2XQZ A;  1F5M A;  4KEN B;  4S2M A;  4NXF A;  3NHQ A;  3G2Z A;  4IVI A;  4PPR A;  4O8G A;  1JWZ A;  3PBT A;  2E8I A;  3ZFZ A;  3LCE A;  2EXA A;  3SH7 A;  3PAG A;  5G4Y A;  3CMZ A;  3WWX A;  2KLI A;  1F2K A;  4BMW A;  3HVF A;  4JKT A;  1DJB A;  2WGV A;  4LV2 A;  5AJG A;  2OLV A;  3MQ0 A;  4GHI B;  2QMI A;  2PD7 A;  2BTF P;  4E6X A;  4MMN A;  2O9C A;  2PAV P;  4EBL A;  4GN2 A;  3GSG A;  4WEK A;  3ICY A;  3A3F A;  2WKH A;  5KSC A;  4Z1W A;  1CEG A;  2ZC7 A;  5DKK A;  1D1J A;  2A2L A;  5C5K A;  1YPR A;  2Y2H A;  5HX9 A;  4MBH A;  2HDQ A;  2Y2K A;  2J9P A;  3JVV A;  2YKF A;  2WUQ A;  3FPW A;  4KZ5 A;  2P04 A;  2KOI A;  5IS1 A;  2ZQC A;  5A92 A;  3IHB A;  3U4L P;  5FQI A;  1VB6 A;  3IT9 A;  4E3L A;  2EX6 A;  4Y0T A;  2Y2O A;  3RH8 B;  1L3L A;  5CHJ A;  5A8B A;  4GNU A;  3D4F A;  4G3K A;  4BEN A;  2ZQ7 A;  4UA6 A;  3T1R A;  2ZOI A;  4P85 A;  4OQG A;  5F83 A;  2OSU A;  1OT9 A;  1S4S A;  4QHC A;  3BWL A;  4QB8 A;  2HDR A;  4JXS A;  1UGU A;  4OQ0 A;  5DFX A;  4N9L A;  2XFT A;  2Z2M B;  3P01 A;  1E3U A;  3KSI A;  1KGE A;  3A0V A;  3KYZ A;  3HJI A;  5FAQ A;  2GJ3 A;  2GNX A;  4XXR A;  3UB9 A;  4H6J B;  4EBN A;  4HJ6 A;  1I2S A;  1XP4 A;  2H28 A;  3O87 A;  3SH8 A;  1WA9 A;  2KX6 A;  3ITB A;  3VOL A;  4KUO A;  4ZBE A;  1F98 A;  4JGR A;  3GR2 A;  3LR5 A;  2Y8H A;  3IHA A;  3K2N A;  3E2L A;  2VGJ A;  4X55 A;  4EW7 A;  1YLZ A;  2Y55 A;  3B3X A;  4JPM A;  1OME A;  2ZM2 A;  4S2P A;  4ZJ1 A;  3Q7Z A;  1YKD A;  3KYE A;  1OTB A;  3UME A;  1LLB A;  3CZD A;  3ZYT A;  1MWR A;  1BTL A;  1M6K A;  2A49 A;  3BYD A;  1DP9 A;  1FCO A;  5GLC A;  4MBK A;  1Y28 A;  1IYQ A;  2W27 A;  2V1A A;  4LGW A;  1PNE A;  1N4O A;  4KG2 A;  1M40 A;  1P97 A;  3ZG8 B;  5CHU A;  3V50 A;  2ZJ9 A;  1KGG A;  4PKY G;  3IS2 B;  2FZ0 A;  1IEM A;  3P7N A;  4E3K A;  3EOI A;  2PU4 A;  2Q9M A;  1MY8 A;  3LUQ A;  1JWV A;  3O5Y A;  1YQS A;  1Q2P A;  3QNB A;  1GSW A;  3MJQ A;  3L7H A;  1ZG6 A;  4DN0 A;  1ZKJ A;  3IX8 A;  4PM5 A;  5G4Z A;  3S1Y A;  1CJF A;  3A3D A;  4R70 A;  2EFX A;  3E0Y A;  3MFX A;  2B18 A;  4Y0O A;  4DXC A;  3F1O B;  1L0E A;  4R4R A;  4WL9 A;  2JKF A;  2I9V A;  2E8J A;  2V0W A;  3V5M A;  2W1R A;  1BLP A;  1J9M A;  1PI4 A;  1W7F A;  4R4S A;  1DJA A;  4X1M A;  1K38 A;  4EV4 A;  3D72 A;  1RGY A;  1K4E A;  4FD8 A;  1FSY A;  2LB9 A;  5GHX A;  1PWD A;  2PU2 A;  4O0P A;  3VV4 A;  1BSG A;  1P9W A;  5F1F A;  2PR5 A;  2PYR A;  1N9B A;  4DJ3 A;  4F94 A;  1WYB A;  5I5L A;  3W8K A;  3QP1 A;  3PHY A;  2L1M A;  1TS7 A;  3A3I A;  3G30 A;  3CWF A;  2VKS A;  2H0Y A;  3FC7 A;  5GL9 A;  3P98 A;  3FPV A;  3VOY A;  2Q9N A;  4HY8 A;  3ZVW A;  2OV5 A;  3PTE A;  2ZQ9 A;  4CLC A;  3DTK A;  2O99 A;  5L09 A;  3T4Q A;  3DWZ A;  4EER A;  1VET B;  1DY6 A;  3BLS A;  2LB5 A;  5E43 A;  1CF0 A;  1FIK A;  4JXG A;  1GA0 A;  4QWO A;  5DTS A;  2EWW A;  2CMN A;  2XK1 A;  2R78 A;  3LFV A;  4UQI S;  2UV0 E;  3C30 A;  3QP4 A;  5HPI A;  1S0W A;  1BLH A;  1GHM A;  1PRQ A;  2Y2Q A;  1YMS A;  1AXB A;  4Y5F A;  3DAV A;  5TBM B;  4ZJ2 A;  2Y4A A;  4LRZ E;  4QY5 A;  1ESI A;  4WMC D;  3EQV A;  1KOU A;  2O9A A;  2W1T B;  4Q8I A;  3IXG A;  2WGI A;  4MN5 A;  4HP9 A;  1PW1 A;  3K3C A;  2B5R A;  1S4R A;  1SCW A;  2VGL M;  3CPT A;  3UDX A;  4ZAM A;  4ARZ B;  3VSL A;  5GLA A;  2ZD8 A;  4U0X A;  5EVI A;  4GS9 A;  4YIN A;  2WYX A;  2OAQ 1;  3IF6 C;  1K55 C;  2OWH A;  4EU0 A;  5HW3 A;  3AGF A;  3NOT C;  4U3T A;  4OLD A;  5F6A A;  5FAS A;  2H0T A;  3I7J A;  3MSH A;  4RA7 A;  1G6O A;  5CHM A;  4BJP A;  2XA7 S;  4Q0I A;  4JGO A;  3IWO A;  5HWV A;  4OKP A;  4U0T A;  1P0Z A;  3NJA A;  1TEM A;  4QD4 A;  3OBF A;  4P6B A;  4OH0 A;  1PIO A;  3DTI A;  2P74 A;  4BWI A;  1L0F A;  1TDG A;  1GSX A;  5L07 A;  1YLP A;  2J9O A;  2ZMA A;  2ZBB A;  2HDU A;  4HP4 A;  1K57 C;  1ERM A;  3FKV A;  3PBN A;  4E3N A;  4XT2 B;  4Y13 A;  4WZ4 A;  2W3E A;  4L9G A;  4E3I A;  5J4E A;  5A93 A;  2QPN A;  4EET B;  3MXS A;  3VSK A;  1GHI A;  1K6S A;  1O7E A;  2V9A A;  4WLA A;  5HWW A;  2PR6 A;  2Y91 A;  3Q1F A;  4N1H A;  3HLF A;  1ZC2 A;  2X02 A;  2XR0 A;  3R7W B;  4EUZ A;  2K2N A;  2OAP 1;  3N8L A;  2EX9 A;  3NIA A;  4IUK A;  4OPQ A;  3HLD A;  1IFQ A;  3SS3 A;  2IA2 A;  3W4Q A;  3VP4 A;  2JKG A;  2O0Y A;  3VP1 A;  1L2S A;  3O3V A;  4JXW A;  5DVA A;  1YLJ A;  4IJG A;  5AQ7 A;  4JGQ A;  2ZOH A;  2BLS A;  1S1Z A;  2Y2L A;  2HP9 A;  2Y59 A;  3GTC A;  3TW8 A;  4KG5 A;  4JLF A;  2R9W A;  5HWT A;  5HZH A;  3Q81 A;  2G2U A;  1SKF A;  3IQA A;  4PM7 A;  5FL3 A;  1YSQ A;  3W4P A;  3MR0 A;  2ZC3 B;  5AVE A;  5CGW A;  1XXM A;  1K25 A;  3LIA A;  2GDN A;  2W3F A; 
#chains in the Genus database with same CATH homology
 2ZQC A;  4X53 A;  5A92 A;  2PBY A;  3IHB A;  3FYZ A;  3MZF A;  4WEL A;  4IVK A;  5FQI A;  5GLB A;  3W4O A;  4GDB A;  4L0L A;  4BD1 A;  5KZH A;  4S2J A;  1QMF A;  3IT9 A;  4E3L A;  2EX6 A;  2ZQA A;  3OCN A;  4H8R A;  4RX2 A;  4BQM A;  4Y0T A;  2Y2O A;  3RXW A;  2R9X A;  3RJU A;  3VP0 A;  5CHJ A;  1DJC A;  5HFO A;  3FWL A;  4GNU A;  1Q2Q A;  4N1X A;  3D4F A;  1FOF A;  4BEN A;  2ZC5 B;  1Y54 A;  2XDM A;  4BL2 A;  4FSF A;  3MBZ A;  4KG6 A;  4UA7 A;  2ZQ7 A;  1K54 C;  4UA6 A;  2FFF B;  5E2E A;  3N8S A;  2XLN A;  4P85 A;  4GD6 A;  1YMX A;  3SOI A;  3UPN A;  2EX8 A;  4OQG A;  5F83 A;  1RP5 A;  2OSU A;  2A3U A;  4S2I A;  1BUL A;  1KVM A;  1NRF A;  3Q07 A;  4KZB A;  3QNC A;  4QHC A;  4PM8 A;  4QB8 A;  4OPY A;  4LCL A;  5FQM A;  2ZC4 B;  1BUE A;  2VGK A;  3ZG7 B;  2HDR A;  2JE5 A;  3PAE A;  4JXS A;  1L0G A;  3V3R A;  4OQ0 A;  2V1Z A;  2WZX A;  1NXY A;  4N9L A;  2XFT A;  2Z2M B;  2WKE A;  1E3U A;  1KVL A;  5CTN A;  1KGE A;  5TGF A;  3UPP A;  3DTM A;  3BFG A;  1K56 D;  3UE3 A;  5FI7 A;  5FAQ A;  4XXR A;  3ZG9 B;  5E2H A;  4HBT A;  5F1G A;  4EBN A;  1VM1 A;  1I2S A;  1SDE A;  1XP4 A;  5GHZ A;  1C3B A;  1CI8 A;  3BEC A;  3HLW A;  4WEJ A;  3GV9 A;  2RL3 A;  3O87 A;  4EQI A;  1GCE A;  3BFE A;  3SH8 A;  2HP5 A;  3AGD A;  5CEC A;  4OQI A;  1BLC A;  3ITB A;  1EI5 A;  3IXH A;  4RYE A;  5FAT A;  4K91 A;  4QJG A;  3G4P A;  4LEN A;  3HRE A;  4ZBE A;  3GR2 A;  3MZE A;  3UDF A;  1FQG A;  1SHV A;  1W5D A;  2IWC A;  3IHA A;  3N7W A;  3E2L A;  5GLD A;  1BT5 A;  4UHU A;  2EXB A;  3C7V A;  2WAF A;  1PZP A;  3C4O A;  2VGJ A;  3HLC A;  2DNS A;  2C6W B;  1ESU A;  3FKW A;  4X55 A;  4OOL A;  2IWB A;  3C4P A;  4CJN A;  1YLZ A;  2Y55 A;  1CEF A;  3B3X A;  3Q82 A;  2EFU A;  4JPM A;  1MWU A;  1OME A;  5DF9 A;  2ZM2 A;  4UAA A;  5FQQ A;  3WS1 A;  1L0D A;  2V20 A;  4S2P A;  5JYP A;  3ZNY A;  1MPL A;  3Q7Z A;  4ZJ1 A;  2H10 A;  1GA9 A;  1LLB A;  3CZD A;  3UPO A;  1CI9 A;  1MWR A;  5HL1 A;  2IWD A;  1BTL A;  1M6K A;  2A49 A;  1NZO A;  3BRM A;  3BYD A;  3P09 A;  1FCO A;  5GLC A;  4MBK A;  1IYQ A;  3C5A A;  5IHV A;  3VOZ A;  4PM6 A;  3OPL A;  1N4O A;  4KG2 A;  3BFF A;  4R0Q A;  3WRT A;  3HBR A;  1M40 A;  3ZG8 B;  1NYM A;  5CHU A;  4C6Y A;  5G18 A;  1E3U D;  3HUO A;  3V50 A;  4O7D A;  2G2W A;  3E2K A;  2WKI A;  2ZJ9 A;  1KGG A;  3G31 A;  1TVF A;  3LY4 A;  4XUX A;  1JWP A;  1I2W A;  3N6I A;  5EOO A;  3OZH A;  4FH4 A;  1IEM A;  4E3K A;  1RCJ A;  5FQJ A;  3EQU A;  4FH2 A;  1K56 A;  2PU4 A;  2Q9M A;  2XFS A;  4OLG A;  3IWQ A;  3TG9 A;  3UNW A;  3IF6 B;  5CTM A;  3ISG A;  1MY8 A;  4E6W A;  4RVA A;  1LL9 A;  5A91 A;  1JWV A;  1ONG A;  1YQS A;  1Q2P A;  1FSW A;  2WGW B;  1E25 A;  1K6R A;  2BG1 A;  3IWI A;  4ZTK A;  5FDH A;  4C3Q A;  3QNB A;  2EX2 A;  3FZC A;  4GD8 A;  1ZG6 A;  5CGX A;  1ZKJ A;  1QME A;  2ZM8 A;  3OCL A;  4PM5 A;  4OP8 A;  4MBF A;  2J7V A;  1JTD A;  3S1Y A;  5FI6 A;  2ZLY A;  4OPZ A;  3IH8 A;  4KZ3 A;  3A3D A;  3G32 A;  4R1G A;  2EFX A;  5M1A A;  1NY0 A;  4RX3 A;  1XX2 A;  4Y0O A;  4BLM A;  1XGJ A;  4DXC A;  1IKI A;  4OVD A;  1L0E A;  2P9V B;  4R4R A;  4IBR A;  2I72 A;  3S4X A;  3JYI A;  4JF5 A;  4S2O A;  4DE0 A;  3BEB A;  3BFD A;  3UDI A;  1I5Q A;  4DE2 A;  1H5X A;  3GRJ A;  2XGN A;  4GB7 A;  4OQH A;  3PBS A;  3MKE A;  2ZC6 B;  4C75 A;  3PBO A;  1NJ4 A;  3SS4 A;  3V5M A;  2CC1 A;  3ZG0 A;  1BLP A;  1FR6 A;  5J8X A;  1J9M A;  1PI4 A;  1W7F A;  4X69 A;  4R4S A;  4S2N A;  5CGS A;  5EE8 A;  3WS5 A;  1DJA A;  1HZO A;  5CER A;  1K38 A;  4N92 A;  5TR7 A;  1LI9 A;  3ZG5 A;  3UY6 A;  2Y2M A;  4EV4 A;  3G35 A;  1RGY A;  3A3E A;  3AGE A;  1IKG A;  4OOM A;  3ZCZ A;  1K4E A;  3IXB A;  4FD8 A;  1MXO A;  1FSY A;  3O86 A;  1W8Q A;  4WM9 A;  1PZO A;  5GHX A;  3DW0 A;  1XA1 A;  4NET A;  3MZD A;  1EWZ A;  5EVI B;  1IEL A;  1NYY A;  1PWD A;  2PU2 A;  5U47 A;  5FSR A;  1BSG A;  3HUN A;  3M2K A;  4Y0U A;  4HBU A;  4LCM A;  5E2G A;  5F1F A;  3O88 A;  1N9B A;  4HES A;  2WZZ A;  3LY3 A;  1GHP A;  4F94 A;  4YFM A;  5EPH A;  1WYB A;  3W8K A;  2XD5 A;  1H8Y A;  3IXD A;  4KZA A;  5F82 A;  3A3I A;  3UE0 A;  2ZM0 A;  4WYY A;  3NBL A;  3G30 A;  4LV0 A;  5EOE A;  2X01 A;  2RCX A;  2H0Y A;  3LO7 A;  4XUZ A;  1CK3 A;  3HLE A;  3MFD A;  5GL9 A;  1MBL A;  3P98 A;  3ZHH A;  3MKF A;  3V3S A;  3VOY A;  5KMW A;  2Q9N A;  3ZVW A;  2OV5 A;  2Y2P A;  1PW8 A;  4DKI A;  3M6H A;  3PTE A;  2XF3 A;  5I94 A;  5AQ9 A;  1NZU A;  4KZ4 A;  5FAP A;  4Y7P A;  2DRW A;  2XEP A;  2ZQ9 A;  3OC2 A;  1YM1 A;  3CJM A;  4R23 A;  5EVI D;  4EBP A;  3DWZ A;  4R3B A;  4QY6 A;  2J8Y A;  1SDN A;  4JBF A;  1DY6 A;  3BLS A;  1ALQ A;  5E43 A;  2Y2N A;  3IF6 A;  1Z6F A;  3HLB A;  4D2O A;  5M18 A;  4JXG A;  1K55 A;  2JC7 A;  4S2N C;  1ONH A;  1GA0 A;  1U60 A;  5EEC A;  3NCK A;  4ZDX A;  5DTS A;  3VMA A;  3NC8 A;  2HP6 A;  3ZGA B;  4WBG A;  5E2F A;  1XA7 A;  5FAO A;  4E3O A;  2XK1 A;  1JVJ A;  2HPB A;  3OPP A;  1LI0 A;  1TDL A;  5EUA A;  1ES5 A;  1XPB A;  3BLM A;  4MEZ A;  3UO9 A;  1ES2 A;  4BD0 A;  1MKI A;  4GZB A;  1HVB A;  1S0W A;  1BLH A;  1GHM A;  1XKZ A;  2Y2Q A;  1YMS A;  1AXB A;  3FV7 A;  4K0X A;  5AQB A;  4OP5 A;  5HAR A;  2P9V A;  3SH9 A;  4K0W A;  1ES3 A;  5FQ9 A;  2C5W B;  2ZQ8 A;  4ZJ2 A;  5DTK A;  3OPR A;  3PBR A;  1BZA A;  1XGI A;  1ZG4 A;  2WAE A;  2Y4A A;  4DE1 A;  4QY5 A;  1ESI A;  4WMC D;  1G68 A;  3EQV A;  4CPK A;  4X6T A;  5AQA A;  3NDE A;  4Q8I A;  4MNR A;  3IXG A;  1MWS A;  2XH9 A;  3RXX A;  4LV1 A;  2XD1 A;  3HUM A;  1ERQ A;  2WGI A;  5CRF A;  3SS5 A;  4GOG A;  1YLW A;  4DE3 A;  5JYO A;  1PW1 A;  2B5R A;  1KDS A;  4OPR A;  4ZJ3 A;  1SCW A;  1K57 A;  1KDW A;  1H8Z A;  5GHY A;  3TOI A;  5HAP A;  1KE3 A;  3UDX A;  3IH9 A;  4ZAM A;  3WS0 A;  1W79 A;  4X56 A;  1MWT A;  3VSL A;  3C7U A;  3ZDJ A;  5GLA A;  2ZD8 A;  3WS4 A;  4U0X A;  5EVI A;  4YIN A;  2WYX A;  4KQO A;  1YLT A;  3IF6 C;  4FCF A;  1BLS A;  2JCH A;  1LL5 A;  2WK0 A;  1K55 C;  5DF8 A;  5BOH A;  5FA7 A;  4DRT A;  3HLG A;  5HW3 A;  4JF6 A;  3WRZ A;  3AGF A;  3M2J A;  3NI9 A;  2QZ6 A;  4IBX A;  3Q7V B;  3TSG A;  4QU3 A;  3VP2 A;  1ES4 A;  1IYO A;  1HD8 A;  4E3J A;  1FR1 A;  2Y2G A;  4OLD A;  4U3T A;  1PWC A;  3UE1 A;  5FAS A;  1ERO A;  2H0T A;  3I7J A;  3OPH A;  4A5R A;  4M3K A;  4RA7 A;  5CHM A;  4BJP A;  1O07 A;  3VP3 A;  4PMA A;  3IWO A;  2JBF A;  3UN7 A;  4OKP A;  5KSH A;  4U0T A;  5L2F A;  1PI5 A;  5A90 A;  4WZ5 A;  4Z9Q A;  1IYS A;  1TEM A;  4N9K A;  1KE4 A;  3PBQ A;  4QD4 A;  3DWK A;  4KZ8 A;  3A3J A;  2OLU A;  3GQZ A;  4P6B A;  1PWG A;  4EWF A;  4OH0 A;  1PIO A;  5FQK A;  2ZQD A;  4MLL A;  5HAQ A;  3N4I A;  2P74 A;  3GVB A;  1L0F A;  3CG5 A;  1TDG A;  3QHY A;  4LV3 A;  4E3M A;  1G6A A;  1WYC A;  2V2F F;  2Z2L B;  2HDS A;  4B88 A;  1YLP A;  4BL3 A;  2J9O A;  4KZ9 A;  2ZMA A;  1E4D A;  4NK3 A;  4WMC A;  2HDU A;  3V39 A;  1YT4 A;  1K57 C;  1ERM A;  3FKV A;  1FCN A;  3PBN A;  4S2L A;  4OON A;  4E3N A;  5D3O A;  5CED A;  3G2Y A;  4PM9 A;  4KQQ A;  4WZ4 A;  1W8Y A;  4E3I A;  4JXV A;  1YLY A;  4KZ6 A;  4P87 A;  4X68 A;  5DF7 A;  5FI2 A;  5A93 A;  3MXR A;  2XQZ A;  2QPN A;  4KEN B;  4S2M A;  5DTT A;  5EVI C;  3NY4 A;  3ITA A;  3MXS A;  3VSK A;  1GHI A;  1K6S A;  5HAI A;  3G2Z A;  1O7E A;  1LHY A;  4IVI A;  4PPR A;  5CXW A;  2Y91 A;  3Q1F A;  4N1H A;  5TFQ A;  1VQQ A;  2X71 A;  1FCM A;  1JWZ A;  2UWX A;  3HLF A;  1ZC2 A;  3IF5 A;  3PBT A;  3G34 A;  2X02 A;  2E8I A;  2XR0 A;  4GDN A;  3ZFZ A;  1PYY A;  2WGW A;  4EUZ A;  3LCE A;  2EXA A;  3N8L A;  3SH7 A;  4DDS A;  4DDY A;  2EX9 A;  3ZNT A;  3NIA A;  3PAG A;  4GKU A;  3VFF A;  3CMZ A;  4KZ7 A;  4KQR A;  5M19 A;  4OPQ A;  3WWX A;  3HLD A;  4HEF A;  1S6R A;  3SS3 A;  1WE4 A;  3LEZ A;  3W4Q A;  2DCF A;  3VP4 A;  1K54 A;  3M6B A;  3HVF A;  3VP1 A;  5EVL A;  3ZVT A;  1L2S A;  3GMW A;  3N8R A;  3O3V A;  4JXW A;  4JKT A;  4S2K A;  4WZ5 C;  3NDG A;  4ID4 A;  1DJB A;  5CEB A;  2WGV A;  4LV2 A;  5DVA A;  4DXB A;  2OLV A;  1YLJ A;  5AQ7 A;  4JF4 A;  2QMI A;  4E6X A;  4DF6 A;  2BLS A;  1HTZ A;  2Y2L A;  2HP9 A;  2Y59 A;  3GTC A;  4KG5 A;  3BM6 A;  4EBL A;  4GN2 A;  2R9W A;  3GSG A;  4JLF A;  4B4X A;  4WEK A;  3Q81 A;  4B4Z A;  1RGZ A;  2Y2J A;  4UA9 A;  3A3F A;  2G2U A;  1SKF A;  2WKH A;  3BFC A;  4P0M A;  5KSC A;  3IQA A;  4PM7 A;  3S22 A;  1CEG A;  3W4P A;  1KGF A;  4R3J A;  1KE0 A;  2Y2I A;  2WAD A;  2ZC7 A;  2ZC3 B;  4IED A;  4OOY A;  2H5S A;  3Q7V A;  5CGW A;  3VFH A;  2FFY A;  1IYP A;  1XXM A;  1JTG A;  1K25 A;  2Y2H A;  1K4F A;  4MBH A;  5HX9 A;  2HDQ A;  2Y2K A;  3WS2 A;  2J9P A;  2GDN A;  2WUQ A;  3HL9 A;  4KZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...