1JNUA

Photoexcited structure of the plant photoreceptor domain, phy3 lov2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
104
structure length
104
Chain Sequence
KSFVITDPRLPDNPIIFASDRFLELTEYTREEVLGNNCRFLQGRGTDRKAVQLIRDAVKEQRDVTVQVLNYTKGGRAFWNLFHLQVMRDENGDVQYFIGVQQEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein, electron transport
molecule keywords PHY3 PROTEIN
publication title Photoexcited structure of a plant photoreceptor domain reveals a light-driven molecular switch.
pubmed doi rcsb
source organism Adiantum capillus-veneris
total genus 28
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1jnuA00
3NOUC 1OT9A 5AVFA 1OTDA 2BASA 3UB9A 2QKPA 3GECA 4RQ9A 2H28A 1D06A 2JHEA 3CWFA 3VOLA 1XJ2A 3LUQA 1EW0A 2PDRA 1GSXA 1LSXA 2Z6CA 5HWTA 5J3WA 2ZBBA 4R6LA 5EFWA 3H7WB 5KIZA 4YWZA 3VE3A 3GDIA 2R78A 4EXOA 3H82A 3UB6A 2V1AA 4R38A 5IU1A 4BBUA 3NOTC 1VB6A 2OOLA 5HZHA 2V9AA 3E4OA 4EESA 2WKQA 4F3LB 1N9LA 4I5SA 5HDDA 2WKPA 3F1OA 4GHIA 4HP9A 5TBMB 1XJ3A 2QWSA 3EEHA 5HWWA 3UB8A 4NXFA 1S4RA 2VV7A 1T1BA 1WA9A 5HWVA 1UGUA 2YKFA 3F1NB 4I3IA 1T19A 1LT0A 1JNUA 1XJ4A 3HJKA 5F69A 4JGPA 1V9ZA 1DRMA 3UB7A 4EQ1A 1XFQA 2PR6A 1N9OA 3C2WA 5F68A 3IS2A 4EERA 3MQOA 5J4EA 2GJ3A 3FG8A 1GSWA 5F5YA 4NXEA 3MR0A 4GS9B 3RTYA 3H7WA 4NXBA 2A24B 2ZOIA 4HHDA 1OTBA 3HJIA 1OJ5A 4DJ2A 4EETB 1DP8A 5AVEA 4XT2B 2VV8A 4LRXC 2KX6A 5DKLA 1DP6A 3MFXA 3A0RA 1LSVA 4EW7A 3PHYA 5HD3A 1MZUA 1S1ZA 4MN6A 4KUKA 4F3LA 5IS1A 2ZOHA 5J7EA 2YKHA 1OT6A 3VE4A 1V9YA 2QHKA 2PYPA 4HNBA 2B02A 2EA9A 5DJTA 4WN5A 5I5LA 1S1YA 4JGRA 2V1BA 5TBMA 1T18A 4E04A 3KX0X 2L0WA 5HDCA 4GW9A 3NOPC 2I9VA 1X0OA 4R70A 3F1NA 4B9OA 3H9WA 2HV1A 3LIAA 3LI9A 4HQAA 5HSQA 4EEPA 2L4RA 1GSVA 3UE6A 4I38A 1ODVA 2PHYA 1S66L 3RH8B 1P97A 4HJ3A 4HH3A 1OJGA 4KUOA 4EEUA 3F1PB 4LLOB 4K08A 4HP4A 1KOUA 4I39A 1G28A 1UWPX 3K3DA 1TS7A 4HJ6A 4GS9A 4GCZA 3CLOA 2A24A 1TS8A 4HI4A 2D01A 4HIAA 4PKYG 3P7NA 4WLAA 4KQDA 3D72A 4XT2A 4NXGA 1OTEA 3FC7A 2WKRA 3OLOA 1DP9A 1F9IA 1P0ZA 3LYXA 1TS0A 4MN5A 2VEAA 2QJ7A 3LICA 2Z6DA 4JGOA 2PYRA 1T1AA 1Y28A 5G4YA 4L9GA 3UMEA 2D02A 2W27A 4I3AA 3MJQA 5HDSA 5F6AA 3ICYA 3UMDA 3IBRA 3LIBA 2KDKA 2CMNA 4WUJA 4HJ4A 2W0NA 2PD8A 4L9EA 3IS2B 2J80A 2V0UA 5DJUA 4LRYC 4H6JB 5DKKA 3BWLA 4HH2A 3ULFA 3B33A 2JN7A 3ZQ5A 3NHQA 1XJ6A 1OTIA 3LIDA 3E4QA 5HD5A 1TS6A 1LL8A 3F1PA 4HOIA 4PKYA 3MXQA 4M4XA 2PR5A 4LRZE 4WL9A 2M1CA 5A8BA 1LSWA 2L1MA 5G4ZA 3NJAA 4LPZA 1D7EA 1OTAA 3LIFA 3H82B 3A0VA 3C8CA 4WF0A 4BBTA 1XFNA 4JGQA 3LI8A 4DJ3A 4I3JA 2VV6A 3G6OA 2PD7A 3SW1A 1S67L 4HY8A 2K7SA 1F98A 2P7JA 1UWNX 2V0WA 2QJ5A 3PYPA 3F1OB 3K3CA 4GHIB 1S4SA 1NWZA 3EWKA 4R3AA 2OWHA 4L9FA 3MQQA 3E4PA 2OWJA 3LIEA 3CAXA 3T50A 2VLGA 3BY9A 3A0SA 4H6JA 1N9NA 4BBVA 2INWA 1BYWA 1T1CA 3BY8A
chains in the Genus database with same CATH superfamily
4Y0UA 3HLEA 1MWRA 3DW0A 1HLUP 4GB7A 4S2NA 4WBGA 4OOLA 2VZWA 2ZL1B 5HX9A 2ZD8A 5EE8A 2WYXA 5CHUA 1QMEA 4FH4A 3QP4A 1QMFA 4IBRA 3WS2A 4JKTA 3VOLA 3RJUA 4CLCE 3KSFA 1XJ2A 1EW0A 2PDRA 1GSXA 4YOFA 3P01A 4OONA 4R6LA 5FDHA 4N9LA 4S2JA 3W4QA 5FDSA 3GDIA 2XSSA 2ZJ9A 3LR0A 4Y7PA 2Q0OA 1K25A 1IKGA 1FIKA 3B42A 3MZEA 2WK0A 5CEBA 4LV0A 2WKEA 4PM5A 1PW8A 2EXAA 4NG2A 1TD5A 5DFYA 4DMZA 2Q9NA 2Y2PA 2K2NA 3IHBA 3IH9A 1VETB 3IX8A 3E2KA 2WGVA 3MFDA 1GHMA 4Y13A 4HP9A 5BOHA 4X1MA 1XJ3A 2QWSA 2Y2MA 3SZTA 3O88A 4JLFA 3PAEA 5HWWA 3T1SA 3CMZA 4WMCA 1ES3A 1WA9A 1XGIA 3G35A 3R7WB 3F1NB 4ME4A 1L0DA 4OQ0A 5F69A 1YMXA 2O0YA 1EWZA 3OOVA 4G3VA 1H8YA 3UB7A 1IOUA 3OCNA 1E4DA 2Y55A 2PR6A 2HDRA 4WMCD 2WKHA 2WGIA 4PM7A 3GSGA 3C2WA 5F68A 5FEGA 2WKIA 4OQIA 2GJ3A 3FG8A 1GSWA 5F5YA 4NXEA 3PBNA 4GS9B 3RTYA 3JVVA 4QY5A 4Y5FA 4O01A 1FCNA 2WGWA 3Q7VA 1PNEA 1P9RA 5FEFA 5GLAA 4OPRA 4BD1A 2JKTM 1JVJA 5DKLA 2P9VA 3WS5A 2KLIA 1YLPA 1LSVA 1PRQA 4E3KA 5HD3A 1S1ZA 4MN6A 1Y4OA 2JKRM 4KUKA 5KSHA 4F3LA 1JTGA 5IS1A 5FQ9A 2ZOHA 3IF6B 1OPXA 2YKHA 5A92A 5CEDA 3FPWA 3JVUA 4MN7A 4BL3A 2PYPA 2B02A 2EA9A 3EEAA 1YSQA 1K55C 2XRNA 5EM0A 4E04A 4KZ6A 1BLSA 5EECA 4JXSA 5M18A 1X0OA 4WEJA 3LI9A 3LIAA 4I38A 5I94A 2BTFP 1ODVA 2VA0A 4X55A 4X6TA 2J3WA 1NRFA 1G6AA 5A91A 3T1QB 2NUTC 4R23A 3DTEA 4FH2A 2ZC7A 4HJ3A 4DXBA 3C30A 3MXRA 3IXGA 2XA7M 4HBTA 4BQMA 3VSLA 5A90A 4ZTKA 5HAPA 3A3EA 5U47A 4UQIS 2C6WB 3PBOA 1XXMA 3ZG7B 4EUVA 4LLOB 3BFFA 3DTKA 2XQZA 3LR3A 1TS7A 2A24A 3MXSA 3PXPA 4HI4A 2Y8HA 3S22A 1YLZA 3S1YA 3P7NA 5KZHA 2JKTI 1PWGA 4XT2A 1MKMA 4S2KA 1XX2A 4MNRA 4HESA 4Z1WA 2GZAA 3OLOA 1P0ZA 2JKRI 5G18A 1SHVA 3SH8A 2VEAA 4LENA 3ZCZA 3QNBA 2J3TC 2Z6DA 1T1AA 1WYBA 3UDIA 3Q1FA 3P09A 5G4YA 1RCJA 4KZBA 1VEUA 1ES5A 4OKPA 5HDSA 3T4SA 5FI6A 5L09A 2OAQ1 1PI4A 3K2NA 3G32A 1MY8A 2XK1A 2EWVA 2V0UA 3KYZA 1STZA 1G68A 2HP6A 3IHAA 4S2NC 5CGSA 3V3RA 1TEMA 3F1PA 4HOIA 4DE0A 3MXQA 3GRJA 4RYEA 2M1CA 2P9VB 3MZFA 1J3WA 3WRTA 5HPIA 4MLLA 2ZC6B 4FD8A 1OTAA 4ARZA 3NY4A 1JWPA 1GHPA 3LIFA 4IHQA 3HLFA 1IYSA 2R9WA 3EQUA 5GHXA 3UPOA 4ETZA 4N92A 2DNSA 1I2WA 3IX4A 1W63M 1PFLA 4OPYA 3LI8A 1YLYA 2VKSA 2IWDA 4KG6A 3W8KA 3W4PA 5HL6A 3ZHHA 3QP8A 1EROA 4I3JA 4KZ8A 5FI2A 2E8IA 2H0TA 2VGLS 3A3JA 2PD7A 4GKUA 1W8QA 3NI9A 3LR4A 2K7SA 4PMAA 2QYBA 4IUKA 1ALQA 2PBDP 4EV4A 4P6ZS 1YMSA 4GHIB 1E3UA 4MDZA 4WZ5C 1NWZA 2ZQAA 4CPKA 3BJNA 1PWDA 3EGDC 3CAXA 3T50A 2J9OA 1NYYA 3TSGA 3BY9A 3UPPA 1IKIA 1E3UD 1O07A 1BYWA 5FQMA 1K55A 1HVBA 5D3OA 5TR7A 2H5SA 4X53A 4EBNA 1YKDA 2ZMAA 2Y59A 2GX5A 3W2ZA 2QKPA 2H28A 2JHEA 2Y2HA 1IFQA 3CWFA 5CGXA 1KVMA 3V67A 3LEQA 1XP4A 3G30A 2XFTA 2EX2A 1NLYA 2ZBBA 1FQGA 1CK3A 3PBRA 2H0YA 3IXDA 1ZHHB 5KIZA 4YWZA 1MWTA 1SKOB 5FASA 4X56A 1BT5A 3T1RA 2IA2A 3UB6A 4WYYA 5EOOA 4CLCA 4S2LA 4R38A 3DBAA 4BBUA 2J9PA 5FA7A 1VB6A 5FAQA 3NCKA 5FAPA 4EESA 2WKQA 1KGEA 4P0MA 5E2HA 2X01A 4BMWA 4CLCD 1N9LA 4MCWA 4I5SA 5HDDA 2Y91A 2R9XA 4Y0TA 2VGJA 4MEZA 1K6SA 2WADA 3UE1A 5EV0A 3N8SA 1TDLA 1NXYA 2XD5A 4IEDA 3HCYA 1OMEA 3UB8A 4IVKA 3VOZA 4LV3A 1DJAA 1YLWA 1SKFA 2W1TB 1ERQA 3HJKA 1LT0A 3WWXA 4IVIA 2PT7A 4UAAA 3KYQA 4Q0IA 1XPBA 4DRTA 3KSHA 1ONGA 5CGWA 3S7PA 1N9OA 2LB9A 3IS2A 4FUWA 4DXCA 1K56A 2XROA 2Q9MA 3HREA 1RGYA 2OV5A 3N7WA 5CECA 3NBLA 3H7WA 3LY4A 4XXRA 5TGFA 4HHDA 1NZUA 3T4KA 3UDXA 1OJ5A 4EETB 5HARA 3UO9A 1LI0A 2VV8A 1KDWA 1DP6A 3DTMA 4R0QA 4ZJ3A 1DJCA 1FSYA 4O7DA 1MPLA 3B47A 5EVLA 1PZOA 3PHYA 4N1HA 2PU2A 3EOIA 2EX9A 3BRMA 2G2WA 1IELA 3IXBA 4DF6A 2VJWA 4GZBA 1HD8A 4CJNA 2EFUA 4HNBA 5GHYA 4WN5A 1PW1A 1MXOA 4OVDA 3CJMA 5TBMA 2W3DA 4LV1A 3HLBA 2O9CA 5IHVA 4D2OA 1L0EA 3BQAA 2L0WA 2J7VA 2ACGA 3OBFA 2I9VA 3TRCA 4HQAA 5HSQA 3HUNA 3VSKA 4WZ5A 5M19A 3SS3A 1XA1A 3RH8B 3M6BA 5F1FA 1P97A 3QP2A 2RCXA 3BQ8A 1KDSA 2ZLYA 1PZPA 5L10A 1OJGA 3T12B 4KUOA 4EEUA 4EU0A 2Y79A 3SH7A 3BFEA 3MF0A 5AQAA 5EM1A 3VP2A 1O7EA 3BFCA 4WELA 1KOUA 4I39A 1G28A 3ZG9B 3DWKA 3K3DA 3CLOA 3BEBA 1W63Q 2PU4A 3VP0A 1AWIA 3VOYA 2XDMA 4Y15A 5F1GA 4HIAA 3C38A 3MQ0A 5AQ9A 4WLAA 1K6RA 1GCEA 2Y4AA 3Q81A 4II7A 4UQIM 1VM1A 3GR2A 2WUQA 2W1RA 2HZ5A 4X68A 1F5MA 5M1AA 2ZM0A 3FC7A 1F9IA 3PAGA 2J8YA 4OOMA 2UV0E 1TS0A 2PAVP 4MN5A 3SOIA 1KVLA 3G2ZA 2Z2LB 2ZC3B 2G7UA 3CZDA 1KGGA 3MS6A 4L9GA 3HLCA 4I3AA 3NC8A 3M2KA 5F83A 4C3QA 2ZQ9A 3UMDA 3ZYTA 5E2EA 3O5YA 1FILA 4Q0JA 1MKIA 4HJ4A 1MWUA 2PD8A 3IS2B 4UA9A 2RL3A 5DJUA 1H3QA 4F94A 2E8JA 2JBFA 4HH2A 5HAIA 3ULFA 2JC7A 2H10A 2QZ6A 3HVFA 3NHQA 3E4QA 5HD5A 1TS6A 5FSRA 1LL8A 1BSGA 1W8YA 4BWIA 3LY3A 2XFSA 4X69A 4M4XA 4WL9A 1ESUA 5DTKA 1Z6FA 5DF9A 5A8BA 5GLDA 4ZDXA 4BL2A 2MJ6A 4KENB 4Z9QA 4QY6A 4FCFA 3N8RA 3ITBA 3BM6A 4S2MA 4X1LA 4NK3A 3A0VA 2W3GA 4ZJ2A 3LO7A 2BG1A 4CLCC 3CG5A 3ZDJA 4EUZA 2HP9A 1C3BA 2XLNA 2A2LA 3G6OA 2KOIA 3SW1A 2P7JA 4OPZA 3DWZA 2DMWA 1CEGA 4U0XA 3FV7A 3KYEA 4U0TA 3TJZC 2QJ5A 3TW8A 3I7JA 2Y2KA 1L2SA 1N9BA 4N1XA 2B18A 5L2FA 4M3KA 3N6IA 5CHMA 3CUEA 2VGLM 3TG9A 3D3OA 3A0SA 4KZ4A 4JBFA 4H6JA 5CRFA 1NLZA 4K0XA 3BY8A 4PM9A 4P6ZM 3FZCA 1DJBA 1VHMA 3NOUC 4ZBEA 5AVFA 3LR5A 3WS1A 3MMHA 2ZQDA 1OTDA 3MKFA 2BASA 3UE0A 3IT9A 2HP5A 1CI9A 1D06A 4R1GA 3EGXC 4B4XA 3TE8A 2M7UA 3LUQA 5HWTA 2Z6CA 3MBZA 1W5DA 5CERA 1PI5A 4RVAA 1SCWA 4PHTA 2ZC5B 2WGWB 3Q7VB 3BFDA 3VE3A 4LFUA 4UA6A 1SDEA 2ZQCA 2R78A 3H82A 2JE5A 2V1AA 3ZVWA 2ZQ7A 2IWBA 3A3FA 2OLVA 2WZXA 4R3BA 3M2JA 2FFFB 3NOTC 4MMNA 5EVIA 5FL3A 1XGJA 2Y2IA 4LCMA 1W79A 3M6HA 3E4OA 1Q2QA 1XKZA 3IF5A 4F3LB 5EOEA 1CI8A 2Y2JA 2A49A 3NDGA 3D4FA 1L0FA 2WKPA 3F1OA 5EVID 3T4TA 3O86A 4XUZA 4C75A 3VP1A 3KO6A 2X71A 5JYOA 5FQKA 1S4RA 4G3WA 5HWVA 1UGUA 2BLSA 4I3IA 1T19A 4JGPA 1JNUA 3VMAA 2LB5A 4ETXA 5JYPA 1JWVA 1DRMA 2P04A 2ZL1A 3QP1A 3WS0A 4U3TA 1XFQA 4O0PA 5EUAA 1BLCA 4LGWA 3MSHA 4UEYA 3MQOA 4QU3A 3V50A 1S6RA 4Y3IA 3MR0A 1K54A 4OLDA 1YPRA 2A24B 3SS5A 3IXHA 2XD1A 4HBUA 4RA7A 2ZOIA 2PRFA 1IYPA 3HJIA 2QPNA 3UN7A 1PIOA 4DJ2A 4FTXA 2VK3A 1LHYA 4X25A 4XT2B 4LRXC 2KX6A 4E6XA 1S0WA 4QPRA 1BLHA 4DN0A 4S2IA 2ZC4B 3A0RA 4PM8A 4DDSA 3ZGAB 4IJGA 2V1ZA 3BW6A 4EW7A 3NIAA 1DY6A 1MZUA 4OLGA 4S2OA 3E0YA 4MBHA 3DAVA 4E3LA 5FQJA 5J7EA 2V2FF 2EWWA 3G4PA 1VEUB 5DJTA 2GDNA 2X02A 4O8GA 1IYOA 3V39A 1S1YA 2HGVA 2V1BA 4JGRA 1BTLA 3IWOA 4N9KA 1T18A 4EWFA 3L7HA 3C7UA 5HDCA 4GW9A 1W7FA 5AJGA 2B95A 2EX6A 1IEMA 5HFOA 3R7WA 4R70A 3F1NA 3H9WA 3QNCA 4EEPA 2L4RA 3P98A 4BJPA 2EXBA 4KZ7A 1BUEA 5E43A 4K91A 5GHZA 4BD0A 1J9MA 3FYZA 3HLDA 3C4OA 5GL9A 4HH3A 5FAOA 3L9KA 4LCLA 3VFFA 3R4KA 5MC7A 3F1PB 3MKEA 4HP4A 4PPRA 5GLCA 3FKWA 4LV2A 4KZ5A 3AGFA 4GS9A 4AFIA 1TS8A 5LBRA 2I72A 4QJGA 4PKYG 5CX7A 3HL9A 4ARZB 3OPRA 1FR1A 3DTIA 1HTZA 2NUPC 1L0GA 2HDSA 1AXBA 1TVFA 4A5RA 3LYXA 4EBLA 1K0KA 1CEFA 1YQSA 3IF6A 4DE1A 4XUXA 4KQQA 1K56D 2W3EA 2PYRA 1Y28A 3C4PA 2EFXA 4R4RA 1H5XA 3UMEA 2W27A 3MJQA 5DFXA 3T4OA 4E3MA 4E6WA 3ICYA 3Q82A 3IBRA 4R3JA 2KDKA 4KQOA 5FI7A 3ZG5A 1I2SA 4WUJA 2W0NA 3QHYA 5AQ7A 4L9EA 3N4IA 1MWSA 4UA7A 1YT4A 1XA7A 3GQZA 4H8RA 3CUEC 2O99A 4LRYC 2XF3A 3ZNYA 5DKKA 3OPPA 1LL9A 5DVAA 4Y0OA 4UHUA 3B33A 2JN7A 1KE3A 1OTIA 3VP3A 1IYQA 5A93A 3NDEA 3PR6A 1G5UA 3JYIA 3G31A 3UY6A 2Y2OA 3IBJA 3T4JA 3S7NA 5HAQA 3S7QA 3D9YA 1LSWA 4WEKA 2L1MA 4LPZA 1D7EA 4KZ9A 3HUOA 4GJ4A 2O9AA 5DTSA 3GMWA 3TOIA 3AGDA 2V8CA 2ZM2A 1K38A 4YNRA 3ZFZA 3SS4A 4CLCB 4BBTA 4JPMA 1HZOA 4JGQA 1LL5A 5HW3A 5FQQA 3PBTA 3CPTA 4DJ3A 3E98A 2VV6A 5EVIC 1GA9A 4OP8A 3RFBA 3OCLA 1FSWA 1H8MA 1F98A 3IX3A 3LEZA 1UWNX 3PYPA 3K3CA 3EWKA 4R3AA 1ZC2A 4NKPA 2OWHA 4OQHA 1ACFA 3MQQA 2WZZA 1BZAA 2Y2LA 2VX8A 3OC2A 2C5WB 3KSIA 2IWCA 1MBLA 3ZNTA 1N9NA 1T1CA 4BLMA 1K57A 3HLWA 4OH0A 2JKGA 3W4OA 3ZVTA 1OT9A 3UDFA 4DE2A 3WS4A 2P74A 4KG2A 3UB9A 2DCFA 2K31A 3QP6A 3LGOA 4C6YA 3GECA 4RQ9A 2XR0A 2Y2GA 3BYDA 1CQAA 1LSXA 5J3WA 1WE4A 5E2GA 4E3JA 5EFWA 3H7WB 1TF1A 3GV9A 1BLPA 1K54C 1N4OA 5KSCA 3C7VA 2JCHA 5L8MA 4EXOA 1M40A 4BENA 1LI9A 3FKVA 5IU1A 1I5QA 4PM6A 4DKIA 3BLMA 3UB5P 4JF6A 2OOLA 5HZHA 2V9AA 5AQBA 1ES4A 4JF5A 5DF7A 3O3VA 4B93A 5CTNA 4K0WA 4EQIA 4DDYA 1F2KA 2P08A 3NECA 3PBSA 4GHIA 1JTDA 5HL1A 1VQQA 4S2PA 5FATA 2A3UA 5TBMB 4GDBA 3EEHA 3CITA 4CQHA 1CF0A 4NXFA 3FWLA 2VV7A 5EVEA 1T1BA 2HPBA 1YLTA 3SH9A 2YKFA 1ES2A 2FZ0A 1XJ4A 3BFGA 4Y2FA 1CJFA 4WM9A 1FCOA 1V9ZA 3OZHA 4NETA 1SDNA 1NZOA 4EQ1A 2XGNA 4KG5A 3HUMA 2OAP1 2M7VA 4EERA 1YAXA 4E3IA 1FCMA 1YLJA 1Z09A 4RX2A 1NY0A 5J4EA 4G3KA 1K4EA 3A3DA 1Q2PA 3O87A 4OQGA 3IH8A 2B5RA 3OPLA 5HPFA 4HEFA 5TJJA 4ZAMA 4RX3A 4NXBA 3CPTB 1P9WA 1SKOA 1H0MA 1OTBA 1ZKJA 3LCEA 1DP8A 5AVEA 3S7OA 5CHJA 1LLBA 2OSUA 3Q07A 1D1JA 2GNXA 3G34A 3GVBA 4P85A 4WZ4A 3KSGA 3MFXA 5E2FA 1NRJA 5C5KA 2Y2QA 4KQRA 1ONHA 3BECA 4GLQA 1ERMA 3V5MA 3VE4A 1OT6A 3BLSA 2XH9A 3ZG0A 1NJ4A 1V9YA 2QHKA 3IF6C 3IQAA 4L0LA 4KZAA 2G2UA 3U2AA 4JF4A 5I5LA 2XA7S 2HJ9C 1WYCA 3KX0X 2AVXA 5KMWA 3NOPC 2O9BA 3VFHA 1ZG4A 3UE3A 1L3LA 2W1TA 4EBPA 4B9OA 2HV1A 1PWCA 1GSVA 3UE6A 3B3XA 4GOGA 4NEED 2PHYA 1FOFA 2Y2NA 1S66L 1Y54A 3UPNA 5TFQA 1KE4A 3UNWA 5EPHA 1H8ZA 2HJEA 3GTCA 2CC1A 3ISGA 5CTMA 2ZMVA 3LFVA 1EI5A 2JKFA 4K08A 1UWPX 4Y17A 3S4XA 3PBQA 4HJ6A 4GCZA 2D01A 3QP5A 1ZTUA 2XEPA 4DE3A 5FQIA 4KQDA 3D72A 2V20A 2FH5A 4NXGA 4OOYA 2VGKA 3C5AA 4B88A 3ITAA 4QWOA 1OTEA 4YINA 2WKRA 4E3OA 1DP9A 1YSPA 3G2YA 3T1XA 3PTEA 4ID4A 2QJ7A 5F82A 3LICA 1KGFA 4GDNA 4PAUA 3IWQA 3CI6A 4JGOA 4FOFA 3E2LA 2D02A 5CXWA 1U60A 3HLGA 4JXVA 4Q0HA 5F6AA 1M6KA 2HDQA 4R4SA 3LIBA 4JXGA 4IBXA 1SZVA 1MC0A 2CMNA 1ESIA 4GD6A 3HBRA 1VETA 5DTTA 4OP5A 4GNUA 2J80A 1NYMA 4E3NA 1PYYA 4H6JB 5DF8A 3BWLA 3VP4A 4QB8A 3IWIA 2FFYA 4QD4A 3EQVA 1K57C 3ZQ5A 3CHWP 1XJ6A 2ZMFA 3LIDA 1KE0A 5IT5A 4PKYA 5GLBA 1K4FA 2ZQ8A 2PR5A 4LRZE 3RXWA 4IUHA 2QMIA 2ZM8A 4ESPA 5G4ZA 3NJAA 1E25A 2Z2MB 2OLUA 3N8LA 3T4LA 1RP5A 1TDGA 1G6OA 4ZRRA 5K5BA 3ZG8B 3H82B 1FR6A 3C8CA 4WF0A 1XFNA 4P6BA 4OPQA 4P87A 2EX8A 5EVIB 3JPUA 1RGZA 2WAEA 4MBFA 2DRWA 3NULA 1GHIA 2UWXA 2V8FA 4Q8IA 1S67L 4HY8A 5L07A 1JWZA 4B4ZA 1BULA 3OPHA 2PBYA 4MBKA 2V0WA 5J8XA 3V3SA 3F1OB 3MZDA 3FPVA 1S4SA 4YFMA 2J3TD 4FSFA 1YM1A 2WAFA 2HDUA 2W3FA 4ZJ1A 2W3HA 4KZ3A 3A3IA 4L9FA 3Q7ZA 3E4PA 2OWJA 3LIEA 1ZG6A 3AGEA 4D60A 3WRZA 4GD8A 1A0KA 3U4LP 3T4QA 2HF6A 2VLGA 3VV4A 1GA0A 4JXWA 4QHCA 4BBVA 2INWA 4GN2A 3RXXA
chains in the Genus database with same CATH topology
3NOUC 1VHMA 1OT9A 5AVFA 3LR5A 4OOLA 2VZWA 3MMHA 1YKDA 1OTDA 2BASA 2GX5A 3UB9A 3W2ZA 2K31A 2QKPA 3GECA 4RQ9A 2H28A 1D06A 2JHEA 1IFQA 3CWFA 3V67A 3EGXC 3VOLA 4CLCE 3KSFA 1XJ2A 3TE8A 2M7UA 3LUQA 1EW0A 2PDRA 1GSXA 4YOFA 3P01A 1LSXA 2Z6CA 1NLYA 5HWTA 2ZBBA 5J3WA 4R6LA 3PBRA 3H7WB 5EFWA 1TF1A 4PHTA 1ZHHB 5KIZA 4YWZA 3VE3A 3GDIA 2XSSA 3LR0A 5L8MA 2R78A 2IA2A 3H82A 4EXOA 3UB6A 4CLCA 3B42A 2V1AA 4R38A 3DBAA 5IU1A 4BBUA 3NOTC 4MMNA 5FL3A 1VB6A 1TD5A 2OOLA 5DFYA 4DMZA 5HZHA 2V9AA 3E4OA 4EESA 2WKQA 2K2NA 4F3LB 4B93A 4BMWA 4CLCD 1N9LA 4MCWA 4I5SA 5HDDA 2WKPA 3F1OA 2P08A 3PBSA 4GHIA 4HP9A 3T4TA 5TBMB 1XJ3A 2QWSA 3EEHA 3CITA 4CQHA 3HCYA 3KO6A 5HWWA 3UB8A 4NXFA 1S4RA 2VV7A 4G3WA 1T1BA 1WA9A 5HWVA 1UGUA 2W1TB 3R7WB 2YKFA 3F1NB 4I3IA 4ME4A 2FZ0A 3HJKA 1T19A 1LT0A 1JNUA 1XJ4A 4JGPA 5F69A 4Y2FA 3OOVA 2O0YA 2LB5A 2PT7A 4G3VA 3KYQA 4ETXA 1V9ZA 1DRMA 2P04A 4Q0IA 3UB7A 1IOUA 3OCNA 4EQ1A 3KSHA 1XFQA 4O0PA 2OAP1 2PR6A 3S7PA 1N9OA 2M7VA 3C2WA 5F68A 2LB9A 3IS2A 1YAXA 4EERA 4UEYA 3MQOA 5J4EA 4G3KA 2XROA 2GJ3A 3FG8A 1GSWA 5F5YA 4NXEA 4Y3IA 5HPFA 3PBNA 3MR0A 4GS9B 5TJJA 3RTYA 3H7WA 4NXBA 2A24B 3JVVA 4Y5FA 4O01A 1P9WA 2ZOIA 4HHDA 3T4KA 1OTBA 3HJIA 1OJ5A 4DJ2A 1P9RA 4EETB 1DP8A 5AVEA 3S7OA 4XT2B 2JKTM 2VV8A 2GNXA 4LRXC 2KX6A 5DKLA 1DP6A 4QPRA 3KSGA 3MFXA 4DN0A 3A0RA 1NRJA 5C5KA 3B47A 2KLIA 4IJGA 3BW6A 1LSVA 4EW7A 3PHYA 5HD3A 1MZUA 1S1ZA 3EOIA 4GLQA 4MN6A 3E0YA 2JKRM 4KUKA 5KSHA 4F3LA 5IS1A 2ZOHA 5J7EA 1OPXA 1OT6A 2YKHA 3VE4A 2VJWA 3FPWA 3JVUA 1V9YA 2QHKA 4MN7A 2PYPA 4L0LA 2EWWA 4HNBA 3U2AA 2B02A 2EA9A 5DJTA 4WN5A 4O8GA 5I5LA 2XA7S 1S1YA 2HGVA 2V1BA 4JGRA 2HJ9C 2W3DA 3EEAA 5TBMA 2O9CA 1YSQA 2XRNA 1T18A 4E04A 3BQAA 3KX0X 2L0WA 5HDCA 4GW9A 3NOPC 2O9BA 5AJGA 3OBFA 3UE3A 2I9VA 1X0OA 4WEJA 2W1TA 3R7WA 4R70A 3F1NA 3TRCA 4B9OA 3H9WA 2HV1A 3LIAA 3LI9A 4HQAA 5HSQA 4EEPA 2L4RA 1GSVA 3UE6A 4I38A 2VA0A 1ODVA 4NEED 2PHYA 4BJPA 2J3WA 1S66L 2NUTC 3RH8B 1P97A 4HJ3A 2HJEA 3C30A 2XA7M 3BQ8A 4HH3A 1OJGA 4EU0A 4KUOA 4EEUA 2ZMVA 2Y79A 3LFVA 4UQIS 3MF0A 3PBOA 3R4KA 5MC7A 3F1PB 4EUVA 4LLOB 4WELA 4K08A 4HP4A 1KOUA 4I39A 1G28A 1UWPX 3K3DA 3LR3A 3PBQA 1TS7A 4HJ6A 4GS9A 4GCZA 4AFIA 3CLOA 1W63Q 2A24A 1TS8A 3PXPA 4HI4A 2D01A 5LBRA 2Y8HA 1ZTUA 4HIAA 4PKYG 3C38A 3MQ0A 5CX7A 3P7NA 4ARZB 4WLAA 4KQDA 3D72A 2JKTI 4XT2A 2FH5A 4NXGA 1MKMA 2NUPC 4II7A 4UQIM 2W1RA 1F5MA 4Z1WA 1OTEA 3FC7A 2WKRA 2GZAA 3OLOA 1DP9A 1F9IA 1P0ZA 4OOMA 3LYXA 1TS0A 1YSPA 2JKRI 4MN5A 2VEAA 2QJ7A 3LICA 4PAUA 2J3TC 2W3EA 3CI6A 2G7UA 2Z6DA 4JGOA 2PYRA 1T1AA 1Y28A 4FOFA 5G4YA 4L9GA 3UMEA 2D02A 2W27A 4I3AA 4Q0HA 3MJQA 5DFXA 5HDSA 3T4OA 5F6AA 3ICYA 3UMDA 3IBRA 3ZYTA 3LIBA 2KDKA 4KQOA 3T4SA 2OAQ1 3O5YA 1MC0A 2CMNA 4Q0JA 4WUJA 4HJ4A 2W0NA 2PD8A 4L9EA 3K2NA 3IS2B 2EWVA 2J80A 2V0UA 3CUEC 3KYZA 5DJUA 2O99A 1H3QA 4LRYC 4H6JB 1STZA 5DKKA 3BWLA 4HH2A 3ULFA 3B33A 2JN7A 3EQVA 3ZQ5A 3NHQA 1XJ6A 1OTIA 2ZMFA 3LIDA 3E4QA 5HD5A 1TS6A 1LL8A 5IT5A 3F1PA 3PR6A 4HOIA 4PKYA 4BWIA 3MXQA 4M4XA 2PR5A 4LRZE 4WL9A 2M1CA 3IBJA 4IUHA 3T4JA 5DF9A 3S7NA 5HPIA 5A8BA 3S7QA 4WEKA 1LSWA 2L1MA 5G4ZA 3NJAA 4LPZA 1D7EA 1OTAA 4ARZA 2MJ6A 4GJ4A 3T4LA 3LIFA 2O9AA 4IHQA 1G6OA 3EQUA 4ZRRA 5K5BA 4ETZA 3H82B 4YNRA 3A0VA 3C8CA 4CLCB 2W3GA 4WF0A 4BBTA 1W63M 1XFNA 4JGQA 3LI8A 4CLCC 2VKSA 3PBTA 5HL6A 4DJ3A 4I3JA 3E98A 2VGLS 2VV6A 2A2LA 2PD7A 3G6OA 2KOIA 3SW1A 1S67L 3OCLA 3RFBA 4HY8A 3LR4A 1H8MA 2K7SA 2QYBA 1F98A 2P7JA 2DMWA 4IUKA 1UWNX 2V0WA 3TJZC 4P6ZS 2QJ5A 3PYPA 3F1OB 3K3CA 4GHIB 3FPVA 1S4SA 4MDZA 3TW8A 1NWZA 2J3TD 3EWKA 4FSFA 2W3FA 4R3AA 4NKPA 2W3HA 2OWHA 4L9FA 3MQQA 3E4PA 2B18A 2OWJA 3BJNA 3LIEA 3EGDC 3CAXA 2VGLM 2VX8A 3CUEA 3T50A 3T4QA 3D3OA 2HF6A 2VLGA 3BY9A 3VV4A 3OC2A 3A0SA 3KSIA 4H6JA 1N9NA 4BBVA 2INWA 1BYWA 1NLZA 1T1CA 3BY8A 4P6ZM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NOU C;  1OT9 A;  5AVF A;  1OTD A;  2BAS A;  3UB9 A;  2QKP A;  3GEC A;  4RQ9 A;  2H28 A;  1D06 A;  2JHE A;  3CWF A;  3VOL A;  1XJ2 A;  3LUQ A;  1EW0 A;  2PDR A;  1GSX A;  1LSX A;  2Z6C A;  5HWT A;  5J3W A;  2ZBB A;  4R6L A;  5EFW A;  3H7W B;  5KIZ A;  4YWZ A;  3VE3 A;  3GDI A;  2R78 A;  4EXO A;  3H82 A;  3UB6 A;  2V1A A;  4R38 A;  5IU1 A;  4BBU A;  3NOT C;  1VB6 A;  2OOL A;  5HZH A;  2V9A A;  3E4O A;  4EES A;  2WKQ A;  4F3L B;  1N9L A;  4I5S A;  5HDD A;  2WKP A;  3F1O A;  4GHI A;  4HP9 A;  5TBM B;  1XJ3 A;  2QWS A;  3EEH A;  5HWW A;  3UB8 A;  4NXF A;  1S4R A;  2VV7 A;  1T1B A;  1WA9 A;  5HWV A;  1UGU A;  2YKF A;  3F1N B;  4I3I A;  1T19 A;  1LT0 A;  1JNU A;  1XJ4 A;  3HJK A;  5F69 A;  4JGP A;  1V9Z A;  1DRM A;  3UB7 A;  4EQ1 A;  1XFQ A;  2PR6 A;  1N9O A;  3C2W A;  5F68 A;  3IS2 A;  4EER A;  3MQO A;  5J4E A;  2GJ3 A;  3FG8 A;  1GSW A;  5F5Y A;  4NXE A;  3MR0 A;  4GS9 B;  3RTY A;  3H7W A;  4NXB A;  2A24 B;  2ZOI A;  4HHD A;  1OTB A;  3HJI A;  1OJ5 A;  4DJ2 A;  4EET B;  1DP8 A;  5AVE A;  4XT2 B;  2VV8 A;  4LRX C;  2KX6 A;  5DKL A;  1DP6 A;  3MFX A;  3A0R A;  1LSV A;  4EW7 A;  3PHY A;  5HD3 A;  1MZU A;  1S1Z A;  4MN6 A;  4KUK A;  4F3L A;  5IS1 A;  2ZOH A;  5J7E A;  2YKH A;  1OT6 A;  3VE4 A;  1V9Y A;  2QHK A;  2PYP A;  4HNB A;  2B02 A;  2EA9 A;  5DJT A;  4WN5 A;  5I5L A;  1S1Y A;  4JGR A;  2V1B A;  5TBM A;  1T18 A;  4E04 A;  3KX0 X;  2L0W A;  5HDC A;  4GW9 A;  3NOP C;  2I9V A;  1X0O A;  4R70 A;  3F1N A;  4B9O A;  3H9W A;  2HV1 A;  3LIA A;  3LI9 A;  4HQA A;  5HSQ A;  4EEP A;  2L4R A;  1GSV A;  3UE6 A;  4I38 A;  1ODV A;  2PHY A;  1S66 L;  3RH8 B;  1P97 A;  4HJ3 A;  4HH3 A;  1OJG A;  4KUO A;  4EEU A;  3F1P B;  4LLO B;  4K08 A;  4HP4 A;  1KOU A;  4I39 A;  1G28 A;  1UWP X;  3K3D A;  1TS7 A;  4HJ6 A;  4GS9 A;  4GCZ A;  3CLO A;  2A24 A;  1TS8 A;  4HI4 A;  2D01 A;  4HIA A;  4PKY G;  3P7N A;  4WLA A;  4KQD A;  3D72 A;  4XT2 A;  4NXG A;  1OTE A;  3FC7 A;  2WKR A;  3OLO A;  1DP9 A;  1F9I A;  1P0Z A;  3LYX A;  1TS0 A;  4MN5 A;  2VEA A;  2QJ7 A;  3LIC A;  2Z6D A;  4JGO A;  2PYR A;  1T1A A;  1Y28 A;  5G4Y A;  4L9G A;  3UME A;  2D02 A;  2W27 A;  4I3A A;  3MJQ A;  5HDS A;  5F6A A;  3ICY A;  3UMD A;  3IBR A;  3LIB A;  2KDK A;  2CMN A;  4WUJ A;  4HJ4 A;  2W0N A;  2PD8 A;  4L9E A;  3IS2 B;  2J80 A;  2V0U A;  5DJU A;  4LRY C;  4H6J B;  5DKK A;  3BWL A;  4HH2 A;  3ULF A;  3B33 A;  2JN7 A;  3ZQ5 A;  3NHQ A;  1XJ6 A;  1OTI A;  3LID A;  3E4Q A;  5HD5 A;  1TS6 A;  1LL8 A;  3F1P A;  4HOI A;  4PKY A;  3MXQ A;  4M4X A;  2PR5 A;  4LRZ E;  4WL9 A;  2M1C A;  5A8B A;  1LSW A;  2L1M A;  5G4Z A;  3NJA A;  4LPZ A;  1D7E A;  1OTA A;  3LIF A;  3H82 B;  3A0V A;  3C8C A;  4WF0 A;  4BBT A;  1XFN A;  4JGQ A;  3LI8 A;  4DJ3 A;  4I3J A;  2VV6 A;  3G6O A;  2PD7 A;  3SW1 A;  1S67 L;  4HY8 A;  2K7S A;  1F98 A;  2P7J A;  1UWN X;  2V0W A;  2QJ5 A;  3PYP A;  3F1O B;  3K3C A;  4GHI B;  1S4S A;  1NWZ A;  3EWK A;  4R3A A;  2OWH A;  4L9F A;  3MQQ A;  3E4P A;  2OWJ A;  3LIE A;  3CAX A;  3T50 A;  2VLG A;  3BY9 A;  3A0S A;  4H6J A;  1N9N A;  4BBV A;  2INW A;  1BYW A;  1T1C A;  3BY8 A; 
#chains in the Genus database with same CATH topology
 4Y0U A;  3HLE A;  1MWR A;  3DW0 A;  1HLU P;  4GB7 A;  4S2N A;  4WBG A;  4OOL A;  2VZW A;  2ZL1 B;  5HX9 A;  2ZD8 A;  5EE8 A;  2WYX A;  5CHU A;  1QME A;  4FH4 A;  3QP4 A;  1QMF A;  4IBR A;  3WS2 A;  4JKT A;  3VOL A;  3RJU A;  4CLC E;  3KSF A;  1XJ2 A;  1EW0 A;  2PDR A;  1GSX A;  4YOF A;  3P01 A;  4OON A;  4R6L A;  5FDH A;  4N9L A;  4S2J A;  3W4Q A;  5FDS A;  3GDI A;  2XSS A;  2ZJ9 A;  3LR0 A;  4Y7P A;  2Q0O A;  1K25 A;  1IKG A;  1FIK A;  3B42 A;  3MZE A;  2WK0 A;  5CEB A;  4LV0 A;  2WKE A;  4PM5 A;  1PW8 A;  2EXA A;  4NG2 A;  1TD5 A;  5DFY A;  4DMZ A;  2Q9N A;  2Y2P A;  2K2N A;  3IHB A;  3IH9 A;  1VET B;  3IX8 A;  3E2K A;  2WGV A;  3MFD A;  1GHM A;  4Y13 A;  4HP9 A;  5BOH A;  4X1M A;  1XJ3 A;  2QWS A;  2Y2M A;  3SZT A;  3O88 A;  4JLF A;  3PAE A;  5HWW A;  3T1S A;  3CMZ A;  4WMC A;  1ES3 A;  1WA9 A;  1XGI A;  3G35 A;  3R7W B;  3F1N B;  4ME4 A;  1L0D A;  4OQ0 A;  5F69 A;  1YMX A;  2O0Y A;  1EWZ A;  3OOV A;  4G3V A;  1H8Y A;  3UB7 A;  1IOU A;  3OCN A;  1E4D A;  2Y55 A;  2PR6 A;  2HDR A;  4WMC D;  2WKH A;  2WGI A;  4PM7 A;  3GSG A;  3C2W A;  5F68 A;  5FEG A;  2WKI A;  4OQI A;  2GJ3 A;  3FG8 A;  1GSW A;  5F5Y A;  4NXE A;  3PBN A;  4GS9 B;  3RTY A;  3JVV A;  4QY5 A;  4Y5F A;  4O01 A;  1FCN A;  2WGW A;  3Q7V A;  1PNE A;  1P9R A;  5FEF A;  5GLA A;  4OPR A;  4BD1 A;  2JKT M;  1JVJ A;  5DKL A;  2P9V A;  3WS5 A;  2KLI A;  1YLP A;  1LSV A;  1PRQ A;  4E3K A;  5HD3 A;  1S1Z A;  4MN6 A;  1Y4O A;  2JKR M;  4KUK A;  5KSH A;  4F3L A;  1JTG A;  5IS1 A;  5FQ9 A;  2ZOH A;  3IF6 B;  1OPX A;  2YKH A;  5A92 A;  5CED A;  3FPW A;  3JVU A;  4MN7 A;  4BL3 A;  2PYP A;  2B02 A;  2EA9 A;  3EEA A;  1YSQ A;  1K55 C;  2XRN A;  5EM0 A;  4E04 A;  4KZ6 A;  1BLS A;  5EEC A;  4JXS A;  5M18 A;  1X0O A;  4WEJ A;  3LI9 A;  3LIA A;  4I38 A;  5I94 A;  2BTF P;  1ODV A;  2VA0 A;  4X55 A;  4X6T A;  2J3W A;  1NRF A;  1G6A A;  5A91 A;  3T1Q B;  2NUT C;  4R23 A;  3DTE A;  4FH2 A;  2ZC7 A;  4HJ3 A;  4DXB A;  3C30 A;  3MXR A;  3IXG A;  2XA7 M;  4HBT A;  4BQM A;  3VSL A;  5A90 A;  4ZTK A;  5HAP A;  3A3E A;  5U47 A;  4UQI S;  2C6W B;  3PBO A;  1XXM A;  3ZG7 B;  4EUV A;  4LLO B;  3BFF A;  3DTK A;  2XQZ A;  3LR3 A;  1TS7 A;  2A24 A;  3MXS A;  3PXP A;  4HI4 A;  2Y8H A;  3S22 A;  1YLZ A;  3S1Y A;  3P7N A;  5KZH A;  2JKT I;  1PWG A;  4XT2 A;  1MKM A;  4S2K A;  1XX2 A;  4MNR A;  4HES A;  4Z1W A;  2GZA A;  3OLO A;  1P0Z A;  2JKR I;  5G18 A;  1SHV A;  3SH8 A;  2VEA A;  4LEN A;  3ZCZ A;  3QNB A;  2J3T C;  2Z6D A;  1T1A A;  1WYB A;  3UDI A;  3Q1F A;  3P09 A;  5G4Y A;  1RCJ A;  4KZB A;  1VEU A;  1ES5 A;  4OKP A;  5HDS A;  3T4S A;  5FI6 A;  5L09 A;  2OAQ 1;  1PI4 A;  3K2N A;  3G32 A;  1MY8 A;  2XK1 A;  2EWV A;  2V0U A;  3KYZ A;  1STZ A;  1G68 A;  2HP6 A;  3IHA A;  4S2N C;  5CGS A;  3V3R A;  1TEM A;  3F1P A;  4HOI A;  4DE0 A;  3MXQ A;  3GRJ A;  4RYE A;  2M1C A;  2P9V B;  3MZF A;  1J3W A;  3WRT A;  5HPI A;  4MLL A;  2ZC6 B;  4FD8 A;  1OTA A;  4ARZ A;  3NY4 A;  1JWP A;  1GHP A;  3LIF A;  4IHQ A;  3HLF A;  1IYS A;  2R9W A;  3EQU A;  5GHX A;  3UPO A;  4ETZ A;  4N92 A;  2DNS A;  1I2W A;  3IX4 A;  1W63 M;  1PFL A;  4OPY A;  3LI8 A;  1YLY A;  2VKS A;  2IWD A;  4KG6 A;  3W8K A;  3W4P A;  5HL6 A;  3ZHH A;  3QP8 A;  1ERO A;  4I3J A;  4KZ8 A;  5FI2 A;  2E8I A;  2H0T A;  2VGL S;  3A3J A;  2PD7 A;  4GKU A;  1W8Q A;  3NI9 A;  3LR4 A;  2K7S A;  4PMA A;  2QYB A;  4IUK A;  1ALQ A;  2PBD P;  4EV4 A;  4P6Z S;  1YMS A;  4GHI B;  1E3U A;  4MDZ A;  4WZ5 C;  1NWZ A;  2ZQA A;  4CPK A;  3BJN A;  1PWD A;  3EGD C;  3CAX A;  3T50 A;  2J9O A;  1NYY A;  3TSG A;  3BY9 A;  3UPP A;  1IKI A;  1E3U D;  1O07 A;  1BYW A;  5FQM A;  1K55 A;  1HVB A;  5D3O A;  5TR7 A;  2H5S A;  4X53 A;  4EBN A;  1YKD A;  2ZMA A;  2Y59 A;  2GX5 A;  3W2Z A;  2QKP A;  2H28 A;  2JHE A;  2Y2H A;  1IFQ A;  3CWF A;  5CGX A;  1KVM A;  3V67 A;  3LEQ A;  1XP4 A;  3G30 A;  2XFT A;  2EX2 A;  1NLY A;  2ZBB A;  1FQG A;  1CK3 A;  3PBR A;  2H0Y A;  3IXD A;  1ZHH B;  5KIZ A;  4YWZ A;  1MWT A;  1SKO B;  5FAS A;  4X56 A;  1BT5 A;  3T1R A;  2IA2 A;  3UB6 A;  4WYY A;  5EOO A;  4CLC A;  4S2L A;  4R38 A;  3DBA A;  4BBU A;  2J9P A;  5FA7 A;  1VB6 A;  5FAQ A;  3NCK A;  5FAP A;  4EES A;  2WKQ A;  1KGE A;  4P0M A;  5E2H A;  2X01 A;  4BMW A;  4CLC D;  1N9L A;  4MCW A;  4I5S A;  5HDD A;  2Y91 A;  2R9X A;  4Y0T A;  2VGJ A;  4MEZ A;  1K6S A;  2WAD A;  3UE1 A;  5EV0 A;  3N8S A;  1TDL A;  1NXY A;  2XD5 A;  4IED A;  3HCY A;  1OME A;  3UB8 A;  4IVK A;  3VOZ A;  4LV3 A;  1DJA A;  1YLW A;  1SKF A;  2W1T B;  1ERQ A;  3HJK A;  1LT0 A;  3WWX A;  4IVI A;  2PT7 A;  4UAA A;  3KYQ A;  4Q0I A;  1XPB A;  4DRT A;  3KSH A;  1ONG A;  5CGW A;  3S7P A;  1N9O A;  2LB9 A;  3IS2 A;  4FUW A;  4DXC A;  1K56 A;  2XRO A;  2Q9M A;  3HRE A;  1RGY A;  2OV5 A;  3N7W A;  5CEC A;  3NBL A;  3H7W A;  3LY4 A;  4XXR A;  5TGF A;  4HHD A;  1NZU A;  3T4K A;  3UDX A;  1OJ5 A;  4EET B;  5HAR A;  3UO9 A;  1LI0 A;  2VV8 A;  1KDW A;  1DP6 A;  3DTM A;  4R0Q A;  4ZJ3 A;  1DJC A;  1FSY A;  4O7D A;  1MPL A;  3B47 A;  5EVL A;  1PZO A;  3PHY A;  4N1H A;  2PU2 A;  3EOI A;  2EX9 A;  3BRM A;  2G2W A;  1IEL A;  3IXB A;  4DF6 A;  2VJW A;  4GZB A;  1HD8 A;  4CJN A;  2EFU A;  4HNB A;  5GHY A;  4WN5 A;  1PW1 A;  1MXO A;  4OVD A;  3CJM A;  5TBM A;  2W3D A;  4LV1 A;  3HLB A;  2O9C A;  5IHV A;  4D2O A;  1L0E A;  3BQA A;  2L0W A;  2J7V A;  2ACG A;  3OBF A;  2I9V A;  3TRC A;  4HQA A;  5HSQ A;  3HUN A;  3VSK A;  4WZ5 A;  5M19 A;  3SS3 A;  1XA1 A;  3RH8 B;  3M6B A;  5F1F A;  1P97 A;  3QP2 A;  2RCX A;  3BQ8 A;  1KDS A;  2ZLY A;  1PZP A;  5L10 A;  1OJG A;  3T12 B;  4KUO A;  4EEU A;  4EU0 A;  2Y79 A;  3SH7 A;  3BFE A;  3MF0 A;  5AQA A;  5EM1 A;  3VP2 A;  1O7E A;  3BFC A;  4WEL A;  1KOU A;  4I39 A;  1G28 A;  3ZG9 B;  3DWK A;  3K3D A;  3CLO A;  3BEB A;  1W63 Q;  2PU4 A;  3VP0 A;  1AWI A;  3VOY A;  2XDM A;  4Y15 A;  5F1G A;  4HIA A;  3C38 A;  3MQ0 A;  5AQ9 A;  4WLA A;  1K6R A;  1GCE A;  2Y4A A;  3Q81 A;  4II7 A;  4UQI M;  1VM1 A;  3GR2 A;  2WUQ A;  2W1R A;  2HZ5 A;  4X68 A;  1F5M A;  5M1A A;  2ZM0 A;  3FC7 A;  1F9I A;  3PAG A;  2J8Y A;  4OOM A;  2UV0 E;  1TS0 A;  2PAV P;  4MN5 A;  3SOI A;  1KVL A;  3G2Z A;  2Z2L B;  2ZC3 B;  2G7U A;  3CZD A;  1KGG A;  3MS6 A;  4L9G A;  3HLC A;  4I3A A;  3NC8 A;  3M2K A;  5F83 A;  4C3Q A;  2ZQ9 A;  3UMD A;  3ZYT A;  5E2E A;  3O5Y A;  1FIL A;  4Q0J A;  1MKI A;  4HJ4 A;  1MWU A;  2PD8 A;  3IS2 B;  4UA9 A;  2RL3 A;  5DJU A;  1H3Q A;  4F94 A;  2E8J A;  2JBF A;  4HH2 A;  5HAI A;  3ULF A;  2JC7 A;  2H10 A;  2QZ6 A;  3HVF A;  3NHQ A;  3E4Q A;  5HD5 A;  1TS6 A;  5FSR A;  1LL8 A;  1BSG A;  1W8Y A;  4BWI A;  3LY3 A;  2XFS A;  4X69 A;  4M4X A;  4WL9 A;  1ESU A;  5DTK A;  1Z6F A;  5DF9 A;  5A8B A;  5GLD A;  4ZDX A;  4BL2 A;  2MJ6 A;  4KEN B;  4Z9Q A;  4QY6 A;  4FCF A;  3N8R A;  3ITB A;  3BM6 A;  4S2M A;  4X1L A;  4NK3 A;  3A0V A;  2W3G A;  4ZJ2 A;  3LO7 A;  2BG1 A;  4CLC C;  3CG5 A;  3ZDJ A;  4EUZ A;  2HP9 A;  1C3B A;  2XLN A;  2A2L A;  3G6O A;  2KOI A;  3SW1 A;  2P7J A;  4OPZ A;  3DWZ A;  2DMW A;  1CEG A;  4U0X A;  3FV7 A;  3KYE A;  4U0T A;  3TJZ C;  2QJ5 A;  3TW8 A;  3I7J A;  2Y2K A;  1L2S A;  1N9B A;  4N1X A;  2B18 A;  5L2F A;  4M3K A;  3N6I A;  5CHM A;  3CUE A;  2VGL M;  3TG9 A;  3D3O A;  3A0S A;  4KZ4 A;  4JBF A;  4H6J A;  5CRF A;  1NLZ A;  4K0X A;  3BY8 A;  4PM9 A;  4P6Z M;  3FZC A;  1DJB A;  1VHM A;  3NOU C;  4ZBE A;  5AVF A;  3LR5 A;  3WS1 A;  3MMH A;  2ZQD A;  1OTD A;  3MKF A;  2BAS A;  3UE0 A;  3IT9 A;  2HP5 A;  1CI9 A;  1D06 A;  4R1G A;  3EGX C;  4B4X A;  3TE8 A;  2M7U A;  3LUQ A;  5HWT A;  2Z6C A;  3MBZ A;  1W5D A;  5CER A;  1PI5 A;  4RVA A;  1SCW A;  4PHT A;  2ZC5 B;  2WGW B;  3Q7V B;  3BFD A;  3VE3 A;  4LFU A;  4UA6 A;  1SDE A;  2ZQC A;  2R78 A;  3H82 A;  2JE5 A;  2V1A A;  3ZVW A;  2ZQ7 A;  2IWB A;  3A3F A;  2OLV A;  2WZX A;  4R3B A;  3M2J A;  2FFF B;  3NOT C;  4MMN A;  5EVI A;  5FL3 A;  1XGJ A;  2Y2I A;  4LCM A;  1W79 A;  3M6H A;  3E4O A;  1Q2Q A;  1XKZ A;  3IF5 A;  4F3L B;  5EOE A;  1CI8 A;  2Y2J A;  2A49 A;  3NDG A;  3D4F A;  1L0F A;  2WKP A;  3F1O A;  5EVI D;  3T4T A;  3O86 A;  4XUZ A;  4C75 A;  3VP1 A;  3KO6 A;  2X71 A;  5JYO A;  5FQK A;  1S4R A;  4G3W A;  5HWV A;  1UGU A;  2BLS A;  4I3I A;  1T19 A;  4JGP A;  1JNU A;  3VMA A;  2LB5 A;  4ETX A;  5JYP A;  1JWV A;  1DRM A;  2P04 A;  2ZL1 A;  3QP1 A;  3WS0 A;  4U3T A;  1XFQ A;  4O0P A;  5EUA A;  1BLC A;  4LGW A;  3MSH A;  4UEY A;  3MQO A;  4QU3 A;  3V50 A;  1S6R A;  4Y3I A;  3MR0 A;  1K54 A;  4OLD A;  1YPR A;  2A24 B;  3SS5 A;  3IXH A;  2XD1 A;  4HBU A;  4RA7 A;  2ZOI A;  2PRF A;  1IYP A;  3HJI A;  2QPN A;  3UN7 A;  1PIO A;  4DJ2 A;  4FTX A;  2VK3 A;  1LHY A;  4X25 A;  4XT2 B;  4LRX C;  2KX6 A;  4E6X A;  1S0W A;  4QPR A;  1BLH A;  4DN0 A;  4S2I A;  2ZC4 B;  3A0R A;  4PM8 A;  4DDS A;  3ZGA B;  4IJG A;  2V1Z A;  3BW6 A;  4EW7 A;  3NIA A;  1DY6 A;  1MZU A;  4OLG A;  4S2O A;  3E0Y A;  4MBH A;  3DAV A;  4E3L A;  5FQJ A;  5J7E A;  2V2F F;  2EWW A;  3G4P A;  1VEU B;  5DJT A;  2GDN A;  2X02 A;  4O8G A;  1IYO A;  3V39 A;  1S1Y A;  2HGV A;  2V1B A;  4JGR A;  1BTL A;  3IWO A;  4N9K A;  1T18 A;  4EWF A;  3L7H A;  3C7U A;  5HDC A;  4GW9 A;  1W7F A;  5AJG A;  2B95 A;  2EX6 A;  1IEM A;  5HFO A;  3R7W A;  4R70 A;  3F1N A;  3H9W A;  3QNC A;  4EEP A;  2L4R A;  3P98 A;  4BJP A;  2EXB A;  4KZ7 A;  1BUE A;  5E43 A;  4K91 A;  5GHZ A;  4BD0 A;  1J9M A;  3FYZ A;  3HLD A;  3C4O A;  5GL9 A;  4HH3 A;  5FAO A;  3L9K A;  4LCL A;  3VFF A;  3R4K A;  5MC7 A;  3F1P B;  3MKE A;  4HP4 A;  4PPR A;  5GLC A;  3FKW A;  4LV2 A;  4KZ5 A;  3AGF A;  4GS9 A;  4AFI A;  1TS8 A;  5LBR A;  2I72 A;  4QJG A;  4PKY G;  5CX7 A;  3HL9 A;  4ARZ B;  3OPR A;  1FR1 A;  3DTI A;  1HTZ A;  2NUP C;  1L0G A;  2HDS A;  1AXB A;  1TVF A;  4A5R A;  3LYX A;  4EBL A;  1K0K A;  1CEF A;  1YQS A;  3IF6 A;  4DE1 A;  4XUX A;  4KQQ A;  1K56 D;  2W3E A;  2PYR A;  1Y28 A;  3C4P A;  2EFX A;  4R4R A;  1H5X A;  3UME A;  2W27 A;  3MJQ A;  5DFX A;  3T4O A;  4E3M A;  4E6W A;  3ICY A;  3Q82 A;  3IBR A;  4R3J A;  2KDK A;  4KQO A;  5FI7 A;  3ZG5 A;  1I2S A;  4WUJ A;  2W0N A;  3QHY A;  5AQ7 A;  4L9E A;  3N4I A;  1MWS A;  4UA7 A;  1YT4 A;  1XA7 A;  3GQZ A;  4H8R A;  3CUE C;  2O99 A;  4LRY C;  2XF3 A;  3ZNY A;  5DKK A;  3OPP A;  1LL9 A;  5DVA A;  4Y0O A;  4UHU A;  3B33 A;  2JN7 A;  1KE3 A;  1OTI A;  3VP3 A;  1IYQ A;  5A93 A;  3NDE A;  3PR6 A;  1G5U A;  3JYI A;  3G31 A;  3UY6 A;  2Y2O A;  3IBJ A;  3T4J A;  3S7N A;  5HAQ A;  3S7Q A;  3D9Y A;  1LSW A;  4WEK A;  2L1M A;  4LPZ A;  1D7E A;  4KZ9 A;  3HUO A;  4GJ4 A;  2O9A A;  5DTS A;  3GMW A;  3TOI A;  3AGD A;  2V8C A;  2ZM2 A;  1K38 A;  4YNR A;  3ZFZ A;  3SS4 A;  4CLC B;  4BBT A;  4JPM A;  1HZO A;  4JGQ A;  1LL5 A;  5HW3 A;  5FQQ A;  3PBT A;  3CPT A;  4DJ3 A;  3E98 A;  2VV6 A;  5EVI C;  1GA9 A;  4OP8 A;  3RFB A;  3OCL A;  1FSW A;  1H8M A;  1F98 A;  3IX3 A;  3LEZ A;  1UWN X;  3PYP A;  3K3C A;  3EWK A;  4R3A A;  1ZC2 A;  4NKP A;  2OWH A;  4OQH A;  1ACF A;  3MQQ A;  2WZZ A;  1BZA A;  2Y2L A;  2VX8 A;  3OC2 A;  2C5W B;  3KSI A;  2IWC A;  1MBL A;  3ZNT A;  1N9N A;  1T1C A;  4BLM A;  1K57 A;  3HLW A;  4OH0 A;  2JKG A;  3W4O A;  3ZVT A;  1OT9 A;  3UDF A;  4DE2 A;  3WS4 A;  2P74 A;  4KG2 A;  3UB9 A;  2DCF A;  2K31 A;  3QP6 A;  3LGO A;  4C6Y A;  3GEC A;  4RQ9 A;  2XR0 A;  2Y2G A;  3BYD A;  1CQA A;  1LSX A;  5J3W A;  1WE4 A;  5E2G A;  4E3J A;  5EFW A;  3H7W B;  1TF1 A;  3GV9 A;  1BLP A;  1K54 C;  1N4O A;  5KSC A;  3C7V A;  2JCH A;  5L8M A;  4EXO A;  1M40 A;  4BEN A;  1LI9 A;  3FKV A;  5IU1 A;  1I5Q A;  4PM6 A;  4DKI A;  3BLM A;  3UB5 P;  4JF6 A;  2OOL A;  5HZH A;  2V9A A;  5AQB A;  1ES4 A;  4JF5 A;  5DF7 A;  3O3V A;  4B93 A;  5CTN A;  4K0W A;  4EQI A;  4DDY A;  1F2K A;  2P08 A;  3NEC A;  3PBS A;  4GHI A;  1JTD A;  5HL1 A;  1VQQ A;  4S2P A;  5FAT A;  2A3U A;  5TBM B;  4GDB A;  3EEH A;  3CIT A;  4CQH A;  1CF0 A;  4NXF A;  3FWL A;  2VV7 A;  5EVE A;  1T1B A;  2HPB A;  1YLT A;  3SH9 A;  2YKF A;  1ES2 A;  2FZ0 A;  1XJ4 A;  3BFG A;  4Y2F A;  1CJF A;  4WM9 A;  1FCO A;  1V9Z A;  3OZH A;  4NET A;  1SDN A;  1NZO A;  4EQ1 A;  2XGN A;  4KG5 A;  3HUM A;  2OAP 1;  2M7V A;  4EER A;  1YAX A;  4E3I A;  1FCM A;  1YLJ A;  1Z09 A;  4RX2 A;  1NY0 A;  5J4E A;  4G3K A;  1K4E A;  3A3D A;  1Q2P A;  3O87 A;  4OQG A;  3IH8 A;  2B5R A;  3OPL A;  5HPF A;  4HEF A;  5TJJ A;  4ZAM A;  4RX3 A;  4NXB A;  3CPT B;  1P9W A;  1SKO A;  1H0M A;  1OTB A;  1ZKJ A;  3LCE A;  1DP8 A;  5AVE A;  3S7O A;  5CHJ A;  1LLB A;  2OSU A;  3Q07 A;  1D1J A;  2GNX A;  3G34 A;  3GVB A;  4P85 A;  4WZ4 A;  3KSG A;  3MFX A;  5E2F A;  1NRJ A;  5C5K A;  2Y2Q A;  4KQR A;  1ONH A;  3BEC A;  4GLQ A;  1ERM A;  3V5M A;  3VE4 A;  1OT6 A;  3BLS A;  2XH9 A;  3ZG0 A;  1NJ4 A;  1V9Y A;  2QHK A;  3IF6 C;  3IQA A;  4L0L A;  4KZA A;  2G2U A;  3U2A A;  4JF4 A;  5I5L A;  2XA7 S;  2HJ9 C;  1WYC A;  3KX0 X;  2AVX A;  5KMW A;  3NOP C;  2O9B A;  3VFH A;  1ZG4 A;  3UE3 A;  1L3L A;  2W1T A;  4EBP A;  4B9O A;  2HV1 A;  1PWC A;  1GSV A;  3UE6 A;  3B3X A;  4GOG A;  4NEE D;  2PHY A;  1FOF A;  2Y2N A;  1S66 L;  1Y54 A;  3UPN A;  5TFQ A;  1KE4 A;  3UNW A;  5EPH A;  1H8Z A;  2HJE A;  3GTC A;  2CC1 A;  3ISG A;  5CTM A;  2ZMV A;  3LFV A;  1EI5 A;  2JKF A;  4K08 A;  1UWP X;  4Y17 A;  3S4X A;  3PBQ A;  4HJ6 A;  4GCZ A;  2D01 A;  3QP5 A;  1ZTU A;  2XEP A;  4DE3 A;  5FQI A;  4KQD A;  3D72 A;  2V20 A;  2FH5 A;  4NXG A;  4OOY A;  2VGK A;  3C5A A;  4B88 A;  3ITA A;  4QWO A;  1OTE A;  4YIN A;  2WKR A;  4E3O A;  1DP9 A;  1YSP A;  3G2Y A;  3T1X A;  3PTE A;  4ID4 A;  2QJ7 A;  5F82 A;  3LIC A;  1KGF A;  4GDN A;  4PAU A;  3IWQ A;  3CI6 A;  4JGO A;  4FOF A;  3E2L A;  2D02 A;  5CXW A;  1U60 A;  3HLG A;  4JXV A;  4Q0H A;  5F6A A;  1M6K A;  2HDQ A;  4R4S A;  3LIB A;  4JXG A;  4IBX A;  1SZV A;  1MC0 A;  2CMN A;  1ESI A;  4GD6 A;  3HBR A;  1VET A;  5DTT A;  4OP5 A;  4GNU A;  2J80 A;  1NYM A;  4E3N A;  1PYY A;  4H6J B;  5DF8 A;  3BWL A;  3VP4 A;  4QB8 A;  3IWI A;  2FFY A;  4QD4 A;  3EQV A;  1K57 C;  3ZQ5 A;  3CHW P;  1XJ6 A;  2ZMF A;  3LID A;  1KE0 A;  5IT5 A;  4PKY A;  5GLB A;  1K4F A;  2ZQ8 A;  2PR5 A;  4LRZ E;  3RXW A;  4IUH A;  2QMI A;  2ZM8 A;  4ESP A;  5G4Z A;  3NJA A;  1E25 A;  2Z2M B;  2OLU A;  3N8L A;  3T4L A;  1RP5 A;  1TDG A;  1G6O A;  4ZRR A;  5K5B A;  3ZG8 B;  3H82 B;  1FR6 A;  3C8C A;  4WF0 A;  1XFN A;  4P6B A;  4OPQ A;  4P87 A;  2EX8 A;  5EVI B;  3JPU A;  1RGZ A;  2WAE A;  4MBF A;  2DRW A;  3NUL A;  1GHI A;  2UWX A;  2V8F A;  4Q8I A;  1S67 L;  4HY8 A;  5L07 A;  1JWZ A;  4B4Z A;  1BUL A;  3OPH A;  2PBY A;  4MBK A;  2V0W A;  5J8X A;  3V3S A;  3F1O B;  3MZD A;  3FPV A;  1S4S A;  4YFM A;  2J3T D;  4FSF A;  1YM1 A;  2WAF A;  2HDU A;  2W3F A;  4ZJ1 A;  2W3H A;  4KZ3 A;  3A3I A;  4L9F A;  3Q7Z A;  3E4P A;  2OWJ A;  3LIE A;  1ZG6 A;  3AGE A;  4D60 A;  3WRZ A;  4GD8 A;  1A0K A;  3U4L P;  3T4Q A;  2HF6 A;  2VLG A;  3VV4 A;  1GA0 A;  4JXW A;  4QHC A;  4BBV A;  2INW A;  4GN2 A;  3RXX A; 
#chains in the Genus database with same CATH homology
 3NOU C;  1VHM A;  1OT9 A;  5AVF A;  3LR5 A;  4OOL A;  2VZW A;  3MMH A;  1YKD A;  1OTD A;  2BAS A;  2GX5 A;  3UB9 A;  3W2Z A;  2K31 A;  2QKP A;  3GEC A;  4RQ9 A;  2H28 A;  1D06 A;  2JHE A;  1IFQ A;  3CWF A;  3V67 A;  3EGX C;  3VOL A;  4CLC E;  3KSF A;  1XJ2 A;  3TE8 A;  2M7U A;  3LUQ A;  1EW0 A;  2PDR A;  1GSX A;  4YOF A;  3P01 A;  1LSX A;  2Z6C A;  1NLY A;  5HWT A;  2ZBB A;  5J3W A;  4R6L A;  3PBR A;  3H7W B;  5EFW A;  1TF1 A;  4PHT A;  1ZHH B;  5KIZ A;  4YWZ A;  3VE3 A;  3GDI A;  2XSS A;  3LR0 A;  5L8M A;  2R78 A;  2IA2 A;  3H82 A;  4EXO A;  3UB6 A;  4CLC A;  3B42 A;  2V1A A;  4R38 A;  3DBA A;  5IU1 A;  4BBU A;  3NOT C;  4MMN A;  5FL3 A;  1VB6 A;  1TD5 A;  2OOL A;  5DFY A;  4DMZ A;  5HZH A;  2V9A A;  3E4O A;  4EES A;  2WKQ A;  2K2N A;  4F3L B;  4B93 A;  4BMW A;  4CLC D;  1N9L A;  4MCW A;  4I5S A;  5HDD A;  2WKP A;  3F1O A;  2P08 A;  3PBS A;  4GHI A;  4HP9 A;  3T4T A;  5TBM B;  1XJ3 A;  2QWS A;  3EEH A;  3CIT A;  4CQH A;  3HCY A;  3KO6 A;  5HWW A;  3UB8 A;  4NXF A;  1S4R A;  2VV7 A;  4G3W A;  1T1B A;  1WA9 A;  5HWV A;  1UGU A;  2W1T B;  3R7W B;  2YKF A;  3F1N B;  4I3I A;  4ME4 A;  2FZ0 A;  3HJK A;  1T19 A;  1LT0 A;  1JNU A;  1XJ4 A;  4JGP A;  5F69 A;  4Y2F A;  3OOV A;  2O0Y A;  2LB5 A;  2PT7 A;  4G3V A;  3KYQ A;  4ETX A;  1V9Z A;  1DRM A;  2P04 A;  4Q0I A;  3UB7 A;  1IOU A;  3OCN A;  4EQ1 A;  3KSH A;  1XFQ A;  4O0P A;  2OAP 1;  2PR6 A;  3S7P A;  1N9O A;  2M7V A;  3C2W A;  5F68 A;  2LB9 A;  3IS2 A;  1YAX A;  4EER A;  4UEY A;  3MQO A;  5J4E A;  4G3K A;  2XRO A;  2GJ3 A;  3FG8 A;  1GSW A;  5F5Y A;  4NXE A;  4Y3I A;  5HPF A;  3PBN A;  3MR0 A;  4GS9 B;  5TJJ A;  3RTY A;  3H7W A;  4NXB A;  2A24 B;  3JVV A;  4Y5F A;  4O01 A;  1P9W A;  2ZOI A;  4HHD A;  3T4K A;  1OTB A;  3HJI A;  1OJ5 A;  4DJ2 A;  1P9R A;  4EET B;  1DP8 A;  5AVE A;  3S7O A;  4XT2 B;  2JKT M;  2VV8 A;  2GNX A;  4LRX C;  2KX6 A;  5DKL A;  1DP6 A;  4QPR A;  3KSG A;  3MFX A;  4DN0 A;  3A0R A;  1NRJ A;  5C5K A;  3B47 A;  2KLI A;  4IJG A;  3BW6 A;  1LSV A;  4EW7 A;  3PHY A;  5HD3 A;  1MZU A;  1S1Z A;  3EOI A;  4GLQ A;  4MN6 A;  3E0Y A;  2JKR M;  4KUK A;  5KSH A;  4F3L A;  5IS1 A;  2ZOH A;  5J7E A;  1OPX A;  1OT6 A;  2YKH A;  3VE4 A;  2VJW A;  3FPW A;  3JVU A;  1V9Y A;  2QHK A;  4MN7 A;  2PYP A;  4L0L A;  2EWW A;  4HNB A;  3U2A A;  2B02 A;  2EA9 A;  5DJT A;  4WN5 A;  4O8G A;  5I5L A;  2XA7 S;  1S1Y A;  2HGV A;  2V1B A;  4JGR A;  2HJ9 C;  2W3D A;  3EEA A;  5TBM A;  2O9C A;  1YSQ A;  2XRN A;  1T18 A;  4E04 A;  3BQA A;  3KX0 X;  2L0W A;  5HDC A;  4GW9 A;  3NOP C;  2O9B A;  5AJG A;  3OBF A;  3UE3 A;  2I9V A;  1X0O A;  4WEJ A;  2W1T A;  3R7W A;  4R70 A;  3F1N A;  3TRC A;  4B9O A;  3H9W A;  2HV1 A;  3LIA A;  3LI9 A;  4HQA A;  5HSQ A;  4EEP A;  2L4R A;  1GSV A;  3UE6 A;  4I38 A;  2VA0 A;  1ODV A;  4NEE D;  2PHY A;  4BJP A;  2J3W A;  1S66 L;  2NUT C;  3RH8 B;  1P97 A;  4HJ3 A;  2HJE A;  3C30 A;  2XA7 M;  3BQ8 A;  4HH3 A;  1OJG A;  4EU0 A;  4KUO A;  4EEU A;  2ZMV A;  2Y79 A;  3LFV A;  4UQI S;  3MF0 A;  3PBO A;  3R4K A;  5MC7 A;  3F1P B;  4EUV A;  4LLO B;  4WEL A;  4K08 A;  4HP4 A;  1KOU A;  4I39 A;  1G28 A;  1UWP X;  3K3D A;  3LR3 A;  3PBQ A;  1TS7 A;  4HJ6 A;  4GS9 A;  4GCZ A;  4AFI A;  3CLO A;  1W63 Q;  2A24 A;  1TS8 A;  3PXP A;  4HI4 A;  2D01 A;  5LBR A;  2Y8H A;  1ZTU A;  4HIA A;  4PKY G;  3C38 A;  3MQ0 A;  5CX7 A;  3P7N A;  4ARZ B;  4WLA A;  4KQD A;  3D72 A;  2JKT I;  4XT2 A;  2FH5 A;  4NXG A;  1MKM A;  2NUP C;  4II7 A;  4UQI M;  2W1R A;  1F5M A;  4Z1W A;  1OTE A;  3FC7 A;  2WKR A;  2GZA A;  3OLO A;  1DP9 A;  1F9I A;  1P0Z A;  4OOM A;  3LYX A;  1TS0 A;  1YSP A;  2JKR I;  4MN5 A;  2VEA A;  2QJ7 A;  3LIC A;  4PAU A;  2J3T C;  2W3E A;  3CI6 A;  2G7U A;  2Z6D A;  4JGO A;  2PYR A;  1T1A A;  1Y28 A;  4FOF A;  5G4Y A;  4L9G A;  3UME A;  2D02 A;  2W27 A;  4I3A A;  4Q0H A;  3MJQ A;  5DFX A;  5HDS A;  3T4O A;  5F6A A;  3ICY A;  3UMD A;  3IBR A;  3ZYT A;  3LIB A;  2KDK A;  4KQO A;  3T4S A;  2OAQ 1;  3O5Y A;  1MC0 A;  2CMN A;  4Q0J A;  4WUJ A;  4HJ4 A;  2W0N A;  2PD8 A;  4L9E A;  3K2N A;  3IS2 B;  2EWV A;  2J80 A;  2V0U A;  3CUE C;  3KYZ A;  5DJU A;  2O99 A;  1H3Q A;  4LRY C;  4H6J B;  1STZ A;  5DKK A;  3BWL A;  4HH2 A;  3ULF A;  3B33 A;  2JN7 A;  3EQV A;  3ZQ5 A;  3NHQ A;  1XJ6 A;  1OTI A;  2ZMF A;  3LID A;  3E4Q A;  5HD5 A;  1TS6 A;  1LL8 A;  5IT5 A;  3F1P A;  3PR6 A;  4HOI A;  4PKY A;  4BWI A;  3MXQ A;  4M4X A;  2PR5 A;  4LRZ E;  4WL9 A;  2M1C A;  3IBJ A;  4IUH A;  3T4J A;  5DF9 A;  3S7N A;  5HPI A;  5A8B A;  3S7Q A;  4WEK A;  1LSW A;  2L1M A;  5G4Z A;  3NJA A;  4LPZ A;  1D7E A;  1OTA A;  4ARZ A;  2MJ6 A;  4GJ4 A;  3T4L A;  3LIF A;  2O9A A;  4IHQ A;  1G6O A;  3EQU A;  4ZRR A;  5K5B A;  4ETZ A;  3H82 B;  4YNR A;  3A0V A;  3C8C A;  4CLC B;  2W3G A;  4WF0 A;  4BBT A;  1W63 M;  1XFN A;  4JGQ A;  3LI8 A;  4CLC C;  2VKS A;  3PBT A;  5HL6 A;  4DJ3 A;  4I3J A;  3E98 A;  2VGL S;  2VV6 A;  2A2L A;  2PD7 A;  3G6O A;  2KOI A;  3SW1 A;  1S67 L;  3OCL A;  3RFB A;  4HY8 A;  3LR4 A;  1H8M A;  2K7S A;  2QYB A;  1F98 A;  2P7J A;  2DMW A;  4IUK A;  1UWN X;  2V0W A;  3TJZ C;  4P6Z S;  2QJ5 A;  3PYP A;  3F1O B;  3K3C A;  4GHI B;  3FPV A;  1S4S A;  4MDZ A;  3TW8 A;  1NWZ A;  2J3T D;  3EWK A;  4FSF A;  2W3F A;  4R3A A;  4NKP A;  2W3H A;  2OWH A;  4L9F A;  3MQQ A;  3E4P A;  2B18 A;  2OWJ A;  3BJN A;  3LIE A;  3EGD C;  3CAX A;  2VGL M;  2VX8 A;  3CUE A;  3T50 A;  3T4Q A;  3D3O A;  2HF6 A;  2VLG A;  3BY9 A;  3VV4 A;  3OC2 A;  3A0S A;  3KSI A;  4H6J A;  1N9N A;  4BBV A;  2INW A;  1BYW A;  1NLZ A;  1T1C A;  3BY8 A;  4P6Z M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...