1JNUA

Photoexcited structure of the plant photoreceptor domain, phy3 lov2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
104
structure length
104
Chain Sequence
KSFVITDPRLPDNPIIFASDRFLELTEYTREEVLGNNCRFLQGRGTDRKAVQLIRDAVKEQRDVTVQVLNYTKGGRAFWNLFHLQVMRDENGDVQYFIGVQQEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Photoexcited structure of a plant photoreceptor domain reveals a light-driven molecular switch.
pubmed doi rcsb
source organism Adiantum capillus-veneris
molecule tags Signaling protein, electron transport
molecule keywords PHY3 PROTEIN
total genus 28
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1jnuA00
1OJ5A 2OOLA 1G28A 2ZOIA 4H6JB 1TS7A 1S66L 3H7WA 3ULFA 3VE4A 3PYPA 3LICA 2OWJA 5A8BA 3F1PB 4HJ6A 2L4RA 1VB6A 4I38A 4F3LB 1UWPX 2V9AA 3FG8A 5HWWA 4HP4A 4HJ4A 5DKLA 1DP9A 3GDIA 3MR0A 5DJUA 2PYRA 5TBMB 2VLGA 2WKQA 4NXGA 3MFXA 5G4ZA 4WUJA 3UMDA 4LPZA 3A0VA 1GSXA 2M1CA 2A24A 3LIAA 3HJKA 3NOUC 1XJ6A 3FC7A 2JN7A 3NOTC 4HIAA 5I5LA 3E4PA 2L1MA 4GCZA 5G4YA 1XFNA 4HH2A 2V1AA 2KDKA 3MQQA 5HDCA 1T19A 4EETB 2PYPA 3E4OA 5HWVA 2VEAA 1T1BA 3GECA 4I3IA 1S1YA 4NXFA 4YWZA 3H9WA 2QKPA 1GSVA 2ZOHA 1D06A 4DJ2A 3ZQ5A 5IS1A 2Z6DA 4EEUA 2PDRA 2A24B 4KQDA 2V0WA 3A0RA 4PKYG 4WL9A 5HWTA 4H6JA 2W0NA 4PKYA 4E04A 2QJ7A 5HSQA 4HQAA 4WLAA 1MZUA 5KIZA 3BY9A 1UGUA 3NHQA 4R3AA 2R78A 3LI8A 1T1AA 1ODVA 3MJQA 4GHIA 4BBVA 4BBUA 1NWZA 3EWKA 3NOPC 4GS9A 4LRYC 1S4RA 5F69A 1V9ZA 3D72A 1TS6A 2PD8A 2GJ3A 2CMNA 4HOIA 3H82B 2YKHA 5HD5A 3UB9A 3UE6A 4EESA 3CWFA 2D01A 5F5YA 3MXQA 3VE3A 1S67L 4DJ3A 1OTIA 3CAXA 3KX0X 4GHIB 4KUKA 4BBTA 2I9VA 1D7EA 1LSXA 1TS8A 1X0OA 2QJ5A 4GS9B 4L9GA 5F68A 3RTYA 1TS0A 3E4QA 1DRMA 1JNUA 4XT2B 1DP6A 4HP9A 3RH8B 1V9YA 3IBRA 4HH3A 3SW1A 3IS2B 4HJ3A 4M4XA 1OTEA 2QWSA 1F98A 4HNBA 4JGQA 3BY8A 3LYXA 3LIEA 2VV8A 1UWNX 2D02A 2V1BA 4NXBA 4WN5A 2VV6A 2W27A 2PR5A 2PHYA 4JGPA 3K3DA 1N9OA 1GSWA 1OT9A 2H28A 4LRZE 4I3AA 4MN5A 3T50A 1LL8A 1LT0A 2VV7A 3CLOA 5J3WA 3UB7A 4EERA 2BASA 1OTAA 3F1NA 4RQ9A 1P0ZA 4R70A 4EXOA 1KOUA 3H82A 4L9EA 2KX6A 5AVEA 5HDSA 4LLOB 2V0UA 1DP8A 3PHYA 3P7NA 3UB6A 1T18A 3C2WA 1OJGA 2ZBBA 3B33A 5AVFA 2PR6A 4I3JA 5EFWA 3F1PA 2L0WA 4F3LA 4MN6A 3BWLA 4XT2A 3F1NB 3C8CA 4KUOA 1S1ZA 5DJTA 1XJ3A 2WKRA 3K3CA 5HD3A 3IS2A 3LI9A 1T1CA 3LIFA 2K7SA 1S4SA 3LUQA 4HI4A 4R6LA 2P7JA 4WF0A 1XJ4A 5J7EA 4LRXC 4B9OA 2YKFA 4EQ1A 1LSVA 1WA9A 4JGOA 4L9FA 4EEPA 3HJIA 3UB8A 1EW0A 3A0SA 4GW9A 5IU1A 1XFQA 5TBMA 5DKKA 3F1OB 4I39A 1F9IA 1LSWA 2B02A 1OT6A 2JHEA 3LIBA 1N9NA 3NJAA 4JGRA 3G6OA 5F6AA 4EW7A 4NXEA 2OWHA 4K08A 5HZHA 4HHDA 1N9LA 3OLOA 5J4EA 2QHKA 1P97A 3ICYA 3LIDA 3H7WB 3VOLA 2WKPA 2Z6CA 1OTDA 5HDDA 2J80A 2EA9A 1Y28A 1XJ2A 3F1OA 3EEHA 1OTBA 3MQOA 4R38A 3UMEA 2HV1A 1BYWA 2PD7A 4I5SA 2INWA 4HY8A
chains in the Genus database with same CATH superfamily
4WZ4A 1TS7A 5FDHA 3P98A 5AQ7A 4QHCA 4HEFA 3BQAA 4ETXA 4KG2A 1KGEA 1SKOA 4OQIA 4GNUA 3VV4A 4OPRA 3SS3A 3H9WA 1G6AA 3O88A 5L8MA 3IXHA 1MWTA 1RGYA 4GHIA 1K55A 5FEGA 2ZMVA 3IF5A 4QD4A 3VE3A 3SS5A 3DWZA 4GS9B 4E04A 2FFFB 2XSSA 3KYQA 3G4PA 3TRCA 4OLGA 1M6KA 1RCJA 2Y2HA 3IBJA 1W79A 3F1NA 1GA0A 4OONA 4EV4A 5FI6A 1MBLA 4I3JA 2R9WA 4FCFA 5TJJA 4KUOA 2ZC6B 3BFGA 3LI9A 4CLCD 3BW6A 1S4SA 1VM1A 3OOVA 4LV3A 1MY8A 4WBGA 3UPNA 2Y91A 3T4TA 4D2OA 1EW0A 4L9FA 1GCEA 3IX3A 1K6RA 1PNEA 4NXEA 2OWHA 3LIDA 5E2HA 3H7WB 4C75A 1YLPA 3FWLA 2K31A 4GN2A 1ESUA 2P08A 4X55A 5GLDA 3ZVWA 1QMFA 4K91A 1NXYA 3VFHA 3WRZA 2B5RA 3E98A 3HLGA 3T4JA 1KGFA 1TDLA 1PYYA 5KSHA 1XJ6A 2JN7A 1PW1A 5I5LA 4HH2A 4OQ0A 5HL1A 2XROA 4RX2A 5HWVA 4R3BA 4DXCA 5CHJA 4N9LA 1H8YA 4EEUA 3CPTB 2B18A 2W0NA 4Z1WA 4CLCE 4E6WA 1MZUA 1UGUA 4R3AA 1MKMA 4P0MA 2UV0E 5HPIA 4HOIA 3GQZA 1D1JA 1MXOA 4KUKA 1VETB 2PAVP 2NUTC 1M40A 1OTEA 1UWNX 4O8GA 3K3DA 3MKFA 2WZXA 3ZVTA 3IXGA 5FEFA 3N7WA 3EEAA 4X56A 2BG1A 4ME4A 3KSIA 5DFXA 1LL5A 3F1NB 1KE4A 5HD3A 3LIFA 1T1CA 2K7SA 4S2KA 4WF0A 3HUMA 1XJ4A 3M2KA 1K54A 5C5KA 3HLDA 3O5YA 4JGRA 3NJAA 3T1QB 1Q2PA 2J3TC 1KVMA 4B93A 1K4EA 1NYMA 2H10A 1XJ2A 1H0MA 1OTBA 3BFFA 4I5SA 3R7WB 1I5QA 4ZDXA 4H6JB 1KGGA 1E3UA 2WK0A 3KSFA 1YPRA 4FSFA 3H7WA 3T4SA 4JXSA 1IEMA 3PYPA 4FH4A 4Q0IA 3WS4A 1DP9A 3T1XA 2HPBA 3UMDA 3NY4A 3WS5A 5A90A 3HJKA 4KQRA 3NOTC 5L07A 2EX6A 1SDNA 5G4YA 2BLSA 2VGKA 4YWZA 4X1MA 5IS1A 2Z6DA 4A5RA 1SKFA 4WYYA 2Y2GA 3HLWA 3R4KA 2CC1A 3NHQA 1CI9A 5GLBA 4BBUA 3VP1A 1W8QA 1DY6A 3MZFA 4C3QA 3SH9A 3H82B 4ID4A 4XUZA 3UB9A 1MWRA 1MKIA 3SW1A 4IVIA 3IF6A 2O9CA 2PR5A 2WADA 3L9KA 3KO6A 2ZLYA 4I3AA 4R1GA 4RA7A 4OPQA 2A49A 4ZRRA 3QP5A 4L9EA 5A93A 4OP8A 3PHYA 4MCWA 3BWLA 2HDSA 3BQ8A 3G31A 1XGIA 4P6BA 2VGJA 1K57C 5A91A 4DN0A 1LSWA 2MJ6A 2XDMA 2QHKA 1K56D 5MC7A 5HDDA 4OLDA 4OKPA 4HY8A 1G28A 2VK3A 1TD5A 4S2LA 3LCEA 2PU4A 5A8BA 2XLNA 1VB6A 2O0YA 4IJGA 1UWPX 1FR1A 3FG8A 4IVKA 2EWWA 2HF6A 3DW0A 4QPRA 5CERA 4OQGA 2ZQ7A 3WS2A 1BTLA 2XEPA 4KZ6A 4R23A 3SH7A 5EVID 4N92A 2I72A 4PM6A 4LRYC 2WAEA 4DE2A 2PD8A 2WKIA 4LV2A 2YKHA 2DRWA 3D3OA 1S67L 3A3IA 4KZ3A 4L9GA 1CEGA 2P9VB 5FL3A 1V9YA 1S0WA 3GSGA 4ARZB 2ZC3B 3SZTA 3TW8A 2JKTM 2VV6A 3NCKA 2PHYA 2IA2A 3UE3A 1RGZA 4E3MA 4LLOB 3WS1A 3ZG0A 5F82A 5FI2A 3LFVA 2X71A 5FQQA 2O99A 2PBDP 3MXSA 4KENB 3A3FA 5HAPA 3ZG7B 3MF0A 1F9IA 4WMCD 3G6OA 4JBFA 5FQ9A 3ICYA 3ITBA 1L0FA 4RX3A 2EFXA 2INWA 4BD1A 2JC7A 1SDEA 2OLVA 2EX2A 1PWGA 3UO9A 5DKLA 1ZG4A 1ZKJA 5CECA 3FC7A 3HLEA 1VQQA 2BTFP 3M6BA 5HDCA 3B42A 1T19A 2WZZA 1MWUA 3UDXA 2PDRA 4B88A 4MMNA 2QPNA 1P9RA 3N6IA 5F1GA 5AJGA 2OV5A 2VGLS 1ODVA 4OPYA 1NWZA 3EWKA 5F69A 2HDRA 2WGIA 2EX9A 1IYPA 2V8FA 1BSGA 5F5YA 2ZJ9A 1W7FA 1L2SA 4WELA 1PWCA 5L2FA 1K57A 3IWIA 4BBTA 4WZ5C 5M18A 1FQGA 5HL6A 4QB8A 5LBRA 3CPTA 5F83A 3UPPA 1W63M 1FSWA 1YQSA 3HUOA 2ZQCA 1IKGA 3IWOA 1JTGA 4X6TA 1LL8A 2H0YA 4LGWA 5AVEA 3B47A 5U47A 3V3RA 3HVFA 2WGWA 1IELA 4PAUA 4KG5A 2VX8A 3IH8A 4X68A 5CHMA 1J9MA 5FAPA 3VOYA 4EQ1A 4KQOA 4KQQA 3HCYA 5TBMA 4H8RA 1OT6A 2JHEA 4EW7A 2C6WB 4MBKA 2H5SA 1N4OA 3O3VA 1F5MA 5CXWA 5DTSA 1BYWA 1BZAA 2HP6A 4RYEA 1PI4A 3G2YA 5CGWA 3GVBA 3N8RA 1L0EA 2XF3A 4GD8A 5DJUA 3ZFZA 2V20A 4EBLA 4PM7A 2M1CA 3S7QA 3MFDA 2ZC5B 3GECA 1LI9A 1ES5A 1BULA 5HWTA 1XA1A 4H6JA 5CTMA 5IHVA 4FH2A 4KZAA 4B4ZA 4Y0OA 2EFUA 2CMNA 2KLIA 2Y2PA 4CPKA 2Q9MA 4IBXA 1TS8A 4XT2B 5HFOA 2UWXA 4HNBA 2Y59A 5AQAA 2W1TB 1L3LA 2GDNA 3KSHA 4JGPA 1N9OA 3Q7ZA 3UY6A 2P74A 2Y8HA 1NY0A 5CHUA 1OTAA 1KOUA 2ZC4B 3QP2A 3UB6A 2ZBBA 5EUAA 4BMWA 3F1PA 4HESA 5FASA 4HBTA 3C8CA 5DJTA 5FA7A 5TFQA 3TE8A 4S2OA 5E2FA 3EQVA 5CTNA 4S2MA 3HJIA 3M6HA 5EPHA 2X01A 5IU1A 1JWPA 3UMEA 2QYBA 3LIBA 4JF4A 3E2KA 1K56A 4DE1A 2QMIA 3PBOA 2WGVA 2JBFA 3DTKA 4XXRA 4ZAMA 2EXBA 3T1RA 4FOFA 1JTDA 4Y13A 2WGWB 3A3DA 2L4RA 1ONGA 1SZVA 4JLFA 5G18A 1YMSA 3MR0A 1K4FA 3EOIA 3LIAA 1N9BA 1VHMA 2PYPA 1T1BA 2Z2MB 1S1YA 2QKPA 4MBFA 3T1SA 2J3TD 2XH9A 5EECA 3V5MA 3QP6A 3MS6A 2HZ5A 4GJ4A 3C4OA 4GLQA 5CGSA 3JVVA 3Q1FA 3S7PA 1RP5A 4DJ3A 1JWZA 1JNUA 4E3IA 3VSLA 3NECA 4CJNA 1F98A 1BT5A 4ETZA 4NXBA 3NI9A 5HAIA 4KZ4A 5AQBA 1KE3A 2KOIA 3MKEA 1KDSA 4LCMA 1GSWA 3QHYA 5GLAA 3N4IA 2DMWA 3C2WA 4U3TA 1OJGA 4MLLA 4E6XA 5I94A 1Y54A 4MN6A 1KE0A 5HAQA 1XJ3A 3KSGA 4EBNA 4M3KA 5M1AA 4HI4A 1KDWA 2ACGA 2X02A 3OCLA 1AXBA 3C7UA 2WKHA 1MWSA 1O07A 1XFQA 1PFLA 2WYXA 3ZG5A 4S2PA 4WEJA 2J9OA 1SCWA 3F1OA 3B3XA 3ISGA 2ZOIA 3UB5P 1STZA 4O01A 1K38A 3BLSA 1KVLA 1YLJA 3KYZA 4HJ4A 4E3NA 4Z9QA 2EX8A 3VP4A 1JWVA 4EUZA 1PW8A 3LR0A 2EWVA 3Q7VB 2JKTI 1NZOA 4OH0A 5GL9A 1OPXA 5EVLA 2V0WA 5FQIA 3IX8A 3PBNA 3BRMA 4GS9A 4WZ5A 5EV0A 3LR3A 3U2AA 3EGDC 1DJAA 3W2ZA 3MXQA 5HPFA 5F68A 3RTYA 1NZUA 2M7UA 1AWIA 2Y4AA 3V3SA 2GX5A 4ZBEA 3UDIA 4JXGA 4N1XA 3D4FA 4O7DA 4UA6A 4OOYA 1H5XA 2WUQA 4R3JA 2FFYA 4Q8IA 3G35A 4E3JA 2VV7A 4P6ZM 3IH9A 4AFIA 2EXAA 1TF1A 1YLYA 2AVXA 2Y2IA 2IWCA 5JYPA 3R7WA 3K3CA 4EBPA 3IS2A 5TR7A 2P7JA 3SH8A 1LSVA 1I2WA 2JKFA 1HLUP 3FKVA 1L0GA 5DKKA 4Y7PA 2RL3A 3T12B 4LV1A 1DJBA 1E25A 4MN7A 2Y2OA 5EM1A 1Y28A 3EEHA 3VFFA 4P6ZS 2ZM2A 2HP9A 3GTCA 3IXDA 2Y55A 3MXRA 4HJ6A 2W3FA 2XFSA 2XD1A 5GHZA 5TBMB 2WKQA 3A3JA 4JF6A 4PPRA 3ZHHA 4BD0A 4EWFA 3LO7A 1E4DA 3E4PA 3JYIA 1DJCA 3HLBA 1P9WA 1W63Q 4C6YA 1CK3A 1GHPA 4DJ2A 3IF6B 3U4LP 3NDEA 4PHTA 1U60A 3BYDA 4DXBA 3CITA 3C4PA 1H3QA 3FZCA 3BY9A 2G7UA 3CI6A 3PR6A 1S4RA 1V9ZA 3D72A 4LFUA 1TS6A 1TDGA 3VP2A 4FUWA 4X53A 4KZ8A 1C3BA 3UDFA 1G6OA 1QMEA 4G3KA 4BJPA 1LLBA 3Q7VA 4WN5A 4GDBA 4UA9A 2PBYA 3VMAA 1ZC2A 3BFCA 4OQHA 1PZOA 1ZHHB 1PI5A 3S22A 4BLMA 3ZDJA 3QNBA 3ZNYA 3FYZA 4R70A 4NETA 5HDSA 1DP8A 3B33A 2L0WA 1NLZA 3D9YA 4XT2A 1S1ZA 3ITAA 1GHIA 5HW3A 3GV9A 3LUQA 1K0KA 1MC0A 5HARA 2VGLM 3VOZA 4DE3A 3UB8A 2Y2MA 3HUNA 5F6AA 5HZHA 4JPMA 2A3UA 2ZL1A 1IOUA 3TJZC 4BQMA 1O7EA 2C5WB 2M7VA 2GNXA 3C30A 3G2ZA 4GD6A 1BLSA 2PRFA 4UAAA 5BOHA 1XA7A 1WYBA 1SHVA 3S1YA 3ZCZA 1YLZA 1I2SA 2G2UA 5EOEA 4Y5FA 3DBAA 3WWXA 3O86A 4ESPA 2OAP1 1IYOA 5KMWA 1GHMA 4UHUA 1FILA 4MNRA 4HQAA 1Q2QA 4CQHA 2B95A 4DDSA 3OC2A 3NIAA 5K5BA 2WKEA 3UE6A 2D01A 4PM8A 4GHIB 2I9VA 1D7EA 1LSXA 5DVAA 1ERQA 5GHYA 3Q82A 1PIOA 4KZ7A 5HD5A 4P85A 3ZYTA 3CG5A 3QP1A 4X25A 2W3DA 2OLUA 4NK3A 4MN5A 3TG9A 4EXOA 4EU0A 4L0LA 1GA9A 1IKIA 3T4LA 1YMXA 3RXWA 5GLCA 2DCFA 2XD5A 4Y0UA 4EERA 2JCHA 4HHDA 1MPLA 3VOLA 1YSQA 1VEUB 2PD7A 2XGNA 4BENA 4LENA 2OOLA 3BM6A 5F1FA 3ULFA 5FATA 4X1LA 1CEFA 4NG2A 2P9VA 2V1ZA 4NXGA 4JXVA 3A0VA 2VKSA 3N8SA 2RCXA 2KDKA 3ZG9B 3DTMA 3RFBA 5EVIC 2XA7M 2VA0A 4PKYA 3JPUA 2OAQ1 5TGFA 2HDUA 2Y2KA 3NOPC 2W3EA 3PBQA 4UA7A 3CWFA 2FH5A 1SKOB 1OTIA 1J3WA 1X0OA 4PMAA 3E4QA 3RH8B 3SS4A 2J9PA 3SOIA 4HJ3A 1XX2A 1PZPA 4JGQA 2V1BA 1FIKA 4LV0A 4G3WA 3Q81A 4YNRA 3M2JA 3T50A 1LT0A 2QZ6A 5JYOA 3IHBA 4IHQA 2XR0A 1NRJA 4S2NA 3OPHA 2ZD8A 4S2IA 4GKUA 3ZGAB 4E3KA 3CZDA 2Q9NA 5EVIA 2ZMFA 1WA9A 1VETA 2ZQAA 5FQMA 3TOIA 1CI8A 5FI7A 3DWKA 2J3WA 3W4PA 2B02A 5FSRA 2W1RA 3LEZA 1TVFA 2WKPA 3GRJA 2Z6CA 1Y4OA 1Z6FA 3MSHA 3PTEA 3MQOA 4R38A 4ZJ1A 3T4QA 4JXWA 1W8YA 2ZM8A 4E3LA 3LICA 1EI5A 2JKRM 1YSPA 1XXMA 2V2FF 5G4ZA 4PM9A 3MQQA 3HL9A 3IQAA 4N1HA 4I3IA 4U0XA 1GSVA 1D06A 3ZQ5A 4KQDA 3A0RA 1YM1A 1VEUA 5FAOA 2QJ7A 3QP4A 4DF6A 1T1AA 3K2NA 3VP0A 4S2JA 1ZTUA 4BL3A 4K0XA 3S4XA 5E2GA 2HJEA 4ZJ2A 3UNWA 3PBTA 4EETB 1TS0A 4WEKA 1FCMA 1K54C 3BY8A 2VV8A 2D02A 4CLCB 5CEDA 2LB5A 4KG6A 2W27A 3S7NA 5J3WA 1TEMA 5CRFA 1LI0A 1T18A 3LEQA 4D60A 1L0DA 1IFQA 4Y15A 4BL2A 2XA7S 4LRXC 4P87A 3A0SA 1LHYA 2WAFA 3UE1A 4NEED 3CUEC 3G30A 2O9AA 4BWIA 3I7JA 1YAXA 4R0QA 3IWQA 3LI8A 3W4QA 1BLHA 5DTTA 4OOLA 3TSGA 4MBHA 1S66L 3AGEA 3C7VA 2IWBA 3GDIA 2VLGA 4QU3A 1GSXA 2K2NA 4HIAA 2FZ0A 5EVIB 4Y2FA 4GCZA 3NBLA 3PBSA 1XKZA 2PT7A 2Y2LA 3MBZA 5DF8A 1YLTA 2ZMAA 4WLAA 2R78A 5E2EA 3BFEA 2IWDA 3IXBA 4CLCC 1CQAA 4UEYA 3Q07A 4DDYA 2G2WA 3A3EA 1DRMA 4HP9A 5E43A 3LYXA 4R4SA 4MEZA 1ACFA 5EVEA 1ES2A 4X69A 3JVUA 1OT9A 2H28A 2NUPC 3FV7A 3AGDA 3UPOA 3DTEA 5KZHA 3C38A 1XPBA 4WM9A 4F3LA 4QWOA 3OCNA 1ESIA 3MZEA 3WRTA 2HJ9C 4OPZA 3QNCA 1K6SA 3E0YA 1A0KA 4JKTA 1FSYA 2LB9A 4I39A 5CEBA 2H0TA 1ALQA 4IBRA 1IYSA 3T4KA 2XQZA 4R4RA 2J80A 5L09A 2JE5A 3L7HA 3OPRA 5KSCA 1BLCA 4OVDA 4I38A 2JKGA 4HP4A 3MFXA 2A24A 4G3VA 3NOUC 1PWDA 2J8YA 2L1MA 4Y3IA 5FQKA 5DTKA 5CX7A 3CMZA 2XFTA 3FPWA 3G34A 2W3GA 1YT4A 5D3OA 3DTIA 2HDQA 1EROA 5KIZA 3W4OA 3W8KA 3MJQA 3RJUA 3MZDA 3N8LA 2GJ3A 4MDZA 4EESA 3BLMA 2PU2A 5A92A 2Y79A 2ZC7A 3KX0X 4YOFA 4WMCA 4UQIM 2V8CA 5IT5A 3IS2B 2QWSA 5FQJA 3IT9A 3T4OA 3LIEA 1Z09A 5DFYA 1HZOA 4GB7A 4S2NC 5FDSA 3GR2A 4DKIA 3CLOA 4DMZA 4II7A 1NYYA 4KZ9A 1S6RA 3H82A 2XRNA 2KX6A 3AGFA 3CJMA 5FAQA 3P7NA 5AVFA 3OBFA 4GZBA 5J8XA 2WKRA 4U0TA 1FCOA 2ZQDA 5L10A 3LR5A 3UN7A 1H8ZA 4E3OA 2YKFA 3GMWA 4JGOA 3OPPA 4UQIS 1H8MA 3S7OA 4QJGA 3F1OB 3C5AA 4K08A 4IUHA 3VSKA 3FPVA 3OLOA 3PAEA 1P97A 4Y17A 3PAGA 1K55C 4DRTA 1OTDA 2Y2NA 4KZBA 5AQ9A 1OJ5A 3LY4A 1ERMA 4DE0A 3VE4A 4B4XA 3PXPA 2Z2LB 1NLYA 3V39A 4F3LB 2V9AA 5HWWA 3OPLA 4WUJA 1YKDA 4GDNA 3IF6C 1XFNA 2V1AA 3HREA 2ZM0A 2VEAA 1XGJA 4NXFA 3IX4A 3BEBA 2ZOHA 4IUKA 2A24B 4PKYG 4WL9A 3BECA 1BLPA 1WYCA 3CUEA 3WS0A 4YINA 2E8IA 4PM5A 3IHAA 5M19A 4OP5A 1G5UA 4F94A 4EQIA 4N9KA 1NJ4A 4IEDA 3MMHA 3QP8A 3LGOA 1JVJA 1DP6A 3IBRA 4HH3A 1EWZA 2R9XA 2HP5A 3LR4A 5EE8A 4LRZE 1ES4A 4Y0TA 3UB7A 5DF9A 4RQ9A 1P0ZA 3PBRA 2W1TA 2J7VA 3EGXC 2V0UA 1YLWA 3HLCA 3UE0A 2OSUA 2HGVA 3MQ0A 4O0PA 3NULA 2Y2JA 3FKWA 4ARZA 4R6LA 4CLCA 1E3UD 5CGXA 5EOOA 4EEPA 3OZHA 4ZJ3A 4XUXA 5J7EA 1W5DA 5EM0A 4NKPA 5J4EA 1CF0A 4FD8A 4KZ5A 2EA9A 1ES3A 2ZQ8A 5HX9A 4Q0HA 2W3HA 2HV1A 1ZG6A 3BFDA 1OMEA 4FTXA 3NDGA 2GZAA 4JF5A 4QY6A 2OWJA 3F1PB 1HD8A 1XP4A 5GHXA 1PRQA 3BJNA 2PYRA 1NRFA 1ONHA 4LPZA 1FOFA 4GOGA 3KYEA 3E4OA 3ZG8B 2VZWA 1HTZA 1FR6A 1CJFA 4QY5A 1IYQA 5HSQA 4LCLA 4RVAA 4BBVA 2ZQ9A 5DF7A 3V67A 3P09A 1F2KA 3VP3A 3CAXA 3O87A 3HLFA 3RXXA 3HBRA 1LL9A 2E8JA 4M4XA 3LY3A 4K0WA 3CHWP 2DNSA 2JKRI 4HBUA 1WE4A 2VJWA 2P04A 4OOMA 2ZL1B 3P01A 2BASA 1K25A 1FCNA 2A2LA 3E2LA 3G32A 2PR6A 5EFWA 1BUEA 2Y2QA 3DAVA 4YFMA 3V50A 1G68A 4Q0JA 2Q0OA 3ZNTA 4B9OA 3EQUA 4GW9A 1N9NA 1HVBA 4ZTKA 1N9LA 4EUVA 2O9BA 3NC8A 2XK1A 2QJ5A
chains in the Genus database with same CATH topology
1TS7A 4OOLA 1S66L 4HJ6A 2W3FA 3BQAA 5DKLA 4ETXA 3GDIA 5TBMB 2VLGA 2WKQA 1GSXA 2K2NA 3FC7A 4HIAA 2FZ0A 3E4PA 4Y2FA 4GCZA 5HDCA 3PBSA 3B42A 1T19A 2PT7A 1P9WA 1W63Q 3VV4A 3H9WA 4DJ2A 2PDRA 4MMNA 1P9RA 4PHTA 5AJGA 3CITA 5L8MA 1H3QA 2VGLS 4WLAA 3BY9A 2G7UA 3CI6A 2R78A 3PR6A 1ODVA 4GHIA 1NWZA 3EWKA 5F69A 1S4RA 1V9ZA 3D72A 1TS6A 2ZMVA 4CLCC 5F5YA 3VE3A 4UEYA 4WELA 4GS9B 4E04A 1G6OA 4BBTA 1DRMA 2XSSA 3KYQA 4HP9A 5HL6A 4G3KA 4BJPA 3LYXA 5LBRA 4WN5A 3TRCA 1W63M 3JVUA 1ZHHB 1OT9A 2H28A 2NUPC 1LL8A 3IBJA 3F1NA 4R70A 3C38A 5HDSA 5AVEA 3B47A 1DP8A 3B33A 4I3JA 4PAUA 2L0WA 4F3LA 1NLZA 3OCNA 2VX8A 4XT2A 5TJJA 4KUOA 1S1ZA 2HJ9C 3LI9A 4CLCD 3BW6A 1S4SA 3LUQA 3OOVA 1MC0A 2VGLM 4EQ1A 3E0YA 4KQOA 3T4TA 3HCYA 3UB8A 1EW0A 5TBMA 2LB9A 4I39A 4L9FA 1OT6A 2JHEA 4EW7A 5F6AA 4NXEA 2OWHA 5HZHA 3LIDA 3H7WB 1F5MA 3T4KA 2J80A 2K31A 1IOUA 3TJZC 1BYWA 2P08A 2M7VA 2GNXA 3C30A 4I38A 4HP4A 3E98A 3T4JA 5DJUA 3MFXA 2M1CA 2A24A 4G3VA 3NOUC 5KSHA 1XJ6A 2JN7A 3S7QA 5I5LA 2L1MA 4HH2A 2XROA 5HWVA 4Y3IA 3GECA 4Y5FA 3DBAA 5CX7A 4EEUA 3FPWA 2W3GA 2OAP1 2B18A 5HWTA 4H6JA 2W0NA 4Z1WA 4CLCE 4HQAA 5KIZA 1MZUA 4CQHA 1UGUA 4R3AA 3MJQA 3OC2A 1MKMA 2GJ3A 2CMNA 5K5BA 5HPIA 4HOIA 3UE6A 4MDZA 4EESA 2D01A 2KLIA 2Y79A 3KX0X 4GHIB 4KUKA 2I9VA 1D7EA 1LSXA 1TS8A 4YOFA 4UQIM 4XT2B 5IT5A 3IS2B 2NUTC 1OTEA 2QWSA 4HNBA 5HD5A 3T4OA 3LIEA 3ZYTA 1UWNX 4O8GA 2W1TB 3KSHA 4JGPA 3K3DA 5DFYA 1N9OA 2W3DA 4MN5A 2Y8HA 3CLOA 4DMZA 4II7A 1OTAA 3EEAA 4EXOA 1KOUA 3H82A 2XRNA 2KX6A 4ME4A 4EU0A 3KSIA 3P7NA 3UB6A 4L0LA 2ZBBA 4BMWA 5AVFA 3OBFA 5DFXA 3F1PA 3F1NB 3C8CA 5DJTA 2WKRA 5HD3A 3TE8A 3LIFA 1T1CA 2K7SA 3T4LA 3LR5A 4WF0A 3EQVA 1XJ4A 2YKFA 4JGOA 4UQIS 3HJIA 5IU1A 5C5KA 1H8MA 3S7OA 3O5YA 3F1OB 4JGRA 3UMEA 2QYBA 4EERA 3NJAA 3LIBA 4K08A 4IUHA 2J3TC 4HHDA 3FPVA 3OLOA 4B93A 1P97A 3VOLA 1YSQA 1OTDA 3PBOA 1XJ2A 1OTBA 2PD7A 4I5SA 3R7WB 1OJ5A 2OOLA 4FOFA 4H6JB 3T4SA 3KSFA 4FSFA 3H7WA 3ULFA 3VE4A 3PXPA 1NLYA 3PYPA 2L4RA 4F3LB 2V9AA 5HWWA 4Q0IA 1DP9A 3MR0A 3UMDA 4NXGA 4WUJA 1YKDA 3A0VA 3EOIA 2VKSA 3LIAA 3HJKA 3NOTC 5G4YA 1XFNA 2V1AA 2KDKA 1VHMA 2PYPA 2VEAA 1T1BA 4NXFA 1S1YA 4YWZA 2QKPA 5IS1A 2ZOHA 4IUKA 2Z6DA 2A24B 4PKYG 4WL9A 3RFBA 2J3TD 2XA7M 2VA0A 4PKYA 3CUEA 2OAQ1 3R4KA 3NHQA 4BBUA 3NOPC 4GJ4A 2W3EA 4GLQA 3PBQA 3H82B 3JVVA 3CWFA 3S7PA 2FH5A 4DJ3A 1OTIA 1X0OA 2QJ5A 3MMHA 3UB9A 3E4QA 3RH8B 1JNUA 1DP6A 3IBRA 4HH3A 3SW1A 4HJ3A 1F98A 4JGQA 4ETZA 4NXBA 2V1BA 3LR4A 2O9CA 2PR5A 2KOIA 4G3WA 1GSWA 3KO6A 4YNRA 4LRZE 4I3AA 3T50A 1LT0A 3UB7A 5DF9A 4RQ9A 1P0ZA 3PBRA 4IHQA 2DMWA 4ZRRA 1NRJA 2W1TA 3EGXC 4L9EA 2V0UA 3PHYA 3C2WA 4MCWA 1OJGA 4MN6A 2HGVA 3BWLA 3MQ0A 3BQ8A 4O0PA 1XJ3A 3KSGA 4ARZA 4HI4A 4R6LA 4CLCA 3OCLA 2ZMFA 1WA9A 4EEPA 1XFQA 2J3WA 4DN0A 1LSWA 2B02A 5J7EA 2W1RA 2MJ6A 4NKPA 5J4EA 2QHKA 5MC7A 2WKPA 4WEJA 2Z6CA 5HDDA 2EA9A 3F1OA 4Q0HA 3MQOA 2W3HA 4R38A 2HV1A 3T4QA 4HY8A 2ZOIA 1G28A 1TD5A 1STZA 2GZAA 4O01A 3LICA 2OWJA 5A8BA 3F1PB 1VB6A 2O0YA 4IJGA 1UWPX 3FG8A 2JKRM 3KYZA 1YSPA 4HJ4A 3BJNA 2EWWA 2PYRA 5G4ZA 2HF6A 4LPZA 4QPRA 3LR0A 2EWVA 3MQQA 3E4OA 2JKTI 4I3IA 2VZWA 1GSVA 1D06A 3ZQ5A 4KQDA 1OPXA 2V0WA 3A0RA 3PBNA 2QJ7A 5HSQA 1T1AA 4BBVA 4GS9A 4LRYC 3K2NA 3V67A 1ZTUA 3LR3A 2PD8A 3EGDC 3U2AA 2YKHA 3D3OA 3W2ZA 3MXQA 5HPFA 1S67L 2HJEA 3CAXA 3PBTA 5F68A 4L9GA 3RTYA 4EETB 1TS0A 2M7UA 5FL3A 4WEKA 1V9YA 4M4XA 2GX5A 4ARZB 3BY8A 2JKRI 2VV8A 2D02A 4CLCB 2LB5A 3TW8A 2JKTM 2VV6A 2W27A 2PHYA 2VJWA 2P04A 4OOMA 3S7NA 2VV7A 4P6ZM 5J3WA 3P01A 2BASA 2IA2A 4AFIA 3UE3A 1TF1A 2A2LA 4LLOB 1T18A 2PR6A 3R7WA 5EFWA 3LFVA 2O99A 1IFQA 3K3CA 3IS2A 2XA7S 4Q0JA 2P7JA 4LRXC 4B9OA 1LSVA 3EQUA 3A0SA 4GW9A 3MF0A 5DKKA 1F9IA 1N9NA 4NEED 3G6OA 3CUEC 1N9LA 4EUVA 2O9BA 3ICYA 2O9AA 4BWIA 4MN7A 1YAXA 1Y28A 3EEHA 4P6ZS 3LI8A 2INWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OJ5 A;  2OOL A;  1G28 A;  2ZOI A;  4H6J B;  1TS7 A;  1S66 L;  3H7W A;  3ULF A;  3VE4 A;  3PYP A;  3LIC A;  2OWJ A;  5A8B A;  3F1P B;  4HJ6 A;  2L4R A;  1VB6 A;  4I38 A;  4F3L B;  1UWP X;  2V9A A;  3FG8 A;  5HWW A;  4HP4 A;  4HJ4 A;  5DKL A;  1DP9 A;  3GDI A;  3MR0 A;  5DJU A;  2PYR A;  5TBM B;  2VLG A;  2WKQ A;  4NXG A;  3MFX A;  5G4Z A;  4WUJ A;  3UMD A;  4LPZ A;  3A0V A;  1GSX A;  2M1C A;  2A24 A;  3LIA A;  3HJK A;  3NOU C;  1XJ6 A;  3FC7 A;  2JN7 A;  3NOT C;  4HIA A;  5I5L A;  3E4P A;  2L1M A;  4GCZ A;  5G4Y A;  1XFN A;  4HH2 A;  2V1A A;  2KDK A;  3MQQ A;  5HDC A;  1T19 A;  4EET B;  2PYP A;  3E4O A;  5HWV A;  2VEA A;  1T1B A;  3GEC A;  4I3I A;  1S1Y A;  4NXF A;  4YWZ A;  3H9W A;  2QKP A;  1GSV A;  2ZOH A;  1D06 A;  4DJ2 A;  3ZQ5 A;  5IS1 A;  2Z6D A;  4EEU A;  2PDR A;  2A24 B;  4KQD A;  2V0W A;  3A0R A;  4PKY G;  4WL9 A;  5HWT A;  4H6J A;  2W0N A;  4PKY A;  4E04 A;  2QJ7 A;  5HSQ A;  4HQA A;  4WLA A;  1MZU A;  5KIZ A;  3BY9 A;  1UGU A;  3NHQ A;  4R3A A;  2R78 A;  3LI8 A;  1T1A A;  1ODV A;  3MJQ A;  4GHI A;  4BBV A;  4BBU A;  1NWZ A;  3EWK A;  3NOP C;  4GS9 A;  4LRY C;  1S4R A;  5F69 A;  1V9Z A;  3D72 A;  1TS6 A;  2PD8 A;  2GJ3 A;  2CMN A;  4HOI A;  3H82 B;  2YKH A;  5HD5 A;  3UB9 A;  3UE6 A;  4EES A;  3CWF A;  2D01 A;  5F5Y A;  3MXQ A;  3VE3 A;  1S67 L;  4DJ3 A;  1OTI A;  3CAX A;  3KX0 X;  4GHI B;  4KUK A;  4BBT A;  2I9V A;  1D7E A;  1LSX A;  1TS8 A;  1X0O A;  2QJ5 A;  4GS9 B;  4L9G A;  5F68 A;  3RTY A;  1TS0 A;  3E4Q A;  1DRM A;  1JNU A;  4XT2 B;  1DP6 A;  4HP9 A;  3RH8 B;  1V9Y A;  3IBR A;  4HH3 A;  3SW1 A;  3IS2 B;  4HJ3 A;  4M4X A;  1OTE A;  2QWS A;  1F98 A;  4HNB A;  4JGQ A;  3BY8 A;  3LYX A;  3LIE A;  2VV8 A;  1UWN X;  2D02 A;  2V1B A;  4NXB A;  4WN5 A;  2VV6 A;  2W27 A;  2PR5 A;  2PHY A;  4JGP A;  3K3D A;  1N9O A;  1GSW A;  1OT9 A;  2H28 A;  4LRZ E;  4I3A A;  4MN5 A;  3T50 A;  1LL8 A;  1LT0 A;  2VV7 A;  3CLO A;  5J3W A;  3UB7 A;  4EER A;  2BAS A;  1OTA A;  3F1N A;  4RQ9 A;  1P0Z A;  4R70 A;  4EXO A;  1KOU A;  3H82 A;  4L9E A;  2KX6 A;  5AVE A;  5HDS A;  4LLO B;  2V0U A;  1DP8 A;  3PHY A;  3P7N A;  3UB6 A;  1T18 A;  3C2W A;  1OJG A;  2ZBB A;  3B33 A;  5AVF A;  2PR6 A;  4I3J A;  5EFW A;  3F1P A;  2L0W A;  4F3L A;  4MN6 A;  3BWL A;  4XT2 A;  3F1N B;  3C8C A;  4KUO A;  1S1Z A;  5DJT A;  1XJ3 A;  2WKR A;  3K3C A;  5HD3 A;  3IS2 A;  3LI9 A;  1T1C A;  3LIF A;  2K7S A;  1S4S A;  3LUQ A;  4HI4 A;  4R6L A;  2P7J A;  4WF0 A;  1XJ4 A;  5J7E A;  4LRX C;  4B9O A;  2YKF A;  4EQ1 A;  1LSV A;  1WA9 A;  4JGO A;  4L9F A;  4EEP A;  3HJI A;  3UB8 A;  1EW0 A;  3A0S A;  4GW9 A;  5IU1 A;  1XFQ A;  5TBM A;  5DKK A;  3F1O B;  4I39 A;  1F9I A;  1LSW A;  2B02 A;  1OT6 A;  2JHE A;  3LIB A;  1N9N A;  3NJA A;  4JGR A;  3G6O A;  5F6A A;  4EW7 A;  4NXE A;  2OWH A;  4K08 A;  5HZH A;  4HHD A;  1N9L A;  3OLO A;  5J4E A;  2QHK A;  1P97 A;  3ICY A;  3LID A;  3H7W B;  3VOL A;  2WKP A;  2Z6C A;  1OTD A;  5HDD A;  2J80 A;  2EA9 A;  1Y28 A;  1XJ2 A;  3F1O A;  3EEH A;  1OTB A;  3MQO A;  4R38 A;  3UME A;  2HV1 A;  1BYW A;  2PD7 A;  4I5S A;  2INW A;  4HY8 A; 
#chains in the Genus database with same CATH topology
 4WZ4 A;  1TS7 A;  5FDH A;  3P98 A;  5AQ7 A;  4QHC A;  4HEF A;  3BQA A;  4ETX A;  4KG2 A;  1KGE A;  1SKO A;  4OQI A;  4GNU A;  3VV4 A;  4OPR A;  3SS3 A;  3H9W A;  1G6A A;  3O88 A;  5L8M A;  3IXH A;  1MWT A;  1RGY A;  4GHI A;  1K55 A;  5FEG A;  2ZMV A;  3IF5 A;  4QD4 A;  3VE3 A;  3SS5 A;  3DWZ A;  4GS9 B;  4E04 A;  2FFF B;  2XSS A;  3KYQ A;  3G4P A;  3TRC A;  4OLG A;  1M6K A;  1RCJ A;  2Y2H A;  3IBJ A;  1W79 A;  3F1N A;  1GA0 A;  4OON A;  4EV4 A;  5FI6 A;  1MBL A;  4I3J A;  2R9W A;  4FCF A;  5TJJ A;  4KUO A;  2ZC6 B;  3BFG A;  3LI9 A;  4CLC D;  3BW6 A;  1S4S A;  1VM1 A;  3OOV A;  4LV3 A;  1MY8 A;  4WBG A;  3UPN A;  2Y91 A;  3T4T A;  4D2O A;  1EW0 A;  4L9F A;  1GCE A;  3IX3 A;  1K6R A;  1PNE A;  4NXE A;  2OWH A;  3LID A;  5E2H A;  3H7W B;  4C75 A;  1YLP A;  3FWL A;  2K31 A;  4GN2 A;  1ESU A;  2P08 A;  4X55 A;  5GLD A;  3ZVW A;  1QMF A;  4K91 A;  1NXY A;  3VFH A;  3WRZ A;  2B5R A;  3E98 A;  3HLG A;  3T4J A;  1KGF A;  1TDL A;  1PYY A;  5KSH A;  1XJ6 A;  2JN7 A;  1PW1 A;  5I5L A;  4HH2 A;  4OQ0 A;  5HL1 A;  2XRO A;  4RX2 A;  5HWV A;  4R3B A;  4DXC A;  5CHJ A;  4N9L A;  1H8Y A;  4EEU A;  3CPT B;  2B18 A;  2W0N A;  4Z1W A;  4CLC E;  4E6W A;  1MZU A;  1UGU A;  4R3A A;  1MKM A;  4P0M A;  2UV0 E;  5HPI A;  4HOI A;  3GQZ A;  1D1J A;  1MXO A;  4KUK A;  1VET B;  2PAV P;  2NUT C;  1M40 A;  1OTE A;  1UWN X;  4O8G A;  3K3D A;  3MKF A;  2WZX A;  3ZVT A;  3IXG A;  5FEF A;  3N7W A;  3EEA A;  4X56 A;  2BG1 A;  4ME4 A;  3KSI A;  5DFX A;  1LL5 A;  3F1N B;  1KE4 A;  5HD3 A;  3LIF A;  1T1C A;  2K7S A;  4S2K A;  4WF0 A;  3HUM A;  1XJ4 A;  3M2K A;  1K54 A;  5C5K A;  3HLD A;  3O5Y A;  4JGR A;  3NJA A;  3T1Q B;  1Q2P A;  2J3T C;  1KVM A;  4B93 A;  1K4E A;  1NYM A;  2H10 A;  1XJ2 A;  1H0M A;  1OTB A;  3BFF A;  4I5S A;  3R7W B;  1I5Q A;  4ZDX A;  4H6J B;  1KGG A;  1E3U A;  2WK0 A;  3KSF A;  1YPR A;  4FSF A;  3H7W A;  3T4S A;  4JXS A;  1IEM A;  3PYP A;  4FH4 A;  4Q0I A;  3WS4 A;  1DP9 A;  3T1X A;  2HPB A;  3UMD A;  3NY4 A;  3WS5 A;  5A90 A;  3HJK A;  4KQR A;  3NOT C;  5L07 A;  2EX6 A;  1SDN A;  5G4Y A;  2BLS A;  2VGK A;  4YWZ A;  4X1M A;  5IS1 A;  2Z6D A;  4A5R A;  1SKF A;  4WYY A;  2Y2G A;  3HLW A;  3R4K A;  2CC1 A;  3NHQ A;  1CI9 A;  5GLB A;  4BBU A;  3VP1 A;  1W8Q A;  1DY6 A;  3MZF A;  4C3Q A;  3SH9 A;  3H82 B;  4ID4 A;  4XUZ A;  3UB9 A;  1MWR A;  1MKI A;  3SW1 A;  4IVI A;  3IF6 A;  2O9C A;  2PR5 A;  2WAD A;  3L9K A;  3KO6 A;  2ZLY A;  4I3A A;  4R1G A;  4RA7 A;  4OPQ A;  2A49 A;  4ZRR A;  3QP5 A;  4L9E A;  5A93 A;  4OP8 A;  3PHY A;  4MCW A;  3BWL A;  2HDS A;  3BQ8 A;  3G31 A;  1XGI A;  4P6B A;  2VGJ A;  1K57 C;  5A91 A;  4DN0 A;  1LSW A;  2MJ6 A;  2XDM A;  2QHK A;  1K56 D;  5MC7 A;  5HDD A;  4OLD A;  4OKP A;  4HY8 A;  1G28 A;  2VK3 A;  1TD5 A;  4S2L A;  3LCE A;  2PU4 A;  5A8B A;  2XLN A;  1VB6 A;  2O0Y A;  4IJG A;  1UWP X;  1FR1 A;  3FG8 A;  4IVK A;  2EWW A;  2HF6 A;  3DW0 A;  4QPR A;  5CER A;  4OQG A;  2ZQ7 A;  3WS2 A;  1BTL A;  2XEP A;  4KZ6 A;  4R23 A;  3SH7 A;  5EVI D;  4N92 A;  2I72 A;  4PM6 A;  4LRY C;  2WAE A;  4DE2 A;  2PD8 A;  2WKI A;  4LV2 A;  2YKH A;  2DRW A;  3D3O A;  1S67 L;  3A3I A;  4KZ3 A;  4L9G A;  1CEG A;  2P9V B;  5FL3 A;  1V9Y A;  1S0W A;  3GSG A;  4ARZ B;  2ZC3 B;  3SZT A;  3TW8 A;  2JKT M;  2VV6 A;  3NCK A;  2PHY A;  2IA2 A;  3UE3 A;  1RGZ A;  4E3M A;  4LLO B;  3WS1 A;  3ZG0 A;  5F82 A;  5FI2 A;  3LFV A;  2X71 A;  5FQQ A;  2O99 A;  2PBD P;  3MXS A;  4KEN B;  3A3F A;  5HAP A;  3ZG7 B;  3MF0 A;  1F9I A;  4WMC D;  3G6O A;  4JBF A;  5FQ9 A;  3ICY A;  3ITB A;  1L0F A;  4RX3 A;  2EFX A;  2INW A;  4BD1 A;  2JC7 A;  1SDE A;  2OLV A;  2EX2 A;  1PWG A;  3UO9 A;  5DKL A;  1ZG4 A;  1ZKJ A;  5CEC A;  3FC7 A;  3HLE A;  1VQQ A;  2BTF P;  3M6B A;  5HDC A;  3B42 A;  1T19 A;  2WZZ A;  1MWU A;  3UDX A;  2PDR A;  4B88 A;  4MMN A;  2QPN A;  1P9R A;  3N6I A;  5F1G A;  5AJG A;  2OV5 A;  2VGL S;  1ODV A;  4OPY A;  1NWZ A;  3EWK A;  5F69 A;  2HDR A;  2WGI A;  2EX9 A;  1IYP A;  2V8F A;  1BSG A;  5F5Y A;  2ZJ9 A;  1W7F A;  1L2S A;  4WEL A;  1PWC A;  5L2F A;  1K57 A;  3IWI A;  4BBT A;  4WZ5 C;  5M18 A;  1FQG A;  5HL6 A;  4QB8 A;  5LBR A;  3CPT A;  5F83 A;  3UPP A;  1W63 M;  1FSW A;  1YQS A;  3HUO A;  2ZQC A;  1IKG A;  3IWO A;  1JTG A;  4X6T A;  1LL8 A;  2H0Y A;  4LGW A;  5AVE A;  3B47 A;  5U47 A;  3V3R A;  3HVF A;  2WGW A;  1IEL A;  4PAU A;  4KG5 A;  2VX8 A;  3IH8 A;  4X68 A;  5CHM A;  1J9M A;  5FAP A;  3VOY A;  4EQ1 A;  4KQO A;  4KQQ A;  3HCY A;  5TBM A;  4H8R A;  1OT6 A;  2JHE A;  4EW7 A;  2C6W B;  4MBK A;  2H5S A;  1N4O A;  3O3V A;  1F5M A;  5CXW A;  5DTS A;  1BYW A;  1BZA A;  2HP6 A;  4RYE A;  1PI4 A;  3G2Y A;  5CGW A;  3GVB A;  3N8R A;  1L0E A;  2XF3 A;  4GD8 A;  5DJU A;  3ZFZ A;  2V20 A;  4EBL A;  4PM7 A;  2M1C A;  3S7Q A;  3MFD A;  2ZC5 B;  3GEC A;  1LI9 A;  1ES5 A;  1BUL A;  5HWT A;  1XA1 A;  4H6J A;  5CTM A;  5IHV A;  4FH2 A;  4KZA A;  4B4Z A;  4Y0O A;  2EFU A;  2CMN A;  2KLI A;  2Y2P A;  4CPK A;  2Q9M A;  4IBX A;  1TS8 A;  4XT2 B;  5HFO A;  2UWX A;  4HNB A;  2Y59 A;  5AQA A;  2W1T B;  1L3L A;  2GDN A;  3KSH A;  4JGP A;  1N9O A;  3Q7Z A;  3UY6 A;  2P74 A;  2Y8H A;  1NY0 A;  5CHU A;  1OTA A;  1KOU A;  2ZC4 B;  3QP2 A;  3UB6 A;  2ZBB A;  5EUA A;  4BMW A;  3F1P A;  4HES A;  5FAS A;  4HBT A;  3C8C A;  5DJT A;  5FA7 A;  5TFQ A;  3TE8 A;  4S2O A;  5E2F A;  3EQV A;  5CTN A;  4S2M A;  3HJI A;  3M6H A;  5EPH A;  2X01 A;  5IU1 A;  1JWP A;  3UME A;  2QYB A;  3LIB A;  4JF4 A;  3E2K A;  1K56 A;  4DE1 A;  2QMI A;  3PBO A;  2WGV A;  2JBF A;  3DTK A;  4XXR A;  4ZAM A;  2EXB A;  3T1R A;  4FOF A;  1JTD A;  4Y13 A;  2WGW B;  3A3D A;  2L4R A;  1ONG A;  1SZV A;  4JLF A;  5G18 A;  1YMS A;  3MR0 A;  1K4F A;  3EOI A;  3LIA A;  1N9B A;  1VHM A;  2PYP A;  1T1B A;  2Z2M B;  1S1Y A;  2QKP A;  4MBF A;  3T1S A;  2J3T D;  2XH9 A;  5EEC A;  3V5M A;  3QP6 A;  3MS6 A;  2HZ5 A;  4GJ4 A;  3C4O A;  4GLQ A;  5CGS A;  3JVV A;  3Q1F A;  3S7P A;  1RP5 A;  4DJ3 A;  1JWZ A;  1JNU A;  4E3I A;  3VSL A;  3NEC A;  4CJN A;  1F98 A;  1BT5 A;  4ETZ A;  4NXB A;  3NI9 A;  5HAI A;  4KZ4 A;  5AQB A;  1KE3 A;  2KOI A;  3MKE A;  1KDS A;  4LCM A;  1GSW A;  3QHY A;  5GLA A;  3N4I A;  2DMW A;  3C2W A;  4U3T A;  1OJG A;  4MLL A;  4E6X A;  5I94 A;  1Y54 A;  4MN6 A;  1KE0 A;  5HAQ A;  1XJ3 A;  3KSG A;  4EBN A;  4M3K A;  5M1A A;  4HI4 A;  1KDW A;  2ACG A;  2X02 A;  3OCL A;  1AXB A;  3C7U A;  2WKH A;  1MWS A;  1O07 A;  1XFQ A;  1PFL A;  2WYX A;  3ZG5 A;  4S2P A;  4WEJ A;  2J9O A;  1SCW A;  3F1O A;  3B3X A;  3ISG A;  2ZOI A;  3UB5 P;  1STZ A;  4O01 A;  1K38 A;  3BLS A;  1KVL A;  1YLJ A;  3KYZ A;  4HJ4 A;  4E3N A;  4Z9Q A;  2EX8 A;  3VP4 A;  1JWV A;  4EUZ A;  1PW8 A;  3LR0 A;  2EWV A;  3Q7V B;  2JKT I;  1NZO A;  4OH0 A;  5GL9 A;  1OPX A;  5EVL A;  2V0W A;  5FQI A;  3IX8 A;  3PBN A;  3BRM A;  4GS9 A;  4WZ5 A;  5EV0 A;  3LR3 A;  3U2A A;  3EGD C;  1DJA A;  3W2Z A;  3MXQ A;  5HPF A;  5F68 A;  3RTY A;  1NZU A;  2M7U A;  1AWI A;  2Y4A A;  3V3S A;  2GX5 A;  4ZBE A;  3UDI A;  4JXG A;  4N1X A;  3D4F A;  4O7D A;  4UA6 A;  4OOY A;  1H5X A;  2WUQ A;  4R3J A;  2FFY A;  4Q8I A;  3G35 A;  4E3J A;  2VV7 A;  4P6Z M;  3IH9 A;  4AFI A;  2EXA A;  1TF1 A;  1YLY A;  2AVX A;  2Y2I A;  2IWC A;  5JYP A;  3R7W A;  3K3C A;  4EBP A;  3IS2 A;  5TR7 A;  2P7J A;  3SH8 A;  1LSV A;  1I2W A;  2JKF A;  1HLU P;  3FKV A;  1L0G A;  5DKK A;  4Y7P A;  2RL3 A;  3T12 B;  4LV1 A;  1DJB A;  1E25 A;  4MN7 A;  2Y2O A;  5EM1 A;  1Y28 A;  3EEH A;  3VFF A;  4P6Z S;  2ZM2 A;  2HP9 A;  3GTC A;  3IXD A;  2Y55 A;  3MXR A;  4HJ6 A;  2W3F A;  2XFS A;  2XD1 A;  5GHZ A;  5TBM B;  2WKQ A;  3A3J A;  4JF6 A;  4PPR A;  3ZHH A;  4BD0 A;  4EWF A;  3LO7 A;  1E4D A;  3E4P A;  3JYI A;  1DJC A;  3HLB A;  1P9W A;  1W63 Q;  4C6Y A;  1CK3 A;  1GHP A;  4DJ2 A;  3IF6 B;  3U4L P;  3NDE A;  4PHT A;  1U60 A;  3BYD A;  4DXB A;  3CIT A;  3C4P A;  1H3Q A;  3FZC A;  3BY9 A;  2G7U A;  3CI6 A;  3PR6 A;  1S4R A;  1V9Z A;  3D72 A;  4LFU A;  1TS6 A;  1TDG A;  3VP2 A;  4FUW A;  4X53 A;  4KZ8 A;  1C3B A;  3UDF A;  1G6O A;  1QME A;  4G3K A;  4BJP A;  1LLB A;  3Q7V A;  4WN5 A;  4GDB A;  4UA9 A;  2PBY A;  3VMA A;  1ZC2 A;  3BFC A;  4OQH A;  1PZO A;  1ZHH B;  1PI5 A;  3S22 A;  4BLM A;  3ZDJ A;  3QNB A;  3ZNY A;  3FYZ A;  4R70 A;  4NET A;  5HDS A;  1DP8 A;  3B33 A;  2L0W A;  1NLZ A;  3D9Y A;  4XT2 A;  1S1Z A;  3ITA A;  1GHI A;  5HW3 A;  3GV9 A;  3LUQ A;  1K0K A;  1MC0 A;  5HAR A;  2VGL M;  3VOZ A;  4DE3 A;  3UB8 A;  2Y2M A;  3HUN A;  5F6A A;  5HZH A;  4JPM A;  2A3U A;  2ZL1 A;  1IOU A;  3TJZ C;  4BQM A;  1O7E A;  2C5W B;  2M7V A;  2GNX A;  3C30 A;  3G2Z A;  4GD6 A;  1BLS A;  2PRF A;  4UAA A;  5BOH A;  1XA7 A;  1WYB A;  1SHV A;  3S1Y A;  3ZCZ A;  1YLZ A;  1I2S A;  2G2U A;  5EOE A;  4Y5F A;  3DBA A;  3WWX A;  3O86 A;  4ESP A;  2OAP 1;  1IYO A;  5KMW A;  1GHM A;  4UHU A;  1FIL A;  4MNR A;  4HQA A;  1Q2Q A;  4CQH A;  2B95 A;  4DDS A;  3OC2 A;  3NIA A;  5K5B A;  2WKE A;  3UE6 A;  2D01 A;  4PM8 A;  4GHI B;  2I9V A;  1D7E A;  1LSX A;  5DVA A;  1ERQ A;  5GHY A;  3Q82 A;  1PIO A;  4KZ7 A;  5HD5 A;  4P85 A;  3ZYT A;  3CG5 A;  3QP1 A;  4X25 A;  2W3D A;  2OLU A;  4NK3 A;  4MN5 A;  3TG9 A;  4EXO A;  4EU0 A;  4L0L A;  1GA9 A;  1IKI A;  3T4L A;  1YMX A;  3RXW A;  5GLC A;  2DCF A;  2XD5 A;  4Y0U A;  4EER A;  2JCH A;  4HHD A;  1MPL A;  3VOL A;  1YSQ A;  1VEU B;  2PD7 A;  2XGN A;  4BEN A;  4LEN A;  2OOL A;  3BM6 A;  5F1F A;  3ULF A;  5FAT A;  4X1L A;  1CEF A;  4NG2 A;  2P9V A;  2V1Z A;  4NXG A;  4JXV A;  3A0V A;  2VKS A;  3N8S A;  2RCX A;  2KDK A;  3ZG9 B;  3DTM A;  3RFB A;  5EVI C;  2XA7 M;  2VA0 A;  4PKY A;  3JPU A;  2OAQ 1;  5TGF A;  2HDU A;  2Y2K A;  3NOP C;  2W3E A;  3PBQ A;  4UA7 A;  3CWF A;  2FH5 A;  1SKO B;  1OTI A;  1J3W A;  1X0O A;  4PMA A;  3E4Q A;  3RH8 B;  3SS4 A;  2J9P A;  3SOI A;  4HJ3 A;  1XX2 A;  1PZP A;  4JGQ A;  2V1B A;  1FIK A;  4LV0 A;  4G3W A;  3Q81 A;  4YNR A;  3M2J A;  3T50 A;  1LT0 A;  2QZ6 A;  5JYO A;  3IHB A;  4IHQ A;  2XR0 A;  1NRJ A;  4S2N A;  3OPH A;  2ZD8 A;  4S2I A;  4GKU A;  3ZGA B;  4E3K A;  3CZD A;  2Q9N A;  5EVI A;  2ZMF A;  1WA9 A;  1VET A;  2ZQA A;  5FQM A;  3TOI A;  1CI8 A;  5FI7 A;  3DWK A;  2J3W A;  3W4P A;  2B02 A;  5FSR A;  2W1R A;  3LEZ A;  1TVF A;  2WKP A;  3GRJ A;  2Z6C A;  1Y4O A;  1Z6F A;  3MSH A;  3PTE A;  3MQO A;  4R38 A;  4ZJ1 A;  3T4Q A;  4JXW A;  1W8Y A;  2ZM8 A;  4E3L A;  3LIC A;  1EI5 A;  2JKR M;  1YSP A;  1XXM A;  2V2F F;  5G4Z A;  4PM9 A;  3MQQ A;  3HL9 A;  3IQA A;  4N1H A;  4I3I A;  4U0X A;  1GSV A;  1D06 A;  3ZQ5 A;  4KQD A;  3A0R A;  1YM1 A;  1VEU A;  5FAO A;  2QJ7 A;  3QP4 A;  4DF6 A;  1T1A A;  3K2N A;  3VP0 A;  4S2J A;  1ZTU A;  4BL3 A;  4K0X A;  3S4X A;  5E2G A;  2HJE A;  4ZJ2 A;  3UNW A;  3PBT A;  4EET B;  1TS0 A;  4WEK A;  1FCM A;  1K54 C;  3BY8 A;  2VV8 A;  2D02 A;  4CLC B;  5CED A;  2LB5 A;  4KG6 A;  2W27 A;  3S7N A;  5J3W A;  1TEM A;  5CRF A;  1LI0 A;  1T18 A;  3LEQ A;  4D60 A;  1L0D A;  1IFQ A;  4Y15 A;  4BL2 A;  2XA7 S;  4LRX C;  4P87 A;  3A0S A;  1LHY A;  2WAF A;  3UE1 A;  4NEE D;  3CUE C;  3G30 A;  2O9A A;  4BWI A;  3I7J A;  1YAX A;  4R0Q A;  3IWQ A;  3LI8 A;  3W4Q A;  1BLH A;  5DTT A;  4OOL A;  3TSG A;  4MBH A;  1S66 L;  3AGE A;  3C7V A;  2IWB A;  3GDI A;  2VLG A;  4QU3 A;  1GSX A;  2K2N A;  4HIA A;  2FZ0 A;  5EVI B;  4Y2F A;  4GCZ A;  3NBL A;  3PBS A;  1XKZ A;  2PT7 A;  2Y2L A;  3MBZ A;  5DF8 A;  1YLT A;  2ZMA A;  4WLA A;  2R78 A;  5E2E A;  3BFE A;  2IWD A;  3IXB A;  4CLC C;  1CQA A;  4UEY A;  3Q07 A;  4DDY A;  2G2W A;  3A3E A;  1DRM A;  4HP9 A;  5E43 A;  3LYX A;  4R4S A;  4MEZ A;  1ACF A;  5EVE A;  1ES2 A;  4X69 A;  3JVU A;  1OT9 A;  2H28 A;  2NUP C;  3FV7 A;  3AGD A;  3UPO A;  3DTE A;  5KZH A;  3C38 A;  1XPB A;  4WM9 A;  4F3L A;  4QWO A;  3OCN A;  1ESI A;  3MZE A;  3WRT A;  2HJ9 C;  4OPZ A;  3QNC A;  1K6S A;  3E0Y A;  1A0K A;  4JKT A;  1FSY A;  2LB9 A;  4I39 A;  5CEB A;  2H0T A;  1ALQ A;  4IBR A;  1IYS A;  3T4K A;  2XQZ A;  4R4R A;  2J80 A;  5L09 A;  2JE5 A;  3L7H A;  3OPR A;  5KSC A;  1BLC A;  4OVD A;  4I38 A;  2JKG A;  4HP4 A;  3MFX A;  2A24 A;  4G3V A;  3NOU C;  1PWD A;  2J8Y A;  2L1M A;  4Y3I A;  5FQK A;  5DTK A;  5CX7 A;  3CMZ A;  2XFT A;  3FPW A;  3G34 A;  2W3G A;  1YT4 A;  5D3O A;  3DTI A;  2HDQ A;  1ERO A;  5KIZ A;  3W4O A;  3W8K A;  3MJQ A;  3RJU A;  3MZD A;  3N8L A;  2GJ3 A;  4MDZ A;  4EES A;  3BLM A;  2PU2 A;  5A92 A;  2Y79 A;  2ZC7 A;  3KX0 X;  4YOF A;  4WMC A;  4UQI M;  2V8C A;  5IT5 A;  3IS2 B;  2QWS A;  5FQJ A;  3IT9 A;  3T4O A;  3LIE A;  1Z09 A;  5DFY A;  1HZO A;  4GB7 A;  4S2N C;  5FDS A;  3GR2 A;  4DKI A;  3CLO A;  4DMZ A;  4II7 A;  1NYY A;  4KZ9 A;  1S6R A;  3H82 A;  2XRN A;  2KX6 A;  3AGF A;  3CJM A;  5FAQ A;  3P7N A;  5AVF A;  3OBF A;  4GZB A;  5J8X A;  2WKR A;  4U0T A;  1FCO A;  2ZQD A;  5L10 A;  3LR5 A;  3UN7 A;  1H8Z A;  4E3O A;  2YKF A;  3GMW A;  4JGO A;  3OPP A;  4UQI S;  1H8M A;  3S7O A;  4QJG A;  3F1O B;  3C5A A;  4K08 A;  4IUH A;  3VSK A;  3FPV A;  3OLO A;  3PAE A;  1P97 A;  4Y17 A;  3PAG A;  1K55 C;  4DRT A;  1OTD A;  2Y2N A;  4KZB A;  5AQ9 A;  1OJ5 A;  3LY4 A;  1ERM A;  4DE0 A;  3VE4 A;  4B4X A;  3PXP A;  2Z2L B;  1NLY A;  3V39 A;  4F3L B;  2V9A A;  5HWW A;  3OPL A;  4WUJ A;  1YKD A;  4GDN A;  3IF6 C;  1XFN A;  2V1A A;  3HRE A;  2ZM0 A;  2VEA A;  1XGJ A;  4NXF A;  3IX4 A;  3BEB A;  2ZOH A;  4IUK A;  2A24 B;  4PKY G;  4WL9 A;  3BEC A;  1BLP A;  1WYC A;  3CUE A;  3WS0 A;  4YIN A;  2E8I A;  4PM5 A;  3IHA A;  5M19 A;  4OP5 A;  1G5U A;  4F94 A;  4EQI A;  4N9K A;  1NJ4 A;  4IED A;  3MMH A;  3QP8 A;  3LGO A;  1JVJ A;  1DP6 A;  3IBR A;  4HH3 A;  1EWZ A;  2R9X A;  2HP5 A;  3LR4 A;  5EE8 A;  4LRZ E;  1ES4 A;  4Y0T A;  3UB7 A;  5DF9 A;  4RQ9 A;  1P0Z A;  3PBR A;  2W1T A;  2J7V A;  3EGX C;  2V0U A;  1YLW A;  3HLC A;  3UE0 A;  2OSU A;  2HGV A;  3MQ0 A;  4O0P A;  3NUL A;  2Y2J A;  3FKW A;  4ARZ A;  4R6L A;  4CLC A;  1E3U D;  5CGX A;  5EOO A;  4EEP A;  3OZH A;  4ZJ3 A;  4XUX A;  5J7E A;  1W5D A;  5EM0 A;  4NKP A;  5J4E A;  1CF0 A;  4FD8 A;  4KZ5 A;  2EA9 A;  1ES3 A;  2ZQ8 A;  5HX9 A;  4Q0H A;  2W3H A;  2HV1 A;  1ZG6 A;  3BFD A;  1OME A;  4FTX A;  3NDG A;  2GZA A;  4JF5 A;  4QY6 A;  2OWJ A;  3F1P B;  1HD8 A;  1XP4 A;  5GHX A;  1PRQ A;  3BJN A;  2PYR A;  1NRF A;  1ONH A;  4LPZ A;  1FOF A;  4GOG A;  3KYE A;  3E4O A;  3ZG8 B;  2VZW A;  1HTZ A;  1FR6 A;  1CJF A;  4QY5 A;  1IYQ A;  5HSQ A;  4LCL A;  4RVA A;  4BBV A;  2ZQ9 A;  5DF7 A;  3V67 A;  3P09 A;  1F2K A;  3VP3 A;  3CAX A;  3O87 A;  3HLF A;  3RXX A;  3HBR A;  1LL9 A;  2E8J A;  4M4X A;  3LY3 A;  4K0W A;  3CHW P;  2DNS A;  2JKR I;  4HBU A;  1WE4 A;  2VJW A;  2P04 A;  4OOM A;  2ZL1 B;  3P01 A;  2BAS A;  1K25 A;  1FCN A;  2A2L A;  3E2L A;  3G32 A;  2PR6 A;  5EFW A;  1BUE A;  2Y2Q A;  3DAV A;  4YFM A;  3V50 A;  1G68 A;  4Q0J A;  2Q0O A;  3ZNT A;  4B9O A;  3EQU A;  4GW9 A;  1N9N A;  1HVB A;  4ZTK A;  1N9L A;  4EUV A;  2O9B A;  3NC8 A;  2XK1 A;  2QJ5 A; 
#chains in the Genus database with same CATH homology
 1TS7 A;  4OOL A;  1S66 L;  4HJ6 A;  2W3F A;  3BQA A;  5DKL A;  4ETX A;  3GDI A;  5TBM B;  2VLG A;  2WKQ A;  1GSX A;  2K2N A;  3FC7 A;  4HIA A;  2FZ0 A;  3E4P A;  4Y2F A;  4GCZ A;  5HDC A;  3PBS A;  3B42 A;  1T19 A;  2PT7 A;  1P9W A;  1W63 Q;  3VV4 A;  3H9W A;  4DJ2 A;  2PDR A;  4MMN A;  1P9R A;  4PHT A;  5AJG A;  3CIT A;  5L8M A;  1H3Q A;  2VGL S;  4WLA A;  3BY9 A;  2G7U A;  3CI6 A;  2R78 A;  3PR6 A;  1ODV A;  4GHI A;  1NWZ A;  3EWK A;  5F69 A;  1S4R A;  1V9Z A;  3D72 A;  1TS6 A;  2ZMV A;  4CLC C;  5F5Y A;  3VE3 A;  4UEY A;  4WEL A;  4GS9 B;  4E04 A;  1G6O A;  4BBT A;  1DRM A;  2XSS A;  3KYQ A;  4HP9 A;  5HL6 A;  4G3K A;  4BJP A;  3LYX A;  5LBR A;  4WN5 A;  3TRC A;  1W63 M;  3JVU A;  1ZHH B;  1OT9 A;  2H28 A;  2NUP C;  1LL8 A;  3IBJ A;  3F1N A;  4R70 A;  3C38 A;  5HDS A;  5AVE A;  3B47 A;  1DP8 A;  3B33 A;  4I3J A;  4PAU A;  2L0W A;  4F3L A;  1NLZ A;  3OCN A;  2VX8 A;  4XT2 A;  5TJJ A;  4KUO A;  1S1Z A;  2HJ9 C;  3LI9 A;  4CLC D;  3BW6 A;  1S4S A;  3LUQ A;  3OOV A;  1MC0 A;  2VGL M;  4EQ1 A;  3E0Y A;  4KQO A;  3T4T A;  3HCY A;  3UB8 A;  1EW0 A;  5TBM A;  2LB9 A;  4I39 A;  4L9F A;  1OT6 A;  2JHE A;  4EW7 A;  5F6A A;  4NXE A;  2OWH A;  5HZH A;  3LID A;  3H7W B;  1F5M A;  3T4K A;  2J80 A;  2K31 A;  1IOU A;  3TJZ C;  1BYW A;  2P08 A;  2M7V A;  2GNX A;  3C30 A;  4I38 A;  4HP4 A;  3E98 A;  3T4J A;  5DJU A;  3MFX A;  2M1C A;  2A24 A;  4G3V A;  3NOU C;  5KSH A;  1XJ6 A;  2JN7 A;  3S7Q A;  5I5L A;  2L1M A;  4HH2 A;  2XRO A;  5HWV A;  4Y3I A;  3GEC A;  4Y5F A;  3DBA A;  5CX7 A;  4EEU A;  3FPW A;  2W3G A;  2OAP 1;  2B18 A;  5HWT A;  4H6J A;  2W0N A;  4Z1W A;  4CLC E;  4HQA A;  5KIZ A;  1MZU A;  4CQH A;  1UGU A;  4R3A A;  3MJQ A;  3OC2 A;  1MKM A;  2GJ3 A;  2CMN A;  5K5B A;  5HPI A;  4HOI A;  3UE6 A;  4MDZ A;  4EES A;  2D01 A;  2KLI A;  2Y79 A;  3KX0 X;  4GHI B;  4KUK A;  2I9V A;  1D7E A;  1LSX A;  1TS8 A;  4YOF A;  4UQI M;  4XT2 B;  5IT5 A;  3IS2 B;  2NUT C;  1OTE A;  2QWS A;  4HNB A;  5HD5 A;  3T4O A;  3LIE A;  3ZYT A;  1UWN X;  4O8G A;  2W1T B;  3KSH A;  4JGP A;  3K3D A;  5DFY A;  1N9O A;  2W3D A;  4MN5 A;  2Y8H A;  3CLO A;  4DMZ A;  4II7 A;  1OTA A;  3EEA A;  4EXO A;  1KOU A;  3H82 A;  2XRN A;  2KX6 A;  4ME4 A;  4EU0 A;  3KSI A;  3P7N A;  3UB6 A;  4L0L A;  2ZBB A;  4BMW A;  5AVF A;  3OBF A;  5DFX A;  3F1P A;  3F1N B;  3C8C A;  5DJT A;  2WKR A;  5HD3 A;  3TE8 A;  3LIF A;  1T1C A;  2K7S A;  3T4L A;  3LR5 A;  4WF0 A;  3EQV A;  1XJ4 A;  2YKF A;  4JGO A;  4UQI S;  3HJI A;  5IU1 A;  5C5K A;  1H8M A;  3S7O A;  3O5Y A;  3F1O B;  4JGR A;  3UME A;  2QYB A;  4EER A;  3NJA A;  3LIB A;  4K08 A;  4IUH A;  2J3T C;  4HHD A;  3FPV A;  3OLO A;  4B93 A;  1P97 A;  3VOL A;  1YSQ A;  1OTD A;  3PBO A;  1XJ2 A;  1OTB A;  2PD7 A;  4I5S A;  3R7W B;  1OJ5 A;  2OOL A;  4FOF A;  4H6J B;  3T4S A;  3KSF A;  4FSF A;  3H7W A;  3ULF A;  3VE4 A;  3PXP A;  1NLY A;  3PYP A;  2L4R A;  4F3L B;  2V9A A;  5HWW A;  4Q0I A;  1DP9 A;  3MR0 A;  3UMD A;  4NXG A;  4WUJ A;  1YKD A;  3A0V A;  3EOI A;  2VKS A;  3LIA A;  3HJK A;  3NOT C;  5G4Y A;  1XFN A;  2V1A A;  2KDK A;  1VHM A;  2PYP A;  2VEA A;  1T1B A;  4NXF A;  1S1Y A;  4YWZ A;  2QKP A;  5IS1 A;  2ZOH A;  4IUK A;  2Z6D A;  2A24 B;  4PKY G;  4WL9 A;  3RFB A;  2J3T D;  2XA7 M;  2VA0 A;  4PKY A;  3CUE A;  2OAQ 1;  3R4K A;  3NHQ A;  4BBU A;  3NOP C;  4GJ4 A;  2W3E A;  4GLQ A;  3PBQ A;  3H82 B;  3JVV A;  3CWF A;  3S7P A;  2FH5 A;  4DJ3 A;  1OTI A;  1X0O A;  2QJ5 A;  3MMH A;  3UB9 A;  3E4Q A;  3RH8 B;  1JNU A;  1DP6 A;  3IBR A;  4HH3 A;  3SW1 A;  4HJ3 A;  1F98 A;  4JGQ A;  4ETZ A;  4NXB A;  2V1B A;  3LR4 A;  2O9C A;  2PR5 A;  2KOI A;  4G3W A;  1GSW A;  3KO6 A;  4YNR A;  4LRZ E;  4I3A A;  3T50 A;  1LT0 A;  3UB7 A;  5DF9 A;  4RQ9 A;  1P0Z A;  3PBR A;  4IHQ A;  2DMW A;  4ZRR A;  1NRJ A;  2W1T A;  3EGX C;  4L9E A;  2V0U A;  3PHY A;  3C2W A;  4MCW A;  1OJG A;  4MN6 A;  2HGV A;  3BWL A;  3MQ0 A;  3BQ8 A;  4O0P A;  1XJ3 A;  3KSG A;  4ARZ A;  4HI4 A;  4R6L A;  4CLC A;  3OCL A;  2ZMF A;  1WA9 A;  4EEP A;  1XFQ A;  2J3W A;  4DN0 A;  1LSW A;  2B02 A;  5J7E A;  2W1R A;  2MJ6 A;  4NKP A;  5J4E A;  2QHK A;  5MC7 A;  2WKP A;  4WEJ A;  2Z6C A;  5HDD A;  2EA9 A;  3F1O A;  4Q0H A;  3MQO A;  2W3H A;  4R38 A;  2HV1 A;  3T4Q A;  4HY8 A;  2ZOI A;  1G28 A;  1TD5 A;  1STZ A;  2GZA A;  4O01 A;  3LIC A;  2OWJ A;  5A8B A;  3F1P B;  1VB6 A;  2O0Y A;  4IJG A;  1UWP X;  3FG8 A;  2JKR M;  3KYZ A;  1YSP A;  4HJ4 A;  3BJN A;  2EWW A;  2PYR A;  5G4Z A;  2HF6 A;  4LPZ A;  4QPR A;  3LR0 A;  2EWV A;  3MQQ A;  3E4O A;  2JKT I;  4I3I A;  2VZW A;  1GSV A;  1D06 A;  3ZQ5 A;  4KQD A;  1OPX A;  2V0W A;  3A0R A;  3PBN A;  2QJ7 A;  5HSQ A;  1T1A A;  4BBV A;  4GS9 A;  4LRY C;  3K2N A;  3V67 A;  1ZTU A;  3LR3 A;  2PD8 A;  3EGD C;  3U2A A;  2YKH A;  3D3O A;  3W2Z A;  3MXQ A;  5HPF A;  1S67 L;  2HJE A;  3CAX A;  3PBT A;  5F68 A;  4L9G A;  3RTY A;  4EET B;  1TS0 A;  2M7U A;  5FL3 A;  4WEK A;  1V9Y A;  4M4X A;  2GX5 A;  4ARZ B;  3BY8 A;  2JKR I;  2VV8 A;  2D02 A;  4CLC B;  2LB5 A;  3TW8 A;  2JKT M;  2VV6 A;  2W27 A;  2PHY A;  2VJW A;  2P04 A;  4OOM A;  3S7N A;  2VV7 A;  4P6Z M;  5J3W A;  3P01 A;  2BAS A;  2IA2 A;  4AFI A;  3UE3 A;  1TF1 A;  2A2L A;  4LLO B;  1T18 A;  2PR6 A;  3R7W A;  5EFW A;  3LFV A;  2O99 A;  1IFQ A;  3K3C A;  3IS2 A;  2XA7 S;  4Q0J A;  2P7J A;  4LRX C;  4B9O A;  1LSV A;  3EQU A;  3A0S A;  4GW9 A;  3MF0 A;  5DKK A;  1F9I A;  1N9N A;  4NEE D;  3G6O A;  3CUE C;  1N9L A;  4EUV A;  2O9B A;  3ICY A;  2O9A A;  4BWI A;  4MN7 A;  1YAX A;  1Y28 A;  3EEH A;  4P6Z S;  3LI8 A;  2INW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...