1JNUA

Photoexcited structure of the plant photoreceptor domain, phy3 lov2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
104
structure length
104
Chain Sequence
b'KSFVITDPRLPDNPIIFASDRFLELTEYTREEVLGNNCRFLQGRGTDRKAVQLIRDAVKEQRDVTVQVLNYTKGGRAFWNLFHLQVMRDENGDVQYFIGVQQEM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHY3 PROTEIN
publication title Photoexcited structure of a plant photoreceptor domain reveals a light-driven molecular switch.
pubmed doi rcsb
source organism Adiantum capillus-veneris
molecule tags Signaling protein, electron transport
total genus 28
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1jnuA00
1N9OA 4KUKA 1V9ZA 3IS2A 1OT6A 3NOTC 3H7WB 4HQAA 2W0NA 1LT0A 4I39A 3B33A 2CMNA 4BBVA 3T50A 5J7EA 1X0OA 1ODVA 3OLOA 1XJ3A 3GECA 4BBUA 2V9AA 4EEUA 2L0WA 1BYWA 3NJAA 4YWZA 2R78A 4KQDA 2D02A 3KX0X 1F98A 2VEAA 3MFXA 3LIFA 5EFWA 3CAXA 2I9VA 4JGRA 4L9GA 3EEHA 3UB6A 4M4XA 2ZBBA 1GSVA 4K08A 2QWSA 3K3CA 5G4ZA 2Z6CA 5HD5A 3MXQA 3VE3A 1OT9A 4GS9B 3MQOA 2VV8A 2QKPA 2V0UA 4NXEA 3UMEA 4KUOA 1N9NA 1OTBA 1S1ZA 1XFNA 3BWLA 3LIEA 3SW1A 3EWKA 5HWVA 4GW9A 1T1BA 5DKKA 1S66L 2PD8A 3F1NB 4GS9A 4LRYC 1P97A 4LRXC 2INWA 5IS1A 4HH3A 5HD3A 4F3LA 5HZHA 1S67L 3CLOA 4HOIA 2HV1A 4HP4A 3LIDA 1DP8A 1UWNX 3UB8A 3FC7A 3HJIA 5J4EA 2KDKA 3F1NA 1T1CA 4NXBA 4DJ3A 4EXOA 2PHYA 5J3WA 4WN5A 3UE6A 1XJ6A 1DP6A 2WKQA 4MN5A 2BASA 1G28A 5F69A 4L9EA 4EQ1A 1DRMA 4EW7A 4WF0A 3F1PA 3E4QA 3P7NA 3H7WA 2ZOIA 1TS6A 3MJQA 2Z6DA 4GCZA 3G6OA 1TS8A 3PYPA 4HP9A 2OOLA 2B02A 4NXGA 4R38A 1GSXA 3IBRA 2PR6A 1D06A 3MQQA 1UGUA 5HDDA 4HJ4A 5HWTA 3FG8A 1N9LA 4HIAA 1XJ2A 1S4SA 2VLGA 4L9FA 2OWHA 4I3IA 4I3JA 2VV6A 1LL8A 3H82B 1T1AA 2J80A 3F1OB 3C2WA 2KX6A 4H6JB 3RH8B 3D72A 4GHIB 5DKLA 3BY8A 4DJ2A 1S4RA 3UMDA 4HNBA 4WUJA 4XT2B 3H82A 1MZUA 5TBMB 3F1OA 3CWFA 4JGOA 2QHKA 4GHIA 2P7JA 1LSWA 3E4PA 3LYXA 5HWWA 3A0VA 1T18A 4LRZE 4I38A 5IU1A 2M1CA 2PYRA 3LICA 5HSQA 4EEPA 1TS7A 1LSXA 2K7SA 2WKPA 4LPZA 5TBMA 4JGPA 3IS2B 2V0WA 5F5YA 4NXFA 4HY8A 3NOPC 2YKHA 2A24B 2PDRA 2PR5A 3H9WA 1UWPX 3UB7A 4I3AA 5F6AA 4EESA 1VB6A 2W27A 3A0RA 5F68A 4RQ9A 4R3AA 4WLAA 2ZOHA 1TS0A 1V9YA 5HDCA 2A24A 2YKFA 5A8BA 1D7EA 1OTEA 3ICYA 1GSWA 4R70A 1OTDA 5DJUA 1XJ4A 2WKRA 4B9OA 3ZQ5A 1XFQA 4EETB 3LI8A 4WL9A 4LLOB 4HI4A 4JGQA 2EA9A 1Y28A 3E4OA 3RTYA 5AVEA 5I5LA 4E04A 2VV7A 3PHYA 2L4RA 1P0ZA 1NWZA 5DJTA 1F9IA 3VOLA 4EERA 5KIZA 3GDIA 3HJKA 4HH2A 3UB9A 3MR0A 1DP9A 1OJ5A 1KOUA 2H28A 3NHQA 3LUQA 4PKYG 4I5SA 3LIAA 4HJ3A 4PKYA 1OJGA 1JNUA 4F3LB 2QJ5A 4H6JA 5G4YA 3BY9A 4HHDA 2JHEA 3K3DA 2L1MA 3VE4A 1OTIA 3ULFA 2D01A 5AVFA 4XT2A 3C8CA 3A0SA 1LSVA 1T19A 4R6LA 3LI9A 3LIBA 2PYPA 2QJ7A 5HDSA 2V1AA 2V1BA 3NOUC 2GJ3A 1EW0A 4BBTA 1WA9A 1OTAA 2OWJA 2JN7A 4HJ6A 1S1YA 4MN6A 3F1PB 2PD7A
chains in the Genus database with same CATH superfamily
5L09A 4KUKA 1YKDA 1V9ZA 1BLSA 4RX3A 1STZA 5JYPA 3H7WB 3O87A 2W0NA 4NETA 2HF6A 4GD6A 3GTCA 3BM6A 2CMNA 1CK3A 2GNXA 3OPLA 5HPFA 4PM8A 4P6BA 3OLOA 3V50A 1XJ3A 2W3EA 2Y79A 1CI9A 3FYZA 1K38A 4O01A 3Q07A 3NJAA 4YWZA 2QZ6A 4ZJ3A 1KVLA 1PYYA 3A3FA 2P08A 2Y8HA 4IVIA 5EVLA 3PAGA 3KX0X 1F98A 2XA7S 5IT5A 1MY8A 3MF0A 4O7DA 3T4TA 3ZGAB 3ZVTA 5CECA 5GLDA 4UAAA 5G4ZA 2O0YA 2XD5A 1E25A 1WE4A 5HD5A 4DE2A 5CRFA 3VE3A 1ZC2A 1OT9A 5FASA 3MQOA 4CLCA 2M7VA 2VV8A 3FPWA 3T12B 3ISGA 2V0UA 2JKTM 4KUOA 4PMAA 5TGFA 4B88A 1OTBA 2HJ9C 3VP4A 1YLWA 5CGXA 4OH0A 5A93A 1H8ZA 4MLLA 2XGNA 3UB5P 3D3OA 1KE3A 1I2WA 3EWKA 3SW1A 2G2WA 4KZ7A 1PIOA 1S66L 3ITBA 1CJFA 4GOGA 4LRXC 1Y54A 4Y5FA 3DTEA 5HD3A 3N6IA 1BLHA 4F3LA 3NY4A 3ZG8B 4Y13A 4E3OA 3FZCA 2PAVP 4IHQA 1IKGA 4CQHA 3EOIA 3SS4A 1ONGA 2WGVA 2Q0OA 1BSGA 2X02A 4QJGA 3PBNA 3S7PA 1ZHHB 4X68A 4WN5A 2Y59A 4EV4A 5M1AA 5HL1A 2HZ5A 2G2UA 2BASA 1XA7A 1DRMA 1LHYA 5KMWA 3JVVA 3E4QA 4OPRA 3HLCA 3EQUA 2OAP1 3S7QA 1CI8A 2H0YA 3JVUA 3OOVA 2Y2PA 3MJQA 4D60A 2OLUA 4GCZA 3LY3A 3PYPA 3UDIA 2JC7A 2OOLA 4IUKA 1EROA 2B02A 2B95A 4NXGA 4R38A 1YM1A 2G7UA 2PR6A 3S1YA 5HAQA 4HBUA 4ZTKA 1IYOA 2J9OA 4HJ4A 1N9LA 4WZ5C 3RXXA 3TJZC 1S4SA 4L9FA 4FH2A 4I3JA 2NUTC 2VV6A 1SKOA 3H82B 2Z2MB 2J80A 3F1OB 3LEZA 3C2WA 1FR6A 3CI6A 3MXSA 1M40A 1K6RA 4KENB 2VGJA 3Q81A 4DJ2A 1S4RA 2ZL1B 2HDRA 3MQ0A 3HUMA 3H82A 1MZUA 1H8MA 5TBMB 3CPTB 3F1OA 2RCXA 4PM5A 3NC8A 3G32A 2OLVA 3OBFA 3WS0A 2A49A 2Y2IA 5EVEA 2P7JA 1LSWA 1ACFA 3LYXA 3RFBA 5HAIA 1Q2QA 5IU1A 2Y4AA 5HSQA 4EEPA 1CQAA 1LSXA 1ESIA 2WKPA 4LPZA 4OP8A 5TBMA 1DY6A 4FCFA 4CJNA 2PT7A 2VKSA 4FH4A 5AJGA 2YKHA 3W2ZA 1NJ4A 2WK0A 1D1JA 1PW8A 1VB6A 2J9PA 4CLCC 4GDNA 4E6XA 4PAUA 2C5WB 3WS4A 1TS0A 1W63M 5HDCA 4G3VA 1OPXA 4UA7A 4ZJ1A 5A8BA 3BQ8A 1LI9A 3ICYA 4LGWA 3MKFA 3AGDA 4K91A 1OTDA 3MFDA 4C75A 2LB5A 4CPKA 3A3EA 4JKTA 1FR1A 1GA0A 3TG9A 1HZOA 4MDZA 4NEED 1XX2A 3T4LA 1JTDA 2EWVA 4E3KA 4JXVA 5HL6A 3E4OA 4Y15A 3PBOA 5AVEA 2ZQ9A 1JVJA 3HCYA 1YLZA 3ZG9B 3A3JA 1MKMA 3PHYA 3LR3A 5DVAA 4QPRA 1P0ZA 4Q0HA 1NWZA 2V8CA 3ZCZA 5FEGA 5KIZA 1K57A 1YLJA 1K54C 1ALQA 1NYYA 2EXBA 2HP5A 3O88A 4M3KA 4IBXA 1SKFA 4MBKA 1TEMA 2ZQ8A 3LUQA 3LIAA 1N9BA 4S2JA 2Z2LB 3VP3A 1OJGA 5FL3A 2IWCA 4ESPA 2HDUA 1CF0A 1SHVA 4DKIA 3IX8A 4OP5A 4S2NA 5AQ7A 4E6WA 5KSHA 1MKIA 1FCOA 3ULFA 2D01A 3D4FA 1PI5A 5GHYA 3HLGA 1PWDA 3GQZA 3UN7A 5DF9A 4R6LA 1IOUA 2QJ7A 5HDSA 4N9LA 1FOFA 1IEMA 3HUNA 4KQOA 4BBTA 4OQGA 4PHTA 2Q9MA 4MCWA 1F2KA 2ZMAA 1S1YA 4DE0A 4MN6A 3TSGA 1N9OA 3N4IA 3KSHA 3GVBA 3PXPA 1H0MA 2B18A 5E2FA 3BFEA 4HQAA 3LR0A 3R7WA 1LT0A 5FDHA 2W1TA 3WWXA 2R9XA 2W3HA 1Z09A 4BBVA 3T50A 5J7EA 1NYMA 1X0OA 4E3NA 1ODVA 3EGDC 4G3WA 4G3KA 3VP2A 3G2YA 4EEUA 1N4OA 5EECA 2P04A 3LY4A 1SCWA 5CXWA 3NCKA 3SH7A 3IWIA 1H8YA 5HX9A 1TDGA 3MFXA 4MMNA 2I9VA 4L9GA 5CEBA 1PWCA 2VJWA 4M4XA 5KSCA 3C4PA 2W1RA 5JYOA 4NKPA 2JKRM 3BLMA 3FV7A 3K3CA 2WYXA 2DRWA 4QD4A 3S7NA 3MXQA 5L07A 5E2EA 3S4XA 2ZC3B 4GS9B 1F5MA 4OKPA 3NBLA 3UY6A 3UMEA 1DJBA 1P9RA 1YLPA 1N9NA 1S1ZA 5F1GA 4DE1A 4JF6A 3ZNTA 4ETXA 3UNWA 5HWVA 4GW9A 1T1BA 2K2NA 5FQMA 1IELA 2WZZA 4GS9A 4WZ4A 3GV9A 2INWA 4A5RA 5IS1A 4HH3A 1RGYA 1C3BA 4NG2A 3MXRA 5L8MA 1J3WA 2ZLYA 4WEJA 4OOMA 5TJJA 3CZDA 2HV1A 3LIDA 3UO9A 1RGZA 1L0EA 3FC7A 3UB8A 4D2OA 4UEYA 3HJIA 3KYZA 1GCEA 1M6KA 3U4LP 3T1RA 4BL3A 4WYYA 2EXAA 4EUVA 5J3WA 3P01A 5FSRA 3VV4A 3ZVWA 5A91A 3UE6A 2JBFA 4ARZB 2BLSA 1GHPA 3AGEA 4JPMA 4MN5A 5FQJA 5BOHA 1K57C 5EOEA 2V1ZA 4IVKA 5F69A 2JKFA 4L9EA 4EQ1A 4WF0A 2H0TA 3F1PA 4Z9QA 5K5BA 2EX8A 3UE3A 1W63Q 2ZC5B 3H7WA 2ZOIA 4MBFA 4RYEA 2Y2GA 3UPNA 1K0KA 1TS8A 4S2NC 3UPPA 4HP9A 4ME4A 4YOFA 2RL3A 3IQAA 3VFHA 1BLCA 3IBRA 3B3XA 3MQQA 3IF6C 1UGUA 1NY0A 5HDDA 5FI7A 2ZQDA 2Y2HA 4YFMA 3A3IA 2V2FF 5HFOA 5EVIB 3D72A 3ZFZA 4GHIB 4LV1A 3U2AA 4KQQA 3VOZA 2IWDA 3GSGA 3VSLA 1IKIA 3BFDA 2JKGA 4KG6A 4HNBA 4XT2B 3SOIA 1YLTA 3CWFA 3V67A 2AVXA 5AQAA 2ZJ9A 3HLFA 2FZ0A 4EBPA 4K0WA 1TDLA 4GHIA 3CITA 3E4PA 3A0VA 4Q8IA 2WKIA 1HVBA 4GJ4A 2M1CA 5EOOA 3LICA 1TS7A 4X25A 4YNRA 3ZG5A 3D9YA 2JKTI 5EPHA 4P87A 3IS2B 5F5YA 4X1MA 2VZWA 5FQKA 4JF4A 2NUPC 2UV0E 2A24B 2PDRA 1UWPX 4LV0A 1K55C 1EI5A 1PZPA 5EM0A 2R9WA 2O9BA 5GHXA 3A0RA 1ONHA 5F68A 4RQ9A 3IWOA 2C6WB 3HUOA 2QPNA 5HPIA 5CGSA 2A24A 3E98A 2EX6A 1MXOA 2DNSA 1D7EA 3MMHA 3R4KA 2DCFA 1GSWA 4KG5A 1K6SA 2X71A 3L7HA 4UHUA 4N92A 4B4ZA 3G31A 2K31A 4UQIM 3BLSA 2WKRA 4Y0OA 1I2SA 1MWSA 3ZQ5A 1XFQA 5M19A 4EETB 1FSWA 3BECA 4X6TA 4HI4A 3SH8A 3IXDA 3JPUA 3M6HA 1PNEA 4OPQA 1Y28A 1QMFA 5HARA 4DE3A 2EX9A 3RTYA 5E43A 1NLYA 4U3TA 3NDGA 1MWUA 3IHBA 2J3WA 4ID4A 1GA9A 4WM9A 2LB9A 2XFTA 1F9IA 4EERA 1NZUA 3GDIA 3HJKA 4HH2A 3MR0A 4OQ0A 4FD8A 2WKEA 1SZVA 4EBNA 2XR0A 2VGKA 5CTMA 3NHQA 4JXWA 4HJ3A 1ES5A 1JNUA 5AQBA 4BD0A 3BY9A 3VP1A 4HHDA 5GLBA 2P9VB 4OPYA 3QHYA 1DJAA 3K3DA 1YT4A 1L0FA 3ZNYA 3PAEA 3QP1A 1OTIA 2ZL1A 2O9CA 3CUEA 2Y2MA 3C8CA 1T19A 4EBLA 3CPTA 2B5RA 4XXRA 1ESUA 2PYPA 1FCNA 2P9VA 2V1AA 2V1BA 2GJ3A 1OMEA 3V3RA 2H5SA 4E3IA 5FAQA 2JCHA 4U0XA 1WA9A 1BUEA 2PBYA 2FFFB 4HJ6A 3O5YA 4QY5A 2PD7A 3EEAA 1OT6A 4WELA 3C38A 3NOTC 2ZM2A 1VETB 4R0QA 5EUAA 5DF7A 4KZ9A 4AFIA 3VSKA 3N8LA 4P6ZM 3Q82A 5CERA 1U60A 3OZHA 3WS1A 2HDSA 4ZBEA 4BBUA 3BW6A 2Y55A 1ZG6A 3HREA 2W3DA 1BYWA 3O86A 1HD8A 5CGWA 4GZBA 1YSQA 2EX2A 2DMWA 2R78A 4R3JA 1E3UD 3OPPA 3M2KA 4X69A 3DTKA 3KSIA 4R4RA 2HPBA 4R3BA 3LIFA 2MJ6A 3VFFA 4EUZA 2FFYA 2OV5A 3UB6A 1AWIA 5DTKA 4NK3A 4BENA 4K08A 4JF5A 2QWSA 2Y2QA 4OQIA 4X56A 1YSPA 3T4KA 1CEGA 3M2JA 1EWZA 1K56A 4PM9A 2Z6CA 1FSYA 1JWVA 5FATA 1FQGA 1BULA 1GHIA 3NIAA 4GNUA 2QKPA 4NXEA 1PI4A 4ZRRA 2O9AA 1S0WA 1XP4A 1LI0A 3ITAA 4S2OA 4E3MA 3MS6A 1IYQA 1XGIA 3BWLA 3QNCA 3QP4A 2J3TD 4OPZA 3KSFA 4KZAA 2PD8A 4LRYC 4DXBA 4C6YA 1QMEA 1SDEA 5A90A 3V39A 1P9WA 1L2SA 3I7JA 5HZHA 4QU3A 1S67L 3CLOA 4KZ6A 3SZTA 5GLAA 5MC7A 2WZXA 3JYIA 4HOIA 2PBDP 1DP8A 1UWNX 2E8IA 1ZTUA 3W8KA 1XKZA 2KDKA 2WUQA 4P6ZS 4C3QA 2PHYA 1KDWA 1AXBA 1MWRA 4II7A 2ACGA 4MBHA 4KQRA 3PR6A 3BFGA 2HP9A 1DP6A 3UE0A 3DWZA 3CJMA 4DMZA 2QMIA 3IXHA 1XA1A 4EW7A 3OC2A 4YINA 4OQHA 4OLGA 2XLNA 4IUHA 5EV0A 2ZMVA 1KGFA 1E3UA 3E0YA 1TS6A 4P0MA 3BQAA 3G6OA 1YMSA 3W4OA 3QP6A 4BJPA 3ZG0A 2PU2A 3BJNA 1GSXA 2XK1A 3VP0A 1D06A 3Q7VB 4F94A 2ZC4B 5HWTA 4Y2FA 3CMZA 3SS3A 2VLGA 3G30A 4JBFA 5F83A 2XRNA 3BFFA 4I3IA 2Y2LA 3S22A 3Q7ZA 4BLMA 3IX4A 1VEUB 1LL8A 4DDSA 1NZOA 4HBTA 4MEZA 3HL9A 2KX6A 4H6JB 4O8GA 2OAQ1 1W7FA 4KZ8A 1S6RA 4GLQA 1K4EA 3G2ZA 4GKUA 2I72A 5DKLA 3BY8A 4BWIA 5DFYA 3W4PA 3UMDA 2PU4A 1HLUP 3DW0A 3OPHA 3KSGA 1CEFA 3EQVA 4JGOA 3VMAA 5DTSA 2JKRI 3BYDA 1KDSA 1JWZA 1RCJA 3EGXC 3HBRA 3PTEA 5EVID 2FH5A 4X53A 3FKVA 4LRZE 2XH9A 2VK3A 2ZQAA 3LCEA 3MSHA 3C5AA 4WEKA 1JWPA 2V0WA 1YPRA 4NXFA 4ZJ2A 3TE8A 4WZ5A 3PBSA 2UWXA 1VM1A 3IWQA 2VX8A 2PR5A 3H9WA 5CHUA 5DTTA 1FIKA 3ZG7B 3UB7A 4I3AA 4S2LA 5F6AA 1MWTA 2W3GA 2V8FA 3BRMA 3N8RA 1IYSA 1VQQA 5GLCA 4BMWA 1E4DA 3GMWA 3P09A 4WLAA 3Q1FA 1V9YA 4ARZA 4WMCD 4Y0TA 2YKFA 1L0GA 5KZHA 1G6OA 4UA9A 4S2IA 3NULA 1K25A 3C7VA 3DTMA 3LFVA 1PW1A 3IBJA 1XJ4A 3K2NA 1KE4A 4FTXA 4LLOB 2EA9A 3G34A 3MZEA 4DDYA 4S2KA 1DJCA 4CLCB 5M18A 2WGWB 3T4SA 3G35A 4DXCA 4R23A 2O99A 4LENA 2L4RA 4CLCE 5J8XA 3OPRA 3PBQA 4BD1A 4OVDA 3PBRA 1DP9A 1YLYA 3G4PA 1OJ5A 3W4QA 2BG1A 4DF6A 3LEQA 5EM1A 4GB7A 5GHZA 4XUZA 2WGWA 4I5SA 4PKYA 3BEBA 3IHAA 4F3LB 2QJ5A 5EVIA 4U0TA 3NDEA 3T4OA 2WAEA 3B42A 3QP2A 4LFUA 3AGFA 2HDQA 5CTNA 1ZKJA 1ES2A 3ZYTA 3T1SA 3T1QB 5AVFA 4XT2A 5FEFA 4X55A 1BT5A 5FQQA 3TW8A 3LI9A 3VOYA 3LIBA 1ZG4A 1G6AA 4ZDXA 3DBAA 3FWLA 5C5KA 2XROA 4EQIA 1FILA 2JN7A 5U47A 3N8SA 3TRCA 4RX2A 1MPLA 2X01A 3SS5A 2XDMA 4PM6A 3IS2A 2ZM8A 4WMCA 1K54A 5FQIA 4I39A 3FKWA 1ES4A 5G18A 3IX3A 3B33A 2J3TC 3L9KA 1LL5A 1W79A 3IH8A 5TFQA 2J7VA 3GECA 2V9AA 2E8JA 2L0WA 1MC0A 3NECA 3LO7A 2GZAA 4RVAA 2VGLM 1XPBA 5FDSA 4IJGA 1TF1A 2KOIA 2H10A 4JLFA 2OSUA 4KQDA 2D02A 1SKOB 1PRQA 2VEAA 1J9MA 3CAXA 5EFWA 4JGRA 3EEHA 5TR7A 4N1XA 1FCMA 1PFLA 2ZBBA 1K4FA 1GSVA 3HLDA 4N9KA 4O0PA 1KGGA 2ZC6B 5E2HA 1IYPA 4UA6A 3GR2A 4MN7A 1XXMA 2W3FA 2Y2KA 4LV2A 2ZM0A 1K56D 5D3OA 1ERQA 1Z6FA 3C4OA 5CHJA 4Y3IA 1KVMA 4HESA 3OCNA 1TD5A 3MZFA 1XFNA 3LIEA 2IA2A 3RXWA 4LCMA 4K0XA 4QWOA 3P98A 4B93A 3QP5A 5DKKA 3FPVA 1BTLA 1NXYA 3F1NB 4PPRA 1Q2PA 1P97A 3E2LA 1HTZA 1I5QA 3UDFA 3S7OA 4R1GA 4LV3A 2P74A 3IXBA 4GN2A 3UPOA 3HLEA 2V20A 4HP4A 2Y2OA 1Y4OA 1NRFA 2ZD8A 3CG5A 2A3UA 4P85A 5J4EA 3F1NA 1T1CA 4NXBA 4DJ3A 4EXOA 2EFXA 3LR5A 4UQIS 4Y7PA 1XJ6A 4IEDA 2VGLS 2WKQA 4Y17A 2XSSA 2Q9NA 1G28A 4ETZA 1YAXA 3C7UA 2Y2NA 2KLIA 4GDBA 2ZC7A 3P7NA 1WYBA 1LL9A 2CC1A 1O07A 1NLZA 5FQ9A 5FI2A 4EU0A 5EVIC 1VETA 1L0DA 1H5XA 2Z6DA 5DF8A 1RP5A 3QNBA 1W8YA 4DRTA 2XD1A 4FSFA 2WADA 5CEDA 3SH9A 3PBTA 4Q0JA 2PRFA 3ZHHA 2BTFP 2GDNA 1MBLA 5FA7A 2XFSA 3FG8A 3V5MA 2ZMFA 4HIAA 1XJ2A 1W5DA 3OCLA 1ES3A 2OWHA 1G68A 3WRTA 2Y2JA 3CHWP 1A0KA 1T1AA 2HP6A 4Q0IA 3RH8B 1YQSA 1KE0A 5HW3A 2VA0A 5FAPA 3NI9A 4JXGA 4EWFA 5IHVA 4FOFA 1ERMA 4WUJA 5E2GA 3IF6B 1XGJA 4L0LA 5CHMA 2QHKA 3UDXA 2HJEA 3T1XA 3DTIA 4FUWA 5HWWA 2WAFA 2XQZA 2WKHA 1T18A 4I38A 2PYRA 3T4JA 2ZQ7A 4H8RA 1VHMA 2HGVA 3E2KA 3DWKA 2K7SA 3IF6A 1H3QA 4OOLA 4JGPA 4Z1WA 1BLPA 5F1FA 3M6BA 4HY8A 1JTGA 4KZ4A 3R7WB 4S2PA 3T4QA 3NOPC 2W1TB 3WS2A 5HAPA 2A2LA 4EESA 3WRZA 2W27A 3IH9A 4MNRA 4QY6A 4ZAMA 1BZAA 2J8YA 4R3AA 4DN0A 2ZOHA 2Y91A 4XUXA 4QHCA 3IF5A 3RJUA 1L3LA 4QB8A 2JE5A 3MBZA 3IXGA 3BFCA 3V3SA 2EFUA 1OTEA 3IT9A 3TOIA 1PWGA 4OLDA 4E3LA 4R70A 5GL9A 4KG2A 5DFXA 5DJUA 3CUEC 4B9OA 4RA7A 4KZ5A 3B47A 4PM7A 3LGOA 3LI8A 4WL9A 4JGQA 2QYBA 3C30A 3MZDA 2XEPA 1W8QA 5LBRA 4Y0UA 5I5LA 4E3JA 4E04A 3KYQA 2VV7A 2GX5A 2EWWA 5L2FA 4KZ3A 3GRJA 3Q7VA 2M7UA 5DJTA 3VOLA 1G5UA 1TVFA 1K55A 4X1LA 3UB9A 4S2MA 3ZDJA 3HLBA 4WBGA 2XA7M 2XF3A 1KOUA 4KZBA 4B4XA 2H28A 1VEUA 3HVFA 3HLWA 5CX7A 2ZQCA 4PKYG 5AQ9A 4CLCD 4H6JA 5G4YA 2JHEA 5L10A 1LLBA 3MKEA 5I94A 2L1MA 3VE4A 3O3VA 1YMXA 5EE8A 2IWBA 4HEFA 3UE1A 3QP8A 4OOYA 4R4SA 4JXSA 1IFQA 4OONA 3N7WA 1SDNA 3A0SA 1KGEA 4IBRA 5FI6A 1O7EA 1LSVA 1PZOA 3A3DA 3WS5A 4N1HA 4BL2A 4BQMA 1GHMA 3NOUC 1NRJA 2WGIA 1EW0A 5FAOA 3LR4A 4GD8A 4LCLA 5F82A 1OTAA 2OWJA 5A92A 3F1PB 3KO6A 3DAVA 3KYEA 1WYCA
chains in the Genus database with same CATH topology
1N9OA 4KUKA 1YKDA 3KSHA 3PXPA 1V9ZA 2B18A 3EEAA 3IS2A 1OT6A 4WELA 1STZA 3C38A 3NOTC 3H7WB 4HQAA 2W0NA 3LR0A 3R7WA 1LT0A 2HF6A 4I39A 2W1TA 3B33A 2CMNA 2GNXA 2J3TC 5HPFA 2W3HA 4AFIA 4BBVA 3T50A 4P6ZM 5J7EA 1X0OA 1ODVA 3EGDC 4G3WA 3OLOA 1XJ3A 3GECA 4BBUA 2W3EA 2V9AA 2Y79A 4G3KA 3BW6A 4EEUA 2L0WA 1MC0A 2W3DA 1BYWA 2GZAA 2VGLM 4O01A 2P04A 3NJAA 4YWZA 1YSQA 4IJGA 2DMWA 2R78A 1TF1A 2KOIA 2P08A 2Y8HA 4KQDA 2D02A 3KX0X 1F98A 3KSIA 2XA7S 2VEAA 3MFXA 3LIFA 2MJ6A 3CAXA 4MMNA 5EFWA 3MF0A 2I9VA 5IT5A 4JGRA 4L9GA 3EEHA 2VJWA 3UB6A 4M4XA 2W1RA 2ZBBA 3T4TA 4NKPA 1GSVA 4K08A 2JKRM 2QWSA 1YSPA 3T4KA 3K3CA 4O0PA 5G4ZA 2O0YA 3S7NA 2Z6CA 4MN7A 5HD5A 3MXQA 2W3FA 3VE3A 1OT9A 4GS9B 1F5MA 3MQOA 4CLCA 2M7VA 2VV8A 3FPWA 2QKPA 2V0UA 4NXEA 4ZRRA 2O9AA 3UMEA 2JKTM 4KUOA 4Y3IA 1P9RA 1N9NA 1OTBA 2HJ9C 1S1ZA 3OCNA 1TD5A 1XFNA 3BWLA 3LIEA 2IA2A 2J3TD 3D3OA 3EWKA 4ETXA 3SW1A 5HWVA 4GW9A 4B93A 3KSFA 1T1BA 5DKKA 2K2NA 1S66L 3FPVA 2PD8A 3F1NB 4GS9A 4LRYC 1P97A 4LRXC 2INWA 1P9WA 4Y5FA 5IS1A 4HH3A 5HD3A 3S7OA 4F3LA 5HZHA 1S67L 3CLOA 5L8MA 5MC7A 4WEJA 4OOMA 4HOIA 4IHQA 5TJJA 4CQHA 2HV1A 3EOIA 3LIDA 1DP8A 1UWNX 4HP4A 3UB8A 3FC7A 1ZTUA 4UEYA 3HJIA 5J4EA 2KDKA 3F1NA 1T1CA 3KYZA 4P6ZS 4NXBA 4DJ3A 3PBNA 4EXOA 3S7PA 1ZHHB 2PHYA 4EUVA 3LR5A 5J3WA 4WN5A 4II7A 3P01A 3VV4A 4UQIS 3UE6A 4ARZB 1XJ6A 3PR6A 2VGLS 1DP6A 2WKQA 2XSSA 4MN5A 2BASA 4DMZA 1G28A 4ETZA 5F69A 4L9EA 1YAXA 4EQ1A 1DRMA 4EW7A 4WF0A 3F1PA 2KLIA 3OC2A 5K5BA 3JVVA 3UE3A 3E4QA 3P7NA 1W63Q 1NLZA 3EQUA 2OAP1 3S7QA 4IUHA 3H7WA 2ZMVA 2ZOIA 3E0YA 3JVUA 4EU0A 3OOVA 1TS6A 3MJQA 2Z6DA 3BQAA 4GCZA 3G6OA 1TS8A 3PYPA 4HP9A 2OOLA 4IUKA 4ME4A 2B02A 4FSFA 4BJPA 4YOFA 4NXGA 4R38A 3BJNA 1GSXA 3IBRA 2G7UA 2PR6A 1D06A 3MQQA 3PBTA 1UGUA 4Q0JA 5HDDA 4HJ4A 5HWTA 4Y2FA 3FG8A 1N9LA 3TJZC 2ZMFA 4HIAA 1XJ2A 3OCLA 1S4SA 2VLGA 4L9FA 2OWHA 2XRNA 4I3IA 4I3JA 2NUTC 2VV6A 1LL8A 3H82B 1T1AA 2J80A 3F1OB 3C2WA 4Q0IA 2KX6A 4H6JB 4O8GA 3RH8B 3CI6A 3D72A 2OAQ1 4GHIB 3U2AA 2VA0A 4GLQA 5DKLA 3BY8A 4DJ2A 1S4RA 4BWIA 5DFYA 3UMDA 3MQ0A 4HNBA 4FOFA 4WUJA 4XT2B 3H82A 3KSGA 1MZUA 1H8MA 5TBMB 3F1OA 3CWFA 4L0LA 3EQVA 3V67A 4JGOA 2QHKA 2FZ0A 2JKRI 3OBFA 4GHIA 3EGXC 3CITA 2P7JA 1LSWA 3E4PA 2HJEA 2FH5A 3LYXA 3RFBA 5HWWA 3A0VA 1T18A 4LRZE 4I38A 5IU1A 4GJ4A 2M1CA 2PYRA 3LICA 5HSQA 3T4JA 4EEPA 1TS7A 4YNRA 1VHMA 2HGVA 1LSXA 2K7SA 2WKPA 4LPZA 5TBMA 1H3QA 2JKTI 4OOLA 4JGPA 4Z1WA 3IS2B 2PT7A 2V0WA 4WEKA 2VKSA 5F5YA 4NXFA 4HY8A 2VZWA 2NUPC 5AJGA 3R7WB 3T4QA 3NOPC 3TE8A 3PBSA 2YKHA 2A24B 2W1TB 2PDRA 3W2ZA 2VX8A 2PR5A 3H9WA 1UWPX 3UB7A 4I3AA 2A2LA 5F6AA 4EESA 1VB6A 2W27A 2W3GA 2O9BA 4BMWA 4CLCC 3A0RA 5F68A 4RQ9A 4R3AA 4DN0A 4PAUA 4WLAA 2ZOHA 5HPIA 1TS0A 1V9YA 1W63M 5HDCA 2A24A 4G3VA 3E98A 1OPXA 4ARZA 2YKFA 5A8BA 1D7EA 3MMHA 1G6OA 3BQ8A 3R4KA 1OTEA 3ICYA 1GSWA 4R70A 1OTDA 3LFVA 5DFXA 2LB5A 2K31A 3IBJA 4UQIM 5DJUA 1XJ4A 3CUEC 2WKRA 4B9OA 3ZQ5A 3K2NA 3B47A 1XFQA 4EETB 4MDZA 3LI8A 4WL9A 4NEED 4LLOB 4HI4A 4JGQA 2EA9A 2QYBA 3C30A 3T4LA 2EWVA 1Y28A 5HL6A 3E4OA 5LBRA 3RTYA 1NLYA 3PBOA 5AVEA 4CLCB 5I5LA 4E04A 3KYQA 3HCYA 3T4SA 2VV7A 2GX5A 2J3WA 2EWWA 1MKMA 3PHYA 3LR3A 2O99A 4CLCE 2L4RA 1P0ZA 2LB9A 4Q0HA 4QPRA 1NWZA 2M7UA 5DJTA 1F9IA 3VOLA 3PBQA 4EERA 5KIZA 3GDIA 3HJKA 4HH2A 3UB9A 3MR0A 3PBRA 1DP9A 2XA7M 1OJ5A 1KOUA 2H28A 3NHQA 3LUQA 4PKYG 5CX7A 4I5SA 3LIAA 4HJ3A 4PKYA 1OJGA 1JNUA 5FL3A 2QJ5A 4F3LB 4CLCD 4H6JA 5G4YA 3BY9A 4HHDA 2JHEA 3T4OA 3B42A 3K3DA 2L1MA 3VE4A 5KSHA 1OTIA 3ULFA 2D01A 3ZYTA 2O9CA 1IFQA 3CUEA 5AVFA 4XT2A 3C8CA 3A0SA 3TW8A 1LSVA 1T19A 5DF9A 4R6LA 3LI9A 1IOUA 3LIBA 2PYPA 2QJ7A 5HDSA 2V1AA 2V1BA 3NOUC 2GJ3A 3DBAA 1NRJA 1EW0A 5C5KA 2XROA 4KQOA 4BBTA 3LR4A 4PHTA 1WA9A 4MCWA 1OTAA 2OWJA 2JN7A 4HJ6A 1S1YA 3O5YA 4MN6A 3F1PB 2PD7A 3KO6A 3TRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9O A;  4KUK A;  1V9Z A;  3IS2 A;  1OT6 A;  3NOT C;  3H7W B;  4HQA A;  2W0N A;  1LT0 A;  4I39 A;  3B33 A;  2CMN A;  4BBV A;  3T50 A;  5J7E A;  1X0O A;  1ODV A;  3OLO A;  1XJ3 A;  3GEC A;  4BBU A;  2V9A A;  4EEU A;  2L0W A;  1BYW A;  3NJA A;  4YWZ A;  2R78 A;  4KQD A;  2D02 A;  3KX0 X;  1F98 A;  2VEA A;  3MFX A;  3LIF A;  5EFW A;  3CAX A;  2I9V A;  4JGR A;  4L9G A;  3EEH A;  3UB6 A;  4M4X A;  2ZBB A;  1GSV A;  4K08 A;  2QWS A;  3K3C A;  5G4Z A;  2Z6C A;  5HD5 A;  3MXQ A;  3VE3 A;  1OT9 A;  4GS9 B;  3MQO A;  2VV8 A;  2QKP A;  2V0U A;  4NXE A;  3UME A;  4KUO A;  1N9N A;  1OTB A;  1S1Z A;  1XFN A;  3BWL A;  3LIE A;  3SW1 A;  3EWK A;  5HWV A;  4GW9 A;  1T1B A;  5DKK A;  1S66 L;  2PD8 A;  3F1N B;  4GS9 A;  4LRY C;  1P97 A;  4LRX C;  2INW A;  5IS1 A;  4HH3 A;  5HD3 A;  4F3L A;  5HZH A;  1S67 L;  3CLO A;  4HOI A;  2HV1 A;  4HP4 A;  3LID A;  1DP8 A;  1UWN X;  3UB8 A;  3FC7 A;  3HJI A;  5J4E A;  2KDK A;  3F1N A;  1T1C A;  4NXB A;  4DJ3 A;  4EXO A;  2PHY A;  5J3W A;  4WN5 A;  3UE6 A;  1XJ6 A;  1DP6 A;  2WKQ A;  4MN5 A;  2BAS A;  1G28 A;  5F69 A;  4L9E A;  4EQ1 A;  1DRM A;  4EW7 A;  4WF0 A;  3F1P A;  3E4Q A;  3P7N A;  3H7W A;  2ZOI A;  1TS6 A;  3MJQ A;  2Z6D A;  4GCZ A;  3G6O A;  1TS8 A;  3PYP A;  4HP9 A;  2OOL A;  2B02 A;  4NXG A;  4R38 A;  1GSX A;  3IBR A;  2PR6 A;  1D06 A;  3MQQ A;  1UGU A;  5HDD A;  4HJ4 A;  5HWT A;  3FG8 A;  1N9L A;  4HIA A;  1XJ2 A;  1S4S A;  2VLG A;  4L9F A;  2OWH A;  4I3I A;  4I3J A;  2VV6 A;  1LL8 A;  3H82 B;  1T1A A;  2J80 A;  3F1O B;  3C2W A;  2KX6 A;  4H6J B;  3RH8 B;  3D72 A;  4GHI B;  5DKL A;  3BY8 A;  4DJ2 A;  1S4R A;  3UMD A;  4HNB A;  4WUJ A;  4XT2 B;  3H82 A;  1MZU A;  5TBM B;  3F1O A;  3CWF A;  4JGO A;  2QHK A;  4GHI A;  2P7J A;  1LSW A;  3E4P A;  3LYX A;  5HWW A;  3A0V A;  1T18 A;  4LRZ E;  4I38 A;  5IU1 A;  2M1C A;  2PYR A;  3LIC A;  5HSQ A;  4EEP A;  1TS7 A;  1LSX A;  2K7S A;  2WKP A;  4LPZ A;  5TBM A;  4JGP A;  3IS2 B;  2V0W A;  5F5Y A;  4NXF A;  4HY8 A;  3NOP C;  2YKH A;  2A24 B;  2PDR A;  2PR5 A;  3H9W A;  1UWP X;  3UB7 A;  4I3A A;  5F6A A;  4EES A;  1VB6 A;  2W27 A;  3A0R A;  5F68 A;  4RQ9 A;  4R3A A;  4WLA A;  2ZOH A;  1TS0 A;  1V9Y A;  5HDC A;  2A24 A;  2YKF A;  5A8B A;  1D7E A;  1OTE A;  3ICY A;  1GSW A;  4R70 A;  1OTD A;  5DJU A;  1XJ4 A;  2WKR A;  4B9O A;  3ZQ5 A;  1XFQ A;  4EET B;  3LI8 A;  4WL9 A;  4LLO B;  4HI4 A;  4JGQ A;  2EA9 A;  1Y28 A;  3E4O A;  3RTY A;  5AVE A;  5I5L A;  4E04 A;  2VV7 A;  3PHY A;  2L4R A;  1P0Z A;  1NWZ A;  5DJT A;  1F9I A;  3VOL A;  4EER A;  5KIZ A;  3GDI A;  3HJK A;  4HH2 A;  3UB9 A;  3MR0 A;  1DP9 A;  1OJ5 A;  1KOU A;  2H28 A;  3NHQ A;  3LUQ A;  4PKY G;  4I5S A;  3LIA A;  4HJ3 A;  4PKY A;  1OJG A;  1JNU A;  4F3L B;  2QJ5 A;  4H6J A;  5G4Y A;  3BY9 A;  4HHD A;  2JHE A;  3K3D A;  2L1M A;  3VE4 A;  1OTI A;  3ULF A;  2D01 A;  5AVF A;  4XT2 A;  3C8C A;  3A0S A;  1LSV A;  1T19 A;  4R6L A;  3LI9 A;  3LIB A;  2PYP A;  2QJ7 A;  5HDS A;  2V1A A;  2V1B A;  3NOU C;  2GJ3 A;  1EW0 A;  4BBT A;  1WA9 A;  1OTA A;  2OWJ A;  2JN7 A;  4HJ6 A;  1S1Y A;  4MN6 A;  3F1P B;  2PD7 A; 
#chains in the Genus database with same CATH topology
 5L09 A;  4KUK A;  1YKD A;  1V9Z A;  1BLS A;  4RX3 A;  1STZ A;  5JYP A;  3H7W B;  3O87 A;  2W0N A;  4NET A;  2HF6 A;  4GD6 A;  3GTC A;  3BM6 A;  2CMN A;  1CK3 A;  2GNX A;  3OPL A;  5HPF A;  4PM8 A;  4P6B A;  3OLO A;  3V50 A;  1XJ3 A;  2W3E A;  2Y79 A;  1CI9 A;  3FYZ A;  1K38 A;  4O01 A;  3Q07 A;  3NJA A;  4YWZ A;  2QZ6 A;  4ZJ3 A;  1KVL A;  1PYY A;  3A3F A;  2P08 A;  2Y8H A;  4IVI A;  5EVL A;  3PAG A;  3KX0 X;  1F98 A;  2XA7 S;  5IT5 A;  1MY8 A;  3MF0 A;  4O7D A;  3T4T A;  3ZGA B;  3ZVT A;  5CEC A;  5GLD A;  4UAA A;  5G4Z A;  2O0Y A;  2XD5 A;  1E25 A;  1WE4 A;  5HD5 A;  4DE2 A;  5CRF A;  3VE3 A;  1ZC2 A;  1OT9 A;  5FAS A;  3MQO A;  4CLC A;  2M7V A;  2VV8 A;  3FPW A;  3T12 B;  3ISG A;  2V0U A;  2JKT M;  4KUO A;  4PMA A;  5TGF A;  4B88 A;  1OTB A;  2HJ9 C;  3VP4 A;  1YLW A;  5CGX A;  4OH0 A;  5A93 A;  1H8Z A;  4MLL A;  2XGN A;  3UB5 P;  3D3O A;  1KE3 A;  1I2W A;  3EWK A;  3SW1 A;  2G2W A;  4KZ7 A;  1PIO A;  1S66 L;  3ITB A;  1CJF A;  4GOG A;  4LRX C;  1Y54 A;  4Y5F A;  3DTE A;  5HD3 A;  3N6I A;  1BLH A;  4F3L A;  3NY4 A;  3ZG8 B;  4Y13 A;  4E3O A;  3FZC A;  2PAV P;  4IHQ A;  1IKG A;  4CQH A;  3EOI A;  3SS4 A;  1ONG A;  2WGV A;  2Q0O A;  1BSG A;  2X02 A;  4QJG A;  3PBN A;  3S7P A;  1ZHH B;  4X68 A;  4WN5 A;  2Y59 A;  4EV4 A;  5M1A A;  5HL1 A;  2HZ5 A;  2G2U A;  2BAS A;  1XA7 A;  1DRM A;  1LHY A;  5KMW A;  3JVV A;  3E4Q A;  4OPR A;  3HLC A;  3EQU A;  2OAP 1;  3S7Q A;  1CI8 A;  2H0Y A;  3JVU A;  3OOV A;  2Y2P A;  3MJQ A;  4D60 A;  2OLU A;  4GCZ A;  3LY3 A;  3PYP A;  3UDI A;  2JC7 A;  2OOL A;  4IUK A;  1ERO A;  2B02 A;  2B95 A;  4NXG A;  4R38 A;  1YM1 A;  2G7U A;  2PR6 A;  3S1Y A;  5HAQ A;  4HBU A;  4ZTK A;  1IYO A;  2J9O A;  4HJ4 A;  1N9L A;  4WZ5 C;  3RXX A;  3TJZ C;  1S4S A;  4L9F A;  4FH2 A;  4I3J A;  2NUT C;  2VV6 A;  1SKO A;  3H82 B;  2Z2M B;  2J80 A;  3F1O B;  3LEZ A;  3C2W A;  1FR6 A;  3CI6 A;  3MXS A;  1M40 A;  1K6R A;  4KEN B;  2VGJ A;  3Q81 A;  4DJ2 A;  1S4R A;  2ZL1 B;  2HDR A;  3MQ0 A;  3HUM A;  3H82 A;  1MZU A;  1H8M A;  5TBM B;  3CPT B;  3F1O A;  2RCX A;  4PM5 A;  3NC8 A;  3G32 A;  2OLV A;  3OBF A;  3WS0 A;  2A49 A;  2Y2I A;  5EVE A;  2P7J A;  1LSW A;  1ACF A;  3LYX A;  3RFB A;  5HAI A;  1Q2Q A;  5IU1 A;  2Y4A A;  5HSQ A;  4EEP A;  1CQA A;  1LSX A;  1ESI A;  2WKP A;  4LPZ A;  4OP8 A;  5TBM A;  1DY6 A;  4FCF A;  4CJN A;  2PT7 A;  2VKS A;  4FH4 A;  5AJG A;  2YKH A;  3W2Z A;  1NJ4 A;  2WK0 A;  1D1J A;  1PW8 A;  1VB6 A;  2J9P A;  4CLC C;  4GDN A;  4E6X A;  4PAU A;  2C5W B;  3WS4 A;  1TS0 A;  1W63 M;  5HDC A;  4G3V A;  1OPX A;  4UA7 A;  4ZJ1 A;  5A8B A;  3BQ8 A;  1LI9 A;  3ICY A;  4LGW A;  3MKF A;  3AGD A;  4K91 A;  1OTD A;  3MFD A;  4C75 A;  2LB5 A;  4CPK A;  3A3E A;  4JKT A;  1FR1 A;  1GA0 A;  3TG9 A;  1HZO A;  4MDZ A;  4NEE D;  1XX2 A;  3T4L A;  1JTD A;  2EWV A;  4E3K A;  4JXV A;  5HL6 A;  3E4O A;  4Y15 A;  3PBO A;  5AVE A;  2ZQ9 A;  1JVJ A;  3HCY A;  1YLZ A;  3ZG9 B;  3A3J A;  1MKM A;  3PHY A;  3LR3 A;  5DVA A;  4QPR A;  1P0Z A;  4Q0H A;  1NWZ A;  2V8C A;  3ZCZ A;  5FEG A;  5KIZ A;  1K57 A;  1YLJ A;  1K54 C;  1ALQ A;  1NYY A;  2EXB A;  2HP5 A;  3O88 A;  4M3K A;  4IBX A;  1SKF A;  4MBK A;  1TEM A;  2ZQ8 A;  3LUQ A;  3LIA A;  1N9B A;  4S2J A;  2Z2L B;  3VP3 A;  1OJG A;  5FL3 A;  2IWC A;  4ESP A;  2HDU A;  1CF0 A;  1SHV A;  4DKI A;  3IX8 A;  4OP5 A;  4S2N A;  5AQ7 A;  4E6W A;  5KSH A;  1MKI A;  1FCO A;  3ULF A;  2D01 A;  3D4F A;  1PI5 A;  5GHY A;  3HLG A;  1PWD A;  3GQZ A;  3UN7 A;  5DF9 A;  4R6L A;  1IOU A;  2QJ7 A;  5HDS A;  4N9L A;  1FOF A;  1IEM A;  3HUN A;  4KQO A;  4BBT A;  4OQG A;  4PHT A;  2Q9M A;  4MCW A;  1F2K A;  2ZMA A;  1S1Y A;  4DE0 A;  4MN6 A;  3TSG A;  1N9O A;  3N4I A;  3KSH A;  3GVB A;  3PXP A;  1H0M A;  2B18 A;  5E2F A;  3BFE A;  4HQA A;  3LR0 A;  3R7W A;  1LT0 A;  5FDH A;  2W1T A;  3WWX A;  2R9X A;  2W3H A;  1Z09 A;  4BBV A;  3T50 A;  5J7E A;  1NYM A;  1X0O A;  4E3N A;  1ODV A;  3EGD C;  4G3W A;  4G3K A;  3VP2 A;  3G2Y A;  4EEU A;  1N4O A;  5EEC A;  2P04 A;  3LY4 A;  1SCW A;  5CXW A;  3NCK A;  3SH7 A;  3IWI A;  1H8Y A;  5HX9 A;  1TDG A;  3MFX A;  4MMN A;  2I9V A;  4L9G A;  5CEB A;  1PWC A;  2VJW A;  4M4X A;  5KSC A;  3C4P A;  2W1R A;  5JYO A;  4NKP A;  2JKR M;  3BLM A;  3FV7 A;  3K3C A;  2WYX A;  2DRW A;  4QD4 A;  3S7N A;  3MXQ A;  5L07 A;  5E2E A;  3S4X A;  2ZC3 B;  4GS9 B;  1F5M A;  4OKP A;  3NBL A;  3UY6 A;  3UME A;  1DJB A;  1P9R A;  1YLP A;  1N9N A;  1S1Z A;  5F1G A;  4DE1 A;  4JF6 A;  3ZNT A;  4ETX A;  3UNW A;  5HWV A;  4GW9 A;  1T1B A;  2K2N A;  5FQM A;  1IEL A;  2WZZ A;  4GS9 A;  4WZ4 A;  3GV9 A;  2INW A;  4A5R A;  5IS1 A;  4HH3 A;  1RGY A;  1C3B A;  4NG2 A;  3MXR A;  5L8M A;  1J3W A;  2ZLY A;  4WEJ A;  4OOM A;  5TJJ A;  3CZD A;  2HV1 A;  3LID A;  3UO9 A;  1RGZ A;  1L0E A;  3FC7 A;  3UB8 A;  4D2O A;  4UEY A;  3HJI A;  3KYZ A;  1GCE A;  1M6K A;  3U4L P;  3T1R A;  4BL3 A;  4WYY A;  2EXA A;  4EUV A;  5J3W A;  3P01 A;  5FSR A;  3VV4 A;  3ZVW A;  5A91 A;  3UE6 A;  2JBF A;  4ARZ B;  2BLS A;  1GHP A;  3AGE A;  4JPM A;  4MN5 A;  5FQJ A;  5BOH A;  1K57 C;  5EOE A;  2V1Z A;  4IVK A;  5F69 A;  2JKF A;  4L9E A;  4EQ1 A;  4WF0 A;  2H0T A;  3F1P A;  4Z9Q A;  5K5B A;  2EX8 A;  3UE3 A;  1W63 Q;  2ZC5 B;  3H7W A;  2ZOI A;  4MBF A;  4RYE A;  2Y2G A;  3UPN A;  1K0K A;  1TS8 A;  4S2N C;  3UPP A;  4HP9 A;  4ME4 A;  4YOF A;  2RL3 A;  3IQA A;  3VFH A;  1BLC A;  3IBR A;  3B3X A;  3MQQ A;  3IF6 C;  1UGU A;  1NY0 A;  5HDD A;  5FI7 A;  2ZQD A;  2Y2H A;  4YFM A;  3A3I A;  2V2F F;  5HFO A;  5EVI B;  3D72 A;  3ZFZ A;  4GHI B;  4LV1 A;  3U2A A;  4KQQ A;  3VOZ A;  2IWD A;  3GSG A;  3VSL A;  1IKI A;  3BFD A;  2JKG A;  4KG6 A;  4HNB A;  4XT2 B;  3SOI A;  1YLT A;  3CWF A;  3V67 A;  2AVX A;  5AQA A;  2ZJ9 A;  3HLF A;  2FZ0 A;  4EBP A;  4K0W A;  1TDL A;  4GHI A;  3CIT A;  3E4P A;  3A0V A;  4Q8I A;  2WKI A;  1HVB A;  4GJ4 A;  2M1C A;  5EOO A;  3LIC A;  1TS7 A;  4X25 A;  4YNR A;  3ZG5 A;  3D9Y A;  2JKT I;  5EPH A;  4P87 A;  3IS2 B;  5F5Y A;  4X1M A;  2VZW A;  5FQK A;  4JF4 A;  2NUP C;  2UV0 E;  2A24 B;  2PDR A;  1UWP X;  4LV0 A;  1K55 C;  1EI5 A;  1PZP A;  5EM0 A;  2R9W A;  2O9B A;  5GHX A;  3A0R A;  1ONH A;  5F68 A;  4RQ9 A;  3IWO A;  2C6W B;  3HUO A;  2QPN A;  5HPI A;  5CGS A;  2A24 A;  3E98 A;  2EX6 A;  1MXO A;  2DNS A;  1D7E A;  3MMH A;  3R4K A;  2DCF A;  1GSW A;  4KG5 A;  1K6S A;  2X71 A;  3L7H A;  4UHU A;  4N92 A;  4B4Z A;  3G31 A;  2K31 A;  4UQI M;  3BLS A;  2WKR A;  4Y0O A;  1I2S A;  1MWS A;  3ZQ5 A;  1XFQ A;  5M19 A;  4EET B;  1FSW A;  3BEC A;  4X6T A;  4HI4 A;  3SH8 A;  3IXD A;  3JPU A;  3M6H A;  1PNE A;  4OPQ A;  1Y28 A;  1QMF A;  5HAR A;  4DE3 A;  2EX9 A;  3RTY A;  5E43 A;  1NLY A;  4U3T A;  3NDG A;  1MWU A;  3IHB A;  2J3W A;  4ID4 A;  1GA9 A;  4WM9 A;  2LB9 A;  2XFT A;  1F9I A;  4EER A;  1NZU A;  3GDI A;  3HJK A;  4HH2 A;  3MR0 A;  4OQ0 A;  4FD8 A;  2WKE A;  1SZV A;  4EBN A;  2XR0 A;  2VGK A;  5CTM A;  3NHQ A;  4JXW A;  4HJ3 A;  1ES5 A;  1JNU A;  5AQB A;  4BD0 A;  3BY9 A;  3VP1 A;  4HHD A;  5GLB A;  2P9V B;  4OPY A;  3QHY A;  1DJA A;  3K3D A;  1YT4 A;  1L0F A;  3ZNY A;  3PAE A;  3QP1 A;  1OTI A;  2ZL1 A;  2O9C A;  3CUE A;  2Y2M A;  3C8C A;  1T19 A;  4EBL A;  3CPT A;  2B5R A;  4XXR A;  1ESU A;  2PYP A;  1FCN A;  2P9V A;  2V1A A;  2V1B A;  2GJ3 A;  1OME A;  3V3R A;  2H5S A;  4E3I A;  5FAQ A;  2JCH A;  4U0X A;  1WA9 A;  1BUE A;  2PBY A;  2FFF B;  4HJ6 A;  3O5Y A;  4QY5 A;  2PD7 A;  3EEA A;  1OT6 A;  4WEL A;  3C38 A;  3NOT C;  2ZM2 A;  1VET B;  4R0Q A;  5EUA A;  5DF7 A;  4KZ9 A;  4AFI A;  3VSK A;  3N8L A;  4P6Z M;  3Q82 A;  5CER A;  1U60 A;  3OZH A;  3WS1 A;  2HDS A;  4ZBE A;  4BBU A;  3BW6 A;  2Y55 A;  1ZG6 A;  3HRE A;  2W3D A;  1BYW A;  3O86 A;  1HD8 A;  5CGW A;  4GZB A;  1YSQ A;  2EX2 A;  2DMW A;  2R78 A;  4R3J A;  1E3U D;  3OPP A;  3M2K A;  4X69 A;  3DTK A;  3KSI A;  4R4R A;  2HPB A;  4R3B A;  3LIF A;  2MJ6 A;  3VFF A;  4EUZ A;  2FFY A;  2OV5 A;  3UB6 A;  1AWI A;  5DTK A;  4NK3 A;  4BEN A;  4K08 A;  4JF5 A;  2QWS A;  2Y2Q A;  4OQI A;  4X56 A;  1YSP A;  3T4K A;  1CEG A;  3M2J A;  1EWZ A;  1K56 A;  4PM9 A;  2Z6C A;  1FSY A;  1JWV A;  5FAT A;  1FQG A;  1BUL A;  1GHI A;  3NIA A;  4GNU A;  2QKP A;  4NXE A;  1PI4 A;  4ZRR A;  2O9A A;  1S0W A;  1XP4 A;  1LI0 A;  3ITA A;  4S2O A;  4E3M A;  3MS6 A;  1IYQ A;  1XGI A;  3BWL A;  3QNC A;  3QP4 A;  2J3T D;  4OPZ A;  3KSF A;  4KZA A;  2PD8 A;  4LRY C;  4DXB A;  4C6Y A;  1QME A;  1SDE A;  5A90 A;  3V39 A;  1P9W A;  1L2S A;  3I7J A;  5HZH A;  4QU3 A;  1S67 L;  3CLO A;  4KZ6 A;  3SZT A;  5GLA A;  5MC7 A;  2WZX A;  3JYI A;  4HOI A;  2PBD P;  1DP8 A;  1UWN X;  2E8I A;  1ZTU A;  3W8K A;  1XKZ A;  2KDK A;  2WUQ A;  4P6Z S;  4C3Q A;  2PHY A;  1KDW A;  1AXB A;  1MWR A;  4II7 A;  2ACG A;  4MBH A;  4KQR A;  3PR6 A;  3BFG A;  2HP9 A;  1DP6 A;  3UE0 A;  3DWZ A;  3CJM A;  4DMZ A;  2QMI A;  3IXH A;  1XA1 A;  4EW7 A;  3OC2 A;  4YIN A;  4OQH A;  4OLG A;  2XLN A;  4IUH A;  5EV0 A;  2ZMV A;  1KGF A;  1E3U A;  3E0Y A;  1TS6 A;  4P0M A;  3BQA A;  3G6O A;  1YMS A;  3W4O A;  3QP6 A;  4BJP A;  3ZG0 A;  2PU2 A;  3BJN A;  1GSX A;  2XK1 A;  3VP0 A;  1D06 A;  3Q7V B;  4F94 A;  2ZC4 B;  5HWT A;  4Y2F A;  3CMZ A;  3SS3 A;  2VLG A;  3G30 A;  4JBF A;  5F83 A;  2XRN A;  3BFF A;  4I3I A;  2Y2L A;  3S22 A;  3Q7Z A;  4BLM A;  3IX4 A;  1VEU B;  1LL8 A;  4DDS A;  1NZO A;  4HBT A;  4MEZ A;  3HL9 A;  2KX6 A;  4H6J B;  4O8G A;  2OAQ 1;  1W7F A;  4KZ8 A;  1S6R A;  4GLQ A;  1K4E A;  3G2Z A;  4GKU A;  2I72 A;  5DKL A;  3BY8 A;  4BWI A;  5DFY A;  3W4P A;  3UMD A;  2PU4 A;  1HLU P;  3DW0 A;  3OPH A;  3KSG A;  1CEF A;  3EQV A;  4JGO A;  3VMA A;  5DTS A;  2JKR I;  3BYD A;  1KDS A;  1JWZ A;  1RCJ A;  3EGX C;  3HBR A;  3PTE A;  5EVI D;  2FH5 A;  4X53 A;  3FKV A;  4LRZ E;  2XH9 A;  2VK3 A;  2ZQA A;  3LCE A;  3MSH A;  3C5A A;  4WEK A;  1JWP A;  2V0W A;  1YPR A;  4NXF A;  4ZJ2 A;  3TE8 A;  4WZ5 A;  3PBS A;  2UWX A;  1VM1 A;  3IWQ A;  2VX8 A;  2PR5 A;  3H9W A;  5CHU A;  5DTT A;  1FIK A;  3ZG7 B;  3UB7 A;  4I3A A;  4S2L A;  5F6A A;  1MWT A;  2W3G A;  2V8F A;  3BRM A;  3N8R A;  1IYS A;  1VQQ A;  5GLC A;  4BMW A;  1E4D A;  3GMW A;  3P09 A;  4WLA A;  3Q1F A;  1V9Y A;  4ARZ A;  4WMC D;  4Y0T A;  2YKF A;  1L0G A;  5KZH A;  1G6O A;  4UA9 A;  4S2I A;  3NUL A;  1K25 A;  3C7V A;  3DTM A;  3LFV A;  1PW1 A;  3IBJ A;  1XJ4 A;  3K2N A;  1KE4 A;  4FTX A;  4LLO B;  2EA9 A;  3G34 A;  3MZE A;  4DDY A;  4S2K A;  1DJC A;  4CLC B;  5M18 A;  2WGW B;  3T4S A;  3G35 A;  4DXC A;  4R23 A;  2O99 A;  4LEN A;  2L4R A;  4CLC E;  5J8X A;  3OPR A;  3PBQ A;  4BD1 A;  4OVD A;  3PBR A;  1DP9 A;  1YLY A;  3G4P A;  1OJ5 A;  3W4Q A;  2BG1 A;  4DF6 A;  3LEQ A;  5EM1 A;  4GB7 A;  5GHZ A;  4XUZ A;  2WGW A;  4I5S A;  4PKY A;  3BEB A;  3IHA A;  4F3L B;  2QJ5 A;  5EVI A;  4U0T A;  3NDE A;  3T4O A;  2WAE A;  3B42 A;  3QP2 A;  4LFU A;  3AGF A;  2HDQ A;  5CTN A;  1ZKJ A;  1ES2 A;  3ZYT A;  3T1S A;  3T1Q B;  5AVF A;  4XT2 A;  5FEF A;  4X55 A;  1BT5 A;  5FQQ A;  3TW8 A;  3LI9 A;  3VOY A;  3LIB A;  1ZG4 A;  1G6A A;  4ZDX A;  3DBA A;  3FWL A;  5C5K A;  2XRO A;  4EQI A;  1FIL A;  2JN7 A;  5U47 A;  3N8S A;  3TRC A;  4RX2 A;  1MPL A;  2X01 A;  3SS5 A;  2XDM A;  4PM6 A;  3IS2 A;  2ZM8 A;  4WMC A;  1K54 A;  5FQI A;  4I39 A;  3FKW A;  1ES4 A;  5G18 A;  3IX3 A;  3B33 A;  2J3T C;  3L9K A;  1LL5 A;  1W79 A;  3IH8 A;  5TFQ A;  2J7V A;  3GEC A;  2V9A A;  2E8J A;  2L0W A;  1MC0 A;  3NEC A;  3LO7 A;  2GZA A;  4RVA A;  2VGL M;  1XPB A;  5FDS A;  4IJG A;  1TF1 A;  2KOI A;  2H10 A;  4JLF A;  2OSU A;  4KQD A;  2D02 A;  1SKO B;  1PRQ A;  2VEA A;  1J9M A;  3CAX A;  5EFW A;  4JGR A;  3EEH A;  5TR7 A;  4N1X A;  1FCM A;  1PFL A;  2ZBB A;  1K4F A;  1GSV A;  3HLD A;  4N9K A;  4O0P A;  1KGG A;  2ZC6 B;  5E2H A;  1IYP A;  4UA6 A;  3GR2 A;  4MN7 A;  1XXM A;  2W3F A;  2Y2K A;  4LV2 A;  2ZM0 A;  1K56 D;  5D3O A;  1ERQ A;  1Z6F A;  3C4O A;  5CHJ A;  4Y3I A;  1KVM A;  4HES A;  3OCN A;  1TD5 A;  3MZF A;  1XFN A;  3LIE A;  2IA2 A;  3RXW A;  4LCM A;  4K0X A;  4QWO A;  3P98 A;  4B93 A;  3QP5 A;  5DKK A;  3FPV A;  1BTL A;  1NXY A;  3F1N B;  4PPR A;  1Q2P A;  1P97 A;  3E2L A;  1HTZ A;  1I5Q A;  3UDF A;  3S7O A;  4R1G A;  4LV3 A;  2P74 A;  3IXB A;  4GN2 A;  3UPO A;  3HLE A;  2V20 A;  4HP4 A;  2Y2O A;  1Y4O A;  1NRF A;  2ZD8 A;  3CG5 A;  2A3U A;  4P85 A;  5J4E A;  3F1N A;  1T1C A;  4NXB A;  4DJ3 A;  4EXO A;  2EFX A;  3LR5 A;  4UQI S;  4Y7P A;  1XJ6 A;  4IED A;  2VGL S;  2WKQ A;  4Y17 A;  2XSS A;  2Q9N A;  1G28 A;  4ETZ A;  1YAX A;  3C7U A;  2Y2N A;  2KLI A;  4GDB A;  2ZC7 A;  3P7N A;  1WYB A;  1LL9 A;  2CC1 A;  1O07 A;  1NLZ A;  5FQ9 A;  5FI2 A;  4EU0 A;  5EVI C;  1VET A;  1L0D A;  1H5X A;  2Z6D A;  5DF8 A;  1RP5 A;  3QNB A;  1W8Y A;  4DRT A;  2XD1 A;  4FSF A;  2WAD A;  5CED A;  3SH9 A;  3PBT A;  4Q0J A;  2PRF A;  3ZHH A;  2BTF P;  2GDN A;  1MBL A;  5FA7 A;  2XFS A;  3FG8 A;  3V5M A;  2ZMF A;  4HIA A;  1XJ2 A;  1W5D A;  3OCL A;  1ES3 A;  2OWH A;  1G68 A;  3WRT A;  2Y2J A;  3CHW P;  1A0K A;  1T1A A;  2HP6 A;  4Q0I A;  3RH8 B;  1YQS A;  1KE0 A;  5HW3 A;  2VA0 A;  5FAP A;  3NI9 A;  4JXG A;  4EWF A;  5IHV A;  4FOF A;  1ERM A;  4WUJ A;  5E2G A;  3IF6 B;  1XGJ A;  4L0L A;  5CHM A;  2QHK A;  3UDX A;  2HJE A;  3T1X A;  3DTI A;  4FUW A;  5HWW A;  2WAF A;  2XQZ A;  2WKH A;  1T18 A;  4I38 A;  2PYR A;  3T4J A;  2ZQ7 A;  4H8R A;  1VHM A;  2HGV A;  3E2K A;  3DWK A;  2K7S A;  3IF6 A;  1H3Q A;  4OOL A;  4JGP A;  4Z1W A;  1BLP A;  5F1F A;  3M6B A;  4HY8 A;  1JTG A;  4KZ4 A;  3R7W B;  4S2P A;  3T4Q A;  3NOP C;  2W1T B;  3WS2 A;  5HAP A;  2A2L A;  4EES A;  3WRZ A;  2W27 A;  3IH9 A;  4MNR A;  4QY6 A;  4ZAM A;  1BZA A;  2J8Y A;  4R3A A;  4DN0 A;  2ZOH A;  2Y91 A;  4XUX A;  4QHC A;  3IF5 A;  3RJU A;  1L3L A;  4QB8 A;  2JE5 A;  3MBZ A;  3IXG A;  3BFC A;  3V3S A;  2EFU A;  1OTE A;  3IT9 A;  3TOI A;  1PWG A;  4OLD A;  4E3L A;  4R70 A;  5GL9 A;  4KG2 A;  5DFX A;  5DJU A;  3CUE C;  4B9O A;  4RA7 A;  4KZ5 A;  3B47 A;  4PM7 A;  3LGO A;  3LI8 A;  4WL9 A;  4JGQ A;  2QYB A;  3C30 A;  3MZD A;  2XEP A;  1W8Q A;  5LBR A;  4Y0U A;  5I5L A;  4E3J A;  4E04 A;  3KYQ A;  2VV7 A;  2GX5 A;  2EWW A;  5L2F A;  4KZ3 A;  3GRJ A;  3Q7V A;  2M7U A;  5DJT A;  3VOL A;  1G5U A;  1TVF A;  1K55 A;  4X1L A;  3UB9 A;  4S2M A;  3ZDJ A;  3HLB A;  4WBG A;  2XA7 M;  2XF3 A;  1KOU A;  4KZB A;  4B4X A;  2H28 A;  1VEU A;  3HVF A;  3HLW A;  5CX7 A;  2ZQC A;  4PKY G;  5AQ9 A;  4CLC D;  4H6J A;  5G4Y A;  2JHE A;  5L10 A;  1LLB A;  3MKE A;  5I94 A;  2L1M A;  3VE4 A;  3O3V A;  1YMX A;  5EE8 A;  2IWB A;  4HEF A;  3UE1 A;  3QP8 A;  4OOY A;  4R4S A;  4JXS A;  1IFQ A;  4OON A;  3N7W A;  1SDN A;  3A0S A;  1KGE A;  4IBR A;  5FI6 A;  1O7E A;  1LSV A;  1PZO A;  3A3D A;  3WS5 A;  4N1H A;  4BL2 A;  4BQM A;  1GHM A;  3NOU C;  1NRJ A;  2WGI A;  1EW0 A;  5FAO A;  3LR4 A;  4GD8 A;  4LCL A;  5F82 A;  1OTA A;  2OWJ A;  5A92 A;  3F1P B;  3KO6 A;  3DAV A;  3KYE A;  1WYC A; 
#chains in the Genus database with same CATH homology
 1N9O A;  4KUK A;  1YKD A;  3KSH A;  3PXP A;  1V9Z A;  2B18 A;  3EEA A;  3IS2 A;  1OT6 A;  4WEL A;  1STZ A;  3C38 A;  3NOT C;  3H7W B;  4HQA A;  2W0N A;  3LR0 A;  3R7W A;  1LT0 A;  2HF6 A;  4I39 A;  2W1T A;  3B33 A;  2CMN A;  2GNX A;  2J3T C;  5HPF A;  2W3H A;  4AFI A;  4BBV A;  3T50 A;  4P6Z M;  5J7E A;  1X0O A;  1ODV A;  3EGD C;  4G3W A;  3OLO A;  1XJ3 A;  3GEC A;  4BBU A;  2W3E A;  2V9A A;  2Y79 A;  4G3K A;  3BW6 A;  4EEU A;  2L0W A;  1MC0 A;  2W3D A;  1BYW A;  2GZA A;  2VGL M;  4O01 A;  2P04 A;  3NJA A;  4YWZ A;  1YSQ A;  4IJG A;  2DMW A;  2R78 A;  1TF1 A;  2KOI A;  2P08 A;  2Y8H A;  4KQD A;  2D02 A;  3KX0 X;  1F98 A;  3KSI A;  2XA7 S;  2VEA A;  3MFX A;  3LIF A;  2MJ6 A;  3CAX A;  4MMN A;  5EFW A;  3MF0 A;  2I9V A;  5IT5 A;  4JGR A;  4L9G A;  3EEH A;  2VJW A;  3UB6 A;  4M4X A;  2W1R A;  2ZBB A;  3T4T A;  4NKP A;  1GSV A;  4K08 A;  2JKR M;  2QWS A;  1YSP A;  3T4K A;  3K3C A;  4O0P A;  5G4Z A;  2O0Y A;  3S7N A;  2Z6C A;  4MN7 A;  5HD5 A;  3MXQ A;  2W3F A;  3VE3 A;  1OT9 A;  4GS9 B;  1F5M A;  3MQO A;  4CLC A;  2M7V A;  2VV8 A;  3FPW A;  2QKP A;  2V0U A;  4NXE A;  4ZRR A;  2O9A A;  3UME A;  2JKT M;  4KUO A;  4Y3I A;  1P9R A;  1N9N A;  1OTB A;  2HJ9 C;  1S1Z A;  3OCN A;  1TD5 A;  1XFN A;  3BWL A;  3LIE A;  2IA2 A;  2J3T D;  3D3O A;  3EWK A;  4ETX A;  3SW1 A;  5HWV A;  4GW9 A;  4B93 A;  3KSF A;  1T1B A;  5DKK A;  2K2N A;  1S66 L;  3FPV A;  2PD8 A;  3F1N B;  4GS9 A;  4LRY C;  1P97 A;  4LRX C;  2INW A;  1P9W A;  4Y5F A;  5IS1 A;  4HH3 A;  5HD3 A;  3S7O A;  4F3L A;  5HZH A;  1S67 L;  3CLO A;  5L8M A;  5MC7 A;  4WEJ A;  4OOM A;  4HOI A;  4IHQ A;  5TJJ A;  4CQH A;  2HV1 A;  3EOI A;  3LID A;  1DP8 A;  1UWN X;  4HP4 A;  3UB8 A;  3FC7 A;  1ZTU A;  4UEY A;  3HJI A;  5J4E A;  2KDK A;  3F1N A;  1T1C A;  3KYZ A;  4P6Z S;  4NXB A;  4DJ3 A;  3PBN A;  4EXO A;  3S7P A;  1ZHH B;  2PHY A;  4EUV A;  3LR5 A;  5J3W A;  4WN5 A;  4II7 A;  3P01 A;  3VV4 A;  4UQI S;  3UE6 A;  4ARZ B;  1XJ6 A;  3PR6 A;  2VGL S;  1DP6 A;  2WKQ A;  2XSS A;  4MN5 A;  2BAS A;  4DMZ A;  1G28 A;  4ETZ A;  5F69 A;  4L9E A;  1YAX A;  4EQ1 A;  1DRM A;  4EW7 A;  4WF0 A;  3F1P A;  2KLI A;  3OC2 A;  5K5B A;  3JVV A;  3UE3 A;  3E4Q A;  3P7N A;  1W63 Q;  1NLZ A;  3EQU A;  2OAP 1;  3S7Q A;  4IUH A;  3H7W A;  2ZMV A;  2ZOI A;  3E0Y A;  3JVU A;  4EU0 A;  3OOV A;  1TS6 A;  3MJQ A;  2Z6D A;  3BQA A;  4GCZ A;  3G6O A;  1TS8 A;  3PYP A;  4HP9 A;  2OOL A;  4IUK A;  4ME4 A;  2B02 A;  4FSF A;  4BJP A;  4YOF A;  4NXG A;  4R38 A;  3BJN A;  1GSX A;  3IBR A;  2G7U A;  2PR6 A;  1D06 A;  3MQQ A;  3PBT A;  1UGU A;  4Q0J A;  5HDD A;  4HJ4 A;  5HWT A;  4Y2F A;  3FG8 A;  1N9L A;  3TJZ C;  2ZMF A;  4HIA A;  1XJ2 A;  3OCL A;  1S4S A;  2VLG A;  4L9F A;  2OWH A;  2XRN A;  4I3I A;  4I3J A;  2NUT C;  2VV6 A;  1LL8 A;  3H82 B;  1T1A A;  2J80 A;  3F1O B;  3C2W A;  4Q0I A;  2KX6 A;  4H6J B;  4O8G A;  3RH8 B;  3CI6 A;  3D72 A;  2OAQ 1;  4GHI B;  3U2A A;  2VA0 A;  4GLQ A;  5DKL A;  3BY8 A;  4DJ2 A;  1S4R A;  4BWI A;  5DFY A;  3UMD A;  3MQ0 A;  4HNB A;  4FOF A;  4WUJ A;  4XT2 B;  3H82 A;  3KSG A;  1MZU A;  1H8M A;  5TBM B;  3F1O A;  3CWF A;  4L0L A;  3EQV A;  3V67 A;  4JGO A;  2QHK A;  2FZ0 A;  2JKR I;  3OBF A;  4GHI A;  3EGX C;  3CIT A;  2P7J A;  1LSW A;  3E4P A;  2HJE A;  2FH5 A;  3LYX A;  3RFB A;  5HWW A;  3A0V A;  1T18 A;  4LRZ E;  4I38 A;  5IU1 A;  4GJ4 A;  2M1C A;  2PYR A;  3LIC A;  5HSQ A;  3T4J A;  4EEP A;  1TS7 A;  4YNR A;  1VHM A;  2HGV A;  1LSX A;  2K7S A;  2WKP A;  4LPZ A;  5TBM A;  1H3Q A;  2JKT I;  4OOL A;  4JGP A;  4Z1W A;  3IS2 B;  2PT7 A;  2V0W A;  4WEK A;  2VKS A;  5F5Y A;  4NXF A;  4HY8 A;  2VZW A;  2NUP C;  5AJG A;  3R7W B;  3T4Q A;  3NOP C;  3TE8 A;  3PBS A;  2YKH A;  2A24 B;  2W1T B;  2PDR A;  3W2Z A;  2VX8 A;  2PR5 A;  3H9W A;  1UWP X;  3UB7 A;  4I3A A;  2A2L A;  5F6A A;  4EES A;  1VB6 A;  2W27 A;  2W3G A;  2O9B A;  4BMW A;  4CLC C;  3A0R A;  5F68 A;  4RQ9 A;  4R3A A;  4DN0 A;  4PAU A;  4WLA A;  2ZOH A;  5HPI A;  1TS0 A;  1V9Y A;  1W63 M;  5HDC A;  2A24 A;  4G3V A;  3E98 A;  1OPX A;  4ARZ A;  2YKF A;  5A8B A;  1D7E A;  3MMH A;  1G6O A;  3BQ8 A;  3R4K A;  1OTE A;  3ICY A;  1GSW A;  4R70 A;  1OTD A;  3LFV A;  5DFX A;  2LB5 A;  2K31 A;  3IBJ A;  4UQI M;  5DJU A;  1XJ4 A;  3CUE C;  2WKR A;  4B9O A;  3ZQ5 A;  3K2N A;  3B47 A;  1XFQ A;  4EET B;  4MDZ A;  3LI8 A;  4WL9 A;  4NEE D;  4LLO B;  4HI4 A;  4JGQ A;  2EA9 A;  2QYB A;  3C30 A;  3T4L A;  2EWV A;  1Y28 A;  5HL6 A;  3E4O A;  5LBR A;  3RTY A;  1NLY A;  3PBO A;  5AVE A;  4CLC B;  5I5L A;  4E04 A;  3KYQ A;  3HCY A;  3T4S A;  2VV7 A;  2GX5 A;  2J3W A;  2EWW A;  1MKM A;  3PHY A;  3LR3 A;  2O99 A;  4CLC E;  2L4R A;  1P0Z A;  2LB9 A;  4Q0H A;  4QPR A;  1NWZ A;  2M7U A;  5DJT A;  1F9I A;  3VOL A;  3PBQ A;  4EER A;  5KIZ A;  3GDI A;  3HJK A;  4HH2 A;  3UB9 A;  3MR0 A;  3PBR A;  1DP9 A;  2XA7 M;  1OJ5 A;  1KOU A;  2H28 A;  3NHQ A;  3LUQ A;  4PKY G;  5CX7 A;  4I5S A;  3LIA A;  4HJ3 A;  4PKY A;  1OJG A;  1JNU A;  5FL3 A;  2QJ5 A;  4F3L B;  4CLC D;  4H6J A;  5G4Y A;  3BY9 A;  4HHD A;  2JHE A;  3T4O A;  3B42 A;  3K3D A;  2L1M A;  3VE4 A;  5KSH A;  1OTI A;  3ULF A;  2D01 A;  3ZYT A;  2O9C A;  1IFQ A;  3CUE A;  5AVF A;  4XT2 A;  3C8C A;  3A0S A;  3TW8 A;  1LSV A;  1T19 A;  5DF9 A;  4R6L A;  3LI9 A;  1IOU A;  3LIB A;  2PYP A;  2QJ7 A;  5HDS A;  2V1A A;  2V1B A;  3NOU C;  2GJ3 A;  3DBA A;  1NRJ A;  1EW0 A;  5C5K A;  2XRO A;  4KQO A;  4BBT A;  3LR4 A;  4PHT A;  1WA9 A;  4MCW A;  1OTA A;  2OWJ A;  2JN7 A;  4HJ6 A;  1S1Y A;  3O5Y A;  4MN6 A;  3F1P B;  2PD7 A;  3KO6 A;  3TRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...