1JNUA

Photoexcited structure of the plant photoreceptor domain, phy3 lov2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
104
structure length
104
Chain Sequence
KSFVITDPRLPDNPIIFASDRFLELTEYTREEVLGNNCRFLQGRGTDRKAVQLIRDAVKEQRDVTVQVLNYTKGGRAFWNLFHLQVMRDENGDVQYFIGVQQEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHY3 PROTEIN
publication title Photoexcited structure of a plant photoreceptor domain reveals a light-driven molecular switch.
pubmed doi rcsb
source organism Adiantum capillus-veneris
molecule tags Signaling protein, electron transport
total genus 28
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1jnuA00
2V9AA 2QJ5A 1T18A 5HZHA 1OTDA 2OWHA 3UB8A 4F3LB 3SW1A 4GHIA 3F1OB 3LIBA 4LRXC 4I38A 4I5SA 4HH3A 3K3CA 4K08A 1T1BA 5DJUA 3FC7A 3MQQA 4EETB 4KUOA 1UGUA 5G4YA 3F1NA 3E4PA 3LUQA 5HD5A 1N9NA 3NJAA 5AVEA 2KX6A 1LSXA 4NXFA 2VV7A 4XT2B 1VB6A 3CAXA 3H82A 4DJ2A 4HIAA 5A8BA 3FG8A 2VV8A 1F98A 2KDKA 2B02A 4LPZA 1XJ3A 5HWTA 2A24B 5DKLA 3LICA 4H6JB 3GECA 3IS2A 4JGOA 4HJ4A 5TBMB 5HWVA 4EESA 3NHQA 4EW7A 4LLOB 3LIAA 2YKHA 3F1OA 3UB7A 1S4RA 5HSQA 3ZQ5A 4WL9A 5AVFA 3UB9A 5F5YA 3CWFA 5HDCA 4JGPA 3EWKA 5J7EA 1D06A 3CLOA 2V1AA 5J4EA 3OLOA 4EXOA 1OJGA 4DJ3A 4WUJA 4I3IA 2M1CA 4GCZA 4HI4A 1XFQA 1XJ2A 2QHKA 3ULFA 4WF0A 5DJTA 2PD7A 4YWZA 3VE4A 4MN5A 3NOPC 3PHYA 4R3AA 1OTIA 1OTEA 3LIEA 1DP8A 1TS7A 2W0NA 1GSWA 1XFNA 1V9YA 2Z6DA 4MN6A 5F68A 3MFXA 4R6LA 3A0RA 5F69A 2Z6CA 1TS0A 2PR5A 2QKPA 5HD3A 4BBTA 3B33A 5KIZA 3RTYA 1JNUA 1X0OA 1GSVA 4R38A 4HY8A 2K7SA 1ODVA 3F1PB 2L0WA 3H7WB 3LI8A 4NXGA 1XJ4A 2JHEA 3MXQA 1N9LA 2YKFA 1MZUA 3KX0X 1NWZA 2V1BA 4I39A 5IS1A 4KQDA 5I5LA 4HOIA 5HDDA 4LRYC 3HJKA 1BYWA 3E4OA 2JN7A 2WKQA 1OT6A 2ZOIA 5DKKA 5HDSA 2W27A 4F3LA 1OTAA 1GSXA 3A0VA 2PHYA 1LSWA 2I9VA 2BASA 2INWA 3EEHA 3MR0A 3H9WA 1T19A 4HQAA 3BWLA 4L9GA 3VOLA 1S4SA 2PR6A 3P7NA 4L9FA 3BY8A 4L9EA 4GHIB 4E04A 2PD8A 4WN5A 1P97A 3T50A 3PYPA 1OJ5A 1DP6A 4RQ9A 3LIFA 2VV6A 4XT2A 4JGRA 4NXEA 4I3JA 2HV1A 3IBRA 4WLAA 3F1NB 2OOLA 3E4QA 4EQ1A 2A24A 4R70A 5EFWA 4H6JA 2D02A 3H82B 4GW9A 4JGQA 3UB6A 2J80A 4HP9A 5TBMA 3RH8B 2V0UA 1DP9A 3A0SA 4HH2A 4HHDA 4BBUA 2PYPA 1OTBA 2PYRA 3K3DA 1XJ6A 5HWWA 3UE6A 1P0ZA 4HP4A 3VE3A 1S66L 1V9ZA 4I3AA 5J3WA 2QJ7A 1UWNX 4KUKA 4HNBA 4PKYG 3UMDA 3MQOA 5G4ZA 1S1ZA 2VEAA 4B9OA 1OT9A 1LSVA 1S1YA 1T1AA 1N9OA 1Y28A 2H28A 3UMEA 2QWSA 2WKPA 1EW0A 3G6OA 2VLGA 2D01A 4EEPA 1S67L 3LIDA 1KOUA 4GS9B 2ZOHA 3MJQA 3LYXA 3D72A 4EERA 2ZBBA 1UWPX 2PDRA 4PKYA 1F9IA 1TS8A 1D7EA 3F1PA 2EA9A 3BY9A 3H7WA 2P7JA 3NOUC 4EEUA 3C8CA 2GJ3A 1LT0A 2OWJA 3C2WA 3HJIA 2V0WA 1DRMA 1TS6A 2CMNA 1G28A 2R78A 4BBVA 2L1MA 4HJ6A 1T1CA 4NXBA 1WA9A 4M4XA 4HJ3A 2WKRA 2L4RA 3ICYA 4GS9A 3LI9A 4LRZE 1LL8A 3NOTC 3GDIA 3IS2B 5IU1A 5F6AA
chains in the Genus database with same CATH superfamily
2V9AA 4B4XA 1OTDA 4QY6A 3IXBA 2HDSA 4JXGA 4Y5FA 3TE8A 4FD8A 1W5DA 3ZG0A 3N4IA 1G6AA 4M3KA 3P09A 3W8KA 3AGFA 4GN2A 4LRXC 4Y3IA 2ZMFA 3K3CA 4GLQA 2J3TD 2XD5A 3MQQA 3SH7A 2WGIA 4S2KA 1L0FA 5G4YA 3F1NA 5CEBA 3LUQA 3LR3A 3IF6C 4BJPA 3A3FA 4KZ7A 5HD5A 5M1AA 1VETB 4EUZA 2VK3A 4ZTKA 3O87A 2O9AA 1W8QA 1SKOA 3MKEA 3IHBA 1VB6A 3CAXA 3T4TA 4HIAA 1MBLA 3LR4A 1MKMA 5TJJA 1I2SA 2BTFP 5HAQA 2KDKA 3U4LP 3B3XA 2WUQA 2A24B 5DKLA 3LICA 4GD6A 4X69A 4H6JB 2ZMVA 3CG5A 3T4JA 3GECA 4YINA 3IH9A 3IS2A 5FEFA 3E0YA 4JGOA 2HP6A 5TBMB 5FAOA 1AXBA 1JVJA 2EWWA 2J3WA 1G68A 2VJWA 4HEFA 4GNUA 3BRMA 3ZG9B 1S4RA 3VOZA 5HSQA 1Z09A 5F1FA 5AVFA 3UB9A 2QMIA 5F5YA 5GLCA 3A3JA 1W63Q 4EBLA 1L0GA 2EX6A 5HDCA 3BW6A 3W4OA 4IJGA 2E8JA 2JKFA 1VHMA 2W3EA 2R9WA 5DF7A 3GR2A 2I72A 2ZM2A 1TDGA 5CGWA 5EE8A 5L07A 4X1MA 2ZLYA 1XA7A 3OCLA 4S2PA 2DRWA 4ARZA 4YWZA 5CERA 5EECA 1YLJA 5FASA 3PHYA 1MWTA 1OTEA 3G4PA 3WRZA 5IHVA 1GSWA 3DWKA 1XFNA 4ESPA 2Z6DA 4MN6A 3HLGA 3MFXA 3DTEA 4OQIA 4OPRA 4DE1A 2Z6CA 5HAPA 4MBKA 4PM6A 1IKIA 1J9MA 3V39A 3MZDA 1PW8A 4B93A 1L2SA 3B33A 3GQZA 2FZ0A 4EQIA 4Z9QA 2NUPC 3CITA 3F1PB 4KQRA 4X56A 2Y2KA 4GZBA 3LI8A 4NXGA 1XJ4A 2Q9NA 2Y2LA 3IX8A 3MXQA 1NZOA 5EOEA 3CPTB 4KQQA 4R3BA 1MZUA 2ZL1A 3NDEA 3KX0X 4YFMA 4X1LA 2V1BA 4I39A 4NKPA 2W3FA 5GLAA 5I5LA 4E3JA 4HOIA 3E2KA 4DRTA 2V8CA 4EBNA 2VGLS 1HZOA 5C5KA 4EU0A 2HPBA 1YKDA 4S2LA 3HJKA 2WKQA 4UA6A 5DKKA 4H8RA 3WRTA 2W27A 1DJBA 3BJNA 3IF6B 3EGXC 3MBZA 4FOFA 5EVIA 2INWA 3KO6A 1BLCA 2JKTI 2P74A 3H9WA 1T19A 4OPYA 4L9GA 3BLMA 4OONA 3A3DA 2HP5A 3BFEA 4L9EA 2ZM0A 2PD8A 4Y0TA 1L3LA 1P97A 1DP6A 4IUHA 4KZBA 3AGDA 3LFVA 4JGRA 3HL9A 4GDNA 4GD8A 2HV1A 2M7UA 3TSGA 4PPRA 5GHXA 5HX9A 2OOLA 2PAVP 4S2MA 5FDHA 1NY0A 3VP4A 5M19A 2XLNA 4NG2A 4UQIM 4WMCA 2XA7S 3C7UA 4IEDA 1GCEA 3H82B 1BULA 1BZAA 4DN0A 4Z1WA 4ME4A 3R7WB 1DP9A 5IT5A 2Y2HA 1KE4A 3MF0A 1YAXA 2B95A 3K3DA 4QY5A 1ERQA 3L7HA 1MXOA 3GSGA 2ZC4B 2Y55A 1P0ZA 1BLHA 3A3IA 2Y79A 3LCEA 1F2KA 4I3AA 4P87A 2W3GA 4N92A 5E43A 2P04A 3MQOA 3MZFA 5G4ZA 1IKGA 3SZTA 1N4OA 1DY6A 5AJGA 3V5MA 3ITAA 5F82A 1K57A 3G2ZA 4KZ9A 4KENB 2XEPA 3HVFA 2H28A 1YLPA 2FFFB 2QPNA 4CLCE 1KE0A 4BENA 3G6OA 2VLGA 5GL9A 3FPWA 3LEZA 3HLWA 2FFYA 3LYXA 2WZZA 3UN7A 5HPFA 2AVXA 3IHAA 4EERA 3Q7VA 3V67A 3OOVA 4E6XA 1NYMA 4PKYA 4OPZA 1FR6A 1D7EA 3BY9A 3SS3A 4B88A 5TR7A 5JYOA 5E2HA 2XROA 5CECA 4P85A 2DNSA 3C8CA 2LB9A 2OWJA 3QNCA 3C2WA 2A2LA 3DBAA 2V0WA 4O01A 4RA7A 3HCYA 3VP3A 1G28A 1Y4OA 1CI8A 2Z2LB 1ZKJA 5CX7A 1T1CA 4BL3A 1K0KA 3IT9A 1WA9A 3SS4A 3MFDA 3LR0A 5FATA 2L4RA 4N9LA 3ICYA 2EFUA 4S2OA 1K54C 4KZ6A 3O88A 4WZ5C 5A92A 2KLIA 4EWFA 3VFHA 1NLYA 5CRFA 4WM9A 4BD0A 1T18A 4R1GA 3KSHA 4Y0OA 2EXBA 1LI0A 4F3LB 4GHIA 3F1OB 2CC1A 3WS2A 3PBNA 1DJAA 4I5SA 2H0TA 3T4KA 1T1BA 1JWVA 3FC7A 2XFSA 3UDIA 2HJEA 2H5SA 1ERMA 2G7UA 1XGJA 4BQMA 3NY4A 1N9NA 5E2GA 1LL5A 1LSXA 3PAEA 2G2WA 4XT2B 2UWXA 2OSUA 1K6SA 3FG8A 3QP8A 1F5MA 2VV8A 2ZC6B 2O9CA 4XUXA 1F98A 5CHUA 2B02A 4Y2FA 4LPZA 2IWDA 5HWTA 1MC0A 3IXHA 1ZG4A 1HTZA 2JKRM 1SCWA 3BLSA 1C3BA 1Q2QA 3TW8A 5HWVA 4HJ4A 1FIKA 4Q0IA 1ACFA 5FQIA 4EW7A 4LLOB 2WKIA 1E25A 4K0WA 1LL9A 5HARA 3ZQ5A 2WAEA 5EOOA 3IBJA 3P01A 1ALQA 3HLBA 2EX9A 4JGPA 2BLSA 1H8YA 1D06A 4JXSA 1YSPA 3M6BA 2V1AA 4GOGA 3T4LA 1PWDA 4X53A 5KMWA 1PYYA 3ULFA 1XX2A 4KZ4A 1DJCA 1OPXA 4YOFA 3OZHA 5DJTA 3TOIA 3ZDJA 4X6TA 2XR0A 4DDYA 3KSFA 3D4FA 4R3AA 1YMXA 3LIEA 1TS7A 3OPPA 2ZQCA 1TVFA 3L9KA 5DFXA 4MLLA 1FCOA 5FAPA 1XXMA 4IVIA 5F69A 1TS0A 3N7WA 4Y13A 4RX3A 4BBTA 1RGZA 1KGEA 3IWIA 1MY8A 5HL6A 4R38A 4ID4A 2X02A 1PFLA 2A3UA 3B47A 2J9OA 3IF5A 3ISGA 1ODVA 3H7WB 3C38A 2Y2OA 4JF4A 5FQ9A 1MWRA 4CLCC 4NEED 2ZQDA 2JHEA 3LR5A 1N9LA 2P9VA 2W1TB 5EV0A 1S6RA 4KZAA 5EUAA 1NWZA 5CTNA 5HL1A 3ZHHA 1GHIA 3T4QA 5L2FA 5CTMA 5L09A 4X55A 1YLZA 3IWOA 4S2IA 3E4OA 3BQAA 2Y8HA 5HDSA 2C6WB 1IYPA 4Y0UA 1GSXA 2BG1A 5MC7A 2PHYA 3G31A 3G34A 1LSWA 4BD1A 3C4PA 3ZNYA 2ZQ9A 4KZ8A 1KGFA 3VOLA 4HESA 3S7QA 3LY4A 1IELA 2PR6A 2EFXA 3T1RA 1GHMA 1SKFA 3S7NA 4S2NC 2XD1A 3UO9A 3KSIA 4DDSA 2Y2MA 5AQ7A 4E3LA 3IXDA 4CLCD 1VQQA 1OJ5A 3UDFA 4RQ9A 3FWLA 5EM0A 5LBRA 1K55C 4I3JA 4F94A 5GLDA 3WS5A 3F1NB 3QHYA 2H0YA 2IWCA 3HLCA 4ZDXA 4IUKA 4OLGA 3N8SA 3RFBA 2EWVA 1NRJA 4GDBA 4R70A 1SKOB 4JGQA 2J80A 3BQ8A 5KSHA 2HGVA 3RH8B 2V0UA 4BMWA 1KDWA 4HH2A 4BBUA 3P98A 1XGIA 3IF6A 1MWUA 3JYIA 1ES3A 3N8RA 4C75A 4QU3A 2EXAA 3HLEA 2JKGA 3Q81A 1XKZA 1S66L 3EGDC 5FI7A 1V9ZA 3MS6A 2QJ7A 4OOYA 4PKYG 3CMZA 4KQOA 3VFFA 4PM8A 4C3QA 4DXCA 4LCLA 1JTDA 2Y2IA 1L0EA 1YLWA 4UHUA 3VP0A 3BYDA 5HFOA 4UA7A 1T1AA 2J9PA 1PW1A 3WWXA 4A5RA 3HUNA 1CEGA 2Y59A 5BOHA 3MMHA 2QWSA 2XK1A 1H3QA 1VM1A 1H8MA 1EW0A 4LENA 3G35A 3LY3A 2WGVA 4ARZB 1K6RA 1QMEA 3LIDA 1KOUA 4GS9B 2ZOHA 2FH5A 3MJQA 4DKIA 1G5UA 1NLZA 4ZAMA 1YLTA 5FQMA 1UWPX 1K57C 4CLCB 3VMAA 3PBTA 5E2EA 1FSWA 4P6ZS 4PAUA 1TS8A 3QP4A 2EA9A 3IXGA 3JVUA 1WYBA 2P7JA 1TD5A 5K5BA 2E8IA 3FV7A 4WEJA 5L10A 1VEUB 4R4SA 4IBRA 3W4QA 1BLSA 1PNEA 2OAQ1 3WS4A 3PBSA 1TS6A 4UA9A 5AQBA 4ZRRA 4NK3A 4GJ4A 1Z6FA 1TDLA 4P6BA 2ZL1B 5FQJA 3G30A 4DE0A 3RJUA 2ZMAA 2QZ6A 2OV5A 2R9XA 2W3HA 1NXYA 4Q0JA 3ZFZA 3LI9A 5JYPA 3IWQA 3GDIA 3PXPA 1I5QA 5IU1A 1YPRA 2QJ5A 5F1GA 3UB8A 3QP6A 4OP5A 5A91A 3NI9A 1M40A 4RX2A 3EOIA 1BUEA 3TJZC 1E3UD 5EVIB 1CF0A 3PR6A 4N9KA 3LIBA 4I38A 2HDUA 3M6HA 4HBTA 3BFDA 5KZHA 2WGWA 4X25A 2RCXA 2WK0A 5U47A 3E4PA 3NJAA 3UY6A 2P08A 2Y2PA 1HD8A 1TEMA 4KZ5A 5A93A 4OQHA 4MBFA 2J7VA 3BECA 2J8YA 2VX8A 3UPPA 2V2FF 1IOUA 3A3EA 3OC2A 4O8GA 4R0QA 1XJ3A 2NUTC 3JVVA 4BLMA 4LV0A 1TF1A 3T1QB 3O86A 4ZJ2A 4WBGA 4EESA 4MEZA 2XGNA 3LIAA 3F1OA 5EM1A 3UB7A 1P9RA 2GZAA 3DTMA 1RCJA 4WL9A 2PBDP 2M7VA 4PM9A 3CZDA 1KVLA 2V1ZA 3CWFA 4HBUA 3N6IA 3DWZA 4G3KA 2Y2JA 2OLUA 4FTXA 3CHWP 1PZOA 1JWPA 3KYZA 5DTKA 4E3KA 4ETZA 3OLOA 5FI2A 3BFFA 3U2AA 1KGGA 3Q82A 4DJ3A 4WUJA 5L8MA 2VZWA 4I3IA 3BEBA 4GCZA 4HI4A 3S7PA 2LB5A 1XJ2A 1ZC2A 3V3SA 2B5RA 4UAAA 4WZ4A 4WF0A 4KG2A 3NULA 2PBYA 3HREA 3W4PA 3ZNTA 4QB8A 5CGXA 3VE4A 4MN5A 3CI6A 3K2NA 3AGEA 4N1HA 1DP8A 1MKIA 5AQAA 2EX8A 2W0NA 4U0TA 4FUWA 4JXVA 4R6LA 4KG5A 3T12B 2W1RA 3G32A 4JPMA 2XDMA 4LCMA 5DTSA 3Q7VB 3UB5P 1YT4A 3FKVA 1W7FA 1K56D 3T1XA 2B18A 1YLYA 2HDQA 4OQGA 3RTYA 3CUEA 1JNUA 1FQGA 1GSVA 4ZJ3A 4HY8A 2L0WA 2ZQ8A 3NIAA 3QP2A 4K91A 2IA2A 2WADA 3MZEA 2Z2MB 4MNRA 1CQAA 3FZCA 3RXXA 5DTTA 1ES4A 3GMWA 5EPHA 5J8XA 1EI5A 2X71A 3C30A 4X68A 4KQDA 4B4ZA 4II7A 5KSCA 3OCNA 3EEAA 4PM7A 3GTCA 4E3NA 1JTGA 3UPNA 3OBFA 3TRCA 5AQ9A 4O7DA 4ETXA 3DAVA 1ZTUA 1OTAA 3S7OA 1SHVA 2K31A 3A0VA 2I9VA 3EEHA 4LV1A 4HQAA 3NDGA 3MQ0A 1JWZA 2ZC5B 3UDXA 3QNBA 1S4SA 3MXSA 2RL3A 3UE1A 2WAFA 3Q7ZA 4GHIB 4E04A 2WKEA 1VETA 5FQQA 4WN5A 3FYZA 4CPKA 1IEMA 5A90A 5DF8A 3LIFA 1YSQA 3CJMA 3QP1A 4LV2A 4OH0A 1IYQA 3IBRA 1K38A 2JCHA 3GVBA 4OLDA 3E4QA 2MJ6A 3VP1A 4EQ1A 2A24A 3T1SA 4H6JA 1CEFA 1A0KA 2D02A 4FSFA 2ZC7A 4GW9A 3UB6A 2HJ9C 4HP9A 5TBMA 1RP5A 1WYCA 1EWZA 2UV0E 1FCMA 3PBRA 1XJ6A 3UE6A 4HP4A 5GHZA 4OOMA 3HLFA 5J3WA 1UWNX 2Q0OA 1BT5A 2PRFA 3UMDA 3MXRA 4C6YA 1S1ZA 5FEGA 3SOIA 1OT9A 1PIOA 3IX3A 1ESIA 1LSVA 5HAIA 3S22A 4EV4A 1N9OA 4JXWA 2K2NA 3UPOA 4WEKA 3UMEA 1D1JA 1Y54A 4E6WA 2OAP1 2JKRI 1S67L 4ZJ1A 4U0XA 1STZA 4OPQA 2WYXA 4OP8A 3D72A 1W63M 2OLVA 2ZBBA 2PDRA 1ZG6A 4OOLA 1FCNA 3SH8A 3EQUA 4RVAA 5FI6A 2VKSA 1F9IA 1NYYA 3VP2A 3F1PA 3W2ZA 2JKTM 2ZQ7A 3NOUC 4LV3A 2VGJA 2WKHA 3M2JA 2XFTA 1RGYA 4D2OA 5EVEA 3UE3A 3CPTA 4MMNA 1PWGA 1FR1A 1H5XA 1K25A 4AFIA 4L0LA 5CGSA 3WS1A 1DRMA 5EVIC 3ZG8B 2ZD8A 4BBVA 2XRNA 1ONGA 1HVBA 2L1MA 1NJ4A 4JKTA 2P9VB 4GKUA 4HJ6A 1OMEA 2VGLM 4R23A 3NBLA 3OPRA 4XXRA 4M4XA 2ZQAA 3ZCZA 1NRFA 2WKRA 2H10A 3S4XA 5CHJA 4GS9A 4LRZE 1LL8A 1FSYA 3BM6A 4XUZA 5M18A 1E4DA 2V20A 3NOTC 2W3DA 4R3JA 2O0YA 3IS2B 4CLCA 2DCFA 5F6AA 4K0XA 1LI9A 4Q0HA 2IWBA 3MKFA 1L0DA 5HZHA 2OWHA 1M6KA 5GHYA 4P6ZM 3SW1A 2Y2GA 1IYSA 4CQHA 2GDNA 1LLBA 4HH3A 4K08A 1VEUA 5DJUA 5CHMA 1AWIA 4EETB 4KUOA 1UGUA 2JC7A 2JE5A 2X01A 4DE2A 5EVID 5AVEA 2XSSA 2ZJ9A 2KX6A 4NXFA 2VV7A 3M2KA 2XA7M 3H82A 4UEYA 4DJ2A 5A8BA 4LGWA 3ZVTA 1FILA 3R7WA 4FCFA 4R4RA 3DW0A 3SH9A 3GV9A 4S2NA 4QPRA 3BFCA 5DFYA 2ZM8A 1CK3A 1K55A 3NHQA 2YKHA 3ZYTA 4Y7PA 4WMCD 5TFQA 2Y2QA 5HW3A 5FDSA 1IYOA 5FSRA 3C7VA 4QJGA 2VA0A 1IFQA 5HPIA 2PU2A 3EWKA 4MN7A 5J7EA 3CLOA 5G18A 1ESUA 1H0MA 4JBFA 5J4EA 3O3VA 4EXOA 3JPUA 4Y17A 1OJGA 1BSGA 1H8ZA 2M1CA 3UNWA 1W79A 4OQ0A 1XFQA 1XA1A 2QHKA 5GLBA 1BTLA 2PD7A 3NOPC 1BLPA 1OTIA 4S2JA 1HLUP 2XQZA 2WZXA 1V9YA 3Q07A 5F68A 3I7JA 3IX4A 1MPLA 3ZGAB 3A0RA 5CEDA 3Q1FA 5DVAA 2PR5A 2QKPA 4QD4A 3NC8A 1GHPA 5FL3A 3DTKA 5HD3A 3G2YA 2QYBA 1CI9A 2O9BA 5KIZA 1YQSA 4YNRA 1X0OA 2O99A 4KG6A 2Y91A 1PI4A 2K7SA 4KZ3A 4E3MA 2YKFA 5DF9A 3WS0A 4QHCA 2VGKA 5CXWA 4IBXA 5D3OA 5E2FA 4FH4A 1KE3A 5IS1A 3KYEA 1ZHHB 4UQIS 2EX2A 2HZ5A 4MDZA 3PTEA 3CUEC 1E3UA 3VSKA 5HDDA 4LRYC 3GRJA 1BYWA 2JN7A 2ZOIA 1OT6A 1K4EA 4F3LA 3D9YA 3R4KA 3PAGA 3NCKA 2C5WB 1PZPA 3IH8A 2DMWA 4U3TA 2BASA 1W8YA 1YMSA 3MR0A 1CJFA 4OVDA 3OPLA 3FPVA 3BWLA 4IVKA 3D3OA 3EQVA 4N1XA 1P9WA 4L9FA 3P7NA 3BY8A 2HDRA 4JF5A 3BFGA 3C5AA 1GA0A 3SS5A 4BL2A 3T50A 3HUMA 1N9BA 3E98A 3PYPA 1PWCA 5I94A 2PU4A 2VV6A 4XT2A 3HUOA 4NXEA 2V8FA 2WGWB 3PBOA 3O5YA 4WLAA 4FH2A 3KSGA 3ZVWA 3LO7A 1KVMA 2A49A 5EFWA 1S0WA 3V50A 3DTIA 3HBRA 4E3OA 3T4SA 4MBHA 2KOIA 1I2WA 3A0SA 4HHDA 1O07A 1PRQA 2PYPA 1OTBA 2JBFA 2PYRA 4BWIA 3KYQA 3T4OA 4G3WA 5HWWA 3E2LA 1Q2PA 5EVLA 4JF6A 3N8LA 5TGFA 3VE3A 2G2UA 4ZBEA 1GA9A 4DE3A 5FQKA 4KUKA 4HNBA 4OKPA 4CJNA 2ACGA 2XF3A 4P0MA 3B42A 4G3VA 3TG9A 3ITBA 3MSHA 2HF6A 1XP4A 2Y4AA 4MCWA 2Q9MA 2VEAA 1FOFA 2PT7A 3IQAA 4B9OA 4PMAA 1O7EA 3HLDA 4D60A 3VOYA 3LEQA 1S1YA 1ES2A 1J3WA 1SDNA 1U60A 1G6OA 4EBPA 1Y28A 4EUVA 3UE0A 3RXWA 4PM5A 3QP5A 1NZUA 4DMZA 2WKPA 4GB7A 4RYEA 1SDEA 1K56A 4LFUA 3ZG5A 2D01A 4EEPA 3PBQA 4WELA 5FA7A 4E3IA 2HP9A 5F83A 3OPHA 1PI5A 4DXBA 2GNXA 2Y2NA 3V3RA 1ONHA 4O0PA 3H7WA 1MWSA 1ES5A 1K54A 2J3TC 4EEUA 4WZ5A 3C4OA 2W1TA 1WE4A 1YM1A 2GJ3A 1LT0A 4QWOA 4Q8IA 4Y15A 4PHTA 3HJIA 4NETA 4WYYA 2XH9A 3LGOA 2CMNA 3FKWA 2R78A 3ZG7B 4IHQA 3S1YA 1XPBA 3NECA 5FAQA 1LHYA 4NXBA 4HJ3A 1K4FA 4DF6A 1KDSA 4JLFA 2GX5A 1QMFA 1SZVA 3VV4A 3VSLA 1EROA 2ZC3B
chains in the Genus database with same CATH topology
2V9AA 2QJ5A 1T18A 5HZHA 1OTDA 2OWHA 3KSHA 3UB8A 4Y5FA 3TE8A 4F3LB 4P6ZM 3SW1A 4GHIA 3EOIA 3F1OB 4CQHA 3TJZC 3PR6A 3LIBA 3PBNA 4LRXC 4I38A 4I5SA 4Y3IA 4HH3A 3T4KA 2ZMFA 3K3CA 4K08A 1T1BA 4GLQA 5DJUA 2J3TD 3FC7A 3MQQA 4EETB 4KUOA 1UGUA 5G4YA 2HJEA 3F1NA 3E4PA 3LUQA 3LR3A 2G7UA 4BJPA 5HD5A 1N9NA 3NJAA 2P08A 5AVEA 2XSSA 2KX6A 2O9AA 1LSXA 4NXFA 2VV7A 4XT2B 1VB6A 2XA7M 3CAXA 3H82A 4UEYA 3T4TA 4DJ2A 4HIAA 5A8BA 2VX8A 3LR4A 3FG8A 1IOUA 1MKMA 1F5MA 2VV8A 5TJJA 3OC2A 2O9CA 1F98A 2KDKA 2B02A 3R7WA 4Y2FA 4O8GA 4LPZA 1XJ3A 5HWTA 2NUTC 2A24B 5DKLA 3LICA 1MC0A 3JVVA 4H6JB 1TF1A 2ZMVA 3T4JA 3GECA 2JKRM 4QPRA 5DFYA 3IS2A 3E0YA 3TW8A 4JGOA 4HJ4A 5TBMB 5HWVA 4Q0IA 4EESA 2EWWA 3NHQA 2J3WA 4EW7A 4LLOB 3LIAA 2YKHA 3ZYTA 2VJWA 3F1OA 3UB7A 1P9RA 1S4RA 2GZAA 5HSQA 3ZQ5A 4WL9A 5AVFA 3UB9A 2M7VA 3IBJA 5F5YA 5F6AA 1W63Q 3P01A 3CWFA 5HDCA 2VA0A 3BW6A 1IFQA 5HPIA 4JGPA 4IJGA 4G3KA 3EWKA 4MN7A 1D06A 3CLOA 1YSPA 5J7EA 3KYZA 2V1AA 4ETZA 5J4EA 1VHMA 3OLOA 4EXOA 2W3EA 3T4LA 1OJGA 3U2AA 4DJ3A 4WUJA 5L8MA 2VZWA 4I3IA 2M1CA 4GCZA 4HI4A 3S7PA 2LB5A 1XFQA 1XJ2A 2QHKA 3ULFA 4WF0A 5DJTA 1OPXA 4YOFA 3OCLA 2PD7A 4ARZA 4YWZA 3VE4A 4MN5A 3NOPC 3KSFA 3PHYA 4R3AA 3CI6A 1OTIA 3K2NA 1OTEA 3LIEA 1DP8A 1TS7A 2W0NA 1GSWA 5DFXA 1XFNA 1V9YA 2Z6DA 4MN6A 5F68A 3MFXA 4R6LA 3A0RA 5F69A 2Z6CA 1TS0A 2PR5A 2QKPA 5FL3A 2W1RA 5HD3A 4B93A 2QYBA 2O9BA 4BBTA 3B33A 5KIZA 2B18A 2FZ0A 3RTYA 3CUEA 1JNUA 4YNRA 1X0OA 1GSVA 4R38A 5HL6A 2O99A 4HY8A 2NUPC 3B47A 3CITA 2K7SA 1ODVA 3F1PB 2L0WA 3H7WB 3C38A 3LI8A 4NXGA 4CLCC 1XJ4A 4NEED 2IA2A 2JHEA 3LR5A 3MXQA 1N9LA 2YKFA 5DF9A 2W1TB 1MZUA 3KX0X 1NWZA 2V1BA 3C30A 4I39A 4NKPA 5IS1A 4KQDA 2W3FA 1ZHHB 4II7A 3OCNA 5I5LA 3T4QA 4HOIA 4UQIS 4MDZA 3EEAA 3CUEC 2VGLS 5C5KA 4EU0A 1YKDA 5HDDA 4LRYC 3HJKA 1BYWA 3E4OA 2JN7A 3OBFA 3BQAA 3TRCA 2WKQA 1OT6A 2ZOIA 4ETXA 2Y8HA 5DKKA 5HDSA 2W27A 4F3LA 1ZTUA 1OTAA 3S7OA 3R4KA 3BJNA 2K31A 1GSXA 3A0VA 5MC7A 3EGXC 2PHYA 2DMWA 1LSWA 2I9VA 4FOFA 2BASA 2INWA 3KO6A 3EEHA 2JKTI 3MR0A 3H9WA 1T19A 4HQAA 3FPVA 3MQ0A 3BWLA 3D3OA 4L9GA 3VOLA 3S7QA 1S4SA 3EQVA 2PR6A 1P9WA 3P7NA 4L9FA 3BY8A 4L9EA 4GHIB 3S7NA 4E04A 2PD8A 4WN5A 1P97A 3KSIA 3T50A 3E98A 3PYPA 4CLCD 1OJ5A 1DP6A 4RQ9A 3LIFA 1YSQA 2VV6A 4IUHA 4XT2A 5LBRA 3LFVA 4JGRA 4NXEA 4I3JA 2HV1A 3PBOA 2M7UA 3O5YA 3IBRA 4WLAA 3F1NB 2OOLA 4IUKA 3KSGA 3RFBA 3E4QA 2EWVA 1NRJA 2MJ6A 4EQ1A 2A24A 4R70A 5EFWA 4UQIM 2XA7S 4H6JA 2D02A 3H82B 4FSFA 4GW9A 4JGQA 3UB6A 2J80A 3BQ8A 4DN0A 3T4SA 2HJ9C 4HP9A 4Z1WA 2HGVA 5TBMA 5KSHA 3RH8B 4ME4A 2V0UA 3R7WB 2KOIA 1DP9A 4BMWA 3A0SA 5IT5A 3MF0A 4HHDA 4HH2A 4BBUA 2PYPA 1YAXA 3PBRA 1OTBA 2PYRA 3K3DA 4BWIA 3KYQA 1XJ6A 3T4OA 4G3WA 5HWWA 3UE6A 1P0ZA 4HP4A 3VE3A 1S66L 3EGDC 2Y79A 4OOMA 1V9ZA 4I3AA 5J3WA 2QJ7A 1UWNX 4KUKA 4HNBA 2W3GA 4PKYG 3UMDA 2P04A 3MQOA 4KQOA 3B42A 5G4ZA 4G3VA 1S1ZA 2HF6A 4MCWA 5AJGA 2VEAA 2PT7A 4B9OA 1OT9A 1LSVA 1S1YA 1T1AA 1N9OA 2K2NA 1G6OA 4WEKA 1Y28A 4EUVA 2H28A 3MMHA 3UMEA 2QWSA 1H3QA 4DMZA 2WKPA 1H8MA 4CLCE 1EW0A 3G6OA 2OAP1 2VLGA 2D01A 2JKRI 4EEPA 1S67L 3PBQA 4WELA 4ARZB 3LIDA 3FPWA 1KOUA 4GS9B 1STZA 2ZOHA 2FH5A 3MJQA 3LYXA 1NLZA 5HPFA 3D72A 1W63M 4EERA 2ZBBA 1UWPX 2PDRA 4CLCB 3V67A 3OOVA 3PBTA 4OOLA 4PKYA 3EQUA 4P6ZS 4PAUA 2VKSA 2GNXA 1F9IA 1TS8A 1D7EA 3F1PA 2EA9A 3BY9A 3JVUA 3W2ZA 4O0PA 3H7WA 2JKTM 2P7JA 1TD5A 5K5BA 3NOUC 2XROA 4WEJA 2J3TC 4EEUA 3UE3A 4MMNA 2W1TA 3C8CA 2LB9A 2GJ3A 1LT0A 2OWJA 3C2WA 2OAQ1 2A2LA 3HJIA 4PHTA 4AFIA 3DBAA 4L0LA 3PBSA 2V0WA 4O01A 1DRMA 1TS6A 3HCYA 2CMNA 4ZRRA 1G28A 2R78A 4BBVA 4GJ4A 2XRNA 2L1MA 4IHQA 5CX7A 4HJ6A 1T1CA 2VGLM 4NXBA 1WA9A 4M4XA 4HJ3A 3LR0A 2WKRA 2L4RA 3ICYA 2W3HA 4GS9A 2GX5A 4Q0JA 3LI9A 4LRZE 1LL8A 3NOTC 2W3DA 3GDIA 3VV4A 3PXPA 2O0YA 2KLIA 3IS2B 4CLCA 5IU1A 1NLYA 4Q0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V9A A;  2QJ5 A;  1T18 A;  5HZH A;  1OTD A;  2OWH A;  3UB8 A;  4F3L B;  3SW1 A;  4GHI A;  3F1O B;  3LIB A;  4LRX C;  4I38 A;  4I5S A;  4HH3 A;  3K3C A;  4K08 A;  1T1B A;  5DJU A;  3FC7 A;  3MQQ A;  4EET B;  4KUO A;  1UGU A;  5G4Y A;  3F1N A;  3E4P A;  3LUQ A;  5HD5 A;  1N9N A;  3NJA A;  5AVE A;  2KX6 A;  1LSX A;  4NXF A;  2VV7 A;  4XT2 B;  1VB6 A;  3CAX A;  3H82 A;  4DJ2 A;  4HIA A;  5A8B A;  3FG8 A;  2VV8 A;  1F98 A;  2KDK A;  2B02 A;  4LPZ A;  1XJ3 A;  5HWT A;  2A24 B;  5DKL A;  3LIC A;  4H6J B;  3GEC A;  3IS2 A;  4JGO A;  4HJ4 A;  5TBM B;  5HWV A;  4EES A;  3NHQ A;  4EW7 A;  4LLO B;  3LIA A;  2YKH A;  3F1O A;  3UB7 A;  1S4R A;  5HSQ A;  3ZQ5 A;  4WL9 A;  5AVF A;  3UB9 A;  5F5Y A;  3CWF A;  5HDC A;  4JGP A;  3EWK A;  5J7E A;  1D06 A;  3CLO A;  2V1A A;  5J4E A;  3OLO A;  4EXO A;  1OJG A;  4DJ3 A;  4WUJ A;  4I3I A;  2M1C A;  4GCZ A;  4HI4 A;  1XFQ A;  1XJ2 A;  2QHK A;  3ULF A;  4WF0 A;  5DJT A;  2PD7 A;  4YWZ A;  3VE4 A;  4MN5 A;  3NOP C;  3PHY A;  4R3A A;  1OTI A;  1OTE A;  3LIE A;  1DP8 A;  1TS7 A;  2W0N A;  1GSW A;  1XFN A;  1V9Y A;  2Z6D A;  4MN6 A;  5F68 A;  3MFX A;  4R6L A;  3A0R A;  5F69 A;  2Z6C A;  1TS0 A;  2PR5 A;  2QKP A;  5HD3 A;  4BBT A;  3B33 A;  5KIZ A;  3RTY A;  1JNU A;  1X0O A;  1GSV A;  4R38 A;  4HY8 A;  2K7S A;  1ODV A;  3F1P B;  2L0W A;  3H7W B;  3LI8 A;  4NXG A;  1XJ4 A;  2JHE A;  3MXQ A;  1N9L A;  2YKF A;  1MZU A;  3KX0 X;  1NWZ A;  2V1B A;  4I39 A;  5IS1 A;  4KQD A;  5I5L A;  4HOI A;  5HDD A;  4LRY C;  3HJK A;  1BYW A;  3E4O A;  2JN7 A;  2WKQ A;  1OT6 A;  2ZOI A;  5DKK A;  5HDS A;  2W27 A;  4F3L A;  1OTA A;  1GSX A;  3A0V A;  2PHY A;  1LSW A;  2I9V A;  2BAS A;  2INW A;  3EEH A;  3MR0 A;  3H9W A;  1T19 A;  4HQA A;  3BWL A;  4L9G A;  3VOL A;  1S4S A;  2PR6 A;  3P7N A;  4L9F A;  3BY8 A;  4L9E A;  4GHI B;  4E04 A;  2PD8 A;  4WN5 A;  1P97 A;  3T50 A;  3PYP A;  1OJ5 A;  1DP6 A;  4RQ9 A;  3LIF A;  2VV6 A;  4XT2 A;  4JGR A;  4NXE A;  4I3J A;  2HV1 A;  3IBR A;  4WLA A;  3F1N B;  2OOL A;  3E4Q A;  4EQ1 A;  2A24 A;  4R70 A;  5EFW A;  4H6J A;  2D02 A;  3H82 B;  4GW9 A;  4JGQ A;  3UB6 A;  2J80 A;  4HP9 A;  5TBM A;  3RH8 B;  2V0U A;  1DP9 A;  3A0S A;  4HH2 A;  4HHD A;  4BBU A;  2PYP A;  1OTB A;  2PYR A;  3K3D A;  1XJ6 A;  5HWW A;  3UE6 A;  1P0Z A;  4HP4 A;  3VE3 A;  1S66 L;  1V9Z A;  4I3A A;  5J3W A;  2QJ7 A;  1UWN X;  4KUK A;  4HNB A;  4PKY G;  3UMD A;  3MQO A;  5G4Z A;  1S1Z A;  2VEA A;  4B9O A;  1OT9 A;  1LSV A;  1S1Y A;  1T1A A;  1N9O A;  1Y28 A;  2H28 A;  3UME A;  2QWS A;  2WKP A;  1EW0 A;  3G6O A;  2VLG A;  2D01 A;  4EEP A;  1S67 L;  3LID A;  1KOU A;  4GS9 B;  2ZOH A;  3MJQ A;  3LYX A;  3D72 A;  4EER A;  2ZBB A;  1UWP X;  2PDR A;  4PKY A;  1F9I A;  1TS8 A;  1D7E A;  3F1P A;  2EA9 A;  3BY9 A;  3H7W A;  2P7J A;  3NOU C;  4EEU A;  3C8C A;  2GJ3 A;  1LT0 A;  2OWJ A;  3C2W A;  3HJI A;  2V0W A;  1DRM A;  1TS6 A;  2CMN A;  1G28 A;  2R78 A;  4BBV A;  2L1M A;  4HJ6 A;  1T1C A;  4NXB A;  1WA9 A;  4M4X A;  4HJ3 A;  2WKR A;  2L4R A;  3ICY A;  4GS9 A;  3LI9 A;  4LRZ E;  1LL8 A;  3NOT C;  3GDI A;  3IS2 B;  5IU1 A;  5F6A A; 
#chains in the Genus database with same CATH topology
 2V9A A;  4B4X A;  1OTD A;  4QY6 A;  3IXB A;  2HDS A;  4JXG A;  4Y5F A;  3TE8 A;  4FD8 A;  1W5D A;  3ZG0 A;  3N4I A;  1G6A A;  4M3K A;  3P09 A;  3W8K A;  3AGF A;  4GN2 A;  4LRX C;  4Y3I A;  2ZMF A;  3K3C A;  4GLQ A;  2J3T D;  2XD5 A;  3MQQ A;  3SH7 A;  2WGI A;  4S2K A;  1L0F A;  5G4Y A;  3F1N A;  5CEB A;  3LUQ A;  3LR3 A;  3IF6 C;  4BJP A;  3A3F A;  4KZ7 A;  5HD5 A;  5M1A A;  1VET B;  4EUZ A;  2VK3 A;  4ZTK A;  3O87 A;  2O9A A;  1W8Q A;  1SKO A;  3MKE A;  3IHB A;  1VB6 A;  3CAX A;  3T4T A;  4HIA A;  1MBL A;  3LR4 A;  1MKM A;  5TJJ A;  1I2S A;  2BTF P;  5HAQ A;  2KDK A;  3U4L P;  3B3X A;  2WUQ A;  2A24 B;  5DKL A;  3LIC A;  4GD6 A;  4X69 A;  4H6J B;  2ZMV A;  3CG5 A;  3T4J A;  3GEC A;  4YIN A;  3IH9 A;  3IS2 A;  5FEF A;  3E0Y A;  4JGO A;  2HP6 A;  5TBM B;  5FAO A;  1AXB A;  1JVJ A;  2EWW A;  2J3W A;  1G68 A;  2VJW A;  4HEF A;  4GNU A;  3BRM A;  3ZG9 B;  1S4R A;  3VOZ A;  5HSQ A;  1Z09 A;  5F1F A;  5AVF A;  3UB9 A;  2QMI A;  5F5Y A;  5GLC A;  3A3J A;  1W63 Q;  4EBL A;  1L0G A;  2EX6 A;  5HDC A;  3BW6 A;  3W4O A;  4IJG A;  2E8J A;  2JKF A;  1VHM A;  2W3E A;  2R9W A;  5DF7 A;  3GR2 A;  2I72 A;  2ZM2 A;  1TDG A;  5CGW A;  5EE8 A;  5L07 A;  4X1M A;  2ZLY A;  1XA7 A;  3OCL A;  4S2P A;  2DRW A;  4ARZ A;  4YWZ A;  5CER A;  5EEC A;  1YLJ A;  5FAS A;  3PHY A;  1MWT A;  1OTE A;  3G4P A;  3WRZ A;  5IHV A;  1GSW A;  3DWK A;  1XFN A;  4ESP A;  2Z6D A;  4MN6 A;  3HLG A;  3MFX A;  3DTE A;  4OQI A;  4OPR A;  4DE1 A;  2Z6C A;  5HAP A;  4MBK A;  4PM6 A;  1IKI A;  1J9M A;  3V39 A;  3MZD A;  1PW8 A;  4B93 A;  1L2S A;  3B33 A;  3GQZ A;  2FZ0 A;  4EQI A;  4Z9Q A;  2NUP C;  3CIT A;  3F1P B;  4KQR A;  4X56 A;  2Y2K A;  4GZB A;  3LI8 A;  4NXG A;  1XJ4 A;  2Q9N A;  2Y2L A;  3IX8 A;  3MXQ A;  1NZO A;  5EOE A;  3CPT B;  4KQQ A;  4R3B A;  1MZU A;  2ZL1 A;  3NDE A;  3KX0 X;  4YFM A;  4X1L A;  2V1B A;  4I39 A;  4NKP A;  2W3F A;  5GLA A;  5I5L A;  4E3J A;  4HOI A;  3E2K A;  4DRT A;  2V8C A;  4EBN A;  2VGL S;  1HZO A;  5C5K A;  4EU0 A;  2HPB A;  1YKD A;  4S2L A;  3HJK A;  2WKQ A;  4UA6 A;  5DKK A;  4H8R A;  3WRT A;  2W27 A;  1DJB A;  3BJN A;  3IF6 B;  3EGX C;  3MBZ A;  4FOF A;  5EVI A;  2INW A;  3KO6 A;  1BLC A;  2JKT I;  2P74 A;  3H9W A;  1T19 A;  4OPY A;  4L9G A;  3BLM A;  4OON A;  3A3D A;  2HP5 A;  3BFE A;  4L9E A;  2ZM0 A;  2PD8 A;  4Y0T A;  1L3L A;  1P97 A;  1DP6 A;  4IUH A;  4KZB A;  3AGD A;  3LFV A;  4JGR A;  3HL9 A;  4GDN A;  4GD8 A;  2HV1 A;  2M7U A;  3TSG A;  4PPR A;  5GHX A;  5HX9 A;  2OOL A;  2PAV P;  4S2M A;  5FDH A;  1NY0 A;  3VP4 A;  5M19 A;  2XLN A;  4NG2 A;  4UQI M;  4WMC A;  2XA7 S;  3C7U A;  4IED A;  1GCE A;  3H82 B;  1BUL A;  1BZA A;  4DN0 A;  4Z1W A;  4ME4 A;  3R7W B;  1DP9 A;  5IT5 A;  2Y2H A;  1KE4 A;  3MF0 A;  1YAX A;  2B95 A;  3K3D A;  4QY5 A;  1ERQ A;  3L7H A;  1MXO A;  3GSG A;  2ZC4 B;  2Y55 A;  1P0Z A;  1BLH A;  3A3I A;  2Y79 A;  3LCE A;  1F2K A;  4I3A A;  4P87 A;  2W3G A;  4N92 A;  5E43 A;  2P04 A;  3MQO A;  3MZF A;  5G4Z A;  1IKG A;  3SZT A;  1N4O A;  1DY6 A;  5AJG A;  3V5M A;  3ITA A;  5F82 A;  1K57 A;  3G2Z A;  4KZ9 A;  4KEN B;  2XEP A;  3HVF A;  2H28 A;  1YLP A;  2FFF B;  2QPN A;  4CLC E;  1KE0 A;  4BEN A;  3G6O A;  2VLG A;  5GL9 A;  3FPW A;  3LEZ A;  3HLW A;  2FFY A;  3LYX A;  2WZZ A;  3UN7 A;  5HPF A;  2AVX A;  3IHA A;  4EER A;  3Q7V A;  3V67 A;  3OOV A;  4E6X A;  1NYM A;  4PKY A;  4OPZ A;  1FR6 A;  1D7E A;  3BY9 A;  3SS3 A;  4B88 A;  5TR7 A;  5JYO A;  5E2H A;  2XRO A;  5CEC A;  4P85 A;  2DNS A;  3C8C A;  2LB9 A;  2OWJ A;  3QNC A;  3C2W A;  2A2L A;  3DBA A;  2V0W A;  4O01 A;  4RA7 A;  3HCY A;  3VP3 A;  1G28 A;  1Y4O A;  1CI8 A;  2Z2L B;  1ZKJ A;  5CX7 A;  1T1C A;  4BL3 A;  1K0K A;  3IT9 A;  1WA9 A;  3SS4 A;  3MFD A;  3LR0 A;  5FAT A;  2L4R A;  4N9L A;  3ICY A;  2EFU A;  4S2O A;  1K54 C;  4KZ6 A;  3O88 A;  4WZ5 C;  5A92 A;  2KLI A;  4EWF A;  3VFH A;  1NLY A;  5CRF A;  4WM9 A;  4BD0 A;  1T18 A;  4R1G A;  3KSH A;  4Y0O A;  2EXB A;  1LI0 A;  4F3L B;  4GHI A;  3F1O B;  2CC1 A;  3WS2 A;  3PBN A;  1DJA A;  4I5S A;  2H0T A;  3T4K A;  1T1B A;  1JWV A;  3FC7 A;  2XFS A;  3UDI A;  2HJE A;  2H5S A;  1ERM A;  2G7U A;  1XGJ A;  4BQM A;  3NY4 A;  1N9N A;  5E2G A;  1LL5 A;  1LSX A;  3PAE A;  2G2W A;  4XT2 B;  2UWX A;  2OSU A;  1K6S A;  3FG8 A;  3QP8 A;  1F5M A;  2VV8 A;  2ZC6 B;  2O9C A;  4XUX A;  1F98 A;  5CHU A;  2B02 A;  4Y2F A;  4LPZ A;  2IWD A;  5HWT A;  1MC0 A;  3IXH A;  1ZG4 A;  1HTZ A;  2JKR M;  1SCW A;  3BLS A;  1C3B A;  1Q2Q A;  3TW8 A;  5HWV A;  4HJ4 A;  1FIK A;  4Q0I A;  1ACF A;  5FQI A;  4EW7 A;  4LLO B;  2WKI A;  1E25 A;  4K0W A;  1LL9 A;  5HAR A;  3ZQ5 A;  2WAE A;  5EOO A;  3IBJ A;  3P01 A;  1ALQ A;  3HLB A;  2EX9 A;  4JGP A;  2BLS A;  1H8Y A;  1D06 A;  4JXS A;  1YSP A;  3M6B A;  2V1A A;  4GOG A;  3T4L A;  1PWD A;  4X53 A;  5KMW A;  1PYY A;  3ULF A;  1XX2 A;  4KZ4 A;  1DJC A;  1OPX A;  4YOF A;  3OZH A;  5DJT A;  3TOI A;  3ZDJ A;  4X6T A;  2XR0 A;  4DDY A;  3KSF A;  3D4F A;  4R3A A;  1YMX A;  3LIE A;  1TS7 A;  3OPP A;  2ZQC A;  1TVF A;  3L9K A;  5DFX A;  4MLL A;  1FCO A;  5FAP A;  1XXM A;  4IVI A;  5F69 A;  1TS0 A;  3N7W A;  4Y13 A;  4RX3 A;  4BBT A;  1RGZ A;  1KGE A;  3IWI A;  1MY8 A;  5HL6 A;  4R38 A;  4ID4 A;  2X02 A;  1PFL A;  2A3U A;  3B47 A;  2J9O A;  3IF5 A;  3ISG A;  1ODV A;  3H7W B;  3C38 A;  2Y2O A;  4JF4 A;  5FQ9 A;  1MWR A;  4CLC C;  4NEE D;  2ZQD A;  2JHE A;  3LR5 A;  1N9L A;  2P9V A;  2W1T B;  5EV0 A;  1S6R A;  4KZA A;  5EUA A;  1NWZ A;  5CTN A;  5HL1 A;  3ZHH A;  1GHI A;  3T4Q A;  5L2F A;  5CTM A;  5L09 A;  4X55 A;  1YLZ A;  3IWO A;  4S2I A;  3E4O A;  3BQA A;  2Y8H A;  5HDS A;  2C6W B;  1IYP A;  4Y0U A;  1GSX A;  2BG1 A;  5MC7 A;  2PHY A;  3G31 A;  3G34 A;  1LSW A;  4BD1 A;  3C4P A;  3ZNY A;  2ZQ9 A;  4KZ8 A;  1KGF A;  3VOL A;  4HES A;  3S7Q A;  3LY4 A;  1IEL A;  2PR6 A;  2EFX A;  3T1R A;  1GHM A;  1SKF A;  3S7N A;  4S2N C;  2XD1 A;  3UO9 A;  3KSI A;  4DDS A;  2Y2M A;  5AQ7 A;  4E3L A;  3IXD A;  4CLC D;  1VQQ A;  1OJ5 A;  3UDF A;  4RQ9 A;  3FWL A;  5EM0 A;  5LBR A;  1K55 C;  4I3J A;  4F94 A;  5GLD A;  3WS5 A;  3F1N B;  3QHY A;  2H0Y A;  2IWC A;  3HLC A;  4ZDX A;  4IUK A;  4OLG A;  3N8S A;  3RFB A;  2EWV A;  1NRJ A;  4GDB A;  4R70 A;  1SKO B;  4JGQ A;  2J80 A;  3BQ8 A;  5KSH A;  2HGV A;  3RH8 B;  2V0U A;  4BMW A;  1KDW A;  4HH2 A;  4BBU A;  3P98 A;  1XGI A;  3IF6 A;  1MWU A;  3JYI A;  1ES3 A;  3N8R A;  4C75 A;  4QU3 A;  2EXA A;  3HLE A;  2JKG A;  3Q81 A;  1XKZ A;  1S66 L;  3EGD C;  5FI7 A;  1V9Z A;  3MS6 A;  2QJ7 A;  4OOY A;  4PKY G;  3CMZ A;  4KQO A;  3VFF A;  4PM8 A;  4C3Q A;  4DXC A;  4LCL A;  1JTD A;  2Y2I A;  1L0E A;  1YLW A;  4UHU A;  3VP0 A;  3BYD A;  5HFO A;  4UA7 A;  1T1A A;  2J9P A;  1PW1 A;  3WWX A;  4A5R A;  3HUN A;  1CEG A;  2Y59 A;  5BOH A;  3MMH A;  2QWS A;  2XK1 A;  1H3Q A;  1VM1 A;  1H8M A;  1EW0 A;  4LEN A;  3G35 A;  3LY3 A;  2WGV A;  4ARZ B;  1K6R A;  1QME A;  3LID A;  1KOU A;  4GS9 B;  2ZOH A;  2FH5 A;  3MJQ A;  4DKI A;  1G5U A;  1NLZ A;  4ZAM A;  1YLT A;  5FQM A;  1UWP X;  1K57 C;  4CLC B;  3VMA A;  3PBT A;  5E2E A;  1FSW A;  4P6Z S;  4PAU A;  1TS8 A;  3QP4 A;  2EA9 A;  3IXG A;  3JVU A;  1WYB A;  2P7J A;  1TD5 A;  5K5B A;  2E8I A;  3FV7 A;  4WEJ A;  5L10 A;  1VEU B;  4R4S A;  4IBR A;  3W4Q A;  1BLS A;  1PNE A;  2OAQ 1;  3WS4 A;  3PBS A;  1TS6 A;  4UA9 A;  5AQB A;  4ZRR A;  4NK3 A;  4GJ4 A;  1Z6F A;  1TDL A;  4P6B A;  2ZL1 B;  5FQJ A;  3G30 A;  4DE0 A;  3RJU A;  2ZMA A;  2QZ6 A;  2OV5 A;  2R9X A;  2W3H A;  1NXY A;  4Q0J A;  3ZFZ A;  3LI9 A;  5JYP A;  3IWQ A;  3GDI A;  3PXP A;  1I5Q A;  5IU1 A;  1YPR A;  2QJ5 A;  5F1G A;  3UB8 A;  3QP6 A;  4OP5 A;  5A91 A;  3NI9 A;  1M40 A;  4RX2 A;  3EOI A;  1BUE A;  3TJZ C;  1E3U D;  5EVI B;  1CF0 A;  3PR6 A;  4N9K A;  3LIB A;  4I38 A;  2HDU A;  3M6H A;  4HBT A;  3BFD A;  5KZH A;  2WGW A;  4X25 A;  2RCX A;  2WK0 A;  5U47 A;  3E4P A;  3NJA A;  3UY6 A;  2P08 A;  2Y2P A;  1HD8 A;  1TEM A;  4KZ5 A;  5A93 A;  4OQH A;  4MBF A;  2J7V A;  3BEC A;  2J8Y A;  2VX8 A;  3UPP A;  2V2F F;  1IOU A;  3A3E A;  3OC2 A;  4O8G A;  4R0Q A;  1XJ3 A;  2NUT C;  3JVV A;  4BLM A;  4LV0 A;  1TF1 A;  3T1Q B;  3O86 A;  4ZJ2 A;  4WBG A;  4EES A;  4MEZ A;  2XGN A;  3LIA A;  3F1O A;  5EM1 A;  3UB7 A;  1P9R A;  2GZA A;  3DTM A;  1RCJ A;  4WL9 A;  2PBD P;  2M7V A;  4PM9 A;  3CZD A;  1KVL A;  2V1Z A;  3CWF A;  4HBU A;  3N6I A;  3DWZ A;  4G3K A;  2Y2J A;  2OLU A;  4FTX A;  3CHW P;  1PZO A;  1JWP A;  3KYZ A;  5DTK A;  4E3K A;  4ETZ A;  3OLO A;  5FI2 A;  3BFF A;  3U2A A;  1KGG A;  3Q82 A;  4DJ3 A;  4WUJ A;  5L8M A;  2VZW A;  4I3I A;  3BEB A;  4GCZ A;  4HI4 A;  3S7P A;  2LB5 A;  1XJ2 A;  1ZC2 A;  3V3S A;  2B5R A;  4UAA A;  4WZ4 A;  4WF0 A;  4KG2 A;  3NUL A;  2PBY A;  3HRE A;  3W4P A;  3ZNT A;  4QB8 A;  5CGX A;  3VE4 A;  4MN5 A;  3CI6 A;  3K2N A;  3AGE A;  4N1H A;  1DP8 A;  1MKI A;  5AQA A;  2EX8 A;  2W0N A;  4U0T A;  4FUW A;  4JXV A;  4R6L A;  4KG5 A;  3T12 B;  2W1R A;  3G32 A;  4JPM A;  2XDM A;  4LCM A;  5DTS A;  3Q7V B;  3UB5 P;  1YT4 A;  3FKV A;  1W7F A;  1K56 D;  3T1X A;  2B18 A;  1YLY A;  2HDQ A;  4OQG A;  3RTY A;  3CUE A;  1JNU A;  1FQG A;  1GSV A;  4ZJ3 A;  4HY8 A;  2L0W A;  2ZQ8 A;  3NIA A;  3QP2 A;  4K91 A;  2IA2 A;  2WAD A;  3MZE A;  2Z2M B;  4MNR A;  1CQA A;  3FZC A;  3RXX A;  5DTT A;  1ES4 A;  3GMW A;  5EPH A;  5J8X A;  1EI5 A;  2X71 A;  3C30 A;  4X68 A;  4KQD A;  4B4Z A;  4II7 A;  5KSC A;  3OCN A;  3EEA A;  4PM7 A;  3GTC A;  4E3N A;  1JTG A;  3UPN A;  3OBF A;  3TRC A;  5AQ9 A;  4O7D A;  4ETX A;  3DAV A;  1ZTU A;  1OTA A;  3S7O A;  1SHV A;  2K31 A;  3A0V A;  2I9V A;  3EEH A;  4LV1 A;  4HQA A;  3NDG A;  3MQ0 A;  1JWZ A;  2ZC5 B;  3UDX A;  3QNB A;  1S4S A;  3MXS A;  2RL3 A;  3UE1 A;  2WAF A;  3Q7Z A;  4GHI B;  4E04 A;  2WKE A;  1VET A;  5FQQ A;  4WN5 A;  3FYZ A;  4CPK A;  1IEM A;  5A90 A;  5DF8 A;  3LIF A;  1YSQ A;  3CJM A;  3QP1 A;  4LV2 A;  4OH0 A;  1IYQ A;  3IBR A;  1K38 A;  2JCH A;  3GVB A;  4OLD A;  3E4Q A;  2MJ6 A;  3VP1 A;  4EQ1 A;  2A24 A;  3T1S A;  4H6J A;  1CEF A;  1A0K A;  2D02 A;  4FSF A;  2ZC7 A;  4GW9 A;  3UB6 A;  2HJ9 C;  4HP9 A;  5TBM A;  1RP5 A;  1WYC A;  1EWZ A;  2UV0 E;  1FCM A;  3PBR A;  1XJ6 A;  3UE6 A;  4HP4 A;  5GHZ A;  4OOM A;  3HLF A;  5J3W A;  1UWN X;  2Q0O A;  1BT5 A;  2PRF A;  3UMD A;  3MXR A;  4C6Y A;  1S1Z A;  5FEG A;  3SOI A;  1OT9 A;  1PIO A;  3IX3 A;  1ESI A;  1LSV A;  5HAI A;  3S22 A;  4EV4 A;  1N9O A;  4JXW A;  2K2N A;  3UPO A;  4WEK A;  3UME A;  1D1J A;  1Y54 A;  4E6W A;  2OAP 1;  2JKR I;  1S67 L;  4ZJ1 A;  4U0X A;  1STZ A;  4OPQ A;  2WYX A;  4OP8 A;  3D72 A;  1W63 M;  2OLV A;  2ZBB A;  2PDR A;  1ZG6 A;  4OOL A;  1FCN A;  3SH8 A;  3EQU A;  4RVA A;  5FI6 A;  2VKS A;  1F9I A;  1NYY A;  3VP2 A;  3F1P A;  3W2Z A;  2JKT M;  2ZQ7 A;  3NOU C;  4LV3 A;  2VGJ A;  2WKH A;  3M2J A;  2XFT A;  1RGY A;  4D2O A;  5EVE A;  3UE3 A;  3CPT A;  4MMN A;  1PWG A;  1FR1 A;  1H5X A;  1K25 A;  4AFI A;  4L0L A;  5CGS A;  3WS1 A;  1DRM A;  5EVI C;  3ZG8 B;  2ZD8 A;  4BBV A;  2XRN A;  1ONG A;  1HVB A;  2L1M A;  1NJ4 A;  4JKT A;  2P9V B;  4GKU A;  4HJ6 A;  1OME A;  2VGL M;  4R23 A;  3NBL A;  3OPR A;  4XXR A;  4M4X A;  2ZQA A;  3ZCZ A;  1NRF A;  2WKR A;  2H10 A;  3S4X A;  5CHJ A;  4GS9 A;  4LRZ E;  1LL8 A;  1FSY A;  3BM6 A;  4XUZ A;  5M18 A;  1E4D A;  2V20 A;  3NOT C;  2W3D A;  4R3J A;  2O0Y A;  3IS2 B;  4CLC A;  2DCF A;  5F6A A;  4K0X A;  1LI9 A;  4Q0H A;  2IWB A;  3MKF A;  1L0D A;  5HZH A;  2OWH A;  1M6K A;  5GHY A;  4P6Z M;  3SW1 A;  2Y2G A;  1IYS A;  4CQH A;  2GDN A;  1LLB A;  4HH3 A;  4K08 A;  1VEU A;  5DJU A;  5CHM A;  1AWI A;  4EET B;  4KUO A;  1UGU A;  2JC7 A;  2JE5 A;  2X01 A;  4DE2 A;  5EVI D;  5AVE A;  2XSS A;  2ZJ9 A;  2KX6 A;  4NXF A;  2VV7 A;  3M2K A;  2XA7 M;  3H82 A;  4UEY A;  4DJ2 A;  5A8B A;  4LGW A;  3ZVT A;  1FIL A;  3R7W A;  4FCF A;  4R4R A;  3DW0 A;  3SH9 A;  3GV9 A;  4S2N A;  4QPR A;  3BFC A;  5DFY A;  2ZM8 A;  1CK3 A;  1K55 A;  3NHQ A;  2YKH A;  3ZYT A;  4Y7P A;  4WMC D;  5TFQ A;  2Y2Q A;  5HW3 A;  5FDS A;  1IYO A;  5FSR A;  3C7V A;  4QJG A;  2VA0 A;  1IFQ A;  5HPI A;  2PU2 A;  3EWK A;  4MN7 A;  5J7E A;  3CLO A;  5G18 A;  1ESU A;  1H0M A;  4JBF A;  5J4E A;  3O3V A;  4EXO A;  3JPU A;  4Y17 A;  1OJG A;  1BSG A;  1H8Z A;  2M1C A;  3UNW A;  1W79 A;  4OQ0 A;  1XFQ A;  1XA1 A;  2QHK A;  5GLB A;  1BTL A;  2PD7 A;  3NOP C;  1BLP A;  1OTI A;  4S2J A;  1HLU P;  2XQZ A;  2WZX A;  1V9Y A;  3Q07 A;  5F68 A;  3I7J A;  3IX4 A;  1MPL A;  3ZGA B;  3A0R A;  5CED A;  3Q1F A;  5DVA A;  2PR5 A;  2QKP A;  4QD4 A;  3NC8 A;  1GHP A;  5FL3 A;  3DTK A;  5HD3 A;  3G2Y A;  2QYB A;  1CI9 A;  2O9B A;  5KIZ A;  1YQS A;  4YNR A;  1X0O A;  2O99 A;  4KG6 A;  2Y91 A;  1PI4 A;  2K7S A;  4KZ3 A;  4E3M A;  2YKF A;  5DF9 A;  3WS0 A;  4QHC A;  2VGK A;  5CXW A;  4IBX A;  5D3O A;  5E2F A;  4FH4 A;  1KE3 A;  5IS1 A;  3KYE A;  1ZHH B;  4UQI S;  2EX2 A;  2HZ5 A;  4MDZ A;  3PTE A;  3CUE C;  1E3U A;  3VSK A;  5HDD A;  4LRY C;  3GRJ A;  1BYW A;  2JN7 A;  2ZOI A;  1OT6 A;  1K4E A;  4F3L A;  3D9Y A;  3R4K A;  3PAG A;  3NCK A;  2C5W B;  1PZP A;  3IH8 A;  2DMW A;  4U3T A;  2BAS A;  1W8Y A;  1YMS A;  3MR0 A;  1CJF A;  4OVD A;  3OPL A;  3FPV A;  3BWL A;  4IVK A;  3D3O A;  3EQV A;  4N1X A;  1P9W A;  4L9F A;  3P7N A;  3BY8 A;  2HDR A;  4JF5 A;  3BFG A;  3C5A A;  1GA0 A;  3SS5 A;  4BL2 A;  3T50 A;  3HUM A;  1N9B A;  3E98 A;  3PYP A;  1PWC A;  5I94 A;  2PU4 A;  2VV6 A;  4XT2 A;  3HUO A;  4NXE A;  2V8F A;  2WGW B;  3PBO A;  3O5Y A;  4WLA A;  4FH2 A;  3KSG A;  3ZVW A;  3LO7 A;  1KVM A;  2A49 A;  5EFW A;  1S0W A;  3V50 A;  3DTI A;  3HBR A;  4E3O A;  3T4S A;  4MBH A;  2KOI A;  1I2W A;  3A0S A;  4HHD A;  1O07 A;  1PRQ A;  2PYP A;  1OTB A;  2JBF A;  2PYR A;  4BWI A;  3KYQ A;  3T4O A;  4G3W A;  5HWW A;  3E2L A;  1Q2P A;  5EVL A;  4JF6 A;  3N8L A;  5TGF A;  3VE3 A;  2G2U A;  4ZBE A;  1GA9 A;  4DE3 A;  5FQK A;  4KUK A;  4HNB A;  4OKP A;  4CJN A;  2ACG A;  2XF3 A;  4P0M A;  3B42 A;  4G3V A;  3TG9 A;  3ITB A;  3MSH A;  2HF6 A;  1XP4 A;  2Y4A A;  4MCW A;  2Q9M A;  2VEA A;  1FOF A;  2PT7 A;  3IQA A;  4B9O A;  4PMA A;  1O7E A;  3HLD A;  4D60 A;  3VOY A;  3LEQ A;  1S1Y A;  1ES2 A;  1J3W A;  1SDN A;  1U60 A;  1G6O A;  4EBP A;  1Y28 A;  4EUV A;  3UE0 A;  3RXW A;  4PM5 A;  3QP5 A;  1NZU A;  4DMZ A;  2WKP A;  4GB7 A;  4RYE A;  1SDE A;  1K56 A;  4LFU A;  3ZG5 A;  2D01 A;  4EEP A;  3PBQ A;  4WEL A;  5FA7 A;  4E3I A;  2HP9 A;  5F83 A;  3OPH A;  1PI5 A;  4DXB A;  2GNX A;  2Y2N A;  3V3R A;  1ONH A;  4O0P A;  3H7W A;  1MWS A;  1ES5 A;  1K54 A;  2J3T C;  4EEU A;  4WZ5 A;  3C4O A;  2W1T A;  1WE4 A;  1YM1 A;  2GJ3 A;  1LT0 A;  4QWO A;  4Q8I A;  4Y15 A;  4PHT A;  3HJI A;  4NET A;  4WYY A;  2XH9 A;  3LGO A;  2CMN A;  3FKW A;  2R78 A;  3ZG7 B;  4IHQ A;  3S1Y A;  1XPB A;  3NEC A;  5FAQ A;  1LHY A;  4NXB A;  4HJ3 A;  1K4F A;  4DF6 A;  1KDS A;  4JLF A;  2GX5 A;  1QMF A;  1SZV A;  3VV4 A;  3VSL A;  1ERO A;  2ZC3 B; 
#chains in the Genus database with same CATH homology
 2V9A A;  2QJ5 A;  1T18 A;  5HZH A;  1OTD A;  2OWH A;  3KSH A;  3UB8 A;  4Y5F A;  3TE8 A;  4F3L B;  4P6Z M;  3SW1 A;  4GHI A;  3EOI A;  3F1O B;  4CQH A;  3TJZ C;  3PR6 A;  3LIB A;  3PBN A;  4LRX C;  4I38 A;  4I5S A;  4Y3I A;  4HH3 A;  3T4K A;  2ZMF A;  3K3C A;  4K08 A;  1T1B A;  4GLQ A;  5DJU A;  2J3T D;  3FC7 A;  3MQQ A;  4EET B;  4KUO A;  1UGU A;  5G4Y A;  2HJE A;  3F1N A;  3E4P A;  3LUQ A;  3LR3 A;  2G7U A;  4BJP A;  5HD5 A;  1N9N A;  3NJA A;  2P08 A;  5AVE A;  2XSS A;  2KX6 A;  2O9A A;  1LSX A;  4NXF A;  2VV7 A;  4XT2 B;  1VB6 A;  2XA7 M;  3CAX A;  3H82 A;  4UEY A;  3T4T A;  4DJ2 A;  4HIA A;  5A8B A;  2VX8 A;  3LR4 A;  3FG8 A;  1IOU A;  1MKM A;  1F5M A;  2VV8 A;  5TJJ A;  3OC2 A;  2O9C A;  1F98 A;  2KDK A;  2B02 A;  3R7W A;  4Y2F A;  4O8G A;  4LPZ A;  1XJ3 A;  5HWT A;  2NUT C;  2A24 B;  5DKL A;  3LIC A;  1MC0 A;  3JVV A;  4H6J B;  1TF1 A;  2ZMV A;  3T4J A;  3GEC A;  2JKR M;  4QPR A;  5DFY A;  3IS2 A;  3E0Y A;  3TW8 A;  4JGO A;  4HJ4 A;  5TBM B;  5HWV A;  4Q0I A;  4EES A;  2EWW A;  3NHQ A;  2J3W A;  4EW7 A;  4LLO B;  3LIA A;  2YKH A;  3ZYT A;  2VJW A;  3F1O A;  3UB7 A;  1P9R A;  1S4R A;  2GZA A;  5HSQ A;  3ZQ5 A;  4WL9 A;  5AVF A;  3UB9 A;  2M7V A;  3IBJ A;  5F5Y A;  5F6A A;  1W63 Q;  3P01 A;  3CWF A;  5HDC A;  2VA0 A;  3BW6 A;  1IFQ A;  5HPI A;  4JGP A;  4IJG A;  4G3K A;  3EWK A;  4MN7 A;  1D06 A;  3CLO A;  1YSP A;  5J7E A;  3KYZ A;  2V1A A;  4ETZ A;  5J4E A;  1VHM A;  3OLO A;  4EXO A;  2W3E A;  3T4L A;  1OJG A;  3U2A A;  4DJ3 A;  4WUJ A;  5L8M A;  2VZW A;  4I3I A;  2M1C A;  4GCZ A;  4HI4 A;  3S7P A;  2LB5 A;  1XFQ A;  1XJ2 A;  2QHK A;  3ULF A;  4WF0 A;  5DJT A;  1OPX A;  4YOF A;  3OCL A;  2PD7 A;  4ARZ A;  4YWZ A;  3VE4 A;  4MN5 A;  3NOP C;  3KSF A;  3PHY A;  4R3A A;  3CI6 A;  1OTI A;  3K2N A;  1OTE A;  3LIE A;  1DP8 A;  1TS7 A;  2W0N A;  1GSW A;  5DFX A;  1XFN A;  1V9Y A;  2Z6D A;  4MN6 A;  5F68 A;  3MFX A;  4R6L A;  3A0R A;  5F69 A;  2Z6C A;  1TS0 A;  2PR5 A;  2QKP A;  5FL3 A;  2W1R A;  5HD3 A;  4B93 A;  2QYB A;  2O9B A;  4BBT A;  3B33 A;  5KIZ A;  2B18 A;  2FZ0 A;  3RTY A;  3CUE A;  1JNU A;  4YNR A;  1X0O A;  1GSV A;  4R38 A;  5HL6 A;  2O99 A;  4HY8 A;  2NUP C;  3B47 A;  3CIT A;  2K7S A;  1ODV A;  3F1P B;  2L0W A;  3H7W B;  3C38 A;  3LI8 A;  4NXG A;  4CLC C;  1XJ4 A;  4NEE D;  2IA2 A;  2JHE A;  3LR5 A;  3MXQ A;  1N9L A;  2YKF A;  5DF9 A;  2W1T B;  1MZU A;  3KX0 X;  1NWZ A;  2V1B A;  3C30 A;  4I39 A;  4NKP A;  5IS1 A;  4KQD A;  2W3F A;  1ZHH B;  4II7 A;  3OCN A;  5I5L A;  3T4Q A;  4HOI A;  4UQI S;  4MDZ A;  3EEA A;  3CUE C;  2VGL S;  5C5K A;  4EU0 A;  1YKD A;  5HDD A;  4LRY C;  3HJK A;  1BYW A;  3E4O A;  2JN7 A;  3OBF A;  3BQA A;  3TRC A;  2WKQ A;  1OT6 A;  2ZOI A;  4ETX A;  2Y8H A;  5DKK A;  5HDS A;  2W27 A;  4F3L A;  1ZTU A;  1OTA A;  3S7O A;  3R4K A;  3BJN A;  2K31 A;  1GSX A;  3A0V A;  5MC7 A;  3EGX C;  2PHY A;  2DMW A;  1LSW A;  2I9V A;  4FOF A;  2BAS A;  2INW A;  3KO6 A;  3EEH A;  2JKT I;  3MR0 A;  3H9W A;  1T19 A;  4HQA A;  3FPV A;  3MQ0 A;  3BWL A;  3D3O A;  4L9G A;  3VOL A;  3S7Q A;  1S4S A;  3EQV A;  2PR6 A;  1P9W A;  3P7N A;  4L9F A;  3BY8 A;  4L9E A;  4GHI B;  3S7N A;  4E04 A;  2PD8 A;  4WN5 A;  1P97 A;  3KSI A;  3T50 A;  3E98 A;  3PYP A;  4CLC D;  1OJ5 A;  1DP6 A;  4RQ9 A;  3LIF A;  1YSQ A;  2VV6 A;  4IUH A;  4XT2 A;  5LBR A;  3LFV A;  4JGR A;  4NXE A;  4I3J A;  2HV1 A;  3PBO A;  2M7U A;  3O5Y A;  3IBR A;  4WLA A;  3F1N B;  2OOL A;  4IUK A;  3KSG A;  3RFB A;  3E4Q A;  2EWV A;  1NRJ A;  2MJ6 A;  4EQ1 A;  2A24 A;  4R70 A;  5EFW A;  4UQI M;  2XA7 S;  4H6J A;  2D02 A;  3H82 B;  4FSF A;  4GW9 A;  4JGQ A;  3UB6 A;  2J80 A;  3BQ8 A;  4DN0 A;  3T4S A;  2HJ9 C;  4HP9 A;  4Z1W A;  2HGV A;  5TBM A;  5KSH A;  3RH8 B;  4ME4 A;  2V0U A;  3R7W B;  2KOI A;  1DP9 A;  4BMW A;  3A0S A;  5IT5 A;  3MF0 A;  4HHD A;  4HH2 A;  4BBU A;  2PYP A;  1YAX A;  3PBR A;  1OTB A;  2PYR A;  3K3D A;  4BWI A;  3KYQ A;  1XJ6 A;  3T4O A;  4G3W A;  5HWW A;  3UE6 A;  1P0Z A;  4HP4 A;  3VE3 A;  1S66 L;  3EGD C;  2Y79 A;  4OOM A;  1V9Z A;  4I3A A;  5J3W A;  2QJ7 A;  1UWN X;  4KUK A;  4HNB A;  2W3G A;  4PKY G;  3UMD A;  2P04 A;  3MQO A;  4KQO A;  3B42 A;  5G4Z A;  4G3V A;  1S1Z A;  2HF6 A;  4MCW A;  5AJG A;  2VEA A;  2PT7 A;  4B9O A;  1OT9 A;  1LSV A;  1S1Y A;  1T1A A;  1N9O A;  2K2N A;  1G6O A;  4WEK A;  1Y28 A;  4EUV A;  2H28 A;  3MMH A;  3UME A;  2QWS A;  1H3Q A;  4DMZ A;  2WKP A;  1H8M A;  4CLC E;  1EW0 A;  3G6O A;  2OAP 1;  2VLG A;  2D01 A;  2JKR I;  4EEP A;  1S67 L;  3PBQ A;  4WEL A;  4ARZ B;  3LID A;  3FPW A;  1KOU A;  4GS9 B;  1STZ A;  2ZOH A;  2FH5 A;  3MJQ A;  3LYX A;  1NLZ A;  5HPF A;  3D72 A;  1W63 M;  4EER A;  2ZBB A;  1UWP X;  2PDR A;  4CLC B;  3V67 A;  3OOV A;  3PBT A;  4OOL A;  4PKY A;  3EQU A;  4P6Z S;  4PAU A;  2VKS A;  2GNX A;  1F9I A;  1TS8 A;  1D7E A;  3F1P A;  2EA9 A;  3BY9 A;  3JVU A;  3W2Z A;  4O0P A;  3H7W A;  2JKT M;  2P7J A;  1TD5 A;  5K5B A;  3NOU C;  2XRO A;  4WEJ A;  2J3T C;  4EEU A;  3UE3 A;  4MMN A;  2W1T A;  3C8C A;  2LB9 A;  2GJ3 A;  1LT0 A;  2OWJ A;  3C2W A;  2OAQ 1;  2A2L A;  3HJI A;  4PHT A;  4AFI A;  3DBA A;  4L0L A;  3PBS A;  2V0W A;  4O01 A;  1DRM A;  1TS6 A;  3HCY A;  2CMN A;  4ZRR A;  1G28 A;  2R78 A;  4BBV A;  4GJ4 A;  2XRN A;  2L1M A;  4IHQ A;  5CX7 A;  4HJ6 A;  1T1C A;  2VGL M;  4NXB A;  1WA9 A;  4M4X A;  4HJ3 A;  3LR0 A;  2WKR A;  2L4R A;  3ICY A;  2W3H A;  4GS9 A;  2GX5 A;  4Q0J A;  3LI9 A;  4LRZ E;  1LL8 A;  3NOT C;  2W3D A;  3GDI A;  3VV4 A;  3PXP A;  2O0Y A;  2KLI A;  3IS2 B;  4CLC A;  5IU1 A;  1NLY A;  4Q0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...