4FCFA

K234r: apo structure of inhibitor resistant beta-lactamase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADRTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase SHV-1
publication title Design and exploration of novel boronic acid inhibitors reveals important interactions with a clavulanic acid-resistant sulfhydryl-variable (SHV) beta-lactamase.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 99
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4fcfA00
1PI4A 1K54C 5EUAA 3EQUA 1PIOA 3ZVWA 5TFQA 2IWCA 2V20A 2OLUA 3GRJA 1L0FA 3C5AA 3V3RA 5CEBA 3UPNA 4X53A 5CHMA 1RCJA 3C4PA 5IHVA 3TG9A 5HAIA 3IXGA 4X55A 4KQRA 2EFXA 4UHUA 5HW3A 2WGVA 1IEMA 3M2JA 4IVIA 4EBPA 3FV7A 5A92A 3HUNA 1NYYA 4OQ0A 1NYMA 3OPPA 3WS0A 2ZC6B 2OLVA 4IEDA 1KGFA 3IWOA 1GHMA 5CXWA 5F83A 4KZ6A 5TR7A 1XXMA 3G2ZA 1JWZA 2Y2HA 1YLZA 4M3KA 4X69A 1ES3A 2P74A 3HUMA 4S2OA 1GA0A 3UY6A 3ZVTA 2OV5A 3IWQA 3BFGA 3O88A 2X02A 4R3BA 1YLTA 4XUXA 2J8YA 5HAQA 4PM6A 3ISGA 4UAAA 5JYPA 1RGZA 1DJAA 2IWDA 4DE1A 1M40A 4BL2A 5KMWA 1CI9A 1FCMA 1K55C 5FQKA 2ZM2A 4ZJ3A 1HTZA 1L2SA 3NDGA 5E2GA 1PZPA 1IKIA 3V50A 2Y91A 4OQGA 1GCEA 1FSYA 5FI2A 3Q7VA 3HLCA 1E3UD 1BULA 5FAQA 3DWZA 2XEPA 1ZKJA 2ZQ7A 1YLWA 2Q9MA 5E2EA 4MBFA 4B88A 2UWXA 3B3XA 4WM9A 4S2KA 4YINA 1XPBA 4KG5A 1KGEA 3IHBA 4S2MA 4FCFA 1DJCA 2XD1A 1MWUA 4U0XA 1YT4A 3NCKA 4RX3A 5GL9A 4E3OA 4PM5A 1FR6A 4N1HA 4KZ9A 5FASA 3IWIA 3PBQA 1MWSA 2FFYA 1W8QA 3GSGA 5A91A 3SS4A 3VSKA 4C75A 4FD8A 4EWFA 2ZM8A 3PBRA 5M1AA 2JE5A 4L0LA 4E3LA 1GHPA 4QY6A 3AGEA 4WYYA 5CGSA 4EV4A 1BUEA 2WZXA 1XP4A 2WUQA 2X71A 1N9BA 5M19A 1BTLA 3VOYA 3BFEA 1ES4A 4F94A 2XQZA 4R4RA 1YMXA 2DRWA 1GHIA 3MZFA 4KZBA 4QHCA 4BENA 5GHZA 5EVLA 3Q82A 1HD8A 1Z6FA 4OPZA 2EX6A 2Y2IA 3PAGA 1U60A 3Q7VB 2HP9A 1ES5A 3O87A 2G2WA 4GD6A 5AQAA 3GQZA 4OPQA 3CMZA 3QHYA 5GHXA 1BLHA 1YM1A 1EI5A 2GDNA 2Y2QA 4EBNA 3HLGA 3VFFA 1LHYA 4KZ5A 4U3TA 4GD8A 1EWZA 3Q7ZA 3HL9A 1O7EA 2WAFA 2ZQ8A 4N92A 1YLJA 2PBYA 1W79A 1K4EA 4DKIA 4E6WA 1PW8A 3GMWA 3OPRA 5F1GA 1NZUA 4JXSA 3A3EA 3UNWA 4OLDA 1IYQA 3FWLA 4XUZA 3WS2A 2Y59A 2XR0A 4S2LA 5CTNA 1BLPA 4LENA 1NZOA 3UPPA 1K54A 2EX2A 3UE1A 5FI7A 1CEFA 1Q2QA 2H0TA 4KQOA 5DTKA 4BL3A 4FSFA 3IH9A 1SKFA 1ERMA 3LO7A 1PZOA 2G2UA 2B5RA 3S4XA 4GNUA 4R23A 4PM8A 3UPOA 1K57C 4WMCA 4JF6A 4QJGA 3OZHA 3IQAA 2ZJ9A 2Y2KA 3EQVA 3DW0A 1JWPA 4ZJ2A 4K91A 5CHUA 3RXXA 4HBUA 4JPMA 4BD0A 1VM1A 4OONA 5FATA 5CGWA 2I72A 2ZC5B 3VP0A 4OKPA 3E2LA 4K0XA 3LY3A 4OPYA 5EOOA 1BT5A 5I94A 4OH0A 4OQIA 2HDQA 3BECA 4P85A 4R3JA 2XGNA 3NBLA 3ZNTA 3FZCA 3WRTA 4DDYA 4KZ4A 4C6YA 3G2YA 4DE2A 3HUOA 3TOIA 1WYCA 3MBZA 4E3IA 2QPNA 3W4QA 1TVFA 1K55A 5FQMA 1QMEA 5FA7A 5KSHA 5HAPA 1KDSA 4WEKA 2C6WB 3ITAA 3PBSA 4OLGA 3NC8A 2Y2LA 3OCLA 3ZHHA 4OVDA 3GTCA 2X01A 3Q07A 5FQ9A 2WADA 3VP4A 3G30A 1YLYA 5E2FA 3AGDA 2JBFA 2ZQDA 3IF6A 1JWVA 4KQQA 3VP1A 4NK3A 3BLMA 5HARA 4FH2A 3I7JA 2ZC4B 1ONGA 2Z2MB 3ZG0A 1K6SA 4LCLA 1YQSA 1S0WA 2XH9A 2XLNA 4OP8A 1K4FA 4GOGA 5F82A 5F1FA 1HVBA 3IXDA 3G31A 3IF6C 1LI0A 4PPRA 3A3IA 3ITBA 5AQBA 3SS5A 5FQJA 5GHYA 3BFDA 2Y2NA 5GLDA 1XGJA 1I5QA 3S1YA 2A49A 1MXOA 1QMFA 1XX2A 2EXBA 2VGKA 1JVJA 3PBTA 3BLSA 2HDRA 3MXRA 5M18A 5L2FA 4N1XA 1TDGA 3N4IA 4B4ZA 1IYPA 3Q81A 3C7UA 2HPBA 1ZC2A 4MEZA 1XGIA 4CPKA 5DF8A 4UA9A 3V39A 5BOHA 2XDMA 3CJMA 3FKVA 4E3NA 1EROA 2J7VA 1FCOA 2ZQCA 3IT9A 5DTTA 3WS1A 2DCFA 1ESUA 3E2KA 3V3SA 3S22A 2XD5A 1K56A 3W8KA 3G4PA 3JYIA 4E3KA 5EOEA 1OMEA 3OPHA 2WAEA 2H0YA 1BZAA 4KG6A 3NY4A 4ZBEA 3IHAA 4E6XA 1CI8A 1Y54A 3PBOA 5CRFA 3OCNA 3PAEA 2QMIA 1MBLA 2QZ6A 3HLEA 1WE4A 1IELA 3IF6B 1KE0A 1KDWA 3CG5A 3D4FA 3IXBA 5EE8A 5CERA 3C7VA 1E3UA 4IBRA 4P6BA 1BSGA 1PW1A 1NRFA 2R9XA 1S6RA 4JF4A 3VOZA 4DDSA 1G68A 5AQ9A 1LLBA 4WZ4A 4A5RA 3P09A 4LV2A 4KZ7A 4RYEA 5CECA 5KZHA 1XA7A 4BQMA 4WELA 4E3JA 3LY4A 4LCMA 3HREA 1H8ZA 4OOYA 1MKIA 4S2PA 5FAOA 3VP3A 2C5WB 4ZDXA 4Y0OA 2ZLYA 5EPHA 4MLLA 4WMCD 1FQGA 1W7FA 2PU4A 5DVAA 3VFHA 5FQIA 3WS5A 4S2NC 4MBKA 3QNBA 1H5XA 5CEDA 3M6HA 4PM7A 5A93A 4RX2A 3LEZA 3UE3A 5D3OA 5CGXA 1K57A 4UA7A 3ZCZA 1G6AA 4OOMA 4JBFA 5U47A 5GLAA 2ZM0A 1I2SA 3ZG9B 3N7WA 2BLSA 3FYZA 4JXWA 1LL5A 1SDNA 2ZMAA 5GLBA 4ZJ1A 3Q1FA 1HZOA 3WRZA 1DJBA 4JXGA 1I2WA 4KZAA 4WZ5C 3RXWA 1DY6A 4EBLA 2WYXA 4RVAA 1XA1A 3CZDA 1ERQA 3IH8A 4QD4A 4BD1A 3NI9A 4QU3A 3FKWA 5A90A 4P87A 3ZDJA 3ZNYA 3ZG5A 1RP5A 4RA7A 2RL3A 4Y0UA 1PI5A 2HDSA 4JLFA 4OPRA 5E43A 1L0GA 4GB7A 3UDXA 5EECA 3MZEA 2WKHA 1YMSA 3AGFA 3WWXA 5HFOA 4HBTA 3TSGA 3VSLA 2EX8A 1MPLA 4QY5A 1LI9A 1BLCA 4GDBA 3ZFZA 2R9WA 4U0TA 5FI6A 1W8YA 4DXCA 1MWTA 2BG1A 5DF9A 1AXBA 1H8YA 2Q9NA 1L0DA 4GZBA 2V2FF 3ZGAB 4ID4A 2E8IA 1CEGA 1TDLA 3BM6A 2Y2JA 2XK1A 1CK3A 4X68A 3BEBA 1ONHA 3HLBA 4H8RA 5DF7A 1JTGA 4E3MA 1IKGA 1ZG4A 4BJPA 4Q8IA 1PWCA 3C4OA 3BFCA 2HP6A 1ES2A 4OP5A 2J9OA 1KVMA 4KZ8A 5EVIA 1K38A 2FFFB 3PBNA 4UA6A 5FDHA 2HDUA 3A3DA 3W4PA 1XKZA 1L0EA 2PU2A 2XFSA 3HLDA 3V5MA 4IBXA 1KGGA 1K56D 1RGYA 3N8SA 4C3QA 5JYOA 5EVIC 2P9VA 4X56A 2Z2LB 1IYOA 5FQQA 1E25A 2ZC7A 2EFUA 4GDNA 3SOIA 4CJNA 2Y2GA 5KSCA 4R0QA 2WK0A 1TEMA 1YLPA 2HP5A 1GA9A 1IYSA 3G32A 4PM9A 4Y0TA 4ZTKA 5G18A 3N6IA 3HBRA 4S2JA 3SH7A 1ALQA 5J8XA 4XXRA 2JCHA 4MBHA 2A3UA 2Y2MA 2ZD8A 4MNRA 3MXSA 1ZG6A 2WGIA 4OOLA 3LCEA 4JKTA 3VMAA 2RCXA 3W4OA 1SHVA 4IVKA 2VGJA 3BRMA 2ZQAA 1PWDA 2XFTA 2Y2PA 4KENB 1PYYA 4HESA 4S2IA 5DTSA 4DXBA 2JC7A 2EX9A 3IXHA 4OQHA 1FCNA 4PMAA 5HL1A 4ZAMA 5GLCA 1W5DA 1FSWA 2WGWA 2J9PA 3OC2A 3GVBA 3BFFA 3O3VA 1JTDA 3RJUA 3N8RA 4KZ3A 3ZG8B 5EVIB 1C3BA 2WZZA 3UN7A 3IF5A 4GN2A 3BYDA 3HLWA 1N4OA 3DTMA 4DF6A 1NJ4A 4EUZA 2ZQ9A 1E4DA 4R4SA 4EQIA 3DWKA 4YFMA 1PWGA 4WEJA 2Y4AA 1J9MA 3PTEA 3NDEA 4Y7PA 2ZC3B 3O86A 4KG2A 4S2NA 5FSRA 4LV1A 4K0WA 2IWBA 2H10A 2P9VB 4P0MA 2Y55A 4DE0A 1M6KA 4BLMA 5CHJA 4JXVA 1BLSA 4LV0A 2CC1A 3UDIA 2WKEA 5CTMA 3VP2A 3ZG7B 4NETA 4FH4A 4HEFA 1NXYA 3GV9A 3UE0A 4N9KA 3P98A 3WS4A 2WKIA 1K6RA 2EXAA 5E2HA 5HX9A 3G35A 5TGFA 4WZ5A 4LV3A 2DNSA 2OSUA 3MKFA 1ESIA 3QNCA 5FAPA 3NIAA 4X6TA 3M2KA 4JF5A 1SCWA 1LL9A 1MWRA 2XF3A 3N8LA 1KVLA 2WGWB 1MY8A 4N9LA 3G34A 3UDFA 4O7DA 4B4XA 3MFDA 4GKUA 1WYBA 3M6BA 3SH8A 4Z9QA 3UO9A 2Y2OA 1VQQA 5AQ7A 1Q2PA 3A3JA 1FR1A 3HLFA 1FOFA 1KE3A 3OPLA 4D2OA 3A3FA 3HVFA 4DE3A 1KE4A 3SH9A 1O07A 2V1ZA 4DRTA 1K25A 1NY0A 1SDEA 4R1GA 4WBGA 3SS3A 2H5SA 3MKEA 3GR2A 4QB8A 5EVID 3MZDA
chains in the Genus database with same CATH superfamily
3LR5A 5EUAA 3EQUA 3ZVWA 4CLCD 4G3WA 2IWCA 2OLUA 2FH5A 4LPZA 4QPRA 3IXGA 4IVIA 4EBPA 5AJGA 2EWVA 3SW1A 1OPXA 1NYMA 3OPPA 4Q0IA 5CXWA 3IWOA 5TR7A 1XXMA 1S66L 2P74A 3HUMA 4S2OA 1GA0A 2K31A 1UGUA 3BFGA 3O88A 2X02A 5JYPA 2J8YA 4D60A 4NKPA 4HIAA 1HTZA 3NDGA 2Y91A 1FSYA 3Q7VA 1E3UD 1BULA 3DWZA 2QKPA 1ZKJA 3RTYA 5E2EA 4MBFA 1KGEA 1DJCA 1MWUA 3NCKA 4RX3A 1FR6A 4EQ1A 3GSGA 1XJ2A 4EETB 3NOTC 1GHPA 4WYYA 3AGEA 4EV4A 3NECA 4EUVA 1N9BA 5M19A 3VOYA 2DRWA 4QHCA 4BENA 4KZBA 5EVLA 5CX7A 4WN5A 3E4OA 4NEED 5J7EA 2O99A 4K08A 3CMZA 3E4QA 1EI5A 4EBNA 2VA0A 3HL9A 2OWHA 1YLJA 2PBYA 4DKIA 1PW8A 3GMWA 3A3EA 4XUZA 3C2WA 3UB6A 1NZOA 1Q2QA 5DTKA 4Y3IA 4BL3A 3IH9A 3LFVA 2WKPA 4P6ZS 1PZOA 3LYXA 2P08A 3OZHA 1JWPA 2R78A 2A24A 3PHYA 4JPMA 4BD0A 1VM1A 4OONA 5FATA 4GHIA 2ZC5B 1VB6A 3E2LA 3LY3A 5EOOA 5I94A 4OH0A 2JKTM 2HDQA 3FPWA 3TW8A 3WRTA 3MQ0A 3G2YA 4YOFA 4E3IA 3MBZA 2QPNA 1TD5A 2HZ5A 5HAPA 2C6WB 3RFBA 2J3TD 3NC8A 3OCLA 3ZHHA 4OVDA 5FQ9A 2WADA 5HPFA 5E2FA 2JBFA 5HPIA 3KYQA 4KQQA 3VP1A 2D01A 4NK3A 3BLMA 2XROA 2PYPA 2XH9A 2QJ5A 4OP8A 1HVBA 3G31A 3ITBA 3BFDA 3JVVA 3UB5P 3IX4A 3S1YA 2A49A 2GNXA 1MXOA 1QMFA 1XX2A 3PBTA 2HDRA 1YPRA 1DRMA 3P7NA 3Q81A 3C7UA 2HPBA 1ZC2A 2INWA 1XGIA 4MEZA 3O5YA 3V39A 4HY8A 5FEGA 1FCOA 2W1RA 4Q0JA 3E2KA 2PYRA 4WF0A 5EOEA 3IHAA 4X1MA 1CI8A 3PBOA 1A0KA 1MBLA 2NUPC 1WE4A 1KE0A 2V8CA 5CERA 1E3UA 1NRFA 1G68A 1SZVA 3DTIA 5HWWA 1ACFA 2VGLM 2VK3A 5FAOA 3CPTB 3R4KA 2C5WB 4ZDXA 3K3DA 2ZLYA 4WMCD 2PU4A 3VFHA 3F1NB 4S2NC 4MBKA 5EFWA 1H5XA 5DKLA 1K57A 1TS7A 4OOMA 2LB5A 5GLAA 1I2SA 3DTKA 5EVEA 1LL5A 5GLBA 2JKTI 5LBRA 4EBLA 2OOLA 2WYXA 2V8FA 2PDRA 3QP6A 1H3QA 5A90A 4WLAA 3ZDJA 3ZNYA 4HP4A 3MS6A 2VZWA 4Z1WA 4RA7A 4JLFA 4OPRA 4GW9A 2J80A 4HJ3A 3AGFA 5HFOA 2KLIA 2JKGA 4GDBA 5FI6A 4DXCA 1AXBA 2Q9NA 2HF6A 2V2FF 3CUEC 1CEGA 2XK1A 1CK3A 4EERA 3HLBA 5DF7A 1JTGA 3JPUA 4BJPA 4Q8IA 1PWCA 3C4OA 4OP5A 5HSQA 2J9OA 2PR5A 1BYWA 4NXFA 3MSHA 4UA6A 5IS1A 3UB9A 1F2KA 3V5MA 3KYZA 5A8BA 3N8SA 2P9VA 3F1OA 4X56A 4ETXA 3E4PA 3SOIA 5KSCA 1XJ6A 2WK0A 2W27A 2HP5A 1GA9A 1IYSA 4G3VA 1PFLA 4XXRA 2JCHA 2A3UA 2Y2MA 2ZD8A 3R7WB 1TS6A 4OOLA 3LCEA 1SHVA 3BRMA 1PYYA 4S2IA 2JC7A 3IBJA 3IXHA 1STZA 5HL1A 1FSWA 2WGWA 2J9PA 3OC2A 2YKHA 3GVBA 3BFFA 3O3VA 3ZG8B 3N8RA 4ME4A 1VETB 1ZTUA 2BASA 3VE4A 4DJ3A 3BYDA 1XFQA 3DTMA 4DF6A 3MFXA 1NJ4A 4EUZA 2ZQ9A 4R4SA 1J9MA 4ESPA 5FSRA 4X1LA 1HLUP 2IWBA 2Y55A 1M6KA 2VV6A 2LB9A 1Z09A 4JXVA 5CHJA 3IS2B 3BY9A 4FUWA 1NXYA 1K6RA 4X25A 3JVUA 5E2HA 3H82B 5TGFA 1G6OA 4PHTA 2W0NA 3NIAA 2KOIA 1MWRA 2XF3A 1KVLA 3OOVA 4Y17A 1T1CA 3M6BA 4I5SA 1VQQA 5AQ7A 3TRCA 1FR1A 3CWFA 3OPLA 3MQOA 3A3FA 4DE3A 3SH9A 3PXPA 4DRTA 4WBGA 4R1GA 3QP4A 2H5SA 2O9CA 3MKEA 3U4LP 3GRJA 5CEBA 4X53A 4X55A 5IU1A 3DAVA 3EGDC 4I39A 1NYYA 3UMEA 2PR6A 3T4KA 2OLVA 1P9WA 4IEDA 1KGFA 4F3LB 3G2ZA 1JWZA 2Y2HA 4X69A 1ES3A 1T18A 3UY6A 3NULA 4XUXA 1DJAA 2IWDA 4DE1A 4BL2A 5HD5A 1CI9A 3F1PA 1L2SA 1IKIA 3V50A 4OQGA 1GCEA 4WUJA 4MCWA 2XEPA 2W1TA 4B9OA 2EWWA 2KX6A 4YINA 4S2MA 4FCFA 4PM5A 1YSQA 4KZ9A 5FASA 3IWIA 3T4SA 1MWSA 3VSKA 4FD8A 2ZM8A 3OBFA 5M1AA 4E3LA 1LL8A 2Z6CA 1XP4A 3MR0A 2X71A 1IFQA 2XQZA 1PNEA 4R4RA 1GHIA 3MZFA 5GHZA 4GLQA 2Y2IA 1MC0A 4BWIA 3O87A 2G2WA 5AQAA 4OPQA 3QHYA 5G4ZA 1DP9A 3HLGA 2UV0E 4H6JB 1EWZA 3PR6A 4N92A 4E04A 4JXSA 2OAQ1 1S1ZA 4JGPA 2XR0A 3WS2A 4LENA 1CEFA 3NJAA 2ZL1B 1SKFA 1XJ4A 2B5RA 4GNUA 4R23A 1K57C 4QJGA 1JNUA 2PBDP 1N9NA 3L9KA 3RXXA 1NLZA 2HJ9C 2I72A 4HI4A 5TBMB 1BT5A 2W3HA 3BECA 4R3JA 2XGNA 3NBLA 3IBRA 4DDYA 4KZ4A 2GX5A 5DJTA 2QHKA 5J4EA 3TOIA 5HD3A 5FQMA 4I38A 2V0UA 4OLGA 2Y2LA 3EEHA 2FZ0A 4G3KA 2WKRA 1J3WA 2X01A 3G30A 3IF6A 1JWVA 3V67A 5HARA 3CLOA 3HJKA 3I7JA 1ONGA 1K6SA 4LCLA 1XFNA 1K4FA 1VHMA 4FTXA 5F1FA 4WL9A 2L4RA 5AQBA 2Y8HA 3SS5A 5GHYA 2Y2NA 1MKMA 5L2FA 4N1XA 4CPKA 4MN6A 1H0MA 2XDMA 3CJMA 2J7VA 1SKOB 2O0YA 2XA7M 2V0WA 3V3SA 2XD5A 3W8KA 3G4PA 4E3KA 2PT7A 4RQ9A 1BZAA 4ZBEA 1OTBA 3PAEA 4PAUA 2QZ6A 1IELA 3C7VA 4R38A 4P6BA 1N9LA 1PW1A 2R9XA 2VGLS 4DDSA 4A5RA 3P09A 3MF0A 4RYEA 5CECA 5HDDA 4WELA 4LCMA 3HREA 2QYBA 1YKDA 4OOYA 3VP3A 4R3AA 1W7FA 2W3EA 5DVAA 3WS5A 3QNBA 5CEDA 3M6HA 3BQ8A 3LEZA 1G6AA 5HWVA 2ZM0A 2OWJA 3ZG9B 2PAVP 3N7WA 4XT2A 1V9ZA 4L9GA 4JXWA 1SDNA 2ZMAA 3Q1FA 2KDKA 1DJBA 1I2WA 1OTIA 1T1AA 4Y2FA 4I3IA 1TS0A 3NI9A 3FKWA 3ZG5A 2W3FA 4GB7A 2WKHA 5EM0A 3VSLA 3TSGA 2JKRM 2EX8A 1BLCA 2D02A 4U0TA 3FC7A 3H7WA 1W8YA 2BTFP 3ZGAB 4CLCE 3C38A 2JKFA 3ZQ5A 4DN0A 4L9EA 1ZG4A 3BFCA 2VKSA 5EM1A 2HV1A 1KVMA 4KZ8A 1K38A 5FDHA 4CLCA 1XKZA 2PU2A 1NRJA 1VEUA 2XFSA 4HJ6A 1K56D 5JYOA 3T1QB 5EVIC 4JGRA 1E25A 2EFUA 4GDNA 4CJNA 2Y2GA 2L0WA 5G18A 3N6IA 4NG2A 1ALQA 2P04A 4MNRA 3D72A 3MXSA 3BY8A 2WGIA 2I9VA 4JKTA 2ZOIA 4IVKA 1PWDA 4KENB 4HESA 5DKKA 4PMAA 1K0KA 3BW6A 2GJ3A 5EVIB 3K2NA 4R70A 3HLWA 2O9BA 4YFMA 1PWGA 3PTEA 3E0YA 4KG2A 4LRZE 4YNRA 4LV1A 3LIFA 2H10A 4GS9B 4LV0A 2V1BA 2WKEA 4EEPA 4NETA 5F6AA 3GV9A 3UE0A 3P98A 2WKIA 2EXAA 5L8MA 5FL3A 2DNSA 3MKFA 3QNCA 4X6TA 1LL9A 3N8LA 3C8CA 3G34A 4GKUA 1GSVA 3UO9A 3FPVA 3NHQA 3A3JA 2PHYA 1KE3A 1TS8A 2Z6DA 1K25A 5KIZA 1CQAA 3KO6A 4QB8A 5EVID 3T4JA 1UWPX 2Q0OA 1PI4A 5AVEA 1N9OA 4ARZB 1PIOA 3T4TA 5DJUA 5TFQA 1EW0A 2V20A 1L0FA 3V3RA 3UPNA 5CHMA 1RCJA 3C4PA 5IHVA 2QJ7A 4KQRA 1F5MA 3M2JA 5A92A 4KUOA 4OQ0A 4EESA 1F9IA 3CHWP 1GHMA 5F83A 4M3KA 1S1YA 4BBVA 4R6LA 4R3BA 5HAQA 3ISGA 4UAAA 1RGZA 1M40A 3IX8A 5KMWA 4O0PA 1PZPA 5L09A 4BMWA 3HLCA 3T4OA 5FAQA 3LUQA 1YLWA 2Q9MA 1IOUA 3CITA 4UQIM 4WM9A 2PD8A 4S2KA 1XPBA 4KG5A 5HL6A 2XD1A 4U0XA 2VX8A 5GL9A 4N1HA 4IHQA 3VE3A 3KSFA 1FIKA 2FFYA 3SS4A 3PBRA 3KX0X 3A0VA 3MJQA 5CGSA 1BUEA 2WUQA 1BTLA 3CAXA 5EV0A 1ES4A 2GZAA 1YMXA 3Q82A 1HD8A 4OPZA 1U60A 3Q7VB 2HP9A 4GD6A 2W3DA 3GQZA 5GHXA 1BLHA 2GDNA 2Y2QA 4U3TA 3Q7ZA 2WAFA 1W79A 3OPRA 2WKQA 1KOUA 5F1GA 1NZUA 2V9AA 4FOFA 1IYQA 3FWLA 2Y59A 4S2LA 5CTNA 3TJZC 1BLPA 3G6OA 1K54A 3UE1A 2VV8A 5FI7A 2H0TA 4HHDA 4KQOA 5HWTA 4YWZA 4FSFA 3HCYA 1ERMA 4Q0HA 3LO7A 4WMCA 4JF6A 1DP6A 2ZJ9A 3EQVA 4ZJ2A 4Y15A 5CGWA 3VP0A 4OPYA 4OQIA 4P85A 3L7HA 3ZNTA 3CI6A 4DE2A 1WYCA 1OTEA 4EEUA 3UB8A 1TVFA 1K55A 2H28A 1QMEA 5KSHA 1KDSA 3ITAA 3GTCA 3Q07A 1YLYA 3AGDA 3QP5A 3EEAA 3LIAA 4FH2A 3KSIA 3A0SA 3LI9A 1YQSA 4HH3A 1S0WA 4GOGA 4PPRA 3IXDA 5L10A 2A24B 4GHIB 4HJ4A 3CPTA 4CLCC 1JVJA 5M18A 4JGQA 2XA7S 3F1NA 2ACGA 4UA9A 5F5YA 3FKVA 1EROA 3WS1A 5DTTA 3DBAA 3S22A 2B95A 3JYIA 4LFUA 1OMEA 3OPHA 1LSXA 4E6XA 1OJGA 4II7A 1Y54A 5CRFA 2QMIA 3DTEA 1KDWA 3CG5A 3D4FA 3S7OA 3IXBA 5EE8A 4KQDA 3NOUC 1S6RA 4JF4A 1VEUB 4KZ7A 5TJJA 1XA7A 4JGOA 1H8ZA 1MKIA 3LICA 4S2PA 4Y0OA 3NOPC 4MLLA 4HNBA 2OAP1 4PM7A 3S7QA 5A93A 4RX2A 5CGXA 1OT6A 4UA7A 4KUKA 5U47A 3LIEA 2BLSA 3BQAA 4ZJ1A 1HZOA 3WRZA 5I5LA 4JXGA 4KZAA 3RXWA 1DY6A 3T1XA 4RVAA 2Y79A 3LGOA 1OTAA 4P87A 1RP5A 2XRNA 4Y0UA 3UDXA 1PI5A 2HDSA 1L0GA 3SZTA 5EECA 1YMSA 3UE6A 4QY5A 1LI9A 2R9WA 4O01A 1MWTA 3R7WA 2DMWA 5DF9A 1H8YA 1L0DA 4GZBA 2PD7A 4ID4A 2Y2JA 4X68A 3BEBA 1ONHA 4H8RA 4E3MA 1IKGA 1UWNX 1ES2A 4EW7A 2VEAA 4MN7A 1VETA 1P9RA 1L0EA 3HLDA 4MDZA 1RGYA 3KSHA 5FQQA 4IJGA 3IS2A 1YLPA 3HJIA 4PM9A 4S2JA 3HBRA 2A2LA 5J8XA 4DMZA 1P97A 1ZG6A 3H82A 3W4OA 4PKYG 3ULFA 2NUTC 2VGJA 3BJNA 3LIDA 2XFTA 2Y2PA 5DTSA 4OQHA 5HDSA 4HQAA 1Y28A 4ZAMA 5GLCA 1CF0A 1JTDA 5AVFA 2J3TC 4KZ3A 3RJUA 4MMNA 3T1RA 3VOLA 1E4DA 4EQIA 1Y4OA 4WEJA 3QP8A 3E98A 1YSPA 2ZOHA 4K0WA 2P9VB 3F1OB 4P0MA 4DE0A 1BLSA 3MXQA 3ZG7B 3EWKA 4FH4A 4N9KA 1T19A 1T1BA 3W2ZA 4WZ5A 5MC7A 4LV3A 5FAPA 5FDSA 3M2KA 4JF5A 1SCWA 2L1MA 4F3LA 2WGWB 3UDFA 4B4XA 3MFDA 5J3WA 2HJEA 4Z9QA 1MZUA 1Q2PA 1YAXA 5FEFA 3D3OA 3HVFA 1KE4A 2V1ZA 3KSGA 1NY0A 1SDEA 3SS3A 3GR2A 1AWIA 3UMDA 3MZDA 1K54C 4DJ2A 3C5AA 3TG9A 5HAIA 2EFXA 4IUHA 1NLYA 3LIBA 4UHUA 5HW3A 2WGVA 1IEMA 3FV7A 3HUNA 3WS0A 2W3GA 1S4SA 2ZC6B 2ZBBA 1F98A 4KZ6A 3B33A 1LSWA 1YLZA 3ZVTA 2OV5A 3IWQA 1YLTA 4PM6A 2M7VA 3FG8A 1TF1A 4IUKA 1FCMA 1K55C 5FQKA 2ZM2A 4ZJ3A 5E2GA 2M7UA 4UQIS 5FI2A 4CQHA 3P01A 2ZQ7A 4B88A 2UWXA 3B3XA 3IHBA 4H6JA 1YT4A 4E3OA 3LR0A 1XJ3A 3PBQA 4BBUA 4C75A 5A91A 1W8QA 2ZMFA 2AVXA 4EWFA 2JE5A 2K7SA 4L0LA 4QY6A 2WZXA 2ZL1A 1G5UA 3BFEA 4F94A 2G7UA 3F1PB 5IT5A 1Z6FA 1X0OA 2EX6A 1P0ZA 3PAGA 1ES5A 3S7NA 2W1TB 3IX3A 5TBMA 1YM1A 3VFFA 1LHYA 4KZ5A 4GD8A 3K3CA 1O7EA 2ZQ8A 1W63Q 1K4EA 4E6WA 1PRQA 2JKRI 3UNWA 4OLDA 3UPPA 2EX2A 1WA9A 3MMHA 3U2AA 3QP2A 1D7EA 4QWOA 2G2UA 3S4XA 4PM8A 3UPOA 3T50A 4BBTA 5C5KA 3T4LA 3IQAA 2Y2KA 3DW0A 4GJ4A 4P6ZM 4K91A 5CHUA 1OTDA 4HBUA 4LLOB 4OKPA 4AFIA 4K0XA 3ZYTA 1D1JA 2HGVA 3FZCA 4C6YA 3HUOA 1DP8A 5DFXA 1SKOA 3W4QA 5HZHA 5G4YA 5FA7A 4WEKA 3PBSA 3VP4A 3LR4A 4EU0A 1W63M 2ZQDA 4B93A 4ETZA 2ZC4B 2B02A 2Z2MB 3ZG0A 1V9YA 2XLNA 5F82A 2CMNA 2YKFA 3IF6C 1LI0A 1FILA 3A3IA 5FQJA 5GLDA 1XGJA 4MN5A 1I5QA 4Y13A 2EXBA 2VGKA 3BLSA 5F68A 3MXRA 1H8MA 1TDGA 3N4IA 4B4ZA 1IYPA 4LRYC 2O9AA 5DF8A 5BOHA 4E3NA 4M4XA 2ZQCA 3IT9A 2DCFA 4Y5FA 1ESUA 4HH2A 1K56A 1GSWA 3GDIA 2WAEA 2H0YA 4KG6A 3NY4A 3OCNA 4I3AA 3HLEA 3IF6B 1D06A 3EGXC 4IBRA 1BSGA 1OJ5A 4NXGA 4EXOA 3VOZA 5AQ9A 1LLBA 4WZ4A 3GECA 4LV2A 1GSXA 5KZHA 4BQMA 4E3JA 3LY4A 3T1SA 3T4QA 5EPHA 1FQGA 1S67L 2ZMVA 5FQIA 1LT0A 5L07A 3TE8A 4LRXC 3UE3A 5D3OA 2EA9A 3ZCZA 3EOIA 4JBFA 3FYZA 1G28A 4LGWA 4WZ5C 1L3LA 1OT9A 1XA1A 2IA2A 3CZDA 4I3JA 4QD4A 1ERQA 3IH8A 4O8GA 4PKYA 4QU3A 4BD1A 2JN7A 3OLOA 3ICYA 2RL3A 5E43A 1S4RA 3MZEA 3D9YA 3WWXA 4HBTA 1MPLA 2J3WA 3ZFZA 2E8JA 2BG1A 2PRFA 4NXEA 3LR3A 2E8IA 3BM6A 1TDLA 2MJ6A 2V1AA 3MQQA 2JHEA 2HP6A 4XT2B 2K2NA 5EVIA 2FFFB 3PBNA 2HDUA 3A3DA 3W4PA 4L9FA 1NWZA 4IBXA 1KGGA 3H9WA 4C3QA 3LEQA 2VLGA 2Z2LB 4GS9A 1IYOA 2ZC7A 5DFYA 4R0QA 5F69A 1TEMA 3G32A 3A0RA 4Y0TA 4ZTKA 3SH7A 4MBHA 3H7WB 3PYPA 3VMAA 2RCXA 2ZQAA 4DXBA 4NXBA 2EX9A 1FCNA 2VV7A 1W5DA 3B42A 3UB7A 1C3BA 2WZZA 4HP9A 3UN7A 3QP1A 3IF5A 4GN2A 3LI8A 4CLCB 1N4OA 3DWKA 2Y4AA 4Y7PA 5HDCA 3NDEA 3C30A 2ZC3B 3O86A 4S2NA 2XSSA 4BLMA 3VP2A 2CC1A 3UDIA 5CTMA 3RH8B 4ARZA 4HEFA 3VV4A 2QWSA 1LSVA 2VJWA 3WS4A 4ZRRA 3S7PA 5HX9A 3G35A 2OSUA 4UEYA 1ESIA 2P7JA 1ODVA 1MY8A 4N9LA 4O7DA 5K5BA 1WYBA 1CJFA 3SH8A 2Y2OA 3HLFA 1FOFA 3KYEA 1ZHHB 2B18A 3T12B 4D2OA 1O07A 3BWLA 3CUEA 4GCZA 3B47A 4HOIA 2M1CA
chains in the Genus database with same CATH topology
1PI4A 1K54C 5EUAA 3EQUA 1PIOA 3ZVWA 5TFQA 2IWCA 2V20A 2OLUA 3GRJA 1L0FA 3C5AA 3V3RA 5CEBA 3UPNA 4X53A 5CHMA 1RCJA 3C4PA 5IHVA 3TG9A 5HAIA 3IXGA 4X55A 4KQRA 2EFXA 4UHUA 5HW3A 2WGVA 1IEMA 3M2JA 4IVIA 4EBPA 3FV7A 5A92A 3HUNA 1NYYA 4OQ0A 1NYMA 3OPPA 3WS0A 2ZC6B 2OLVA 4IEDA 1KGFA 3IWOA 1GHMA 5CXWA 5F83A 4KZ6A 5TR7A 1XXMA 3G2ZA 1JWZA 2Y2HA 1YLZA 4M3KA 4X69A 1ES3A 2P74A 3HUMA 4S2OA 1GA0A 3UY6A 3ZVTA 2OV5A 3IWQA 3BFGA 3O88A 2X02A 4R3BA 1YLTA 4XUXA 2J8YA 5HAQA 4PM6A 3ISGA 4UAAA 5JYPA 1RGZA 1DJAA 2IWDA 4DE1A 1M40A 4BL2A 5KMWA 1CI9A 1FCMA 1K55C 5FQKA 2ZM2A 4ZJ3A 1HTZA 1L2SA 3NDGA 5E2GA 1PZPA 1IKIA 3V50A 2Y91A 4OQGA 1GCEA 1FSYA 5FI2A 3Q7VA 3HLCA 1E3UD 1BULA 5FAQA 3DWZA 2XEPA 1ZKJA 2ZQ7A 1YLWA 2Q9MA 5E2EA 4MBFA 4B88A 2UWXA 3B3XA 4WM9A 4S2KA 4YINA 1XPBA 4KG5A 1KGEA 3IHBA 4S2MA 4FCFA 1DJCA 2XD1A 1MWUA 4U0XA 1YT4A 3NCKA 4RX3A 5GL9A 4E3OA 4PM5A 1FR6A 4N1HA 4KZ9A 5FASA 3IWIA 3PBQA 1MWSA 2FFYA 1W8QA 3GSGA 5A91A 3SS4A 3VSKA 4C75A 4FD8A 4EWFA 2ZM8A 3PBRA 5M1AA 2JE5A 4L0LA 4E3LA 1GHPA 4QY6A 3AGEA 4WYYA 5CGSA 4EV4A 1BUEA 2WZXA 1XP4A 2WUQA 2X71A 1N9BA 5M19A 1BTLA 3VOYA 3BFEA 1ES4A 4F94A 2XQZA 4R4RA 1YMXA 2DRWA 1GHIA 3MZFA 4KZBA 4QHCA 4BENA 5GHZA 5EVLA 3Q82A 1HD8A 1Z6FA 4OPZA 2EX6A 2Y2IA 3PAGA 1U60A 3Q7VB 2HP9A 1ES5A 3O87A 2G2WA 4GD6A 5AQAA 3GQZA 4OPQA 3CMZA 3QHYA 5GHXA 1BLHA 1YM1A 1EI5A 2GDNA 2Y2QA 4EBNA 3HLGA 3VFFA 1LHYA 4KZ5A 4U3TA 4GD8A 1EWZA 3Q7ZA 3HL9A 1O7EA 2WAFA 2ZQ8A 4N92A 1YLJA 2PBYA 1W79A 1K4EA 4DKIA 4E6WA 1PW8A 3GMWA 3OPRA 5F1GA 1NZUA 4JXSA 3A3EA 3UNWA 4OLDA 1IYQA 3FWLA 4XUZA 3WS2A 2Y59A 2XR0A 4S2LA 5CTNA 1BLPA 4LENA 1NZOA 3UPPA 1K54A 2EX2A 3UE1A 5FI7A 1CEFA 1Q2QA 2H0TA 4KQOA 5DTKA 4BL3A 4FSFA 3IH9A 1SKFA 1ERMA 3LO7A 1PZOA 2G2UA 2B5RA 3S4XA 4GNUA 4R23A 4PM8A 3UPOA 1K57C 4WMCA 4JF6A 4QJGA 3OZHA 3IQAA 2ZJ9A 2Y2KA 3EQVA 3DW0A 1JWPA 4ZJ2A 4K91A 5CHUA 3RXXA 4HBUA 4JPMA 4BD0A 1VM1A 4OONA 5FATA 5CGWA 2I72A 2ZC5B 3VP0A 4OKPA 3E2LA 4K0XA 3LY3A 4OPYA 5EOOA 1BT5A 5I94A 4OH0A 4OQIA 2HDQA 3BECA 4P85A 4R3JA 2XGNA 3NBLA 3ZNTA 3FZCA 3WRTA 4DDYA 4KZ4A 4C6YA 3G2YA 4DE2A 3HUOA 3TOIA 1WYCA 3MBZA 4E3IA 2QPNA 3W4QA 1TVFA 1K55A 5FQMA 1QMEA 5FA7A 5KSHA 5HAPA 1KDSA 4WEKA 2C6WB 3ITAA 3PBSA 4OLGA 3NC8A 2Y2LA 3OCLA 3ZHHA 4OVDA 3GTCA 2X01A 3Q07A 5FQ9A 2WADA 3VP4A 3G30A 1YLYA 5E2FA 3AGDA 2JBFA 2ZQDA 3IF6A 1JWVA 4KQQA 3VP1A 4NK3A 3BLMA 5HARA 4FH2A 3I7JA 2ZC4B 1ONGA 2Z2MB 3ZG0A 1K6SA 4LCLA 1YQSA 1S0WA 2XH9A 2XLNA 4OP8A 1K4FA 4GOGA 5F82A 5F1FA 1HVBA 3IXDA 3G31A 3IF6C 1LI0A 4PPRA 3A3IA 3ITBA 5AQBA 3SS5A 5FQJA 5GHYA 3BFDA 2Y2NA 5GLDA 1XGJA 1I5QA 3S1YA 2A49A 1MXOA 1QMFA 1XX2A 2EXBA 2VGKA 1JVJA 3PBTA 3BLSA 2HDRA 3MXRA 5M18A 5L2FA 4N1XA 1TDGA 3N4IA 4B4ZA 1IYPA 3Q81A 3C7UA 2HPBA 1ZC2A 4MEZA 1XGIA 4CPKA 5DF8A 4UA9A 3V39A 5BOHA 2XDMA 3CJMA 3FKVA 4E3NA 1EROA 2J7VA 1FCOA 2ZQCA 3IT9A 5DTTA 3WS1A 2DCFA 1ESUA 3E2KA 3V3SA 3S22A 2XD5A 1K56A 3W8KA 3G4PA 3JYIA 4E3KA 5EOEA 1OMEA 3OPHA 2WAEA 2H0YA 1BZAA 4KG6A 3NY4A 4ZBEA 3IHAA 4E6XA 1CI8A 1Y54A 3PBOA 5CRFA 3OCNA 3PAEA 2QMIA 1MBLA 2QZ6A 3HLEA 1WE4A 1IELA 3IF6B 1KE0A 1KDWA 3CG5A 3D4FA 3IXBA 5EE8A 5CERA 3C7VA 1E3UA 4IBRA 4P6BA 1BSGA 1PW1A 1NRFA 2R9XA 1S6RA 4JF4A 3VOZA 4DDSA 1G68A 5AQ9A 1LLBA 4WZ4A 4A5RA 3P09A 4LV2A 4KZ7A 4RYEA 5CECA 5KZHA 1XA7A 4BQMA 4WELA 4E3JA 3LY4A 4LCMA 3HREA 1H8ZA 4OOYA 1MKIA 4S2PA 5FAOA 3VP3A 2C5WB 4ZDXA 4Y0OA 2ZLYA 5EPHA 4MLLA 4WMCD 1FQGA 1W7FA 2PU4A 5DVAA 3VFHA 5FQIA 3WS5A 4S2NC 4MBKA 3QNBA 1H5XA 5CEDA 3M6HA 4PM7A 5A93A 4RX2A 3LEZA 3UE3A 5D3OA 5CGXA 1K57A 4UA7A 3ZCZA 1G6AA 4OOMA 4JBFA 5U47A 5GLAA 2ZM0A 1I2SA 3ZG9B 3N7WA 2BLSA 3FYZA 4JXWA 1LL5A 1SDNA 2ZMAA 5GLBA 4ZJ1A 3Q1FA 1HZOA 3WRZA 1DJBA 4JXGA 1I2WA 4KZAA 4WZ5C 3RXWA 1DY6A 4EBLA 2WYXA 4RVAA 1XA1A 3CZDA 1ERQA 3IH8A 4QD4A 4BD1A 3NI9A 4QU3A 3FKWA 5A90A 4P87A 3ZDJA 3ZNYA 3ZG5A 1RP5A 4RA7A 2RL3A 4Y0UA 1PI5A 2HDSA 4JLFA 4OPRA 5E43A 1L0GA 4GB7A 3UDXA 5EECA 3MZEA 2WKHA 1YMSA 3AGFA 3WWXA 5HFOA 4HBTA 3TSGA 3VSLA 2EX8A 1MPLA 4QY5A 1LI9A 1BLCA 4GDBA 3ZFZA 2R9WA 4U0TA 5FI6A 1W8YA 4DXCA 1MWTA 2BG1A 5DF9A 1AXBA 1H8YA 2Q9NA 1L0DA 4GZBA 2V2FF 3ZGAB 4ID4A 2E8IA 1CEGA 1TDLA 3BM6A 2Y2JA 2XK1A 1CK3A 4X68A 3BEBA 1ONHA 3HLBA 4H8RA 5DF7A 1JTGA 4E3MA 1IKGA 1ZG4A 4BJPA 4Q8IA 1PWCA 3C4OA 3BFCA 2HP6A 1ES2A 4OP5A 2J9OA 1KVMA 4KZ8A 5EVIA 1K38A 2FFFB 3PBNA 4UA6A 5FDHA 2HDUA 3A3DA 3W4PA 1XKZA 1L0EA 2PU2A 2XFSA 3HLDA 3V5MA 4IBXA 1KGGA 1K56D 1RGYA 3N8SA 4C3QA 5JYOA 5EVIC 2P9VA 4X56A 2Z2LB 1IYOA 5FQQA 1E25A 2ZC7A 2EFUA 4GDNA 3SOIA 4CJNA 2Y2GA 5KSCA 4R0QA 2WK0A 1TEMA 1YLPA 2HP5A 1GA9A 1IYSA 3G32A 4PM9A 4Y0TA 4ZTKA 5G18A 3N6IA 3HBRA 4S2JA 3SH7A 1ALQA 5J8XA 4XXRA 2JCHA 4MBHA 2A3UA 2Y2MA 2ZD8A 4MNRA 3MXSA 1ZG6A 2WGIA 4OOLA 3LCEA 4JKTA 3VMAA 2RCXA 3W4OA 1SHVA 4IVKA 2VGJA 3BRMA 2ZQAA 1PWDA 2XFTA 2Y2PA 4KENB 1PYYA 4HESA 4S2IA 5DTSA 4DXBA 2JC7A 2EX9A 3IXHA 4OQHA 1FCNA 4PMAA 5HL1A 4ZAMA 5GLCA 1W5DA 1FSWA 2WGWA 2J9PA 3OC2A 3GVBA 3BFFA 3O3VA 1JTDA 3RJUA 3N8RA 4KZ3A 3ZG8B 5EVIB 1C3BA 2WZZA 3UN7A 3IF5A 4GN2A 3BYDA 3HLWA 1N4OA 3DTMA 4DF6A 1NJ4A 4EUZA 2ZQ9A 1E4DA 4R4SA 4EQIA 3DWKA 4YFMA 1PWGA 4WEJA 2Y4AA 1J9MA 3PTEA 3NDEA 4Y7PA 2ZC3B 3O86A 4KG2A 4S2NA 5FSRA 4LV1A 4K0WA 2IWBA 2H10A 2P9VB 4P0MA 2Y55A 4DE0A 1M6KA 4BLMA 5CHJA 4JXVA 1BLSA 4LV0A 2CC1A 3UDIA 2WKEA 5CTMA 3VP2A 3ZG7B 4NETA 4FH4A 4HEFA 1NXYA 3GV9A 3UE0A 4N9KA 3P98A 3WS4A 2WKIA 1K6RA 2EXAA 5E2HA 5HX9A 3G35A 5TGFA 4WZ5A 4LV3A 2DNSA 2OSUA 3MKFA 1ESIA 3QNCA 5FAPA 3NIAA 4X6TA 3M2KA 4JF5A 1SCWA 1LL9A 1MWRA 2XF3A 3N8LA 1KVLA 2WGWB 1MY8A 4N9LA 3G34A 3UDFA 4O7DA 4B4XA 3MFDA 4GKUA 1WYBA 3M6BA 3SH8A 4Z9QA 3UO9A 2Y2OA 1VQQA 5AQ7A 1Q2PA 3A3JA 1FR1A 3HLFA 1FOFA 1KE3A 3OPLA 4D2OA 3A3FA 3HVFA 4DE3A 1KE4A 3SH9A 1O07A 2V1ZA 4DRTA 1K25A 1NY0A 1SDEA 4R1GA 4WBGA 3SS3A 2H5SA 3MKEA 3GR2A 4QB8A 5EVID 3MZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PI4 A;  1K54 C;  5EUA A;  3EQU A;  1PIO A;  3ZVW A;  5TFQ A;  2IWC A;  2V20 A;  2OLU A;  3GRJ A;  1L0F A;  3C5A A;  3V3R A;  5CEB A;  3UPN A;  4X53 A;  5CHM A;  1RCJ A;  3C4P A;  5IHV A;  3TG9 A;  5HAI A;  3IXG A;  4X55 A;  4KQR A;  2EFX A;  4UHU A;  5HW3 A;  2WGV A;  1IEM A;  3M2J A;  4IVI A;  4EBP A;  3FV7 A;  5A92 A;  3HUN A;  1NYY A;  4OQ0 A;  1NYM A;  3OPP A;  3WS0 A;  2ZC6 B;  2OLV A;  4IED A;  1KGF A;  3IWO A;  1GHM A;  5CXW A;  5F83 A;  4KZ6 A;  5TR7 A;  1XXM A;  3G2Z A;  1JWZ A;  2Y2H A;  1YLZ A;  4M3K A;  4X69 A;  1ES3 A;  2P74 A;  3HUM A;  4S2O A;  1GA0 A;  3UY6 A;  3ZVT A;  2OV5 A;  3IWQ A;  3BFG A;  3O88 A;  2X02 A;  4R3B A;  1YLT A;  4XUX A;  2J8Y A;  5HAQ A;  4PM6 A;  3ISG A;  4UAA A;  5JYP A;  1RGZ A;  1DJA A;  2IWD A;  4DE1 A;  1M40 A;  4BL2 A;  5KMW A;  1CI9 A;  1FCM A;  1K55 C;  5FQK A;  2ZM2 A;  4ZJ3 A;  1HTZ A;  1L2S A;  3NDG A;  5E2G A;  1PZP A;  1IKI A;  3V50 A;  2Y91 A;  4OQG A;  1GCE A;  1FSY A;  5FI2 A;  3Q7V A;  3HLC A;  1E3U D;  1BUL A;  5FAQ A;  3DWZ A;  2XEP A;  1ZKJ A;  2ZQ7 A;  1YLW A;  2Q9M A;  5E2E A;  4MBF A;  4B88 A;  2UWX A;  3B3X A;  4WM9 A;  4S2K A;  4YIN A;  1XPB A;  4KG5 A;  1KGE A;  3IHB A;  4S2M A;  4FCF A;  1DJC A;  2XD1 A;  1MWU A;  4U0X A;  1YT4 A;  3NCK A;  4RX3 A;  5GL9 A;  4E3O A;  4PM5 A;  1FR6 A;  4N1H A;  4KZ9 A;  5FAS A;  3IWI A;  3PBQ A;  1MWS A;  2FFY A;  1W8Q A;  3GSG A;  5A91 A;  3SS4 A;  3VSK A;  4C75 A;  4FD8 A;  4EWF A;  2ZM8 A;  3PBR A;  5M1A A;  2JE5 A;  4L0L A;  4E3L A;  1GHP A;  4QY6 A;  3AGE A;  4WYY A;  5CGS A;  4EV4 A;  1BUE A;  2WZX A;  1XP4 A;  2WUQ A;  2X71 A;  1N9B A;  5M19 A;  1BTL A;  3VOY A;  3BFE A;  1ES4 A;  4F94 A;  2XQZ A;  4R4R A;  1YMX A;  2DRW A;  1GHI A;  3MZF A;  4KZB A;  4QHC A;  4BEN A;  5GHZ A;  5EVL A;  3Q82 A;  1HD8 A;  1Z6F A;  4OPZ A;  2EX6 A;  2Y2I A;  3PAG A;  1U60 A;  3Q7V B;  2HP9 A;  1ES5 A;  3O87 A;  2G2W A;  4GD6 A;  5AQA A;  3GQZ A;  4OPQ A;  3CMZ A;  3QHY A;  5GHX A;  1BLH A;  1YM1 A;  1EI5 A;  2GDN A;  2Y2Q A;  4EBN A;  3HLG A;  3VFF A;  1LHY A;  4KZ5 A;  4U3T A;  4GD8 A;  1EWZ A;  3Q7Z A;  3HL9 A;  1O7E A;  2WAF A;  2ZQ8 A;  4N92 A;  1YLJ A;  2PBY A;  1W79 A;  1K4E A;  4DKI A;  4E6W A;  1PW8 A;  3GMW A;  3OPR A;  5F1G A;  1NZU A;  4JXS A;  3A3E A;  3UNW A;  4OLD A;  1IYQ A;  3FWL A;  4XUZ A;  3WS2 A;  2Y59 A;  2XR0 A;  4S2L A;  5CTN A;  1BLP A;  4LEN A;  1NZO A;  3UPP A;  1K54 A;  2EX2 A;  3UE1 A;  5FI7 A;  1CEF A;  1Q2Q A;  2H0T A;  4KQO A;  5DTK A;  4BL3 A;  4FSF A;  3IH9 A;  1SKF A;  1ERM A;  3LO7 A;  1PZO A;  2G2U A;  2B5R A;  3S4X A;  4GNU A;  4R23 A;  4PM8 A;  3UPO A;  1K57 C;  4WMC A;  4JF6 A;  4QJG A;  3OZH A;  3IQA A;  2ZJ9 A;  2Y2K A;  3EQV A;  3DW0 A;  1JWP A;  4ZJ2 A;  4K91 A;  5CHU A;  3RXX A;  4HBU A;  4JPM A;  4BD0 A;  1VM1 A;  4OON A;  5FAT A;  5CGW A;  2I72 A;  2ZC5 B;  3VP0 A;  4OKP A;  3E2L A;  4K0X A;  3LY3 A;  4OPY A;  5EOO A;  1BT5 A;  5I94 A;  4OH0 A;  4OQI A;  2HDQ A;  3BEC A;  4P85 A;  4R3J A;  2XGN A;  3NBL A;  3ZNT A;  3FZC A;  3WRT A;  4DDY A;  4KZ4 A;  4C6Y A;  3G2Y A;  4DE2 A;  3HUO A;  3TOI A;  1WYC A;  3MBZ A;  4E3I A;  2QPN A;  3W4Q A;  1TVF A;  1K55 A;  5FQM A;  1QME A;  5FA7 A;  5KSH A;  5HAP A;  1KDS A;  4WEK A;  2C6W B;  3ITA A;  3PBS A;  4OLG A;  3NC8 A;  2Y2L A;  3OCL A;  3ZHH A;  4OVD A;  3GTC A;  2X01 A;  3Q07 A;  5FQ9 A;  2WAD A;  3VP4 A;  3G30 A;  1YLY A;  5E2F A;  3AGD A;  2JBF A;  2ZQD A;  3IF6 A;  1JWV A;  4KQQ A;  3VP1 A;  4NK3 A;  3BLM A;  5HAR A;  4FH2 A;  3I7J A;  2ZC4 B;  1ONG A;  2Z2M B;  3ZG0 A;  1K6S A;  4LCL A;  1YQS A;  1S0W A;  2XH9 A;  2XLN A;  4OP8 A;  1K4F A;  4GOG A;  5F82 A;  5F1F A;  1HVB A;  3IXD A;  3G31 A;  3IF6 C;  1LI0 A;  4PPR A;  3A3I A;  3ITB A;  5AQB A;  3SS5 A;  5FQJ A;  5GHY A;  3BFD A;  2Y2N A;  5GLD A;  1XGJ A;  1I5Q A;  3S1Y A;  2A49 A;  1MXO A;  1QMF A;  1XX2 A;  2EXB A;  2VGK A;  1JVJ A;  3PBT A;  3BLS A;  2HDR A;  3MXR A;  5M18 A;  5L2F A;  4N1X A;  1TDG A;  3N4I A;  4B4Z A;  1IYP A;  3Q81 A;  3C7U A;  2HPB A;  1ZC2 A;  4MEZ A;  1XGI A;  4CPK A;  5DF8 A;  4UA9 A;  3V39 A;  5BOH A;  2XDM A;  3CJM A;  3FKV A;  4E3N A;  1ERO A;  2J7V A;  1FCO A;  2ZQC A;  3IT9 A;  5DTT A;  3WS1 A;  2DCF A;  1ESU A;  3E2K A;  3V3S A;  3S22 A;  2XD5 A;  1K56 A;  3W8K A;  3G4P A;  3JYI A;  4E3K A;  5EOE A;  1OME A;  3OPH A;  2WAE A;  2H0Y A;  1BZA A;  4KG6 A;  3NY4 A;  4ZBE A;  3IHA A;  4E6X A;  1CI8 A;  1Y54 A;  3PBO A;  5CRF A;  3OCN A;  3PAE A;  2QMI A;  1MBL A;  2QZ6 A;  3HLE A;  1WE4 A;  1IEL A;  3IF6 B;  1KE0 A;  1KDW A;  3CG5 A;  3D4F A;  3IXB A;  5EE8 A;  5CER A;  3C7V A;  1E3U A;  4IBR A;  4P6B A;  1BSG A;  1PW1 A;  1NRF A;  2R9X A;  1S6R A;  4JF4 A;  3VOZ A;  4DDS A;  1G68 A;  5AQ9 A;  1LLB A;  4WZ4 A;  4A5R A;  3P09 A;  4LV2 A;  4KZ7 A;  4RYE A;  5CEC A;  5KZH A;  1XA7 A;  4BQM A;  4WEL A;  4E3J A;  3LY4 A;  4LCM A;  3HRE A;  1H8Z A;  4OOY A;  1MKI A;  4S2P A;  5FAO A;  3VP3 A;  2C5W B;  4ZDX A;  4Y0O A;  2ZLY A;  5EPH A;  4MLL A;  4WMC D;  1FQG A;  1W7F A;  2PU4 A;  5DVA A;  3VFH A;  5FQI A;  3WS5 A;  4S2N C;  4MBK A;  3QNB A;  1H5X A;  5CED A;  3M6H A;  4PM7 A;  5A93 A;  4RX2 A;  3LEZ A;  3UE3 A;  5D3O A;  5CGX A;  1K57 A;  4UA7 A;  3ZCZ A;  1G6A A;  4OOM A;  4JBF A;  5U47 A;  5GLA A;  2ZM0 A;  1I2S A;  3ZG9 B;  3N7W A;  2BLS A;  3FYZ A;  4JXW A;  1LL5 A;  1SDN A;  2ZMA A;  5GLB A;  4ZJ1 A;  3Q1F A;  1HZO A;  3WRZ A;  1DJB A;  4JXG A;  1I2W A;  4KZA A;  4WZ5 C;  3RXW A;  1DY6 A;  4EBL A;  2WYX A;  4RVA A;  1XA1 A;  3CZD A;  1ERQ A;  3IH8 A;  4QD4 A;  4BD1 A;  3NI9 A;  4QU3 A;  3FKW A;  5A90 A;  4P87 A;  3ZDJ A;  3ZNY A;  3ZG5 A;  1RP5 A;  4RA7 A;  2RL3 A;  4Y0U A;  1PI5 A;  2HDS A;  4JLF A;  4OPR A;  5E43 A;  1L0G A;  4GB7 A;  3UDX A;  5EEC A;  3MZE A;  2WKH A;  1YMS A;  3AGF A;  3WWX A;  5HFO A;  4HBT A;  3TSG A;  3VSL A;  2EX8 A;  1MPL A;  4QY5 A;  1LI9 A;  1BLC A;  4GDB A;  3ZFZ A;  2R9W A;  4U0T A;  5FI6 A;  1W8Y A;  4DXC A;  1MWT A;  2BG1 A;  5DF9 A;  1AXB A;  1H8Y A;  2Q9N A;  1L0D A;  4GZB A;  2V2F F;  3ZGA B;  4ID4 A;  2E8I A;  1CEG A;  1TDL A;  3BM6 A;  2Y2J A;  2XK1 A;  1CK3 A;  4X68 A;  3BEB A;  1ONH A;  3HLB A;  4H8R A;  5DF7 A;  1JTG A;  4E3M A;  1IKG A;  1ZG4 A;  4BJP A;  4Q8I A;  1PWC A;  3C4O A;  3BFC A;  2HP6 A;  1ES2 A;  4OP5 A;  2J9O A;  1KVM A;  4KZ8 A;  5EVI A;  1K38 A;  2FFF B;  3PBN A;  4UA6 A;  5FDH A;  2HDU A;  3A3D A;  3W4P A;  1XKZ A;  1L0E A;  2PU2 A;  2XFS A;  3HLD A;  3V5M A;  4IBX A;  1KGG A;  1K56 D;  1RGY A;  3N8S A;  4C3Q A;  5JYO A;  5EVI C;  2P9V A;  4X56 A;  2Z2L B;  1IYO A;  5FQQ A;  1E25 A;  2ZC7 A;  2EFU A;  4GDN A;  3SOI A;  4CJN A;  2Y2G A;  5KSC A;  4R0Q A;  2WK0 A;  1TEM A;  1YLP A;  2HP5 A;  1GA9 A;  1IYS A;  3G32 A;  4PM9 A;  4Y0T A;  4ZTK A;  5G18 A;  3N6I A;  3HBR A;  4S2J A;  3SH7 A;  1ALQ A;  5J8X A;  4XXR A;  2JCH A;  4MBH A;  2A3U A;  2Y2M A;  2ZD8 A;  4MNR A;  3MXS A;  1ZG6 A;  2WGI A;  4OOL A;  3LCE A;  4JKT A;  3VMA A;  2RCX A;  3W4O A;  1SHV A;  4IVK A;  2VGJ A;  3BRM A;  2ZQA A;  1PWD A;  2XFT A;  2Y2P A;  4KEN B;  1PYY A;  4HES A;  4S2I A;  5DTS A;  4DXB A;  2JC7 A;  2EX9 A;  3IXH A;  4OQH A;  1FCN A;  4PMA A;  5HL1 A;  4ZAM A;  5GLC A;  1W5D A;  1FSW A;  2WGW A;  2J9P A;  3OC2 A;  3GVB A;  3BFF A;  3O3V A;  1JTD A;  3RJU A;  3N8R A;  4KZ3 A;  3ZG8 B;  5EVI B;  1C3B A;  2WZZ A;  3UN7 A;  3IF5 A;  4GN2 A;  3BYD A;  3HLW A;  1N4O A;  3DTM A;  4DF6 A;  1NJ4 A;  4EUZ A;  2ZQ9 A;  1E4D A;  4R4S A;  4EQI A;  3DWK A;  4YFM A;  1PWG A;  4WEJ A;  2Y4A A;  1J9M A;  3PTE A;  3NDE A;  4Y7P A;  2ZC3 B;  3O86 A;  4KG2 A;  4S2N A;  5FSR A;  4LV1 A;  4K0W A;  2IWB A;  2H10 A;  2P9V B;  4P0M A;  2Y55 A;  4DE0 A;  1M6K A;  4BLM A;  5CHJ A;  4JXV A;  1BLS A;  4LV0 A;  2CC1 A;  3UDI A;  2WKE A;  5CTM A;  3VP2 A;  3ZG7 B;  4NET A;  4FH4 A;  4HEF A;  1NXY A;  3GV9 A;  3UE0 A;  4N9K A;  3P98 A;  3WS4 A;  2WKI A;  1K6R A;  2EXA A;  5E2H A;  5HX9 A;  3G35 A;  5TGF A;  4WZ5 A;  4LV3 A;  2DNS A;  2OSU A;  3MKF A;  1ESI A;  3QNC A;  5FAP A;  3NIA A;  4X6T A;  3M2K A;  4JF5 A;  1SCW A;  1LL9 A;  1MWR A;  2XF3 A;  3N8L A;  1KVL A;  2WGW B;  1MY8 A;  4N9L A;  3G34 A;  3UDF A;  4O7D A;  4B4X A;  3MFD A;  4GKU A;  1WYB A;  3M6B A;  3SH8 A;  4Z9Q A;  3UO9 A;  2Y2O A;  1VQQ A;  5AQ7 A;  1Q2P A;  3A3J A;  1FR1 A;  3HLF A;  1FOF A;  1KE3 A;  3OPL A;  4D2O A;  3A3F A;  3HVF A;  4DE3 A;  1KE4 A;  3SH9 A;  1O07 A;  2V1Z A;  4DRT A;  1K25 A;  1NY0 A;  1SDE A;  4R1G A;  4WBG A;  3SS3 A;  2H5S A;  3MKE A;  3GR2 A;  4QB8 A;  5EVI D;  3MZD A; 
#chains in the Genus database with same CATH topology
 3LR5 A;  5EUA A;  3EQU A;  3ZVW A;  4CLC D;  4G3W A;  2IWC A;  2OLU A;  2FH5 A;  4LPZ A;  4QPR A;  3IXG A;  4IVI A;  4EBP A;  5AJG A;  2EWV A;  3SW1 A;  1OPX A;  1NYM A;  3OPP A;  4Q0I A;  5CXW A;  3IWO A;  5TR7 A;  1XXM A;  1S66 L;  2P74 A;  3HUM A;  4S2O A;  1GA0 A;  2K31 A;  1UGU A;  3BFG A;  3O88 A;  2X02 A;  5JYP A;  2J8Y A;  4D60 A;  4NKP A;  4HIA A;  1HTZ A;  3NDG A;  2Y91 A;  1FSY A;  3Q7V A;  1E3U D;  1BUL A;  3DWZ A;  2QKP A;  1ZKJ A;  3RTY A;  5E2E A;  4MBF A;  1KGE A;  1DJC A;  1MWU A;  3NCK A;  4RX3 A;  1FR6 A;  4EQ1 A;  3GSG A;  1XJ2 A;  4EET B;  3NOT C;  1GHP A;  4WYY A;  3AGE A;  4EV4 A;  3NEC A;  4EUV A;  1N9B A;  5M19 A;  3VOY A;  2DRW A;  4QHC A;  4BEN A;  4KZB A;  5EVL A;  5CX7 A;  4WN5 A;  3E4O A;  4NEE D;  5J7E A;  2O99 A;  4K08 A;  3CMZ A;  3E4Q A;  1EI5 A;  4EBN A;  2VA0 A;  3HL9 A;  2OWH A;  1YLJ A;  2PBY A;  4DKI A;  1PW8 A;  3GMW A;  3A3E A;  4XUZ A;  3C2W A;  3UB6 A;  1NZO A;  1Q2Q A;  5DTK A;  4Y3I A;  4BL3 A;  3IH9 A;  3LFV A;  2WKP A;  4P6Z S;  1PZO A;  3LYX A;  2P08 A;  3OZH A;  1JWP A;  2R78 A;  2A24 A;  3PHY A;  4JPM A;  4BD0 A;  1VM1 A;  4OON A;  5FAT A;  4GHI A;  2ZC5 B;  1VB6 A;  3E2L A;  3LY3 A;  5EOO A;  5I94 A;  4OH0 A;  2JKT M;  2HDQ A;  3FPW A;  3TW8 A;  3WRT A;  3MQ0 A;  3G2Y A;  4YOF A;  4E3I A;  3MBZ A;  2QPN A;  1TD5 A;  2HZ5 A;  5HAP A;  2C6W B;  3RFB A;  2J3T D;  3NC8 A;  3OCL A;  3ZHH A;  4OVD A;  5FQ9 A;  2WAD A;  5HPF A;  5E2F A;  2JBF A;  5HPI A;  3KYQ A;  4KQQ A;  3VP1 A;  2D01 A;  4NK3 A;  3BLM A;  2XRO A;  2PYP A;  2XH9 A;  2QJ5 A;  4OP8 A;  1HVB A;  3G31 A;  3ITB A;  3BFD A;  3JVV A;  3UB5 P;  3IX4 A;  3S1Y A;  2A49 A;  2GNX A;  1MXO A;  1QMF A;  1XX2 A;  3PBT A;  2HDR A;  1YPR A;  1DRM A;  3P7N A;  3Q81 A;  3C7U A;  2HPB A;  1ZC2 A;  2INW A;  1XGI A;  4MEZ A;  3O5Y A;  3V39 A;  4HY8 A;  5FEG A;  1FCO A;  2W1R A;  4Q0J A;  3E2K A;  2PYR A;  4WF0 A;  5EOE A;  3IHA A;  4X1M A;  1CI8 A;  3PBO A;  1A0K A;  1MBL A;  2NUP C;  1WE4 A;  1KE0 A;  2V8C A;  5CER A;  1E3U A;  1NRF A;  1G68 A;  1SZV A;  3DTI A;  5HWW A;  1ACF A;  2VGL M;  2VK3 A;  5FAO A;  3CPT B;  3R4K A;  2C5W B;  4ZDX A;  3K3D A;  2ZLY A;  4WMC D;  2PU4 A;  3VFH A;  3F1N B;  4S2N C;  4MBK A;  5EFW A;  1H5X A;  5DKL A;  1K57 A;  1TS7 A;  4OOM A;  2LB5 A;  5GLA A;  1I2S A;  3DTK A;  5EVE A;  1LL5 A;  5GLB A;  2JKT I;  5LBR A;  4EBL A;  2OOL A;  2WYX A;  2V8F A;  2PDR A;  3QP6 A;  1H3Q A;  5A90 A;  4WLA A;  3ZDJ A;  3ZNY A;  4HP4 A;  3MS6 A;  2VZW A;  4Z1W A;  4RA7 A;  4JLF A;  4OPR A;  4GW9 A;  2J80 A;  4HJ3 A;  3AGF A;  5HFO A;  2KLI A;  2JKG A;  4GDB A;  5FI6 A;  4DXC A;  1AXB A;  2Q9N A;  2HF6 A;  2V2F F;  3CUE C;  1CEG A;  2XK1 A;  1CK3 A;  4EER A;  3HLB A;  5DF7 A;  1JTG A;  3JPU A;  4BJP A;  4Q8I A;  1PWC A;  3C4O A;  4OP5 A;  5HSQ A;  2J9O A;  2PR5 A;  1BYW A;  4NXF A;  3MSH A;  4UA6 A;  5IS1 A;  3UB9 A;  1F2K A;  3V5M A;  3KYZ A;  5A8B A;  3N8S A;  2P9V A;  3F1O A;  4X56 A;  4ETX A;  3E4P A;  3SOI A;  5KSC A;  1XJ6 A;  2WK0 A;  2W27 A;  2HP5 A;  1GA9 A;  1IYS A;  4G3V A;  1PFL A;  4XXR A;  2JCH A;  2A3U A;  2Y2M A;  2ZD8 A;  3R7W B;  1TS6 A;  4OOL A;  3LCE A;  1SHV A;  3BRM A;  1PYY A;  4S2I A;  2JC7 A;  3IBJ A;  3IXH A;  1STZ A;  5HL1 A;  1FSW A;  2WGW A;  2J9P A;  3OC2 A;  2YKH A;  3GVB A;  3BFF A;  3O3V A;  3ZG8 B;  3N8R A;  4ME4 A;  1VET B;  1ZTU A;  2BAS A;  3VE4 A;  4DJ3 A;  3BYD A;  1XFQ A;  3DTM A;  4DF6 A;  3MFX A;  1NJ4 A;  4EUZ A;  2ZQ9 A;  4R4S A;  1J9M A;  4ESP A;  5FSR A;  4X1L A;  1HLU P;  2IWB A;  2Y55 A;  1M6K A;  2VV6 A;  2LB9 A;  1Z09 A;  4JXV A;  5CHJ A;  3IS2 B;  3BY9 A;  4FUW A;  1NXY A;  1K6R A;  4X25 A;  3JVU A;  5E2H A;  3H82 B;  5TGF A;  1G6O A;  4PHT A;  2W0N A;  3NIA A;  2KOI A;  1MWR A;  2XF3 A;  1KVL A;  3OOV A;  4Y17 A;  1T1C A;  3M6B A;  4I5S A;  1VQQ A;  5AQ7 A;  3TRC A;  1FR1 A;  3CWF A;  3OPL A;  3MQO A;  3A3F A;  4DE3 A;  3SH9 A;  3PXP A;  4DRT A;  4WBG A;  4R1G A;  3QP4 A;  2H5S A;  2O9C A;  3MKE A;  3U4L P;  3GRJ A;  5CEB A;  4X53 A;  4X55 A;  5IU1 A;  3DAV A;  3EGD C;  4I39 A;  1NYY A;  3UME A;  2PR6 A;  3T4K A;  2OLV A;  1P9W A;  4IED A;  1KGF A;  4F3L B;  3G2Z A;  1JWZ A;  2Y2H A;  4X69 A;  1ES3 A;  1T18 A;  3UY6 A;  3NUL A;  4XUX A;  1DJA A;  2IWD A;  4DE1 A;  4BL2 A;  5HD5 A;  1CI9 A;  3F1P A;  1L2S A;  1IKI A;  3V50 A;  4OQG A;  1GCE A;  4WUJ A;  4MCW A;  2XEP A;  2W1T A;  4B9O A;  2EWW A;  2KX6 A;  4YIN A;  4S2M A;  4FCF A;  4PM5 A;  1YSQ A;  4KZ9 A;  5FAS A;  3IWI A;  3T4S A;  1MWS A;  3VSK A;  4FD8 A;  2ZM8 A;  3OBF A;  5M1A A;  4E3L A;  1LL8 A;  2Z6C A;  1XP4 A;  3MR0 A;  2X71 A;  1IFQ A;  2XQZ A;  1PNE A;  4R4R A;  1GHI A;  3MZF A;  5GHZ A;  4GLQ A;  2Y2I A;  1MC0 A;  4BWI A;  3O87 A;  2G2W A;  5AQA A;  4OPQ A;  3QHY A;  5G4Z A;  1DP9 A;  3HLG A;  2UV0 E;  4H6J B;  1EWZ A;  3PR6 A;  4N92 A;  4E04 A;  4JXS A;  2OAQ 1;  1S1Z A;  4JGP A;  2XR0 A;  3WS2 A;  4LEN A;  1CEF A;  3NJA A;  2ZL1 B;  1SKF A;  1XJ4 A;  2B5R A;  4GNU A;  4R23 A;  1K57 C;  4QJG A;  1JNU A;  2PBD P;  1N9N A;  3L9K A;  3RXX A;  1NLZ A;  2HJ9 C;  2I72 A;  4HI4 A;  5TBM B;  1BT5 A;  2W3H A;  3BEC A;  4R3J A;  2XGN A;  3NBL A;  3IBR A;  4DDY A;  4KZ4 A;  2GX5 A;  5DJT A;  2QHK A;  5J4E A;  3TOI A;  5HD3 A;  5FQM A;  4I38 A;  2V0U A;  4OLG A;  2Y2L A;  3EEH A;  2FZ0 A;  4G3K A;  2WKR A;  1J3W A;  2X01 A;  3G30 A;  3IF6 A;  1JWV A;  3V67 A;  5HAR A;  3CLO A;  3HJK A;  3I7J A;  1ONG A;  1K6S A;  4LCL A;  1XFN A;  1K4F A;  1VHM A;  4FTX A;  5F1F A;  4WL9 A;  2L4R A;  5AQB A;  2Y8H A;  3SS5 A;  5GHY A;  2Y2N A;  1MKM A;  5L2F A;  4N1X A;  4CPK A;  4MN6 A;  1H0M A;  2XDM A;  3CJM A;  2J7V A;  1SKO B;  2O0Y A;  2XA7 M;  2V0W A;  3V3S A;  2XD5 A;  3W8K A;  3G4P A;  4E3K A;  2PT7 A;  4RQ9 A;  1BZA A;  4ZBE A;  1OTB A;  3PAE A;  4PAU A;  2QZ6 A;  1IEL A;  3C7V A;  4R38 A;  4P6B A;  1N9L A;  1PW1 A;  2R9X A;  2VGL S;  4DDS A;  4A5R A;  3P09 A;  3MF0 A;  4RYE A;  5CEC A;  5HDD A;  4WEL A;  4LCM A;  3HRE A;  2QYB A;  1YKD A;  4OOY A;  3VP3 A;  4R3A A;  1W7F A;  2W3E A;  5DVA A;  3WS5 A;  3QNB A;  5CED A;  3M6H A;  3BQ8 A;  3LEZ A;  1G6A A;  5HWV A;  2ZM0 A;  2OWJ A;  3ZG9 B;  2PAV P;  3N7W A;  4XT2 A;  1V9Z A;  4L9G A;  4JXW A;  1SDN A;  2ZMA A;  3Q1F A;  2KDK A;  1DJB A;  1I2W A;  1OTI A;  1T1A A;  4Y2F A;  4I3I A;  1TS0 A;  3NI9 A;  3FKW A;  3ZG5 A;  2W3F A;  4GB7 A;  2WKH A;  5EM0 A;  3VSL A;  3TSG A;  2JKR M;  2EX8 A;  1BLC A;  2D02 A;  4U0T A;  3FC7 A;  3H7W A;  1W8Y A;  2BTF P;  3ZGA B;  4CLC E;  3C38 A;  2JKF A;  3ZQ5 A;  4DN0 A;  4L9E A;  1ZG4 A;  3BFC A;  2VKS A;  5EM1 A;  2HV1 A;  1KVM A;  4KZ8 A;  1K38 A;  5FDH A;  4CLC A;  1XKZ A;  2PU2 A;  1NRJ A;  1VEU A;  2XFS A;  4HJ6 A;  1K56 D;  5JYO A;  3T1Q B;  5EVI C;  4JGR A;  1E25 A;  2EFU A;  4GDN A;  4CJN A;  2Y2G A;  2L0W A;  5G18 A;  3N6I A;  4NG2 A;  1ALQ A;  2P04 A;  4MNR A;  3D72 A;  3MXS A;  3BY8 A;  2WGI A;  2I9V A;  4JKT A;  2ZOI A;  4IVK A;  1PWD A;  4KEN B;  4HES A;  5DKK A;  4PMA A;  1K0K A;  3BW6 A;  2GJ3 A;  5EVI B;  3K2N A;  4R70 A;  3HLW A;  2O9B A;  4YFM A;  1PWG A;  3PTE A;  3E0Y A;  4KG2 A;  4LRZ E;  4YNR A;  4LV1 A;  3LIF A;  2H10 A;  4GS9 B;  4LV0 A;  2V1B A;  2WKE A;  4EEP A;  4NET A;  5F6A A;  3GV9 A;  3UE0 A;  3P98 A;  2WKI A;  2EXA A;  5L8M A;  5FL3 A;  2DNS A;  3MKF A;  3QNC A;  4X6T A;  1LL9 A;  3N8L A;  3C8C A;  3G34 A;  4GKU A;  1GSV A;  3UO9 A;  3FPV A;  3NHQ A;  3A3J A;  2PHY A;  1KE3 A;  1TS8 A;  2Z6D A;  1K25 A;  5KIZ A;  1CQA A;  3KO6 A;  4QB8 A;  5EVI D;  3T4J A;  1UWP X;  2Q0O A;  1PI4 A;  5AVE A;  1N9O A;  4ARZ B;  1PIO A;  3T4T A;  5DJU A;  5TFQ A;  1EW0 A;  2V20 A;  1L0F A;  3V3R A;  3UPN A;  5CHM A;  1RCJ A;  3C4P A;  5IHV A;  2QJ7 A;  4KQR A;  1F5M A;  3M2J A;  5A92 A;  4KUO A;  4OQ0 A;  4EES A;  1F9I A;  3CHW P;  1GHM A;  5F83 A;  4M3K A;  1S1Y A;  4BBV A;  4R6L A;  4R3B A;  5HAQ A;  3ISG A;  4UAA A;  1RGZ A;  1M40 A;  3IX8 A;  5KMW A;  4O0P A;  1PZP A;  5L09 A;  4BMW A;  3HLC A;  3T4O A;  5FAQ A;  3LUQ A;  1YLW A;  2Q9M A;  1IOU A;  3CIT A;  4UQI M;  4WM9 A;  2PD8 A;  4S2K A;  1XPB A;  4KG5 A;  5HL6 A;  2XD1 A;  4U0X A;  2VX8 A;  5GL9 A;  4N1H A;  4IHQ A;  3VE3 A;  3KSF A;  1FIK A;  2FFY A;  3SS4 A;  3PBR A;  3KX0 X;  3A0V A;  3MJQ A;  5CGS A;  1BUE A;  2WUQ A;  1BTL A;  3CAX A;  5EV0 A;  1ES4 A;  2GZA A;  1YMX A;  3Q82 A;  1HD8 A;  4OPZ A;  1U60 A;  3Q7V B;  2HP9 A;  4GD6 A;  2W3D A;  3GQZ A;  5GHX A;  1BLH A;  2GDN A;  2Y2Q A;  4U3T A;  3Q7Z A;  2WAF A;  1W79 A;  3OPR A;  2WKQ A;  1KOU A;  5F1G A;  1NZU A;  2V9A A;  4FOF A;  1IYQ A;  3FWL A;  2Y59 A;  4S2L A;  5CTN A;  3TJZ C;  1BLP A;  3G6O A;  1K54 A;  3UE1 A;  2VV8 A;  5FI7 A;  2H0T A;  4HHD A;  4KQO A;  5HWT A;  4YWZ A;  4FSF A;  3HCY A;  1ERM A;  4Q0H A;  3LO7 A;  4WMC A;  4JF6 A;  1DP6 A;  2ZJ9 A;  3EQV A;  4ZJ2 A;  4Y15 A;  5CGW A;  3VP0 A;  4OPY A;  4OQI A;  4P85 A;  3L7H A;  3ZNT A;  3CI6 A;  4DE2 A;  1WYC A;  1OTE A;  4EEU A;  3UB8 A;  1TVF A;  1K55 A;  2H28 A;  1QME A;  5KSH A;  1KDS A;  3ITA A;  3GTC A;  3Q07 A;  1YLY A;  3AGD A;  3QP5 A;  3EEA A;  3LIA A;  4FH2 A;  3KSI A;  3A0S A;  3LI9 A;  1YQS A;  4HH3 A;  1S0W A;  4GOG A;  4PPR A;  3IXD A;  5L10 A;  2A24 B;  4GHI B;  4HJ4 A;  3CPT A;  4CLC C;  1JVJ A;  5M18 A;  4JGQ A;  2XA7 S;  3F1N A;  2ACG A;  4UA9 A;  5F5Y A;  3FKV A;  1ERO A;  3WS1 A;  5DTT A;  3DBA A;  3S22 A;  2B95 A;  3JYI A;  4LFU A;  1OME A;  3OPH A;  1LSX A;  4E6X A;  1OJG A;  4II7 A;  1Y54 A;  5CRF A;  2QMI A;  3DTE A;  1KDW A;  3CG5 A;  3D4F A;  3S7O A;  3IXB A;  5EE8 A;  4KQD A;  3NOU C;  1S6R A;  4JF4 A;  1VEU B;  4KZ7 A;  5TJJ A;  1XA7 A;  4JGO A;  1H8Z A;  1MKI A;  3LIC A;  4S2P A;  4Y0O A;  3NOP C;  4MLL A;  4HNB A;  2OAP 1;  4PM7 A;  3S7Q A;  5A93 A;  4RX2 A;  5CGX A;  1OT6 A;  4UA7 A;  4KUK A;  5U47 A;  3LIE A;  2BLS A;  3BQA A;  4ZJ1 A;  1HZO A;  3WRZ A;  5I5L A;  4JXG A;  4KZA A;  3RXW A;  1DY6 A;  3T1X A;  4RVA A;  2Y79 A;  3LGO A;  1OTA A;  4P87 A;  1RP5 A;  2XRN A;  4Y0U A;  3UDX A;  1PI5 A;  2HDS A;  1L0G A;  3SZT A;  5EEC A;  1YMS A;  3UE6 A;  4QY5 A;  1LI9 A;  2R9W A;  4O01 A;  1MWT A;  3R7W A;  2DMW A;  5DF9 A;  1H8Y A;  1L0D A;  4GZB A;  2PD7 A;  4ID4 A;  2Y2J A;  4X68 A;  3BEB A;  1ONH A;  4H8R A;  4E3M A;  1IKG A;  1UWN X;  1ES2 A;  4EW7 A;  2VEA A;  4MN7 A;  1VET A;  1P9R A;  1L0E A;  3HLD A;  4MDZ A;  1RGY A;  3KSH A;  5FQQ A;  4IJG A;  3IS2 A;  1YLP A;  3HJI A;  4PM9 A;  4S2J A;  3HBR A;  2A2L A;  5J8X A;  4DMZ A;  1P97 A;  1ZG6 A;  3H82 A;  3W4O A;  4PKY G;  3ULF A;  2NUT C;  2VGJ A;  3BJN A;  3LID A;  2XFT A;  2Y2P A;  5DTS A;  4OQH A;  5HDS A;  4HQA A;  1Y28 A;  4ZAM A;  5GLC A;  1CF0 A;  1JTD A;  5AVF A;  2J3T C;  4KZ3 A;  3RJU A;  4MMN A;  3T1R A;  3VOL A;  1E4D A;  4EQI A;  1Y4O A;  4WEJ A;  3QP8 A;  3E98 A;  1YSP A;  2ZOH A;  4K0W A;  2P9V B;  3F1O B;  4P0M A;  4DE0 A;  1BLS A;  3MXQ A;  3ZG7 B;  3EWK A;  4FH4 A;  4N9K A;  1T19 A;  1T1B A;  3W2Z A;  4WZ5 A;  5MC7 A;  4LV3 A;  5FAP A;  5FDS A;  3M2K A;  4JF5 A;  1SCW A;  2L1M A;  4F3L A;  2WGW B;  3UDF A;  4B4X A;  3MFD A;  5J3W A;  2HJE A;  4Z9Q A;  1MZU A;  1Q2P A;  1YAX A;  5FEF A;  3D3O A;  3HVF A;  1KE4 A;  2V1Z A;  3KSG A;  1NY0 A;  1SDE A;  3SS3 A;  3GR2 A;  1AWI A;  3UMD A;  3MZD A;  1K54 C;  4DJ2 A;  3C5A A;  3TG9 A;  5HAI A;  2EFX A;  4IUH A;  1NLY A;  3LIB A;  4UHU A;  5HW3 A;  2WGV A;  1IEM A;  3FV7 A;  3HUN A;  3WS0 A;  2W3G A;  1S4S A;  2ZC6 B;  2ZBB A;  1F98 A;  4KZ6 A;  3B33 A;  1LSW A;  1YLZ A;  3ZVT A;  2OV5 A;  3IWQ A;  1YLT A;  4PM6 A;  2M7V A;  3FG8 A;  1TF1 A;  4IUK A;  1FCM A;  1K55 C;  5FQK A;  2ZM2 A;  4ZJ3 A;  5E2G A;  2M7U A;  4UQI S;  5FI2 A;  4CQH A;  3P01 A;  2ZQ7 A;  4B88 A;  2UWX A;  3B3X A;  3IHB A;  4H6J A;  1YT4 A;  4E3O A;  3LR0 A;  1XJ3 A;  3PBQ A;  4BBU A;  4C75 A;  5A91 A;  1W8Q A;  2ZMF A;  2AVX A;  4EWF A;  2JE5 A;  2K7S A;  4L0L A;  4QY6 A;  2WZX A;  2ZL1 A;  1G5U A;  3BFE A;  4F94 A;  2G7U A;  3F1P B;  5IT5 A;  1Z6F A;  1X0O A;  2EX6 A;  1P0Z A;  3PAG A;  1ES5 A;  3S7N A;  2W1T B;  3IX3 A;  5TBM A;  1YM1 A;  3VFF A;  1LHY A;  4KZ5 A;  4GD8 A;  3K3C A;  1O7E A;  2ZQ8 A;  1W63 Q;  1K4E A;  4E6W A;  1PRQ A;  2JKR I;  3UNW A;  4OLD A;  3UPP A;  2EX2 A;  1WA9 A;  3MMH A;  3U2A A;  3QP2 A;  1D7E A;  4QWO A;  2G2U A;  3S4X A;  4PM8 A;  3UPO A;  3T50 A;  4BBT A;  5C5K A;  3T4L A;  3IQA A;  2Y2K A;  3DW0 A;  4GJ4 A;  4P6Z M;  4K91 A;  5CHU A;  1OTD A;  4HBU A;  4LLO B;  4OKP A;  4AFI A;  4K0X A;  3ZYT A;  1D1J A;  2HGV A;  3FZC A;  4C6Y A;  3HUO A;  1DP8 A;  5DFX A;  1SKO A;  3W4Q A;  5HZH A;  5G4Y A;  5FA7 A;  4WEK A;  3PBS A;  3VP4 A;  3LR4 A;  4EU0 A;  1W63 M;  2ZQD A;  4B93 A;  4ETZ A;  2ZC4 B;  2B02 A;  2Z2M B;  3ZG0 A;  1V9Y A;  2XLN A;  5F82 A;  2CMN A;  2YKF A;  3IF6 C;  1LI0 A;  1FIL A;  3A3I A;  5FQJ A;  5GLD A;  1XGJ A;  4MN5 A;  1I5Q A;  4Y13 A;  2EXB A;  2VGK A;  3BLS A;  5F68 A;  3MXR A;  1H8M A;  1TDG A;  3N4I A;  4B4Z A;  1IYP A;  4LRY C;  2O9A A;  5DF8 A;  5BOH A;  4E3N A;  4M4X A;  2ZQC A;  3IT9 A;  2DCF A;  4Y5F A;  1ESU A;  4HH2 A;  1K56 A;  1GSW A;  3GDI A;  2WAE A;  2H0Y A;  4KG6 A;  3NY4 A;  3OCN A;  4I3A A;  3HLE A;  3IF6 B;  1D06 A;  3EGX C;  4IBR A;  1BSG A;  1OJ5 A;  4NXG A;  4EXO A;  3VOZ A;  5AQ9 A;  1LLB A;  4WZ4 A;  3GEC A;  4LV2 A;  1GSX A;  5KZH A;  4BQM A;  4E3J A;  3LY4 A;  3T1S A;  3T4Q A;  5EPH A;  1FQG A;  1S67 L;  2ZMV A;  5FQI A;  1LT0 A;  5L07 A;  3TE8 A;  4LRX C;  3UE3 A;  5D3O A;  2EA9 A;  3ZCZ A;  3EOI A;  4JBF A;  3FYZ A;  1G28 A;  4LGW A;  4WZ5 C;  1L3L A;  1OT9 A;  1XA1 A;  2IA2 A;  3CZD A;  4I3J A;  4QD4 A;  1ERQ A;  3IH8 A;  4O8G A;  4PKY A;  4QU3 A;  4BD1 A;  2JN7 A;  3OLO A;  3ICY A;  2RL3 A;  5E43 A;  1S4R A;  3MZE A;  3D9Y A;  3WWX A;  4HBT A;  1MPL A;  2J3W A;  3ZFZ A;  2E8J A;  2BG1 A;  2PRF A;  4NXE A;  3LR3 A;  2E8I A;  3BM6 A;  1TDL A;  2MJ6 A;  2V1A A;  3MQQ A;  2JHE A;  2HP6 A;  4XT2 B;  2K2N A;  5EVI A;  2FFF B;  3PBN A;  2HDU A;  3A3D A;  3W4P A;  4L9F A;  1NWZ A;  4IBX A;  1KGG A;  3H9W A;  4C3Q A;  3LEQ A;  2VLG A;  2Z2L B;  4GS9 A;  1IYO A;  2ZC7 A;  5DFY A;  4R0Q A;  5F69 A;  1TEM A;  3G32 A;  3A0R A;  4Y0T A;  4ZTK A;  3SH7 A;  4MBH A;  3H7W B;  3PYP A;  3VMA A;  2RCX A;  2ZQA A;  4DXB A;  4NXB A;  2EX9 A;  1FCN A;  2VV7 A;  1W5D A;  3B42 A;  3UB7 A;  1C3B A;  2WZZ A;  4HP9 A;  3UN7 A;  3QP1 A;  3IF5 A;  4GN2 A;  3LI8 A;  4CLC B;  1N4O A;  3DWK A;  2Y4A A;  4Y7P A;  5HDC A;  3NDE A;  3C30 A;  2ZC3 B;  3O86 A;  4S2N A;  2XSS A;  4BLM A;  3VP2 A;  2CC1 A;  3UDI A;  5CTM A;  3RH8 B;  4ARZ A;  4HEF A;  3VV4 A;  2QWS A;  1LSV A;  2VJW A;  3WS4 A;  4ZRR A;  3S7P A;  5HX9 A;  3G35 A;  2OSU A;  4UEY A;  1ESI A;  2P7J A;  1ODV A;  1MY8 A;  4N9L A;  4O7D A;  5K5B A;  1WYB A;  1CJF A;  3SH8 A;  2Y2O A;  3HLF A;  1FOF A;  3KYE A;  1ZHH B;  2B18 A;  3T12 B;  4D2O A;  1O07 A;  3BWL A;  3CUE A;  4GCZ A;  3B47 A;  4HOI A;  2M1C A; 
#chains in the Genus database with same CATH homology
 1PI4 A;  1K54 C;  5EUA A;  3EQU A;  1PIO A;  3ZVW A;  5TFQ A;  2IWC A;  2V20 A;  2OLU A;  3GRJ A;  1L0F A;  3C5A A;  3V3R A;  5CEB A;  3UPN A;  4X53 A;  5CHM A;  1RCJ A;  3C4P A;  5IHV A;  3TG9 A;  5HAI A;  3IXG A;  4X55 A;  4KQR A;  2EFX A;  4UHU A;  5HW3 A;  2WGV A;  1IEM A;  3M2J A;  4IVI A;  4EBP A;  3FV7 A;  5A92 A;  3HUN A;  1NYY A;  4OQ0 A;  1NYM A;  3OPP A;  3WS0 A;  2ZC6 B;  2OLV A;  4IED A;  1KGF A;  3IWO A;  1GHM A;  5CXW A;  5F83 A;  4KZ6 A;  5TR7 A;  1XXM A;  3G2Z A;  1JWZ A;  2Y2H A;  1YLZ A;  4M3K A;  4X69 A;  1ES3 A;  2P74 A;  3HUM A;  4S2O A;  1GA0 A;  3UY6 A;  3ZVT A;  2OV5 A;  3IWQ A;  3BFG A;  3O88 A;  2X02 A;  4R3B A;  1YLT A;  4XUX A;  2J8Y A;  5HAQ A;  4PM6 A;  3ISG A;  4UAA A;  5JYP A;  1RGZ A;  1DJA A;  2IWD A;  4DE1 A;  1M40 A;  4BL2 A;  5KMW A;  1CI9 A;  1FCM A;  1K55 C;  5FQK A;  2ZM2 A;  4ZJ3 A;  1HTZ A;  1L2S A;  3NDG A;  5E2G A;  1PZP A;  1IKI A;  3V50 A;  2Y91 A;  4OQG A;  1GCE A;  1FSY A;  5FI2 A;  3Q7V A;  3HLC A;  1E3U D;  1BUL A;  5FAQ A;  3DWZ A;  2XEP A;  1ZKJ A;  2ZQ7 A;  1YLW A;  2Q9M A;  5E2E A;  4MBF A;  4B88 A;  2UWX A;  3B3X A;  4WM9 A;  4S2K A;  4YIN A;  1XPB A;  4KG5 A;  1KGE A;  3IHB A;  4S2M A;  4FCF A;  1DJC A;  2XD1 A;  1MWU A;  4U0X A;  1YT4 A;  3NCK A;  4RX3 A;  5GL9 A;  4E3O A;  4PM5 A;  1FR6 A;  4N1H A;  4KZ9 A;  5FAS A;  3IWI A;  3PBQ A;  1MWS A;  2FFY A;  1W8Q A;  3GSG A;  5A91 A;  3SS4 A;  3VSK A;  4C75 A;  4FD8 A;  4EWF A;  2ZM8 A;  3PBR A;  5M1A A;  2JE5 A;  4L0L A;  4E3L A;  1GHP A;  4QY6 A;  3AGE A;  4WYY A;  5CGS A;  4EV4 A;  1BUE A;  2WZX A;  1XP4 A;  2WUQ A;  2X71 A;  1N9B A;  5M19 A;  1BTL A;  3VOY A;  3BFE A;  1ES4 A;  4F94 A;  2XQZ A;  4R4R A;  1YMX A;  2DRW A;  1GHI A;  3MZF A;  4KZB A;  4QHC A;  4BEN A;  5GHZ A;  5EVL A;  3Q82 A;  1HD8 A;  1Z6F A;  4OPZ A;  2EX6 A;  2Y2I A;  3PAG A;  1U60 A;  3Q7V B;  2HP9 A;  1ES5 A;  3O87 A;  2G2W A;  4GD6 A;  5AQA A;  3GQZ A;  4OPQ A;  3CMZ A;  3QHY A;  5GHX A;  1BLH A;  1YM1 A;  1EI5 A;  2GDN A;  2Y2Q A;  4EBN A;  3HLG A;  3VFF A;  1LHY A;  4KZ5 A;  4U3T A;  4GD8 A;  1EWZ A;  3Q7Z A;  3HL9 A;  1O7E A;  2WAF A;  2ZQ8 A;  4N92 A;  1YLJ A;  2PBY A;  1W79 A;  1K4E A;  4DKI A;  4E6W A;  1PW8 A;  3GMW A;  3OPR A;  5F1G A;  1NZU A;  4JXS A;  3A3E A;  3UNW A;  4OLD A;  1IYQ A;  3FWL A;  4XUZ A;  3WS2 A;  2Y59 A;  2XR0 A;  4S2L A;  5CTN A;  1BLP A;  4LEN A;  1NZO A;  3UPP A;  1K54 A;  2EX2 A;  3UE1 A;  5FI7 A;  1CEF A;  1Q2Q A;  2H0T A;  4KQO A;  5DTK A;  4BL3 A;  4FSF A;  3IH9 A;  1SKF A;  1ERM A;  3LO7 A;  1PZO A;  2G2U A;  2B5R A;  3S4X A;  4GNU A;  4R23 A;  4PM8 A;  3UPO A;  1K57 C;  4WMC A;  4JF6 A;  4QJG A;  3OZH A;  3IQA A;  2ZJ9 A;  2Y2K A;  3EQV A;  3DW0 A;  1JWP A;  4ZJ2 A;  4K91 A;  5CHU A;  3RXX A;  4HBU A;  4JPM A;  4BD0 A;  1VM1 A;  4OON A;  5FAT A;  5CGW A;  2I72 A;  2ZC5 B;  3VP0 A;  4OKP A;  3E2L A;  4K0X A;  3LY3 A;  4OPY A;  5EOO A;  1BT5 A;  5I94 A;  4OH0 A;  4OQI A;  2HDQ A;  3BEC A;  4P85 A;  4R3J A;  2XGN A;  3NBL A;  3ZNT A;  3FZC A;  3WRT A;  4DDY A;  4KZ4 A;  4C6Y A;  3G2Y A;  4DE2 A;  3HUO A;  3TOI A;  1WYC A;  3MBZ A;  4E3I A;  2QPN A;  3W4Q A;  1TVF A;  1K55 A;  5FQM A;  1QME A;  5FA7 A;  5KSH A;  5HAP A;  1KDS A;  4WEK A;  2C6W B;  3ITA A;  3PBS A;  4OLG A;  3NC8 A;  2Y2L A;  3OCL A;  3ZHH A;  4OVD A;  3GTC A;  2X01 A;  3Q07 A;  5FQ9 A;  2WAD A;  3VP4 A;  3G30 A;  1YLY A;  5E2F A;  3AGD A;  2JBF A;  2ZQD A;  3IF6 A;  1JWV A;  4KQQ A;  3VP1 A;  4NK3 A;  3BLM A;  5HAR A;  4FH2 A;  3I7J A;  2ZC4 B;  1ONG A;  2Z2M B;  3ZG0 A;  1K6S A;  4LCL A;  1YQS A;  1S0W A;  2XH9 A;  2XLN A;  4OP8 A;  1K4F A;  4GOG A;  5F82 A;  5F1F A;  1HVB A;  3IXD A;  3G31 A;  3IF6 C;  1LI0 A;  4PPR A;  3A3I A;  3ITB A;  5AQB A;  3SS5 A;  5FQJ A;  5GHY A;  3BFD A;  2Y2N A;  5GLD A;  1XGJ A;  1I5Q A;  3S1Y A;  2A49 A;  1MXO A;  1QMF A;  1XX2 A;  2EXB A;  2VGK A;  1JVJ A;  3PBT A;  3BLS A;  2HDR A;  3MXR A;  5M18 A;  5L2F A;  4N1X A;  1TDG A;  3N4I A;  4B4Z A;  1IYP A;  3Q81 A;  3C7U A;  2HPB A;  1ZC2 A;  4MEZ A;  1XGI A;  4CPK A;  5DF8 A;  4UA9 A;  3V39 A;  5BOH A;  2XDM A;  3CJM A;  3FKV A;  4E3N A;  1ERO A;  2J7V A;  1FCO A;  2ZQC A;  3IT9 A;  5DTT A;  3WS1 A;  2DCF A;  1ESU A;  3E2K A;  3V3S A;  3S22 A;  2XD5 A;  1K56 A;  3W8K A;  3G4P A;  3JYI A;  4E3K A;  5EOE A;  1OME A;  3OPH A;  2WAE A;  2H0Y A;  1BZA A;  4KG6 A;  3NY4 A;  4ZBE A;  3IHA A;  4E6X A;  1CI8 A;  1Y54 A;  3PBO A;  5CRF A;  3OCN A;  3PAE A;  2QMI A;  1MBL A;  2QZ6 A;  3HLE A;  1WE4 A;  1IEL A;  3IF6 B;  1KE0 A;  1KDW A;  3CG5 A;  3D4F A;  3IXB A;  5EE8 A;  5CER A;  3C7V A;  1E3U A;  4IBR A;  4P6B A;  1BSG A;  1PW1 A;  1NRF A;  2R9X A;  1S6R A;  4JF4 A;  3VOZ A;  4DDS A;  1G68 A;  5AQ9 A;  1LLB A;  4WZ4 A;  4A5R A;  3P09 A;  4LV2 A;  4KZ7 A;  4RYE A;  5CEC A;  5KZH A;  1XA7 A;  4BQM A;  4WEL A;  4E3J A;  3LY4 A;  4LCM A;  3HRE A;  1H8Z A;  4OOY A;  1MKI A;  4S2P A;  5FAO A;  3VP3 A;  2C5W B;  4ZDX A;  4Y0O A;  2ZLY A;  5EPH A;  4MLL A;  4WMC D;  1FQG A;  1W7F A;  2PU4 A;  5DVA A;  3VFH A;  5FQI A;  3WS5 A;  4S2N C;  4MBK A;  3QNB A;  1H5X A;  5CED A;  3M6H A;  4PM7 A;  5A93 A;  4RX2 A;  3LEZ A;  3UE3 A;  5D3O A;  5CGX A;  1K57 A;  4UA7 A;  3ZCZ A;  1G6A A;  4OOM A;  4JBF A;  5U47 A;  5GLA A;  2ZM0 A;  1I2S A;  3ZG9 B;  3N7W A;  2BLS A;  3FYZ A;  4JXW A;  1LL5 A;  1SDN A;  2ZMA A;  5GLB A;  4ZJ1 A;  3Q1F A;  1HZO A;  3WRZ A;  1DJB A;  4JXG A;  1I2W A;  4KZA A;  4WZ5 C;  3RXW A;  1DY6 A;  4EBL A;  2WYX A;  4RVA A;  1XA1 A;  3CZD A;  1ERQ A;  3IH8 A;  4QD4 A;  4BD1 A;  3NI9 A;  4QU3 A;  3FKW A;  5A90 A;  4P87 A;  3ZDJ A;  3ZNY A;  3ZG5 A;  1RP5 A;  4RA7 A;  2RL3 A;  4Y0U A;  1PI5 A;  2HDS A;  4JLF A;  4OPR A;  5E43 A;  1L0G A;  4GB7 A;  3UDX A;  5EEC A;  3MZE A;  2WKH A;  1YMS A;  3AGF A;  3WWX A;  5HFO A;  4HBT A;  3TSG A;  3VSL A;  2EX8 A;  1MPL A;  4QY5 A;  1LI9 A;  1BLC A;  4GDB A;  3ZFZ A;  2R9W A;  4U0T A;  5FI6 A;  1W8Y A;  4DXC A;  1MWT A;  2BG1 A;  5DF9 A;  1AXB A;  1H8Y A;  2Q9N A;  1L0D A;  4GZB A;  2V2F F;  3ZGA B;  4ID4 A;  2E8I A;  1CEG A;  1TDL A;  3BM6 A;  2Y2J A;  2XK1 A;  1CK3 A;  4X68 A;  3BEB A;  1ONH A;  3HLB A;  4H8R A;  5DF7 A;  1JTG A;  4E3M A;  1IKG A;  1ZG4 A;  4BJP A;  4Q8I A;  1PWC A;  3C4O A;  3BFC A;  2HP6 A;  1ES2 A;  4OP5 A;  2J9O A;  1KVM A;  4KZ8 A;  5EVI A;  1K38 A;  2FFF B;  3PBN A;  4UA6 A;  5FDH A;  2HDU A;  3A3D A;  3W4P A;  1XKZ A;  1L0E A;  2PU2 A;  2XFS A;  3HLD A;  3V5M A;  4IBX A;  1KGG A;  1K56 D;  1RGY A;  3N8S A;  4C3Q A;  5JYO A;  5EVI C;  2P9V A;  4X56 A;  2Z2L B;  1IYO A;  5FQQ A;  1E25 A;  2ZC7 A;  2EFU A;  4GDN A;  3SOI A;  4CJN A;  2Y2G A;  5KSC A;  4R0Q A;  2WK0 A;  1TEM A;  1YLP A;  2HP5 A;  1GA9 A;  1IYS A;  3G32 A;  4PM9 A;  4Y0T A;  4ZTK A;  5G18 A;  3N6I A;  3HBR A;  4S2J A;  3SH7 A;  1ALQ A;  5J8X A;  4XXR A;  2JCH A;  4MBH A;  2A3U A;  2Y2M A;  2ZD8 A;  4MNR A;  3MXS A;  1ZG6 A;  2WGI A;  4OOL A;  3LCE A;  4JKT A;  3VMA A;  2RCX A;  3W4O A;  1SHV A;  4IVK A;  2VGJ A;  3BRM A;  2ZQA A;  1PWD A;  2XFT A;  2Y2P A;  4KEN B;  1PYY A;  4HES A;  4S2I A;  5DTS A;  4DXB A;  2JC7 A;  2EX9 A;  3IXH A;  4OQH A;  1FCN A;  4PMA A;  5HL1 A;  4ZAM A;  5GLC A;  1W5D A;  1FSW A;  2WGW A;  2J9P A;  3OC2 A;  3GVB A;  3BFF A;  3O3V A;  1JTD A;  3RJU A;  3N8R A;  4KZ3 A;  3ZG8 B;  5EVI B;  1C3B A;  2WZZ A;  3UN7 A;  3IF5 A;  4GN2 A;  3BYD A;  3HLW A;  1N4O A;  3DTM A;  4DF6 A;  1NJ4 A;  4EUZ A;  2ZQ9 A;  1E4D A;  4R4S A;  4EQI A;  3DWK A;  4YFM A;  1PWG A;  4WEJ A;  2Y4A A;  1J9M A;  3PTE A;  3NDE A;  4Y7P A;  2ZC3 B;  3O86 A;  4KG2 A;  4S2N A;  5FSR A;  4LV1 A;  4K0W A;  2IWB A;  2H10 A;  2P9V B;  4P0M A;  2Y55 A;  4DE0 A;  1M6K A;  4BLM A;  5CHJ A;  4JXV A;  1BLS A;  4LV0 A;  2CC1 A;  3UDI A;  2WKE A;  5CTM A;  3VP2 A;  3ZG7 B;  4NET A;  4FH4 A;  4HEF A;  1NXY A;  3GV9 A;  3UE0 A;  4N9K A;  3P98 A;  3WS4 A;  2WKI A;  1K6R A;  2EXA A;  5E2H A;  5HX9 A;  3G35 A;  5TGF A;  4WZ5 A;  4LV3 A;  2DNS A;  2OSU A;  3MKF A;  1ESI A;  3QNC A;  5FAP A;  3NIA A;  4X6T A;  3M2K A;  4JF5 A;  1SCW A;  1LL9 A;  1MWR A;  2XF3 A;  3N8L A;  1KVL A;  2WGW B;  1MY8 A;  4N9L A;  3G34 A;  3UDF A;  4O7D A;  4B4X A;  3MFD A;  4GKU A;  1WYB A;  3M6B A;  3SH8 A;  4Z9Q A;  3UO9 A;  2Y2O A;  1VQQ A;  5AQ7 A;  1Q2P A;  3A3J A;  1FR1 A;  3HLF A;  1FOF A;  1KE3 A;  3OPL A;  4D2O A;  3A3F A;  3HVF A;  4DE3 A;  1KE4 A;  3SH9 A;  1O07 A;  2V1Z A;  4DRT A;  1K25 A;  1NY0 A;  1SDE A;  4R1G A;  4WBG A;  3SS3 A;  2H5S A;  3MKE A;  3GR2 A;  4QB8 A;  5EVI D;  3MZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...