4FCFA

K234r: apo structure of inhibitor resistant beta-lactamase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADRTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and exploration of novel boronic acid inhibitors reveals important interactions with a clavulanic acid-resistant sulfhydryl-variable (SHV) beta-lactamase.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase SHV-1
total genus 99
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4fcfA00
4MLLA 2Y2PA 2ZQ9A 3TG9A 3Q7ZA 2A49A 1CEGA 5CGSA 2RCXA 1MY8A 1XPBA 3DWKA 1CI9A 4BD0A 5M1AA 2EXBA 2XF3A 3JYIA 5EVIB 3BLSA 4WZ4A 1K4EA 2QMIA 5E2FA 4WZ5A 2RL3A 3QHYA 2J7VA 3BM6A 4HBUA 3ZG7B 4BJPA 4K91A 1K56D 2G2WA 1MWUA 3EQVA 4WMCA 4R3BA 2A3UA 4Q8IA 2JBFA 3IHBA 4OQ0A 5CECA 5FAQA 2HPBA 3IH8A 3UPNA 3S22A 5CERA 2H0YA 2EFUA 4P0MA 2C5WB 3NDEA 4YFMA 1TEMA 1JWPA 4MEZA 4X53A 4XUXA 5E2HA 5FI7A 3VOYA 4X69A 4ZJ1A 5KSCA 4KQRA 4GOGA 5EVLA 4DE2A 1PWGA 1K55C 1K25A 3IXHA 4GKUA 3DWZA 4PM8A 5E2GA 3VFFA 3SOIA 1MBLA 1U60A 4E3OA 3O87A 3HL9A 1PWDA 4EWFA 5HX9A 3HUNA 1I2WA 1YLYA 1W8YA 2Y55A 2EFXA 1Q2PA 5DF8A 3RXXA 1KE0A 1YT4A 3N8SA 3DW0A 2HP5A 4DE0A 5EVIA 1NZOA 4OP5A 4KZ8A 1YMSA 2XEPA 3UNWA 4OOLA 2HDUA 2Y91A 4GDNA 3PAGA 5F82A 2QPNA 4LV1A 3SH9A 3UPPA 1HTZA 3PAEA 4S2JA 5CRFA 3SS3A 1BUEA 4QD4A 2ZM2A 4P6BA 1W79A 1IKGA 2ZQ7A 2BG1A 3GVBA 4JBFA 1IKIA 3NC8A 3G35A 5EOOA 1YMXA 3HLBA 4KZ7A 5FI2A 4C75A 4KZ4A 1J9MA 1K57A 5L2FA 3P09A 1JTGA 1XP4A 2WADA 4U3TA 4D2OA 4M3KA 2ZLYA 4WM9A 5F83A 2Y2MA 3BFCA 3FKWA 4JXGA 4NETA 2Y2GA 4PMAA 3IXGA 4B4ZA 4MBHA 4B88A 3IWIA 2HP6A 2ZC3B 4FH2A 1DJBA 1RCJA 2Y2IA 2WKIA 1GHMA 5GHYA 3HLEA 4MBFA 3W4OA 3BECA 4OKPA 5FQMA 1BULA 3LCEA 1ES5A 4KG5A 4RX3A 2FFYA 2XK1A 3Q7VB 3Q07A 1SHVA 3UO9A 1HD8A 5FAOA 1FCNA 4X6TA 5CEDA 3IQAA 4FH4A 3MBZA 5DTSA 4ZAMA 5A91A 1MXOA 1K6RA 3NBLA 4EV4A 5AQ7A 4PM9A 3HREA 4JXSA 1ZKJA 3HUMA 1NRFA 4GD8A 3S1YA 2DNSA 4IBRA 2V20A 4UHUA 3RJUA 1Z6FA 5EVIC 3V3RA 2ZM8A 3NI9A 1PZOA 1SDEA 1XA1A 2X02A 4Z9QA 5GHZA 3IF6C 4BLMA 1BLPA 1LI9A 4FCFA 4U0TA 1YLJA 4KZBA 3HLCA 1FR6A 3ITAA 4KZ6A 4E3MA 2R9XA 1DJCA 3CJMA 2Y2KA 4EBPA 3G31A 3BFDA 3UN7A 1XA7A 5CTMA 1XGIA 1KE3A 2JC7A 4C6YA 4JXWA 4DE1A 3N6IA 1I2SA 4QY6A 5TGFA 2P9VA 4R4SA 4GDBA 1FSWA 1YLZA 1FSYA 3G34A 5TR7A 3VP2A 3FWLA 4WEKA 2ZQCA 3W8KA 5DTKA 3WWXA 1LI0A 1H5XA 3I7JA 3HLWA 1E25A 2V1ZA 3CMZA 3MFDA 4S2KA 2HDRA 4EBNA 3ITBA 2JCHA 2WKEA 1NYYA 3IXBA 4X55A 1KDSA 4OQGA 3GQZA 2ZQDA 1E4DA 2WKHA 2R9WA 4ID4A 3MZFA 4EQIA 1S0WA 5DF7A 1L0EA 5FQJA 3VMAA 3C7UA 2H5SA 2IWBA 1G6AA 2B5RA 2EX8A 1KGGA 4R23A 2WAFA 4R0QA 3MKFA 3A3JA 4Y0OA 4RA7A 4OPZA 3VSKA 1IYOA 2EX6A 3ZVTA 1ZC2A 1FQGA 1HZOA 2XD1A 4X68A 5GHXA 1H8YA 3EQUA 3FYZA 4HEFA 3WS5A 2J9OA 3WRTA 3ZFZA 4JKTA 4OPQA 5EE8A 2HP9A 4L0LA 3VOZA 3ZHHA 1EROA 1VQQA 1HVBA 4DXBA 4KENB 3IF6B 1GHIA 5EECA 5FQIA 3Q7VA 2ZQ8A 1YLPA 3TOIA 5I94A 2PU2A 1BZAA 3B3XA 3LEZA 3OPRA 4NK3A 4N9LA 4XUZA 3IF6A 3IWOA 3TSGA 3IT9A 4P87A 3ZNTA 4WMCD 1ONGA 4BD1A 2Y2JA 5TFQA 2XH9A 4E6XA 1O7EA 4OH0A 3M2KA 4OPRA 1EWZA 2P74A 4GD6A 4KQQA 2ZJ9A 3IF5A 3N8LA 1IYQA 4Y0UA 4OLDA 1E3UA 3FZCA 4LV0A 4E3NA 1ES3A 1PW1A 1RP5A 1KVLA 1NXYA 3IH9A 3G30A 1YM1A 2Y59A 3G2YA 3VP1A 3V5MA 4MNRA 3QNBA 1E3UD 2QZ6A 4LV3A 3VSLA 4DF6A 4PM7A 1N9BA 3HUOA 4HESA 2BLSA 1ZG4A 3C4PA 2WZZA 2ZMAA 5BOHA 1MWSA 3IXDA 4OQHA 4RYEA 2CC1A 3V50A 4X56A 3C5AA 5EPHA 3PBTA 4DXCA 5M18A 2GDNA 1LLBA 5KZHA 4OOMA 4S2OA 5DVAA 4WZ5C 3OPHA 4Y7PA 4DE3A 1FR1A 4IBXA 4UA6A 4OQIA 4UA9A 5EUAA 1QMEA 3OC2A 4A5RA 2UWXA 5FA7A 1WE4A 4ZJ2A 3GRJA 1XXMA 2Q9NA 3G2ZA 4FD8A 5GLBA 3GSGA 1JWVA 2WAEA 2Z2MB 3SS4A 2Y2HA 2EX9A 1M6KA 4KQOA 1PZPA 1ESUA 5U47A 3WRZA 3M6BA 3MXSA 4E3KA 5HW3A 5GLAA 5D3OA 1K55A 4RX2A 3OPPA 2FFFB 5FQKA 4JXVA 4GNUA 4KG6A 4F94A 5CGXA 3AGFA 1KGEA 5J8XA 4QHCA 4EUZA 3C4OA 1W5DA 2XLNA 3LY4A 2I72A 3VP4A 3ZCZA 4CJNA 4IVKA 5HARA 2XFSA 1IYPA 3HBRA 5F1GA 3SH7A 2JE5A 5AQ9A 3P98A 3PTEA 1OMEA 1PI4A 3ISGA 3PBRA 4R3JA 1XKZA 1S6RA 4S2PA 1TDGA 2ZQAA 4E3JA 3AGDA 1KVMA 1TDLA 1GCEA 3MZEA 1XX2A 3IWQA 4GZBA 1BT5A 2ZM0A 1FCMA 2WGIA 5AQAA 1C3BA 2WK0A 3FKVA 3N8RA 4WBGA 3NDGA 2V2FF 3G4PA 4N1XA 3NY4A 5HFOA 1W8QA 2Y2QA 1IYSA 3PBQA 2E8IA 1MWTA 4HBTA 1RGYA 4IEDA 4BQMA 1SCWA 1FOFA 4YINA 3ZGAB 4DRTA 4OVDA 4ZDXA 3NIAA 2H10A 4P85A 3PBOA 2J8YA 3HLGA 2PBYA 2ZC5B 1IEMA 1XGJA 2WGWB 1ESIA 3N4IA 5FATA 4FSFA 2WGWA 1KGFA 1LHYA 1TVFA 4KZ9A 4LCMA 4GB7A 5GLDA 5E2EA 3ZG0A 2ZC7A 4N9KA 5FQ9A 1MPLA 1BTLA 3O3VA 4UA7A 3WS4A 1K54A 2OLVA 2Z2LB 5A93A 2Y2NA 4Y0TA 4PM6A 3LO7A 1ZG6A 4WELA 1K57C 1MKIA 2Y2LA 3ZVWA 3BFEA 2P9VB 4OLGA 3BFFA 3PBSA 3V3SA 1L0DA 1LL9A 1VM1A 4OONA 1O07A 1Q2QA 4PPRA 1PIOA 4ZBEA 1SKFA 5E43A 3FV7A 2OV5A 3ZG9B 5JYOA 1KDWA 4JF6A 5G18A 1MWRA 1ERQA 1JWZA 3A3DA 5FAPA 3UE3A 3A3FA 3MZDA 4N1HA 5GLCA 3RXWA 2Y4AA 4KZAA 2Y2OA 3O88A 3Q82A 2EX2A 1L0GA 3ZG8B 1N4OA 2G2UA 3SS5A 4E6WA 5FASA 1GA9A 1JTDA 2PU4A 4K0XA 3OCNA 4UAAA 5IHVA 3OZHA 3UDFA 4BL3A 4OOYA 1KE4A 2HDQA 3VFHA 2ZC6B 3D4FA 5KSHA 4XXRA 3QNCA 3AGEA 4JLFA 2OSUA 4PM5A 5HAIA 5M19A 4E3LA 1CK3A 1BSGA 3LY3A 3CZDA 5HAQA 1EI5A 3BFGA 1QMFA 5CHMA 4RVAA 3GV9A 2OLUA 3VP0A 4DDYA 1GA0A 1YLTA 3MKEA 4S2NA 2HDSA 4E3IA 5JYPA 5CHJA 5DF9A 3N7WA 4N92A 3DTMA 4S2MA 1Y54A 2XGNA 1YLWA 3A3IA 4ZTKA 3W4PA 2XQZA 5CGWA 3NCKA 3ZG5A 4BENA 4DKIA 1K6SA 1JVJA 2WZXA 3GMWA 3E2KA 2IWDA 1CI8A 3Q81A 3HLDA 3HVFA 1L2SA 4JF5A 2X01A 1K54C 3BRMA 3UE1A 2XDMA 5AQBA 4ZJ3A 1WYCA 1BLCA 2ZD8A 3BEBA 3MXRA 4K0WA 3UPOA 4MBKA 4OP8A 3UY6A 3PBNA 1K38A 5GL9A 3SH8A 2VGKA 1IELA 2XR0A 2Q9MA 4U0XA 3WS1A 1M40A 4JPMA 1K56A 1PI5A 3CG5A 4GN2A 1SDNA 4WYYA 5FDHA 3V39A 3WS0A 1L0FA 4DDSA 1PYYA 1H8ZA 1FCOA 4KZ3A 3UDXA 1PWCA 1PW8A 1BLSA 4LENA 1NYMA 2H0TA 3G32A 1K4FA 4R4RA 4LV2A 3IHAA 5HAPA 2IWCA 4KZ5A 3W4QA 4KG2A 4OPYA 2WUQA 1BLHA 4R1GA 1AXBA 2WGVA 2XFTA 4QY5A 3VP3A 3UE0A 1YQSA 1ES2A 2WYXA 4H8RA 5CHUA 3M6HA 4LCLA 5CTNA 2X71A 2J9PA 2ZC4B 3ZDJA 3HLFA 3Q1FA 5A92A 1G68A 1NJ4A 4QB8A 4B4XA 1LL5A 4BL2A 4C3QA 5HL1A 1ALQA 4S2NC 1DY6A 4JF4A 3E2LA 1DJAA 3BYDA 3GTCA 3BLMA 4O7DA 1NZUA 2DRWA 3A3EA 5DTTA 2EXAA 2DCFA 4S2LA 1NY0A 4WEJA 1I5QA 3OCLA 1CEFA 4S2IA 3ZNYA 4QJGA 5FQQA 3OPLA 3WS2A 1ERMA 5CEBA 5CXWA 2XD5A 1RGZA 3GR2A 1WYBA 2VGJA 1GHPA 5EVID 4QU3A 2C6WB 5FI6A 3O86A 3M2JA 1ONHA 5F1FA 5EOEA 1W7FA 3C7VA 4IVIA 5A90A 4CPKA 5KMWA 5FSRA 1ES4A 3S4XA 3UDIA 4EBLA
chains in the Genus database with same CATH superfamily
4MLLA 2Y2PA 2ZQ9A 3TG9A 3Q7ZA 2KLIA 1MY8A 1XPBA 2EXBA 3BLSA 4WZ4A 1K4EA 3CAXA 3QHYA 3BM6A 4HBUA 2WKQA 3ZG7B 1PNEA 2G2WA 4NG2A 4WMCA 4R3BA 2A3UA 4Q8IA 2JBFA 4OQ0A 5CECA 3IH8A 4II7A 1JWPA 1OTDA 5FI7A 4X69A 3BY9A 5EVLA 4LLOB 1K25A 3KSFA 4GKUA 5DKKA 4PM8A 3E0YA 1U60A 3HL9A 1YLYA 1NLYA 2Y55A 3RXXA 2O9AA 4OP5A 2XEPA 3UNWA 4LRXC 4OOLA 1SKOA 2HDUA 2Y91A 4GDNA 2QPNA 1HTZA 5CRFA 3CWFA 4HOIA 5FEGA 4QD4A 1V9ZA 3GVBA 2BG1A 5FI2A 4D2OA 2PD7A 3FKWA 4PMAA 3F1NA 1AWIA 4MBHA 2HJ9C 3RFBA 3IBJA 5EM0A 4FH2A 4JGOA 4UQIS 2W1TB 3DTEA 3HLEA 4MBFA 3W4OA 2LB5A 4WUJA 1BULA 1ES5A 2PBDP 1CQAA 3Q07A 1NLZA 1SHVA 2DMWA 4CLCA 1FCNA 4X6TA 3MBZA 5DFYA 5DTSA 1VB6A 4PM9A 2K7SA 3H9WA 3HUMA 3S1YA 2GJ3A 2DNSA 4UHUA 5HPIA 3V3RA 4X1LA 1PZOA 4Z9QA 1XA1A 3IF6C 1LI9A 3MMHA 4KZBA 1XA7A 1XGIA 4HP9A 4DE1A 1ZHHB 2P08A 1I2SA 4QY6A 4GDBA 1FSWA 3G34A 1T18A 4EQ1A 3FWLA 2O9CA 3WWXA 2V1ZA 1D06A 3ITBA 2JCHA 4X55A 2J3TD 2W3EA 4OQGA 3GQZA 4LPZA 1E4DA 2R9WA 3BW6A 4EUVA 5FQJA 4ARZA 2BTFP 2H5SA 2IWBA 3U4LP 2EX8A 5L07A 4H6JA 4R0QA 3A3JA 4Y0OA 4RA7A 1ZC2A 2XD1A 1HZOA 4X68A 4HEFA 3MF0A 1UGUA 2W3FA 4HH3A 3EWKA 3P7NA 1GHIA 4IHQA 2B18A 1Z09A 3IWOA 2ZOHA 4WMCD 4BD1A 2JKRM 2PHYA 2Y2JA 1O7EA 4OH0A 3M2KA 4Y15A 2PT7A 1EWZA 2P74A 4KQQA 2ZJ9A 3K2NA 1IYQA 3LIAA 4OLDA 1E3UA 3G30A 3QNBA 1E3UD 2V8CA 3VSLA 1STZA 3HUOA 4HESA 2VV6A 2WZZA 2ZMAA 2FH5A 1MWSA 4OQHA 1S4RA 1ZTUA 4NXFA 4DXCA 3PBTA 2GDNA 4WZ5C 3OPHA 5HL6A 5EUAA 1QMEA 1T19A 1T1AA 3OC2A 4A5RA 4ZJ2A 5J7EA 1XFQA 2KDKA 2Q9NA 3G2ZA 3B47A 4DJ2A 2Y2HA 2EX9A 2L1MA 2OAQ1 3WRZA 5U47A 3MXSA 5GLAA 1K55A 3LGOA 2FFFB 3EEHA 5FQKA 4LGWA 4KG6A 3DTKA 3O5YA 5G4ZA 2E8JA 2I72A 1Y28A 3VV4A 3SH7A 2JE5A 2M7VA 1OMEA 3PBRA 4O01A 2V0UA 1S6RA 2ZQAA 5DFXA 1G5UA 1KVMA 3IWQA 4Z1WA 2WGIA 4AFIA 2WK0A 3FKVA 4GS9A 4WBGA 2V2FF 2Y2QA 4MCWA 3F1OA 4HBTA 4IEDA 4BQMA 1F9IA 3NIAA 4P85A 3PBOA 2PBYA 2O9BA 1LHYA 4LCMA 4GB7A 5GLDA 5E2EA 5FQ9A 1MPLA 1BTLA 4UA7A 3WS4A 1K54A 5A93A 1F2KA 3BFEA 2P9VB 1Q2QA 4MDZA 5E43A 1KDWA 5G18A 1SKOB 5GLCA 3H7WA 3TE8A 5FASA 2G2UA 4Q0HA 3JVVA 1JTDA 2B95A 4UAAA 3T50A 3OZHA 3UDFA 4OOYA 4KUOA 2OSUA 5HAIA 5TBMB 1CK3A 5I5LA 4O0PA 2A24A 2Q0OA 4JGRA 1GA0A 2OWJA 4G3WA 5CHJA 5DF9A 3N7WA 4N92A 1Y54A 2EWVA 3MQ0A 5HWVA 4ZTKA 4ESPA 4G3VA 5CGWA 3NCKA 2VLGA 4BENA 1JVJA 3E2KA 1CI8A 4JF5A 1K54C 4ETZA 1DP9A 5EVEA 2ZD8A 3LIBA 3KSIA 5HDSA 4MBKA 3UY6A 5GL9A 1IELA 2Q9MA 4EU0A 4JPMA 1WA9A 2GNXA 1SDNA 4WYYA 1L0FA 3K3CA 4KZ3A 3UDXA 2Z6DA 4LENA 5J4EA 4I3IA 2NUPC 4R4RA 2Y8HA 2PAVP 1BLHA 4R1GA 2XFTA 3VP3A 3IS2B 5CTNA 3HLFA 2WKPA 1LL5A 3UB6A 4JF4A 4O7DA 2DRWA 3A3EA 4S2LA 2DCFA 1NY0A 4WEJA 1CEFA 4ARZB 2ZBBA 5FQQA 2VGLM 3RH8B 3WS2A 3ULFA 5CXWA 2XD5A 5J3WA 1GHPA 4QU3A 3PHYA 5FI6A 3O86A 3C7VA 5A90A 3PXPA 3HJKA 1N9NA 3PR6A 4X1MA 3VE3A 3QP8A 4GCZA 4DN0A 4BD0A 3JYIA 3RJUA 5E2FA 2QMIA 2RL3A 2J7VA 3SW1A 3F1OB 3EQVA 2HPBA 4P0MA 5IS1A 1X0OA 3ICYA 3UB7A 3VOYA 4ZJ1A 4KQRA 3E98A 1PWGA 1K55C 3IXHA 5E2GA 3SOIA 4E3OA 5HX9A 3HUNA 5DJTA 3MFXA 2QJ7A 1YT4A 3OLOA 2K2NA 5EVIA 1NZOA 4KZ8A 3PAGA 5F82A 4LV1A 4BMWA 3UPPA 2J3WA 3T1SA 3G6OA 1BUEA 2ZM2A 1W79A 1TS7A 1IKIA 3NC8A 1N9OA 3G35A 4XT2A 3B33A 3P09A 1JTGA 4WM9A 5F83A 2Y2MA 3BFCA 2PDRA 5HSQA 5KIZA 2HP6A 2ZC3B 3B42A 1RCJA 3LEQA 3UB9A 1GHMA 2JHEA 4OKPA 3C8CA 1S1YA 3MS6A 2AVXA 2XK1A 3Q7VB 4HH2A 3UO9A 1NWZA 3IQAA 4FH4A 1DRMA 4KQDA 4ZAMA 5A91A 1MXOA 1XJ3A 4EV4A 3HREA 1LL8A 1NRFA 2B02A 2V20A 3T4KA 1T1BA 2X02A 3R4KA 3VE4A 3ZYTA 4FCFA 1FR6A 3ITAA 4KZ6A 3CJMA 1UWPX 3G31A 3BFDA 2O99A 3QP5A 4I38A 3UN7A 1KE3A 4QPRA 2Y79A 4NKPA 1YLZA 1FSYA 3VP2A 2EA9A 3KYEA 2ZQCA 3OOVA 1LI0A 3HLWA 1PRQA 4S2KA 2JKRI 1NYYA 3H7WB 1KDSA 3EGXC 2ZQDA 5EM1A 2WKHA 1L0EA 2D02A 3VMAA 2B5RA 2WAFA 3MKFA 4OPZA 3VSKA 1IYOA 1T1CA 2EX6A 5GHXA 1FQGA 4R70A 1H8MA 3WS5A 4KUKA 3CUEA 4JKTA 4OPQA 4CLCE 4L0LA 1EROA 2W3GA 4DXBA 3IF6B 4GHIB 1YLPA 3TOIA 3LEZA 1CJFA 3NECA 3IF6A 3TSGA 3ZNTA 4BBVA 4E6XA 1OTBA 3CLOA 4K08A 3S7OA 3IBRA 3N8LA 4Y0UA 5LBRA 4E3NA 1G28A 2Y59A 4XT2B 4MNRA 4PHTA 1N9BA 2BLSA 3LIDA 3C4PA 1XFNA 3DTIA 2XSSA 4X56A 5EPHA 4S2OA 4DE3A 4UA9A 5GLBA 1JWVA 3SS4A 3IS2A 1M6KA 1ESUA 3IX3A 2V1AA 3OPPA 1VEUA 4GNUA 4F94A 1J3WA 5CGXA 2XLNA 3LR5A 3VP4A 3ZCZA 4FTXA 2XFSA 3P98A 5DJUA 1VETB 1PI4A 3ISGA 1GSXA 1TDGA 1LSXA 4E3JA 1XX2A 4GZBA 5AQAA 2QKPA 4HIAA 3G4PA 5HFOA 1W8QA 1MWTA 4YINA 3ZGAB 5MC7A 1D7EA 4LRZE 5L8MA 3KSGA 2VV7A 4BWIA 2WGWB 2J3TC 1TVFA 3CPTA 3UB5P 3ZG0A 4N9KA 3O3VA 4HJ6A 2K31A 3TW8A 4JGQA 2Z2LB 4PM6A 3LO7A 1ZG6A 4WELA 3BFFA 2VZWA 3V3SA 1L0DA 4OONA 1O07A 4PPRA 3MXQA 1SKFA 1MWRA 3A3DA 5FAPA 3UE3A 3A3FA 4N1HA 5L09A 3RXWA 2XRNA 1SZVA 2EX2A 1VEUB 3OCNA 2HDQA 5K5BA 3VFHA 3D4FA 5KSHA 2PRFA 3QNCA 3AGEA 4JLFA 2ZMFA 4GLQA 4HP4A 1BSGA 3LY3A 2V9AA 5CHMA 4RVAA 3GV9A 2VGLS 3VP0A 4DDYA 3MKEA 2W3HA 4E3IA 5FEFA 4S2MA 1YLWA 3A3IA 3W4PA 4CLCD 3ZG5A 3DAVA 2IWDA 4WL9A 3HLDA 1L2SA 2ZMVA 2PR6A 5AQBA 1WYCA 1BLCA 4HNBA 4K0WA 4EESA 3S7NA 3SH8A 2VGKA 1YKDA 3WS1A 4DDSA 5FDHA 2MJ6A 5C5KA 2JN7A 5AVEA 2YKHA 1PW8A 1NYMA 3TRCA 1K4FA 4GHIA 5HAPA 2IWCA 4KZ5A 3NULA 2WUQA 1JNUA 4CLCB 2WYXA 2G7UA 5CHUA 3M6HA 2PR5A 3ZDJA 1G68A 1NJ4A 4QB8A 1DY6A 3GTCA 5DTTA 1G6OA 4LRYC 4S2IA 3ZNYA 4QJGA 2KOIA 1OT9A 3M2JA 1ONHA 5F1FA 1W7FA 4CLCC 4IVIA 5FSRA 1ES4A 3MSHA 1IOUA 3S4XA 4JGPA 1CF0A 4NXBA 1CEGA 3DWKA 1CI9A 3BY8A 4WZ5A 4ZRRA 4QWOA 4BJPA 4K91A 1K56D 1MWUA 3E4PA 1OJ5A 3IHBA 3E4OA 5F68A 2C5WB 1HLUP 1TEMA 3NOPC 5KSCA 5L10A 3DWZA 3VFFA 1MBLA 4EWFA 1I2WA 1W8YA 2EFXA 5DF8A 1KE0A 3DW0A 2HP5A 5HWWA 2KX6A 4BBTA 3SH9A 5G4YA 3KYZA 3PAEA 3SS3A 3ZQ5A 1IKGA 2ZQ7A 4F3LB 5EOOA 1YMXA 3HLBA 4KZ7A 3T4LA 4C75A 1K57A 5L2FA 2WADA 4U3TA 4M3KA 5TBMA 4NETA 2Y2GA 3IXGA 4B4ZA 4B88A 1DJBA 2JKTM 4KG5A 2FFYA 2FZ0A 1S67L 1HD8A 5FAOA 5CEDA 1L3LA 1K6RA 1S4SA 3NBLA 4HI4A 3T4TA 1PFLA 3D9YA 4JXSA 1ZKJA 3NHQA 4IBRA 1DP8A 3NI9A 3QP2A 4BBUA 4BLMA 1EW0A 3BJNA 3HLCA 3LYXA 2R9XA 1DJCA 2Y2KA 4ME4A 4EBPA 4MN7A 4C6YA 2JKTI 3N6IA 5TGFA 4R4SA 3NOUC 3MQOA 4EEPA 5EFWA 4WEKA 5DTKA 5F5YA 4ETXA 3MFDA 4HJ4A 1OTAA 4EBNA 3K3DA 2QJ5A 1D1JA 3LR3A 4I39A 3MZFA 4EQIA 1S0WA 2PD8A 5EV0A 4EERA 1A0KA 3ZVTA 3EQUA 3ZFZA 3WRTA 5EE8A 2HP9A 3ZHHA 1VQQA 1HVBA 3TJZC 4KENB 4EETB 4HQAA 5EECA 5FQIA 3Q7VA 2LB9A 1BZAA 2PU2A 3OPRA 4NK3A 4N9LA 1MC0A 3H82B 3IT9A 4P87A 1ONGA 5TFQA 4HHDA 2XH9A 2QYBA 1NRJA 1TS8A 2VX8A 4GD6A 3CITA 5A8BA 4E04A 4LV0A 1ES3A 1PW1A 1KVLA 3IH9A 1YM1A 3V5MA 1YSQA 4YNRA 4LV3A 5HPFA 4DF6A 4PM7A 3MQQA 4UEYA 2UV0E 4RYEA 2CC1A 3V67A 2P7JA 3C5AA 5M18A 4WF0A 5KZHA 4OOMA 5DVAA 4Y7PA 3H82A 4IBXA 4OQIA 5FA7A 1IFQA 3GRJA 4Q0JA 1XXMA 4FD8A 3GSGA 2WAEA 2Z2MB 1UWNX 3LFVA 4E3KA 5HW3A 5D3OA 2D01A 2ZL1A 2OOLA 4MN5A 1V9YA 3AGFA 1KGEA 5J8XA 2ACGA 4GW9A 1LSWA 4H6JB 3C4OA 1W5DA 1GSVA 1W63Q 3JPUA 1IYPA 1H3QA 5F1GA 1VETA 4R3JA 1F5MA 3AGDA 4DMZA 3MZEA 1BT5A 1FCMA 2ZM0A 3CI6A 3N8RA 4PKYA 4N1XA 3NY4A 3PBQA 2E8IA 2W3DA 1RGYA 4DRTA 3MR0A 5HDCA 4ZDXA 2W0NA 2H10A 1IEMA 1XGJA 4NXEA 1ESIA 3N4IA 4I3JA 3LICA 4FSFA 3A0RA 1KGFA 1OTIA 3R7WA 2A2LA 1P9WA 2Y2NA 4Y0TA 3S7QA 2XROA 1K57C 4WN5A 4GS9B 3T1XA 3PBSA 1LL9A 1VM1A 3OBFA 1PIOA 3FV7A 5JYOA 4NEED 3MZDA 4MMNA 2Y4AA 4KZAA 4R3AA 3Q82A 1N4OA 4E6WA 1BYWA 4LFUA 5IU1A 1XJ6A 1K0KA 2ZC6B 4XXRA 3T1QB 3QP4A 4PM5A 1OTEA 1W63M 3IX4A 3FC7A 5HAQA 3BFGA 2OLUA 2GX5A 1FIKA 2V1BA 4S2NA 2HDSA 5JYPA 2QWSA 2XGNA 3PYPA 4MN6A 1DP6A 1TF1A 2WZXA 3Q81A 2X01A 3BRMA 2XDMA 3D3OA 1N9LA 3PBNA 2HZ5A 4U0XA 1M40A 3U2AA 1K56A 1PI5A 3V39A 3WS0A 3F1PA 3LR4A 1H8ZA 1PWCA 1BLSA 3G32A 3P01A 3BQ8A 4Y13A 4LV2A 2VA0A 3W4QA 4KG2A 4OPYA 2R78A 4DJ3A 1AXBA 2WGVA 4QY5A 3UE0A 1YQSA 3MJQA 4H8RA 4LCLA 2X71A 2ZC4B 1F98A 3Q1FA 3UMEA 3HCYA 3E2LA 2YKFA 4G3KA 2EXAA 3C30A 4O8GA 3IX8A 3VOLA 3RTYA 3FPWA 1RGZA 2L4RA 3GR2A 4Y5FA 5EVID 4HY8A 2C6WB 2PYRA 4R38A 2VJWA 1ACFA 3NJAA 2PYPA 3UDIA 4EBLA 4L9FA 4YWZA 2A49A 5CGSA 2RCXA 2VK3A 3FG8A 2IA2A 5M1AA 2XF3A 5EVIB 3ZVWA 3KO6A 1YSPA 5IT5A 2ZL1B 5HD5A 3C2WA 5FAQA 3UPNA 3S22A 5CERA 4YOFA 2H0YA 2EFUA 3NDEA 4YFMA 2J80A 4MEZA 4X53A 4XUXA 5E2HA 1MKMA 3D72A 4GOGA 4DE2A 4NXGA 5F6AA 5FDSA 1LT0A 2VEAA 3LR0A 2INWA 1TS6A 3O87A 2HGVA 1PWDA 2H28A 1Q2PA 3N8SA 4PKYG 4DE0A 1YMSA 2JKGA 4S2JA 4P6BA 4JBFA 1OT6A 4KZ4A 1J9MA 1XP4A 2ZLYA 3CUEC 4JXGA 3KX0X 3CPTB 3IWIA 1FILA 3F1NB 5AVFA 3UB8A 2Y2IA 5HD3A 2WKIA 5GHYA 3BECA 5FQMA 2CMNA 4CQHA 3LCEA 4RX3A 2JKFA 2HF6A 2L0WA 1S1ZA 4M4XA 1OJGA 1P9RA 3JVUA 5AQ7A 3LIFA 3SZTA 4GD8A 2OAP1 1Z6FA 5EVIC 2ZM8A 4EEUA 1TD5A 1SDEA 2QHKA 3GDIA 2NUTC 5GHZA 3L7HA 1BLPA 4U0TA 1YLJA 4E3MA 3DBAA 3BWLA 5CTMA 3F1PB 2JC7A 4JXWA 2A24B 2P9VA 5TJJA 4WLAA 5TR7A 5HDDA 3W8KA 3EEAA 1H5XA 3I7JA 3KSHA 1XJ2A 1E25A 3CMZA 1XJ4A 2HDRA 4IUKA 2WKEA 3IXBA 3A0VA 2XA7M 4ID4A 5DF7A 1YAXA 3C7UA 2P04A 1G6AA 3T12B 2ZOIA 1KGGA 4R23A 5HZHA 2HV1A 3UMDA 2W1RA 1H8YA 3FYZA 3T1RA 2J9OA 3CHWP 3VOZA 2XA7S 3T4OA 2ZQ8A 5I94A 3B3XA 4XUZA 3S7PA 4I5SA 5F69A 4R6LA 3L9KA 3KYQA 4OPRA 3IF5A 4EXOA 2M1CA 3FZCA 4P6ZS 1RP5A 4GJ4A 1NXYA 3VP1A 3G2YA 2QZ6A 3W2ZA 2M7UA 1ZG4A 5BOHA 3IXDA 3V50A 3C38A 4PAUA 2W1TA 1LLBA 1FR1A 4UA6A 2UWXA 3EGDC 1WE4A 1S66L 3T4JA 2GZAA 5FL3A 4KQOA 1PZPA 2HJEA 3M6BA 5DKLA 1LSVA 1GSWA 4RX2A 3QP1A 4F3LA 4JXVA 4P6ZM 4QHCA 4EUZA 3QP6A 3LY4A 4CJNA 5HARA 4IVKA 3HBRA 5CX7A 5AQ9A 3PTEA 4RQ9A 4HJ3A 3LI9A 2V0WA 3LUQA 1XKZA 4S2PA 1TDLA 4EW7A 1GCEA 2WKRA 4L9GA 1P97A 1C3BA 3NDGA 2EWWA 2V8FA 1IYSA 2BASA 2VKSA 1H0MA 1SCWA 1FOFA 4OVDA 4I3AA 1Y4OA 2J8YA 3HLGA 2ZC5B 4D60A 1VHMA 4L9EA 5FATA 1P0ZA 4FOFA 2WGWA 4KZ9A 3BQAA 2ZC7A 2OLVA 1MKIA 2Y2LA 4OLGA 4IUHA 4ZBEA 3ZG9B 2OV5A 4FUWA 3EOIA 4JF6A 1ODVA 1ERQA 1JWZA 1MZUA 2OWHA 1L0GA 2Y2OA 3O88A 3ZG8B 3SS5A 1GA9A 2PU4A 4K0XA 5IHVA 4BL3A 1KE4A 3LI8A 3UE6A 4X25A 5M19A 1YPRA 4E3LA 4Y3IA 3R7WB 3CZDA 1EI5A 1QMFA 4B9OA 1YLTA 4Q0IA 2Z6CA 1KOUA 3DTMA 5AJGA 2XQZA 4DKIA 1K6SA 3T4SA 3GMWA 3HVFA 3LIEA 3UE1A 4ZJ3A 3MXRA 3BEBA 3UPOA 4OP8A 1K38A 1OPXA 2XR0A 3CG5A 4GN2A 1PYYA 1FCOA 2I9VA 5HWTA 2H0TA 3NOTC 3IHAA 3GECA 3FPVA 1ES2A 2J9PA 3HJIA 5A92A 4B4XA 4BL2A 4C3QA 5HL1A 3E4QA 4Y17A 1ALQA 4S2NC 1DJAA 3BYDA 3BLMA 1NZUA 2O0YA 1I5QA 3OCLA 3A0SA 3OPLA 1ERMA 5CEBA 3T4QA 1WYBA 2VGJA 4B93A 2VV8A 4IJGA 2W27A 5EOEA 1TS0A 4Y2FA 4UQIM 4CPKA 5KMWA
chains in the Genus database with same CATH topology
4MLLA 2Y2PA 2ZQ9A 3TG9A 3Q7ZA 2A49A 1CEGA 5CGSA 2RCXA 1MY8A 1XPBA 3DWKA 1CI9A 4BD0A 5M1AA 2EXBA 2XF3A 3JYIA 5EVIB 3BLSA 4WZ4A 1K4EA 2QMIA 5E2FA 4WZ5A 2RL3A 3QHYA 2J7VA 3BM6A 4HBUA 3ZG7B 4BJPA 4K91A 1K56D 2G2WA 1MWUA 3EQVA 4WMCA 4R3BA 2A3UA 4Q8IA 2JBFA 3IHBA 4OQ0A 5CECA 5FAQA 2HPBA 3IH8A 3UPNA 3S22A 5CERA 2H0YA 2EFUA 4P0MA 2C5WB 3NDEA 4YFMA 1TEMA 1JWPA 4MEZA 4X53A 4XUXA 5E2HA 5FI7A 3VOYA 4X69A 4ZJ1A 5KSCA 4KQRA 4GOGA 5EVLA 4DE2A 1PWGA 1K55C 1K25A 3IXHA 4GKUA 3DWZA 4PM8A 5E2GA 3VFFA 3SOIA 1MBLA 1U60A 4E3OA 3O87A 3HL9A 1PWDA 4EWFA 5HX9A 3HUNA 1I2WA 1YLYA 1W8YA 2Y55A 2EFXA 1Q2PA 5DF8A 3RXXA 1KE0A 1YT4A 3N8SA 3DW0A 2HP5A 4DE0A 5EVIA 1NZOA 4OP5A 4KZ8A 1YMSA 2XEPA 3UNWA 4OOLA 2HDUA 2Y91A 4GDNA 3PAGA 5F82A 2QPNA 4LV1A 3SH9A 3UPPA 1HTZA 3PAEA 4S2JA 5CRFA 3SS3A 1BUEA 4QD4A 2ZM2A 4P6BA 1W79A 1IKGA 2ZQ7A 2BG1A 3GVBA 4JBFA 1IKIA 3NC8A 3G35A 5EOOA 1YMXA 3HLBA 4KZ7A 5FI2A 4C75A 4KZ4A 1J9MA 1K57A 5L2FA 3P09A 1JTGA 1XP4A 2WADA 4U3TA 4D2OA 4M3KA 2ZLYA 4WM9A 5F83A 2Y2MA 3BFCA 3FKWA 4JXGA 4NETA 2Y2GA 4PMAA 3IXGA 4B4ZA 4MBHA 4B88A 3IWIA 2HP6A 2ZC3B 4FH2A 1DJBA 1RCJA 2Y2IA 2WKIA 1GHMA 5GHYA 3HLEA 4MBFA 3W4OA 3BECA 4OKPA 5FQMA 1BULA 3LCEA 1ES5A 4KG5A 4RX3A 2FFYA 2XK1A 3Q7VB 3Q07A 1SHVA 3UO9A 1HD8A 5FAOA 1FCNA 4X6TA 5CEDA 3IQAA 4FH4A 3MBZA 5DTSA 4ZAMA 5A91A 1MXOA 1K6RA 3NBLA 4EV4A 5AQ7A 4PM9A 3HREA 4JXSA 1ZKJA 3HUMA 1NRFA 4GD8A 3S1YA 2DNSA 4IBRA 2V20A 4UHUA 3RJUA 1Z6FA 5EVIC 3V3RA 2ZM8A 3NI9A 1PZOA 1SDEA 1XA1A 2X02A 4Z9QA 5GHZA 3IF6C 4BLMA 1BLPA 1LI9A 4FCFA 4U0TA 1YLJA 4KZBA 3HLCA 1FR6A 3ITAA 4KZ6A 4E3MA 2R9XA 1DJCA 3CJMA 2Y2KA 4EBPA 3G31A 3BFDA 3UN7A 1XA7A 5CTMA 1XGIA 1KE3A 2JC7A 4C6YA 4JXWA 4DE1A 3N6IA 1I2SA 4QY6A 5TGFA 2P9VA 4R4SA 4GDBA 1FSWA 1YLZA 1FSYA 3G34A 5TR7A 3VP2A 3FWLA 4WEKA 2ZQCA 3W8KA 5DTKA 3WWXA 1LI0A 1H5XA 3I7JA 3HLWA 1E25A 2V1ZA 3CMZA 3MFDA 4S2KA 2HDRA 4EBNA 3ITBA 2JCHA 2WKEA 1NYYA 3IXBA 4X55A 1KDSA 4OQGA 3GQZA 2ZQDA 1E4DA 2WKHA 2R9WA 4ID4A 3MZFA 4EQIA 1S0WA 5DF7A 1L0EA 5FQJA 3VMAA 3C7UA 2H5SA 2IWBA 1G6AA 2B5RA 2EX8A 1KGGA 4R23A 2WAFA 4R0QA 3MKFA 3A3JA 4Y0OA 4RA7A 4OPZA 3VSKA 1IYOA 2EX6A 3ZVTA 1ZC2A 1FQGA 1HZOA 2XD1A 4X68A 5GHXA 1H8YA 3EQUA 3FYZA 4HEFA 3WS5A 2J9OA 3WRTA 3ZFZA 4JKTA 4OPQA 5EE8A 2HP9A 4L0LA 3VOZA 3ZHHA 1EROA 1VQQA 1HVBA 4DXBA 4KENB 3IF6B 1GHIA 5EECA 5FQIA 3Q7VA 2ZQ8A 1YLPA 3TOIA 5I94A 2PU2A 1BZAA 3B3XA 3LEZA 3OPRA 4NK3A 4N9LA 4XUZA 3IF6A 3IWOA 3TSGA 3IT9A 4P87A 3ZNTA 4WMCD 1ONGA 4BD1A 2Y2JA 5TFQA 2XH9A 4E6XA 1O7EA 4OH0A 3M2KA 4OPRA 1EWZA 2P74A 4GD6A 4KQQA 2ZJ9A 3IF5A 3N8LA 1IYQA 4Y0UA 4OLDA 1E3UA 3FZCA 4LV0A 4E3NA 1ES3A 1PW1A 1RP5A 1KVLA 1NXYA 3IH9A 3G30A 1YM1A 2Y59A 3G2YA 3VP1A 3V5MA 4MNRA 3QNBA 1E3UD 2QZ6A 4LV3A 3VSLA 4DF6A 4PM7A 1N9BA 3HUOA 4HESA 2BLSA 1ZG4A 3C4PA 2WZZA 2ZMAA 5BOHA 1MWSA 3IXDA 4OQHA 4RYEA 2CC1A 3V50A 4X56A 3C5AA 5EPHA 3PBTA 4DXCA 5M18A 2GDNA 1LLBA 5KZHA 4OOMA 4S2OA 5DVAA 4WZ5C 3OPHA 4Y7PA 4DE3A 1FR1A 4IBXA 4UA6A 4OQIA 4UA9A 5EUAA 1QMEA 3OC2A 4A5RA 2UWXA 5FA7A 1WE4A 4ZJ2A 3GRJA 1XXMA 2Q9NA 3G2ZA 4FD8A 5GLBA 3GSGA 1JWVA 2WAEA 2Z2MB 3SS4A 2Y2HA 2EX9A 1M6KA 4KQOA 1PZPA 1ESUA 5U47A 3WRZA 3M6BA 3MXSA 4E3KA 5HW3A 5GLAA 5D3OA 1K55A 4RX2A 3OPPA 2FFFB 5FQKA 4JXVA 4GNUA 4KG6A 4F94A 5CGXA 3AGFA 1KGEA 5J8XA 4QHCA 4EUZA 3C4OA 1W5DA 2XLNA 3LY4A 2I72A 3VP4A 3ZCZA 4CJNA 4IVKA 5HARA 2XFSA 1IYPA 3HBRA 5F1GA 3SH7A 2JE5A 5AQ9A 3P98A 3PTEA 1OMEA 1PI4A 3ISGA 3PBRA 4R3JA 1XKZA 1S6RA 4S2PA 1TDGA 2ZQAA 4E3JA 3AGDA 1KVMA 1TDLA 1GCEA 3MZEA 1XX2A 3IWQA 4GZBA 1BT5A 2ZM0A 1FCMA 2WGIA 5AQAA 1C3BA 2WK0A 3FKVA 3N8RA 4WBGA 3NDGA 2V2FF 3G4PA 4N1XA 3NY4A 5HFOA 1W8QA 2Y2QA 1IYSA 3PBQA 2E8IA 1MWTA 4HBTA 1RGYA 4IEDA 4BQMA 1SCWA 1FOFA 4YINA 3ZGAB 4DRTA 4OVDA 4ZDXA 3NIAA 2H10A 4P85A 3PBOA 2J8YA 3HLGA 2PBYA 2ZC5B 1IEMA 1XGJA 2WGWB 1ESIA 3N4IA 5FATA 4FSFA 2WGWA 1KGFA 1LHYA 1TVFA 4KZ9A 4LCMA 4GB7A 5GLDA 5E2EA 3ZG0A 2ZC7A 4N9KA 5FQ9A 1MPLA 1BTLA 3O3VA 4UA7A 3WS4A 1K54A 2OLVA 2Z2LB 5A93A 2Y2NA 4Y0TA 4PM6A 3LO7A 1ZG6A 4WELA 1K57C 1MKIA 2Y2LA 3ZVWA 3BFEA 2P9VB 4OLGA 3BFFA 3PBSA 3V3SA 1L0DA 1LL9A 1VM1A 4OONA 1O07A 1Q2QA 4PPRA 1PIOA 4ZBEA 1SKFA 5E43A 3FV7A 2OV5A 3ZG9B 5JYOA 1KDWA 4JF6A 5G18A 1MWRA 1ERQA 1JWZA 3A3DA 5FAPA 3UE3A 3A3FA 3MZDA 4N1HA 5GLCA 3RXWA 2Y4AA 4KZAA 2Y2OA 3O88A 3Q82A 2EX2A 1L0GA 3ZG8B 1N4OA 2G2UA 3SS5A 4E6WA 5FASA 1GA9A 1JTDA 2PU4A 4K0XA 3OCNA 4UAAA 5IHVA 3OZHA 3UDFA 4BL3A 4OOYA 1KE4A 2HDQA 3VFHA 2ZC6B 3D4FA 5KSHA 4XXRA 3QNCA 3AGEA 4JLFA 2OSUA 4PM5A 5HAIA 5M19A 4E3LA 1CK3A 1BSGA 3LY3A 3CZDA 5HAQA 1EI5A 3BFGA 1QMFA 5CHMA 4RVAA 3GV9A 2OLUA 3VP0A 4DDYA 1GA0A 1YLTA 3MKEA 4S2NA 2HDSA 4E3IA 5JYPA 5CHJA 5DF9A 3N7WA 4N92A 3DTMA 4S2MA 1Y54A 2XGNA 1YLWA 3A3IA 4ZTKA 3W4PA 2XQZA 5CGWA 3NCKA 3ZG5A 4BENA 4DKIA 1K6SA 1JVJA 2WZXA 3GMWA 3E2KA 2IWDA 1CI8A 3Q81A 3HLDA 3HVFA 1L2SA 4JF5A 2X01A 1K54C 3BRMA 3UE1A 2XDMA 5AQBA 4ZJ3A 1WYCA 1BLCA 2ZD8A 3BEBA 3MXRA 4K0WA 3UPOA 4MBKA 4OP8A 3UY6A 3PBNA 1K38A 5GL9A 3SH8A 2VGKA 1IELA 2XR0A 2Q9MA 4U0XA 3WS1A 1M40A 4JPMA 1K56A 1PI5A 3CG5A 4GN2A 1SDNA 4WYYA 5FDHA 3V39A 3WS0A 1L0FA 4DDSA 1PYYA 1H8ZA 1FCOA 4KZ3A 3UDXA 1PWCA 1PW8A 1BLSA 4LENA 1NYMA 2H0TA 3G32A 1K4FA 4R4RA 4LV2A 3IHAA 5HAPA 2IWCA 4KZ5A 3W4QA 4KG2A 4OPYA 2WUQA 1BLHA 4R1GA 1AXBA 2WGVA 2XFTA 4QY5A 3VP3A 3UE0A 1YQSA 1ES2A 2WYXA 4H8RA 5CHUA 3M6HA 4LCLA 5CTNA 2X71A 2J9PA 2ZC4B 3ZDJA 3HLFA 3Q1FA 5A92A 1G68A 1NJ4A 4QB8A 4B4XA 1LL5A 4BL2A 4C3QA 5HL1A 1ALQA 4S2NC 1DY6A 4JF4A 3E2LA 1DJAA 3BYDA 3GTCA 3BLMA 4O7DA 1NZUA 2DRWA 3A3EA 5DTTA 2EXAA 2DCFA 4S2LA 1NY0A 4WEJA 1I5QA 3OCLA 1CEFA 4S2IA 3ZNYA 4QJGA 5FQQA 3OPLA 3WS2A 1ERMA 5CEBA 5CXWA 2XD5A 1RGZA 3GR2A 1WYBA 2VGJA 1GHPA 5EVID 4QU3A 2C6WB 5FI6A 3O86A 3M2JA 1ONHA 5F1FA 5EOEA 1W7FA 3C7VA 4IVIA 5A90A 4CPKA 5KMWA 5FSRA 1ES4A 3S4XA 3UDIA 4EBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MLL A;  2Y2P A;  2ZQ9 A;  3TG9 A;  3Q7Z A;  2A49 A;  1CEG A;  5CGS A;  2RCX A;  1MY8 A;  1XPB A;  3DWK A;  1CI9 A;  4BD0 A;  5M1A A;  2EXB A;  2XF3 A;  3JYI A;  5EVI B;  3BLS A;  4WZ4 A;  1K4E A;  2QMI A;  5E2F A;  4WZ5 A;  2RL3 A;  3QHY A;  2J7V A;  3BM6 A;  4HBU A;  3ZG7 B;  4BJP A;  4K91 A;  1K56 D;  2G2W A;  1MWU A;  3EQV A;  4WMC A;  4R3B A;  2A3U A;  4Q8I A;  2JBF A;  3IHB A;  4OQ0 A;  5CEC A;  5FAQ A;  2HPB A;  3IH8 A;  3UPN A;  3S22 A;  5CER A;  2H0Y A;  2EFU A;  4P0M A;  2C5W B;  3NDE A;  4YFM A;  1TEM A;  1JWP A;  4MEZ A;  4X53 A;  4XUX A;  5E2H A;  5FI7 A;  3VOY A;  4X69 A;  4ZJ1 A;  5KSC A;  4KQR A;  4GOG A;  5EVL A;  4DE2 A;  1PWG A;  1K55 C;  1K25 A;  3IXH A;  4GKU A;  3DWZ A;  4PM8 A;  5E2G A;  3VFF A;  3SOI A;  1MBL A;  1U60 A;  4E3O A;  3O87 A;  3HL9 A;  1PWD A;  4EWF A;  5HX9 A;  3HUN A;  1I2W A;  1YLY A;  1W8Y A;  2Y55 A;  2EFX A;  1Q2P A;  5DF8 A;  3RXX A;  1KE0 A;  1YT4 A;  3N8S A;  3DW0 A;  2HP5 A;  4DE0 A;  5EVI A;  1NZO A;  4OP5 A;  4KZ8 A;  1YMS A;  2XEP A;  3UNW A;  4OOL A;  2HDU A;  2Y91 A;  4GDN A;  3PAG A;  5F82 A;  2QPN A;  4LV1 A;  3SH9 A;  3UPP A;  1HTZ A;  3PAE A;  4S2J A;  5CRF A;  3SS3 A;  1BUE A;  4QD4 A;  2ZM2 A;  4P6B A;  1W79 A;  1IKG A;  2ZQ7 A;  2BG1 A;  3GVB A;  4JBF A;  1IKI A;  3NC8 A;  3G35 A;  5EOO A;  1YMX A;  3HLB A;  4KZ7 A;  5FI2 A;  4C75 A;  4KZ4 A;  1J9M A;  1K57 A;  5L2F A;  3P09 A;  1JTG A;  1XP4 A;  2WAD A;  4U3T A;  4D2O A;  4M3K A;  2ZLY A;  4WM9 A;  5F83 A;  2Y2M A;  3BFC A;  3FKW A;  4JXG A;  4NET A;  2Y2G A;  4PMA A;  3IXG A;  4B4Z A;  4MBH A;  4B88 A;  3IWI A;  2HP6 A;  2ZC3 B;  4FH2 A;  1DJB A;  1RCJ A;  2Y2I A;  2WKI A;  1GHM A;  5GHY A;  3HLE A;  4MBF A;  3W4O A;  3BEC A;  4OKP A;  5FQM A;  1BUL A;  3LCE A;  1ES5 A;  4KG5 A;  4RX3 A;  2FFY A;  2XK1 A;  3Q7V B;  3Q07 A;  1SHV A;  3UO9 A;  1HD8 A;  5FAO A;  1FCN A;  4X6T A;  5CED A;  3IQA A;  4FH4 A;  3MBZ A;  5DTS A;  4ZAM A;  5A91 A;  1MXO A;  1K6R A;  3NBL A;  4EV4 A;  5AQ7 A;  4PM9 A;  3HRE A;  4JXS A;  1ZKJ A;  3HUM A;  1NRF A;  4GD8 A;  3S1Y A;  2DNS A;  4IBR A;  2V20 A;  4UHU A;  3RJU A;  1Z6F A;  5EVI C;  3V3R A;  2ZM8 A;  3NI9 A;  1PZO A;  1SDE A;  1XA1 A;  2X02 A;  4Z9Q A;  5GHZ A;  3IF6 C;  4BLM A;  1BLP A;  1LI9 A;  4FCF A;  4U0T A;  1YLJ A;  4KZB A;  3HLC A;  1FR6 A;  3ITA A;  4KZ6 A;  4E3M A;  2R9X A;  1DJC A;  3CJM A;  2Y2K A;  4EBP A;  3G31 A;  3BFD A;  3UN7 A;  1XA7 A;  5CTM A;  1XGI A;  1KE3 A;  2JC7 A;  4C6Y A;  4JXW A;  4DE1 A;  3N6I A;  1I2S A;  4QY6 A;  5TGF A;  2P9V A;  4R4S A;  4GDB A;  1FSW A;  1YLZ A;  1FSY A;  3G34 A;  5TR7 A;  3VP2 A;  3FWL A;  4WEK A;  2ZQC A;  3W8K A;  5DTK A;  3WWX A;  1LI0 A;  1H5X A;  3I7J A;  3HLW A;  1E25 A;  2V1Z A;  3CMZ A;  3MFD A;  4S2K A;  2HDR A;  4EBN A;  3ITB A;  2JCH A;  2WKE A;  1NYY A;  3IXB A;  4X55 A;  1KDS A;  4OQG A;  3GQZ A;  2ZQD A;  1E4D A;  2WKH A;  2R9W A;  4ID4 A;  3MZF A;  4EQI A;  1S0W A;  5DF7 A;  1L0E A;  5FQJ A;  3VMA A;  3C7U A;  2H5S A;  2IWB A;  1G6A A;  2B5R A;  2EX8 A;  1KGG A;  4R23 A;  2WAF A;  4R0Q A;  3MKF A;  3A3J A;  4Y0O A;  4RA7 A;  4OPZ A;  3VSK A;  1IYO A;  2EX6 A;  3ZVT A;  1ZC2 A;  1FQG A;  1HZO A;  2XD1 A;  4X68 A;  5GHX A;  1H8Y A;  3EQU A;  3FYZ A;  4HEF A;  3WS5 A;  2J9O A;  3WRT A;  3ZFZ A;  4JKT A;  4OPQ A;  5EE8 A;  2HP9 A;  4L0L A;  3VOZ A;  3ZHH A;  1ERO A;  1VQQ A;  1HVB A;  4DXB A;  4KEN B;  3IF6 B;  1GHI A;  5EEC A;  5FQI A;  3Q7V A;  2ZQ8 A;  1YLP A;  3TOI A;  5I94 A;  2PU2 A;  1BZA A;  3B3X A;  3LEZ A;  3OPR A;  4NK3 A;  4N9L A;  4XUZ A;  3IF6 A;  3IWO A;  3TSG A;  3IT9 A;  4P87 A;  3ZNT A;  4WMC D;  1ONG A;  4BD1 A;  2Y2J A;  5TFQ A;  2XH9 A;  4E6X A;  1O7E A;  4OH0 A;  3M2K A;  4OPR A;  1EWZ A;  2P74 A;  4GD6 A;  4KQQ A;  2ZJ9 A;  3IF5 A;  3N8L A;  1IYQ A;  4Y0U A;  4OLD A;  1E3U A;  3FZC A;  4LV0 A;  4E3N A;  1ES3 A;  1PW1 A;  1RP5 A;  1KVL A;  1NXY A;  3IH9 A;  3G30 A;  1YM1 A;  2Y59 A;  3G2Y A;  3VP1 A;  3V5M A;  4MNR A;  3QNB A;  1E3U D;  2QZ6 A;  4LV3 A;  3VSL A;  4DF6 A;  4PM7 A;  1N9B A;  3HUO A;  4HES A;  2BLS A;  1ZG4 A;  3C4P A;  2WZZ A;  2ZMA A;  5BOH A;  1MWS A;  3IXD A;  4OQH A;  4RYE A;  2CC1 A;  3V50 A;  4X56 A;  3C5A A;  5EPH A;  3PBT A;  4DXC A;  5M18 A;  2GDN A;  1LLB A;  5KZH A;  4OOM A;  4S2O A;  5DVA A;  4WZ5 C;  3OPH A;  4Y7P A;  4DE3 A;  1FR1 A;  4IBX A;  4UA6 A;  4OQI A;  4UA9 A;  5EUA A;  1QME A;  3OC2 A;  4A5R A;  2UWX A;  5FA7 A;  1WE4 A;  4ZJ2 A;  3GRJ A;  1XXM A;  2Q9N A;  3G2Z A;  4FD8 A;  5GLB A;  3GSG A;  1JWV A;  2WAE A;  2Z2M B;  3SS4 A;  2Y2H A;  2EX9 A;  1M6K A;  4KQO A;  1PZP A;  1ESU A;  5U47 A;  3WRZ A;  3M6B A;  3MXS A;  4E3K A;  5HW3 A;  5GLA A;  5D3O A;  1K55 A;  4RX2 A;  3OPP A;  2FFF B;  5FQK A;  4JXV A;  4GNU A;  4KG6 A;  4F94 A;  5CGX A;  3AGF A;  1KGE A;  5J8X A;  4QHC A;  4EUZ A;  3C4O A;  1W5D A;  2XLN A;  3LY4 A;  2I72 A;  3VP4 A;  3ZCZ A;  4CJN A;  4IVK A;  5HAR A;  2XFS A;  1IYP A;  3HBR A;  5F1G A;  3SH7 A;  2JE5 A;  5AQ9 A;  3P98 A;  3PTE A;  1OME A;  1PI4 A;  3ISG A;  3PBR A;  4R3J A;  1XKZ A;  1S6R A;  4S2P A;  1TDG A;  2ZQA A;  4E3J A;  3AGD A;  1KVM A;  1TDL A;  1GCE A;  3MZE A;  1XX2 A;  3IWQ A;  4GZB A;  1BT5 A;  2ZM0 A;  1FCM A;  2WGI A;  5AQA A;  1C3B A;  2WK0 A;  3FKV A;  3N8R A;  4WBG A;  3NDG A;  2V2F F;  3G4P A;  4N1X A;  3NY4 A;  5HFO A;  1W8Q A;  2Y2Q A;  1IYS A;  3PBQ A;  2E8I A;  1MWT A;  4HBT A;  1RGY A;  4IED A;  4BQM A;  1SCW A;  1FOF A;  4YIN A;  3ZGA B;  4DRT A;  4OVD A;  4ZDX A;  3NIA A;  2H10 A;  4P85 A;  3PBO A;  2J8Y A;  3HLG A;  2PBY A;  2ZC5 B;  1IEM A;  1XGJ A;  2WGW B;  1ESI A;  3N4I A;  5FAT A;  4FSF A;  2WGW A;  1KGF A;  1LHY A;  1TVF A;  4KZ9 A;  4LCM A;  4GB7 A;  5GLD A;  5E2E A;  3ZG0 A;  2ZC7 A;  4N9K A;  5FQ9 A;  1MPL A;  1BTL A;  3O3V A;  4UA7 A;  3WS4 A;  1K54 A;  2OLV A;  2Z2L B;  5A93 A;  2Y2N A;  4Y0T A;  4PM6 A;  3LO7 A;  1ZG6 A;  4WEL A;  1K57 C;  1MKI A;  2Y2L A;  3ZVW A;  3BFE A;  2P9V B;  4OLG A;  3BFF A;  3PBS A;  3V3S A;  1L0D A;  1LL9 A;  1VM1 A;  4OON A;  1O07 A;  1Q2Q A;  4PPR A;  1PIO A;  4ZBE A;  1SKF A;  5E43 A;  3FV7 A;  2OV5 A;  3ZG9 B;  5JYO A;  1KDW A;  4JF6 A;  5G18 A;  1MWR A;  1ERQ A;  1JWZ A;  3A3D A;  5FAP A;  3UE3 A;  3A3F A;  3MZD A;  4N1H A;  5GLC A;  3RXW A;  2Y4A A;  4KZA A;  2Y2O A;  3O88 A;  3Q82 A;  2EX2 A;  1L0G A;  3ZG8 B;  1N4O A;  2G2U A;  3SS5 A;  4E6W A;  5FAS A;  1GA9 A;  1JTD A;  2PU4 A;  4K0X A;  3OCN A;  4UAA A;  5IHV A;  3OZH A;  3UDF A;  4BL3 A;  4OOY A;  1KE4 A;  2HDQ A;  3VFH A;  2ZC6 B;  3D4F A;  5KSH A;  4XXR A;  3QNC A;  3AGE A;  4JLF A;  2OSU A;  4PM5 A;  5HAI A;  5M19 A;  4E3L A;  1CK3 A;  1BSG A;  3LY3 A;  3CZD A;  5HAQ A;  1EI5 A;  3BFG A;  1QMF A;  5CHM A;  4RVA A;  3GV9 A;  2OLU A;  3VP0 A;  4DDY A;  1GA0 A;  1YLT A;  3MKE A;  4S2N A;  2HDS A;  4E3I A;  5JYP A;  5CHJ A;  5DF9 A;  3N7W A;  4N92 A;  3DTM A;  4S2M A;  1Y54 A;  2XGN A;  1YLW A;  3A3I A;  4ZTK A;  3W4P A;  2XQZ A;  5CGW A;  3NCK A;  3ZG5 A;  4BEN A;  4DKI A;  1K6S A;  1JVJ A;  2WZX A;  3GMW A;  3E2K A;  2IWD A;  1CI8 A;  3Q81 A;  3HLD A;  3HVF A;  1L2S A;  4JF5 A;  2X01 A;  1K54 C;  3BRM A;  3UE1 A;  2XDM A;  5AQB A;  4ZJ3 A;  1WYC A;  1BLC A;  2ZD8 A;  3BEB A;  3MXR A;  4K0W A;  3UPO A;  4MBK A;  4OP8 A;  3UY6 A;  3PBN A;  1K38 A;  5GL9 A;  3SH8 A;  2VGK A;  1IEL A;  2XR0 A;  2Q9M A;  4U0X A;  3WS1 A;  1M40 A;  4JPM A;  1K56 A;  1PI5 A;  3CG5 A;  4GN2 A;  1SDN A;  4WYY A;  5FDH A;  3V39 A;  3WS0 A;  1L0F A;  4DDS A;  1PYY A;  1H8Z A;  1FCO A;  4KZ3 A;  3UDX A;  1PWC A;  1PW8 A;  1BLS A;  4LEN A;  1NYM A;  2H0T A;  3G32 A;  1K4F A;  4R4R A;  4LV2 A;  3IHA A;  5HAP A;  2IWC A;  4KZ5 A;  3W4Q A;  4KG2 A;  4OPY A;  2WUQ A;  1BLH A;  4R1G A;  1AXB A;  2WGV A;  2XFT A;  4QY5 A;  3VP3 A;  3UE0 A;  1YQS A;  1ES2 A;  2WYX A;  4H8R A;  5CHU A;  3M6H A;  4LCL A;  5CTN A;  2X71 A;  2J9P A;  2ZC4 B;  3ZDJ A;  3HLF A;  3Q1F A;  5A92 A;  1G68 A;  1NJ4 A;  4QB8 A;  4B4X A;  1LL5 A;  4BL2 A;  4C3Q A;  5HL1 A;  1ALQ A;  4S2N C;  1DY6 A;  4JF4 A;  3E2L A;  1DJA A;  3BYD A;  3GTC A;  3BLM A;  4O7D A;  1NZU A;  2DRW A;  3A3E A;  5DTT A;  2EXA A;  2DCF A;  4S2L A;  1NY0 A;  4WEJ A;  1I5Q A;  3OCL A;  1CEF A;  4S2I A;  3ZNY A;  4QJG A;  5FQQ A;  3OPL A;  3WS2 A;  1ERM A;  5CEB A;  5CXW A;  2XD5 A;  1RGZ A;  3GR2 A;  1WYB A;  2VGJ A;  1GHP A;  5EVI D;  4QU3 A;  2C6W B;  5FI6 A;  3O86 A;  3M2J A;  1ONH A;  5F1F A;  5EOE A;  1W7F A;  3C7V A;  4IVI A;  5A90 A;  4CPK A;  5KMW A;  5FSR A;  1ES4 A;  3S4X A;  3UDI A;  4EBL A; 
#chains in the Genus database with same CATH topology
 4MLL A;  2Y2P A;  2ZQ9 A;  3TG9 A;  3Q7Z A;  2KLI A;  1MY8 A;  1XPB A;  2EXB A;  3BLS A;  4WZ4 A;  1K4E A;  3CAX A;  3QHY A;  3BM6 A;  4HBU A;  2WKQ A;  3ZG7 B;  1PNE A;  2G2W A;  4NG2 A;  4WMC A;  4R3B A;  2A3U A;  4Q8I A;  2JBF A;  4OQ0 A;  5CEC A;  3IH8 A;  4II7 A;  1JWP A;  1OTD A;  5FI7 A;  4X69 A;  3BY9 A;  5EVL A;  4LLO B;  1K25 A;  3KSF A;  4GKU A;  5DKK A;  4PM8 A;  3E0Y A;  1U60 A;  3HL9 A;  1YLY A;  1NLY A;  2Y55 A;  3RXX A;  2O9A A;  4OP5 A;  2XEP A;  3UNW A;  4LRX C;  4OOL A;  1SKO A;  2HDU A;  2Y91 A;  4GDN A;  2QPN A;  1HTZ A;  5CRF A;  3CWF A;  4HOI A;  5FEG A;  4QD4 A;  1V9Z A;  3GVB A;  2BG1 A;  5FI2 A;  4D2O A;  2PD7 A;  3FKW A;  4PMA A;  3F1N A;  1AWI A;  4MBH A;  2HJ9 C;  3RFB A;  3IBJ A;  5EM0 A;  4FH2 A;  4JGO A;  4UQI S;  2W1T B;  3DTE A;  3HLE A;  4MBF A;  3W4O A;  2LB5 A;  4WUJ A;  1BUL A;  1ES5 A;  2PBD P;  1CQA A;  3Q07 A;  1NLZ A;  1SHV A;  2DMW A;  4CLC A;  1FCN A;  4X6T A;  3MBZ A;  5DFY A;  5DTS A;  1VB6 A;  4PM9 A;  2K7S A;  3H9W A;  3HUM A;  3S1Y A;  2GJ3 A;  2DNS A;  4UHU A;  5HPI A;  3V3R A;  4X1L A;  1PZO A;  4Z9Q A;  1XA1 A;  3IF6 C;  1LI9 A;  3MMH A;  4KZB A;  1XA7 A;  1XGI A;  4HP9 A;  4DE1 A;  1ZHH B;  2P08 A;  1I2S A;  4QY6 A;  4GDB A;  1FSW A;  3G34 A;  1T18 A;  4EQ1 A;  3FWL A;  2O9C A;  3WWX A;  2V1Z A;  1D06 A;  3ITB A;  2JCH A;  4X55 A;  2J3T D;  2W3E A;  4OQG A;  3GQZ A;  4LPZ A;  1E4D A;  2R9W A;  3BW6 A;  4EUV A;  5FQJ A;  4ARZ A;  2BTF P;  2H5S A;  2IWB A;  3U4L P;  2EX8 A;  5L07 A;  4H6J A;  4R0Q A;  3A3J A;  4Y0O A;  4RA7 A;  1ZC2 A;  2XD1 A;  1HZO A;  4X68 A;  4HEF A;  3MF0 A;  1UGU A;  2W3F A;  4HH3 A;  3EWK A;  3P7N A;  1GHI A;  4IHQ A;  2B18 A;  1Z09 A;  3IWO A;  2ZOH A;  4WMC D;  4BD1 A;  2JKR M;  2PHY A;  2Y2J A;  1O7E A;  4OH0 A;  3M2K A;  4Y15 A;  2PT7 A;  1EWZ A;  2P74 A;  4KQQ A;  2ZJ9 A;  3K2N A;  1IYQ A;  3LIA A;  4OLD A;  1E3U A;  3G30 A;  3QNB A;  1E3U D;  2V8C A;  3VSL A;  1STZ A;  3HUO A;  4HES A;  2VV6 A;  2WZZ A;  2ZMA A;  2FH5 A;  1MWS A;  4OQH A;  1S4R A;  1ZTU A;  4NXF A;  4DXC A;  3PBT A;  2GDN A;  4WZ5 C;  3OPH A;  5HL6 A;  5EUA A;  1QME A;  1T19 A;  1T1A A;  3OC2 A;  4A5R A;  4ZJ2 A;  5J7E A;  1XFQ A;  2KDK A;  2Q9N A;  3G2Z A;  3B47 A;  4DJ2 A;  2Y2H A;  2EX9 A;  2L1M A;  2OAQ 1;  3WRZ A;  5U47 A;  3MXS A;  5GLA A;  1K55 A;  3LGO A;  2FFF B;  3EEH A;  5FQK A;  4LGW A;  4KG6 A;  3DTK A;  3O5Y A;  5G4Z A;  2E8J A;  2I72 A;  1Y28 A;  3VV4 A;  3SH7 A;  2JE5 A;  2M7V A;  1OME A;  3PBR A;  4O01 A;  2V0U A;  1S6R A;  2ZQA A;  5DFX A;  1G5U A;  1KVM A;  3IWQ A;  4Z1W A;  2WGI A;  4AFI A;  2WK0 A;  3FKV A;  4GS9 A;  4WBG A;  2V2F F;  2Y2Q A;  4MCW A;  3F1O A;  4HBT A;  4IED A;  4BQM A;  1F9I A;  3NIA A;  4P85 A;  3PBO A;  2PBY A;  2O9B A;  1LHY A;  4LCM A;  4GB7 A;  5GLD A;  5E2E A;  5FQ9 A;  1MPL A;  1BTL A;  4UA7 A;  3WS4 A;  1K54 A;  5A93 A;  1F2K A;  3BFE A;  2P9V B;  1Q2Q A;  4MDZ A;  5E43 A;  1KDW A;  5G18 A;  1SKO B;  5GLC A;  3H7W A;  3TE8 A;  5FAS A;  2G2U A;  4Q0H A;  3JVV A;  1JTD A;  2B95 A;  4UAA A;  3T50 A;  3OZH A;  3UDF A;  4OOY A;  4KUO A;  2OSU A;  5HAI A;  5TBM B;  1CK3 A;  5I5L A;  4O0P A;  2A24 A;  2Q0O A;  4JGR A;  1GA0 A;  2OWJ A;  4G3W A;  5CHJ A;  5DF9 A;  3N7W A;  4N92 A;  1Y54 A;  2EWV A;  3MQ0 A;  5HWV A;  4ZTK A;  4ESP A;  4G3V A;  5CGW A;  3NCK A;  2VLG A;  4BEN A;  1JVJ A;  3E2K A;  1CI8 A;  4JF5 A;  1K54 C;  4ETZ A;  1DP9 A;  5EVE A;  2ZD8 A;  3LIB A;  3KSI A;  5HDS A;  4MBK A;  3UY6 A;  5GL9 A;  1IEL A;  2Q9M A;  4EU0 A;  4JPM A;  1WA9 A;  2GNX A;  1SDN A;  4WYY A;  1L0F A;  3K3C A;  4KZ3 A;  3UDX A;  2Z6D A;  4LEN A;  5J4E A;  4I3I A;  2NUP C;  4R4R A;  2Y8H A;  2PAV P;  1BLH A;  4R1G A;  2XFT A;  3VP3 A;  3IS2 B;  5CTN A;  3HLF A;  2WKP A;  1LL5 A;  3UB6 A;  4JF4 A;  4O7D A;  2DRW A;  3A3E A;  4S2L A;  2DCF A;  1NY0 A;  4WEJ A;  1CEF A;  4ARZ B;  2ZBB A;  5FQQ A;  2VGL M;  3RH8 B;  3WS2 A;  3ULF A;  5CXW A;  2XD5 A;  5J3W A;  1GHP A;  4QU3 A;  3PHY A;  5FI6 A;  3O86 A;  3C7V A;  5A90 A;  3PXP A;  3HJK A;  1N9N A;  3PR6 A;  4X1M A;  3VE3 A;  3QP8 A;  4GCZ A;  4DN0 A;  4BD0 A;  3JYI A;  3RJU A;  5E2F A;  2QMI A;  2RL3 A;  2J7V A;  3SW1 A;  3F1O B;  3EQV A;  2HPB A;  4P0M A;  5IS1 A;  1X0O A;  3ICY A;  3UB7 A;  3VOY A;  4ZJ1 A;  4KQR A;  3E98 A;  1PWG A;  1K55 C;  3IXH A;  5E2G A;  3SOI A;  4E3O A;  5HX9 A;  3HUN A;  5DJT A;  3MFX A;  2QJ7 A;  1YT4 A;  3OLO A;  2K2N A;  5EVI A;  1NZO A;  4KZ8 A;  3PAG A;  5F82 A;  4LV1 A;  4BMW A;  3UPP A;  2J3W A;  3T1S A;  3G6O A;  1BUE A;  2ZM2 A;  1W79 A;  1TS7 A;  1IKI A;  3NC8 A;  1N9O A;  3G35 A;  4XT2 A;  3B33 A;  3P09 A;  1JTG A;  4WM9 A;  5F83 A;  2Y2M A;  3BFC A;  2PDR A;  5HSQ A;  5KIZ A;  2HP6 A;  2ZC3 B;  3B42 A;  1RCJ A;  3LEQ A;  3UB9 A;  1GHM A;  2JHE A;  4OKP A;  3C8C A;  1S1Y A;  3MS6 A;  2AVX A;  2XK1 A;  3Q7V B;  4HH2 A;  3UO9 A;  1NWZ A;  3IQA A;  4FH4 A;  1DRM A;  4KQD A;  4ZAM A;  5A91 A;  1MXO A;  1XJ3 A;  4EV4 A;  3HRE A;  1LL8 A;  1NRF A;  2B02 A;  2V20 A;  3T4K A;  1T1B A;  2X02 A;  3R4K A;  3VE4 A;  3ZYT A;  4FCF A;  1FR6 A;  3ITA A;  4KZ6 A;  3CJM A;  1UWP X;  3G31 A;  3BFD A;  2O99 A;  3QP5 A;  4I38 A;  3UN7 A;  1KE3 A;  4QPR A;  2Y79 A;  4NKP A;  1YLZ A;  1FSY A;  3VP2 A;  2EA9 A;  3KYE A;  2ZQC A;  3OOV A;  1LI0 A;  3HLW A;  1PRQ A;  4S2K A;  2JKR I;  1NYY A;  3H7W B;  1KDS A;  3EGX C;  2ZQD A;  5EM1 A;  2WKH A;  1L0E A;  2D02 A;  3VMA A;  2B5R A;  2WAF A;  3MKF A;  4OPZ A;  3VSK A;  1IYO A;  1T1C A;  2EX6 A;  5GHX A;  1FQG A;  4R70 A;  1H8M A;  3WS5 A;  4KUK A;  3CUE A;  4JKT A;  4OPQ A;  4CLC E;  4L0L A;  1ERO A;  2W3G A;  4DXB A;  3IF6 B;  4GHI B;  1YLP A;  3TOI A;  3LEZ A;  1CJF A;  3NEC A;  3IF6 A;  3TSG A;  3ZNT A;  4BBV A;  4E6X A;  1OTB A;  3CLO A;  4K08 A;  3S7O A;  3IBR A;  3N8L A;  4Y0U A;  5LBR A;  4E3N A;  1G28 A;  2Y59 A;  4XT2 B;  4MNR A;  4PHT A;  1N9B A;  2BLS A;  3LID A;  3C4P A;  1XFN A;  3DTI A;  2XSS A;  4X56 A;  5EPH A;  4S2O A;  4DE3 A;  4UA9 A;  5GLB A;  1JWV A;  3SS4 A;  3IS2 A;  1M6K A;  1ESU A;  3IX3 A;  2V1A A;  3OPP A;  1VEU A;  4GNU A;  4F94 A;  1J3W A;  5CGX A;  2XLN A;  3LR5 A;  3VP4 A;  3ZCZ A;  4FTX A;  2XFS A;  3P98 A;  5DJU A;  1VET B;  1PI4 A;  3ISG A;  1GSX A;  1TDG A;  1LSX A;  4E3J A;  1XX2 A;  4GZB A;  5AQA A;  2QKP A;  4HIA A;  3G4P A;  5HFO A;  1W8Q A;  1MWT A;  4YIN A;  3ZGA B;  5MC7 A;  1D7E A;  4LRZ E;  5L8M A;  3KSG A;  2VV7 A;  4BWI A;  2WGW B;  2J3T C;  1TVF A;  3CPT A;  3UB5 P;  3ZG0 A;  4N9K A;  3O3V A;  4HJ6 A;  2K31 A;  3TW8 A;  4JGQ A;  2Z2L B;  4PM6 A;  3LO7 A;  1ZG6 A;  4WEL A;  3BFF A;  2VZW A;  3V3S A;  1L0D A;  4OON A;  1O07 A;  4PPR A;  3MXQ A;  1SKF A;  1MWR A;  3A3D A;  5FAP A;  3UE3 A;  3A3F A;  4N1H A;  5L09 A;  3RXW A;  2XRN A;  1SZV A;  2EX2 A;  1VEU B;  3OCN A;  2HDQ A;  5K5B A;  3VFH A;  3D4F A;  5KSH A;  2PRF A;  3QNC A;  3AGE A;  4JLF A;  2ZMF A;  4GLQ A;  4HP4 A;  1BSG A;  3LY3 A;  2V9A A;  5CHM A;  4RVA A;  3GV9 A;  2VGL S;  3VP0 A;  4DDY A;  3MKE A;  2W3H A;  4E3I A;  5FEF A;  4S2M A;  1YLW A;  3A3I A;  3W4P A;  4CLC D;  3ZG5 A;  3DAV A;  2IWD A;  4WL9 A;  3HLD A;  1L2S A;  2ZMV A;  2PR6 A;  5AQB A;  1WYC A;  1BLC A;  4HNB A;  4K0W A;  4EES A;  3S7N A;  3SH8 A;  2VGK A;  1YKD A;  3WS1 A;  4DDS A;  5FDH A;  2MJ6 A;  5C5K A;  2JN7 A;  5AVE A;  2YKH A;  1PW8 A;  1NYM A;  3TRC A;  1K4F A;  4GHI A;  5HAP A;  2IWC A;  4KZ5 A;  3NUL A;  2WUQ A;  1JNU A;  4CLC B;  2WYX A;  2G7U A;  5CHU A;  3M6H A;  2PR5 A;  3ZDJ A;  1G68 A;  1NJ4 A;  4QB8 A;  1DY6 A;  3GTC A;  5DTT A;  1G6O A;  4LRY C;  4S2I A;  3ZNY A;  4QJG A;  2KOI A;  1OT9 A;  3M2J A;  1ONH A;  5F1F A;  1W7F A;  4CLC C;  4IVI A;  5FSR A;  1ES4 A;  3MSH A;  1IOU A;  3S4X A;  4JGP A;  1CF0 A;  4NXB A;  1CEG A;  3DWK A;  1CI9 A;  3BY8 A;  4WZ5 A;  4ZRR A;  4QWO A;  4BJP A;  4K91 A;  1K56 D;  1MWU A;  3E4P A;  1OJ5 A;  3IHB A;  3E4O A;  5F68 A;  2C5W B;  1HLU P;  1TEM A;  3NOP C;  5KSC A;  5L10 A;  3DWZ A;  3VFF A;  1MBL A;  4EWF A;  1I2W A;  1W8Y A;  2EFX A;  5DF8 A;  1KE0 A;  3DW0 A;  2HP5 A;  5HWW A;  2KX6 A;  4BBT A;  3SH9 A;  5G4Y A;  3KYZ A;  3PAE A;  3SS3 A;  3ZQ5 A;  1IKG A;  2ZQ7 A;  4F3L B;  5EOO A;  1YMX A;  3HLB A;  4KZ7 A;  3T4L A;  4C75 A;  1K57 A;  5L2F A;  2WAD A;  4U3T A;  4M3K A;  5TBM A;  4NET A;  2Y2G A;  3IXG A;  4B4Z A;  4B88 A;  1DJB A;  2JKT M;  4KG5 A;  2FFY A;  2FZ0 A;  1S67 L;  1HD8 A;  5FAO A;  5CED A;  1L3L A;  1K6R A;  1S4S A;  3NBL A;  4HI4 A;  3T4T A;  1PFL A;  3D9Y A;  4JXS A;  1ZKJ A;  3NHQ A;  4IBR A;  1DP8 A;  3NI9 A;  3QP2 A;  4BBU A;  4BLM A;  1EW0 A;  3BJN A;  3HLC A;  3LYX A;  2R9X A;  1DJC A;  2Y2K A;  4ME4 A;  4EBP A;  4MN7 A;  4C6Y A;  2JKT I;  3N6I A;  5TGF A;  4R4S A;  3NOU C;  3MQO A;  4EEP A;  5EFW A;  4WEK A;  5DTK A;  5F5Y A;  4ETX A;  3MFD A;  4HJ4 A;  1OTA A;  4EBN A;  3K3D A;  2QJ5 A;  1D1J A;  3LR3 A;  4I39 A;  3MZF A;  4EQI A;  1S0W A;  2PD8 A;  5EV0 A;  4EER A;  1A0K A;  3ZVT A;  3EQU A;  3ZFZ A;  3WRT A;  5EE8 A;  2HP9 A;  3ZHH A;  1VQQ A;  1HVB A;  3TJZ C;  4KEN B;  4EET B;  4HQA A;  5EEC A;  5FQI A;  3Q7V A;  2LB9 A;  1BZA A;  2PU2 A;  3OPR A;  4NK3 A;  4N9L A;  1MC0 A;  3H82 B;  3IT9 A;  4P87 A;  1ONG A;  5TFQ A;  4HHD A;  2XH9 A;  2QYB A;  1NRJ A;  1TS8 A;  2VX8 A;  4GD6 A;  3CIT A;  5A8B A;  4E04 A;  4LV0 A;  1ES3 A;  1PW1 A;  1KVL A;  3IH9 A;  1YM1 A;  3V5M A;  1YSQ A;  4YNR A;  4LV3 A;  5HPF A;  4DF6 A;  4PM7 A;  3MQQ A;  4UEY A;  2UV0 E;  4RYE A;  2CC1 A;  3V67 A;  2P7J A;  3C5A A;  5M18 A;  4WF0 A;  5KZH A;  4OOM A;  5DVA A;  4Y7P A;  3H82 A;  4IBX A;  4OQI A;  5FA7 A;  1IFQ A;  3GRJ A;  4Q0J A;  1XXM A;  4FD8 A;  3GSG A;  2WAE A;  2Z2M B;  1UWN X;  3LFV A;  4E3K A;  5HW3 A;  5D3O A;  2D01 A;  2ZL1 A;  2OOL A;  4MN5 A;  1V9Y A;  3AGF A;  1KGE A;  5J8X A;  2ACG A;  4GW9 A;  1LSW A;  4H6J B;  3C4O A;  1W5D A;  1GSV A;  1W63 Q;  3JPU A;  1IYP A;  1H3Q A;  5F1G A;  1VET A;  4R3J A;  1F5M A;  3AGD A;  4DMZ A;  3MZE A;  1BT5 A;  1FCM A;  2ZM0 A;  3CI6 A;  3N8R A;  4PKY A;  4N1X A;  3NY4 A;  3PBQ A;  2E8I A;  2W3D A;  1RGY A;  4DRT A;  3MR0 A;  5HDC A;  4ZDX A;  2W0N A;  2H10 A;  1IEM A;  1XGJ A;  4NXE A;  1ESI A;  3N4I A;  4I3J A;  3LIC A;  4FSF A;  3A0R A;  1KGF A;  1OTI A;  3R7W A;  2A2L A;  1P9W A;  2Y2N A;  4Y0T A;  3S7Q A;  2XRO A;  1K57 C;  4WN5 A;  4GS9 B;  3T1X A;  3PBS A;  1LL9 A;  1VM1 A;  3OBF A;  1PIO A;  3FV7 A;  5JYO A;  4NEE D;  3MZD A;  4MMN A;  2Y4A A;  4KZA A;  4R3A A;  3Q82 A;  1N4O A;  4E6W A;  1BYW A;  4LFU A;  5IU1 A;  1XJ6 A;  1K0K A;  2ZC6 B;  4XXR A;  3T1Q B;  3QP4 A;  4PM5 A;  1OTE A;  1W63 M;  3IX4 A;  3FC7 A;  5HAQ A;  3BFG A;  2OLU A;  2GX5 A;  1FIK A;  2V1B A;  4S2N A;  2HDS A;  5JYP A;  2QWS A;  2XGN A;  3PYP A;  4MN6 A;  1DP6 A;  1TF1 A;  2WZX A;  3Q81 A;  2X01 A;  3BRM A;  2XDM A;  3D3O A;  1N9L A;  3PBN A;  2HZ5 A;  4U0X A;  1M40 A;  3U2A A;  1K56 A;  1PI5 A;  3V39 A;  3WS0 A;  3F1P A;  3LR4 A;  1H8Z A;  1PWC A;  1BLS A;  3G32 A;  3P01 A;  3BQ8 A;  4Y13 A;  4LV2 A;  2VA0 A;  3W4Q A;  4KG2 A;  4OPY A;  2R78 A;  4DJ3 A;  1AXB A;  2WGV A;  4QY5 A;  3UE0 A;  1YQS A;  3MJQ A;  4H8R A;  4LCL A;  2X71 A;  2ZC4 B;  1F98 A;  3Q1F A;  3UME A;  3HCY A;  3E2L A;  2YKF A;  4G3K A;  2EXA A;  3C30 A;  4O8G A;  3IX8 A;  3VOL A;  3RTY A;  3FPW A;  1RGZ A;  2L4R A;  3GR2 A;  4Y5F A;  5EVI D;  4HY8 A;  2C6W B;  2PYR A;  4R38 A;  2VJW A;  1ACF A;  3NJA A;  2PYP A;  3UDI A;  4EBL A;  4L9F A;  4YWZ A;  2A49 A;  5CGS A;  2RCX A;  2VK3 A;  3FG8 A;  2IA2 A;  5M1A A;  2XF3 A;  5EVI B;  3ZVW A;  3KO6 A;  1YSP A;  5IT5 A;  2ZL1 B;  5HD5 A;  3C2W A;  5FAQ A;  3UPN A;  3S22 A;  5CER A;  4YOF A;  2H0Y A;  2EFU A;  3NDE A;  4YFM A;  2J80 A;  4MEZ A;  4X53 A;  4XUX A;  5E2H A;  1MKM A;  3D72 A;  4GOG A;  4DE2 A;  4NXG A;  5F6A A;  5FDS A;  1LT0 A;  2VEA A;  3LR0 A;  2INW A;  1TS6 A;  3O87 A;  2HGV A;  1PWD A;  2H28 A;  1Q2P A;  3N8S A;  4PKY G;  4DE0 A;  1YMS A;  2JKG A;  4S2J A;  4P6B A;  4JBF A;  1OT6 A;  4KZ4 A;  1J9M A;  1XP4 A;  2ZLY A;  3CUE C;  4JXG A;  3KX0 X;  3CPT B;  3IWI A;  1FIL A;  3F1N B;  5AVF A;  3UB8 A;  2Y2I A;  5HD3 A;  2WKI A;  5GHY A;  3BEC A;  5FQM A;  2CMN A;  4CQH A;  3LCE A;  4RX3 A;  2JKF A;  2HF6 A;  2L0W A;  1S1Z A;  4M4X A;  1OJG A;  1P9R A;  3JVU A;  5AQ7 A;  3LIF A;  3SZT A;  4GD8 A;  2OAP 1;  1Z6F A;  5EVI C;  2ZM8 A;  4EEU A;  1TD5 A;  1SDE A;  2QHK A;  3GDI A;  2NUT C;  5GHZ A;  3L7H A;  1BLP A;  4U0T A;  1YLJ A;  4E3M A;  3DBA A;  3BWL A;  5CTM A;  3F1P B;  2JC7 A;  4JXW A;  2A24 B;  2P9V A;  5TJJ A;  4WLA A;  5TR7 A;  5HDD A;  3W8K A;  3EEA A;  1H5X A;  3I7J A;  3KSH A;  1XJ2 A;  1E25 A;  3CMZ A;  1XJ4 A;  2HDR A;  4IUK A;  2WKE A;  3IXB A;  3A0V A;  2XA7 M;  4ID4 A;  5DF7 A;  1YAX A;  3C7U A;  2P04 A;  1G6A A;  3T12 B;  2ZOI A;  1KGG A;  4R23 A;  5HZH A;  2HV1 A;  3UMD A;  2W1R A;  1H8Y A;  3FYZ A;  3T1R A;  2J9O A;  3CHW P;  3VOZ A;  2XA7 S;  3T4O A;  2ZQ8 A;  5I94 A;  3B3X A;  4XUZ A;  3S7P A;  4I5S A;  5F69 A;  4R6L A;  3L9K A;  3KYQ A;  4OPR A;  3IF5 A;  4EXO A;  2M1C A;  3FZC A;  4P6Z S;  1RP5 A;  4GJ4 A;  1NXY A;  3VP1 A;  3G2Y A;  2QZ6 A;  3W2Z A;  2M7U A;  1ZG4 A;  5BOH A;  3IXD A;  3V50 A;  3C38 A;  4PAU A;  2W1T A;  1LLB A;  1FR1 A;  4UA6 A;  2UWX A;  3EGD C;  1WE4 A;  1S66 L;  3T4J A;  2GZA A;  5FL3 A;  4KQO A;  1PZP A;  2HJE A;  3M6B A;  5DKL A;  1LSV A;  1GSW A;  4RX2 A;  3QP1 A;  4F3L A;  4JXV A;  4P6Z M;  4QHC A;  4EUZ A;  3QP6 A;  3LY4 A;  4CJN A;  5HAR A;  4IVK A;  3HBR A;  5CX7 A;  5AQ9 A;  3PTE A;  4RQ9 A;  4HJ3 A;  3LI9 A;  2V0W A;  3LUQ A;  1XKZ A;  4S2P A;  1TDL A;  4EW7 A;  1GCE A;  2WKR A;  4L9G A;  1P97 A;  1C3B A;  3NDG A;  2EWW A;  2V8F A;  1IYS A;  2BAS A;  2VKS A;  1H0M A;  1SCW A;  1FOF A;  4OVD A;  4I3A A;  1Y4O A;  2J8Y A;  3HLG A;  2ZC5 B;  4D60 A;  1VHM A;  4L9E A;  5FAT A;  1P0Z A;  4FOF A;  2WGW A;  4KZ9 A;  3BQA A;  2ZC7 A;  2OLV A;  1MKI A;  2Y2L A;  4OLG A;  4IUH A;  4ZBE A;  3ZG9 B;  2OV5 A;  4FUW A;  3EOI A;  4JF6 A;  1ODV A;  1ERQ A;  1JWZ A;  1MZU A;  2OWH A;  1L0G A;  2Y2O A;  3O88 A;  3ZG8 B;  3SS5 A;  1GA9 A;  2PU4 A;  4K0X A;  5IHV A;  4BL3 A;  1KE4 A;  3LI8 A;  3UE6 A;  4X25 A;  5M19 A;  1YPR A;  4E3L A;  4Y3I A;  3R7W B;  3CZD A;  1EI5 A;  1QMF A;  4B9O A;  1YLT A;  4Q0I A;  2Z6C A;  1KOU A;  3DTM A;  5AJG A;  2XQZ A;  4DKI A;  1K6S A;  3T4S A;  3GMW A;  3HVF A;  3LIE A;  3UE1 A;  4ZJ3 A;  3MXR A;  3BEB A;  3UPO A;  4OP8 A;  1K38 A;  1OPX A;  2XR0 A;  3CG5 A;  4GN2 A;  1PYY A;  1FCO A;  2I9V A;  5HWT A;  2H0T A;  3NOT C;  3IHA A;  3GEC A;  3FPV A;  1ES2 A;  2J9P A;  3HJI A;  5A92 A;  4B4X A;  4BL2 A;  4C3Q A;  5HL1 A;  3E4Q A;  4Y17 A;  1ALQ A;  4S2N C;  1DJA A;  3BYD A;  3BLM A;  1NZU A;  2O0Y A;  1I5Q A;  3OCL A;  3A0S A;  3OPL A;  1ERM A;  5CEB A;  3T4Q A;  1WYB A;  2VGJ A;  4B93 A;  2VV8 A;  4IJG A;  2W27 A;  5EOE A;  1TS0 A;  4Y2F A;  4UQI M;  4CPK A;  5KMW A; 
#chains in the Genus database with same CATH homology
 4MLL A;  2Y2P A;  2ZQ9 A;  3TG9 A;  3Q7Z A;  2A49 A;  1CEG A;  5CGS A;  2RCX A;  1MY8 A;  1XPB A;  3DWK A;  1CI9 A;  4BD0 A;  5M1A A;  2EXB A;  2XF3 A;  3JYI A;  5EVI B;  3BLS A;  4WZ4 A;  1K4E A;  2QMI A;  5E2F A;  4WZ5 A;  2RL3 A;  3QHY A;  2J7V A;  3BM6 A;  4HBU A;  3ZG7 B;  4BJP A;  4K91 A;  1K56 D;  2G2W A;  1MWU A;  3EQV A;  4WMC A;  4R3B A;  2A3U A;  4Q8I A;  2JBF A;  3IHB A;  4OQ0 A;  5CEC A;  5FAQ A;  2HPB A;  3IH8 A;  3UPN A;  3S22 A;  5CER A;  2H0Y A;  2EFU A;  4P0M A;  2C5W B;  3NDE A;  4YFM A;  1TEM A;  1JWP A;  4MEZ A;  4X53 A;  4XUX A;  5E2H A;  5FI7 A;  3VOY A;  4X69 A;  4ZJ1 A;  5KSC A;  4KQR A;  4GOG A;  5EVL A;  4DE2 A;  1PWG A;  1K55 C;  1K25 A;  3IXH A;  4GKU A;  3DWZ A;  4PM8 A;  5E2G A;  3VFF A;  3SOI A;  1MBL A;  1U60 A;  4E3O A;  3O87 A;  3HL9 A;  1PWD A;  4EWF A;  5HX9 A;  3HUN A;  1I2W A;  1YLY A;  1W8Y A;  2Y55 A;  2EFX A;  1Q2P A;  5DF8 A;  3RXX A;  1KE0 A;  1YT4 A;  3N8S A;  3DW0 A;  2HP5 A;  4DE0 A;  5EVI A;  1NZO A;  4OP5 A;  4KZ8 A;  1YMS A;  2XEP A;  3UNW A;  4OOL A;  2HDU A;  2Y91 A;  4GDN A;  3PAG A;  5F82 A;  2QPN A;  4LV1 A;  3SH9 A;  3UPP A;  1HTZ A;  3PAE A;  4S2J A;  5CRF A;  3SS3 A;  1BUE A;  4QD4 A;  2ZM2 A;  4P6B A;  1W79 A;  1IKG A;  2ZQ7 A;  2BG1 A;  3GVB A;  4JBF A;  1IKI A;  3NC8 A;  3G35 A;  5EOO A;  1YMX A;  3HLB A;  4KZ7 A;  5FI2 A;  4C75 A;  4KZ4 A;  1J9M A;  1K57 A;  5L2F A;  3P09 A;  1JTG A;  1XP4 A;  2WAD A;  4U3T A;  4D2O A;  4M3K A;  2ZLY A;  4WM9 A;  5F83 A;  2Y2M A;  3BFC A;  3FKW A;  4JXG A;  4NET A;  2Y2G A;  4PMA A;  3IXG A;  4B4Z A;  4MBH A;  4B88 A;  3IWI A;  2HP6 A;  2ZC3 B;  4FH2 A;  1DJB A;  1RCJ A;  2Y2I A;  2WKI A;  1GHM A;  5GHY A;  3HLE A;  4MBF A;  3W4O A;  3BEC A;  4OKP A;  5FQM A;  1BUL A;  3LCE A;  1ES5 A;  4KG5 A;  4RX3 A;  2FFY A;  2XK1 A;  3Q7V B;  3Q07 A;  1SHV A;  3UO9 A;  1HD8 A;  5FAO A;  1FCN A;  4X6T A;  5CED A;  3IQA A;  4FH4 A;  3MBZ A;  5DTS A;  4ZAM A;  5A91 A;  1MXO A;  1K6R A;  3NBL A;  4EV4 A;  5AQ7 A;  4PM9 A;  3HRE A;  4JXS A;  1ZKJ A;  3HUM A;  1NRF A;  4GD8 A;  3S1Y A;  2DNS A;  4IBR A;  2V20 A;  4UHU A;  3RJU A;  1Z6F A;  5EVI C;  3V3R A;  2ZM8 A;  3NI9 A;  1PZO A;  1SDE A;  1XA1 A;  2X02 A;  4Z9Q A;  5GHZ A;  3IF6 C;  4BLM A;  1BLP A;  1LI9 A;  4FCF A;  4U0T A;  1YLJ A;  4KZB A;  3HLC A;  1FR6 A;  3ITA A;  4KZ6 A;  4E3M A;  2R9X A;  1DJC A;  3CJM A;  2Y2K A;  4EBP A;  3G31 A;  3BFD A;  3UN7 A;  1XA7 A;  5CTM A;  1XGI A;  1KE3 A;  2JC7 A;  4C6Y A;  4JXW A;  4DE1 A;  3N6I A;  1I2S A;  4QY6 A;  5TGF A;  2P9V A;  4R4S A;  4GDB A;  1FSW A;  1YLZ A;  1FSY A;  3G34 A;  5TR7 A;  3VP2 A;  3FWL A;  4WEK A;  2ZQC A;  3W8K A;  5DTK A;  3WWX A;  1LI0 A;  1H5X A;  3I7J A;  3HLW A;  1E25 A;  2V1Z A;  3CMZ A;  3MFD A;  4S2K A;  2HDR A;  4EBN A;  3ITB A;  2JCH A;  2WKE A;  1NYY A;  3IXB A;  4X55 A;  1KDS A;  4OQG A;  3GQZ A;  2ZQD A;  1E4D A;  2WKH A;  2R9W A;  4ID4 A;  3MZF A;  4EQI A;  1S0W A;  5DF7 A;  1L0E A;  5FQJ A;  3VMA A;  3C7U A;  2H5S A;  2IWB A;  1G6A A;  2B5R A;  2EX8 A;  1KGG A;  4R23 A;  2WAF A;  4R0Q A;  3MKF A;  3A3J A;  4Y0O A;  4RA7 A;  4OPZ A;  3VSK A;  1IYO A;  2EX6 A;  3ZVT A;  1ZC2 A;  1FQG A;  1HZO A;  2XD1 A;  4X68 A;  5GHX A;  1H8Y A;  3EQU A;  3FYZ A;  4HEF A;  3WS5 A;  2J9O A;  3WRT A;  3ZFZ A;  4JKT A;  4OPQ A;  5EE8 A;  2HP9 A;  4L0L A;  3VOZ A;  3ZHH A;  1ERO A;  1VQQ A;  1HVB A;  4DXB A;  4KEN B;  3IF6 B;  1GHI A;  5EEC A;  5FQI A;  3Q7V A;  2ZQ8 A;  1YLP A;  3TOI A;  5I94 A;  2PU2 A;  1BZA A;  3B3X A;  3LEZ A;  3OPR A;  4NK3 A;  4N9L A;  4XUZ A;  3IF6 A;  3IWO A;  3TSG A;  3IT9 A;  4P87 A;  3ZNT A;  4WMC D;  1ONG A;  4BD1 A;  2Y2J A;  5TFQ A;  2XH9 A;  4E6X A;  1O7E A;  4OH0 A;  3M2K A;  4OPR A;  1EWZ A;  2P74 A;  4GD6 A;  4KQQ A;  2ZJ9 A;  3IF5 A;  3N8L A;  1IYQ A;  4Y0U A;  4OLD A;  1E3U A;  3FZC A;  4LV0 A;  4E3N A;  1ES3 A;  1PW1 A;  1RP5 A;  1KVL A;  1NXY A;  3IH9 A;  3G30 A;  1YM1 A;  2Y59 A;  3G2Y A;  3VP1 A;  3V5M A;  4MNR A;  3QNB A;  1E3U D;  2QZ6 A;  4LV3 A;  3VSL A;  4DF6 A;  4PM7 A;  1N9B A;  3HUO A;  4HES A;  2BLS A;  1ZG4 A;  3C4P A;  2WZZ A;  2ZMA A;  5BOH A;  1MWS A;  3IXD A;  4OQH A;  4RYE A;  2CC1 A;  3V50 A;  4X56 A;  3C5A A;  5EPH A;  3PBT A;  4DXC A;  5M18 A;  2GDN A;  1LLB A;  5KZH A;  4OOM A;  4S2O A;  5DVA A;  4WZ5 C;  3OPH A;  4Y7P A;  4DE3 A;  1FR1 A;  4IBX A;  4UA6 A;  4OQI A;  4UA9 A;  5EUA A;  1QME A;  3OC2 A;  4A5R A;  2UWX A;  5FA7 A;  1WE4 A;  4ZJ2 A;  3GRJ A;  1XXM A;  2Q9N A;  3G2Z A;  4FD8 A;  5GLB A;  3GSG A;  1JWV A;  2WAE A;  2Z2M B;  3SS4 A;  2Y2H A;  2EX9 A;  1M6K A;  4KQO A;  1PZP A;  1ESU A;  5U47 A;  3WRZ A;  3M6B A;  3MXS A;  4E3K A;  5HW3 A;  5GLA A;  5D3O A;  1K55 A;  4RX2 A;  3OPP A;  2FFF B;  5FQK A;  4JXV A;  4GNU A;  4KG6 A;  4F94 A;  5CGX A;  3AGF A;  1KGE A;  5J8X A;  4QHC A;  4EUZ A;  3C4O A;  1W5D A;  2XLN A;  3LY4 A;  2I72 A;  3VP4 A;  3ZCZ A;  4CJN A;  4IVK A;  5HAR A;  2XFS A;  1IYP A;  3HBR A;  5F1G A;  3SH7 A;  2JE5 A;  5AQ9 A;  3P98 A;  3PTE A;  1OME A;  1PI4 A;  3ISG A;  3PBR A;  4R3J A;  1XKZ A;  1S6R A;  4S2P A;  1TDG A;  2ZQA A;  4E3J A;  3AGD A;  1KVM A;  1TDL A;  1GCE A;  3MZE A;  1XX2 A;  3IWQ A;  4GZB A;  1BT5 A;  2ZM0 A;  1FCM A;  2WGI A;  5AQA A;  1C3B A;  2WK0 A;  3FKV A;  3N8R A;  4WBG A;  3NDG A;  2V2F F;  3G4P A;  4N1X A;  3NY4 A;  5HFO A;  1W8Q A;  2Y2Q A;  1IYS A;  3PBQ A;  2E8I A;  1MWT A;  4HBT A;  1RGY A;  4IED A;  4BQM A;  1SCW A;  1FOF A;  4YIN A;  3ZGA B;  4DRT A;  4OVD A;  4ZDX A;  3NIA A;  2H10 A;  4P85 A;  3PBO A;  2J8Y A;  3HLG A;  2PBY A;  2ZC5 B;  1IEM A;  1XGJ A;  2WGW B;  1ESI A;  3N4I A;  5FAT A;  4FSF A;  2WGW A;  1KGF A;  1LHY A;  1TVF A;  4KZ9 A;  4LCM A;  4GB7 A;  5GLD A;  5E2E A;  3ZG0 A;  2ZC7 A;  4N9K A;  5FQ9 A;  1MPL A;  1BTL A;  3O3V A;  4UA7 A;  3WS4 A;  1K54 A;  2OLV A;  2Z2L B;  5A93 A;  2Y2N A;  4Y0T A;  4PM6 A;  3LO7 A;  1ZG6 A;  4WEL A;  1K57 C;  1MKI A;  2Y2L A;  3ZVW A;  3BFE A;  2P9V B;  4OLG A;  3BFF A;  3PBS A;  3V3S A;  1L0D A;  1LL9 A;  1VM1 A;  4OON A;  1O07 A;  1Q2Q A;  4PPR A;  1PIO A;  4ZBE A;  1SKF A;  5E43 A;  3FV7 A;  2OV5 A;  3ZG9 B;  5JYO A;  1KDW A;  4JF6 A;  5G18 A;  1MWR A;  1ERQ A;  1JWZ A;  3A3D A;  5FAP A;  3UE3 A;  3A3F A;  3MZD A;  4N1H A;  5GLC A;  3RXW A;  2Y4A A;  4KZA A;  2Y2O A;  3O88 A;  3Q82 A;  2EX2 A;  1L0G A;  3ZG8 B;  1N4O A;  2G2U A;  3SS5 A;  4E6W A;  5FAS A;  1GA9 A;  1JTD A;  2PU4 A;  4K0X A;  3OCN A;  4UAA A;  5IHV A;  3OZH A;  3UDF A;  4BL3 A;  4OOY A;  1KE4 A;  2HDQ A;  3VFH A;  2ZC6 B;  3D4F A;  5KSH A;  4XXR A;  3QNC A;  3AGE A;  4JLF A;  2OSU A;  4PM5 A;  5HAI A;  5M19 A;  4E3L A;  1CK3 A;  1BSG A;  3LY3 A;  3CZD A;  5HAQ A;  1EI5 A;  3BFG A;  1QMF A;  5CHM A;  4RVA A;  3GV9 A;  2OLU A;  3VP0 A;  4DDY A;  1GA0 A;  1YLT A;  3MKE A;  4S2N A;  2HDS A;  4E3I A;  5JYP A;  5CHJ A;  5DF9 A;  3N7W A;  4N92 A;  3DTM A;  4S2M A;  1Y54 A;  2XGN A;  1YLW A;  3A3I A;  4ZTK A;  3W4P A;  2XQZ A;  5CGW A;  3NCK A;  3ZG5 A;  4BEN A;  4DKI A;  1K6S A;  1JVJ A;  2WZX A;  3GMW A;  3E2K A;  2IWD A;  1CI8 A;  3Q81 A;  3HLD A;  3HVF A;  1L2S A;  4JF5 A;  2X01 A;  1K54 C;  3BRM A;  3UE1 A;  2XDM A;  5AQB A;  4ZJ3 A;  1WYC A;  1BLC A;  2ZD8 A;  3BEB A;  3MXR A;  4K0W A;  3UPO A;  4MBK A;  4OP8 A;  3UY6 A;  3PBN A;  1K38 A;  5GL9 A;  3SH8 A;  2VGK A;  1IEL A;  2XR0 A;  2Q9M A;  4U0X A;  3WS1 A;  1M40 A;  4JPM A;  1K56 A;  1PI5 A;  3CG5 A;  4GN2 A;  1SDN A;  4WYY A;  5FDH A;  3V39 A;  3WS0 A;  1L0F A;  4DDS A;  1PYY A;  1H8Z A;  1FCO A;  4KZ3 A;  3UDX A;  1PWC A;  1PW8 A;  1BLS A;  4LEN A;  1NYM A;  2H0T A;  3G32 A;  1K4F A;  4R4R A;  4LV2 A;  3IHA A;  5HAP A;  2IWC A;  4KZ5 A;  3W4Q A;  4KG2 A;  4OPY A;  2WUQ A;  1BLH A;  4R1G A;  1AXB A;  2WGV A;  2XFT A;  4QY5 A;  3VP3 A;  3UE0 A;  1YQS A;  1ES2 A;  2WYX A;  4H8R A;  5CHU A;  3M6H A;  4LCL A;  5CTN A;  2X71 A;  2J9P A;  2ZC4 B;  3ZDJ A;  3HLF A;  3Q1F A;  5A92 A;  1G68 A;  1NJ4 A;  4QB8 A;  4B4X A;  1LL5 A;  4BL2 A;  4C3Q A;  5HL1 A;  1ALQ A;  4S2N C;  1DY6 A;  4JF4 A;  3E2L A;  1DJA A;  3BYD A;  3GTC A;  3BLM A;  4O7D A;  1NZU A;  2DRW A;  3A3E A;  5DTT A;  2EXA A;  2DCF A;  4S2L A;  1NY0 A;  4WEJ A;  1I5Q A;  3OCL A;  1CEF A;  4S2I A;  3ZNY A;  4QJG A;  5FQQ A;  3OPL A;  3WS2 A;  1ERM A;  5CEB A;  5CXW A;  2XD5 A;  1RGZ A;  3GR2 A;  1WYB A;  2VGJ A;  1GHP A;  5EVI D;  4QU3 A;  2C6W B;  5FI6 A;  3O86 A;  3M2J A;  1ONH A;  5F1F A;  5EOE A;  1W7F A;  3C7V A;  4IVI A;  5A90 A;  4CPK A;  5KMW A;  5FSR A;  1ES4 A;  3S4X A;  3UDI A;  4EBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...