4FCFA

K234r: apo structure of inhibitor resistant beta-lactamase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADRTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
publication title Design and exploration of novel boronic acid inhibitors reveals important interactions with a clavulanic acid-resistant sulfhydryl-variable (SHV) beta-lactamase.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase/hydrolase inhibitor
total genus 99
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4fcfA00
5E2HA 3G32A 5CEBA 5CGWA 3PBSA 4GNUA 3PBOA 3MZDA 4XUZA 4F94A 2WAFA 4MBHA 3PBRA 4KZBA 2G2UA 4K91A 5FI7A 1CK3A 4OQGA 4R3BA 3LY4A 4LV0A 3NI9A 2EX8A 4NETA 1TDLA 4X69A 1BUEA 3S1YA 3SOIA 4KQQA 4YFMA 2JBFA 3HUNA 2XGNA 3PBNA 4WZ5C 1I2WA 4HESA 1Q2QA 5FQJA 4BENA 4BQMA 5DTTA 3NIAA 1N4OA 3WS4A 5U47A 4EBPA 1K55A 5FATA 1TDGA 3V3RA 2A3UA 5EVLA 3VFHA 1ERMA 3C5AA 1YQSA 4N1XA 5CHUA 1YLPA 3VP0A 1PW8A 4OOMA 3UY6A 2XD1A 2Y55A 1ES2A 3OPHA 3OZHA 3Q7VA 1NYMA 5HARA 1LL9A 2Q9MA 4X68A 1PW1A 3Q07A 3IXBA 3HUMA 1EROA 1JTDA 2JE5A 1HTZA 1BLPA 4WEKA 1FSYA 3FWLA 1CEGA 3I7JA 4OPQA 1S6RA 1YLZA 4R1GA 3V50A 2QPNA 4KZ5A 4Y0TA 3UE0A 1L0GA 3S22A 3W4OA 5GLDA 5GLBA 4IBRA 2V2FF 4PM8A 4A5RA 3UE1A 3MBZA 5F83A 2V1ZA 1LHYA 3HREA 4N9LA 4R23A 4OP8A 5CGXA 4KG6A 1O07A 2P9VB 3BFEA 1CI8A 2ZQ7A 1MWRA 5GLAA 1L0DA 3HL9A 3IXGA 3A3FA 4UHUA 1IEMA 1ESIA 3ZNTA 5HAQA 5EECA 4BJPA 3ZG0A 4E6XA 3IH9A 1TEMA 4OVDA 3QHYA 4B4XA 4DF6A 3N7WA 5DF8A 1CI9A 1H5XA 4OPZA 5FDHA 4XUXA 4OLGA 3SH7A 4E3LA 1K6RA 1FCMA 3O3VA 4QY6A 5CGSA 2ZM0A 3E2LA 3ZG9B 1MWTA 3N8SA 5HX9A 1RP5A 4HBUA 3UN7A 2BG1A 2WGWA 3IF5A 1K25A 2Y59A 3PAEA 2VGKA 3E2KA 2ZQDA 1MXOA 4MLLA 3IHBA 3BM6A 4N92A 1BTLA 1K38A 1RCJA 3MKEA 1YLYA 4LV2A 3VSLA 3PBTA 4E3KA 5KMWA 1SCWA 3BRMA 4BL2A 1M40A 3V5MA 4FCFA 2EX2A 3HLDA 1K4FA 4CJNA 2WKIA 3ITAA 4OONA 4MBFA 1ZG6A 4EBNA 4JBFA 2Y2IA 2XR0A 1GCEA 3GR2A 1DJAA 1XGJA 4FH2A 3WS1A 2HDQA 5EVIA 1WE4A 2Y2LA 3CG5A 5FSRA 5AQ9A 4P85A 3SS3A 1BLHA 5EVID 2XF3A 4LCMA 2XFSA 2FFFB 2EXBA 3HLEA 1XA1A 1AXBA 3UPNA 4S2NC 2X02A 5EE8A 4RX3A 1KGFA 4ZJ2A 1E4DA 1G68A 3PTEA 2H5SA 5JYOA 2EX9A 4PM5A 5EOEA 2Q9NA 3OPLA 1DY6A 3UPPA 2XDMA 4OOLA 4WZ5A 3P98A 4KZ8A 4DRTA 3Q81A 5A93A 4R3JA 5E2EA 1XP4A 3G4PA 3M6HA 4MBKA 3PAGA 4JXVA 4S2PA 1YT4A 3UDXA 3OPRA 5AQBA 4ZTKA 1KDWA 5FAPA 1IYSA 5GL9A 3VP2A 2H0YA 1SKFA 2P74A 1DJCA 1MPLA 1CEFA 2EFXA 4R0QA 2Y2KA 5M1AA 5TR7A 5DTKA 4IVKA 4H8RA 3S4XA 3IF6B 3ZCZA 5A92A 5FI2A 1HZOA 3VSKA 4CPKA 2R9XA 2OV5A 1L2SA 2ZQAA 1NJ4A 2EX6A 2HPBA 4GD6A 1SDEA 4R4SA 4Y0UA 4ZJ1A 5TGFA 4BLMA 1I5QA 4L0LA 1YMSA 2WZXA 2C6WB 2ZLYA 2ZQCA 3V3SA 2Y2PA 2WZZA 5DF7A 1KVMA 1GHPA 2ZMAA 5AQAA 5FQKA 3BECA 1JWVA 1PYYA 1BZAA 4DE3A 1VQQA 2HP9A 1ERQA 2X01A 4X53A 1NY0A 1H8YA 1MY8A 3AGDA 4S2IA 4JLFA 4GDNA 3MZFA 2Z2LB 4U3TA 4JXGA 5J8XA 4N1HA 4GD8A 5FQMA 3G2YA 4U0TA 3RJUA 1ONGA 1EI5A 1XX2A 4WM9A 1W79A 1ZC2A 3GVBA 1JWZA 3Q7ZA 5HAIA 3GSGA 3M2JA 3C7VA 3EQVA 4HBTA 3TG9A 4P0MA 4GOGA 3IWOA 1N9BA 4N9KA 1K56A 3C4OA 1ES5A 5CERA 1BLSA 3HLBA 3MZEA 1PWGA 4B88A 3EQUA 1FR6A 5IHVA 3IF6C 5DVAA 3RXXA 4RYEA 1K56D 4PMAA 3BEBA 1KVLA 4FSFA 4E3JA 3GMWA 3BFGA 2PU4A 5JYPA 3AGEA 2Y2QA 1K54C 3DWZA 2ZC6B 3HLGA 4ZDXA 4S2OA 5M18A 3BYDA 3ITBA 4O7DA 4KZ4A 2WKHA 3WS2A 4KQRA 4LENA 2H0TA 4PM6A 3MKFA 4U0XA 1YMXA 3GQZA 3IXHA 3WS5A 2P9VA 3LY3A 3SS4A 4X56A 3C4PA 3W8KA 1K6SA 2RCXA 1U60A 5I94A 4OOYA 5EUAA 1GHIA 1K57C 2ZC5B 1Y54A 2ZQ8A 5DTSA 2Y2JA 4OQ0A 1FCNA 1S0WA 1GA9A 1GHMA 2JC7A 1EWZA 1PI4A 3UDFA 5HAPA 4QD4A 3VP3A 5GHYA 2UWXA 4Z9QA 3M2KA 4R4RA 2ZM2A 2XQZA 1ES3A 2QMIA 5GLCA 1W5DA 3SH8A 2PBYA 3UDIA 4S2NA 3ZNYA 3B3XA 4E3MA 3LCEA 1JTGA 4EQIA 3ZG8B 5CECA 4WBGA 4YINA 4GKUA 1Z6FA 3ZDJA 4KG5A 2WYXA 3HVFA 4WMCA 5E2FA 4QHCA 3VP1A 4JF5A 4RVAA 3SS5A 4DE0A 2PU2A 4OP5A 4WMCD 5FQQA 2A49A 3G2ZA 1ALQA 4M3KA 5G18A 1IYQA 4Y0OA 5CTNA 4HEFA 1ES4A 3FV7A 4RX2A 5KSHA 2OSUA 5F1GA 3NC8A 4DE2A 3HLFA 1ZKJA 2Y2GA 1JWPA 3UE3A 4JXSA 4E3OA 1QMEA 4ID4A 1LL5A 4MEZA 4NK3A 2H10A 2QZ6A 1VM1A 1YLTA 4EV4A 2OLUA 5GHZA 3VOZA 4OH0A 5CXWA 5CTMA 4P87A 2IWBA 1JVJA 1FQGA 4PPRA 3IWQA 4DDSA 1BULA 3IT9A 4LV3A 4EWFA 1O7EA 2B5RA 2HDSA 1HD8A 1TVFA 2HDUA 2ZC7A 3A3EA 3AGFA 5A91A 3TOIA 2XD5A 2J9PA 3CZDA 1KDSA 1IELA 4FD8A 3SH9A 5M19A 2CC1A 4C3QA 4QB8A 3OCLA 3A3IA 3GRJA 5FAQA 2ZC4B 4JF6A 5FI6A 4QU3A 4ZBEA 5FQ9A 1LI9A 1NYYA 4KQOA 5FA7A 4JPMA 2WGVA 4WEJA 2WGIA 3NCKA 5KZHA 5KSCA 3WRTA 2WK0A 2Z2MB 3IQAA 1IKIA 1XXMA 4GDBA 3FKWA 5BOHA 1IYOA 4S2KA 5FAOA 4XXRA 4DE1A 2HP6A 2GDNA 1RGZA 1PI5A 1KE3A 1Q2PA 3LO7A 1ZG4A 4RA7A 1RGYA 4DKIA 1MWUA 3G31A 1KGEA 1ONHA 1YM1A 5E2GA 3WWXA 3ZG7B 4IVIA 1SHVA 3IF6A 5HFOA 4KZ6A 4DXCA 2BLSA 1PWDA 3P09A 4WELA 2XLNA 4UA7A 4JKTA 1PIOA 4QY5A 2Y2MA 1K54A 4S2MA 2JCHA 3CJMA 3G30A 4KZAA 3Q7VB 2IWCA 3GV9A 1W8QA 2R9WA 2Y2HA 3ZGAB 3LEZA 1BLCA 3WS0A 1PWCA 2Y4AA 4WZ4A 3O88A 2FFYA 3D4FA 3NDGA 3QNCA 3RXWA 3ZFZA 4JF4A 3IXDA 4P6BA 3FYZA 5HW3A 1K57A 2ZJ9A 3HUOA 3WRZA 3FZCA 2VGJA 3NBLA 4DDYA 3MFDA 1BT5A 1DJBA 1MKIA 3BLMA 4GN2A 4C6YA 5EOOA 1FCOA 1I2SA 2WKEA 4JXWA 1XPBA 3VFFA 2Y2NA 3ISGA 4LV1A 1FR1A 1XKZA 3NDEA 3NY4A 3MXRA 1YLWA 3MXSA 3OPPA 1HVBA 2XEPA 3IHAA 4E3NA 3PBQA 2EXAA 2HP5A 4BL3A 3G35A 3O87A 3W4QA 2X71A 1E3UA 1W7FA 4MNRA 3A3JA 5AQ7A 1K55C 2J8YA 4X55A 1KGGA 2G2WA 1C3BA 2WUQA 1KE0A 1MBLA 1H8ZA 1E3UD 1NZUA 3BLSA 5FASA 5F82A 5E43A 1WYBA 2DRWA 4PM9A 3HLCA 5CRFA 4ZAMA 4UA9A 2E8IA 1GA0A 1PZOA 2WGWB 4KZ9A 4C75A 3DWKA 1FOFA 5CHJA 1BSGA 1IYPA 3HBRA 2WAEA 3N8LA 3N8RA 4X6TA 1W8YA 2V20A 4BD1A 5HL1A 4PM7A 1IKGA 3BFCA 4KG2A 4OLDA 4OPRA 3ZVWA 2DNSA 3N4IA 4Q8IA 3W4PA 1LI0A 1WYCA 3UNWA 1FSWA 2IWDA 5CEDA 3Q82A 2DCFA 2OLVA 5TFQA 1G6AA 1L0EA 3VMAA 1NRFA 3BFDA 1K4EA 1MWSA 1J9MA 3CMZA 3M6BA 4K0XA 5CHMA 3UO9A 5EVIB 5L2FA 3N6IA 1XA7A 4EUZA 5GHXA 4IBXA 3GTCA 5D3OA 3TSGA 1YLJA 3O86A 4KZ3A 2J7VA 3V39A 1ESUA 2ZC3B 3IWIA 4EBLA 4OQIA 1KE4A 2XK1A 1LLBA 4QJGA 2RL3A 4S2JA 4ZJ3A 1M6KA 3G34A 1NZOA 4WYYA 5FQIA 3OC2A 3DTMA 1SDNA 3ZG5A 5EPHA 4LCLA 3ZHHA 2ZD8A 3IH8A 3ZVTA 4DXBA 4Y7PA 4E3IA 3VOYA 2ZQ9A 4B4ZA 2I72A 2Y91A 3BFFA 3UPOA 3HLWA 3C7UA 1NXYA 2HDRA 4GB7A 3Q1FA 4GZBA 4S2LA 2ZM8A 1L0FA 3OCNA 4IEDA 3VP4A 1E25A 3QNBA 5A90A 4KZ7A 4OKPA 1XGIA 4K0WA 1QMFA 5DF9A 4D2OA 1OMEA 2EFUA 3DW0A 2XH9A 2WADA 2J9OA 3FKVA 2Y2OA 5F1FA 3JYIA 1PZPA 4UA6A 2C5WB 4OQHA 4OPYA 4FH4A 4KENB 4UAAA 4BD0A 2XFTA 3A3DA 5EVIC 4E6WA
chains in the Genus database with same CATH superfamily
5E2HA 3G32A 5CEBA 2HV1A 1G6OA 4MBHA 2G2UA 1OPXA 5TBMA 1NLYA 2JKFA 3IX4A 4EQ1A 4HH2A 3EGXC 2XGNA 3PBNA 4BENA 1OJ5A 3NOTC 5DTTA 4BWIA 3VFHA 4N1XA 4HJ3A 1PW8A 4OOMA 3UY6A 1ES2A 4WF0A 3PXPA 5HARA 2Q9MA 2O9AA 2JE5A 1FSYA 1CEGA 1KOUA 4KZ5A 3GECA 3UE0A 1L0GA 3W4OA 3BJNA 4IBRA 4PM8A 5F83A 4R23A 1S4SA 5AJGA 1CI8A 4GLQA 3ZG0A 1T19A 3IH9A 4OVDA 4X25A 4PAUA 4ARZB 2PR6A 3S7OA 2ZM0A 3E2LA 1SKOB 2AVXA 5HX9A 2BG1A 4AFIA 2VGKA 3E2KA 1MXOA 3BM6A 3MJQA 4CLCA 1K38A 3IBJA 5EV0A 1SCWA 4CLCD 5FEGA 2BASA 4BL2A 3V5MA 3CHWP 4HI4A 3E4QA 2QWSA 4CJNA 4OONA 1ZG6A 4JBFA 2XR0A 3BY8A 4FH2A 4NXFA 3D3OA 4M4XA 3MFXA 4NEED 1AXBA 2X02A 3F1OB 1KGFA 1UWNX 3RTYA 3PTEA 5JYOA 1ACFA 2EX9A 4LRZE 3OPLA 4IUHA 3Q81A 4LRYC 3M6HA 5F5YA 2VV6A 4MBKA 4Q0HA 4GHIB 2YKFA 3OPRA 1KDWA 2OOLA 5FAPA 4KUKA 5IT5A 2P74A 3LR5A 3EEHA 2B95A 4H8RA 3ZCZA 3H7WB 5FI2A 1HZOA 2OV5A 4Y0UA 2HPBA 5TGFA 3V3SA 2ZQCA 2Y79A 2WZZA 4LPZA 3CWFA 5FQKA 3S7PA 1PYYA 4P6ZS 3LICA 1VQQA 1Y28A 2O99A 2X01A 1F98A 1H8YA 2HGVA 4JLFA 2J3TD 4H6JB 2NUPC 3T4LA 3B42A 4U0TA 3RJUA 1EI5A 1NRJA 4GW9A 3IBRA 1S1YA 4QPRA 3C7VA 4N9KA 2I9VA 3IWOA 1PWGA 5IHVA 5DVAA 3T4OA 3DTIA 4E3JA 2Y2QA 1P0ZA 4BBTA 2W3EA 2VGLS 4S2OA 4KZ4A 2WKHA 4LENA 4WUJA 5L10A 5HWTA 1T1CA 1YMXA 3GQZA 3WS5A 3SS4A 2ZOHA 3LY3A 5I94A 1TS8A 1GA9A 2VK3A 3UDFA 4QD4A 4ARZA 2UWXA 5FL3A 3M2KA 4R4RA 3NOPC 1CF0A 3UDIA 3LFVA 3LR3A 3C30A 4E3MA 1SKOA 2A2LA 2H28A 4GKUA 2PHYA 4JF5A 4DE0A 2A49A 3G2ZA 4GS9B 3F1PB 1IYQA 5EVEA 4HEFA 1ES4A 4DE2A 2Y2GA 3UE3A 4E3OA 3A0VA 3T4JA 1VM1A 1YLTA 1YAXA 3IWQA 1BULA 1TVFA 5A91A 2J9PA 5M19A 1ODVA 3MXQA 5F68A 3A3IA 4O0PA 5FI6A 4ZBEA 4JF6A 5FQ9A 4Y13A 3DAVA 1XJ4A 2EWVA 4WEJA 2Z6CA 3LI8A 4GHIA 5BOHA 1F2KA 1RGZA 1ZG4A 1RGYA 2ZOIA 1YM1A 3WWXA 4DXCA 3H7WA 2BLSA 1PWDA 5HDDA 3L7HA 4UA7A 4S2MA 1K54A 4KZAA 3Q7VB 1Y4OA 2Y2HA 2Y4AA 3D4FA 1FIKA 3FYZA 1K57A 2EWWA 3T1QB 1LSVA 4DDYA 1A0KA 4JGOA 3S7QA 1BT5A 1F9IA 3BLMA 4GN2A 5EOOA 2Y2NA 2WKRA 4H6JA 3D72A 3NY4A 3MXSA 3IHAA 4BL3A 3G35A 5KIZA 3W4QA 1W7FA 1K55C 3QP2A 2J8YA 4X55A 3G6OA 5MC7A 1C3BA 1H8ZA 1NZUA 3BLSA 5CRFA 3LI9A 1GA0A 4C75A 3NOUC 2WAEA 2PRFA 2OWJA 3N8RA 1W8YA 2V20A 5HL1A 1IKGA 2W27A 5C5KA 2DNSA 3N4IA 1LI0A 3UNWA 2Y8HA 1G6AA 2W1TB 1K4EA 3CMZA 5L8MA 3CITA 1XA7A 3TSGA 4KZ3A 4JGQA 2M7VA 2PD7A 3IWIA 3NJAA 4GS9A 3F1PA 1T18A 5HPIA 2XK1A 5DJUA 2RL3A 1M6KA 1NZOA 5FQIA 3IH8A 4DXBA 2XA7M 4Y7PA 4E3IA 2QJ5A 2Y91A 3BFFA 3HLWA 4GB7A 1OTEA 1XJ6A 1L0FA 3VP4A 3QNBA 2PYPA 4OKPA 1XGIA 4K0WA 1QMFA 5DF9A 2EFUA 5F1FA 2Y2OA 4FOFA 2DMWA 4KENB 4UAAA 4NXEA 4BD0A 2XFTA 3A3DA 3KYQA 4E6WA 3TE8A 4F94A 2HF6A 3PBRA 1CK3A 4LV0A 3NI9A 4HIAA 2V1AA 1BUEA 3SOIA 4Y3IA 1DP9A 2ZMVA 5L07A 3V3RA 3C5AA 1YQSA 5F69A 3OPHA 3Q7VA 1LL9A 4X68A 1F5MA 3IXBA 1HTZA 1BLPA 3I7JA 4OPQA 5AVFA 1S6RA 2QPNA 4Y0TA 5GLDA 4A5RA 2V1ZA 3HREA 4OP8A 4HP9A 5HL6A 2ZQ7A 2BTFP 5GLAA 1L0DA 3HL9A 2W0NA 4UHUA 5EECA 4E6XA 1TEMA 5HD5A 1CJFA 3N7WA 1CI9A 1H5XA 1PRQA 4E3LA 1K6RA 3KSFA 1MWTA 1RP5A 3UN7A 1G5UA 3PAEA 2Y59A 2VV8A 4FTXA 2VEAA 4N92A 2PD8A 2L4RA 3CUEA 3VSLA 3PBTA 2M1CA 3S7NA 1M40A 3RFBA 3HLDA 1K4FA 2WKIA 2QYBA 1OT9A 1VETB 2W1TA 3B47A 3GR2A 1DJAA 2HDQA 1OJGA 3SS3A 3ZQ5A 2XF3A 2XFSA 3HLEA 1XA1A 1W63Q 3BW6A 3MF0A 1E4DA 2UV0E 2H5SA 1NLZA 5EOEA 3UPPA 4WZ5A 4DRTA 4E04A 4IHQA 4R3JA 5HDCA 2ZMFA 1XP4A 2WKPA 3G4PA 2CMNA 1IYSA 3VP2A 3HJIA 3LIAA 2HZ5A 2W1RA 1TD5A 5M1AA 3S4XA 5A92A 1SZVA 3VSKA 1XJ2A 2ZQAA 4ZJ1A 4BLMA 1SDEA 2C6WB 1H0MA 2PYRA 1KVMA 1VHMA 2EA9A 2W3DA 1BZAA 2HP9A 1ERQA 4PKYG 3MZFA 4JXGA 4N1HA 5FQMA 3G2YA 4Y5FA 1XX2A 4WM9A 3UMDA 4LLOB 4NXBA 3C8CA 3M2JA 3TG9A 4P0MA 3UB6A 4GOGA 4EUVA 1K56A 3C4OA 1ES5A 1BLSA 3MZEA 4B88A 3EQUA 1FR6A 3IF6C 3P01A 1K56D 4FSFA 5FDSA 3BFGA 2PU4A 5JYPA 2ZC6B 2K2NA 3WS2A 2H0TA 4KQDA 4U0XA 3W8KA 3TW8A 1K6SA 1LT0A 1U60A 2RCXA 3OBFA 3HCYA 1Y54A 5DTSA 2OAQ1 1GHMA 1EWZA 5GHYA 4Z9QA 1ES3A 1W5DA 4S2NA 4I5SA 4YINA 3ZDJA 2WYXA 3HVFA 4WMCA 3VP1A 4YNRA 1T1BA 4RVAA 1GSXA 2JKTM 4WMCD 4UQIM 3FV7A 4RX2A 5F1GA 1AWIA 5HD3A 1JWPA 1LSWA 1VETA 4YWZA 2ZL1B 1LL5A 4I3JA 4IUKA 3KYEA 4EV4A 2OLUA 4Q0JA 4P87A 1FQGA 4DDSA 4I38A 2P04A 2OAP1 3IX3A 2B5RA 2HDSA 1HD8A 2HDUA 3TOIA 4DJ3A 1KDSA 1Z09A 4I3AA 4C3QA 3OCLA 4O01A 3TRCA 1NYYA 4KQOA 5FA7A 2WGVA 3KSHA 3SZTA 4GJ4A 5KSCA 4ZRRA 3FKWA 1IYOA 4XXRA 2HP6A 1Q2PA 3MQQA 4RA7A 4DKIA 1MWUA 1ONHA 2R78A 4KZ6A 3P09A 4WELA 4JKTA 1PIOA 4I3IA 3G30A 3CJMA 3CI6A 3ICYA 3GV9A 3LEZA 1BLCA 3WS0A 1XFQA 1W63M 2V0WA 3RXWA 4JF4A 3WRZA 3MFDA 4K08A 1D1JA 1MKIA 4C6YA 1FCOA 2D01A 2K7SA 4JXWA 1XPBA 3VFFA 3ISGA 1FR1A 1XKZA 3MXRA 3OPPA 3T50A 3MQ0A 3F1NB 3KSIA 4II7A 3O87A 2X71A 1E3UA 3U2AA 2WUQA 1E3UD 2L0WA 4BMWA 1V9YA 1ZHHB 4PM9A 4GCZA 3PYPA 1IFQA 3HBRA 2JKRI 2FZ0A 1YPRA 4BD1A 3RH8B 4Q8IA 5IS1A 5F6AA 2IWDA 5CEDA 3Q82A 5TFQA 5HSQA 1NRFA 2JKTI 3BFDA 2QHKA 4K0XA 3M6BA 5EVIB 4EUZA 1YSQA 4IBXA 2J80A 2J7VA 1YKDA 1ESUA 2GNXA 4L9EA 4OQIA 4S2JA 1SDNA 1H3QA 3A0RA 4LCLA 2ZD8A 4CLCC 2ZL1A 4B4ZA 3F1OA 3C7UA 1NXYA 2ZM8A 3OCNA 1E25A 4KZ7A 3NULA 4KUOA 2PT7A 3FKVA 3DW0A 2XH9A 1OTIA 2J9OA 3JYIA 3K3CA 4OPYA 5CGWA 1VEUB 4HOIA 4GNUA 3MZDA 4XUZA 2JN7A 1CQAA 3CLOA 4K91A 5FI7A 4OQGA 4NETA 1TDLA 4X69A 3S1YA 4YFMA 4BQMA 2B18A 1I2WA 3NIAA 5U47A 5FATA 1TDGA 4Z1WA 3FC7A 1ERMA 3CPTB 3VP0A 5J7EA 1N9NA 2Y55A 4CQHA 3OZHA 1NYMA 1PW1A 3Q07A 1OTDA 3HUMA 3FWLA 4R1GA 3V50A 4NG2A 3S22A 3KX0X 1EW0A 5GLBA 2V2FF 3T1RA 3B33A 1O07A 2P9VB 2HJ9C 4YOFA 3ZNTA 4FUWA 3F1NA 5HAQA 4BJPA 2J3TC 2W3HA 4DF6A 4CLCE 4OPZA 4UEYA 2M7UA 1FCMA 3O3VA 4QY6A 5CGSA 5A8BA 3DTKA 3N8SA 1ZTUA 2ZQDA 1BTLA 1DP6A 1TF1A 4P6ZM 3UE6A 1RCJA 3MKEA 4LV2A 4E3KA 5KMWA 2PAVP 2W3GA 3NECA 3BRMA 4HJ6A 3UB5P 4FCFA 4EEPA 3LYXA 3L9KA 4MBFA 4EBNA 1STZA 5EVIA 1WE4A 5FSRA 3CG5A 3OOVA 5AQ9A 5EVID 4F3LB 2EXBA 2XROA 3PHYA 3UPNA 4RX3A 2VGLM 5CX7A 5EFWA 2Q9NA 2INWA 3P98A 5K5BA 4DJ2A 1S67L 2PBDP 5E2EA 4S2PA 3PAGA 4JXVA 1YT4A 3KSGA 3EEAA 2O9CA 5GL9A 1SKFA 4EW7A 1MPLA 2VLGA 1CEFA 2EFXA 4EU0A 2D02A 3VE3A 3KYZA 1VEUA 4HNBA 2R9XA 2E8JA 1NJ4A 4NXGA 1I5QA 1YMSA 2V9AA 2Y2PA 5DF7A 2ZMAA 3BECA 3UMEA 1G28A 5EM1A 1WA9A 4X53A 1NY0A 2OWHA 4S2IA 2WKQA 2Z2LB 4U3TA 4GD8A 3DTEA 3QP1A 3C2WA 4ESPA 1ONGA 3CPTA 1W79A 3GVBA 3Q7ZA 3JVUA 4HBTA 5G4YA 5CERA 3HLBA 3RXXA 4PMAA 4HH3A 1KVLA 3T4SA 3GMWA 4B9OA 3PR6A 4JGPA 1K54C 3DWZA 5M18A 4O7DA 4KQRA 4PM6A 3MKFA 2P9VA 2L1MA 4X56A 3C4PA 4OOYA 5EUAA 3MSHA 1K57C 2ZQ8A 1S0WA 2JC7A 5HAPA 3VP3A 3VV4A 2QMIA 3SH8A 3LIFA 3B3XA 4EQIA 5CECA 4WBGA 3R4KA 4QHCA 1J3WA 1JNUA 2PU2A 1ALQA 4M3KA 5G18A 4Y0OA 5CTNA 5KSHA 2Z6DA 3HLFA 1ZKJA 1S1ZA 5DKLA 1IOUA 2QKPA 4O8GA 1N9LA 2H10A 1GSWA 1S4RA 4HP4A 3QP5A 3VOZA 5CXWA 1JVJA 4PPRA 3FPWA 3IX8A 2VA0A 3IT9A 4F3LA 4EWFA 2ZC7A 3A3EA 3JPUA 3AGFA 4L9FA 1YSPA 3CZDA 1IELA 3LR4A 4XT2B 3E0YA 3GRJA 1LI9A 4JPMA 3UB7A 4I39A 3NCKA 2W3FA 3EOIA 3WRTA 4R6LA 4GDBA 1IKIA 4S2KA 2GDNA 1KE3A 3UB9A 5E2GA 3ZG7B 4IVIA 5J4EA 3LIDA 2Y2MA 3LEQA 2R9WA 3LIBA 3ZGAB 1BYWA 1PWCA 4WZ4A 3FG8A 3O88A 4B93A 2FFYA 3QNCA 3ZFZA 3IXDA 2ZJ9A 2VGJA 1I2SA 4MN6A 4LV1A 1YLWA 1HVBA 2XEPA 3QP6A 3E4PA 2EXAA 4WLAA 4L9GA 5AQ7A 3A3JA 3E98A 3T12B 1KGGA 2KLIA 1MBLA 4D60A 3O5YA 5F82A 5G4ZA 1P9WA 2JKRM 1X0OA 1WYBA 4ZAMA 4UA9A 3V67A 3IS2B 2WGWB 4KZ9A 3DWKA 1FOFA 4BBUA 5DFXA 1UWPX 4X1LA 2VJWA 2V8FA 4PM7A 3ZVWA 5EM0A 1WYCA 2OLVA 3VMAA 1MWSA 1J9MA 5CHMA 2J3WA 3N6IA 4EETB 5D3OA 4WN5A 1DP8A 1YLJA 3O86A 4EEUA 3V39A 2ZC3B 1LLBA 4QJGA 3DBAA 3G34A 2JKGA 1K0KA 3OC2A 3T1XA 3DTMA 5EPHA 3ZHHA 3CUEC 3VOYA 4LRXC 3UPOA 4G3KA 2HDRA 4GZBA 2QJ7A 3LGOA 2GJ3A 4ME4A 1FILA 3H82B 3LUQA 4HHDA 2HJEA 3EGDC 3KO6A 4MN7A 2IA2A 4FH4A 3MS6A 1TS7A 4XT2A 3PBSA 3PBOA 2WAFA 4KZBA 4LFUA 4R3BA 3LY4A 4HQAA 2EX8A 3QP8A 4EBLA 3JVVA 4KQQA 2JBFA 3HUNA 4WZ5C 5FQJA 4HESA 1Q2QA 4EBPA 1N4OA 3WS4A 1K55A 4R70A 1TS0A 2A3UA 5EVLA 3BY9A 5CHUA 1YLPA 2XD1A 1EROA 1JTDA 2G7UA 3ULFA 4WEKA 1YLZA 1D06A 1N9OA 1XFNA 5DFYA 3UE1A 3MBZA 3MR0A 1LHYA 4N9LA 5CGXA 5HWWA 2NUTC 4KG6A 2XA7S 3BFEA 4IJGA 1MWRA 3IXGA 3A3FA 1IEMA 1ESIA 3CAXA 1VB6A 3QHYA 4B4XA 3LR0A 5DF8A 5FDHA 4XUXA 4OLGA 3SH7A 3VOLA 4Y15A 3ZG9B 4HBUA 3IS2A 3IF5A 2WGWA 1K25A 2O0YA 4MLLA 3IHBA 2O9BA 1YLYA 5LBRA 4MDZA 4QWOA 2ACGA 2EX2A 3C38A 3ITAA 3P7NA 2LB5A 2Y2IA 1GCEA 1XGJA 3WS1A 3LIEA 2Y2LA 1OTBA 4P85A 1BLHA 2GZAA 5FEFA 4LCMA 2FFFB 4S2NC 5EE8A 2ZBBA 4BBVA 4NKPA 4ZJ2A 1G68A 1P9RA 3D9YA 4PM5A 1DY6A 2XDMA 4OOLA 4X1MA 4KZ8A 5A93A 3T4QA 2A24B 4R38A 4ETZA 3UDXA 4MCWA 3H82A 5AQBA 4ZTKA 2H0YA 1DJCA 2P08A 3K3DA 4R0QA 2Y2KA 5TR7A 5DTKA 4G3WA 4IVKA 3IF6B 4WL9A 2GX5A 4CPKA 1L2SA 2EX6A 4GD6A 4R4SA 4L0LA 2WZXA 2ZLYA 1LSXA 1GHPA 5AQAA 1JWVA 4DE3A 1MY8A 3AGDA 4GDNA 5J8XA 3BQ8A 2YKHA 5HDSA 5DKKA 4HY8A 5DJTA 1ZC2A 1JWZA 5HAIA 3K2NA 3GSGA 3EQVA 1MZUA 1N9BA 3BQAA 2KX6A 4R3AA 4RYEA 3BEBA 3AGEA 5AVEA 3HLGA 4ZDXA 3BYDA 3ITBA 5HWVA 2FH5A 3IXHA 1GHIA 2ZC5B 1V9ZA 3U4LP 2Y2JA 4OQ0A 1FCNA 3E4OA 1D7EA 1PI4A 4LGWA 1S66L 2ZM2A 2KDKA 2XQZA 4JGRA 5GLCA 2PBYA 3ZNYA 3LCEA 1JTGA 3ZG8B 3VE4A 1Z6FA 2V0UA 4KG5A 5I5LA 5E2FA 3SS5A 4EERA 4OP5A 1DRMA 5FQQA 4EXOA 2K31A 2OSUA 3NC8A 4JXSA 1QMEA 1UGUA 4ID4A 4MEZA 3W2ZA 4NK3A 2QZ6A 5GHZA 1NWZA 4OH0A 5TJJA 5CTMA 2IWBA 1HLUP 4LV3A 1L3LA 1O7EA 1PNEA 3R7WB 3ZYTA 5J3WA 1OT6A 4RQ9A 1TS6A 2XD5A 4FD8A 3SH9A 2CC1A 4QB8A 3TJZC 5FAQA 2ZC4B 4QU3A 3T1SA 4DN0A 2A24A 2WGIA 2KOIA 3MQOA 5KZHA 5TBMB 2WK0A 2Z2MB 4PKYA 3IQAA 1XXMA 4HJ4A 2VV7A 5FAOA 4DE1A 1PI5A 2XRNA 3LO7A 2B02A 5IU1A 4DMZA 3BWLA 3G31A 1KGEA 1SHVA 3IF6A 5HFOA 2XLNA 3QP4A 4QY5A 2JCHA 2IWCA 4PHTA 1W8QA 5L09A 3OLOA 1GSVA 2MJ6A 3NDGA 5HW3A 4P6BA 2XSSA 3HUOA 4UQIS 3FZCA 3NBLA 4MN5A 1MKMA 1DJBA 2WKEA 3GDIA 3NDEA 2V1BA 2LB9A 4E3NA 3PBQA 1H8MA 2HP5A 4MNRA 3MMHA 2G2WA 1KE0A 4ETXA 2VKSA 5FASA 1P97A 5E43A 3T4KA 2DRWA 3HLCA 2Q0OA 4Y2FA 2E8IA 2VX8A 1PZOA 2PDRA 2VZWA 5CHJA 1BSGA 1IYPA 3T4TA 5HPFA 4CLCB 3N8LA 4X6TA 3BFCA 4KG2A 4OLDA 4OPRA 3W4PA 1OTAA 5HZHA 1FSWA 3SW1A 4G3VA 2DCFA 3H9WA 1LL8A 1L0EA 3FPVA 4MMNA 1T1AA 3NHQA 3UO9A 5L2FA 5GHXA 3GTCA 1MC0A 4Q0IA 3EWKA 1KE4A 2PR5A 4ZJ3A 4WYYA 3ZG5A 3ZVTA 4Y17A 1XJ3A 3A0SA 2ZQ9A 2I72A 3UB8A 3Q1FA 4S2LA 2P7JA 4IEDA 2JHEA 2V8CA 5A90A 1PFLA 4D2OA 4EESA 1OMEA 2WADA 1PZPA 4UA6A 2C5WB 3HJKA 4OQHA 3R7WA 5EVIC
chains in the Genus database with same CATH topology
5E2HA 3G32A 5CEBA 5CGWA 3PBSA 4GNUA 3PBOA 3MZDA 4XUZA 4F94A 2WAFA 4MBHA 3PBRA 4KZBA 2G2UA 4K91A 5FI7A 1CK3A 4OQGA 4R3BA 3LY4A 4LV0A 3NI9A 2EX8A 4NETA 1TDLA 4X69A 1BUEA 3S1YA 3SOIA 4KQQA 4YFMA 2JBFA 3HUNA 2XGNA 3PBNA 4WZ5C 1I2WA 4HESA 1Q2QA 5FQJA 4BENA 4BQMA 5DTTA 3NIAA 1N4OA 3WS4A 5U47A 4EBPA 1K55A 5FATA 1TDGA 3V3RA 2A3UA 5EVLA 3VFHA 1ERMA 3C5AA 1YQSA 4N1XA 5CHUA 1YLPA 3VP0A 1PW8A 4OOMA 3UY6A 2XD1A 2Y55A 1ES2A 3OPHA 3OZHA 3Q7VA 1NYMA 5HARA 1LL9A 2Q9MA 4X68A 1PW1A 3Q07A 3IXBA 3HUMA 1EROA 1JTDA 2JE5A 1HTZA 1BLPA 4WEKA 1FSYA 3FWLA 1CEGA 3I7JA 4OPQA 1S6RA 1YLZA 4R1GA 3V50A 2QPNA 4KZ5A 4Y0TA 3UE0A 1L0GA 3S22A 3W4OA 5GLDA 5GLBA 4IBRA 2V2FF 4PM8A 4A5RA 3UE1A 3MBZA 5F83A 2V1ZA 1LHYA 3HREA 4N9LA 4R23A 4OP8A 5CGXA 4KG6A 1O07A 2P9VB 3BFEA 1CI8A 2ZQ7A 1MWRA 5GLAA 1L0DA 3HL9A 3IXGA 3A3FA 4UHUA 1IEMA 1ESIA 3ZNTA 5HAQA 5EECA 4BJPA 3ZG0A 4E6XA 3IH9A 1TEMA 4OVDA 3QHYA 4B4XA 4DF6A 3N7WA 5DF8A 1CI9A 1H5XA 4OPZA 5FDHA 4XUXA 4OLGA 3SH7A 4E3LA 1K6RA 1FCMA 3O3VA 4QY6A 5CGSA 2ZM0A 3E2LA 3ZG9B 1MWTA 3N8SA 5HX9A 1RP5A 4HBUA 3UN7A 2BG1A 2WGWA 3IF5A 1K25A 2Y59A 3PAEA 2VGKA 3E2KA 2ZQDA 1MXOA 4MLLA 3IHBA 3BM6A 4N92A 1BTLA 1K38A 1RCJA 3MKEA 1YLYA 4LV2A 3VSLA 3PBTA 4E3KA 5KMWA 1SCWA 3BRMA 4BL2A 1M40A 3V5MA 4FCFA 2EX2A 3HLDA 1K4FA 4CJNA 2WKIA 3ITAA 4OONA 4MBFA 1ZG6A 4EBNA 4JBFA 2Y2IA 2XR0A 1GCEA 3GR2A 1DJAA 1XGJA 4FH2A 3WS1A 2HDQA 5EVIA 1WE4A 2Y2LA 3CG5A 5FSRA 5AQ9A 4P85A 3SS3A 1BLHA 5EVID 2XF3A 4LCMA 2XFSA 2FFFB 2EXBA 3HLEA 1XA1A 1AXBA 3UPNA 4S2NC 2X02A 5EE8A 4RX3A 1KGFA 4ZJ2A 1E4DA 1G68A 3PTEA 2H5SA 5JYOA 2EX9A 4PM5A 5EOEA 2Q9NA 3OPLA 1DY6A 3UPPA 2XDMA 4OOLA 4WZ5A 3P98A 4KZ8A 4DRTA 3Q81A 5A93A 4R3JA 5E2EA 1XP4A 3G4PA 3M6HA 4MBKA 3PAGA 4JXVA 4S2PA 1YT4A 3UDXA 3OPRA 5AQBA 4ZTKA 1KDWA 5FAPA 1IYSA 5GL9A 3VP2A 2H0YA 1SKFA 2P74A 1DJCA 1MPLA 1CEFA 2EFXA 4R0QA 2Y2KA 5M1AA 5TR7A 5DTKA 4IVKA 4H8RA 3S4XA 3IF6B 3ZCZA 5A92A 5FI2A 1HZOA 3VSKA 4CPKA 2R9XA 2OV5A 1L2SA 2ZQAA 1NJ4A 2EX6A 2HPBA 4GD6A 1SDEA 4R4SA 4Y0UA 4ZJ1A 5TGFA 4BLMA 1I5QA 4L0LA 1YMSA 2WZXA 2C6WB 2ZLYA 2ZQCA 3V3SA 2Y2PA 2WZZA 5DF7A 1KVMA 1GHPA 2ZMAA 5AQAA 5FQKA 3BECA 1JWVA 1PYYA 1BZAA 4DE3A 1VQQA 2HP9A 1ERQA 2X01A 4X53A 1NY0A 1H8YA 1MY8A 3AGDA 4S2IA 4JLFA 4GDNA 3MZFA 2Z2LB 4U3TA 4JXGA 5J8XA 4N1HA 4GD8A 5FQMA 3G2YA 4U0TA 3RJUA 1ONGA 1EI5A 1XX2A 4WM9A 1W79A 1ZC2A 3GVBA 1JWZA 3Q7ZA 5HAIA 3GSGA 3M2JA 3C7VA 3EQVA 4HBTA 3TG9A 4P0MA 4GOGA 3IWOA 1N9BA 4N9KA 1K56A 3C4OA 1ES5A 5CERA 1BLSA 3HLBA 3MZEA 1PWGA 4B88A 3EQUA 1FR6A 5IHVA 3IF6C 5DVAA 3RXXA 4RYEA 1K56D 4PMAA 3BEBA 1KVLA 4FSFA 4E3JA 3GMWA 3BFGA 2PU4A 5JYPA 3AGEA 2Y2QA 1K54C 3DWZA 2ZC6B 3HLGA 4ZDXA 4S2OA 5M18A 3BYDA 3ITBA 4O7DA 4KZ4A 2WKHA 3WS2A 4KQRA 4LENA 2H0TA 4PM6A 3MKFA 4U0XA 1YMXA 3GQZA 3IXHA 3WS5A 2P9VA 3LY3A 3SS4A 4X56A 3C4PA 3W8KA 1K6SA 2RCXA 1U60A 5I94A 4OOYA 5EUAA 1GHIA 1K57C 2ZC5B 1Y54A 2ZQ8A 5DTSA 2Y2JA 4OQ0A 1FCNA 1S0WA 1GA9A 1GHMA 2JC7A 1EWZA 1PI4A 3UDFA 5HAPA 4QD4A 3VP3A 5GHYA 2UWXA 4Z9QA 3M2KA 4R4RA 2ZM2A 2XQZA 1ES3A 2QMIA 5GLCA 1W5DA 3SH8A 2PBYA 3UDIA 4S2NA 3ZNYA 3B3XA 4E3MA 3LCEA 1JTGA 4EQIA 3ZG8B 5CECA 4WBGA 4YINA 4GKUA 1Z6FA 3ZDJA 4KG5A 2WYXA 3HVFA 4WMCA 5E2FA 4QHCA 3VP1A 4JF5A 4RVAA 3SS5A 4DE0A 2PU2A 4OP5A 4WMCD 5FQQA 2A49A 3G2ZA 1ALQA 4M3KA 5G18A 1IYQA 4Y0OA 5CTNA 4HEFA 1ES4A 3FV7A 4RX2A 5KSHA 2OSUA 5F1GA 3NC8A 4DE2A 3HLFA 1ZKJA 2Y2GA 1JWPA 3UE3A 4JXSA 4E3OA 1QMEA 4ID4A 1LL5A 4MEZA 4NK3A 2H10A 2QZ6A 1VM1A 1YLTA 4EV4A 2OLUA 5GHZA 3VOZA 4OH0A 5CXWA 5CTMA 4P87A 2IWBA 1JVJA 1FQGA 4PPRA 3IWQA 4DDSA 1BULA 3IT9A 4LV3A 4EWFA 1O7EA 2B5RA 2HDSA 1HD8A 1TVFA 2HDUA 2ZC7A 3A3EA 3AGFA 5A91A 3TOIA 2XD5A 2J9PA 3CZDA 1KDSA 1IELA 4FD8A 3SH9A 5M19A 2CC1A 4C3QA 4QB8A 3OCLA 3A3IA 3GRJA 5FAQA 2ZC4B 4JF6A 5FI6A 4QU3A 4ZBEA 5FQ9A 1LI9A 1NYYA 4KQOA 5FA7A 4JPMA 2WGVA 4WEJA 2WGIA 3NCKA 5KZHA 5KSCA 3WRTA 2WK0A 2Z2MB 3IQAA 1IKIA 1XXMA 4GDBA 3FKWA 5BOHA 1IYOA 4S2KA 5FAOA 4XXRA 4DE1A 2HP6A 2GDNA 1RGZA 1PI5A 1KE3A 1Q2PA 3LO7A 1ZG4A 4RA7A 1RGYA 4DKIA 1MWUA 3G31A 1KGEA 1ONHA 1YM1A 5E2GA 3WWXA 3ZG7B 4IVIA 1SHVA 3IF6A 5HFOA 4KZ6A 4DXCA 2BLSA 1PWDA 3P09A 4WELA 2XLNA 4UA7A 4JKTA 1PIOA 4QY5A 2Y2MA 1K54A 4S2MA 2JCHA 3CJMA 3G30A 4KZAA 3Q7VB 2IWCA 3GV9A 1W8QA 2R9WA 2Y2HA 3ZGAB 3LEZA 1BLCA 3WS0A 1PWCA 2Y4AA 4WZ4A 3O88A 2FFYA 3D4FA 3NDGA 3QNCA 3RXWA 3ZFZA 4JF4A 3IXDA 4P6BA 3FYZA 5HW3A 1K57A 2ZJ9A 3HUOA 3WRZA 3FZCA 2VGJA 3NBLA 4DDYA 3MFDA 1BT5A 1DJBA 1MKIA 3BLMA 4GN2A 4C6YA 5EOOA 1FCOA 1I2SA 2WKEA 4JXWA 1XPBA 3VFFA 2Y2NA 3ISGA 4LV1A 1FR1A 1XKZA 3NDEA 3NY4A 3MXRA 1YLWA 3MXSA 3OPPA 1HVBA 2XEPA 3IHAA 4E3NA 3PBQA 2EXAA 2HP5A 4BL3A 3G35A 3O87A 3W4QA 2X71A 1E3UA 1W7FA 4MNRA 3A3JA 5AQ7A 1K55C 2J8YA 4X55A 1KGGA 2G2WA 1C3BA 2WUQA 1KE0A 1MBLA 1H8ZA 1E3UD 1NZUA 3BLSA 5FASA 5F82A 5E43A 1WYBA 2DRWA 4PM9A 3HLCA 5CRFA 4ZAMA 4UA9A 2E8IA 1GA0A 1PZOA 2WGWB 4KZ9A 4C75A 3DWKA 1FOFA 5CHJA 1BSGA 1IYPA 3HBRA 2WAEA 3N8LA 3N8RA 4X6TA 1W8YA 2V20A 4BD1A 5HL1A 4PM7A 1IKGA 3BFCA 4KG2A 4OLDA 4OPRA 3ZVWA 2DNSA 3N4IA 4Q8IA 3W4PA 1LI0A 1WYCA 3UNWA 1FSWA 2IWDA 5CEDA 3Q82A 2DCFA 2OLVA 5TFQA 1G6AA 1L0EA 3VMAA 1NRFA 3BFDA 1K4EA 1MWSA 1J9MA 3CMZA 3M6BA 4K0XA 5CHMA 3UO9A 5EVIB 5L2FA 3N6IA 1XA7A 4EUZA 5GHXA 4IBXA 3GTCA 5D3OA 3TSGA 1YLJA 3O86A 4KZ3A 2J7VA 3V39A 1ESUA 2ZC3B 3IWIA 4EBLA 4OQIA 1KE4A 2XK1A 1LLBA 4QJGA 2RL3A 4S2JA 4ZJ3A 1M6KA 3G34A 1NZOA 4WYYA 5FQIA 3OC2A 3DTMA 1SDNA 3ZG5A 5EPHA 4LCLA 3ZHHA 2ZD8A 3IH8A 3ZVTA 4DXBA 4Y7PA 4E3IA 3VOYA 2ZQ9A 4B4ZA 2I72A 2Y91A 3BFFA 3UPOA 3HLWA 3C7UA 1NXYA 2HDRA 4GB7A 3Q1FA 4GZBA 4S2LA 2ZM8A 1L0FA 3OCNA 4IEDA 3VP4A 1E25A 3QNBA 5A90A 4KZ7A 4OKPA 1XGIA 4K0WA 1QMFA 5DF9A 4D2OA 1OMEA 2EFUA 3DW0A 2XH9A 2WADA 2J9OA 3FKVA 2Y2OA 5F1FA 3JYIA 1PZPA 4UA6A 2C5WB 4OQHA 4OPYA 4FH4A 4KENB 4UAAA 4BD0A 2XFTA 3A3DA 5EVIC 4E6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E2H A;  3G32 A;  5CEB A;  5CGW A;  3PBS A;  4GNU A;  3PBO A;  3MZD A;  4XUZ A;  4F94 A;  2WAF A;  4MBH A;  3PBR A;  4KZB A;  2G2U A;  4K91 A;  5FI7 A;  1CK3 A;  4OQG A;  4R3B A;  3LY4 A;  4LV0 A;  3NI9 A;  2EX8 A;  4NET A;  1TDL A;  4X69 A;  1BUE A;  3S1Y A;  3SOI A;  4KQQ A;  4YFM A;  2JBF A;  3HUN A;  2XGN A;  3PBN A;  4WZ5 C;  1I2W A;  4HES A;  1Q2Q A;  5FQJ A;  4BEN A;  4BQM A;  5DTT A;  3NIA A;  1N4O A;  3WS4 A;  5U47 A;  4EBP A;  1K55 A;  5FAT A;  1TDG A;  3V3R A;  2A3U A;  5EVL A;  3VFH A;  1ERM A;  3C5A A;  1YQS A;  4N1X A;  5CHU A;  1YLP A;  3VP0 A;  1PW8 A;  4OOM A;  3UY6 A;  2XD1 A;  2Y55 A;  1ES2 A;  3OPH A;  3OZH A;  3Q7V A;  1NYM A;  5HAR A;  1LL9 A;  2Q9M A;  4X68 A;  1PW1 A;  3Q07 A;  3IXB A;  3HUM A;  1ERO A;  1JTD A;  2JE5 A;  1HTZ A;  1BLP A;  4WEK A;  1FSY A;  3FWL A;  1CEG A;  3I7J A;  4OPQ A;  1S6R A;  1YLZ A;  4R1G A;  3V50 A;  2QPN A;  4KZ5 A;  4Y0T A;  3UE0 A;  1L0G A;  3S22 A;  3W4O A;  5GLD A;  5GLB A;  4IBR A;  2V2F F;  4PM8 A;  4A5R A;  3UE1 A;  3MBZ A;  5F83 A;  2V1Z A;  1LHY A;  3HRE A;  4N9L A;  4R23 A;  4OP8 A;  5CGX A;  4KG6 A;  1O07 A;  2P9V B;  3BFE A;  1CI8 A;  2ZQ7 A;  1MWR A;  5GLA A;  1L0D A;  3HL9 A;  3IXG A;  3A3F A;  4UHU A;  1IEM A;  1ESI A;  3ZNT A;  5HAQ A;  5EEC A;  4BJP A;  3ZG0 A;  4E6X A;  3IH9 A;  1TEM A;  4OVD A;  3QHY A;  4B4X A;  4DF6 A;  3N7W A;  5DF8 A;  1CI9 A;  1H5X A;  4OPZ A;  5FDH A;  4XUX A;  4OLG A;  3SH7 A;  4E3L A;  1K6R A;  1FCM A;  3O3V A;  4QY6 A;  5CGS A;  2ZM0 A;  3E2L A;  3ZG9 B;  1MWT A;  3N8S A;  5HX9 A;  1RP5 A;  4HBU A;  3UN7 A;  2BG1 A;  2WGW A;  3IF5 A;  1K25 A;  2Y59 A;  3PAE A;  2VGK A;  3E2K A;  2ZQD A;  1MXO A;  4MLL A;  3IHB A;  3BM6 A;  4N92 A;  1BTL A;  1K38 A;  1RCJ A;  3MKE A;  1YLY A;  4LV2 A;  3VSL A;  3PBT A;  4E3K A;  5KMW A;  1SCW A;  3BRM A;  4BL2 A;  1M40 A;  3V5M A;  4FCF A;  2EX2 A;  3HLD A;  1K4F A;  4CJN A;  2WKI A;  3ITA A;  4OON A;  4MBF A;  1ZG6 A;  4EBN A;  4JBF A;  2Y2I A;  2XR0 A;  1GCE A;  3GR2 A;  1DJA A;  1XGJ A;  4FH2 A;  3WS1 A;  2HDQ A;  5EVI A;  1WE4 A;  2Y2L A;  3CG5 A;  5FSR A;  5AQ9 A;  4P85 A;  3SS3 A;  1BLH A;  5EVI D;  2XF3 A;  4LCM A;  2XFS A;  2FFF B;  2EXB A;  3HLE A;  1XA1 A;  1AXB A;  3UPN A;  4S2N C;  2X02 A;  5EE8 A;  4RX3 A;  1KGF A;  4ZJ2 A;  1E4D A;  1G68 A;  3PTE A;  2H5S A;  5JYO A;  2EX9 A;  4PM5 A;  5EOE A;  2Q9N A;  3OPL A;  1DY6 A;  3UPP A;  2XDM A;  4OOL A;  4WZ5 A;  3P98 A;  4KZ8 A;  4DRT A;  3Q81 A;  5A93 A;  4R3J A;  5E2E A;  1XP4 A;  3G4P A;  3M6H A;  4MBK A;  3PAG A;  4JXV A;  4S2P A;  1YT4 A;  3UDX A;  3OPR A;  5AQB A;  4ZTK A;  1KDW A;  5FAP A;  1IYS A;  5GL9 A;  3VP2 A;  2H0Y A;  1SKF A;  2P74 A;  1DJC A;  1MPL A;  1CEF A;  2EFX A;  4R0Q A;  2Y2K A;  5M1A A;  5TR7 A;  5DTK A;  4IVK A;  4H8R A;  3S4X A;  3IF6 B;  3ZCZ A;  5A92 A;  5FI2 A;  1HZO A;  3VSK A;  4CPK A;  2R9X A;  2OV5 A;  1L2S A;  2ZQA A;  1NJ4 A;  2EX6 A;  2HPB A;  4GD6 A;  1SDE A;  4R4S A;  4Y0U A;  4ZJ1 A;  5TGF A;  4BLM A;  1I5Q A;  4L0L A;  1YMS A;  2WZX A;  2C6W B;  2ZLY A;  2ZQC A;  3V3S A;  2Y2P A;  2WZZ A;  5DF7 A;  1KVM A;  1GHP A;  2ZMA A;  5AQA A;  5FQK A;  3BEC A;  1JWV A;  1PYY A;  1BZA A;  4DE3 A;  1VQQ A;  2HP9 A;  1ERQ A;  2X01 A;  4X53 A;  1NY0 A;  1H8Y A;  1MY8 A;  3AGD A;  4S2I A;  4JLF A;  4GDN A;  3MZF A;  2Z2L B;  4U3T A;  4JXG A;  5J8X A;  4N1H A;  4GD8 A;  5FQM A;  3G2Y A;  4U0T A;  3RJU A;  1ONG A;  1EI5 A;  1XX2 A;  4WM9 A;  1W79 A;  1ZC2 A;  3GVB A;  1JWZ A;  3Q7Z A;  5HAI A;  3GSG A;  3M2J A;  3C7V A;  3EQV A;  4HBT A;  3TG9 A;  4P0M A;  4GOG A;  3IWO A;  1N9B A;  4N9K A;  1K56 A;  3C4O A;  1ES5 A;  5CER A;  1BLS A;  3HLB A;  3MZE A;  1PWG A;  4B88 A;  3EQU A;  1FR6 A;  5IHV A;  3IF6 C;  5DVA A;  3RXX A;  4RYE A;  1K56 D;  4PMA A;  3BEB A;  1KVL A;  4FSF A;  4E3J A;  3GMW A;  3BFG A;  2PU4 A;  5JYP A;  3AGE A;  2Y2Q A;  1K54 C;  3DWZ A;  2ZC6 B;  3HLG A;  4ZDX A;  4S2O A;  5M18 A;  3BYD A;  3ITB A;  4O7D A;  4KZ4 A;  2WKH A;  3WS2 A;  4KQR A;  4LEN A;  2H0T A;  4PM6 A;  3MKF A;  4U0X A;  1YMX A;  3GQZ A;  3IXH A;  3WS5 A;  2P9V A;  3LY3 A;  3SS4 A;  4X56 A;  3C4P A;  3W8K A;  1K6S A;  2RCX A;  1U60 A;  5I94 A;  4OOY A;  5EUA A;  1GHI A;  1K57 C;  2ZC5 B;  1Y54 A;  2ZQ8 A;  5DTS A;  2Y2J A;  4OQ0 A;  1FCN A;  1S0W A;  1GA9 A;  1GHM A;  2JC7 A;  1EWZ A;  1PI4 A;  3UDF A;  5HAP A;  4QD4 A;  3VP3 A;  5GHY A;  2UWX A;  4Z9Q A;  3M2K A;  4R4R A;  2ZM2 A;  2XQZ A;  1ES3 A;  2QMI A;  5GLC A;  1W5D A;  3SH8 A;  2PBY A;  3UDI A;  4S2N A;  3ZNY A;  3B3X A;  4E3M A;  3LCE A;  1JTG A;  4EQI A;  3ZG8 B;  5CEC A;  4WBG A;  4YIN A;  4GKU A;  1Z6F A;  3ZDJ A;  4KG5 A;  2WYX A;  3HVF A;  4WMC A;  5E2F A;  4QHC A;  3VP1 A;  4JF5 A;  4RVA A;  3SS5 A;  4DE0 A;  2PU2 A;  4OP5 A;  4WMC D;  5FQQ A;  2A49 A;  3G2Z A;  1ALQ A;  4M3K A;  5G18 A;  1IYQ A;  4Y0O A;  5CTN A;  4HEF A;  1ES4 A;  3FV7 A;  4RX2 A;  5KSH A;  2OSU A;  5F1G A;  3NC8 A;  4DE2 A;  3HLF A;  1ZKJ A;  2Y2G A;  1JWP A;  3UE3 A;  4JXS A;  4E3O A;  1QME A;  4ID4 A;  1LL5 A;  4MEZ A;  4NK3 A;  2H10 A;  2QZ6 A;  1VM1 A;  1YLT A;  4EV4 A;  2OLU A;  5GHZ A;  3VOZ A;  4OH0 A;  5CXW A;  5CTM A;  4P87 A;  2IWB A;  1JVJ A;  1FQG A;  4PPR A;  3IWQ A;  4DDS A;  1BUL A;  3IT9 A;  4LV3 A;  4EWF A;  1O7E A;  2B5R A;  2HDS A;  1HD8 A;  1TVF A;  2HDU A;  2ZC7 A;  3A3E A;  3AGF A;  5A91 A;  3TOI A;  2XD5 A;  2J9P A;  3CZD A;  1KDS A;  1IEL A;  4FD8 A;  3SH9 A;  5M19 A;  2CC1 A;  4C3Q A;  4QB8 A;  3OCL A;  3A3I A;  3GRJ A;  5FAQ A;  2ZC4 B;  4JF6 A;  5FI6 A;  4QU3 A;  4ZBE A;  5FQ9 A;  1LI9 A;  1NYY A;  4KQO A;  5FA7 A;  4JPM A;  2WGV A;  4WEJ A;  2WGI A;  3NCK A;  5KZH A;  5KSC A;  3WRT A;  2WK0 A;  2Z2M B;  3IQA A;  1IKI A;  1XXM A;  4GDB A;  3FKW A;  5BOH A;  1IYO A;  4S2K A;  5FAO A;  4XXR A;  4DE1 A;  2HP6 A;  2GDN A;  1RGZ A;  1PI5 A;  1KE3 A;  1Q2P A;  3LO7 A;  1ZG4 A;  4RA7 A;  1RGY A;  4DKI A;  1MWU A;  3G31 A;  1KGE A;  1ONH A;  1YM1 A;  5E2G A;  3WWX A;  3ZG7 B;  4IVI A;  1SHV A;  3IF6 A;  5HFO A;  4KZ6 A;  4DXC A;  2BLS A;  1PWD A;  3P09 A;  4WEL A;  2XLN A;  4UA7 A;  4JKT A;  1PIO A;  4QY5 A;  2Y2M A;  1K54 A;  4S2M A;  2JCH A;  3CJM A;  3G30 A;  4KZA A;  3Q7V B;  2IWC A;  3GV9 A;  1W8Q A;  2R9W A;  2Y2H A;  3ZGA B;  3LEZ A;  1BLC A;  3WS0 A;  1PWC A;  2Y4A A;  4WZ4 A;  3O88 A;  2FFY A;  3D4F A;  3NDG A;  3QNC A;  3RXW A;  3ZFZ A;  4JF4 A;  3IXD A;  4P6B A;  3FYZ A;  5HW3 A;  1K57 A;  2ZJ9 A;  3HUO A;  3WRZ A;  3FZC A;  2VGJ A;  3NBL A;  4DDY A;  3MFD A;  1BT5 A;  1DJB A;  1MKI A;  3BLM A;  4GN2 A;  4C6Y A;  5EOO A;  1FCO A;  1I2S A;  2WKE A;  4JXW A;  1XPB A;  3VFF A;  2Y2N A;  3ISG A;  4LV1 A;  1FR1 A;  1XKZ A;  3NDE A;  3NY4 A;  3MXR A;  1YLW A;  3MXS A;  3OPP A;  1HVB A;  2XEP A;  3IHA A;  4E3N A;  3PBQ A;  2EXA A;  2HP5 A;  4BL3 A;  3G35 A;  3O87 A;  3W4Q A;  2X71 A;  1E3U A;  1W7F A;  4MNR A;  3A3J A;  5AQ7 A;  1K55 C;  2J8Y A;  4X55 A;  1KGG A;  2G2W A;  1C3B A;  2WUQ A;  1KE0 A;  1MBL A;  1H8Z A;  1E3U D;  1NZU A;  3BLS A;  5FAS A;  5F82 A;  5E43 A;  1WYB A;  2DRW A;  4PM9 A;  3HLC A;  5CRF A;  4ZAM A;  4UA9 A;  2E8I A;  1GA0 A;  1PZO A;  2WGW B;  4KZ9 A;  4C75 A;  3DWK A;  1FOF A;  5CHJ A;  1BSG A;  1IYP A;  3HBR A;  2WAE A;  3N8L A;  3N8R A;  4X6T A;  1W8Y A;  2V20 A;  4BD1 A;  5HL1 A;  4PM7 A;  1IKG A;  3BFC A;  4KG2 A;  4OLD A;  4OPR A;  3ZVW A;  2DNS A;  3N4I A;  4Q8I A;  3W4P A;  1LI0 A;  1WYC A;  3UNW A;  1FSW A;  2IWD A;  5CED A;  3Q82 A;  2DCF A;  2OLV A;  5TFQ A;  1G6A A;  1L0E A;  3VMA A;  1NRF A;  3BFD A;  1K4E A;  1MWS A;  1J9M A;  3CMZ A;  3M6B A;  4K0X A;  5CHM A;  3UO9 A;  5EVI B;  5L2F A;  3N6I A;  1XA7 A;  4EUZ A;  5GHX A;  4IBX A;  3GTC A;  5D3O A;  3TSG A;  1YLJ A;  3O86 A;  4KZ3 A;  2J7V A;  3V39 A;  1ESU A;  2ZC3 B;  3IWI A;  4EBL A;  4OQI A;  1KE4 A;  2XK1 A;  1LLB A;  4QJG A;  2RL3 A;  4S2J A;  4ZJ3 A;  1M6K A;  3G34 A;  1NZO A;  4WYY A;  5FQI A;  3OC2 A;  3DTM A;  1SDN A;  3ZG5 A;  5EPH A;  4LCL A;  3ZHH A;  2ZD8 A;  3IH8 A;  3ZVT A;  4DXB A;  4Y7P A;  4E3I A;  3VOY A;  2ZQ9 A;  4B4Z A;  2I72 A;  2Y91 A;  3BFF A;  3UPO A;  3HLW A;  3C7U A;  1NXY A;  2HDR A;  4GB7 A;  3Q1F A;  4GZB A;  4S2L A;  2ZM8 A;  1L0F A;  3OCN A;  4IED A;  3VP4 A;  1E25 A;  3QNB A;  5A90 A;  4KZ7 A;  4OKP A;  1XGI A;  4K0W A;  1QMF A;  5DF9 A;  4D2O A;  1OME A;  2EFU A;  3DW0 A;  2XH9 A;  2WAD A;  2J9O A;  3FKV A;  2Y2O A;  5F1F A;  3JYI A;  1PZP A;  4UA6 A;  2C5W B;  4OQH A;  4OPY A;  4FH4 A;  4KEN B;  4UAA A;  4BD0 A;  2XFT A;  3A3D A;  5EVI C;  4E6W A; 
#chains in the Genus database with same CATH topology
 5E2H A;  3G32 A;  5CEB A;  2HV1 A;  1G6O A;  4MBH A;  2G2U A;  1OPX A;  5TBM A;  1NLY A;  2JKF A;  3IX4 A;  4EQ1 A;  4HH2 A;  3EGX C;  2XGN A;  3PBN A;  4BEN A;  1OJ5 A;  3NOT C;  5DTT A;  4BWI A;  3VFH A;  4N1X A;  4HJ3 A;  1PW8 A;  4OOM A;  3UY6 A;  1ES2 A;  4WF0 A;  3PXP A;  5HAR A;  2Q9M A;  2O9A A;  2JE5 A;  1FSY A;  1CEG A;  1KOU A;  4KZ5 A;  3GEC A;  3UE0 A;  1L0G A;  3W4O A;  3BJN A;  4IBR A;  4PM8 A;  5F83 A;  4R23 A;  1S4S A;  5AJG A;  1CI8 A;  4GLQ A;  3ZG0 A;  1T19 A;  3IH9 A;  4OVD A;  4X25 A;  4PAU A;  4ARZ B;  2PR6 A;  3S7O A;  2ZM0 A;  3E2L A;  1SKO B;  2AVX A;  5HX9 A;  2BG1 A;  4AFI A;  2VGK A;  3E2K A;  1MXO A;  3BM6 A;  3MJQ A;  4CLC A;  1K38 A;  3IBJ A;  5EV0 A;  1SCW A;  4CLC D;  5FEG A;  2BAS A;  4BL2 A;  3V5M A;  3CHW P;  4HI4 A;  3E4Q A;  2QWS A;  4CJN A;  4OON A;  1ZG6 A;  4JBF A;  2XR0 A;  3BY8 A;  4FH2 A;  4NXF A;  3D3O A;  4M4X A;  3MFX A;  4NEE D;  1AXB A;  2X02 A;  3F1O B;  1KGF A;  1UWN X;  3RTY A;  3PTE A;  5JYO A;  1ACF A;  2EX9 A;  4LRZ E;  3OPL A;  4IUH A;  3Q81 A;  4LRY C;  3M6H A;  5F5Y A;  2VV6 A;  4MBK A;  4Q0H A;  4GHI B;  2YKF A;  3OPR A;  1KDW A;  2OOL A;  5FAP A;  4KUK A;  5IT5 A;  2P74 A;  3LR5 A;  3EEH A;  2B95 A;  4H8R A;  3ZCZ A;  3H7W B;  5FI2 A;  1HZO A;  2OV5 A;  4Y0U A;  2HPB A;  5TGF A;  3V3S A;  2ZQC A;  2Y79 A;  2WZZ A;  4LPZ A;  3CWF A;  5FQK A;  3S7P A;  1PYY A;  4P6Z S;  3LIC A;  1VQQ A;  1Y28 A;  2O99 A;  2X01 A;  1F98 A;  1H8Y A;  2HGV A;  4JLF A;  2J3T D;  4H6J B;  2NUP C;  3T4L A;  3B42 A;  4U0T A;  3RJU A;  1EI5 A;  1NRJ A;  4GW9 A;  3IBR A;  1S1Y A;  4QPR A;  3C7V A;  4N9K A;  2I9V A;  3IWO A;  1PWG A;  5IHV A;  5DVA A;  3T4O A;  3DTI A;  4E3J A;  2Y2Q A;  1P0Z A;  4BBT A;  2W3E A;  2VGL S;  4S2O A;  4KZ4 A;  2WKH A;  4LEN A;  4WUJ A;  5L10 A;  5HWT A;  1T1C A;  1YMX A;  3GQZ A;  3WS5 A;  3SS4 A;  2ZOH A;  3LY3 A;  5I94 A;  1TS8 A;  1GA9 A;  2VK3 A;  3UDF A;  4QD4 A;  4ARZ A;  2UWX A;  5FL3 A;  3M2K A;  4R4R A;  3NOP C;  1CF0 A;  3UDI A;  3LFV A;  3LR3 A;  3C30 A;  4E3M A;  1SKO A;  2A2L A;  2H28 A;  4GKU A;  2PHY A;  4JF5 A;  4DE0 A;  2A49 A;  3G2Z A;  4GS9 B;  3F1P B;  1IYQ A;  5EVE A;  4HEF A;  1ES4 A;  4DE2 A;  2Y2G A;  3UE3 A;  4E3O A;  3A0V A;  3T4J A;  1VM1 A;  1YLT A;  1YAX A;  3IWQ A;  1BUL A;  1TVF A;  5A91 A;  2J9P A;  5M19 A;  1ODV A;  3MXQ A;  5F68 A;  3A3I A;  4O0P A;  5FI6 A;  4ZBE A;  4JF6 A;  5FQ9 A;  4Y13 A;  3DAV A;  1XJ4 A;  2EWV A;  4WEJ A;  2Z6C A;  3LI8 A;  4GHI A;  5BOH A;  1F2K A;  1RGZ A;  1ZG4 A;  1RGY A;  2ZOI A;  1YM1 A;  3WWX A;  4DXC A;  3H7W A;  2BLS A;  1PWD A;  5HDD A;  3L7H A;  4UA7 A;  4S2M A;  1K54 A;  4KZA A;  3Q7V B;  1Y4O A;  2Y2H A;  2Y4A A;  3D4F A;  1FIK A;  3FYZ A;  1K57 A;  2EWW A;  3T1Q B;  1LSV A;  4DDY A;  1A0K A;  4JGO A;  3S7Q A;  1BT5 A;  1F9I A;  3BLM A;  4GN2 A;  5EOO A;  2Y2N A;  2WKR A;  4H6J A;  3D72 A;  3NY4 A;  3MXS A;  3IHA A;  4BL3 A;  3G35 A;  5KIZ A;  3W4Q A;  1W7F A;  1K55 C;  3QP2 A;  2J8Y A;  4X55 A;  3G6O A;  5MC7 A;  1C3B A;  1H8Z A;  1NZU A;  3BLS A;  5CRF A;  3LI9 A;  1GA0 A;  4C75 A;  3NOU C;  2WAE A;  2PRF A;  2OWJ A;  3N8R A;  1W8Y A;  2V20 A;  5HL1 A;  1IKG A;  2W27 A;  5C5K A;  2DNS A;  3N4I A;  1LI0 A;  3UNW A;  2Y8H A;  1G6A A;  2W1T B;  1K4E A;  3CMZ A;  5L8M A;  3CIT A;  1XA7 A;  3TSG A;  4KZ3 A;  4JGQ A;  2M7V A;  2PD7 A;  3IWI A;  3NJA A;  4GS9 A;  3F1P A;  1T18 A;  5HPI A;  2XK1 A;  5DJU A;  2RL3 A;  1M6K A;  1NZO A;  5FQI A;  3IH8 A;  4DXB A;  2XA7 M;  4Y7P A;  4E3I A;  2QJ5 A;  2Y91 A;  3BFF A;  3HLW A;  4GB7 A;  1OTE A;  1XJ6 A;  1L0F A;  3VP4 A;  3QNB A;  2PYP A;  4OKP A;  1XGI A;  4K0W A;  1QMF A;  5DF9 A;  2EFU A;  5F1F A;  2Y2O A;  4FOF A;  2DMW A;  4KEN B;  4UAA A;  4NXE A;  4BD0 A;  2XFT A;  3A3D A;  3KYQ A;  4E6W A;  3TE8 A;  4F94 A;  2HF6 A;  3PBR A;  1CK3 A;  4LV0 A;  3NI9 A;  4HIA A;  2V1A A;  1BUE A;  3SOI A;  4Y3I A;  1DP9 A;  2ZMV A;  5L07 A;  3V3R A;  3C5A A;  1YQS A;  5F69 A;  3OPH A;  3Q7V A;  1LL9 A;  4X68 A;  1F5M A;  3IXB A;  1HTZ A;  1BLP A;  3I7J A;  4OPQ A;  5AVF A;  1S6R A;  2QPN A;  4Y0T A;  5GLD A;  4A5R A;  2V1Z A;  3HRE A;  4OP8 A;  4HP9 A;  5HL6 A;  2ZQ7 A;  2BTF P;  5GLA A;  1L0D A;  3HL9 A;  2W0N A;  4UHU A;  5EEC A;  4E6X A;  1TEM A;  5HD5 A;  1CJF A;  3N7W A;  1CI9 A;  1H5X A;  1PRQ A;  4E3L A;  1K6R A;  3KSF A;  1MWT A;  1RP5 A;  3UN7 A;  1G5U A;  3PAE A;  2Y59 A;  2VV8 A;  4FTX A;  2VEA A;  4N92 A;  2PD8 A;  2L4R A;  3CUE A;  3VSL A;  3PBT A;  2M1C A;  3S7N A;  1M40 A;  3RFB A;  3HLD A;  1K4F A;  2WKI A;  2QYB A;  1OT9 A;  1VET B;  2W1T A;  3B47 A;  3GR2 A;  1DJA A;  2HDQ A;  1OJG A;  3SS3 A;  3ZQ5 A;  2XF3 A;  2XFS A;  3HLE A;  1XA1 A;  1W63 Q;  3BW6 A;  3MF0 A;  1E4D A;  2UV0 E;  2H5S A;  1NLZ A;  5EOE A;  3UPP A;  4WZ5 A;  4DRT A;  4E04 A;  4IHQ A;  4R3J A;  5HDC A;  2ZMF A;  1XP4 A;  2WKP A;  3G4P A;  2CMN A;  1IYS A;  3VP2 A;  3HJI A;  3LIA A;  2HZ5 A;  2W1R A;  1TD5 A;  5M1A A;  3S4X A;  5A92 A;  1SZV A;  3VSK A;  1XJ2 A;  2ZQA A;  4ZJ1 A;  4BLM A;  1SDE A;  2C6W B;  1H0M A;  2PYR A;  1KVM A;  1VHM A;  2EA9 A;  2W3D A;  1BZA A;  2HP9 A;  1ERQ A;  4PKY G;  3MZF A;  4JXG A;  4N1H A;  5FQM A;  3G2Y A;  4Y5F A;  1XX2 A;  4WM9 A;  3UMD A;  4LLO B;  4NXB A;  3C8C A;  3M2J A;  3TG9 A;  4P0M A;  3UB6 A;  4GOG A;  4EUV A;  1K56 A;  3C4O A;  1ES5 A;  1BLS A;  3MZE A;  4B88 A;  3EQU A;  1FR6 A;  3IF6 C;  3P01 A;  1K56 D;  4FSF A;  5FDS A;  3BFG A;  2PU4 A;  5JYP A;  2ZC6 B;  2K2N A;  3WS2 A;  2H0T A;  4KQD A;  4U0X A;  3W8K A;  3TW8 A;  1K6S A;  1LT0 A;  1U60 A;  2RCX A;  3OBF A;  3HCY A;  1Y54 A;  5DTS A;  2OAQ 1;  1GHM A;  1EWZ A;  5GHY A;  4Z9Q A;  1ES3 A;  1W5D A;  4S2N A;  4I5S A;  4YIN A;  3ZDJ A;  2WYX A;  3HVF A;  4WMC A;  3VP1 A;  4YNR A;  1T1B A;  4RVA A;  1GSX A;  2JKT M;  4WMC D;  4UQI M;  3FV7 A;  4RX2 A;  5F1G A;  1AWI A;  5HD3 A;  1JWP A;  1LSW A;  1VET A;  4YWZ A;  2ZL1 B;  1LL5 A;  4I3J A;  4IUK A;  3KYE A;  4EV4 A;  2OLU A;  4Q0J A;  4P87 A;  1FQG A;  4DDS A;  4I38 A;  2P04 A;  2OAP 1;  3IX3 A;  2B5R A;  2HDS A;  1HD8 A;  2HDU A;  3TOI A;  4DJ3 A;  1KDS A;  1Z09 A;  4I3A A;  4C3Q A;  3OCL A;  4O01 A;  3TRC A;  1NYY A;  4KQO A;  5FA7 A;  2WGV A;  3KSH A;  3SZT A;  4GJ4 A;  5KSC A;  4ZRR A;  3FKW A;  1IYO A;  4XXR A;  2HP6 A;  1Q2P A;  3MQQ A;  4RA7 A;  4DKI A;  1MWU A;  1ONH A;  2R78 A;  4KZ6 A;  3P09 A;  4WEL A;  4JKT A;  1PIO A;  4I3I A;  3G30 A;  3CJM A;  3CI6 A;  3ICY A;  3GV9 A;  3LEZ A;  1BLC A;  3WS0 A;  1XFQ A;  1W63 M;  2V0W A;  3RXW A;  4JF4 A;  3WRZ A;  3MFD A;  4K08 A;  1D1J A;  1MKI A;  4C6Y A;  1FCO A;  2D01 A;  2K7S A;  4JXW A;  1XPB A;  3VFF A;  3ISG A;  1FR1 A;  1XKZ A;  3MXR A;  3OPP A;  3T50 A;  3MQ0 A;  3F1N B;  3KSI A;  4II7 A;  3O87 A;  2X71 A;  1E3U A;  3U2A A;  2WUQ A;  1E3U D;  2L0W A;  4BMW A;  1V9Y A;  1ZHH B;  4PM9 A;  4GCZ A;  3PYP A;  1IFQ A;  3HBR A;  2JKR I;  2FZ0 A;  1YPR A;  4BD1 A;  3RH8 B;  4Q8I A;  5IS1 A;  5F6A A;  2IWD A;  5CED A;  3Q82 A;  5TFQ A;  5HSQ A;  1NRF A;  2JKT I;  3BFD A;  2QHK A;  4K0X A;  3M6B A;  5EVI B;  4EUZ A;  1YSQ A;  4IBX A;  2J80 A;  2J7V A;  1YKD A;  1ESU A;  2GNX A;  4L9E A;  4OQI A;  4S2J A;  1SDN A;  1H3Q A;  3A0R A;  4LCL A;  2ZD8 A;  4CLC C;  2ZL1 A;  4B4Z A;  3F1O A;  3C7U A;  1NXY A;  2ZM8 A;  3OCN A;  1E25 A;  4KZ7 A;  3NUL A;  4KUO A;  2PT7 A;  3FKV A;  3DW0 A;  2XH9 A;  1OTI A;  2J9O A;  3JYI A;  3K3C A;  4OPY A;  5CGW A;  1VEU B;  4HOI A;  4GNU A;  3MZD A;  4XUZ A;  2JN7 A;  1CQA A;  3CLO A;  4K91 A;  5FI7 A;  4OQG A;  4NET A;  1TDL A;  4X69 A;  3S1Y A;  4YFM A;  4BQM A;  2B18 A;  1I2W A;  3NIA A;  5U47 A;  5FAT A;  1TDG A;  4Z1W A;  3FC7 A;  1ERM A;  3CPT B;  3VP0 A;  5J7E A;  1N9N A;  2Y55 A;  4CQH A;  3OZH A;  1NYM A;  1PW1 A;  3Q07 A;  1OTD A;  3HUM A;  3FWL A;  4R1G A;  3V50 A;  4NG2 A;  3S22 A;  3KX0 X;  1EW0 A;  5GLB A;  2V2F F;  3T1R A;  3B33 A;  1O07 A;  2P9V B;  2HJ9 C;  4YOF A;  3ZNT A;  4FUW A;  3F1N A;  5HAQ A;  4BJP A;  2J3T C;  2W3H A;  4DF6 A;  4CLC E;  4OPZ A;  4UEY A;  2M7U A;  1FCM A;  3O3V A;  4QY6 A;  5CGS A;  5A8B A;  3DTK A;  3N8S A;  1ZTU A;  2ZQD A;  1BTL A;  1DP6 A;  1TF1 A;  4P6Z M;  3UE6 A;  1RCJ A;  3MKE A;  4LV2 A;  4E3K A;  5KMW A;  2PAV P;  2W3G A;  3NEC A;  3BRM A;  4HJ6 A;  3UB5 P;  4FCF A;  4EEP A;  3LYX A;  3L9K A;  4MBF A;  4EBN A;  1STZ A;  5EVI A;  1WE4 A;  5FSR A;  3CG5 A;  3OOV A;  5AQ9 A;  5EVI D;  4F3L B;  2EXB A;  2XRO A;  3PHY A;  3UPN A;  4RX3 A;  2VGL M;  5CX7 A;  5EFW A;  2Q9N A;  2INW A;  3P98 A;  5K5B A;  4DJ2 A;  1S67 L;  2PBD P;  5E2E A;  4S2P A;  3PAG A;  4JXV A;  1YT4 A;  3KSG A;  3EEA A;  2O9C A;  5GL9 A;  1SKF A;  4EW7 A;  1MPL A;  2VLG A;  1CEF A;  2EFX A;  4EU0 A;  2D02 A;  3VE3 A;  3KYZ A;  1VEU A;  4HNB A;  2R9X A;  2E8J A;  1NJ4 A;  4NXG A;  1I5Q A;  1YMS A;  2V9A A;  2Y2P A;  5DF7 A;  2ZMA A;  3BEC A;  3UME A;  1G28 A;  5EM1 A;  1WA9 A;  4X53 A;  1NY0 A;  2OWH A;  4S2I A;  2WKQ A;  2Z2L B;  4U3T A;  4GD8 A;  3DTE A;  3QP1 A;  3C2W A;  4ESP A;  1ONG A;  3CPT A;  1W79 A;  3GVB A;  3Q7Z A;  3JVU A;  4HBT A;  5G4Y A;  5CER A;  3HLB A;  3RXX A;  4PMA A;  4HH3 A;  1KVL A;  3T4S A;  3GMW A;  4B9O A;  3PR6 A;  4JGP A;  1K54 C;  3DWZ A;  5M18 A;  4O7D A;  4KQR A;  4PM6 A;  3MKF A;  2P9V A;  2L1M A;  4X56 A;  3C4P A;  4OOY A;  5EUA A;  3MSH A;  1K57 C;  2ZQ8 A;  1S0W A;  2JC7 A;  5HAP A;  3VP3 A;  3VV4 A;  2QMI A;  3SH8 A;  3LIF A;  3B3X A;  4EQI A;  5CEC A;  4WBG A;  3R4K A;  4QHC A;  1J3W A;  1JNU A;  2PU2 A;  1ALQ A;  4M3K A;  5G18 A;  4Y0O A;  5CTN A;  5KSH A;  2Z6D A;  3HLF A;  1ZKJ A;  1S1Z A;  5DKL A;  1IOU A;  2QKP A;  4O8G A;  1N9L A;  2H10 A;  1GSW A;  1S4R A;  4HP4 A;  3QP5 A;  3VOZ A;  5CXW A;  1JVJ A;  4PPR A;  3FPW A;  3IX8 A;  2VA0 A;  3IT9 A;  4F3L A;  4EWF A;  2ZC7 A;  3A3E A;  3JPU A;  3AGF A;  4L9F A;  1YSP A;  3CZD A;  1IEL A;  3LR4 A;  4XT2 B;  3E0Y A;  3GRJ A;  1LI9 A;  4JPM A;  3UB7 A;  4I39 A;  3NCK A;  2W3F A;  3EOI A;  3WRT A;  4R6L A;  4GDB A;  1IKI A;  4S2K A;  2GDN A;  1KE3 A;  3UB9 A;  5E2G A;  3ZG7 B;  4IVI A;  5J4E A;  3LID A;  2Y2M A;  3LEQ A;  2R9W A;  3LIB A;  3ZGA B;  1BYW A;  1PWC A;  4WZ4 A;  3FG8 A;  3O88 A;  4B93 A;  2FFY A;  3QNC A;  3ZFZ A;  3IXD A;  2ZJ9 A;  2VGJ A;  1I2S A;  4MN6 A;  4LV1 A;  1YLW A;  1HVB A;  2XEP A;  3QP6 A;  3E4P A;  2EXA A;  4WLA A;  4L9G A;  5AQ7 A;  3A3J A;  3E98 A;  3T12 B;  1KGG A;  2KLI A;  1MBL A;  4D60 A;  3O5Y A;  5F82 A;  5G4Z A;  1P9W A;  2JKR M;  1X0O A;  1WYB A;  4ZAM A;  4UA9 A;  3V67 A;  3IS2 B;  2WGW B;  4KZ9 A;  3DWK A;  1FOF A;  4BBU A;  5DFX A;  1UWP X;  4X1L A;  2VJW A;  2V8F A;  4PM7 A;  3ZVW A;  5EM0 A;  1WYC A;  2OLV A;  3VMA A;  1MWS A;  1J9M A;  5CHM A;  2J3W A;  3N6I A;  4EET B;  5D3O A;  4WN5 A;  1DP8 A;  1YLJ A;  3O86 A;  4EEU A;  3V39 A;  2ZC3 B;  1LLB A;  4QJG A;  3DBA A;  3G34 A;  2JKG A;  1K0K A;  3OC2 A;  3T1X A;  3DTM A;  5EPH A;  3ZHH A;  3CUE C;  3VOY A;  4LRX C;  3UPO A;  4G3K A;  2HDR A;  4GZB A;  2QJ7 A;  3LGO A;  2GJ3 A;  4ME4 A;  1FIL A;  3H82 B;  3LUQ A;  4HHD A;  2HJE A;  3EGD C;  3KO6 A;  4MN7 A;  2IA2 A;  4FH4 A;  3MS6 A;  1TS7 A;  4XT2 A;  3PBS A;  3PBO A;  2WAF A;  4KZB A;  4LFU A;  4R3B A;  3LY4 A;  4HQA A;  2EX8 A;  3QP8 A;  4EBL A;  3JVV A;  4KQQ A;  2JBF A;  3HUN A;  4WZ5 C;  5FQJ A;  4HES A;  1Q2Q A;  4EBP A;  1N4O A;  3WS4 A;  1K55 A;  4R70 A;  1TS0 A;  2A3U A;  5EVL A;  3BY9 A;  5CHU A;  1YLP A;  2XD1 A;  1ERO A;  1JTD A;  2G7U A;  3ULF A;  4WEK A;  1YLZ A;  1D06 A;  1N9O A;  1XFN A;  5DFY A;  3UE1 A;  3MBZ A;  3MR0 A;  1LHY A;  4N9L A;  5CGX A;  5HWW A;  2NUT C;  4KG6 A;  2XA7 S;  3BFE A;  4IJG A;  1MWR A;  3IXG A;  3A3F A;  1IEM A;  1ESI A;  3CAX A;  1VB6 A;  3QHY A;  4B4X A;  3LR0 A;  5DF8 A;  5FDH A;  4XUX A;  4OLG A;  3SH7 A;  3VOL A;  4Y15 A;  3ZG9 B;  4HBU A;  3IS2 A;  3IF5 A;  2WGW A;  1K25 A;  2O0Y A;  4MLL A;  3IHB A;  2O9B A;  1YLY A;  5LBR A;  4MDZ A;  4QWO A;  2ACG A;  2EX2 A;  3C38 A;  3ITA A;  3P7N A;  2LB5 A;  2Y2I A;  1GCE A;  1XGJ A;  3WS1 A;  3LIE A;  2Y2L A;  1OTB A;  4P85 A;  1BLH A;  2GZA A;  5FEF A;  4LCM A;  2FFF B;  4S2N C;  5EE8 A;  2ZBB A;  4BBV A;  4NKP A;  4ZJ2 A;  1G68 A;  1P9R A;  3D9Y A;  4PM5 A;  1DY6 A;  2XDM A;  4OOL A;  4X1M A;  4KZ8 A;  5A93 A;  3T4Q A;  2A24 B;  4R38 A;  4ETZ A;  3UDX A;  4MCW A;  3H82 A;  5AQB A;  4ZTK A;  2H0Y A;  1DJC A;  2P08 A;  3K3D A;  4R0Q A;  2Y2K A;  5TR7 A;  5DTK A;  4G3W A;  4IVK A;  3IF6 B;  4WL9 A;  2GX5 A;  4CPK A;  1L2S A;  2EX6 A;  4GD6 A;  4R4S A;  4L0L A;  2WZX A;  2ZLY A;  1LSX A;  1GHP A;  5AQA A;  1JWV A;  4DE3 A;  1MY8 A;  3AGD A;  4GDN A;  5J8X A;  3BQ8 A;  2YKH A;  5HDS A;  5DKK A;  4HY8 A;  5DJT A;  1ZC2 A;  1JWZ A;  5HAI A;  3K2N A;  3GSG A;  3EQV A;  1MZU A;  1N9B A;  3BQA A;  2KX6 A;  4R3A A;  4RYE A;  3BEB A;  3AGE A;  5AVE A;  3HLG A;  4ZDX A;  3BYD A;  3ITB A;  5HWV A;  2FH5 A;  3IXH A;  1GHI A;  2ZC5 B;  1V9Z A;  3U4L P;  2Y2J A;  4OQ0 A;  1FCN A;  3E4O A;  1D7E A;  1PI4 A;  4LGW A;  1S66 L;  2ZM2 A;  2KDK A;  2XQZ A;  4JGR A;  5GLC A;  2PBY A;  3ZNY A;  3LCE A;  1JTG A;  3ZG8 B;  3VE4 A;  1Z6F A;  2V0U A;  4KG5 A;  5I5L A;  5E2F A;  3SS5 A;  4EER A;  4OP5 A;  1DRM A;  5FQQ A;  4EXO A;  2K31 A;  2OSU A;  3NC8 A;  4JXS A;  1QME A;  1UGU A;  4ID4 A;  4MEZ A;  3W2Z A;  4NK3 A;  2QZ6 A;  5GHZ A;  1NWZ A;  4OH0 A;  5TJJ A;  5CTM A;  2IWB A;  1HLU P;  4LV3 A;  1L3L A;  1O7E A;  1PNE A;  3R7W B;  3ZYT A;  5J3W A;  1OT6 A;  4RQ9 A;  1TS6 A;  2XD5 A;  4FD8 A;  3SH9 A;  2CC1 A;  4QB8 A;  3TJZ C;  5FAQ A;  2ZC4 B;  4QU3 A;  3T1S A;  4DN0 A;  2A24 A;  2WGI A;  2KOI A;  3MQO A;  5KZH A;  5TBM B;  2WK0 A;  2Z2M B;  4PKY A;  3IQA A;  1XXM A;  4HJ4 A;  2VV7 A;  5FAO A;  4DE1 A;  1PI5 A;  2XRN A;  3LO7 A;  2B02 A;  5IU1 A;  4DMZ A;  3BWL A;  3G31 A;  1KGE A;  1SHV A;  3IF6 A;  5HFO A;  2XLN A;  3QP4 A;  4QY5 A;  2JCH A;  2IWC A;  4PHT A;  1W8Q A;  5L09 A;  3OLO A;  1GSV A;  2MJ6 A;  3NDG A;  5HW3 A;  4P6B A;  2XSS A;  3HUO A;  4UQI S;  3FZC A;  3NBL A;  4MN5 A;  1MKM A;  1DJB A;  2WKE A;  3GDI A;  3NDE A;  2V1B A;  2LB9 A;  4E3N A;  3PBQ A;  1H8M A;  2HP5 A;  4MNR A;  3MMH A;  2G2W A;  1KE0 A;  4ETX A;  2VKS A;  5FAS A;  1P97 A;  5E43 A;  3T4K A;  2DRW A;  3HLC A;  2Q0O A;  4Y2F A;  2E8I A;  2VX8 A;  1PZO A;  2PDR A;  2VZW A;  5CHJ A;  1BSG A;  1IYP A;  3T4T A;  5HPF A;  4CLC B;  3N8L A;  4X6T A;  3BFC A;  4KG2 A;  4OLD A;  4OPR A;  3W4P A;  1OTA A;  5HZH A;  1FSW A;  3SW1 A;  4G3V A;  2DCF A;  3H9W A;  1LL8 A;  1L0E A;  3FPV A;  4MMN A;  1T1A A;  3NHQ A;  3UO9 A;  5L2F A;  5GHX A;  3GTC A;  1MC0 A;  4Q0I A;  3EWK A;  1KE4 A;  2PR5 A;  4ZJ3 A;  4WYY A;  3ZG5 A;  3ZVT A;  4Y17 A;  1XJ3 A;  3A0S A;  2ZQ9 A;  2I72 A;  3UB8 A;  3Q1F A;  4S2L A;  2P7J A;  4IED A;  2JHE A;  2V8C A;  5A90 A;  1PFL A;  4D2O A;  4EES A;  1OME A;  2WAD A;  1PZP A;  4UA6 A;  2C5W B;  3HJK A;  4OQH A;  3R7W A;  5EVI C; 
#chains in the Genus database with same CATH homology
 5E2H A;  3G32 A;  5CEB A;  5CGW A;  3PBS A;  4GNU A;  3PBO A;  3MZD A;  4XUZ A;  4F94 A;  2WAF A;  4MBH A;  3PBR A;  4KZB A;  2G2U A;  4K91 A;  5FI7 A;  1CK3 A;  4OQG A;  4R3B A;  3LY4 A;  4LV0 A;  3NI9 A;  2EX8 A;  4NET A;  1TDL A;  4X69 A;  1BUE A;  3S1Y A;  3SOI A;  4KQQ A;  4YFM A;  2JBF A;  3HUN A;  2XGN A;  3PBN A;  4WZ5 C;  1I2W A;  4HES A;  1Q2Q A;  5FQJ A;  4BEN A;  4BQM A;  5DTT A;  3NIA A;  1N4O A;  3WS4 A;  5U47 A;  4EBP A;  1K55 A;  5FAT A;  1TDG A;  3V3R A;  2A3U A;  5EVL A;  3VFH A;  1ERM A;  3C5A A;  1YQS A;  4N1X A;  5CHU A;  1YLP A;  3VP0 A;  1PW8 A;  4OOM A;  3UY6 A;  2XD1 A;  2Y55 A;  1ES2 A;  3OPH A;  3OZH A;  3Q7V A;  1NYM A;  5HAR A;  1LL9 A;  2Q9M A;  4X68 A;  1PW1 A;  3Q07 A;  3IXB A;  3HUM A;  1ERO A;  1JTD A;  2JE5 A;  1HTZ A;  1BLP A;  4WEK A;  1FSY A;  3FWL A;  1CEG A;  3I7J A;  4OPQ A;  1S6R A;  1YLZ A;  4R1G A;  3V50 A;  2QPN A;  4KZ5 A;  4Y0T A;  3UE0 A;  1L0G A;  3S22 A;  3W4O A;  5GLD A;  5GLB A;  4IBR A;  2V2F F;  4PM8 A;  4A5R A;  3UE1 A;  3MBZ A;  5F83 A;  2V1Z A;  1LHY A;  3HRE A;  4N9L A;  4R23 A;  4OP8 A;  5CGX A;  4KG6 A;  1O07 A;  2P9V B;  3BFE A;  1CI8 A;  2ZQ7 A;  1MWR A;  5GLA A;  1L0D A;  3HL9 A;  3IXG A;  3A3F A;  4UHU A;  1IEM A;  1ESI A;  3ZNT A;  5HAQ A;  5EEC A;  4BJP A;  3ZG0 A;  4E6X A;  3IH9 A;  1TEM A;  4OVD A;  3QHY A;  4B4X A;  4DF6 A;  3N7W A;  5DF8 A;  1CI9 A;  1H5X A;  4OPZ A;  5FDH A;  4XUX A;  4OLG A;  3SH7 A;  4E3L A;  1K6R A;  1FCM A;  3O3V A;  4QY6 A;  5CGS A;  2ZM0 A;  3E2L A;  3ZG9 B;  1MWT A;  3N8S A;  5HX9 A;  1RP5 A;  4HBU A;  3UN7 A;  2BG1 A;  2WGW A;  3IF5 A;  1K25 A;  2Y59 A;  3PAE A;  2VGK A;  3E2K A;  2ZQD A;  1MXO A;  4MLL A;  3IHB A;  3BM6 A;  4N92 A;  1BTL A;  1K38 A;  1RCJ A;  3MKE A;  1YLY A;  4LV2 A;  3VSL A;  3PBT A;  4E3K A;  5KMW A;  1SCW A;  3BRM A;  4BL2 A;  1M40 A;  3V5M A;  4FCF A;  2EX2 A;  3HLD A;  1K4F A;  4CJN A;  2WKI A;  3ITA A;  4OON A;  4MBF A;  1ZG6 A;  4EBN A;  4JBF A;  2Y2I A;  2XR0 A;  1GCE A;  3GR2 A;  1DJA A;  1XGJ A;  4FH2 A;  3WS1 A;  2HDQ A;  5EVI A;  1WE4 A;  2Y2L A;  3CG5 A;  5FSR A;  5AQ9 A;  4P85 A;  3SS3 A;  1BLH A;  5EVI D;  2XF3 A;  4LCM A;  2XFS A;  2FFF B;  2EXB A;  3HLE A;  1XA1 A;  1AXB A;  3UPN A;  4S2N C;  2X02 A;  5EE8 A;  4RX3 A;  1KGF A;  4ZJ2 A;  1E4D A;  1G68 A;  3PTE A;  2H5S A;  5JYO A;  2EX9 A;  4PM5 A;  5EOE A;  2Q9N A;  3OPL A;  1DY6 A;  3UPP A;  2XDM A;  4OOL A;  4WZ5 A;  3P98 A;  4KZ8 A;  4DRT A;  3Q81 A;  5A93 A;  4R3J A;  5E2E A;  1XP4 A;  3G4P A;  3M6H A;  4MBK A;  3PAG A;  4JXV A;  4S2P A;  1YT4 A;  3UDX A;  3OPR A;  5AQB A;  4ZTK A;  1KDW A;  5FAP A;  1IYS A;  5GL9 A;  3VP2 A;  2H0Y A;  1SKF A;  2P74 A;  1DJC A;  1MPL A;  1CEF A;  2EFX A;  4R0Q A;  2Y2K A;  5M1A A;  5TR7 A;  5DTK A;  4IVK A;  4H8R A;  3S4X A;  3IF6 B;  3ZCZ A;  5A92 A;  5FI2 A;  1HZO A;  3VSK A;  4CPK A;  2R9X A;  2OV5 A;  1L2S A;  2ZQA A;  1NJ4 A;  2EX6 A;  2HPB A;  4GD6 A;  1SDE A;  4R4S A;  4Y0U A;  4ZJ1 A;  5TGF A;  4BLM A;  1I5Q A;  4L0L A;  1YMS A;  2WZX A;  2C6W B;  2ZLY A;  2ZQC A;  3V3S A;  2Y2P A;  2WZZ A;  5DF7 A;  1KVM A;  1GHP A;  2ZMA A;  5AQA A;  5FQK A;  3BEC A;  1JWV A;  1PYY A;  1BZA A;  4DE3 A;  1VQQ A;  2HP9 A;  1ERQ A;  2X01 A;  4X53 A;  1NY0 A;  1H8Y A;  1MY8 A;  3AGD A;  4S2I A;  4JLF A;  4GDN A;  3MZF A;  2Z2L B;  4U3T A;  4JXG A;  5J8X A;  4N1H A;  4GD8 A;  5FQM A;  3G2Y A;  4U0T A;  3RJU A;  1ONG A;  1EI5 A;  1XX2 A;  4WM9 A;  1W79 A;  1ZC2 A;  3GVB A;  1JWZ A;  3Q7Z A;  5HAI A;  3GSG A;  3M2J A;  3C7V A;  3EQV A;  4HBT A;  3TG9 A;  4P0M A;  4GOG A;  3IWO A;  1N9B A;  4N9K A;  1K56 A;  3C4O A;  1ES5 A;  5CER A;  1BLS A;  3HLB A;  3MZE A;  1PWG A;  4B88 A;  3EQU A;  1FR6 A;  5IHV A;  3IF6 C;  5DVA A;  3RXX A;  4RYE A;  1K56 D;  4PMA A;  3BEB A;  1KVL A;  4FSF A;  4E3J A;  3GMW A;  3BFG A;  2PU4 A;  5JYP A;  3AGE A;  2Y2Q A;  1K54 C;  3DWZ A;  2ZC6 B;  3HLG A;  4ZDX A;  4S2O A;  5M18 A;  3BYD A;  3ITB A;  4O7D A;  4KZ4 A;  2WKH A;  3WS2 A;  4KQR A;  4LEN A;  2H0T A;  4PM6 A;  3MKF A;  4U0X A;  1YMX A;  3GQZ A;  3IXH A;  3WS5 A;  2P9V A;  3LY3 A;  3SS4 A;  4X56 A;  3C4P A;  3W8K A;  1K6S A;  2RCX A;  1U60 A;  5I94 A;  4OOY A;  5EUA A;  1GHI A;  1K57 C;  2ZC5 B;  1Y54 A;  2ZQ8 A;  5DTS A;  2Y2J A;  4OQ0 A;  1FCN A;  1S0W A;  1GA9 A;  1GHM A;  2JC7 A;  1EWZ A;  1PI4 A;  3UDF A;  5HAP A;  4QD4 A;  3VP3 A;  5GHY A;  2UWX A;  4Z9Q A;  3M2K A;  4R4R A;  2ZM2 A;  2XQZ A;  1ES3 A;  2QMI A;  5GLC A;  1W5D A;  3SH8 A;  2PBY A;  3UDI A;  4S2N A;  3ZNY A;  3B3X A;  4E3M A;  3LCE A;  1JTG A;  4EQI A;  3ZG8 B;  5CEC A;  4WBG A;  4YIN A;  4GKU A;  1Z6F A;  3ZDJ A;  4KG5 A;  2WYX A;  3HVF A;  4WMC A;  5E2F A;  4QHC A;  3VP1 A;  4JF5 A;  4RVA A;  3SS5 A;  4DE0 A;  2PU2 A;  4OP5 A;  4WMC D;  5FQQ A;  2A49 A;  3G2Z A;  1ALQ A;  4M3K A;  5G18 A;  1IYQ A;  4Y0O A;  5CTN A;  4HEF A;  1ES4 A;  3FV7 A;  4RX2 A;  5KSH A;  2OSU A;  5F1G A;  3NC8 A;  4DE2 A;  3HLF A;  1ZKJ A;  2Y2G A;  1JWP A;  3UE3 A;  4JXS A;  4E3O A;  1QME A;  4ID4 A;  1LL5 A;  4MEZ A;  4NK3 A;  2H10 A;  2QZ6 A;  1VM1 A;  1YLT A;  4EV4 A;  2OLU A;  5GHZ A;  3VOZ A;  4OH0 A;  5CXW A;  5CTM A;  4P87 A;  2IWB A;  1JVJ A;  1FQG A;  4PPR A;  3IWQ A;  4DDS A;  1BUL A;  3IT9 A;  4LV3 A;  4EWF A;  1O7E A;  2B5R A;  2HDS A;  1HD8 A;  1TVF A;  2HDU A;  2ZC7 A;  3A3E A;  3AGF A;  5A91 A;  3TOI A;  2XD5 A;  2J9P A;  3CZD A;  1KDS A;  1IEL A;  4FD8 A;  3SH9 A;  5M19 A;  2CC1 A;  4C3Q A;  4QB8 A;  3OCL A;  3A3I A;  3GRJ A;  5FAQ A;  2ZC4 B;  4JF6 A;  5FI6 A;  4QU3 A;  4ZBE A;  5FQ9 A;  1LI9 A;  1NYY A;  4KQO A;  5FA7 A;  4JPM A;  2WGV A;  4WEJ A;  2WGI A;  3NCK A;  5KZH A;  5KSC A;  3WRT A;  2WK0 A;  2Z2M B;  3IQA A;  1IKI A;  1XXM A;  4GDB A;  3FKW A;  5BOH A;  1IYO A;  4S2K A;  5FAO A;  4XXR A;  4DE1 A;  2HP6 A;  2GDN A;  1RGZ A;  1PI5 A;  1KE3 A;  1Q2P A;  3LO7 A;  1ZG4 A;  4RA7 A;  1RGY A;  4DKI A;  1MWU A;  3G31 A;  1KGE A;  1ONH A;  1YM1 A;  5E2G A;  3WWX A;  3ZG7 B;  4IVI A;  1SHV A;  3IF6 A;  5HFO A;  4KZ6 A;  4DXC A;  2BLS A;  1PWD A;  3P09 A;  4WEL A;  2XLN A;  4UA7 A;  4JKT A;  1PIO A;  4QY5 A;  2Y2M A;  1K54 A;  4S2M A;  2JCH A;  3CJM A;  3G30 A;  4KZA A;  3Q7V B;  2IWC A;  3GV9 A;  1W8Q A;  2R9W A;  2Y2H A;  3ZGA B;  3LEZ A;  1BLC A;  3WS0 A;  1PWC A;  2Y4A A;  4WZ4 A;  3O88 A;  2FFY A;  3D4F A;  3NDG A;  3QNC A;  3RXW A;  3ZFZ A;  4JF4 A;  3IXD A;  4P6B A;  3FYZ A;  5HW3 A;  1K57 A;  2ZJ9 A;  3HUO A;  3WRZ A;  3FZC A;  2VGJ A;  3NBL A;  4DDY A;  3MFD A;  1BT5 A;  1DJB A;  1MKI A;  3BLM A;  4GN2 A;  4C6Y A;  5EOO A;  1FCO A;  1I2S A;  2WKE A;  4JXW A;  1XPB A;  3VFF A;  2Y2N A;  3ISG A;  4LV1 A;  1FR1 A;  1XKZ A;  3NDE A;  3NY4 A;  3MXR A;  1YLW A;  3MXS A;  3OPP A;  1HVB A;  2XEP A;  3IHA A;  4E3N A;  3PBQ A;  2EXA A;  2HP5 A;  4BL3 A;  3G35 A;  3O87 A;  3W4Q A;  2X71 A;  1E3U A;  1W7F A;  4MNR A;  3A3J A;  5AQ7 A;  1K55 C;  2J8Y A;  4X55 A;  1KGG A;  2G2W A;  1C3B A;  2WUQ A;  1KE0 A;  1MBL A;  1H8Z A;  1E3U D;  1NZU A;  3BLS A;  5FAS A;  5F82 A;  5E43 A;  1WYB A;  2DRW A;  4PM9 A;  3HLC A;  5CRF A;  4ZAM A;  4UA9 A;  2E8I A;  1GA0 A;  1PZO A;  2WGW B;  4KZ9 A;  4C75 A;  3DWK A;  1FOF A;  5CHJ A;  1BSG A;  1IYP A;  3HBR A;  2WAE A;  3N8L A;  3N8R A;  4X6T A;  1W8Y A;  2V20 A;  4BD1 A;  5HL1 A;  4PM7 A;  1IKG A;  3BFC A;  4KG2 A;  4OLD A;  4OPR A;  3ZVW A;  2DNS A;  3N4I A;  4Q8I A;  3W4P A;  1LI0 A;  1WYC A;  3UNW A;  1FSW A;  2IWD A;  5CED A;  3Q82 A;  2DCF A;  2OLV A;  5TFQ A;  1G6A A;  1L0E A;  3VMA A;  1NRF A;  3BFD A;  1K4E A;  1MWS A;  1J9M A;  3CMZ A;  3M6B A;  4K0X A;  5CHM A;  3UO9 A;  5EVI B;  5L2F A;  3N6I A;  1XA7 A;  4EUZ A;  5GHX A;  4IBX A;  3GTC A;  5D3O A;  3TSG A;  1YLJ A;  3O86 A;  4KZ3 A;  2J7V A;  3V39 A;  1ESU A;  2ZC3 B;  3IWI A;  4EBL A;  4OQI A;  1KE4 A;  2XK1 A;  1LLB A;  4QJG A;  2RL3 A;  4S2J A;  4ZJ3 A;  1M6K A;  3G34 A;  1NZO A;  4WYY A;  5FQI A;  3OC2 A;  3DTM A;  1SDN A;  3ZG5 A;  5EPH A;  4LCL A;  3ZHH A;  2ZD8 A;  3IH8 A;  3ZVT A;  4DXB A;  4Y7P A;  4E3I A;  3VOY A;  2ZQ9 A;  4B4Z A;  2I72 A;  2Y91 A;  3BFF A;  3UPO A;  3HLW A;  3C7U A;  1NXY A;  2HDR A;  4GB7 A;  3Q1F A;  4GZB A;  4S2L A;  2ZM8 A;  1L0F A;  3OCN A;  4IED A;  3VP4 A;  1E25 A;  3QNB A;  5A90 A;  4KZ7 A;  4OKP A;  1XGI A;  4K0W A;  1QMF A;  5DF9 A;  4D2O A;  1OME A;  2EFU A;  3DW0 A;  2XH9 A;  2WAD A;  2J9O A;  3FKV A;  2Y2O A;  5F1F A;  3JYI A;  1PZP A;  4UA6 A;  2C5W B;  4OQH A;  4OPY A;  4FH4 A;  4KEN B;  4UAA A;  4BD0 A;  2XFT A;  3A3D A;  5EVI C;  4E6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...