4FCFA

K234r: apo structure of inhibitor resistant beta-lactamase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
b'SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADRTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
publication title Design and exploration of novel boronic acid inhibitors reveals important interactions with a clavulanic acid-resistant sulfhydryl-variable (SHV) beta-lactamase.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase/hydrolase inhibitor
total genus 99
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4fcfA00
2ZQAA 3SS4A 1BLHA 1CI9A 4R4RA 5CGSA 1PZPA 3WS4A 3TOIA 3C7VA 2HDUA 3IXGA 1NJ4A 1IEMA 2WKIA 3JYIA 3MBZA 4GKUA 1LL5A 2ZM8A 1KDWA 2V1ZA 5GLCA 5F1FA 2RCXA 4BL3A 2H5SA 4DDYA 4DE1A 3SS3A 5HL1A 2JCHA 5CXWA 2EX9A 3NI9A 3BFFA 4OLGA 1ESUA 2OLVA 2OLUA 1XKZA 1SDEA 2J9PA 3LO7A 5CRFA 3UY6A 5BOHA 1KE0A 4MBKA 3SOIA 4R0QA 4X56A 3C7UA 4LV1A 1KGFA 4WELA 3GV9A 1NY0A 2GDNA 4Q8IA 5FQJA 4OOMA 3Q7VB 1CK3A 1WE4A 1N9BA 4KZBA 4WM9A 5E2FA 1K54C 4C3QA 5U47A 3ZCZA 4R4SA 1ESIA 2HDSA 4OQIA 1RGZA 3V5MA 1O07A 2R9XA 1K4FA 3HBRA 3Q7VA 4EBNA 4E3MA 2ZM0A 4GZBA 4JXSA 5FQIA 3FZCA 1K25A 3ZVWA 4S2PA 1VQQA 3HLBA 3AGFA 3BYDA 4KQRA 5A93A 4ZDXA 1IKIA 1RCJA 2EFXA 1AXBA 1W79A 3IWQA 3P98A 4QD4A 3G4PA 4S2OA 3ZVTA 4GD8A 1NZUA 4Y7PA 1L0EA 4O7DA 3HL9A 3IHBA 1FQGA 4DDSA 2BLSA 2EXAA 4OP5A 5E2EA 5EOEA 3CZDA 3RXWA 1ES3A 4OQGA 4X55A 3M2JA 1YLPA 2Z2MB 1SHVA 2IWDA 3ZG7B 3HVFA 1PW1A 3A3IA 3ZNYA 4Z9QA 4QY5A 3HLDA 3OZHA 1ZG4A 3PTEA 3CMZA 2Y2LA 3SS5A 1NXYA 1KDSA 2ZLYA 4GD6A 1GHIA 5KZHA 4HBUA 4PM5A 1HVBA 1SDNA 1W5DA 5GLBA 4CPKA 1MPLA 4JBFA 3G2ZA 3G34A 3A3EA 3ITAA 3LY3A 3FV7A 4OONA 5IHVA 4FSFA 4S2MA 4WBGA 5A90A 3OPPA 4ZJ1A 5TR7A 4DE0A 1TVFA 4RX2A 2QMIA 4B4XA 5KMWA 1ZKJA 2RL3A 1K55C 1KVLA 2ZQCA 3VSLA 1J9MA 5M1AA 2XFSA 2Y91A 4BL2A 2Y59A 1FCOA 2Y2PA 1E4DA 4X69A 4DKIA 1IYPA 4KZ7A 4R23A 3HLEA 2V20A 5EVIA 3WS1A 3B3XA 1K57C 2C6WB 4C6YA 4WMCA 4DXCA 1XPBA 1Y54A 3SH9A 3QNBA 5HAQA 4OPQA 1MY8A 3HLGA 3C5AA 2X02A 1K4EA 4DE2A 1IYOA 3Q1FA 4R3BA 2ZQDA 3UE0A 4FH2A 2Y4AA 3HREA 4KZ4A 5GLAA 2Q9NA 1LL9A 3N8RA 2WYXA 5HX9A 5L2FA 1BSGA 4R1GA 4EWFA 4OVDA 2V2FF 4IBXA 1U60A 4LENA 4OOLA 5AQAA 4PM6A 1LHYA 1PW8A 1BZAA 4S2IA 4IBRA 1E3UA 3CG5A 1K6RA 1JWPA 2HPBA 1EWZA 3N8LA 4QU3A 1K38A 1TEMA 2WGWA 4PM8A 5FATA 2CC1A 5EE8A 2VGKA 4GNUA 2G2UA 2ZC7A 2JBFA 4KZ8A 3S4XA 3Q7ZA 5CHJA 3EQVA 5FAPA 1C3BA 1PIOA 4OPZA 3P09A 1RP5A 4LV3A 3MZEA 1EROA 3EQUA 1K54A 3NBLA 2Y2GA 1FCNA 2ZC6B 4KZ5A 5DF7A 2HP5A 5E2HA 3D4FA 2J7VA 3PBSA 3Q81A 1KE3A 4JKTA 1N4OA 1YLYA 1GA0A 1H8YA 3BFCA 3AGEA 2B5RA 2ZJ9A 3ISGA 5FAQA 1MXOA 3UO9A 2HP6A 2OV5A 2HDQA 2WUQA 2J8YA 2XFTA 3MKEA 4F94A 3UPOA 2Z2LB 4JF6A 4EBLA 3ZGAB 4KZ9A 3W4OA 3I7JA 1CEFA 4BJPA 4JXWA 1NYYA 2FFYA 3NC8A 3UDIA 2QZ6A 3VP4A 3GQZA 3HUMA 3MZDA 4X6TA 2HP9A 1MBLA 3O87A 1BLCA 1XXMA 3PAEA 1IKGA 3C4PA 3GTCA 3HUNA 3W4PA 4OPYA 4E3LA 4JXGA 5D3OA 3FKWA 4OKPA 4BD0A 4HEFA 1ALQA 4LCLA 2P74A 2X01A 1HTZA 2WGVA 1PWGA 4MBFA 3Q82A 3IHAA 1PYYA 2WZXA 2Y2HA 5FSRA 5FI7A 1YMSA 4PM9A 4FH4A 1K56A 1PWDA 1BUEA 1XA1A 4GB7A 3V3SA 4K91A 4P87A 3VOYA 1JVJA 1ES4A 3WS0A 3DW0A 5CTNA 4KQQA 1ERMA 1VM1A 3C4OA 1GCEA 1KE4A 4JPMA 4IVKA 4N92A 3IF6C 4UA6A 4KQOA 4JF5A 3WRZA 2Y2NA 4UA9A 4IVIA 3FWLA 2ZD8A 3OPLA 4N1XA 5EECA 3OC2A 3MKFA 1PZOA 2ZMAA 1K55A 4QY6A 2Y2QA 3NDEA 3UNWA 1YLWA 1H5XA 4P6BA 1ZC2A 2ZC3B 1NZOA 5EUAA 1JTDA 4FD8A 2XEPA 5CHMA 1GHPA 4P0MA 3UDFA 4OP8A 1SCWA 4H8RA 5TFQA 5GHYA 1ERQA 1K57A 3PBNA 3UE1A 1YLJA 3OCNA 1LLBA 5DF8A 4S2LA 1FCMA 4UHUA 1DY6A 2WAEA 1TDLA 3IXHA 3BLMA 3IWIA 4JLFA 1CEGA 3SH8A 4IEDA 2XD1A 4XUZA 5JYPA 3OPHA 3G2YA 4OLDA 2UWXA 2Y2KA 1SKFA 1XA7A 2WAFA 3W4QA 1FSYA 2ZQ8A 2XDMA 4OQ0A 5E2GA 5EVIB 5EPHA 4U0TA 1YLZA 4FCFA 5DTTA 2A49A 2G2WA 1XP4A 5HAPA 1HZOA 1QMFA 3FYZA 1JWVA 3A3JA 1FSWA 1E25A 5GHXA 3N7WA 5GL9A 2XQZA 2XK1A 3VFFA 1YQSA 5FDHA 3PBTA 1W8YA 3ZHHA 1DJBA 4XUXA 4DRTA 2A3UA 5FASA 4K0XA 3SH7A 1BLSA 2H0TA 3E2KA 4U3TA 1EI5A 3M6HA 3GR2A 5I94A 3S1YA 1MWTA 2HDRA 4WZ5C 5HW3A 1XGJA 2IWBA 3ZG8B 5A92A 4ID4A 3WRTA 2Y2MA 1I2WA 4YINA 5AQBA 2DCFA 1G68A 3GSGA 2FFFB 3MXSA 4U0XA 3UDXA 4DF6A 1QMEA 3V3RA 2WGWB 2PU4A 4EV4A 1H8ZA 3BFDA 3BLSA 4BQMA 4BENA 2ZQ7A 5AQ7A 5DF9A 4RX3A 4ZAMA 5EVLA 3MZFA 3IH8A 1YT4A 2XR0A 4Y0TA 1ES5A 3S22A 2JE5A 4OQHA 3BFGA 2H0YA 3GRJA 4Y0OA 3DTMA 5CHUA 1WYCA 4X53A 4KG5A 2J9OA 3NDGA 1M6KA 2P9VB 3O88A 3PBQA 5DVAA 1MKIA 1XX2A 2XF3A 2Y2IA 3OCLA 4KZAA 4E3IA 2XD5A 3G31A 3NCKA 4N1HA 2QPNA 1Q2QA 2EX2A 4GDBA 2WKEA 2P9VA 3M2KA 4WYYA 5DTSA 4HBTA 1LI0A 4KG6A 1LI9A 2E8IA 4WEKA 1TDGA 4S2KA 2ZC5B 1L0DA 3VSKA 4GDNA 3BFEA 5CGWA 3Q07A 1HD8A 3NIAA 4RVAA 3IF6B 4QJGA 4KG2A 2XGNA 3UPPA 1DJAA 1NYMA 3HUOA 3VP2A 2EXBA 3A3DA 4WZ4A 1M40A 3HLFA 3IXDA 3N4IA 4BD1A 3IQAA 4DXBA 1FOFA 4PPRA 2DRWA 3GVBA 3WWXA 1BULA 3IF6A 4GOGA 2PBYA 2OSUA 5EVID 3ZFZA 3BM6A 5KSHA 3LY4A 1L0GA 4WMCD 4S2NC 4A5RA 4D2OA 4NETA 1GHMA 1I2SA 4PMAA 3OPRA 1ES2A 2DNSA 4L0LA 1Q2PA 1GA9A 4C75A 4RYEA 3G30A 4KENB 4WEJA 4B88A 3ITBA 4X68A 3V50A 4EQIA 1RGYA 4QHCA 3V39A 3VFHA 2PU2A 5FI6A 4E3KA 3VP3A 2XH9A 2WKHA 2Y55A 4KZ3A 5A91A 2Y2JA 5CTMA 3ZG5A 4B4ZA 3IH9A 1E3UD 1JWZA 3MXRA 5CERA 4BLMA 5HAIA 3VOZA 1CI8A 2I72A 3IF5A 4ZTKA 3RXXA 3W8KA 1PWCA 3QNCA 1KVMA 3E2LA 4E6XA 4E3NA 3PBOA 3BEBA 2R9WA 4P85A 3NY4A 2VGJA 1K6SA 2IWCA 3TSGA 4EUZA 1ONGA 3PBRA 5FI2A 4ZJ3A 4EBPA 5M18A 1IYQA 4KZ6A 4MLLA 5F1GA 5FQMA 5G18A 4E3OA 1NRFA 3ZNTA 1DJCA 2WK0A 2EX6A 4RA7A 4ZBEA 2ZM2A 3VMAA 5JYOA 3RJUA 5AQ9A 5FQ9A 1IELA 4UAAA 3TG9A 3LCEA 1BT5A 1BLPA 3IXBA 1YM1A 3QHYA 4WZ5A 1JTGA 3AGDA 3O86A 4OPRA 5F83A 4UA7A 1ZG6A 1KGEA 2WGIA 4OH0A 3DWKA 3N8SA 5M19A 5GHZA 5HFOA 5TGFA 5CECA 1WYBA 2ZC4B 5KSCA 2H10A 5DTKA 1MWUA 2XLNA 3UN7A 4MEZA 3A3FA 3G32A 3GMWA 4YFMA 3VP1A 1YLTA 2EFUA 4LCMA 3CJMA 2Y2OA 4DE3A 3UPNA 1G6AA 3IWOA 3ZG0A 5FA7A 1MWSA 2WZZA 1XGIA 4QB8A 4E3JA 5CEDA 3WS2A 4CJNA 3BECA 1L0FA 5E43A 1PI5A 3PAGA 1K56D 2Q9MA 3O3VA 4LV0A 3N6IA 4K0WA 3LEZA 3MFDA 4XXRA 1Z6FA 5FAOA 3VP0A 1FR1A 5FQQA 5GLDA 3ZDJA 1IYSA 2BG1A 3WS5A 1OMEA 4N9LA 1PI4A 4HESA 1MWRA 4ZJ2A 4Y0UA 4LV2A 1L2SA 4GN2A 2X71A 1YMXA 4NK3A 1BTLA 2WADA 4JF4A 4PM7A 5CGXA 3IT9A 2C5WB 1KGGA 1W7FA 4E6WA 5J8XA 1O7EA 3BRMA 4JXVA 1S0WA 4MNRA 1FR6A 4S2JA 3FKVA 2EX8A 1W8QA 5FQKA 3UE3A 3ZG9B 3G35A 5EVIC 3DWZA 3HLCA 4MBHA 4S2NA 5EOOA 5F82A 2ZQ9A 4OOYA 1S6RA 3HLWA 5CEBA 2JC7A 4R3JA 5HARA 4M3KA 1ONHA 3M6BA 1I5QA 4N9KA
chains in the Genus database with same CATH superfamily
1S4RA 2KX6A 2LB9A 2HDUA 3C7VA 1NJ4A 1LL5A 4BMWA 2RCXA 4BL3A 4DE1A 5HL1A 2V1BA 2JCHA 2EX9A 3BFFA 2OLUA 1SDEA 3UY6A 2KLIA 3SOIA 1P0ZA 2XA7M 2XROA 1LL8A 4WELA 2GDNA 4OOMA 2V8CA 1N9BA 3EWKA 3V67A 1LSXA 1RGZA 1O07A 2HJ9C 4E3MA 3CUEA 3UMDA 3LUQA 4Q0JA 1K25A 4ZRRA 1VQQA 4KQRA 5A93A 4MN7A 3P98A 4MDZA 4O01A 2ZBBA 4P6ZM 4R38A 4O7DA 3HL9A 1CJFA 4O8GA 5E2EA 5EOEA 3CHWP 1ES3A 4LLOB 1YLPA 1T1AA 2IWDA 4CLCD 3FG8A 3SS5A 4GD6A 4B93A 2JKGA 1HVBA 1W5DA 1MPLA 4PAUA 3KSFA 3G34A 2VX8A 4BBUA 4S2MA 4WBGA 1LSWA 1TS6A 4ZJ1A 1AWIA 1TVFA 3K2NA 3E4QA 4ARZA 2XFSA 4BL2A 1FCOA 4GCZA 4I5SA 2D02A 1IYPA 1F2KA 2V20A 1MKMA 3WS1A 2O0YA 4DXCA 2QJ5A 5DKKA 3EEHA 4OPQA 3T50A 5HWVA 4WN5A 2ZQDA 3UE0A 1VEUB 2P08A 5HX9A 5L2FA 4NG2A 1JWPA 4M4XA 2QYBA 2Y79A 1T1BA 1S67L 3EQVA 5FAPA 1PIOA 4LV3A 1K54A 4Y13A 4KZ5A 4X1LA 3PBSA 4JKTA 3AGEA 2K7SA 3ISGA 3RTYA 1G6OA 2GJ3A 2HP9A 3QP6A 2PYPA 3W4PA 4OPYA 4CLCC 4HEFA 1ALQA 4LCLA 4MBFA 3IHAA 1PYYA 5FSRA 4FH4A 3DTIA 1ES4A 3DW0A 4K08A 1ERMA 1KE4A 4IVKA 3LR0A 1K55A 2IA2A 2JKFA 3VE3A 2UV0E 3UNWA 1YLWA 4P6BA 3MF0A 2ZC3B 3A0RA 2XEPA 3LIEA 5CHMA 3HJIA 5TFQA 3PBNA 1LLBA 1DY6A 3DTEA 1G5UA 4KUOA 5JYPA 3OPHA 1N9OA 2Y2KA 1XA7A 2XDMA 3IS2A 4L9FA 5DFXA 2JHEA 1HLUP 1HZOA 5FDSA 1FSWA 5HWWA 3N7WA 2XQZA 1YQSA 3PBTA 1W8YA 1DJBA 4DRTA 2OAQ1 4GHIA 3NOTC 5I94A 2HDRA 5A92A 4ID4A 3WRTA 2Y2MA 1DP8A 4YINA 5AQBA 2DCFA 1G68A 2FFFB 1N9NA 2ACGA 5HD5A 1D1JA 3BFDA 4BENA 5AQ7A 1P9WA 4NEED 3QP1A 2ZMVA 1YT4A 1ES5A 3BFGA 3DTMA 1TD5A 1M6KA 2P9VB 3O88A 4HP4A 4E3IA 3NCKA 3G31A 3LIAA 4N1HA 3NECA 3M2KA 3DTKA 4Z1WA 3BFEA 1HD8A 3MR0A 1XJ4A 5AJGA 2XGNA 3A3DA 3N4IA 2VLGA 1OTAA 2AVXA 3WWXA 1BULA 3C38A 5HD3A 2PBYA 1SKOB 5KSHA 3T1SA 1L0GA 2PRFA 1ES2A 2DNSA 2VGLS 1Q2PA 4L0LA 3NHQA 4RYEA 5J3WA 4QHCA 4E3KA 2P7JA 2Y55A 2Y2JA 3MXRA 3LR4A 5EM0A 4E3NA 1NLYA 2R9WA 3H7WA 4EBPA 4E3OA 1DJCA 3S7NA 4RA7A 3RJUA 5AQ9A 5FQ9A 3NULA 3IS2B 2W3DA 3RFBA 1BLPA 4BBVA 3UB8A 4WZ5A 3CUEC 1FIKA 3FPWA 5F83A 4UA7A 4OH0A 3DWKA 5GHZA 3KYQA 5A8BA 5TGFA 5CECA 5DTKA 4MEZA 3LGOA 4HY8A 3GMWA 2EFUA 4HNBA 3CJMA 5F5YA 2Y2OA 2K31A 4DJ2A 5FA7A 2V0UA 4QB8A 5CEDA 5E43A 2YKFA 4HP9A 4K0WA 3T4TA 5HPFA 1UGUA 3VV4A 1Y28A 4L9GA 4HESA 1MWRA 1OTDA 2GNXA 4PM7A 2X71A 5CGXA 2WADA 2C5WB 3A0SA 3B42A 1S0WA 4MNRA 1FR6A 3R4KA 4S2JA 4MCWA 3G35A 4NKPA 1XJ6A 3MMHA 2ZQ9A 5CEBA 3HLWA 5F6AA 5F69A 4DMZA 3T4QA 3A0VA 1S1ZA 5DJUA 4R3JA 5F68A 1ONHA 4H6JB 3M6BA 3ZNYA 3MQOA 1BLHA 1PZPA 2M1CA 1IEMA 1P9RA 3S7QA 3EOIA 4GKUA 5GLCA 5F1FA 1H8MA 4DDYA 4OLGA 3ZYTA 3KYZA 2OLVA 5BOHA 2J9PA 4MBKA 1L3LA 2V0WA 1W63M 3EGXC 4LV1A 2G7UA 3GV9A 4Q8IA 3LEQA 3Q7VB 1CK3A 4KZBA 4WM9A 5I5LA 1K54C 4Y5FA 1ESIA 2HDSA 2OAP1 3V5MA 2R9XA 4NXFA 3H7WB 3KYEA 4JXSA 4S2PA 3HLBA 4EU0A 3AGFA 2WKRA 1RCJA 1AXBA 4QD4A 3ZVTA 4GD8A 4X1MA 3RXWA 4OQGA 3E98A 4X55A 3M2JA 3ZG7B 2QJ7A 1PW1A 3A3IA 1NRJA 4QY5A 3C30A 2Y2LA 3CMZA 3DBAA 1GHIA 4PM5A 1SDNA 5GLBA 4CPKA 3A3EA 1F9IA 1YSQA 3OPPA 4AFIA 4DE0A 2QMIA 4B4XA 3D3OA 1K55C 1KVLA 3TRCA 2Y91A 2EWVA 4DKIA 4R23A 3HLEA 2C6WB 1XPBA 3P7NA 4GS9B 1MY8A 3C5AA 3U4LP 2X02A 1K4EA 4DE2A 4WL9A 4G3VA 4HIAA 4R3BA 4FH2A 4HHDA 2W3GA 2Q9NA 3N8RA 2V2FF 1U60A 4OOLA 5AQAA 1PW8A 4S2IA 3OBFA 1VEUA 3N8LA 2VV8A 2VJWA 4CQHA 4PM8A 2WGWA 5FATA 2ZOIA 1YSPA 4GNUA 3LI8A 3Q7ZA 1H0MA 1C3BA 1RP5A 1EROA 2W3EA 2OOLA 3EQUA 4I3AA 2ZC6B 3MFXA 4PKYA 3T1RA 5FAQA 4MN6A 1MXOA 4PKYG 3UO9A 2HDQA 2XFTA 3UPOA 2Z2LB 4EBLA 2W27A 3ZGAB 4KZ9A 2FFYA 3UDIA 3MZDA 1FILA 5TBMB 4X6TA 5HZHA 3O87A 5EV0A 1XXMA 3GTCA 3FKWA 2P74A 2WGVA 4Q0HA 4UEYA 2WZXA 1STZA 3V3SA 4K91A 4P87A 3VOYA 1JVJA 2HV1A 2Y2NA 4UA9A 3OPLA 2ZMAA 1PNEA 3L7HA 2Y2QA 1H5XA 1S1YA 3C2WA 5IT5A 4IUKA 5EUAA 4FD8A 4P0MA 1SCWA 3UE1A 1K57A 2B18A 5DF8A 2WAEA 4JLFA 3BLMA 5HPIA 4IEDA 4BBTA 4XUZA 2UWXA 2ZQ8A 2A49A 1XP4A 5HAPA 5G4YA 3KSIA 1OTIA 1K0KA 3VFFA 1X0OA 1DRMA 1V9YA 1EI5A 3S1YA 1MWTA 4WZ5C 5HW3A 2IWBA 1MZUA 1I2WA 3UDXA 1QMEA 2WGWB 4EV4A 3D9YA 3O5YA 3EGDC 2VA0A 3NJAA 3CITA 3MZFA 4O0PA 2L4RA 2JE5A 3GRJA 5CHUA 4KG5A 3F1NB 4NXGA 4Y17A 3OCLA 2QPNA 4EUVA 2WKEA 2P9VA 2JKRM 5DTSA 1LI0A 3IX3A 1OTBA 1LI9A 4EXOA 1UWPX 2JKRI 4QJGA 3Q07A 4RVAA 3NIAA 3IF6B 3UPPA 4WZ4A 5HDCA 1M40A 3HLFA 4BD1A 3IQAA 3F1PB 5MC7A 1FOFA 4PPRA 2DRWA 3GVBA 1A0KA 4B9OA 4KQDA 1ZHHB 3ZFZA 1H3QA 3LY4A 1KOUA 4D2OA 4NETA 1GHMA 1GA9A 5K5BA 1SKOA 3BW6A 4KENB 4WEJA 4B88A 3ITBA 3V50A 2GZAA 2WKPA 1RGYA 4EQIA 2PU2A 2W1TB 2XH9A 2J3TD 3ZG5A 1JWZA 5CERA 4BLMA 5HAIA 3LR3A 3RXXA 1PWCA 1T18A 3BEBA 2IWCA 3TSGA 4FTXA 3TE8A 3PBRA 5FI2A 4ZJ3A 5HSQA 3FPVA 3S7OA 3ZNTA 4HOIA 4ZBEA 5JYOA 2ZMFA 4UAAA 4ETXA 3PR6A 5L07A 4OPRA 2O99A 1KGEA 4R70A 5DJTA 5M19A 2A24A 4LFUA 3T1XA 4HJ4A 2CMNA 1WYBA 3H9WA 5LBRA 4LCMA 4UQIS 2Q0OA 3ZG0A 1XGIA 4E3JA 1D7EA 3T4JA 2Q9MA 4FUWA 4LV0A 3N6IA 4XXRA 3LEZA 3MFDA 4WF0A 1Z6FA 3UE6A 3VP0A 1FR1A 5FQQA 5GLDA 1IYSA 1OMEA 4N9LA 1PI4A 4ZJ2A 2JKTM 3SS3A 5CXWA 4GN2A 3RH8B 2KDKA 4JF4A 4EERA 3IT9A 3NOUC 3R7WB 3FKVA 2JKTI 1F5MA 3FC7A 3ZG9B 1Y4OA 4HQAA 2J80A 2B02A 4GW9A 1I5QA 4N9KA 2HJEA 1CI9A 5CGSA 4R4RA 3WS4A 3TOIA 3IXGA 4E04A 2WKIA 4G3WA 4H6JA 5FL3A 1LSVA 2J3TC 2ZM8A 1KDWA 3G6OA 1OT6A 3NI9A 1VETA 3KSHA 4I3JA 1ESUA 1XKZA 3LO7A 3ULFA 1KE0A 2V9AA 1KGFA 2Y8HA 5U47A 3ZCZA 4R4SA 2PHYA 4OQIA 2VV7A 1K4FA 2BASA 2V1AA 3HBRA 3Q7VA 1TS7A 2ZM0A 3MS6A 3FZCA 3ZVWA 4ZDXA 1IKIA 2EFXA 2I9VA 3G4PA 2OWHA 4S2OA 4Y7PA 1L0EA 1FQGA 2BLSA 3CZDA 3SW1A 2A24B 2YKHA 2Z2MB 1SHVA 2PD8A 4Z9QA 3HLDA 3OZHA 3PTEA 1NXYA 1KDSA 2ZLYA 3OLOA 5KZHA 4HBUA 3MSHA 3ITAA 2VEAA 3FV7A 3IX8A 4OONA 5A90A 3DAVA 5KMWA 5HWTA 2LB5A 1YAXA 2Y59A 2Y2PA 4X69A 1E4DA 1ODVA 3QP4A 2DMWA 1K57C 5L10A 4C6YA 1Y54A 3SH9A 5HAQA 4GLQA 2HZ5A 4MMNA 3Q1FA 2NUPC 3HREA 4HH2A 4GS9A 2P04A 2WYXA 1BSGA 4R1GA 4IBXA 4I3IA 4LENA 1BZAA 4FOFA 1K6RA 4QU3A 1K38A 1TEMA 2CC1A 5EE8A 3H82B 4NXBA 3S4XA 4KZ8A 3B47A 5CHJA 2MJ6A 3P09A 2E8JA 3NBLA 2Y2GA 1FCNA 1VETB 3EEAA 2HP5A 5E2HA 2J7VA 1YLYA 3L9KA 4LRZE 2HP6A 2OV5A 4F94A 4JF6A 2VGLM 2FH5A 3I7JA 4JXWA 3OOVA 1OPXA 2QZ6A 1MBLA 1G28A 3BQ8A 2GX5A 3PAEA 1IKGA 3C4PA 3HUNA 1OTEA 5EM1A 4E3LA 5D3OA 5TBMA 4BD0A 3UB7A 2X01A 1CF0A 2XA7S 2R78A 5FI7A 1YMSA 4PM9A 1K56A 2VV6A 4JPMA 1VB6A 3WRZA 3FWLA 3MKFA 3B33A 4QY6A 5HL6A 3NDEA 1ZC2A 1VHMA 1JTDA 4WLAA 4P6ZS 3UDFA 1ERQA 3OCNA 4UHUA 3CWFA 1TDLA 4LRYC 4Y15A 1CEGA 3W4QA 4GJ4A 5E2GA 4U0TA 4FCFA 4BWIA 2FZ0A 3A3JA 4R6LA 2QKPA 5GL9A 2VK3A 3ZHHA 3PYPA 4K0XA 3SZTA 2H0TA 3E2KA 3M6HA 3GR2A 1XGJA 4HH3A 3GSGA 4DF6A 1H8ZA 3BLSA 4BQMA 5EFWA 2ZQ7A 4RX3A 5C5KA 5EVLA 3IH8A 4G3KA 2XR0A 2PD7A 3UMEA 2M7VA 2PR5A 4Y0OA 2H0YA 1WYCA 1GSWA 2J9OA 2EWWA 2QHKA 1MKIA 1XX2A 2Y2IA 2PYRA 4EESA 4CLCB 2XD5A 1Q2QA 2EX2A 4GDBA 3F1NA 4HBTA 1SZVA 5L09A 3F1OA 3KSGA 4WEKA 1GSVA 3TW8A 4S2KA 2BTFP 2ZC5B 4YNRA 3VSKA 2PAVP 5CGWA 4KG2A 1DJAA 1NYMA 3IF6A 4GOGA 3F1PA 5FEGA 3LIFA 4F3LA 3G30A 4II7A 3VFHA 4EW7A 5FI6A 4KZ3A 4MN5A 5CTMA 3IH9A 1F98A 1CI8A 2B95A 2I72A 3IF5A 4ZTKA 3VOLA 2W1TA 3QNCA 1KVMA 3E2LA 2Z6CA 3PBOA 3T4LA 3C8CA 2VGJA 4EUZA 1ONGA 5M18A 4KZ6A 4MLLA 2EA9A 5F1GA 3ZQ5A 2ZM2A 4EEPA 3U2AA 3E4OA 3JVVA 1YM1A 3QHYA 1JTGA 1V9ZA 3AGDA 3O86A 2W0NA 2WGIA 1IOUA 3N8SA 3TJZC 3LICA 3E0YA 5HFOA 3LR5A 2ZC4B 5KSCA 1MWUA 2XLNA 3UN7A 4LGWA 3A3FA 1TS8A 5DKLA 4KUKA 2L0WA 1G6AA 5IU1A 1MWSA 4CJNA 3BECA 4Y2FA 1PI5A 1K56D 5FAOA 1S66L 3UB9A 3ZDJA 3E4PA 1S4SA 1PRQA 4NK3A 5E2FA 1YMXA 1KGGA 1W7FA 4E6WA 1O7EA 2PDRA 4JXVA 2V8FA 3F1OB 1XJ3A 3UE3A 5FQKA 2XRNA 3CPTB 1OT9A 5IS1A 4MBHA 5CX7A 4Q0IA 3R7WA 2O9CA 4S2NA 3T1QB 1JNUA 3BWLA 4OOYA 2JC7A 1W63Q 4NXEA 2ZQAA 3SS4A 3K3DA 2L1MA 3JYIA 3MBZA 1XFNA 1DP6A 2V1ZA 4F3LB 2H5SA 5L8MA 3MJQA 3KX0X 3LIDA 5CRFA 3LYXA 4R0QA 4X56A 3C7UA 1NY0A 5FQJA 4C3QA 1WE4A 3MQ0A 3NOPC 4IJGA 1WA9A 4EBNA 4GZBA 5FQIA 3T4SA 3BYDA 5DFYA 2INWA 1W79A 3IWQA 3PHYA 3LI9A 1NZUA 1T1CA 4ME4A 3IHBA 4DDSA 5KIZA 2EXAA 4OP5A 3K3CA 2WKQA 3HVFA 5J7EA 1ZG4A 4HI4A 2NUTC 5J4EA 4JGRA 4JBFA 3G2ZA 5AVFA 1LT0A 3LY3A 1OJ5A 5IHVA 4FSFA 3IBRA 3S7PA 5TR7A 3P01A 4ARZB 4RX2A 1ZKJA 3LFVA 2RL3A 2ZQCA 3VSLA 1J9MA 5M1AA 2ZOHA 3LIBA 4KZ7A 5EVIA 3B3XA 4R3AA 4WMCA 3QNBA 4YOFA 3HLGA 2O9AA 2J3WA 4I38A 1IYOA 4LPZA 2Y4AA 3QP2A 4KZ4A 5GLAA 1LL9A 1ZTUA 4EWFA 4OVDA 1XJ2A 4PM6A 1LHYA 4IBRA 1E3UA 3CG5A 2HPBA 3T4OA 1EWZA 1CQAA 2VGKA 2G2UA 2ZC7A 2JBFA 4OPZA 4HJ3A 3MZEA 4YWZA 3UB5P 2PR6A 3H82A 5DF7A 1UWNX 3D4FA 3Q81A 1KE3A 1N4OA 1GA0A 1H8YA 3BFCA 2PBDP 2B5RA 2ZJ9A 4JGPA 2H28A 2WUQA 2J8YA 3MKEA 3W4OA 1CEFA 4BJPA 4CLCE 1NYYA 3IX4A 3GECA 1EW0A 3HCYA 3NC8A 3BY8A 3VP4A 3GQZA 3HUMA 3GDIA 1BLCA 4QWOA 4JXGA 4OKPA 4I39A 3W2ZA 1HTZA 1PWGA 3Q82A 2Y2HA 4Y3IA 2W1RA 4X25A 1PWDA 1BUEA 1XA1A 4GB7A 3UB6A 2HGVA 3WS0A 3PXPA 5CTNA 4KQQA 1VM1A 3C4OA 1GCEA 4UA6A 1T19A 4N92A 3IF6C 4KQOA 4JF5A 4IVIA 4N1XA 2ZD8A 5EECA 3OC2A 1PZOA 2VKSA 1NZOA 2W3HA 4EETB 2K2NA 1GHPA 4OP8A 4H8RA 5GHYA 1YLJA 1FCMA 1NLZA 4XT2A 3IXHA 3IWIA 3SH8A 3BQAA 2XD1A 3T12B 3G2YA 4OLDA 1J3WA 3VE4A 1SKFA 2WAFA 1GSXA 1FSYA 4OQ0A 5EVIB 2Z6DA 5EPHA 1YLZA 5DTTA 2G2WA 4UQIM 3BY9A 1P97A 1QMFA 3FYZA 1JWVA 4GHIB 1E25A 5GHXA 4JGQA 2XK1A 4PHTA 3ICYA 5FDHA 4XUXA 2A3UA 4L9EA 5FASA 1YKDA 2M7UA 3SH7A 1BLSA 3CAXA 4U3TA 3CLOA 3JPUA 2HF6A 3D72A 1YPRA 3QP8A 4JGOA 3ZG8B 3MXSA 4U0XA 2W3FA 3JVUA 1TS0A 3V3RA 2PU4A 2PT7A 2ZL1A 5DF9A 4ZAMA 3HJKA 4Y0TA 3S22A 4OQHA 1N9LA 4DJ3A 4EQ1A 2KOIA 4X53A 3NDGA 3PBQA 5DVAA 2XF3A 4KZAA 1Z09A 4ETZA 5EVEA 2QWSA 3KO6A 4WYYA 4KG6A 4CLCA 2E8IA 1TDGA 1L0DA 4GDNA 4D60A 2XSSA 3VP2A 3HUOA 2EXBA 3IXDA 4DXBA 1TF1A 1ACFA 2OSUA 5EVID 2JN7A 3BM6A 4A5RA 4WMCD 4S2NC 5FEFA 1XFQA 1I2SA 4PMAA 3BJNA 4C75A 3CI6A 4X68A 3V39A 5TJJA 3VP3A 1NWZA 2WKHA 5A91A 4LRXC 4B4ZA 1E3UD 3VOZA 3W8KA 1BYWA 2O9BA 5AVEA 4E6XA 1IFQA 4P85A 3NY4A 1K6SA 1DP9A 3MXQA 1IYQA 5FQMA 5G18A 4XT2B 1NRFA 2WK0A 2EX6A 3VMAA 1IELA 1MC0A 3TG9A 3LCEA 1BT5A 5G4ZA 3IXBA 2A2LA 4HJ6A 1ZG6A 4EEUA 4ESPA 2VZWA 1OJGA 2H10A 3G32A 4YFMA 3VP1A 1YLTA 5HDSA 1PFLA 2ZL1B 3UPNA 4DE3A 2D01A 1D06A 3IWOA 2WZZA 3WS2A 1L0FA 4RQ9A 4QPRA 4DN0A 3PAGA 3O3VA 3QP5A 4IHQA 2BG1A 3WS5A 4Y0UA 4LV2A 1L2SA 3IBJA 1BTLA 5J8XA 3T4KA 3BRMA 4WUJA 2EX8A 1W8QA 4IUHA 5EVIC 3DWZA 3HLCA 5EOOA 5F82A 1S6RA 2OWJA 5HARA 5HDDA 4M3KA 3MQQA 3OPRA 3CPTA 4S2LA
chains in the Genus database with same CATH topology
2ZQAA 3SS4A 1BLHA 1CI9A 4R4RA 5CGSA 1PZPA 3WS4A 3TOIA 3C7VA 2HDUA 3IXGA 1NJ4A 1IEMA 2WKIA 3JYIA 3MBZA 4GKUA 1LL5A 2ZM8A 1KDWA 2V1ZA 5GLCA 5F1FA 2RCXA 4BL3A 2H5SA 4DDYA 4DE1A 3SS3A 5HL1A 2JCHA 5CXWA 2EX9A 3NI9A 3BFFA 4OLGA 1ESUA 2OLVA 2OLUA 1XKZA 1SDEA 2J9PA 3LO7A 5CRFA 3UY6A 5BOHA 1KE0A 4MBKA 3SOIA 4R0QA 4X56A 3C7UA 4LV1A 1KGFA 4WELA 3GV9A 1NY0A 2GDNA 4Q8IA 5FQJA 4OOMA 3Q7VB 1CK3A 1WE4A 1N9BA 4KZBA 4WM9A 5E2FA 1K54C 4C3QA 5U47A 3ZCZA 4R4SA 1ESIA 2HDSA 4OQIA 1RGZA 3V5MA 1O07A 2R9XA 1K4FA 3HBRA 3Q7VA 4EBNA 4E3MA 2ZM0A 4GZBA 4JXSA 5FQIA 3FZCA 1K25A 3ZVWA 4S2PA 1VQQA 3HLBA 3AGFA 3BYDA 4KQRA 5A93A 4ZDXA 1IKIA 1RCJA 2EFXA 1AXBA 1W79A 3IWQA 3P98A 4QD4A 3G4PA 4S2OA 3ZVTA 4GD8A 1NZUA 4Y7PA 1L0EA 4O7DA 3HL9A 3IHBA 1FQGA 4DDSA 2BLSA 2EXAA 4OP5A 5E2EA 5EOEA 3CZDA 3RXWA 1ES3A 4OQGA 4X55A 3M2JA 1YLPA 2Z2MB 1SHVA 2IWDA 3ZG7B 3HVFA 1PW1A 3A3IA 3ZNYA 4Z9QA 4QY5A 3HLDA 3OZHA 1ZG4A 3PTEA 3CMZA 2Y2LA 3SS5A 1NXYA 1KDSA 2ZLYA 4GD6A 1GHIA 5KZHA 4HBUA 4PM5A 1HVBA 1SDNA 1W5DA 5GLBA 4CPKA 1MPLA 4JBFA 3G2ZA 3G34A 3A3EA 3ITAA 3LY3A 3FV7A 4OONA 5IHVA 4FSFA 4S2MA 4WBGA 5A90A 3OPPA 4ZJ1A 5TR7A 4DE0A 1TVFA 4RX2A 2QMIA 4B4XA 5KMWA 1ZKJA 2RL3A 1K55C 1KVLA 2ZQCA 3VSLA 1J9MA 5M1AA 2XFSA 2Y91A 4BL2A 2Y59A 1FCOA 2Y2PA 1E4DA 4X69A 4DKIA 1IYPA 4KZ7A 4R23A 3HLEA 2V20A 5EVIA 3WS1A 3B3XA 1K57C 2C6WB 4C6YA 4WMCA 4DXCA 1XPBA 1Y54A 3SH9A 3QNBA 5HAQA 4OPQA 1MY8A 3HLGA 3C5AA 2X02A 1K4EA 4DE2A 1IYOA 3Q1FA 4R3BA 2ZQDA 3UE0A 4FH2A 2Y4AA 3HREA 4KZ4A 5GLAA 2Q9NA 1LL9A 3N8RA 2WYXA 5HX9A 5L2FA 1BSGA 4R1GA 4EWFA 4OVDA 2V2FF 4IBXA 1U60A 4LENA 4OOLA 5AQAA 4PM6A 1LHYA 1PW8A 1BZAA 4S2IA 4IBRA 1E3UA 3CG5A 1K6RA 1JWPA 2HPBA 1EWZA 3N8LA 4QU3A 1K38A 1TEMA 2WGWA 4PM8A 5FATA 2CC1A 5EE8A 2VGKA 4GNUA 2G2UA 2ZC7A 2JBFA 4KZ8A 3S4XA 3Q7ZA 5CHJA 3EQVA 5FAPA 1C3BA 1PIOA 4OPZA 3P09A 1RP5A 4LV3A 3MZEA 1EROA 3EQUA 1K54A 3NBLA 2Y2GA 1FCNA 2ZC6B 4KZ5A 5DF7A 2HP5A 5E2HA 3D4FA 2J7VA 3PBSA 3Q81A 1KE3A 4JKTA 1N4OA 1YLYA 1GA0A 1H8YA 3BFCA 3AGEA 2B5RA 2ZJ9A 3ISGA 5FAQA 1MXOA 3UO9A 2HP6A 2OV5A 2HDQA 2WUQA 2J8YA 2XFTA 3MKEA 4F94A 3UPOA 2Z2LB 4JF6A 4EBLA 3ZGAB 4KZ9A 3W4OA 3I7JA 1CEFA 4BJPA 4JXWA 1NYYA 2FFYA 3NC8A 3UDIA 2QZ6A 3VP4A 3GQZA 3HUMA 3MZDA 4X6TA 2HP9A 1MBLA 3O87A 1BLCA 1XXMA 3PAEA 1IKGA 3C4PA 3GTCA 3HUNA 3W4PA 4OPYA 4E3LA 4JXGA 5D3OA 3FKWA 4OKPA 4BD0A 4HEFA 1ALQA 4LCLA 2P74A 2X01A 1HTZA 2WGVA 1PWGA 4MBFA 3Q82A 3IHAA 1PYYA 2WZXA 2Y2HA 5FSRA 5FI7A 1YMSA 4PM9A 4FH4A 1K56A 1PWDA 1BUEA 1XA1A 4GB7A 3V3SA 4K91A 4P87A 3VOYA 1JVJA 1ES4A 3WS0A 3DW0A 5CTNA 4KQQA 1ERMA 1VM1A 3C4OA 1GCEA 1KE4A 4JPMA 4IVKA 4N92A 3IF6C 4UA6A 4KQOA 4JF5A 3WRZA 2Y2NA 4UA9A 4IVIA 3FWLA 2ZD8A 3OPLA 4N1XA 5EECA 3OC2A 3MKFA 1PZOA 2ZMAA 1K55A 4QY6A 2Y2QA 3NDEA 3UNWA 1YLWA 1H5XA 4P6BA 1ZC2A 2ZC3B 1NZOA 5EUAA 1JTDA 4FD8A 2XEPA 5CHMA 1GHPA 4P0MA 3UDFA 4OP8A 1SCWA 4H8RA 5TFQA 5GHYA 1ERQA 1K57A 3PBNA 3UE1A 1YLJA 3OCNA 1LLBA 5DF8A 4S2LA 1FCMA 4UHUA 1DY6A 2WAEA 1TDLA 3IXHA 3BLMA 3IWIA 4JLFA 1CEGA 3SH8A 4IEDA 2XD1A 4XUZA 5JYPA 3OPHA 3G2YA 4OLDA 2UWXA 2Y2KA 1SKFA 1XA7A 2WAFA 3W4QA 1FSYA 2ZQ8A 2XDMA 4OQ0A 5E2GA 5EVIB 5EPHA 4U0TA 1YLZA 4FCFA 5DTTA 2A49A 2G2WA 1XP4A 5HAPA 1HZOA 1QMFA 3FYZA 1JWVA 3A3JA 1FSWA 1E25A 5GHXA 3N7WA 5GL9A 2XQZA 2XK1A 3VFFA 1YQSA 5FDHA 3PBTA 1W8YA 3ZHHA 1DJBA 4XUXA 4DRTA 2A3UA 5FASA 4K0XA 3SH7A 1BLSA 2H0TA 3E2KA 4U3TA 1EI5A 3M6HA 3GR2A 5I94A 3S1YA 1MWTA 2HDRA 4WZ5C 5HW3A 1XGJA 2IWBA 3ZG8B 5A92A 4ID4A 3WRTA 2Y2MA 1I2WA 4YINA 5AQBA 2DCFA 1G68A 3GSGA 2FFFB 3MXSA 4U0XA 3UDXA 4DF6A 1QMEA 3V3RA 2WGWB 2PU4A 4EV4A 1H8ZA 3BFDA 3BLSA 4BQMA 4BENA 2ZQ7A 5AQ7A 5DF9A 4RX3A 4ZAMA 5EVLA 3MZFA 3IH8A 1YT4A 2XR0A 4Y0TA 1ES5A 3S22A 2JE5A 4OQHA 3BFGA 2H0YA 3GRJA 4Y0OA 3DTMA 5CHUA 1WYCA 4X53A 4KG5A 2J9OA 3NDGA 1M6KA 2P9VB 3O88A 3PBQA 5DVAA 1MKIA 1XX2A 2XF3A 2Y2IA 3OCLA 4KZAA 4E3IA 2XD5A 3G31A 3NCKA 4N1HA 2QPNA 1Q2QA 2EX2A 4GDBA 2WKEA 2P9VA 3M2KA 4WYYA 5DTSA 4HBTA 1LI0A 4KG6A 1LI9A 2E8IA 4WEKA 1TDGA 4S2KA 2ZC5B 1L0DA 3VSKA 4GDNA 3BFEA 5CGWA 3Q07A 1HD8A 3NIAA 4RVAA 3IF6B 4QJGA 4KG2A 2XGNA 3UPPA 1DJAA 1NYMA 3HUOA 3VP2A 2EXBA 3A3DA 4WZ4A 1M40A 3HLFA 3IXDA 3N4IA 4BD1A 3IQAA 4DXBA 1FOFA 4PPRA 2DRWA 3GVBA 3WWXA 1BULA 3IF6A 4GOGA 2PBYA 2OSUA 5EVID 3ZFZA 3BM6A 5KSHA 3LY4A 1L0GA 4WMCD 4S2NC 4A5RA 4D2OA 4NETA 1GHMA 1I2SA 4PMAA 3OPRA 1ES2A 2DNSA 4L0LA 1Q2PA 1GA9A 4C75A 4RYEA 3G30A 4KENB 4WEJA 4B88A 3ITBA 4X68A 3V50A 4EQIA 1RGYA 4QHCA 3V39A 3VFHA 2PU2A 5FI6A 4E3KA 3VP3A 2XH9A 2WKHA 2Y55A 4KZ3A 5A91A 2Y2JA 5CTMA 3ZG5A 4B4ZA 3IH9A 1E3UD 1JWZA 3MXRA 5CERA 4BLMA 5HAIA 3VOZA 1CI8A 2I72A 3IF5A 4ZTKA 3RXXA 3W8KA 1PWCA 3QNCA 1KVMA 3E2LA 4E6XA 4E3NA 3PBOA 3BEBA 2R9WA 4P85A 3NY4A 2VGJA 1K6SA 2IWCA 3TSGA 4EUZA 1ONGA 3PBRA 5FI2A 4ZJ3A 4EBPA 5M18A 1IYQA 4KZ6A 4MLLA 5F1GA 5FQMA 5G18A 4E3OA 1NRFA 3ZNTA 1DJCA 2WK0A 2EX6A 4RA7A 4ZBEA 2ZM2A 3VMAA 5JYOA 3RJUA 5AQ9A 5FQ9A 1IELA 4UAAA 3TG9A 3LCEA 1BT5A 1BLPA 3IXBA 1YM1A 3QHYA 4WZ5A 1JTGA 3AGDA 3O86A 4OPRA 5F83A 4UA7A 1ZG6A 1KGEA 2WGIA 4OH0A 3DWKA 3N8SA 5M19A 5GHZA 5HFOA 5TGFA 5CECA 1WYBA 2ZC4B 5KSCA 2H10A 5DTKA 1MWUA 2XLNA 3UN7A 4MEZA 3A3FA 3G32A 3GMWA 4YFMA 3VP1A 1YLTA 2EFUA 4LCMA 3CJMA 2Y2OA 4DE3A 3UPNA 1G6AA 3IWOA 3ZG0A 5FA7A 1MWSA 2WZZA 1XGIA 4QB8A 4E3JA 5CEDA 3WS2A 4CJNA 3BECA 1L0FA 5E43A 1PI5A 3PAGA 1K56D 2Q9MA 3O3VA 4LV0A 3N6IA 4K0WA 3LEZA 3MFDA 4XXRA 1Z6FA 5FAOA 3VP0A 1FR1A 5FQQA 5GLDA 3ZDJA 1IYSA 2BG1A 3WS5A 1OMEA 4N9LA 1PI4A 4HESA 1MWRA 4ZJ2A 4Y0UA 4LV2A 1L2SA 4GN2A 2X71A 1YMXA 4NK3A 1BTLA 2WADA 4JF4A 4PM7A 5CGXA 3IT9A 2C5WB 1KGGA 1W7FA 4E6WA 5J8XA 1O7EA 3BRMA 4JXVA 1S0WA 4MNRA 1FR6A 4S2JA 3FKVA 2EX8A 1W8QA 5FQKA 3UE3A 3ZG9B 3G35A 5EVIC 3DWZA 3HLCA 4MBHA 4S2NA 5EOOA 5F82A 2ZQ9A 4OOYA 1S6RA 3HLWA 5CEBA 2JC7A 4R3JA 5HARA 4M3KA 1ONHA 3M6BA 1I5QA 4N9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZQA A;  3SS4 A;  1BLH A;  1CI9 A;  4R4R A;  5CGS A;  1PZP A;  3WS4 A;  3TOI A;  3C7V A;  2HDU A;  3IXG A;  1NJ4 A;  1IEM A;  2WKI A;  3JYI A;  3MBZ A;  4GKU A;  1LL5 A;  2ZM8 A;  1KDW A;  2V1Z A;  5GLC A;  5F1F A;  2RCX A;  4BL3 A;  2H5S A;  4DDY A;  4DE1 A;  3SS3 A;  5HL1 A;  2JCH A;  5CXW A;  2EX9 A;  3NI9 A;  3BFF A;  4OLG A;  1ESU A;  2OLV A;  2OLU A;  1XKZ A;  1SDE A;  2J9P A;  3LO7 A;  5CRF A;  3UY6 A;  5BOH A;  1KE0 A;  4MBK A;  3SOI A;  4R0Q A;  4X56 A;  3C7U A;  4LV1 A;  1KGF A;  4WEL A;  3GV9 A;  1NY0 A;  2GDN A;  4Q8I A;  5FQJ A;  4OOM A;  3Q7V B;  1CK3 A;  1WE4 A;  1N9B A;  4KZB A;  4WM9 A;  5E2F A;  1K54 C;  4C3Q A;  5U47 A;  3ZCZ A;  4R4S A;  1ESI A;  2HDS A;  4OQI A;  1RGZ A;  3V5M A;  1O07 A;  2R9X A;  1K4F A;  3HBR A;  3Q7V A;  4EBN A;  4E3M A;  2ZM0 A;  4GZB A;  4JXS A;  5FQI A;  3FZC A;  1K25 A;  3ZVW A;  4S2P A;  1VQQ A;  3HLB A;  3AGF A;  3BYD A;  4KQR A;  5A93 A;  4ZDX A;  1IKI A;  1RCJ A;  2EFX A;  1AXB A;  1W79 A;  3IWQ A;  3P98 A;  4QD4 A;  3G4P A;  4S2O A;  3ZVT A;  4GD8 A;  1NZU A;  4Y7P A;  1L0E A;  4O7D A;  3HL9 A;  3IHB A;  1FQG A;  4DDS A;  2BLS A;  2EXA A;  4OP5 A;  5E2E A;  5EOE A;  3CZD A;  3RXW A;  1ES3 A;  4OQG A;  4X55 A;  3M2J A;  1YLP A;  2Z2M B;  1SHV A;  2IWD A;  3ZG7 B;  3HVF A;  1PW1 A;  3A3I A;  3ZNY A;  4Z9Q A;  4QY5 A;  3HLD A;  3OZH A;  1ZG4 A;  3PTE A;  3CMZ A;  2Y2L A;  3SS5 A;  1NXY A;  1KDS A;  2ZLY A;  4GD6 A;  1GHI A;  5KZH A;  4HBU A;  4PM5 A;  1HVB A;  1SDN A;  1W5D A;  5GLB A;  4CPK A;  1MPL A;  4JBF A;  3G2Z A;  3G34 A;  3A3E A;  3ITA A;  3LY3 A;  3FV7 A;  4OON A;  5IHV A;  4FSF A;  4S2M A;  4WBG A;  5A90 A;  3OPP A;  4ZJ1 A;  5TR7 A;  4DE0 A;  1TVF A;  4RX2 A;  2QMI A;  4B4X A;  5KMW A;  1ZKJ A;  2RL3 A;  1K55 C;  1KVL A;  2ZQC A;  3VSL A;  1J9M A;  5M1A A;  2XFS A;  2Y91 A;  4BL2 A;  2Y59 A;  1FCO A;  2Y2P A;  1E4D A;  4X69 A;  4DKI A;  1IYP A;  4KZ7 A;  4R23 A;  3HLE A;  2V20 A;  5EVI A;  3WS1 A;  3B3X A;  1K57 C;  2C6W B;  4C6Y A;  4WMC A;  4DXC A;  1XPB A;  1Y54 A;  3SH9 A;  3QNB A;  5HAQ A;  4OPQ A;  1MY8 A;  3HLG A;  3C5A A;  2X02 A;  1K4E A;  4DE2 A;  1IYO A;  3Q1F A;  4R3B A;  2ZQD A;  3UE0 A;  4FH2 A;  2Y4A A;  3HRE A;  4KZ4 A;  5GLA A;  2Q9N A;  1LL9 A;  3N8R A;  2WYX A;  5HX9 A;  5L2F A;  1BSG A;  4R1G A;  4EWF A;  4OVD A;  2V2F F;  4IBX A;  1U60 A;  4LEN A;  4OOL A;  5AQA A;  4PM6 A;  1LHY A;  1PW8 A;  1BZA A;  4S2I A;  4IBR A;  1E3U A;  3CG5 A;  1K6R A;  1JWP A;  2HPB A;  1EWZ A;  3N8L A;  4QU3 A;  1K38 A;  1TEM A;  2WGW A;  4PM8 A;  5FAT A;  2CC1 A;  5EE8 A;  2VGK A;  4GNU A;  2G2U A;  2ZC7 A;  2JBF A;  4KZ8 A;  3S4X A;  3Q7Z A;  5CHJ A;  3EQV A;  5FAP A;  1C3B A;  1PIO A;  4OPZ A;  3P09 A;  1RP5 A;  4LV3 A;  3MZE A;  1ERO A;  3EQU A;  1K54 A;  3NBL A;  2Y2G A;  1FCN A;  2ZC6 B;  4KZ5 A;  5DF7 A;  2HP5 A;  5E2H A;  3D4F A;  2J7V A;  3PBS A;  3Q81 A;  1KE3 A;  4JKT A;  1N4O A;  1YLY A;  1GA0 A;  1H8Y A;  3BFC A;  3AGE A;  2B5R A;  2ZJ9 A;  3ISG A;  5FAQ A;  1MXO A;  3UO9 A;  2HP6 A;  2OV5 A;  2HDQ A;  2WUQ A;  2J8Y A;  2XFT A;  3MKE A;  4F94 A;  3UPO A;  2Z2L B;  4JF6 A;  4EBL A;  3ZGA B;  4KZ9 A;  3W4O A;  3I7J A;  1CEF A;  4BJP A;  4JXW A;  1NYY A;  2FFY A;  3NC8 A;  3UDI A;  2QZ6 A;  3VP4 A;  3GQZ A;  3HUM A;  3MZD A;  4X6T A;  2HP9 A;  1MBL A;  3O87 A;  1BLC A;  1XXM A;  3PAE A;  1IKG A;  3C4P A;  3GTC A;  3HUN A;  3W4P A;  4OPY A;  4E3L A;  4JXG A;  5D3O A;  3FKW A;  4OKP A;  4BD0 A;  4HEF A;  1ALQ A;  4LCL A;  2P74 A;  2X01 A;  1HTZ A;  2WGV A;  1PWG A;  4MBF A;  3Q82 A;  3IHA A;  1PYY A;  2WZX A;  2Y2H A;  5FSR A;  5FI7 A;  1YMS A;  4PM9 A;  4FH4 A;  1K56 A;  1PWD A;  1BUE A;  1XA1 A;  4GB7 A;  3V3S A;  4K91 A;  4P87 A;  3VOY A;  1JVJ A;  1ES4 A;  3WS0 A;  3DW0 A;  5CTN A;  4KQQ A;  1ERM A;  1VM1 A;  3C4O A;  1GCE A;  1KE4 A;  4JPM A;  4IVK A;  4N92 A;  3IF6 C;  4UA6 A;  4KQO A;  4JF5 A;  3WRZ A;  2Y2N A;  4UA9 A;  4IVI A;  3FWL A;  2ZD8 A;  3OPL A;  4N1X A;  5EEC A;  3OC2 A;  3MKF A;  1PZO A;  2ZMA A;  1K55 A;  4QY6 A;  2Y2Q A;  3NDE A;  3UNW A;  1YLW A;  1H5X A;  4P6B A;  1ZC2 A;  2ZC3 B;  1NZO A;  5EUA A;  1JTD A;  4FD8 A;  2XEP A;  5CHM A;  1GHP A;  4P0M A;  3UDF A;  4OP8 A;  1SCW A;  4H8R A;  5TFQ A;  5GHY A;  1ERQ A;  1K57 A;  3PBN A;  3UE1 A;  1YLJ A;  3OCN A;  1LLB A;  5DF8 A;  4S2L A;  1FCM A;  4UHU A;  1DY6 A;  2WAE A;  1TDL A;  3IXH A;  3BLM A;  3IWI A;  4JLF A;  1CEG A;  3SH8 A;  4IED A;  2XD1 A;  4XUZ A;  5JYP A;  3OPH A;  3G2Y A;  4OLD A;  2UWX A;  2Y2K A;  1SKF A;  1XA7 A;  2WAF A;  3W4Q A;  1FSY A;  2ZQ8 A;  2XDM A;  4OQ0 A;  5E2G A;  5EVI B;  5EPH A;  4U0T A;  1YLZ A;  4FCF A;  5DTT A;  2A49 A;  2G2W A;  1XP4 A;  5HAP A;  1HZO A;  1QMF A;  3FYZ A;  1JWV A;  3A3J A;  1FSW A;  1E25 A;  5GHX A;  3N7W A;  5GL9 A;  2XQZ A;  2XK1 A;  3VFF A;  1YQS A;  5FDH A;  3PBT A;  1W8Y A;  3ZHH A;  1DJB A;  4XUX A;  4DRT A;  2A3U A;  5FAS A;  4K0X A;  3SH7 A;  1BLS A;  2H0T A;  3E2K A;  4U3T A;  1EI5 A;  3M6H A;  3GR2 A;  5I94 A;  3S1Y A;  1MWT A;  2HDR A;  4WZ5 C;  5HW3 A;  1XGJ A;  2IWB A;  3ZG8 B;  5A92 A;  4ID4 A;  3WRT A;  2Y2M A;  1I2W A;  4YIN A;  5AQB A;  2DCF A;  1G68 A;  3GSG A;  2FFF B;  3MXS A;  4U0X A;  3UDX A;  4DF6 A;  1QME A;  3V3R A;  2WGW B;  2PU4 A;  4EV4 A;  1H8Z A;  3BFD A;  3BLS A;  4BQM A;  4BEN A;  2ZQ7 A;  5AQ7 A;  5DF9 A;  4RX3 A;  4ZAM A;  5EVL A;  3MZF A;  3IH8 A;  1YT4 A;  2XR0 A;  4Y0T A;  1ES5 A;  3S22 A;  2JE5 A;  4OQH A;  3BFG A;  2H0Y A;  3GRJ A;  4Y0O A;  3DTM A;  5CHU A;  1WYC A;  4X53 A;  4KG5 A;  2J9O A;  3NDG A;  1M6K A;  2P9V B;  3O88 A;  3PBQ A;  5DVA A;  1MKI A;  1XX2 A;  2XF3 A;  2Y2I A;  3OCL A;  4KZA A;  4E3I A;  2XD5 A;  3G31 A;  3NCK A;  4N1H A;  2QPN A;  1Q2Q A;  2EX2 A;  4GDB A;  2WKE A;  2P9V A;  3M2K A;  4WYY A;  5DTS A;  4HBT A;  1LI0 A;  4KG6 A;  1LI9 A;  2E8I A;  4WEK A;  1TDG A;  4S2K A;  2ZC5 B;  1L0D A;  3VSK A;  4GDN A;  3BFE A;  5CGW A;  3Q07 A;  1HD8 A;  3NIA A;  4RVA A;  3IF6 B;  4QJG A;  4KG2 A;  2XGN A;  3UPP A;  1DJA A;  1NYM A;  3HUO A;  3VP2 A;  2EXB A;  3A3D A;  4WZ4 A;  1M40 A;  3HLF A;  3IXD A;  3N4I A;  4BD1 A;  3IQA A;  4DXB A;  1FOF A;  4PPR A;  2DRW A;  3GVB A;  3WWX A;  1BUL A;  3IF6 A;  4GOG A;  2PBY A;  2OSU A;  5EVI D;  3ZFZ A;  3BM6 A;  5KSH A;  3LY4 A;  1L0G A;  4WMC D;  4S2N C;  4A5R A;  4D2O A;  4NET A;  1GHM A;  1I2S A;  4PMA A;  3OPR A;  1ES2 A;  2DNS A;  4L0L A;  1Q2P A;  1GA9 A;  4C75 A;  4RYE A;  3G30 A;  4KEN B;  4WEJ A;  4B88 A;  3ITB A;  4X68 A;  3V50 A;  4EQI A;  1RGY A;  4QHC A;  3V39 A;  3VFH A;  2PU2 A;  5FI6 A;  4E3K A;  3VP3 A;  2XH9 A;  2WKH A;  2Y55 A;  4KZ3 A;  5A91 A;  2Y2J A;  5CTM A;  3ZG5 A;  4B4Z A;  3IH9 A;  1E3U D;  1JWZ A;  3MXR A;  5CER A;  4BLM A;  5HAI A;  3VOZ A;  1CI8 A;  2I72 A;  3IF5 A;  4ZTK A;  3RXX A;  3W8K A;  1PWC A;  3QNC A;  1KVM A;  3E2L A;  4E6X A;  4E3N A;  3PBO A;  3BEB A;  2R9W A;  4P85 A;  3NY4 A;  2VGJ A;  1K6S A;  2IWC A;  3TSG A;  4EUZ A;  1ONG A;  3PBR A;  5FI2 A;  4ZJ3 A;  4EBP A;  5M18 A;  1IYQ A;  4KZ6 A;  4MLL A;  5F1G A;  5FQM A;  5G18 A;  4E3O A;  1NRF A;  3ZNT A;  1DJC A;  2WK0 A;  2EX6 A;  4RA7 A;  4ZBE A;  2ZM2 A;  3VMA A;  5JYO A;  3RJU A;  5AQ9 A;  5FQ9 A;  1IEL A;  4UAA A;  3TG9 A;  3LCE A;  1BT5 A;  1BLP A;  3IXB A;  1YM1 A;  3QHY A;  4WZ5 A;  1JTG A;  3AGD A;  3O86 A;  4OPR A;  5F83 A;  4UA7 A;  1ZG6 A;  1KGE A;  2WGI A;  4OH0 A;  3DWK A;  3N8S A;  5M19 A;  5GHZ A;  5HFO A;  5TGF A;  5CEC A;  1WYB A;  2ZC4 B;  5KSC A;  2H10 A;  5DTK A;  1MWU A;  2XLN A;  3UN7 A;  4MEZ A;  3A3F A;  3G32 A;  3GMW A;  4YFM A;  3VP1 A;  1YLT A;  2EFU A;  4LCM A;  3CJM A;  2Y2O A;  4DE3 A;  3UPN A;  1G6A A;  3IWO A;  3ZG0 A;  5FA7 A;  1MWS A;  2WZZ A;  1XGI A;  4QB8 A;  4E3J A;  5CED A;  3WS2 A;  4CJN A;  3BEC A;  1L0F A;  5E43 A;  1PI5 A;  3PAG A;  1K56 D;  2Q9M A;  3O3V A;  4LV0 A;  3N6I A;  4K0W A;  3LEZ A;  3MFD A;  4XXR A;  1Z6F A;  5FAO A;  3VP0 A;  1FR1 A;  5FQQ A;  5GLD A;  3ZDJ A;  1IYS A;  2BG1 A;  3WS5 A;  1OME A;  4N9L A;  1PI4 A;  4HES A;  1MWR A;  4ZJ2 A;  4Y0U A;  4LV2 A;  1L2S A;  4GN2 A;  2X71 A;  1YMX A;  4NK3 A;  1BTL A;  2WAD A;  4JF4 A;  4PM7 A;  5CGX A;  3IT9 A;  2C5W B;  1KGG A;  1W7F A;  4E6W A;  5J8X A;  1O7E A;  3BRM A;  4JXV A;  1S0W A;  4MNR A;  1FR6 A;  4S2J A;  3FKV A;  2EX8 A;  1W8Q A;  5FQK A;  3UE3 A;  3ZG9 B;  3G35 A;  5EVI C;  3DWZ A;  3HLC A;  4MBH A;  4S2N A;  5EOO A;  5F82 A;  2ZQ9 A;  4OOY A;  1S6R A;  3HLW A;  5CEB A;  2JC7 A;  4R3J A;  5HAR A;  4M3K A;  1ONH A;  3M6B A;  1I5Q A;  4N9K A; 
#chains in the Genus database with same CATH topology
 1S4R A;  2KX6 A;  2LB9 A;  2HDU A;  3C7V A;  1NJ4 A;  1LL5 A;  4BMW A;  2RCX A;  4BL3 A;  4DE1 A;  5HL1 A;  2V1B A;  2JCH A;  2EX9 A;  3BFF A;  2OLU A;  1SDE A;  3UY6 A;  2KLI A;  3SOI A;  1P0Z A;  2XA7 M;  2XRO A;  1LL8 A;  4WEL A;  2GDN A;  4OOM A;  2V8C A;  1N9B A;  3EWK A;  3V67 A;  1LSX A;  1RGZ A;  1O07 A;  2HJ9 C;  4E3M A;  3CUE A;  3UMD A;  3LUQ A;  4Q0J A;  1K25 A;  4ZRR A;  1VQQ A;  4KQR A;  5A93 A;  4MN7 A;  3P98 A;  4MDZ A;  4O01 A;  2ZBB A;  4P6Z M;  4R38 A;  4O7D A;  3HL9 A;  1CJF A;  4O8G A;  5E2E A;  5EOE A;  3CHW P;  1ES3 A;  4LLO B;  1YLP A;  1T1A A;  2IWD A;  4CLC D;  3FG8 A;  3SS5 A;  4GD6 A;  4B93 A;  2JKG A;  1HVB A;  1W5D A;  1MPL A;  4PAU A;  3KSF A;  3G34 A;  2VX8 A;  4BBU A;  4S2M A;  4WBG A;  1LSW A;  1TS6 A;  4ZJ1 A;  1AWI A;  1TVF A;  3K2N A;  3E4Q A;  4ARZ A;  2XFS A;  4BL2 A;  1FCO A;  4GCZ A;  4I5S A;  2D02 A;  1IYP A;  1F2K A;  2V20 A;  1MKM A;  3WS1 A;  2O0Y A;  4DXC A;  2QJ5 A;  5DKK A;  3EEH A;  4OPQ A;  3T50 A;  5HWV A;  4WN5 A;  2ZQD A;  3UE0 A;  1VEU B;  2P08 A;  5HX9 A;  5L2F A;  4NG2 A;  1JWP A;  4M4X A;  2QYB A;  2Y79 A;  1T1B A;  1S67 L;  3EQV A;  5FAP A;  1PIO A;  4LV3 A;  1K54 A;  4Y13 A;  4KZ5 A;  4X1L A;  3PBS A;  4JKT A;  3AGE A;  2K7S A;  3ISG A;  3RTY A;  1G6O A;  2GJ3 A;  2HP9 A;  3QP6 A;  2PYP A;  3W4P A;  4OPY A;  4CLC C;  4HEF A;  1ALQ A;  4LCL A;  4MBF A;  3IHA A;  1PYY A;  5FSR A;  4FH4 A;  3DTI A;  1ES4 A;  3DW0 A;  4K08 A;  1ERM A;  1KE4 A;  4IVK A;  3LR0 A;  1K55 A;  2IA2 A;  2JKF A;  3VE3 A;  2UV0 E;  3UNW A;  1YLW A;  4P6B A;  3MF0 A;  2ZC3 B;  3A0R A;  2XEP A;  3LIE A;  5CHM A;  3HJI A;  5TFQ A;  3PBN A;  1LLB A;  1DY6 A;  3DTE A;  1G5U A;  4KUO A;  5JYP A;  3OPH A;  1N9O A;  2Y2K A;  1XA7 A;  2XDM A;  3IS2 A;  4L9F A;  5DFX A;  2JHE A;  1HLU P;  1HZO A;  5FDS A;  1FSW A;  5HWW A;  3N7W A;  2XQZ A;  1YQS A;  3PBT A;  1W8Y A;  1DJB A;  4DRT A;  2OAQ 1;  4GHI A;  3NOT C;  5I94 A;  2HDR A;  5A92 A;  4ID4 A;  3WRT A;  2Y2M A;  1DP8 A;  4YIN A;  5AQB A;  2DCF A;  1G68 A;  2FFF B;  1N9N A;  2ACG A;  5HD5 A;  1D1J A;  3BFD A;  4BEN A;  5AQ7 A;  1P9W A;  4NEE D;  3QP1 A;  2ZMV A;  1YT4 A;  1ES5 A;  3BFG A;  3DTM A;  1TD5 A;  1M6K A;  2P9V B;  3O88 A;  4HP4 A;  4E3I A;  3NCK A;  3G31 A;  3LIA A;  4N1H A;  3NEC A;  3M2K A;  3DTK A;  4Z1W A;  3BFE A;  1HD8 A;  3MR0 A;  1XJ4 A;  5AJG A;  2XGN A;  3A3D A;  3N4I A;  2VLG A;  1OTA A;  2AVX A;  3WWX A;  1BUL A;  3C38 A;  5HD3 A;  2PBY A;  1SKO B;  5KSH A;  3T1S A;  1L0G A;  2PRF A;  1ES2 A;  2DNS A;  2VGL S;  1Q2P A;  4L0L A;  3NHQ A;  4RYE A;  5J3W A;  4QHC A;  4E3K A;  2P7J A;  2Y55 A;  2Y2J A;  3MXR A;  3LR4 A;  5EM0 A;  4E3N A;  1NLY A;  2R9W A;  3H7W A;  4EBP A;  4E3O A;  1DJC A;  3S7N A;  4RA7 A;  3RJU A;  5AQ9 A;  5FQ9 A;  3NUL A;  3IS2 B;  2W3D A;  3RFB A;  1BLP A;  4BBV A;  3UB8 A;  4WZ5 A;  3CUE C;  1FIK A;  3FPW A;  5F83 A;  4UA7 A;  4OH0 A;  3DWK A;  5GHZ A;  3KYQ A;  5A8B A;  5TGF A;  5CEC A;  5DTK A;  4MEZ A;  3LGO A;  4HY8 A;  3GMW A;  2EFU A;  4HNB A;  3CJM A;  5F5Y A;  2Y2O A;  2K31 A;  4DJ2 A;  5FA7 A;  2V0U A;  4QB8 A;  5CED A;  5E43 A;  2YKF A;  4HP9 A;  4K0W A;  3T4T A;  5HPF A;  1UGU A;  3VV4 A;  1Y28 A;  4L9G A;  4HES A;  1MWR A;  1OTD A;  2GNX A;  4PM7 A;  2X71 A;  5CGX A;  2WAD A;  2C5W B;  3A0S A;  3B42 A;  1S0W A;  4MNR A;  1FR6 A;  3R4K A;  4S2J A;  4MCW A;  3G35 A;  4NKP A;  1XJ6 A;  3MMH A;  2ZQ9 A;  5CEB A;  3HLW A;  5F6A A;  5F69 A;  4DMZ A;  3T4Q A;  3A0V A;  1S1Z A;  5DJU A;  4R3J A;  5F68 A;  1ONH A;  4H6J B;  3M6B A;  3ZNY A;  3MQO A;  1BLH A;  1PZP A;  2M1C A;  1IEM A;  1P9R A;  3S7Q A;  3EOI A;  4GKU A;  5GLC A;  5F1F A;  1H8M A;  4DDY A;  4OLG A;  3ZYT A;  3KYZ A;  2OLV A;  5BOH A;  2J9P A;  4MBK A;  1L3L A;  2V0W A;  1W63 M;  3EGX C;  4LV1 A;  2G7U A;  3GV9 A;  4Q8I A;  3LEQ A;  3Q7V B;  1CK3 A;  4KZB A;  4WM9 A;  5I5L A;  1K54 C;  4Y5F A;  1ESI A;  2HDS A;  2OAP 1;  3V5M A;  2R9X A;  4NXF A;  3H7W B;  3KYE A;  4JXS A;  4S2P A;  3HLB A;  4EU0 A;  3AGF A;  2WKR A;  1RCJ A;  1AXB A;  4QD4 A;  3ZVT A;  4GD8 A;  4X1M A;  3RXW A;  4OQG A;  3E98 A;  4X55 A;  3M2J A;  3ZG7 B;  2QJ7 A;  1PW1 A;  3A3I A;  1NRJ A;  4QY5 A;  3C30 A;  2Y2L A;  3CMZ A;  3DBA A;  1GHI A;  4PM5 A;  1SDN A;  5GLB A;  4CPK A;  3A3E A;  1F9I A;  1YSQ A;  3OPP A;  4AFI A;  4DE0 A;  2QMI A;  4B4X A;  3D3O A;  1K55 C;  1KVL A;  3TRC A;  2Y91 A;  2EWV A;  4DKI A;  4R23 A;  3HLE A;  2C6W B;  1XPB A;  3P7N A;  4GS9 B;  1MY8 A;  3C5A A;  3U4L P;  2X02 A;  1K4E A;  4DE2 A;  4WL9 A;  4G3V A;  4HIA A;  4R3B A;  4FH2 A;  4HHD A;  2W3G A;  2Q9N A;  3N8R A;  2V2F F;  1U60 A;  4OOL A;  5AQA A;  1PW8 A;  4S2I A;  3OBF A;  1VEU A;  3N8L A;  2VV8 A;  2VJW A;  4CQH A;  4PM8 A;  2WGW A;  5FAT A;  2ZOI A;  1YSP A;  4GNU A;  3LI8 A;  3Q7Z A;  1H0M A;  1C3B A;  1RP5 A;  1ERO A;  2W3E A;  2OOL A;  3EQU A;  4I3A A;  2ZC6 B;  3MFX A;  4PKY A;  3T1R A;  5FAQ A;  4MN6 A;  1MXO A;  4PKY G;  3UO9 A;  2HDQ A;  2XFT A;  3UPO A;  2Z2L B;  4EBL A;  2W27 A;  3ZGA B;  4KZ9 A;  2FFY A;  3UDI A;  3MZD A;  1FIL A;  5TBM B;  4X6T A;  5HZH A;  3O87 A;  5EV0 A;  1XXM A;  3GTC A;  3FKW A;  2P74 A;  2WGV A;  4Q0H A;  4UEY A;  2WZX A;  1STZ A;  3V3S A;  4K91 A;  4P87 A;  3VOY A;  1JVJ A;  2HV1 A;  2Y2N A;  4UA9 A;  3OPL A;  2ZMA A;  1PNE A;  3L7H A;  2Y2Q A;  1H5X A;  1S1Y A;  3C2W A;  5IT5 A;  4IUK A;  5EUA A;  4FD8 A;  4P0M A;  1SCW A;  3UE1 A;  1K57 A;  2B18 A;  5DF8 A;  2WAE A;  4JLF A;  3BLM A;  5HPI A;  4IED A;  4BBT A;  4XUZ A;  2UWX A;  2ZQ8 A;  2A49 A;  1XP4 A;  5HAP A;  5G4Y A;  3KSI A;  1OTI A;  1K0K A;  3VFF A;  1X0O A;  1DRM A;  1V9Y A;  1EI5 A;  3S1Y A;  1MWT A;  4WZ5 C;  5HW3 A;  2IWB A;  1MZU A;  1I2W A;  3UDX A;  1QME A;  2WGW B;  4EV4 A;  3D9Y A;  3O5Y A;  3EGD C;  2VA0 A;  3NJA A;  3CIT A;  3MZF A;  4O0P A;  2L4R A;  2JE5 A;  3GRJ A;  5CHU A;  4KG5 A;  3F1N B;  4NXG A;  4Y17 A;  3OCL A;  2QPN A;  4EUV A;  2WKE A;  2P9V A;  2JKR M;  5DTS A;  1LI0 A;  3IX3 A;  1OTB A;  1LI9 A;  4EXO A;  1UWP X;  2JKR I;  4QJG A;  3Q07 A;  4RVA A;  3NIA A;  3IF6 B;  3UPP A;  4WZ4 A;  5HDC A;  1M40 A;  3HLF A;  4BD1 A;  3IQA A;  3F1P B;  5MC7 A;  1FOF A;  4PPR A;  2DRW A;  3GVB A;  1A0K A;  4B9O A;  4KQD A;  1ZHH B;  3ZFZ A;  1H3Q A;  3LY4 A;  1KOU A;  4D2O A;  4NET A;  1GHM A;  1GA9 A;  5K5B A;  1SKO A;  3BW6 A;  4KEN B;  4WEJ A;  4B88 A;  3ITB A;  3V50 A;  2GZA A;  2WKP A;  1RGY A;  4EQI A;  2PU2 A;  2W1T B;  2XH9 A;  2J3T D;  3ZG5 A;  1JWZ A;  5CER A;  4BLM A;  5HAI A;  3LR3 A;  3RXX A;  1PWC A;  1T18 A;  3BEB A;  2IWC A;  3TSG A;  4FTX A;  3TE8 A;  3PBR A;  5FI2 A;  4ZJ3 A;  5HSQ A;  3FPV A;  3S7O A;  3ZNT A;  4HOI A;  4ZBE A;  5JYO A;  2ZMF A;  4UAA A;  4ETX A;  3PR6 A;  5L07 A;  4OPR A;  2O99 A;  1KGE A;  4R70 A;  5DJT A;  5M19 A;  2A24 A;  4LFU A;  3T1X A;  4HJ4 A;  2CMN A;  1WYB A;  3H9W A;  5LBR A;  4LCM A;  4UQI S;  2Q0O A;  3ZG0 A;  1XGI A;  4E3J A;  1D7E A;  3T4J A;  2Q9M A;  4FUW A;  4LV0 A;  3N6I A;  4XXR A;  3LEZ A;  3MFD A;  4WF0 A;  1Z6F A;  3UE6 A;  3VP0 A;  1FR1 A;  5FQQ A;  5GLD A;  1IYS A;  1OME A;  4N9L A;  1PI4 A;  4ZJ2 A;  2JKT M;  3SS3 A;  5CXW A;  4GN2 A;  3RH8 B;  2KDK A;  4JF4 A;  4EER A;  3IT9 A;  3NOU C;  3R7W B;  3FKV A;  2JKT I;  1F5M A;  3FC7 A;  3ZG9 B;  1Y4O A;  4HQA A;  2J80 A;  2B02 A;  4GW9 A;  1I5Q A;  4N9K A;  2HJE A;  1CI9 A;  5CGS A;  4R4R A;  3WS4 A;  3TOI A;  3IXG A;  4E04 A;  2WKI A;  4G3W A;  4H6J A;  5FL3 A;  1LSV A;  2J3T C;  2ZM8 A;  1KDW A;  3G6O A;  1OT6 A;  3NI9 A;  1VET A;  3KSH A;  4I3J A;  1ESU A;  1XKZ A;  3LO7 A;  3ULF A;  1KE0 A;  2V9A A;  1KGF A;  2Y8H A;  5U47 A;  3ZCZ A;  4R4S A;  2PHY A;  4OQI A;  2VV7 A;  1K4F A;  2BAS A;  2V1A A;  3HBR A;  3Q7V A;  1TS7 A;  2ZM0 A;  3MS6 A;  3FZC A;  3ZVW A;  4ZDX A;  1IKI A;  2EFX A;  2I9V A;  3G4P A;  2OWH A;  4S2O A;  4Y7P A;  1L0E A;  1FQG A;  2BLS A;  3CZD A;  3SW1 A;  2A24 B;  2YKH A;  2Z2M B;  1SHV A;  2PD8 A;  4Z9Q A;  3HLD A;  3OZH A;  3PTE A;  1NXY A;  1KDS A;  2ZLY A;  3OLO A;  5KZH A;  4HBU A;  3MSH A;  3ITA A;  2VEA A;  3FV7 A;  3IX8 A;  4OON A;  5A90 A;  3DAV A;  5KMW A;  5HWT A;  2LB5 A;  1YAX A;  2Y59 A;  2Y2P A;  4X69 A;  1E4D A;  1ODV A;  3QP4 A;  2DMW A;  1K57 C;  5L10 A;  4C6Y A;  1Y54 A;  3SH9 A;  5HAQ A;  4GLQ A;  2HZ5 A;  4MMN A;  3Q1F A;  2NUP C;  3HRE A;  4HH2 A;  4GS9 A;  2P04 A;  2WYX A;  1BSG A;  4R1G A;  4IBX A;  4I3I A;  4LEN A;  1BZA A;  4FOF A;  1K6R A;  4QU3 A;  1K38 A;  1TEM A;  2CC1 A;  5EE8 A;  3H82 B;  4NXB A;  3S4X A;  4KZ8 A;  3B47 A;  5CHJ A;  2MJ6 A;  3P09 A;  2E8J A;  3NBL A;  2Y2G A;  1FCN A;  1VET B;  3EEA A;  2HP5 A;  5E2H A;  2J7V A;  1YLY A;  3L9K A;  4LRZ E;  2HP6 A;  2OV5 A;  4F94 A;  4JF6 A;  2VGL M;  2FH5 A;  3I7J A;  4JXW A;  3OOV A;  1OPX A;  2QZ6 A;  1MBL A;  1G28 A;  3BQ8 A;  2GX5 A;  3PAE A;  1IKG A;  3C4P A;  3HUN A;  1OTE A;  5EM1 A;  4E3L A;  5D3O A;  5TBM A;  4BD0 A;  3UB7 A;  2X01 A;  1CF0 A;  2XA7 S;  2R78 A;  5FI7 A;  1YMS A;  4PM9 A;  1K56 A;  2VV6 A;  4JPM A;  1VB6 A;  3WRZ A;  3FWL A;  3MKF A;  3B33 A;  4QY6 A;  5HL6 A;  3NDE A;  1ZC2 A;  1VHM A;  1JTD A;  4WLA A;  4P6Z S;  3UDF A;  1ERQ A;  3OCN A;  4UHU A;  3CWF A;  1TDL A;  4LRY C;  4Y15 A;  1CEG A;  3W4Q A;  4GJ4 A;  5E2G A;  4U0T A;  4FCF A;  4BWI A;  2FZ0 A;  3A3J A;  4R6L A;  2QKP A;  5GL9 A;  2VK3 A;  3ZHH A;  3PYP A;  4K0X A;  3SZT A;  2H0T A;  3E2K A;  3M6H A;  3GR2 A;  1XGJ A;  4HH3 A;  3GSG A;  4DF6 A;  1H8Z A;  3BLS A;  4BQM A;  5EFW A;  2ZQ7 A;  4RX3 A;  5C5K A;  5EVL A;  3IH8 A;  4G3K A;  2XR0 A;  2PD7 A;  3UME A;  2M7V A;  2PR5 A;  4Y0O A;  2H0Y A;  1WYC A;  1GSW A;  2J9O A;  2EWW A;  2QHK A;  1MKI A;  1XX2 A;  2Y2I A;  2PYR A;  4EES A;  4CLC B;  2XD5 A;  1Q2Q A;  2EX2 A;  4GDB A;  3F1N A;  4HBT A;  1SZV A;  5L09 A;  3F1O A;  3KSG A;  4WEK A;  1GSV A;  3TW8 A;  4S2K A;  2BTF P;  2ZC5 B;  4YNR A;  3VSK A;  2PAV P;  5CGW A;  4KG2 A;  1DJA A;  1NYM A;  3IF6 A;  4GOG A;  3F1P A;  5FEG A;  3LIF A;  4F3L A;  3G30 A;  4II7 A;  3VFH A;  4EW7 A;  5FI6 A;  4KZ3 A;  4MN5 A;  5CTM A;  3IH9 A;  1F98 A;  1CI8 A;  2B95 A;  2I72 A;  3IF5 A;  4ZTK A;  3VOL A;  2W1T A;  3QNC A;  1KVM A;  3E2L A;  2Z6C A;  3PBO A;  3T4L A;  3C8C A;  2VGJ A;  4EUZ A;  1ONG A;  5M18 A;  4KZ6 A;  4MLL A;  2EA9 A;  5F1G A;  3ZQ5 A;  2ZM2 A;  4EEP A;  3U2A A;  3E4O A;  3JVV A;  1YM1 A;  3QHY A;  1JTG A;  1V9Z A;  3AGD A;  3O86 A;  2W0N A;  2WGI A;  1IOU A;  3N8S A;  3TJZ C;  3LIC A;  3E0Y A;  5HFO A;  3LR5 A;  2ZC4 B;  5KSC A;  1MWU A;  2XLN A;  3UN7 A;  4LGW A;  3A3F A;  1TS8 A;  5DKL A;  4KUK A;  2L0W A;  1G6A A;  5IU1 A;  1MWS A;  4CJN A;  3BEC A;  4Y2F A;  1PI5 A;  1K56 D;  5FAO A;  1S66 L;  3UB9 A;  3ZDJ A;  3E4P A;  1S4S A;  1PRQ A;  4NK3 A;  5E2F A;  1YMX A;  1KGG A;  1W7F A;  4E6W A;  1O7E A;  2PDR A;  4JXV A;  2V8F A;  3F1O B;  1XJ3 A;  3UE3 A;  5FQK A;  2XRN A;  3CPT B;  1OT9 A;  5IS1 A;  4MBH A;  5CX7 A;  4Q0I A;  3R7W A;  2O9C A;  4S2N A;  3T1Q B;  1JNU A;  3BWL A;  4OOY A;  2JC7 A;  1W63 Q;  4NXE A;  2ZQA A;  3SS4 A;  3K3D A;  2L1M A;  3JYI A;  3MBZ A;  1XFN A;  1DP6 A;  2V1Z A;  4F3L B;  2H5S A;  5L8M A;  3MJQ A;  3KX0 X;  3LID A;  5CRF A;  3LYX A;  4R0Q A;  4X56 A;  3C7U A;  1NY0 A;  5FQJ A;  4C3Q A;  1WE4 A;  3MQ0 A;  3NOP C;  4IJG A;  1WA9 A;  4EBN A;  4GZB A;  5FQI A;  3T4S A;  3BYD A;  5DFY A;  2INW A;  1W79 A;  3IWQ A;  3PHY A;  3LI9 A;  1NZU A;  1T1C A;  4ME4 A;  3IHB A;  4DDS A;  5KIZ A;  2EXA A;  4OP5 A;  3K3C A;  2WKQ A;  3HVF A;  5J7E A;  1ZG4 A;  4HI4 A;  2NUT C;  5J4E A;  4JGR A;  4JBF A;  3G2Z A;  5AVF A;  1LT0 A;  3LY3 A;  1OJ5 A;  5IHV A;  4FSF A;  3IBR A;  3S7P A;  5TR7 A;  3P01 A;  4ARZ B;  4RX2 A;  1ZKJ A;  3LFV A;  2RL3 A;  2ZQC A;  3VSL A;  1J9M A;  5M1A A;  2ZOH A;  3LIB A;  4KZ7 A;  5EVI A;  3B3X A;  4R3A A;  4WMC A;  3QNB A;  4YOF A;  3HLG A;  2O9A A;  2J3W A;  4I38 A;  1IYO A;  4LPZ A;  2Y4A A;  3QP2 A;  4KZ4 A;  5GLA A;  1LL9 A;  1ZTU A;  4EWF A;  4OVD A;  1XJ2 A;  4PM6 A;  1LHY A;  4IBR A;  1E3U A;  3CG5 A;  2HPB A;  3T4O A;  1EWZ A;  1CQA A;  2VGK A;  2G2U A;  2ZC7 A;  2JBF A;  4OPZ A;  4HJ3 A;  3MZE A;  4YWZ A;  3UB5 P;  2PR6 A;  3H82 A;  5DF7 A;  1UWN X;  3D4F A;  3Q81 A;  1KE3 A;  1N4O A;  1GA0 A;  1H8Y A;  3BFC A;  2PBD P;  2B5R A;  2ZJ9 A;  4JGP A;  2H28 A;  2WUQ A;  2J8Y A;  3MKE A;  3W4O A;  1CEF A;  4BJP A;  4CLC E;  1NYY A;  3IX4 A;  3GEC A;  1EW0 A;  3HCY A;  3NC8 A;  3BY8 A;  3VP4 A;  3GQZ A;  3HUM A;  3GDI A;  1BLC A;  4QWO A;  4JXG A;  4OKP A;  4I39 A;  3W2Z A;  1HTZ A;  1PWG A;  3Q82 A;  2Y2H A;  4Y3I A;  2W1R A;  4X25 A;  1PWD A;  1BUE A;  1XA1 A;  4GB7 A;  3UB6 A;  2HGV A;  3WS0 A;  3PXP A;  5CTN A;  4KQQ A;  1VM1 A;  3C4O A;  1GCE A;  4UA6 A;  1T19 A;  4N92 A;  3IF6 C;  4KQO A;  4JF5 A;  4IVI A;  4N1X A;  2ZD8 A;  5EEC A;  3OC2 A;  1PZO A;  2VKS A;  1NZO A;  2W3H A;  4EET B;  2K2N A;  1GHP A;  4OP8 A;  4H8R A;  5GHY A;  1YLJ A;  1FCM A;  1NLZ A;  4XT2 A;  3IXH A;  3IWI A;  3SH8 A;  3BQA A;  2XD1 A;  3T12 B;  3G2Y A;  4OLD A;  1J3W A;  3VE4 A;  1SKF A;  2WAF A;  1GSX A;  1FSY A;  4OQ0 A;  5EVI B;  2Z6D A;  5EPH A;  1YLZ A;  5DTT A;  2G2W A;  4UQI M;  3BY9 A;  1P97 A;  1QMF A;  3FYZ A;  1JWV A;  4GHI B;  1E25 A;  5GHX A;  4JGQ A;  2XK1 A;  4PHT A;  3ICY A;  5FDH A;  4XUX A;  2A3U A;  4L9E A;  5FAS A;  1YKD A;  2M7U A;  3SH7 A;  1BLS A;  3CAX A;  4U3T A;  3CLO A;  3JPU A;  2HF6 A;  3D72 A;  1YPR A;  3QP8 A;  4JGO A;  3ZG8 B;  3MXS A;  4U0X A;  2W3F A;  3JVU A;  1TS0 A;  3V3R A;  2PU4 A;  2PT7 A;  2ZL1 A;  5DF9 A;  4ZAM A;  3HJK A;  4Y0T A;  3S22 A;  4OQH A;  1N9L A;  4DJ3 A;  4EQ1 A;  2KOI A;  4X53 A;  3NDG A;  3PBQ A;  5DVA A;  2XF3 A;  4KZA A;  1Z09 A;  4ETZ A;  5EVE A;  2QWS A;  3KO6 A;  4WYY A;  4KG6 A;  4CLC A;  2E8I A;  1TDG A;  1L0D A;  4GDN A;  4D60 A;  2XSS A;  3VP2 A;  3HUO A;  2EXB A;  3IXD A;  4DXB A;  1TF1 A;  1ACF A;  2OSU A;  5EVI D;  2JN7 A;  3BM6 A;  4A5R A;  4WMC D;  4S2N C;  5FEF A;  1XFQ A;  1I2S A;  4PMA A;  3BJN A;  4C75 A;  3CI6 A;  4X68 A;  3V39 A;  5TJJ A;  3VP3 A;  1NWZ A;  2WKH A;  5A91 A;  4LRX C;  4B4Z A;  1E3U D;  3VOZ A;  3W8K A;  1BYW A;  2O9B A;  5AVE A;  4E6X A;  1IFQ A;  4P85 A;  3NY4 A;  1K6S A;  1DP9 A;  3MXQ A;  1IYQ A;  5FQM A;  5G18 A;  4XT2 B;  1NRF A;  2WK0 A;  2EX6 A;  3VMA A;  1IEL A;  1MC0 A;  3TG9 A;  3LCE A;  1BT5 A;  5G4Z A;  3IXB A;  2A2L A;  4HJ6 A;  1ZG6 A;  4EEU A;  4ESP A;  2VZW A;  1OJG A;  2H10 A;  3G32 A;  4YFM A;  3VP1 A;  1YLT A;  5HDS A;  1PFL A;  2ZL1 B;  3UPN A;  4DE3 A;  2D01 A;  1D06 A;  3IWO A;  2WZZ A;  3WS2 A;  1L0F A;  4RQ9 A;  4QPR A;  4DN0 A;  3PAG A;  3O3V A;  3QP5 A;  4IHQ A;  2BG1 A;  3WS5 A;  4Y0U A;  4LV2 A;  1L2S A;  3IBJ A;  1BTL A;  5J8X A;  3T4K A;  3BRM A;  4WUJ A;  2EX8 A;  1W8Q A;  4IUH A;  5EVI C;  3DWZ A;  3HLC A;  5EOO A;  5F82 A;  1S6R A;  2OWJ A;  5HAR A;  5HDD A;  4M3K A;  3MQQ A;  3OPR A;  3CPT A;  4S2L A; 
#chains in the Genus database with same CATH homology
 2ZQA A;  3SS4 A;  1BLH A;  1CI9 A;  4R4R A;  5CGS A;  1PZP A;  3WS4 A;  3TOI A;  3C7V A;  2HDU A;  3IXG A;  1NJ4 A;  1IEM A;  2WKI A;  3JYI A;  3MBZ A;  4GKU A;  1LL5 A;  2ZM8 A;  1KDW A;  2V1Z A;  5GLC A;  5F1F A;  2RCX A;  4BL3 A;  2H5S A;  4DDY A;  4DE1 A;  3SS3 A;  5HL1 A;  2JCH A;  5CXW A;  2EX9 A;  3NI9 A;  3BFF A;  4OLG A;  1ESU A;  2OLV A;  2OLU A;  1XKZ A;  1SDE A;  2J9P A;  3LO7 A;  5CRF A;  3UY6 A;  5BOH A;  1KE0 A;  4MBK A;  3SOI A;  4R0Q A;  4X56 A;  3C7U A;  4LV1 A;  1KGF A;  4WEL A;  3GV9 A;  1NY0 A;  2GDN A;  4Q8I A;  5FQJ A;  4OOM A;  3Q7V B;  1CK3 A;  1WE4 A;  1N9B A;  4KZB A;  4WM9 A;  5E2F A;  1K54 C;  4C3Q A;  5U47 A;  3ZCZ A;  4R4S A;  1ESI A;  2HDS A;  4OQI A;  1RGZ A;  3V5M A;  1O07 A;  2R9X A;  1K4F A;  3HBR A;  3Q7V A;  4EBN A;  4E3M A;  2ZM0 A;  4GZB A;  4JXS A;  5FQI A;  3FZC A;  1K25 A;  3ZVW A;  4S2P A;  1VQQ A;  3HLB A;  3AGF A;  3BYD A;  4KQR A;  5A93 A;  4ZDX A;  1IKI A;  1RCJ A;  2EFX A;  1AXB A;  1W79 A;  3IWQ A;  3P98 A;  4QD4 A;  3G4P A;  4S2O A;  3ZVT A;  4GD8 A;  1NZU A;  4Y7P A;  1L0E A;  4O7D A;  3HL9 A;  3IHB A;  1FQG A;  4DDS A;  2BLS A;  2EXA A;  4OP5 A;  5E2E A;  5EOE A;  3CZD A;  3RXW A;  1ES3 A;  4OQG A;  4X55 A;  3M2J A;  1YLP A;  2Z2M B;  1SHV A;  2IWD A;  3ZG7 B;  3HVF A;  1PW1 A;  3A3I A;  3ZNY A;  4Z9Q A;  4QY5 A;  3HLD A;  3OZH A;  1ZG4 A;  3PTE A;  3CMZ A;  2Y2L A;  3SS5 A;  1NXY A;  1KDS A;  2ZLY A;  4GD6 A;  1GHI A;  5KZH A;  4HBU A;  4PM5 A;  1HVB A;  1SDN A;  1W5D A;  5GLB A;  4CPK A;  1MPL A;  4JBF A;  3G2Z A;  3G34 A;  3A3E A;  3ITA A;  3LY3 A;  3FV7 A;  4OON A;  5IHV A;  4FSF A;  4S2M A;  4WBG A;  5A90 A;  3OPP A;  4ZJ1 A;  5TR7 A;  4DE0 A;  1TVF A;  4RX2 A;  2QMI A;  4B4X A;  5KMW A;  1ZKJ A;  2RL3 A;  1K55 C;  1KVL A;  2ZQC A;  3VSL A;  1J9M A;  5M1A A;  2XFS A;  2Y91 A;  4BL2 A;  2Y59 A;  1FCO A;  2Y2P A;  1E4D A;  4X69 A;  4DKI A;  1IYP A;  4KZ7 A;  4R23 A;  3HLE A;  2V20 A;  5EVI A;  3WS1 A;  3B3X A;  1K57 C;  2C6W B;  4C6Y A;  4WMC A;  4DXC A;  1XPB A;  1Y54 A;  3SH9 A;  3QNB A;  5HAQ A;  4OPQ A;  1MY8 A;  3HLG A;  3C5A A;  2X02 A;  1K4E A;  4DE2 A;  1IYO A;  3Q1F A;  4R3B A;  2ZQD A;  3UE0 A;  4FH2 A;  2Y4A A;  3HRE A;  4KZ4 A;  5GLA A;  2Q9N A;  1LL9 A;  3N8R A;  2WYX A;  5HX9 A;  5L2F A;  1BSG A;  4R1G A;  4EWF A;  4OVD A;  2V2F F;  4IBX A;  1U60 A;  4LEN A;  4OOL A;  5AQA A;  4PM6 A;  1LHY A;  1PW8 A;  1BZA A;  4S2I A;  4IBR A;  1E3U A;  3CG5 A;  1K6R A;  1JWP A;  2HPB A;  1EWZ A;  3N8L A;  4QU3 A;  1K38 A;  1TEM A;  2WGW A;  4PM8 A;  5FAT A;  2CC1 A;  5EE8 A;  2VGK A;  4GNU A;  2G2U A;  2ZC7 A;  2JBF A;  4KZ8 A;  3S4X A;  3Q7Z A;  5CHJ A;  3EQV A;  5FAP A;  1C3B A;  1PIO A;  4OPZ A;  3P09 A;  1RP5 A;  4LV3 A;  3MZE A;  1ERO A;  3EQU A;  1K54 A;  3NBL A;  2Y2G A;  1FCN A;  2ZC6 B;  4KZ5 A;  5DF7 A;  2HP5 A;  5E2H A;  3D4F A;  2J7V A;  3PBS A;  3Q81 A;  1KE3 A;  4JKT A;  1N4O A;  1YLY A;  1GA0 A;  1H8Y A;  3BFC A;  3AGE A;  2B5R A;  2ZJ9 A;  3ISG A;  5FAQ A;  1MXO A;  3UO9 A;  2HP6 A;  2OV5 A;  2HDQ A;  2WUQ A;  2J8Y A;  2XFT A;  3MKE A;  4F94 A;  3UPO A;  2Z2L B;  4JF6 A;  4EBL A;  3ZGA B;  4KZ9 A;  3W4O A;  3I7J A;  1CEF A;  4BJP A;  4JXW A;  1NYY A;  2FFY A;  3NC8 A;  3UDI A;  2QZ6 A;  3VP4 A;  3GQZ A;  3HUM A;  3MZD A;  4X6T A;  2HP9 A;  1MBL A;  3O87 A;  1BLC A;  1XXM A;  3PAE A;  1IKG A;  3C4P A;  3GTC A;  3HUN A;  3W4P A;  4OPY A;  4E3L A;  4JXG A;  5D3O A;  3FKW A;  4OKP A;  4BD0 A;  4HEF A;  1ALQ A;  4LCL A;  2P74 A;  2X01 A;  1HTZ A;  2WGV A;  1PWG A;  4MBF A;  3Q82 A;  3IHA A;  1PYY A;  2WZX A;  2Y2H A;  5FSR A;  5FI7 A;  1YMS A;  4PM9 A;  4FH4 A;  1K56 A;  1PWD A;  1BUE A;  1XA1 A;  4GB7 A;  3V3S A;  4K91 A;  4P87 A;  3VOY A;  1JVJ A;  1ES4 A;  3WS0 A;  3DW0 A;  5CTN A;  4KQQ A;  1ERM A;  1VM1 A;  3C4O A;  1GCE A;  1KE4 A;  4JPM A;  4IVK A;  4N92 A;  3IF6 C;  4UA6 A;  4KQO A;  4JF5 A;  3WRZ A;  2Y2N A;  4UA9 A;  4IVI A;  3FWL A;  2ZD8 A;  3OPL A;  4N1X A;  5EEC A;  3OC2 A;  3MKF A;  1PZO A;  2ZMA A;  1K55 A;  4QY6 A;  2Y2Q A;  3NDE A;  3UNW A;  1YLW A;  1H5X A;  4P6B A;  1ZC2 A;  2ZC3 B;  1NZO A;  5EUA A;  1JTD A;  4FD8 A;  2XEP A;  5CHM A;  1GHP A;  4P0M A;  3UDF A;  4OP8 A;  1SCW A;  4H8R A;  5TFQ A;  5GHY A;  1ERQ A;  1K57 A;  3PBN A;  3UE1 A;  1YLJ A;  3OCN A;  1LLB A;  5DF8 A;  4S2L A;  1FCM A;  4UHU A;  1DY6 A;  2WAE A;  1TDL A;  3IXH A;  3BLM A;  3IWI A;  4JLF A;  1CEG A;  3SH8 A;  4IED A;  2XD1 A;  4XUZ A;  5JYP A;  3OPH A;  3G2Y A;  4OLD A;  2UWX A;  2Y2K A;  1SKF A;  1XA7 A;  2WAF A;  3W4Q A;  1FSY A;  2ZQ8 A;  2XDM A;  4OQ0 A;  5E2G A;  5EVI B;  5EPH A;  4U0T A;  1YLZ A;  4FCF A;  5DTT A;  2A49 A;  2G2W A;  1XP4 A;  5HAP A;  1HZO A;  1QMF A;  3FYZ A;  1JWV A;  3A3J A;  1FSW A;  1E25 A;  5GHX A;  3N7W A;  5GL9 A;  2XQZ A;  2XK1 A;  3VFF A;  1YQS A;  5FDH A;  3PBT A;  1W8Y A;  3ZHH A;  1DJB A;  4XUX A;  4DRT A;  2A3U A;  5FAS A;  4K0X A;  3SH7 A;  1BLS A;  2H0T A;  3E2K A;  4U3T A;  1EI5 A;  3M6H A;  3GR2 A;  5I94 A;  3S1Y A;  1MWT A;  2HDR A;  4WZ5 C;  5HW3 A;  1XGJ A;  2IWB A;  3ZG8 B;  5A92 A;  4ID4 A;  3WRT A;  2Y2M A;  1I2W A;  4YIN A;  5AQB A;  2DCF A;  1G68 A;  3GSG A;  2FFF B;  3MXS A;  4U0X A;  3UDX A;  4DF6 A;  1QME A;  3V3R A;  2WGW B;  2PU4 A;  4EV4 A;  1H8Z A;  3BFD A;  3BLS A;  4BQM A;  4BEN A;  2ZQ7 A;  5AQ7 A;  5DF9 A;  4RX3 A;  4ZAM A;  5EVL A;  3MZF A;  3IH8 A;  1YT4 A;  2XR0 A;  4Y0T A;  1ES5 A;  3S22 A;  2JE5 A;  4OQH A;  3BFG A;  2H0Y A;  3GRJ A;  4Y0O A;  3DTM A;  5CHU A;  1WYC A;  4X53 A;  4KG5 A;  2J9O A;  3NDG A;  1M6K A;  2P9V B;  3O88 A;  3PBQ A;  5DVA A;  1MKI A;  1XX2 A;  2XF3 A;  2Y2I A;  3OCL A;  4KZA A;  4E3I A;  2XD5 A;  3G31 A;  3NCK A;  4N1H A;  2QPN A;  1Q2Q A;  2EX2 A;  4GDB A;  2WKE A;  2P9V A;  3M2K A;  4WYY A;  5DTS A;  4HBT A;  1LI0 A;  4KG6 A;  1LI9 A;  2E8I A;  4WEK A;  1TDG A;  4S2K A;  2ZC5 B;  1L0D A;  3VSK A;  4GDN A;  3BFE A;  5CGW A;  3Q07 A;  1HD8 A;  3NIA A;  4RVA A;  3IF6 B;  4QJG A;  4KG2 A;  2XGN A;  3UPP A;  1DJA A;  1NYM A;  3HUO A;  3VP2 A;  2EXB A;  3A3D A;  4WZ4 A;  1M40 A;  3HLF A;  3IXD A;  3N4I A;  4BD1 A;  3IQA A;  4DXB A;  1FOF A;  4PPR A;  2DRW A;  3GVB A;  3WWX A;  1BUL A;  3IF6 A;  4GOG A;  2PBY A;  2OSU A;  5EVI D;  3ZFZ A;  3BM6 A;  5KSH A;  3LY4 A;  1L0G A;  4WMC D;  4S2N C;  4A5R A;  4D2O A;  4NET A;  1GHM A;  1I2S A;  4PMA A;  3OPR A;  1ES2 A;  2DNS A;  4L0L A;  1Q2P A;  1GA9 A;  4C75 A;  4RYE A;  3G30 A;  4KEN B;  4WEJ A;  4B88 A;  3ITB A;  4X68 A;  3V50 A;  4EQI A;  1RGY A;  4QHC A;  3V39 A;  3VFH A;  2PU2 A;  5FI6 A;  4E3K A;  3VP3 A;  2XH9 A;  2WKH A;  2Y55 A;  4KZ3 A;  5A91 A;  2Y2J A;  5CTM A;  3ZG5 A;  4B4Z A;  3IH9 A;  1E3U D;  1JWZ A;  3MXR A;  5CER A;  4BLM A;  5HAI A;  3VOZ A;  1CI8 A;  2I72 A;  3IF5 A;  4ZTK A;  3RXX A;  3W8K A;  1PWC A;  3QNC A;  1KVM A;  3E2L A;  4E6X A;  4E3N A;  3PBO A;  3BEB A;  2R9W A;  4P85 A;  3NY4 A;  2VGJ A;  1K6S A;  2IWC A;  3TSG A;  4EUZ A;  1ONG A;  3PBR A;  5FI2 A;  4ZJ3 A;  4EBP A;  5M18 A;  1IYQ A;  4KZ6 A;  4MLL A;  5F1G A;  5FQM A;  5G18 A;  4E3O A;  1NRF A;  3ZNT A;  1DJC A;  2WK0 A;  2EX6 A;  4RA7 A;  4ZBE A;  2ZM2 A;  3VMA A;  5JYO A;  3RJU A;  5AQ9 A;  5FQ9 A;  1IEL A;  4UAA A;  3TG9 A;  3LCE A;  1BT5 A;  1BLP A;  3IXB A;  1YM1 A;  3QHY A;  4WZ5 A;  1JTG A;  3AGD A;  3O86 A;  4OPR A;  5F83 A;  4UA7 A;  1ZG6 A;  1KGE A;  2WGI A;  4OH0 A;  3DWK A;  3N8S A;  5M19 A;  5GHZ A;  5HFO A;  5TGF A;  5CEC A;  1WYB A;  2ZC4 B;  5KSC A;  2H10 A;  5DTK A;  1MWU A;  2XLN A;  3UN7 A;  4MEZ A;  3A3F A;  3G32 A;  3GMW A;  4YFM A;  3VP1 A;  1YLT A;  2EFU A;  4LCM A;  3CJM A;  2Y2O A;  4DE3 A;  3UPN A;  1G6A A;  3IWO A;  3ZG0 A;  5FA7 A;  1MWS A;  2WZZ A;  1XGI A;  4QB8 A;  4E3J A;  5CED A;  3WS2 A;  4CJN A;  3BEC A;  1L0F A;  5E43 A;  1PI5 A;  3PAG A;  1K56 D;  2Q9M A;  3O3V A;  4LV0 A;  3N6I A;  4K0W A;  3LEZ A;  3MFD A;  4XXR A;  1Z6F A;  5FAO A;  3VP0 A;  1FR1 A;  5FQQ A;  5GLD A;  3ZDJ A;  1IYS A;  2BG1 A;  3WS5 A;  1OME A;  4N9L A;  1PI4 A;  4HES A;  1MWR A;  4ZJ2 A;  4Y0U A;  4LV2 A;  1L2S A;  4GN2 A;  2X71 A;  1YMX A;  4NK3 A;  1BTL A;  2WAD A;  4JF4 A;  4PM7 A;  5CGX A;  3IT9 A;  2C5W B;  1KGG A;  1W7F A;  4E6W A;  5J8X A;  1O7E A;  3BRM A;  4JXV A;  1S0W A;  4MNR A;  1FR6 A;  4S2J A;  3FKV A;  2EX8 A;  1W8Q A;  5FQK A;  3UE3 A;  3ZG9 B;  3G35 A;  5EVI C;  3DWZ A;  3HLC A;  4MBH A;  4S2N A;  5EOO A;  5F82 A;  2ZQ9 A;  4OOY A;  1S6R A;  3HLW A;  5CEB A;  2JC7 A;  4R3J A;  5HAR A;  4M3K A;  1ONH A;  3M6B A;  1I5Q A;  4N9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...