3MQOA

The crystal structure of the pas domain in complex with isopropanol of a transcriptional regulator in the luxr family from burkholderia thailandensis to 1.7a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
113
structure length
113
Chain Sequence
b'IDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, LuxR family
molecule tags Transcription regulator
source organism Burkholderia thailandensis
publication title The Crystal Structure of the PAS domain in complex with isopropanol of a Transcriptional Regulator in the LuxR family from Burkholderia thailandensis to 1.7A
rcsb
total genus 28
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3mqoA00
1F9IA 2L0WA 3KX0X 4WUJA 2WKPA 3MXQA 2BASA 4HJ4A 4HY8A 4I3IA 2M1CA 2PR5A 3LIEA 3F1OB 1G28A 1TS0A 2H28A 2V1AA 2A24A 3K3DA 3PYPA 4JGPA 2WKQA 3LICA 3LIBA 2GJ3A 3LIFA 1S4SA 3D72A 1OTIA 1VB6A 4NXBA 5DJUA 1XFNA 1P0ZA 3F1OA 3NHQA 3PHYA 4HI4A 3CLOA 5TBMB 3RTYA 1MZUA 5IS1A 2D01A 4H6JB 1T1CA 3ZQ5A 2VEAA 1OT9A 4BBTA 4NXEA 2YKFA 3EEHA 1X0OA 5TBMA 3ULFA 2QJ7A 4EQ1A 2PHYA 3LUQA 4M4XA 3A0SA 1TS8A 4I39A 4L9FA 3VOLA 5G4ZA 3NJAA 3UMDA 1UWPX 3NOPC 3NOUC 4R6LA 1OJ5A 2J80A 1DP9A 1LSXA 2OWHA 2CMNA 4R3AA 3BY9A 4JGOA 5HD3A 5A8BA 1OTBA 2QWSA 3CWFA 1TS7A 2QHKA 3HJIA 3P7NA 4HJ6A 4RQ9A 4KUKA 1T1AA 3UB8A 1LSVA 1S1YA 2OWJA 1DP6A 4I3AA 5F6AA 1LT0A 2HV1A 2I9VA 2OOLA 3E4PA 4BBVA 1D7EA 1KOUA 2KX6A 2V9AA 4LRZE 5HD5A 3LI9A 4GHIA 4WL9A 1Y28A 3E4QA 3F1PB 3IBRA 4EXOA 3FG8A 2PYPA 3H82A 4EW7A 1OT6A 3H7WB 3LYXA 3MQQA 4K08A 1UWNX 3ICYA 3LI8A 5HDCA 3UMEA 3IS2B 3VE4A 2Z6DA 3F1NB 1WA9A 1OTAA 4HOIA 5HWWA 3C8CA 1BYWA 1S1ZA 3B33A 3HJKA 1GSXA 2EA9A 4R70A 5KIZA 1F98A 4MN5A 5J3WA 4HHDA 1XJ2A 4HQAA 2K7SA 3IS2A 1S66L 2A24B 1N9OA 1S4RA 1XJ4A 4WN5A 3RH8B 1OTDA 1N9NA 4R38A 5EFWA 2ZOHA 5HDDA 2R78A 3CAXA 4GS9A 4KQDA 3A0VA 4LRXC 1NWZA 1T18A 3G6OA 4EEUA 4PKYA 1JNUA 4EETB 4XT2A 2L4RA 3MFXA 4L9EA 3MR0A 3UE6A 2KDKA 3FC7A 3LIDA 5HDSA 3BWLA 4B9OA 2YKHA 2ZBBA 3H9WA 4GS9B 5J7EA 2Z6CA 2B02A 4KUOA 4WF0A 1GSVA 1XJ3A 2VLGA 1XFQA 4F3LA 2L1MA 2PR6A 4I3JA 4HH2A 1D06A 5DKLA 5IU1A 4EERA 5J4EA 3LIAA 1XJ6A 2D02A 2PD8A 5HWVA 1LSWA 4GW9A 3H82B 3UB9A 5DJTA 5HWTA 2VV8A 3F1PA 3EWKA 2P7JA 2VV7A 3K3CA 4I38A 1T1BA 2W0NA 1OJGA 3MJQA 4HNBA 2VV6A 4E04A 5F69A 1T19A 4EESA 4EEPA 2V0WA 3F1NA 3A0RA 2PD7A 2ZOIA 4JGRA 4XT2B 4DJ2A 2JHEA 3T50A 2QKPA 5AVEA 4JGQA 1EW0A 1V9YA 4HP4A 3MQOA 4GCZA 4HH3A 4NXFA 2W27A 1DRMA 4PKYG 4LRYC 5F68A 2QJ5A 1DP8A 1UGUA 4HIAA 4I5SA 4LPZA 5F5YA 3UB6A 4H6JA 5AVFA 4DJ3A 5HSQA 3SW1A 4L9GA 1S67L 3C2WA 3GDIA 2PDRA 1LL8A 1P97A 4HP9A 2V0UA 3NOTC 4YWZA 3BY8A 4HJ3A 3GECA 3OLOA 1V9ZA 1GSWA 4LLOB 4WLAA 2WKRA 3UB7A 4BBUA 2INWA 4GHIB 1OTEA 4MN6A 5I5LA 3VE3A 2JN7A 5HZHA 3E4OA 3H7WA 4NXGA 5DKKA 1ODVA 4F3LB 2PYRA 2V1BA 1TS6A 5G4YA 1N9LA
chains in the Genus database with same CATH superfamily
1K55A 4CLCD 1H8YA 4R3JA 4JGPA 1KDWA 3LIBA 4PM8A 2GJ3A 1XXMA 1Q2PA 3M2KA 3PBRA 1PWCA 3RTYA 1CI9A 4MNRA 4DE3A 3UMDA 3S7OA 4WZ5A 4CLCA 2KLIA 5AQ9A 4R6LA 4WELA 3Q7VB 5HD3A 3ZNYA 4JF6A 3VFHA 2Q9MA 1HVBA 2WKIA 3TW8A 2OWJA 2Y8HA 5DF9A 3F1PB 3IBRA 2WGWA 4X69A 5CGXA 4EETB 4C75A 2WZZA 3AGEA 2HP9A 4EUVA 3EOIA 5HWWA 1XKZA 1P9RA 1GCEA 4OPZA 2ZMVA 3LEZA 3DTKA 3C7UA 3HLEA 4IHQA 3HLBA 1Y54A 2ZQDA 3LIDA 4JXVA 4KUOA 4XUXA 2VLGA 3UDXA 1U60A 5GHZA 3H82B 5EM1A 4JPMA 4LENA 2JE5A 1PYYA 2ZM0A 3QNBA 5FAPA 3A0RA 3QP1A 2V8FA 1EW0A 1YQSA 1DP8A 2Y2GA 1VHMA 1KE4A 3SW1A 4K0XA 3C2WA 5DFXA 2EWWA 3HLFA 4PM6A 4LLOB 5GL9A 3NECA 5TFQA 2V1BA 4Y5FA 4UEYA 2HJEA 2Y2KA 2PR5A 1TS0A 2PAVP 5KMWA 3ZGAB 1G68A 1OTIA 1XFNA 1J9MA 4Y0TA 3MS6A 4Y15A 4GJ4A 5AJGA 2AVXA 1NZOA 5FL3A 3S7NA 2ZC5B 4U3TA 4KZ9A 2GDNA 5FI6A 4P87A 4XUZA 3OCLA 3UB8A 5FI7A 5F6AA 2O9CA 1M6KA 3G35A 5A91A 2LB5A 3M2JA 3E4QA 3IXGA 4PM5A 3A3FA 4WBGA 2B5RA 4Q8IA 5U47A 5L10A 3HVFA 4HHDA 4OOMA 4HQAA 1K56A 4GDNA 2P04A 1OTDA 2BG1A 1DJBA 1ERMA 2ZOHA 3T4TA 1FIKA 3N4IA 3DTIA 5EM0A 4JXSA 5HW3A 1CEFA 1XFQA 4KZ3A 2ZC4B 3EWKA 1NRFA 5FASA 2W3EA 1RP5A 3SH9A 4E04A 3MKEA 4OVDA 2G7UA 2ZOIA 4EQIA 3T50A 1M40A 3VSLA 2XFSA 5F68A 2K2NA 2VGLS 3GDIA 1LL8A 2HDQA 1CI8A 1I2WA 3UPPA 1ONGA 4GDBA 2DNSA 2VGLM 5K5BA 2HP5A 5L2FA 2Q9NA 5I5LA 1NY0A 5DKKA 2Y2JA 3C7VA 3LIEA 1G28A 4Q0IA 2HGVA 3IF6B 3NI9A 3PYPA 5FI2A 4OQIA 3HL9A 3ZVTA 3SS4A 4N1HA 4KZ7A 5F83A 3WS4A 1MKIA 5I94A 5CTMA 2FZ0A 1VM1A 3N8SA 2QJ7A 4DN0A 2H0YA 2X71A 1LL5A 2H0TA 1HZOA 1CF0A 5DF8A 4GZBA 3NDEA 3JVUA 4HJ6A 1ZG4A 4GHIA 3P01A 4DRTA 5GLDA 3H7WB 3ICYA 2Z6DA 3LR0A 4EBPA 1VEUA 4MN5A 4BL3A 4U0TA 2K7SA 1FR6A 5CHUA 4YFMA 3Q82A 5HDDA 4BQMA 4OH0A 2O0YA 5F1GA 1MWRA 3CMZA 4Y7PA 4QJGA 4L9EA 3MR0A 2KDKA 3QP2A 1QMEA 3ZDJA 3TG9A 5M19A 2P9VA 2ZM8A 4F94A 1XA7A 4M3KA 4EERA 5L07A 2H10A 2UV0E 4I38A 1OJGA 1WYCA 1YKDA 3UE0A 1MWTA 4HESA 4JGQA 1FR1A 5HAPA 2W27A 3WS2A 1JWZA 4BMWA 5FAQA 4UAAA 3WRTA 4YWZA 2XF3A 4O8GA 5A90A 2EX8A 1L3LA 4B4ZA 1TF1A 4X1LA 4EUZA 1WYBA 4PKYA 4WUJA 1FOFA 4LV3A 5DTKA 3VSKA 1SKOB 2WYXA 3HLCA 3BFDA 1XX2A 5GLCA 1MKMA 4S2NC 2WAFA 3Q7ZA 3HLDA 3LUQA 4OP5A 3IX8A 4PM9A 2Y4AA 3CUEA 1NXYA 5CEBA 3HBRA 3DW0A 2FH5A 3R4KA 5KSHA 3LI9A 2B95A 3MQQA 4ETXA 2ACGA 3MFDA 3WS1A 2QYBA 4ARZA 3HLGA 5HDSA 3ZYTA 3G34A 3ZG5A 1FCMA 5HWVA 4FTXA 4Y2FA 5FQJA 5EPHA 3PBSA 2WUQA 4GCZA 1PW8A 3PBNA 1GHPA 4NETA 2PBYA 3OPRA 2PT7A 4JXWA 3MZFA 3E0YA 3IX4A 1V9ZA 1GSWA 2WKRA 3MMHA 4DDYA 4N9LA 4X68A 1YLZA 1IKIA 1HTZA 4XT2B 4X25A 2M1CA 2H28A 4QD4A 3W8KA 2Y2QA 3ZG7B 5CECA 3DTEA 4OOLA 1ESIA 3C38A 3VP3A 4FOFA 5EOOA 5EVIC 2M7UA 1CQAA 3O86A 1O07A 3V5MA 3C30A 3NOPC 3ISGA 2J80A 3GTCA 5JYOA 3WS5A 2GZAA 3TOIA 4RX3A 2PU4A 4QY5A 4WEKA 1T1AA 2VKSA 4BBVA 2OOLA 5EUAA 2QZ6A 4DMZA 2HDRA 4K08A 3UB5P 3BLSA 1OTAA 4JLFA 2BLSA 3V67A 2PBDP 5IT5A 4CJNA 2IWCA 3G31A 4DXCA 2WKHA 1YSPA 2V2FF 1L0GA 4GNUA 2VGKA 5M18A 2PR6A 4ESPA 3VP4A 3HUMA 4KZAA 5IU1A 3NBLA 3LY4A 3EEAA 4GW9A 1SZVA 3UB9A 2XLNA 4LCMA 4S2PA 2IWDA 4B4XA 5F69A 1EWZA 4EEPA 5FQQA 5AVEA 4QB8A 1EI5A 4LRYC 4PKYG 4I5SA 4LPZA 3UDIA 4MLLA 1S67L 2I72A 1P97A 1MWUA 3VOZA 4IUKA 5FEGA 1SCWA 1OTEA 3VE3A 2XD5A 2FFFB 4XXRA 3RJUA 1F9IA 4WYYA 2BASA 4HY8A 4KUKA 3K3DA 3G2YA 3ZG9B 4P0MA 3NY4A 5HL1A 3D4FA 5EOEA 1ZKJA 1OT9A 2EFUA 2HZ5A 3LR5A 2YKFA 1IYQA 2Y2NA 5J8XA 1E4DA 1XA1A 4N1XA 3NOUC 1LSXA 3O3VA 1PZOA 2HJ9C 3MZDA 3KYZA 3CPTA 1BSGA 1IYSA 2EXAA 3Q81A 4ME4A 1S1YA 1PI4A 3LGOA 2HDSA 2QPNA 3EGXC 3LI8A 3FYZA 1ES3A 4BWIA 3B47A 4E3JA 5CRFA 2EA9A 4JBFA 1BLPA 2A24B 3Q1FA 4IVKA 2B18A 4XT2A 1S0WA 3ZVWA 3CPTB 2OLVA 1LL9A 5DF7A 2ZBBA 1XPBA 3E98A 1XJ3A 4RA7A 1ZG6A 4OPRA 1XJ6A 1CK3A 4KENB 2P7JA 4HNBA 4EESA 1EROA 5AQAA 3R7WA 1C3BA 4NXFA 2XROA 4KZBA 1UGUA 1VQQA 4KQRA 1MC0A 1F2KA 3P09A 3MKFA 4HJ3A 3ZCZA 3SOIA 1YSQA 4GHIB 4X53A 2J3TC 2JN7A 1ODVA 4ARZB 3UE3A 2EX9A 3UY6A 3HUOA 2KOIA 1YAXA 4NXBA 2WGWB 1PWDA 3F1OA 3PHYA 3PBQA 3ZG0A 1E3UA 1VEUB 2A49A 5FA7A 4I39A 4L9FA 3FKWA 3DAVA 2HP6A 4R3AA 2OWHA 5A8BA 1RGZA 5LBRA 3L9KA 1ES5A 3JPUA 4NG2A 4MBFA 1PZPA 4KG5A 1ZHHB 3IF6A 2O99A 1W8YA 5HPIA 2W1RA 2V8CA 3T4OA 1GSXA 1BLHA 1F98A 1ES2A 4CQHA 2WKEA 4LV0A 3T4LA 2PRFA 1RCJA 3MFXA 3T1SA 4B88A 4B9OA 2YKHA 4E3NA 2EXBA 4OOYA 1PWGA 3LIAA 5AQ7A 2MJ6A 1DY6A 2V0WA 3V39A 2QKPA 3DBAA 4HP4A 3DWZA 1N9BA 3N6IA 1K6RA 1FQGA 3IT9A 3OLOA 3W4OA 3UB7A 5EVLA 1KGEA 3OC2A 2INWA 2OV5A 3M6HA 4JXGA 4OPQA 3T4SA 2P9VB 2HPBA 4LFUA 4YINA 1JWPA 5CHMA 3KSIA 3KX0X 2E8JA 3LICA 1K6SA 1BTLA 1S4SA 4Y3IA 2J7VA 2X01A 2XDMA 3AGDA 4E3KA 3QP4A 2D01A 1W5DA 2ZC6B 4BBTA 5CTNA 2JKGA 5TBMA 5L09A 4DDSA 4UA7A 1ZC2A 4QPRA 1K57C 2ZQ8A 2R9XA 1L2SA 3HJIA 2ZJ9A 1W7FA 1BUEA 1LSVA 1K56D 1D7EA 1KOUA 2V9AA 4X6TA 4WEJA 1DJCA 2XFTA 3R7WB 5J3WA 1P9WA 4EBLA 1S4RA 1XJ4A 4UQIM 3C4OA 2R78A 3N8LA 4BENA 4UA6A 5L8MA 3Q07A 4MBKA 3BEBA 3FC7A 4OKPA 3IF6C 2H5SA 5DKLA 1H3QA 3MXSA 5DJTA 4B93A 3QP5A 2VV6A 5CHJA 2C5WB 4Y0UA 4CLCB 2WAEA 1IOUA 4DKIA 5F5YA 3D9YA 5AVFA 3KSGA 4Q0HA 5HARA 3NOTC 1BLCA 2ZL1A 4ZBEA 5FQMA 4WZ4A 1FSYA 1CEGA 3IBJA 3VFFA 3MQ0A 2XD1A 2ZC3B 1H8ZA 2L0WA 3MXQA 4QY6A 3W4QA 4PMAA 4U0XA 2A3UA 1MZUA 3T1XA 4H6JB 2JC7A 3T12B 4R4RA 2ZQ7A 3W4PA 3E2LA 3WRZA 4KZ6A 1YM1A 3A0SA 1NZUA 4ID4A 2XQZA 4K0WA 1Z09A 1YLPA 4S2OA 3LEQA 1MXOA 4G3KA 3IWOA 3EQUA 3BRMA 5DTTA 3LYXA 3VE4A 2JKTM 1WA9A 1MBLA 4QHCA 2ZQCA 1S66L 1PIOA 2FFYA 3CAXA 4LRXC 5CXWA 4P6ZS 3G6OA 4HEFA 3QHYA 3KSHA 3JVVA 5J7EA 1TD5A 4OQ0A 3UPOA 1CJFA 4I3JA 3UO9A 4S2JA 5J4EA 2Y2LA 4D60A 3Q7VA 4E3IA 1FILA 1YPRA 4WZ5C 4CLCC 2IWBA 4DJ2A 1G6AA 3GSGA 1V9YA 4WMCA 1ALQA 2J3TD 4DJ3A 5KSCA 4L9GA 4P85A 4S2KA 2WGIA 1LLBA 3CITA 4EU0A 4RX2A 1D1JA 2WK0A 1H0MA 1A0KA 5HZHA 1VETA 1NYMA 4S2MA 2PYRA 4R4SA 4FH4A 2WKPA 4H8RA 3F1OB 2Y55A 5E2FA 1ZTUA 2W1TB 4IEDA 5DJUA 5EV0A 5CEDA 3NHQA 3CLOA 3TJZC 4ZJ3A 5G18A 1FSWA 2VEAA 1X0OA 4DF6A 4E3MA 5FSRA 3BLMA 2VX8A 2EX6A 4P6BA 1DP9A 2CMNA 3BY9A 2Y91A 2QWSA 1TS7A 4IBRA 2J9OA 3GR2A 1E25A 1Q2QA 4I3AA 3UPNA 5JYPA 4EXOA 1Y28A 2XR0A 2PYPA 4K91A 2Q0OA 3ITBA 3BM6A 3IF5A 4MMNA 4ETZA 4OONA 1J3WA 1SKFA 3A0VA 1IFQA 1JNUA 5GHYA 2WADA 2XEPA 3EQVA 1JTDA 1K54C 1YLJA 1K4FA 3LR3A 2Z2MB 3LCEA 3ZG8B 3OPPA 2Y2OA 3HUNA 5C5KA 3OPHA 4HBTA 4NEED 3BFGA 1LHYA 4JGRA 4S2IA 3UB6A 5GHXA 2R9WA 1RGYA 4ZTKA 3TE8A 4O7DA 4BBUA 4Y0OA 3H7WA 4F3LB 3O87A 3IWIA 5EVIB 1IELA 3FV7A 1Y4OA 2V1AA 3SS3A 3A3JA 1VB6A 3UDFA 1P0ZA 5TBMB 4BL2A 3IHAA 3DTMA 3VMAA 2JKRI 2GX5A 3MBZA 5FATA 5AQBA 4G3WA 3TRCA 1BT5A 1LI0A 2JKFA 4JF5A 2G2UA 3BFCA 4UHUA 3FPWA 3CHWP 3IH9A 1BLSA 4R23A 3P7NA 1G6OA 3NULA 2ZQAA 2X02A 1LT0A 3IX3A 2KX6A 2E8IA 3H82A 1UWNX 4HOIA 1XP4A 1S1ZA 2G2WA 4G3VA 5FQ9A 2V1ZA 4PAUA 2Y2MA 4Z1WA 1N9OA 4OLGA 4R38A 4X1MA 4EBNA 2PU2A 3PR6A 2ZQ9A 5F1FA 1XGJA 2B02A 4S2NA 2L1MA 3A3EA 4Y13A 1LSWA 1AXBA 1G5UA 2P08A 5HWTA 3F1PA 3K3CA 3FZCA 5E43A 1T1BA 2W0NA 1T19A 3CUEC 4OQHA 4KZ8A 4LV2A 4C3QA 4FCFA 2RCXA 5EECA 3MQOA 5EVID 2QJ5A 4LCLA 2J9PA 3RXWA 3G32A 5A93A 5CX7A 5M1AA 1K54A 2XA7M 1GA0A 3S7PA 3K2NA 3NIAA 5CGWA 3W2ZA 3ZNTA 4D2OA 5G4YA 4I3IA 4EEUA 3B3XA 1K25A 2W3DA 4IBXA 3LIFA 3E2KA 2UWXA 1H5XA 3T1QB 4Z9QA 1YT4A 4PPRA 3RFBA 1IKGA 3NC8A 3ULFA 4EQ1A 2EX2A 2W3HA 3QP6A 1AWIA 1FCNA 3FPVA 4OQGA 4NKPA 1HD8A 5FEFA 1YLTA 1NRJA 1KDSA 2HV1A 4KZ4A 4EWFA 1VETB 3HLWA 3IS2B 2ZL1B 3F1NB 3VP1A 4WMCD 1BYWA 4DE0A 3C4PA 1SKOA 2JBFA 3VV4A 4C6YA 3RH8B 1T18A 1XGIA 3BWLA 4GS9B 2O9AA 4WF0A 3FWLA 4GKUA 1IYPA 5EVIA 2PD8A 3BW6A 3SH8A 2VV8A 2VV7A 1NLYA 4IUHA 1KGFA 1LI9A 3OCNA 4BJPA 4O01A 2OAP1 5BOHA 3GQZA 5HSQA 1N4OA 4H6JA 2NUTC 1NYYA 1PI5A 4QU3A 5DFYA 3P98A 4X55A 4UA9A 1PNEA 3T4QA 2XH9A 1KVLA 1YMSA 4UQIS 1GHMA 1N9LA 2EWVA 4R0QA 3I7JA 4HJ4A 1MPLA 2BTFP 3OOVA 3D72A 4KQQA 2XRNA 1TVFA 4E3LA 2Y2PA 2W1TA 3M6BA 2VK3A 4N92A 2WZXA 2QMIA 4JF4A 1L0EA 1UWPX 4ZJ2A 2HDUA 2VGJA 1OPXA 2VA0A 4PHTA 4MN7A 3CZDA 2J3WA 2I9VA 3O88A 5TJJA 1YLYA 3ZFZA 3LR4A 4KG2A 3BFFA 3T1RA 3FG8A 3AGFA 3UMEA 4A5RA 3B33A 4FD8A 4R70A 1SDNA 3WWXA 3VP2A 3ITAA 1JVJA 1O7EA 5HL6A 4CPKA 3V3SA 3G30A 3T4JA 4OPYA 3LY3A 4AFIA 4ZAMA 2Y2HA 3HCYA 3QNCA 4LGWA 4GD8A 3HREA 1ES4A 4HIAA 3BQ8A 4MEZA 4HP9A 2PDRA 3QP8A 1F5MA 4E6XA 3GECA 3KYEA 4WLAA 4LV1A 1H8MA 4II7A 2XA7S 3E4OA 4GD6A 3UNWA 5HAQA 3SZTA 4FH2A 5F82A 4O0PA 1K4EA 3N7WA 3IXHA 2A24A 3BFEA 1KE0A 1E3UD 3BECA 3CI6A 4HI4A 4IVIA 1T1CA 1TDGA 1STZA 5E2HA 2ZLYA 1OJ5A 3S1YA 3WS0A 1OTBA 2JKTI 3CWFA 1K38A 3IHBA 2C6WB 4YOFA 1BZAA 3G4PA 4L0LA 2Y79A 1YLWA 1W63M 1FCOA 5CERA 4LRZE 2M7VA 5HDCA 3PAGA 4WM9A 2ZC7A 2XK1A 3U4LP 5HPFA 3C8CA 4DE2A 3OPLA 1PFLA 3U2AA 1KVMA 4KQDA 4X56A 3IWQA 1K0KA 4IJGA 2W3FA 3S7QA 4ZRRA 2ZMAA 1SDEA 4OLDA 3MJQA 5FQKA 2Z2LB 4KQOA 3BYDA 1JTGA 2OLUA 2V0UA 1TDLA 3BY8A 2RL3A 4BLMA 3PAEA 4GOGA 1W63Q 2XGNA 2W3GA 4MN6A 4KG6A 1TS6A 3PBOA 3KO6A 3UE1A 3IQAA 3IXDA 1MWSA 1QMFA 4GLQA 1HLUP 2DCFA 3PTEA 3SS5A 1IEMA 1ESUA 5TR7A 5FDHA 3SH7A 5IS1A 3LFVA 2O9BA 4YNRA 3B42A 4E3OA 3NCKA 2Y59A 1JWVA 1TS8A 3VOLA 3GV9A 4S2LA 4CLCE 1KGGA 3S4XA 1YMXA 4JGOA 5EVEA 5GLAA 1ONHA 3L7HA 3MSHA 2QHKA 2EFXA 2CC1A 3V3RA 1L0FA 2VZWA 3OZHA 5MC7A 3O5YA 1S6RA 5HD5A 3IH8A 4R1GA 4WL9A 4EW7A 4ZJ1A 5KIZA 3N8RA 4HBUA 2J8YA 5GLBA 3NDGA 2LB9A 3BQAA 4P6ZM 3IS2A 2K31A 5DVAA 4GB7A 3GMWA 1PRQA 5EFWA 4GS9A 2OSUA 2ZD8A 2L4RA 2DMWA 3C5AA 4ZDXA 2HF6A 1ERQA 2Z6CA 1GSVA 4HH2A 3TSGA 4BD0A 4KZ5A 4EV4A 2D02A 4E6WA 2ZM2A 1K55C 2P74A 2A2LA 1BULA 2DRWA 4HH3A 4Y17A 1DRMA 3MZEA 5CGSA 5D3OA 3JYIA 3GVBA 5HFOA 1L0DA 5IHVA 2OAQ1 5E2GA 1PW1A 2XSSA 1KE3A 1W79A 3A3DA 2ZMFA 3CJMA 3RXXA 4QWOA 4RVAA 5HX9A 2WKQA 2NUPC 5FQIA 5A92A 3ZQ5A 4GN2A 4NXEA 4MBHA 3EEHA 1GHIA 3EGDC 3ZHHA 4OP8A 2PHYA 4M4XA 5G4ZA 3NJAA 5DTSA 3G2ZA 3GRJA 5HAIA 5FDSA 4R3BA 1W8QA 1NLZA 1GA9A 2GNXA 4RQ9A 4FUWA 1DJAA 1DP6A 3PXPA 3E4PA 3OBFA 4N9KA 1OT6A 5FAOA 4RYEA 3T4KA 3MXRA 2JKRM 3BJNA 3UN7A 1IYOA 3KYQA 3HJKA 3VP0A 1ACFA 5KZHA 1XJ2A 4WN5A 1N9NA 1SHVA 3CG5A 4MDZA 1NWZA 4NK3A 4JKTA 4DE1A 4MCWA 3UE6A 2VJWA 4FSFA 5TGFA 3H9WA 4F3LA 1D06A 1NJ4A 3A3IA 3LO7A 2IA2A 2Y2IA 3V50A 1MY8A 3VOYA 3F1NA 2PD7A 1K57A 2JHEA 4BD1A 4PM7A 3IXBA 2V20A 3DWKA 1WE4A 3PBTA 1Z6FA 2WGVA 3FKVA 1TEMA 3S22A 3D3OA 4Q0JA 1I5QA 1I2SA 4DXBA 4NXGA 2JCHA 3MF0A 1OMEA 5E2EA 3KSFA 5EE8A
chains in the Genus database with same CATH topology
2L0WA 4CLCD 3MXQA 4HJ4A 4XT2B 2M1CA 2H28A 4JGPA 3LIBA 3OOVA 2GJ3A 3D72A 2XRNA 3PBRA 3RTYA 1MZUA 4H6JB 2W1TA 4OOLA 3C38A 4FOFA 2M7UA 3A0SA 3UMDA 3S7OA 3C30A 1UWPX 2KLIA 3NOPC 4CLCA 4R6LA 4WELA 2J80A 5HD3A 1OPXA 2GZAA 4G3KA 2VA0A 4WEKA 4PHTA 1T1AA 4MN7A 2VKSA 2OWJA 3TW8A 4BBVA 2J3WA 2I9VA 3EQUA 2OOLA 5TJJA 2Y8HA 3LR4A 4DMZA 5DF9A 3F1PB 3IBRA 3FG8A 4EETB 3LYXA 4K08A 3UMEA 4EUVA 3EOIA 3VE4A 2JKTM 5HWWA 1WA9A 1OTAA 1P9RA 3B33A 4R70A 2ZMVA 1S66L 3V67A 5IT5A 3CAXA 4LRXC 4P6ZS 3G6OA 4IHQA 3KSHA 1YSPA 3LIDA 3JVVA 5J7EA 1TD5A 4KUOA 2VLGA 2PR6A 4I3JA 5HL6A 5IU1A 5J4EA 3T4JA 3EEAA 4GW9A 3H82B 3UB9A 4AFIA 5F69A 3HCYA 4EEPA 4CLCC 3A0RA 4DJ2A 5AVEA 1EW0A 1V9YA 4PKYG 4LRYC 4HIAA 1DP8A 4I5SA 4LPZA 3BQ8A 1VHMA 2J3TD 4DJ3A 3SW1A 4L9GA 1S67L 3C2WA 4HP9A 2PDRA 1P97A 5DFXA 1F5MA 2EWWA 4IUKA 3GECA 4WLAA 4LLOB 3CITA 4EU0A 1OTEA 1H8MA 3VE3A 4II7A 5HZHA 2XA7S 3E4OA 2PYRA 2V1BA 4Y5FA 4UEYA 2HJEA 1F9IA 2WKPA 2BASA 4HY8A 4O0PA 2PR5A 4KUKA 3F1OB 1TS0A 3K3DA 2A24A 1ZTUA 2W1TB 1OTIA 5DJUA 1XFNA 3NHQA 3CI6A 4HI4A 3CLOA 3TJZC 1T1CA 4GJ4A 2VEAA 1STZA 5AJGA 1OT9A 3LR5A 2YKFA 1X0OA 5FL3A 3S7NA 2VX8A 3NOUC 1OJ5A 1DP9A 1LSXA 2CMNA 3BY9A 2HJ9C 1OTBA 2QWSA 2JKTI 3KYZA 3CWFA 1TS7A 4YOFA 4ME4A 4L0LA 3OCLA 3UB8A 1S1YA 2Y79A 4I3AA 1W63M 5F6AA 2O9CA 2LB5A 4LRZE 4EXOA 1Y28A 3E4QA 2M7VA 2PYPA 5HDCA 3EGXC 3LI8A 4BWIA 4MMNA 3B47A 4ETZA 5HPFA 3C8CA 2EA9A 4HHDA 4OOMA 4HQAA 2A24B 3U2AA 2P04A 1OTDA 2ZOHA 4KQDA 3A0VA 1IFQA 2B18A 3T4TA 1JNUA 4XT2A 3EQVA 2ZBBA 3LR3A 4IJGA 3E98A 1XJ3A 1XFQA 2W3FA 5C5KA 3S7QA 1XJ6A 4ZRRA 3EWKA 2P7JA 4NEED 2W3EA 3MJQA 4HNBA 4E04A 4EESA 2G7UA 2ZOIA 4JGRA 3R7WA 3T50A 4NXFA 2XROA 5F68A 2K2NA 3UB6A 1UGUA 4KQOA 2VGLS 3GDIA 1LL8A 2V0UA 1MC0A 3BY8A 3TE8A 2VGLM 4HJ3A 5K5BA 1W63Q 4BBUA 2W3GA 1YSQA 4GHIB 4MN6A 5I5LA 2J3TC 2JN7A 3H7WA 5DKKA 4F3LB 1ODVA 1TS6A 4ARZB 3PBOA 3KO6A 3UE3A 3LIEA 1G28A 2V1AA 4Q0IA 2HGVA 3PYPA 2KOIA 4GLQA 1VB6A 1YAXA 4NXBA 3PHYA 1P0ZA 3F1OA 5TBMB 5IS1A 3LFVA 2O9BA 2JKRI 3PBQA 2GX5A 2FZ0A 4YNRA 3B42A 2QJ7A 4G3WA 3TRCA 4DN0A 1TS8A 4I39A 4L9FA 3VOLA 3FPWA 4CLCE 4R3AA 2OWHA 5A8BA 4JGOA 5LBRA 2QHKA 3P7NA 3JVUA 1G6OA 4HJ6A 1LT0A 1ZHHB 2VZWA 2KX6A 5MC7A 3O5YA 5HD5A 4GHIA 4WL9A 4EW7A 3P01A 3H82A 2O99A 5KIZA 3H7WB 1UWNX 3ICYA 5HPIA 2Z6DA 4HOIA 2W1RA 1S1ZA 2LB9A 3T4OA 3LR0A 1GSXA 4G3VA 1F98A 3BQAA 4MN5A 4P6ZM 4PAUA 4CQHA 2K7SA 3IS2A 4Z1WA 2K31A 1N9OA 3T4LA 4R38A 5EFWA 5HDDA 4GS9A 2O0YA 2L4RA 2DMWA 3MFXA 3PR6A 3MR0A 4L9EA 2KDKA 4B9OA 2YKHA 2HF6A 2Z6CA 2B02A 1GSVA 2L1MA 4HH2A 4EERA 3LIAA 2D02A 1LSWA 2P08A 5HWTA 3F1PA 4I38A 3K3CA 2MJ6A 1T1BA 2W0NA 1OJGA 2A2LA 1T19A 3CUEC 1YKDA 2V0WA 2QKPA 4JGQA 3DBAA 4HP4A 3MQOA 4HH3A 2W27A 1DRMA 2QJ5A 4BMWA 5CX7A 4YWZA 4O8GA 2XA7M 3OLOA 3S7PA 3UB7A 3K2NA 3OC2A 2INWA 2OAQ1 3W2ZA 1TF1A 3T4SA 2XSSA 5G4YA 4PKYA 2ZMFA 4WUJA 3KSIA 3KX0X 4I3IA 4EEUA 2W3DA 2WKQA 3LICA 2NUPC 3LIFA 1S4SA 4Y3IA 1MKMA 2D01A 3ZQ5A 4BBTA 4NXEA 3RFBA 3EEHA 5TBMA 3ULFA 3EGDC 4EQ1A 2PHYA 3LUQA 4M4XA 2W3HA 5G4ZA 3NJAA 4QPRA 3FPVA 3CUEA 3HJIA 1NLZA 4NKPA 2GNXA 4RQ9A 1NRJA 1LSVA 1DP6A 3PXPA 3E4PA 2HV1A 2FH5A 3OBFA 3R4KA 1D7EA 1KOUA 2V9AA 5KSHA 3LI9A 4WEJA 1OT6A 3MQQA 3T4KA 3IS2B 2JKRM 3BJNA 3F1NB 1BYWA 3R7WB 3KYQA 3HJKA 4ETXA 5J3WA 1XJ2A 3VV4A 1P9WA 2QYBA 1S4RA 1XJ4A 4UQIM 4WN5A 3RH8B 1N9NA 4ARZA 2R78A 4MDZA 1NWZA 1T18A 4MCWA 5L8MA 3UE6A 2VJWA 3FC7A 4FSFA 5HDSA 3BWLA 3ZYTA 4GS9B 2O9AA 3H9WA 4WF0A 4F3LA 1D06A 5DKLA 1H3QA 2PD8A 5HWVA 3BW6A 5DJTA 2VV8A 4Y2FA 2IA2A 2VV7A 4B93A 2VV6A 1NLYA 3PBSA 3F1NA 2PD7A 4IUHA 4CLCB 2JHEA 3OCNA 4BJPA 4O01A 1IOUA 2OAP1 4GCZA 5F5YA 3PBNA 5HSQA 4H6JA 5AVFA 2NUTC 3KSGA 4Q0HA 3PBTA 3NOTC 5DFYA 2PT7A 3D3OA 3E0YA 3T4QA 4Q0JA 1V9ZA 1GSWA 2WKRA 3IBJA 3MMHA 3MQ0A 4UQIS 4NXGA 3MF0A 3KSFA 1N9LA 2EWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9I A;  2L0W A;  3KX0 X;  4WUJ A;  2WKP A;  3MXQ A;  2BAS A;  4HJ4 A;  4HY8 A;  4I3I A;  2M1C A;  2PR5 A;  3LIE A;  3F1O B;  1G28 A;  1TS0 A;  2H28 A;  2V1A A;  2A24 A;  3K3D A;  3PYP A;  4JGP A;  2WKQ A;  3LIC A;  3LIB A;  2GJ3 A;  3LIF A;  1S4S A;  3D72 A;  1OTI A;  1VB6 A;  4NXB A;  5DJU A;  1XFN A;  1P0Z A;  3F1O A;  3NHQ A;  3PHY A;  4HI4 A;  3CLO A;  5TBM B;  3RTY A;  1MZU A;  5IS1 A;  2D01 A;  4H6J B;  1T1C A;  3ZQ5 A;  2VEA A;  1OT9 A;  4BBT A;  4NXE A;  2YKF A;  3EEH A;  1X0O A;  5TBM A;  3ULF A;  2QJ7 A;  4EQ1 A;  2PHY A;  3LUQ A;  4M4X A;  3A0S A;  1TS8 A;  4I39 A;  4L9F A;  3VOL A;  5G4Z A;  3NJA A;  3UMD A;  1UWP X;  3NOP C;  3NOU C;  4R6L A;  1OJ5 A;  2J80 A;  1DP9 A;  1LSX A;  2OWH A;  2CMN A;  4R3A A;  3BY9 A;  4JGO A;  5HD3 A;  5A8B A;  1OTB A;  2QWS A;  3CWF A;  1TS7 A;  2QHK A;  3HJI A;  3P7N A;  4HJ6 A;  4RQ9 A;  4KUK A;  1T1A A;  3UB8 A;  1LSV A;  1S1Y A;  2OWJ A;  1DP6 A;  4I3A A;  5F6A A;  1LT0 A;  2HV1 A;  2I9V A;  2OOL A;  3E4P A;  4BBV A;  1D7E A;  1KOU A;  2KX6 A;  2V9A A;  4LRZ E;  5HD5 A;  3LI9 A;  4GHI A;  4WL9 A;  1Y28 A;  3E4Q A;  3F1P B;  3IBR A;  4EXO A;  3FG8 A;  2PYP A;  3H82 A;  4EW7 A;  1OT6 A;  3H7W B;  3LYX A;  3MQQ A;  4K08 A;  1UWN X;  3ICY A;  3LI8 A;  5HDC A;  3UME A;  3IS2 B;  3VE4 A;  2Z6D A;  3F1N B;  1WA9 A;  1OTA A;  4HOI A;  5HWW A;  3C8C A;  1BYW A;  1S1Z A;  3B33 A;  3HJK A;  1GSX A;  2EA9 A;  4R70 A;  5KIZ A;  1F98 A;  4MN5 A;  5J3W A;  4HHD A;  1XJ2 A;  4HQA A;  2K7S A;  3IS2 A;  1S66 L;  2A24 B;  1N9O A;  1S4R A;  1XJ4 A;  4WN5 A;  3RH8 B;  1OTD A;  1N9N A;  4R38 A;  5EFW A;  2ZOH A;  5HDD A;  2R78 A;  3CAX A;  4GS9 A;  4KQD A;  3A0V A;  4LRX C;  1NWZ A;  1T18 A;  3G6O A;  4EEU A;  4PKY A;  1JNU A;  4EET B;  4XT2 A;  2L4R A;  3MFX A;  4L9E A;  3MR0 A;  3UE6 A;  2KDK A;  3FC7 A;  3LID A;  5HDS A;  3BWL A;  4B9O A;  2YKH A;  2ZBB A;  3H9W A;  4GS9 B;  5J7E A;  2Z6C A;  2B02 A;  4KUO A;  4WF0 A;  1GSV A;  1XJ3 A;  2VLG A;  1XFQ A;  4F3L A;  2L1M A;  2PR6 A;  4I3J A;  4HH2 A;  1D06 A;  5DKL A;  5IU1 A;  4EER A;  5J4E A;  3LIA A;  1XJ6 A;  2D02 A;  2PD8 A;  5HWV A;  1LSW A;  4GW9 A;  3H82 B;  3UB9 A;  5DJT A;  5HWT A;  2VV8 A;  3F1P A;  3EWK A;  2P7J A;  2VV7 A;  3K3C A;  4I38 A;  1T1B A;  2W0N A;  1OJG A;  3MJQ A;  4HNB A;  2VV6 A;  4E04 A;  5F69 A;  1T19 A;  4EES A;  4EEP A;  2V0W A;  3F1N A;  3A0R A;  2PD7 A;  2ZOI A;  4JGR A;  4XT2 B;  4DJ2 A;  2JHE A;  3T50 A;  2QKP A;  5AVE A;  4JGQ A;  1EW0 A;  1V9Y A;  4HP4 A;  3MQO A;  4GCZ A;  4HH3 A;  4NXF A;  2W27 A;  1DRM A;  4PKY G;  4LRY C;  5F68 A;  2QJ5 A;  1DP8 A;  1UGU A;  4HIA A;  4I5S A;  4LPZ A;  5F5Y A;  3UB6 A;  4H6J A;  5AVF A;  4DJ3 A;  5HSQ A;  3SW1 A;  4L9G A;  1S67 L;  3C2W A;  3GDI A;  2PDR A;  1LL8 A;  1P97 A;  4HP9 A;  2V0U A;  3NOT C;  4YWZ A;  3BY8 A;  4HJ3 A;  3GEC A;  3OLO A;  1V9Z A;  1GSW A;  4LLO B;  4WLA A;  2WKR A;  3UB7 A;  4BBU A;  2INW A;  4GHI B;  1OTE A;  4MN6 A;  5I5L A;  3VE3 A;  2JN7 A;  5HZH A;  3E4O A;  3H7W A;  4NXG A;  5DKK A;  1ODV A;  4F3L B;  2PYR A;  2V1B A;  1TS6 A;  5G4Y A;  1N9L A; 
#chains in the Genus database with same CATH topology
 1K55 A;  4CLC D;  1H8Y A;  4R3J A;  4JGP A;  1KDW A;  3LIB A;  4PM8 A;  2GJ3 A;  1XXM A;  1Q2P A;  3M2K A;  3PBR A;  1PWC A;  3RTY A;  1CI9 A;  4MNR A;  4DE3 A;  3UMD A;  3S7O A;  4WZ5 A;  4CLC A;  2KLI A;  5AQ9 A;  4R6L A;  4WEL A;  3Q7V B;  5HD3 A;  3ZNY A;  4JF6 A;  3VFH A;  2Q9M A;  1HVB A;  2WKI A;  3TW8 A;  2OWJ A;  2Y8H A;  5DF9 A;  3F1P B;  3IBR A;  2WGW A;  4X69 A;  5CGX A;  4EET B;  4C75 A;  2WZZ A;  3AGE A;  2HP9 A;  4EUV A;  3EOI A;  5HWW A;  1XKZ A;  1P9R A;  1GCE A;  4OPZ A;  2ZMV A;  3LEZ A;  3DTK A;  3C7U A;  3HLE A;  4IHQ A;  3HLB A;  1Y54 A;  2ZQD A;  3LID A;  4JXV A;  4KUO A;  4XUX A;  2VLG A;  3UDX A;  1U60 A;  5GHZ A;  3H82 B;  5EM1 A;  4JPM A;  4LEN A;  2JE5 A;  1PYY A;  2ZM0 A;  3QNB A;  5FAP A;  3A0R A;  3QP1 A;  2V8F A;  1EW0 A;  1YQS A;  1DP8 A;  2Y2G A;  1VHM A;  1KE4 A;  3SW1 A;  4K0X A;  3C2W A;  5DFX A;  2EWW A;  3HLF A;  4PM6 A;  4LLO B;  5GL9 A;  3NEC A;  5TFQ A;  2V1B A;  4Y5F A;  4UEY A;  2HJE A;  2Y2K A;  2PR5 A;  1TS0 A;  2PAV P;  5KMW A;  3ZGA B;  1G68 A;  1OTI A;  1XFN A;  1J9M A;  4Y0T A;  3MS6 A;  4Y15 A;  4GJ4 A;  5AJG A;  2AVX A;  1NZO A;  5FL3 A;  3S7N A;  2ZC5 B;  4U3T A;  4KZ9 A;  2GDN A;  5FI6 A;  4P87 A;  4XUZ A;  3OCL A;  3UB8 A;  5FI7 A;  5F6A A;  2O9C A;  1M6K A;  3G35 A;  5A91 A;  2LB5 A;  3M2J A;  3E4Q A;  3IXG A;  4PM5 A;  3A3F A;  4WBG A;  2B5R A;  4Q8I A;  5U47 A;  5L10 A;  3HVF A;  4HHD A;  4OOM A;  4HQA A;  1K56 A;  4GDN A;  2P04 A;  1OTD A;  2BG1 A;  1DJB A;  1ERM A;  2ZOH A;  3T4T A;  1FIK A;  3N4I A;  3DTI A;  5EM0 A;  4JXS A;  5HW3 A;  1CEF A;  1XFQ A;  4KZ3 A;  2ZC4 B;  3EWK A;  1NRF A;  5FAS A;  2W3E A;  1RP5 A;  3SH9 A;  4E04 A;  3MKE A;  4OVD A;  2G7U A;  2ZOI A;  4EQI A;  3T50 A;  1M40 A;  3VSL A;  2XFS A;  5F68 A;  2K2N A;  2VGL S;  3GDI A;  1LL8 A;  2HDQ A;  1CI8 A;  1I2W A;  3UPP A;  1ONG A;  4GDB A;  2DNS A;  2VGL M;  5K5B A;  2HP5 A;  5L2F A;  2Q9N A;  5I5L A;  1NY0 A;  5DKK A;  2Y2J A;  3C7V A;  3LIE A;  1G28 A;  4Q0I A;  2HGV A;  3IF6 B;  3NI9 A;  3PYP A;  5FI2 A;  4OQI A;  3HL9 A;  3ZVT A;  3SS4 A;  4N1H A;  4KZ7 A;  5F83 A;  3WS4 A;  1MKI A;  5I94 A;  5CTM A;  2FZ0 A;  1VM1 A;  3N8S A;  2QJ7 A;  4DN0 A;  2H0Y A;  2X71 A;  1LL5 A;  2H0T A;  1HZO A;  1CF0 A;  5DF8 A;  4GZB A;  3NDE A;  3JVU A;  4HJ6 A;  1ZG4 A;  4GHI A;  3P01 A;  4DRT A;  5GLD A;  3H7W B;  3ICY A;  2Z6D A;  3LR0 A;  4EBP A;  1VEU A;  4MN5 A;  4BL3 A;  4U0T A;  2K7S A;  1FR6 A;  5CHU A;  4YFM A;  3Q82 A;  5HDD A;  4BQM A;  4OH0 A;  2O0Y A;  5F1G A;  1MWR A;  3CMZ A;  4Y7P A;  4QJG A;  4L9E A;  3MR0 A;  2KDK A;  3QP2 A;  1QME A;  3ZDJ A;  3TG9 A;  5M19 A;  2P9V A;  2ZM8 A;  4F94 A;  1XA7 A;  4M3K A;  4EER A;  5L07 A;  2H10 A;  2UV0 E;  4I38 A;  1OJG A;  1WYC A;  1YKD A;  3UE0 A;  1MWT A;  4HES A;  4JGQ A;  1FR1 A;  5HAP A;  2W27 A;  3WS2 A;  1JWZ A;  4BMW A;  5FAQ A;  4UAA A;  3WRT A;  4YWZ A;  2XF3 A;  4O8G A;  5A90 A;  2EX8 A;  1L3L A;  4B4Z A;  1TF1 A;  4X1L A;  4EUZ A;  1WYB A;  4PKY A;  4WUJ A;  1FOF A;  4LV3 A;  5DTK A;  3VSK A;  1SKO B;  2WYX A;  3HLC A;  3BFD A;  1XX2 A;  5GLC A;  1MKM A;  4S2N C;  2WAF A;  3Q7Z A;  3HLD A;  3LUQ A;  4OP5 A;  3IX8 A;  4PM9 A;  2Y4A A;  3CUE A;  1NXY A;  5CEB A;  3HBR A;  3DW0 A;  2FH5 A;  3R4K A;  5KSH A;  3LI9 A;  2B95 A;  3MQQ A;  4ETX A;  2ACG A;  3MFD A;  3WS1 A;  2QYB A;  4ARZ A;  3HLG A;  5HDS A;  3ZYT A;  3G34 A;  3ZG5 A;  1FCM A;  5HWV A;  4FTX A;  4Y2F A;  5FQJ A;  5EPH A;  3PBS A;  2WUQ A;  4GCZ A;  1PW8 A;  3PBN A;  1GHP A;  4NET A;  2PBY A;  3OPR A;  2PT7 A;  4JXW A;  3MZF A;  3E0Y A;  3IX4 A;  1V9Z A;  1GSW A;  2WKR A;  3MMH A;  4DDY A;  4N9L A;  4X68 A;  1YLZ A;  1IKI A;  1HTZ A;  4XT2 B;  4X25 A;  2M1C A;  2H28 A;  4QD4 A;  3W8K A;  2Y2Q A;  3ZG7 B;  5CEC A;  3DTE A;  4OOL A;  1ESI A;  3C38 A;  3VP3 A;  4FOF A;  5EOO A;  5EVI C;  2M7U A;  1CQA A;  3O86 A;  1O07 A;  3V5M A;  3C30 A;  3NOP C;  3ISG A;  2J80 A;  3GTC A;  5JYO A;  3WS5 A;  2GZA A;  3TOI A;  4RX3 A;  2PU4 A;  4QY5 A;  4WEK A;  1T1A A;  2VKS A;  4BBV A;  2OOL A;  5EUA A;  2QZ6 A;  4DMZ A;  2HDR A;  4K08 A;  3UB5 P;  3BLS A;  1OTA A;  4JLF A;  2BLS A;  3V67 A;  2PBD P;  5IT5 A;  4CJN A;  2IWC A;  3G31 A;  4DXC A;  2WKH A;  1YSP A;  2V2F F;  1L0G A;  4GNU A;  2VGK A;  5M18 A;  2PR6 A;  4ESP A;  3VP4 A;  3HUM A;  4KZA A;  5IU1 A;  3NBL A;  3LY4 A;  3EEA A;  4GW9 A;  1SZV A;  3UB9 A;  2XLN A;  4LCM A;  4S2P A;  2IWD A;  4B4X A;  5F69 A;  1EWZ A;  4EEP A;  5FQQ A;  5AVE A;  4QB8 A;  1EI5 A;  4LRY C;  4PKY G;  4I5S A;  4LPZ A;  3UDI A;  4MLL A;  1S67 L;  2I72 A;  1P97 A;  1MWU A;  3VOZ A;  4IUK A;  5FEG A;  1SCW A;  1OTE A;  3VE3 A;  2XD5 A;  2FFF B;  4XXR A;  3RJU A;  1F9I A;  4WYY A;  2BAS A;  4HY8 A;  4KUK A;  3K3D A;  3G2Y A;  3ZG9 B;  4P0M A;  3NY4 A;  5HL1 A;  3D4F A;  5EOE A;  1ZKJ A;  1OT9 A;  2EFU A;  2HZ5 A;  3LR5 A;  2YKF A;  1IYQ A;  2Y2N A;  5J8X A;  1E4D A;  1XA1 A;  4N1X A;  3NOU C;  1LSX A;  3O3V A;  1PZO A;  2HJ9 C;  3MZD A;  3KYZ A;  3CPT A;  1BSG A;  1IYS A;  2EXA A;  3Q81 A;  4ME4 A;  1S1Y A;  1PI4 A;  3LGO A;  2HDS A;  2QPN A;  3EGX C;  3LI8 A;  3FYZ A;  1ES3 A;  4BWI A;  3B47 A;  4E3J A;  5CRF A;  2EA9 A;  4JBF A;  1BLP A;  2A24 B;  3Q1F A;  4IVK A;  2B18 A;  4XT2 A;  1S0W A;  3ZVW A;  3CPT B;  2OLV A;  1LL9 A;  5DF7 A;  2ZBB A;  1XPB A;  3E98 A;  1XJ3 A;  4RA7 A;  1ZG6 A;  4OPR A;  1XJ6 A;  1CK3 A;  4KEN B;  2P7J A;  4HNB A;  4EES A;  1ERO A;  5AQA A;  3R7W A;  1C3B A;  4NXF A;  2XRO A;  4KZB A;  1UGU A;  1VQQ A;  4KQR A;  1MC0 A;  1F2K A;  3P09 A;  3MKF A;  4HJ3 A;  3ZCZ A;  3SOI A;  1YSQ A;  4GHI B;  4X53 A;  2J3T C;  2JN7 A;  1ODV A;  4ARZ B;  3UE3 A;  2EX9 A;  3UY6 A;  3HUO A;  2KOI A;  1YAX A;  4NXB A;  2WGW B;  1PWD A;  3F1O A;  3PHY A;  3PBQ A;  3ZG0 A;  1E3U A;  1VEU B;  2A49 A;  5FA7 A;  4I39 A;  4L9F A;  3FKW A;  3DAV A;  2HP6 A;  4R3A A;  2OWH A;  5A8B A;  1RGZ A;  5LBR A;  3L9K A;  1ES5 A;  3JPU A;  4NG2 A;  4MBF A;  1PZP A;  4KG5 A;  1ZHH B;  3IF6 A;  2O99 A;  1W8Y A;  5HPI A;  2W1R A;  2V8C A;  3T4O A;  1GSX A;  1BLH A;  1F98 A;  1ES2 A;  4CQH A;  2WKE A;  4LV0 A;  3T4L A;  2PRF A;  1RCJ A;  3MFX A;  3T1S A;  4B88 A;  4B9O A;  2YKH A;  4E3N A;  2EXB A;  4OOY A;  1PWG A;  3LIA A;  5AQ7 A;  2MJ6 A;  1DY6 A;  2V0W A;  3V39 A;  2QKP A;  3DBA A;  4HP4 A;  3DWZ A;  1N9B A;  3N6I A;  1K6R A;  1FQG A;  3IT9 A;  3OLO A;  3W4O A;  3UB7 A;  5EVL A;  1KGE A;  3OC2 A;  2INW A;  2OV5 A;  3M6H A;  4JXG A;  4OPQ A;  3T4S A;  2P9V B;  2HPB A;  4LFU A;  4YIN A;  1JWP A;  5CHM A;  3KSI A;  3KX0 X;  2E8J A;  3LIC A;  1K6S A;  1BTL A;  1S4S A;  4Y3I A;  2J7V A;  2X01 A;  2XDM A;  3AGD A;  4E3K A;  3QP4 A;  2D01 A;  1W5D A;  2ZC6 B;  4BBT A;  5CTN A;  2JKG A;  5TBM A;  5L09 A;  4DDS A;  4UA7 A;  1ZC2 A;  4QPR A;  1K57 C;  2ZQ8 A;  2R9X A;  1L2S A;  3HJI A;  2ZJ9 A;  1W7F A;  1BUE A;  1LSV A;  1K56 D;  1D7E A;  1KOU A;  2V9A A;  4X6T A;  4WEJ A;  1DJC A;  2XFT A;  3R7W B;  5J3W A;  1P9W A;  4EBL A;  1S4R A;  1XJ4 A;  4UQI M;  3C4O A;  2R78 A;  3N8L A;  4BEN A;  4UA6 A;  5L8M A;  3Q07 A;  4MBK A;  3BEB A;  3FC7 A;  4OKP A;  3IF6 C;  2H5S A;  5DKL A;  1H3Q A;  3MXS A;  5DJT A;  4B93 A;  3QP5 A;  2VV6 A;  5CHJ A;  2C5W B;  4Y0U A;  4CLC B;  2WAE A;  1IOU A;  4DKI A;  5F5Y A;  3D9Y A;  5AVF A;  3KSG A;  4Q0H A;  5HAR A;  3NOT C;  1BLC A;  2ZL1 A;  4ZBE A;  5FQM A;  4WZ4 A;  1FSY A;  1CEG A;  3IBJ A;  3VFF A;  3MQ0 A;  2XD1 A;  2ZC3 B;  1H8Z A;  2L0W A;  3MXQ A;  4QY6 A;  3W4Q A;  4PMA A;  4U0X A;  2A3U A;  1MZU A;  3T1X A;  4H6J B;  2JC7 A;  3T12 B;  4R4R A;  2ZQ7 A;  3W4P A;  3E2L A;  3WRZ A;  4KZ6 A;  1YM1 A;  3A0S A;  1NZU A;  4ID4 A;  2XQZ A;  4K0W A;  1Z09 A;  1YLP A;  4S2O A;  3LEQ A;  1MXO A;  4G3K A;  3IWO A;  3EQU A;  3BRM A;  5DTT A;  3LYX A;  3VE4 A;  2JKT M;  1WA9 A;  1MBL A;  4QHC A;  2ZQC A;  1S66 L;  1PIO A;  2FFY A;  3CAX A;  4LRX C;  5CXW A;  4P6Z S;  3G6O A;  4HEF A;  3QHY A;  3KSH A;  3JVV A;  5J7E A;  1TD5 A;  4OQ0 A;  3UPO A;  1CJF A;  4I3J A;  3UO9 A;  4S2J A;  5J4E A;  2Y2L A;  4D60 A;  3Q7V A;  4E3I A;  1FIL A;  1YPR A;  4WZ5 C;  4CLC C;  2IWB A;  4DJ2 A;  1G6A A;  3GSG A;  1V9Y A;  4WMC A;  1ALQ A;  2J3T D;  4DJ3 A;  5KSC A;  4L9G A;  4P85 A;  4S2K A;  2WGI A;  1LLB A;  3CIT A;  4EU0 A;  4RX2 A;  1D1J A;  2WK0 A;  1H0M A;  1A0K A;  5HZH A;  1VET A;  1NYM A;  4S2M A;  2PYR A;  4R4S A;  4FH4 A;  2WKP A;  4H8R A;  3F1O B;  2Y55 A;  5E2F A;  1ZTU A;  2W1T B;  4IED A;  5DJU A;  5EV0 A;  5CED A;  3NHQ A;  3CLO A;  3TJZ C;  4ZJ3 A;  5G18 A;  1FSW A;  2VEA A;  1X0O A;  4DF6 A;  4E3M A;  5FSR A;  3BLM A;  2VX8 A;  2EX6 A;  4P6B A;  1DP9 A;  2CMN A;  3BY9 A;  2Y91 A;  2QWS A;  1TS7 A;  4IBR A;  2J9O A;  3GR2 A;  1E25 A;  1Q2Q A;  4I3A A;  3UPN A;  5JYP A;  4EXO A;  1Y28 A;  2XR0 A;  2PYP A;  4K91 A;  2Q0O A;  3ITB A;  3BM6 A;  3IF5 A;  4MMN A;  4ETZ A;  4OON A;  1J3W A;  1SKF A;  3A0V A;  1IFQ A;  1JNU A;  5GHY A;  2WAD A;  2XEP A;  3EQV A;  1JTD A;  1K54 C;  1YLJ A;  1K4F A;  3LR3 A;  2Z2M B;  3LCE A;  3ZG8 B;  3OPP A;  2Y2O A;  3HUN A;  5C5K A;  3OPH A;  4HBT A;  4NEE D;  3BFG A;  1LHY A;  4JGR A;  4S2I A;  3UB6 A;  5GHX A;  2R9W A;  1RGY A;  4ZTK A;  3TE8 A;  4O7D A;  4BBU A;  4Y0O A;  3H7W A;  4F3L B;  3O87 A;  3IWI A;  5EVI B;  1IEL A;  3FV7 A;  1Y4O A;  2V1A A;  3SS3 A;  3A3J A;  1VB6 A;  3UDF A;  1P0Z A;  5TBM B;  4BL2 A;  3IHA A;  3DTM A;  3VMA A;  2JKR I;  2GX5 A;  3MBZ A;  5FAT A;  5AQB A;  4G3W A;  3TRC A;  1BT5 A;  1LI0 A;  2JKF A;  4JF5 A;  2G2U A;  3BFC A;  4UHU A;  3FPW A;  3CHW P;  3IH9 A;  1BLS A;  4R23 A;  3P7N A;  1G6O A;  3NUL A;  2ZQA A;  2X02 A;  1LT0 A;  3IX3 A;  2KX6 A;  2E8I A;  3H82 A;  1UWN X;  4HOI A;  1XP4 A;  1S1Z A;  2G2W A;  4G3V A;  5FQ9 A;  2V1Z A;  4PAU A;  2Y2M A;  4Z1W A;  1N9O A;  4OLG A;  4R38 A;  4X1M A;  4EBN A;  2PU2 A;  3PR6 A;  2ZQ9 A;  5F1F A;  1XGJ A;  2B02 A;  4S2N A;  2L1M A;  3A3E A;  4Y13 A;  1LSW A;  1AXB A;  1G5U A;  2P08 A;  5HWT A;  3F1P A;  3K3C A;  3FZC A;  5E43 A;  1T1B A;  2W0N A;  1T19 A;  3CUE C;  4OQH A;  4KZ8 A;  4LV2 A;  4C3Q A;  4FCF A;  2RCX A;  5EEC A;  3MQO A;  5EVI D;  2QJ5 A;  4LCL A;  2J9P A;  3RXW A;  3G32 A;  5A93 A;  5CX7 A;  5M1A A;  1K54 A;  2XA7 M;  1GA0 A;  3S7P A;  3K2N A;  3NIA A;  5CGW A;  3W2Z A;  3ZNT A;  4D2O A;  5G4Y A;  4I3I A;  4EEU A;  3B3X A;  1K25 A;  2W3D A;  4IBX A;  3LIF A;  3E2K A;  2UWX A;  1H5X A;  3T1Q B;  4Z9Q A;  1YT4 A;  4PPR A;  3RFB A;  1IKG A;  3NC8 A;  3ULF A;  4EQ1 A;  2EX2 A;  2W3H A;  3QP6 A;  1AWI A;  1FCN A;  3FPV A;  4OQG A;  4NKP A;  1HD8 A;  5FEF A;  1YLT A;  1NRJ A;  1KDS A;  2HV1 A;  4KZ4 A;  4EWF A;  1VET B;  3HLW A;  3IS2 B;  2ZL1 B;  3F1N B;  3VP1 A;  4WMC D;  1BYW A;  4DE0 A;  3C4P A;  1SKO A;  2JBF A;  3VV4 A;  4C6Y A;  3RH8 B;  1T18 A;  1XGI A;  3BWL A;  4GS9 B;  2O9A A;  4WF0 A;  3FWL A;  4GKU A;  1IYP A;  5EVI A;  2PD8 A;  3BW6 A;  3SH8 A;  2VV8 A;  2VV7 A;  1NLY A;  4IUH A;  1KGF A;  1LI9 A;  3OCN A;  4BJP A;  4O01 A;  2OAP 1;  5BOH A;  3GQZ A;  5HSQ A;  1N4O A;  4H6J A;  2NUT C;  1NYY A;  1PI5 A;  4QU3 A;  5DFY A;  3P98 A;  4X55 A;  4UA9 A;  1PNE A;  3T4Q A;  2XH9 A;  1KVL A;  1YMS A;  4UQI S;  1GHM A;  1N9L A;  2EWV A;  4R0Q A;  3I7J A;  4HJ4 A;  1MPL A;  2BTF P;  3OOV A;  3D72 A;  4KQQ A;  2XRN A;  1TVF A;  4E3L A;  2Y2P A;  2W1T A;  3M6B A;  2VK3 A;  4N92 A;  2WZX A;  2QMI A;  4JF4 A;  1L0E A;  1UWP X;  4ZJ2 A;  2HDU A;  2VGJ A;  1OPX A;  2VA0 A;  4PHT A;  4MN7 A;  3CZD A;  2J3W A;  2I9V A;  3O88 A;  5TJJ A;  1YLY A;  3ZFZ A;  3LR4 A;  4KG2 A;  3BFF A;  3T1R A;  3FG8 A;  3AGF A;  3UME A;  4A5R A;  3B33 A;  4FD8 A;  4R70 A;  1SDN A;  3WWX A;  3VP2 A;  3ITA A;  1JVJ A;  1O7E A;  5HL6 A;  4CPK A;  3V3S A;  3G30 A;  3T4J A;  4OPY A;  3LY3 A;  4AFI A;  4ZAM A;  2Y2H A;  3HCY A;  3QNC A;  4LGW A;  4GD8 A;  3HRE A;  1ES4 A;  4HIA A;  3BQ8 A;  4MEZ A;  4HP9 A;  2PDR A;  3QP8 A;  1F5M A;  4E6X A;  3GEC A;  3KYE A;  4WLA A;  4LV1 A;  1H8M A;  4II7 A;  2XA7 S;  3E4O A;  4GD6 A;  3UNW A;  5HAQ A;  3SZT A;  4FH2 A;  5F82 A;  4O0P A;  1K4E A;  3N7W A;  3IXH A;  2A24 A;  3BFE A;  1KE0 A;  1E3U D;  3BEC A;  3CI6 A;  4HI4 A;  4IVI A;  1T1C A;  1TDG A;  1STZ A;  5E2H A;  2ZLY A;  1OJ5 A;  3S1Y A;  3WS0 A;  1OTB A;  2JKT I;  3CWF A;  1K38 A;  3IHB A;  2C6W B;  4YOF A;  1BZA A;  3G4P A;  4L0L A;  2Y79 A;  1YLW A;  1W63 M;  1FCO A;  5CER A;  4LRZ E;  2M7V A;  5HDC A;  3PAG A;  4WM9 A;  2ZC7 A;  2XK1 A;  3U4L P;  5HPF A;  3C8C A;  4DE2 A;  3OPL A;  1PFL A;  3U2A A;  1KVM A;  4KQD A;  4X56 A;  3IWQ A;  1K0K A;  4IJG A;  2W3F A;  3S7Q A;  4ZRR A;  2ZMA A;  1SDE A;  4OLD A;  3MJQ A;  5FQK A;  2Z2L B;  4KQO A;  3BYD A;  1JTG A;  2OLU A;  2V0U A;  1TDL A;  3BY8 A;  2RL3 A;  4BLM A;  3PAE A;  4GOG A;  1W63 Q;  2XGN A;  2W3G A;  4MN6 A;  4KG6 A;  1TS6 A;  3PBO A;  3KO6 A;  3UE1 A;  3IQA A;  3IXD A;  1MWS A;  1QMF A;  4GLQ A;  1HLU P;  2DCF A;  3PTE A;  3SS5 A;  1IEM A;  1ESU A;  5TR7 A;  5FDH A;  3SH7 A;  5IS1 A;  3LFV A;  2O9B A;  4YNR A;  3B42 A;  4E3O A;  3NCK A;  2Y59 A;  1JWV A;  1TS8 A;  3VOL A;  3GV9 A;  4S2L A;  4CLC E;  1KGG A;  3S4X A;  1YMX A;  4JGO A;  5EVE A;  5GLA A;  1ONH A;  3L7H A;  3MSH A;  2QHK A;  2EFX A;  2CC1 A;  3V3R A;  1L0F A;  2VZW A;  3OZH A;  5MC7 A;  3O5Y A;  1S6R A;  5HD5 A;  3IH8 A;  4R1G A;  4WL9 A;  4EW7 A;  4ZJ1 A;  5KIZ A;  3N8R A;  4HBU A;  2J8Y A;  5GLB A;  3NDG A;  2LB9 A;  3BQA A;  4P6Z M;  3IS2 A;  2K31 A;  5DVA A;  4GB7 A;  3GMW A;  1PRQ A;  5EFW A;  4GS9 A;  2OSU A;  2ZD8 A;  2L4R A;  2DMW A;  3C5A A;  4ZDX A;  2HF6 A;  1ERQ A;  2Z6C A;  1GSV A;  4HH2 A;  3TSG A;  4BD0 A;  4KZ5 A;  4EV4 A;  2D02 A;  4E6W A;  2ZM2 A;  1K55 C;  2P74 A;  2A2L A;  1BUL A;  2DRW A;  4HH3 A;  4Y17 A;  1DRM A;  3MZE A;  5CGS A;  5D3O A;  3JYI A;  3GVB A;  5HFO A;  1L0D A;  5IHV A;  2OAQ 1;  5E2G A;  1PW1 A;  2XSS A;  1KE3 A;  1W79 A;  3A3D A;  2ZMF A;  3CJM A;  3RXX A;  4QWO A;  4RVA A;  5HX9 A;  2WKQ A;  2NUP C;  5FQI A;  5A92 A;  3ZQ5 A;  4GN2 A;  4NXE A;  4MBH A;  3EEH A;  1GHI A;  3EGD C;  3ZHH A;  4OP8 A;  2PHY A;  4M4X A;  5G4Z A;  3NJA A;  5DTS A;  3G2Z A;  3GRJ A;  5HAI A;  5FDS A;  4R3B A;  1W8Q A;  1NLZ A;  1GA9 A;  2GNX A;  4RQ9 A;  4FUW A;  1DJA A;  1DP6 A;  3PXP A;  3E4P A;  3OBF A;  4N9K A;  1OT6 A;  5FAO A;  4RYE A;  3T4K A;  3MXR A;  2JKR M;  3BJN A;  3UN7 A;  1IYO A;  3KYQ A;  3HJK A;  3VP0 A;  1ACF A;  5KZH A;  1XJ2 A;  4WN5 A;  1N9N A;  1SHV A;  3CG5 A;  4MDZ A;  1NWZ A;  4NK3 A;  4JKT A;  4DE1 A;  4MCW A;  3UE6 A;  2VJW A;  4FSF A;  5TGF A;  3H9W A;  4F3L A;  1D06 A;  1NJ4 A;  3A3I A;  3LO7 A;  2IA2 A;  2Y2I A;  3V50 A;  1MY8 A;  3VOY A;  3F1N A;  2PD7 A;  1K57 A;  2JHE A;  4BD1 A;  4PM7 A;  3IXB A;  2V20 A;  3DWK A;  1WE4 A;  3PBT A;  1Z6F A;  2WGV A;  3FKV A;  1TEM A;  3S22 A;  3D3O A;  4Q0J A;  1I5Q A;  1I2S A;  4DXB A;  4NXG A;  2JCH A;  3MF0 A;  1OME A;  5E2E A;  3KSF A;  5EE8 A; 
#chains in the Genus database with same CATH homology
 2L0W A;  4CLC D;  3MXQ A;  4HJ4 A;  4XT2 B;  2M1C A;  2H28 A;  4JGP A;  3LIB A;  3OOV A;  2GJ3 A;  3D72 A;  2XRN A;  3PBR A;  3RTY A;  1MZU A;  4H6J B;  2W1T A;  4OOL A;  3C38 A;  4FOF A;  2M7U A;  3A0S A;  3UMD A;  3S7O A;  3C30 A;  1UWP X;  2KLI A;  3NOP C;  4CLC A;  4R6L A;  4WEL A;  2J80 A;  5HD3 A;  1OPX A;  2GZA A;  4G3K A;  2VA0 A;  4WEK A;  4PHT A;  1T1A A;  4MN7 A;  2VKS A;  2OWJ A;  3TW8 A;  4BBV A;  2J3W A;  2I9V A;  3EQU A;  2OOL A;  5TJJ A;  2Y8H A;  3LR4 A;  4DMZ A;  5DF9 A;  3F1P B;  3IBR A;  3FG8 A;  4EET B;  3LYX A;  4K08 A;  3UME A;  4EUV A;  3EOI A;  3VE4 A;  2JKT M;  5HWW A;  1WA9 A;  1OTA A;  1P9R A;  3B33 A;  4R70 A;  2ZMV A;  1S66 L;  3V67 A;  5IT5 A;  3CAX A;  4LRX C;  4P6Z S;  3G6O A;  4IHQ A;  3KSH A;  1YSP A;  3LID A;  3JVV A;  5J7E A;  1TD5 A;  4KUO A;  2VLG A;  2PR6 A;  4I3J A;  5HL6 A;  5IU1 A;  5J4E A;  3T4J A;  3EEA A;  4GW9 A;  3H82 B;  3UB9 A;  4AFI A;  5F69 A;  3HCY A;  4EEP A;  4CLC C;  3A0R A;  4DJ2 A;  5AVE A;  1EW0 A;  1V9Y A;  4PKY G;  4LRY C;  4HIA A;  1DP8 A;  4I5S A;  4LPZ A;  3BQ8 A;  1VHM A;  2J3T D;  4DJ3 A;  3SW1 A;  4L9G A;  1S67 L;  3C2W A;  4HP9 A;  2PDR A;  1P97 A;  5DFX A;  1F5M A;  2EWW A;  4IUK A;  3GEC A;  4WLA A;  4LLO B;  3CIT A;  4EU0 A;  1OTE A;  1H8M A;  3VE3 A;  4II7 A;  5HZH A;  2XA7 S;  3E4O A;  2PYR A;  2V1B A;  4Y5F A;  4UEY A;  2HJE A;  1F9I A;  2WKP A;  2BAS A;  4HY8 A;  4O0P A;  2PR5 A;  4KUK A;  3F1O B;  1TS0 A;  3K3D A;  2A24 A;  1ZTU A;  2W1T B;  1OTI A;  5DJU A;  1XFN A;  3NHQ A;  3CI6 A;  4HI4 A;  3CLO A;  3TJZ C;  1T1C A;  4GJ4 A;  2VEA A;  1STZ A;  5AJG A;  1OT9 A;  3LR5 A;  2YKF A;  1X0O A;  5FL3 A;  3S7N A;  2VX8 A;  3NOU C;  1OJ5 A;  1DP9 A;  1LSX A;  2CMN A;  3BY9 A;  2HJ9 C;  1OTB A;  2QWS A;  2JKT I;  3KYZ A;  3CWF A;  1TS7 A;  4YOF A;  4ME4 A;  4L0L A;  3OCL A;  3UB8 A;  1S1Y A;  2Y79 A;  4I3A A;  1W63 M;  5F6A A;  2O9C A;  2LB5 A;  4LRZ E;  4EXO A;  1Y28 A;  3E4Q A;  2M7V A;  2PYP A;  5HDC A;  3EGX C;  3LI8 A;  4BWI A;  4MMN A;  3B47 A;  4ETZ A;  5HPF A;  3C8C A;  2EA9 A;  4HHD A;  4OOM A;  4HQA A;  2A24 B;  3U2A A;  2P04 A;  1OTD A;  2ZOH A;  4KQD A;  3A0V A;  1IFQ A;  2B18 A;  3T4T A;  1JNU A;  4XT2 A;  3EQV A;  2ZBB A;  3LR3 A;  4IJG A;  3E98 A;  1XJ3 A;  1XFQ A;  2W3F A;  5C5K A;  3S7Q A;  1XJ6 A;  4ZRR A;  3EWK A;  2P7J A;  4NEE D;  2W3E A;  3MJQ A;  4HNB A;  4E04 A;  4EES A;  2G7U A;  2ZOI A;  4JGR A;  3R7W A;  3T50 A;  4NXF A;  2XRO A;  5F68 A;  2K2N A;  3UB6 A;  1UGU A;  4KQO A;  2VGL S;  3GDI A;  1LL8 A;  2V0U A;  1MC0 A;  3BY8 A;  3TE8 A;  2VGL M;  4HJ3 A;  5K5B A;  1W63 Q;  4BBU A;  2W3G A;  1YSQ A;  4GHI B;  4MN6 A;  5I5L A;  2J3T C;  2JN7 A;  3H7W A;  5DKK A;  4F3L B;  1ODV A;  1TS6 A;  4ARZ B;  3PBO A;  3KO6 A;  3UE3 A;  3LIE A;  1G28 A;  2V1A A;  4Q0I A;  2HGV A;  3PYP A;  2KOI A;  4GLQ A;  1VB6 A;  1YAX A;  4NXB A;  3PHY A;  1P0Z A;  3F1O A;  5TBM B;  5IS1 A;  3LFV A;  2O9B A;  2JKR I;  3PBQ A;  2GX5 A;  2FZ0 A;  4YNR A;  3B42 A;  2QJ7 A;  4G3W A;  3TRC A;  4DN0 A;  1TS8 A;  4I39 A;  4L9F A;  3VOL A;  3FPW A;  4CLC E;  4R3A A;  2OWH A;  5A8B A;  4JGO A;  5LBR A;  2QHK A;  3P7N A;  3JVU A;  1G6O A;  4HJ6 A;  1LT0 A;  1ZHH B;  2VZW A;  2KX6 A;  5MC7 A;  3O5Y A;  5HD5 A;  4GHI A;  4WL9 A;  4EW7 A;  3P01 A;  3H82 A;  2O99 A;  5KIZ A;  3H7W B;  1UWN X;  3ICY A;  5HPI A;  2Z6D A;  4HOI A;  2W1R A;  1S1Z A;  2LB9 A;  3T4O A;  3LR0 A;  1GSX A;  4G3V A;  1F98 A;  3BQA A;  4MN5 A;  4P6Z M;  4PAU A;  4CQH A;  2K7S A;  3IS2 A;  4Z1W A;  2K31 A;  1N9O A;  3T4L A;  4R38 A;  5EFW A;  5HDD A;  4GS9 A;  2O0Y A;  2L4R A;  2DMW A;  3MFX A;  3PR6 A;  3MR0 A;  4L9E A;  2KDK A;  4B9O A;  2YKH A;  2HF6 A;  2Z6C A;  2B02 A;  1GSV A;  2L1M A;  4HH2 A;  4EER A;  3LIA A;  2D02 A;  1LSW A;  2P08 A;  5HWT A;  3F1P A;  4I38 A;  3K3C A;  2MJ6 A;  1T1B A;  2W0N A;  1OJG A;  2A2L A;  1T19 A;  3CUE C;  1YKD A;  2V0W A;  2QKP A;  4JGQ A;  3DBA A;  4HP4 A;  3MQO A;  4HH3 A;  2W27 A;  1DRM A;  2QJ5 A;  4BMW A;  5CX7 A;  4YWZ A;  4O8G A;  2XA7 M;  3OLO A;  3S7P A;  3UB7 A;  3K2N A;  3OC2 A;  2INW A;  2OAQ 1;  3W2Z A;  1TF1 A;  3T4S A;  2XSS A;  5G4Y A;  4PKY A;  2ZMF A;  4WUJ A;  3KSI A;  3KX0 X;  4I3I A;  4EEU A;  2W3D A;  2WKQ A;  3LIC A;  2NUP C;  3LIF A;  1S4S A;  4Y3I A;  1MKM A;  2D01 A;  3ZQ5 A;  4BBT A;  4NXE A;  3RFB A;  3EEH A;  5TBM A;  3ULF A;  3EGD C;  4EQ1 A;  2PHY A;  3LUQ A;  4M4X A;  2W3H A;  5G4Z A;  3NJA A;  4QPR A;  3FPV A;  3CUE A;  3HJI A;  1NLZ A;  4NKP A;  2GNX A;  4RQ9 A;  1NRJ A;  1LSV A;  1DP6 A;  3PXP A;  3E4P A;  2HV1 A;  2FH5 A;  3OBF A;  3R4K A;  1D7E A;  1KOU A;  2V9A A;  5KSH A;  3LI9 A;  4WEJ A;  1OT6 A;  3MQQ A;  3T4K A;  3IS2 B;  2JKR M;  3BJN A;  3F1N B;  1BYW A;  3R7W B;  3KYQ A;  3HJK A;  4ETX A;  5J3W A;  1XJ2 A;  3VV4 A;  1P9W A;  2QYB A;  1S4R A;  1XJ4 A;  4UQI M;  4WN5 A;  3RH8 B;  1N9N A;  4ARZ A;  2R78 A;  4MDZ A;  1NWZ A;  1T18 A;  4MCW A;  5L8M A;  3UE6 A;  2VJW A;  3FC7 A;  4FSF A;  5HDS A;  3BWL A;  3ZYT A;  4GS9 B;  2O9A A;  3H9W A;  4WF0 A;  4F3L A;  1D06 A;  5DKL A;  1H3Q A;  2PD8 A;  5HWV A;  3BW6 A;  5DJT A;  2VV8 A;  4Y2F A;  2IA2 A;  2VV7 A;  4B93 A;  2VV6 A;  1NLY A;  3PBS A;  3F1N A;  2PD7 A;  4IUH A;  4CLC B;  2JHE A;  3OCN A;  4BJP A;  4O01 A;  1IOU A;  2OAP 1;  4GCZ A;  5F5Y A;  3PBN A;  5HSQ A;  4H6J A;  5AVF A;  2NUT C;  3KSG A;  4Q0H A;  3PBT A;  3NOT C;  5DFY A;  2PT7 A;  3D3O A;  3E0Y A;  3T4Q A;  4Q0J A;  1V9Z A;  1GSW A;  2WKR A;  3IBJ A;  3MMH A;  3MQ0 A;  4UQI S;  4NXG A;  3MF0 A;  3KSF A;  1N9L A;  2EWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...