3MQOA

The crystal structure of the pas domain in complex with isopropanol of a transcriptional regulator in the luxr family from burkholderia thailandensis to 1.7a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
113
structure length
113
Chain Sequence
IDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, LuxR family
publication title The Crystal Structure of the PAS domain in complex with isopropanol of a Transcriptional Regulator in the LuxR family from Burkholderia thailandensis to 1.7A
rcsb
source organism Burkholderia thailandensis
molecule tags Transcription regulator
total genus 28
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3mqoA00
4BBVA 2J80A 3NOTC 1D06A 1UGUA 2QJ5A 5TBMA 3H82B 4F3LA 1OTAA 3GDIA 1GSWA 3UMDA 5AVFA 1WA9A 1LSVA 4KUKA 2W0NA 1JNUA 1N9LA 4NXEA 4LLOB 3K3CA 1BYWA 4EEUA 5HD3A 5I5LA 2H28A 4MN5A 1DRMA 1LSXA 1S1YA 1OTBA 4R3AA 3MFXA 5F68A 3F1NB 4KUOA 3EWKA 4JGRA 4JGOA 5A8BA 2VV6A 3LUQA 2V9AA 5HDCA 3UMEA 4HP9A 1G28A 5TBMB 1KOUA 4PKYA 4F3LB 2PR6A 3VOLA 3MQQA 1XFNA 4NXBA 4I39A 1V9ZA 3CWFA 4WLAA 3NJAA 5HD5A 1GSXA 2A24A 4GS9B 4GW9A 4HI4A 1V9YA 2ZOIA 1GSVA 1N9NA 1P0ZA 3E4OA 5HDDA 4WL9A 2M1CA 1S66L 3MXQA 5G4YA 3FG8A 3MJQA 2GJ3A 3LI8A 4NXGA 5IS1A 2PD7A 2PYPA 3B33A 3VE4A 3HJIA 2L4RA 5DKKA 4HJ4A 5F69A 2Z6DA 1D7EA 4BBTA 4L9GA 2V0WA 3UB7A 1F9IA 1T18A 1LSWA 2A24B 2P7JA 1S4SA 3IS2B 3EEHA 5HSQA 2D01A 2QKPA 1XJ3A 2QWSA 1OJGA 3GECA 4GS9A 1DP6A 2HV1A 3P7NA 1TS6A 3UB6A 5DJTA 4EXOA 1XJ6A 4HQAA 5F6AA 4L9FA 4HP4A 3PYPA 2PYRA 4R6LA 4HJ6A 2VV8A 5DKLA 3K3DA 1DP9A 3NOUC 4HH3A 4RQ9A 3LIFA 1N9OA 1OT9A 4EETB 4DJ3A 3BY8A 3LIAA 4KQDA 5F5YA 4JGQA 2B02A 3G6OA 4HHDA 5HDSA 4R70A 3UB9A 3NHQA 2VEAA 1UWNX 3LICA 4L9EA 2D02A 3LIDA 1OJ5A 3LIBA 3ICYA 3RH8B 2PR5A 1OTDA 1OTIA 2EA9A 1Y28A 3VE3A 3IS2A 4EERA 2OOLA 2I9VA 4MN6A 2WKQA 4I5SA 2OWHA 3IBRA 1OTEA 4HNBA 3BWLA 4XT2B 1LL8A 3C2WA 1NWZA 4GHIA 3F1OA 2WKPA 2L0WA 4WN5A 2QHKA 2R78A 2JN7A 1OT6A 1UWPX 2ZBBA 1T1CA 4JGPA 3KX0X 4HJ3A 4BBUA 5HWWA 2WKRA 1TS0A 4H6JA 4I3IA 3F1PA 4R38A 3CLOA 1ODVA 3E4QA 3H9WA 4EESA 1XFQA 5IU1A 1S1ZA 1P97A 1TS8A 4LRZE 2K7SA 4GCZA 4LRYC 5J4EA 2Z6CA 1EW0A 4LRXC 4WF0A 1XJ4A 4HIAA 2KX6A 4I3AA 5HZHA 4E04A 4I38A 2JHEA 2QJ7A 4LPZA 2L1MA 4WUJA 4GHIB 3F1OB 4EEPA 2YKFA 4NXFA 4M4XA 3T50A 3FC7A 5AVEA 1S4RA 1XJ2A 1VB6A 2PD8A 4XT2A 3LIEA 4YWZA 3HJKA 2V0UA 1T1BA 2VLGA 3UE6A 3ZQ5A 4H6JB 3ULFA 3F1PB 3OLOA 3PHYA 4I3JA 1F98A 3LYXA 1S67L 4HOIA 5KIZA 1X0OA 4HH2A 3A0RA 1T19A 3A0SA 4PKYG 2CMNA 5HWTA 2W27A 3D72A 3UB8A 1DP8A 5DJUA 3H7WA 2KDKA 2PHYA 2BASA 4K08A 4EW7A 3BY9A 2ZOHA 4DJ2A 3H82A 3LI9A 5J7EA 3SW1A 1T1AA 5HWVA 2VV7A 3RTYA 5G4ZA 3C8CA 1LT0A 2OWJA 5EFWA 4EQ1A 4B9OA 3A0VA 3MR0A 3MQOA 2INWA 2YKHA 2V1BA 5J3WA 2V1AA 3NOPC 3CAXA 3F1NA 1TS7A 3H7WB 3E4PA 1MZUA 4HY8A 2PDRA
chains in the Genus database with same CATH superfamily
4GDBA 3B3XA 3EQVA 1RP5A 3KSGA 5TBMA 3H82B 3MXRA 3T1QB 5FQKA 3N4IA 3CPTA 3QP8A 2C6WB 3UMDA 3U2AA 1HTZA 1K56A 5FQQA 2Y91A 4MEZA 1IELA 4R3JA 3FKVA 1BYWA 3VP0A 3Q82A 3G31A 5J8XA 1FCNA 1MC0A 3LR4A 5DF9A 3VV4A 1PWDA 1BUEA 1S1YA 2ZM8A 4U3TA 3MFDA 4BWIA 3SS4A 5CX7A 4ZTKA 3MFXA 3LEQA 3NDEA 3VSKA 1GA0A 1J9MA 3OPPA 1JWVA 4JGRA 3OCNA 4JGOA 2J7VA 2Y2NA 4HBTA 5HFOA 4K91A 2VV6A 3DTMA 2OAP1 1JVJA 5TBMB 2ZQCA 4DXBA 2O99A 1LI9A 3HBRA 4B93A 1KVLA 1XFNA 3CWFA 4WLAA 1M6KA 3E2KA 4C6YA 1GSXA 3VOYA 1OMEA 2WADA 5DF7A 4X1MA 5E2GA 4GW9A 3VOZA 4Y5FA 1V9YA 2JKRI 5CTNA 1GSVA 1N9NA 1S66L 1BTLA 3O87A 3S7NA 4GD6A 4CLCA 5FI6A 1BZAA 5GLAA 5DFXA 3LI8A 4UA6A 1W8QA 5IS1A 4BL2A 2PYPA 2IWCA 3B33A 3VE4A 3IH9A 2RCXA 4HJ4A 3FPWA 4BBTA 3IX4A 3NIAA 1NJ4A 4PM9A 2V0WA 3UB7A 1ONGA 1F9IA 4OQGA 1SDNA 3IS2B 2W1TA 5FQMA 5EECA 2M7VA 2ZMAA 4WEJA 3PTEA 3A3IA 1XJ3A 2QWSA 1OJGA 3GECA 1ZG4A 3ZVTA 3DTEA 2XR0A 5F6AA 4CLCB 5EOEA 3NI9A 2ZMVA 4HP4A 3BLMA 2J3TD 1G5UA 2WAFA 4ARZA 1YKDA 5FA7A 5DKLA 3DWKA 2XGNA 5I94A 3NOUC 4U0TA 2VJWA 1ZHHB 2A49A 4RQ9A 3LIFA 1BSGA 4MNRA 4BQMA 3T4QA 5CTMA 4KQDA 3PR6A 1PZOA 5C5KA 2QYBA 5A92A 3DTKA 4IUKA 5DTSA 2W1TB 3D4FA 1OJ5A 5GHYA 3WRTA 2Y2HA 1OPXA 3AGDA 4ID4A 3HUNA 1TEMA 3VE3A 4EERA 1KGFA 4GOGA 4Y17A 4WYYA 3QP5A 3NDGA 3A3EA 4QB8A 3T4JA 2M7UA 5CEDA 4I5SA 1NRJA 4ARZB 2OWHA 3C4OA 5KSCA 1OTEA 2O9CA 3PXPA 2CC1A 1H8MA 1IYPA 1NY0A 2QHKA 2NUTC 3MBZA 2XLNA 1ZC2A 2PBDP 4XUZA 2B5RA 3RXWA 2ZBBA 3KX0X 3MZEA 1TS0A 3PBTA 3AGFA 5CERA 2W3GA 3CLOA 3E4QA 2ACGA 4BMWA 1XFQA 1S1ZA 3QHYA 1K25A 3WS0A 3Q7VA 2JKRM 2Z6CA 5FAQA 5MC7A 4LV2A 1D1JA 4LRXC 4HIAA 4YNRA 1NYYA 4I3AA 5HZHA 4E04A 3C38A 4EU0A 2V8CA 3RJUA 4C3QA 1TDLA 3MSHA 4EEPA 3T50A 4X69A 4O01A 4BD0A 3FC7A 5AVEA 4D2OA 4N92A 1BLPA 5EPHA 4N9LA 3LIEA 5CGWA 3MQ0A 1PYYA 2V0UA 3P01A 2ZC6B 1CEGA 3EEAA 3PHYA 2J8YA 3UO9A 1KDSA 1YSPA 4YFMA 1DJBA 1ESIA 2W1RA 3IHAA 4HOIA 5KIZA 2GX5A 3A3DA 1X0OA 1TVFA 1PI4A 1T19A 1HLUP 4PKYG 4RVAA 1FCMA 2CMNA 3CI6A 3D72A 1S6RA 2R9XA 1QMFA 3MS6A 3I7JA 4FOFA 1G6OA 4Q8IA 3OOVA 4DDSA 2G2UA 3QP6A 4GB7A 4GJ4A 4GKUA 2FZ0A 4OPQA 5HX9A 4Y0UA 1T1AA 5EM1A 4OVDA 2O0YA 1FOFA 2VV7A 3IXDA 1FILA 1HD8A 4MN7A 3RTYA 4EBPA 3G34A 3UN7A 3C8CA 1GHPA 1IKIA 3VSLA 5TJJA 3ZG9B 3OPRA 5EUAA 2LB5A 3N8SA 4Y7PA 1GA9A 1BULA 4ESPA 2ZL1A 4CLCD 5F1FA 2V1AA 5FQ9A 3NOPC 1RGZA 2HDRA 3E4PA 5CHMA 3N6IA 4BBVA 3NOTC 1FR6A 4Y3IA 3T12B 4F3LA 3FYZA 1TD5A 3N7WA 1OTAA 1GSWA 2W3FA 4KZ3A 5AVFA 3T4LA 1YMXA 1JNUA 2VA0A 5JYPA 3B47A 3BRMA 1ERMA 5M19A 1Z6FA 2H28A 3LFVA 3SOIA 3C7UA 1YLZA 4MBFA 4KZBA 1DJAA 2ZL1B 3CMZA 3BFCA 4NETA 4QD4A 4LV3A 5A93A 4KUOA 1KE4A 1ES2A 3T4KA 3K2NA 3LY3A 2Y2LA 3IHBA 1PWGA 3W4PA 2V9AA 1RGYA 2Q9MA 1G28A 3LO7A 1KOUA 2ZC3B 4F3LB 2XF3A 4NXBA 1GHIA 3IX8A 2QZ6A 5KMWA 3CJMA 4E3NA 2P08A 4GS9B 4Q0JA 5FEFA 3UE3A 4N1HA 3A3FA 3G4PA 2EX8A 1P0ZA 2GDNA 2XQZA 5HDDA 2M1CA 4Y0TA 1G68A 4KG2A 3MXQA 3RXXA 2X01A 1JWPA 4DRTA 3TOIA 1MBLA 3C5AA 2WKEA 3ITBA 2R9WA 2OV5A 2GJ3A 5AQAA 1N9BA 3ZFZA 3GR2A 3OC2A 3LY4A 3WRZA 3NULA 3CITA 3D3OA 3HJIA 1IEMA 5L07A 1SHVA 2WGIA 4C75A 3P09A 5F69A 2Z6DA 4L9GA 5HL6A 3ZDJA 5BOHA 4P85A 1KE0A 2HJ9C 4OOMA 3IWOA 2P7JA 3CG5A 1SDEA 1S4SA 1NZUA 3HLGA 5A91A 5GLCA 1BLSA 2QKPA 1DP6A 1TS6A 3T1SA 2JKFA 5GHZA 4L9FA 4KZ9A 1ES5A 2WGWA 3EQUA 3FWLA 4DE3A 2EFUA 3EOIA 5CEBA 2E8JA 4YOFA 4S2IA 2PYRA 4HJ6A 2VV8A 4Y2FA 4EUVA 3KYZA 1ES4A 3K3DA 5A90A 1DP9A 4X25A 3SH8A 4HH3A 4JXSA 3TSGA 3W4QA 2PAVP 4X56A 3UE0A 5M18A 4EETB 5L8MA 5F5YA 1NYMA 4ZJ1A 2W3HA 3BFEA 4EV4A 3T1XA 4MBHA 3UPPA 2D02A 3LIBA 2ZQ8A 1YLYA 3JVVA 2E8IA 4R4SA 1CF0A 3ICYA 5FAOA 3C4PA 1K0KA 1SKOB 4OPYA 2VGKA 3M2JA 3Q7ZA 1L0GA 3IS2A 2OOLA 3ITAA 4MN6A 2WKQA 4Z1WA 4XUXA 4ZBEA 2WGWB 4B4ZA 5E2FA 4G3VA 4PM8A 5FQIA 4JF5A 1CEFA 3UDXA 5CGXA 1K4FA 2L0WA 2PT7A 5FI7A 1PFLA 4KG5A 4P87A 1W8YA 4O0PA 2JC7A 3HVFA 3ZG7B 1AWIA 1K54A 2XD1A 4GLQA 1OT6A 1LI0A 1EI5A 1L3LA 3M6HA 3MXSA 4JGPA 3W4OA 4HJ3A 4BBUA 4BD1A 3OCLA 2WAEA 3F1PA 2HGVA 1WYCA 3NY4A 4GNUA 2FH5A 1K38A 4X68A 1H8ZA 4ETXA 4GCZA 2V20A 5E2HA 3HUOA 1XJ4A 4N1XA 3IH8A 2JHEA 1HVBA 3T4TA 4JPMA 1XXMA 5AQ7A 5FEGA 4NEED 4NXFA 1YLTA 2LB9A 2WKIA 1IYOA 4KG6A 4CLCE 3BFDA 1W79A 3LR3A 4RA7A 4KQQA 4YWZA 3HJKA 1T1BA 2VLGA 4E3JA 1VHMA 2BLSA 1XPBA 3F1PB 1MWRA 3M2KA 1VETB 3GQZA 2HJEA 5HAQA 2W3DA 3MF0A 3LYXA 2Q0OA 2ZQAA 3R7WA 2PU4A 2DRWA 2A3UA 2VK3A 2Y2OA 3DTIA 1EWZA 2W27A 2PRFA 2OLUA 3SH9A 1DJCA 1DP8A 3HLBA 4G3WA 5HPFA 3H7WA 4QY5A 4PMAA 2PHYA 1IOUA 4MDZA 5EVEA 1JTGA 2BG1A 4KZAA 3V5MA 2VGJA 4ZAMA 4CJNA 4OP5A 5TR7A 5FL3A 3UPNA 5KZHA 1MWSA 3VFFA 4S2KA 3SW1A 5HAIA 3G2ZA 4X6TA 2V8FA 5G4ZA 4PPRA 1KGGA 1MKIA 1YQSA 5E43A 1CI9A 1LT0A 3BFGA 5EFWA 4UHUA 3MR0A 1SCWA 5IT5A 3R7WB 3HLCA 2H0YA 3BFFA 4IUHA 2G2WA 4E3IA 4HESA 3PBNA 1K57A 3B42A 3F1NA 1TS7A 3H7WB 1Y54A 4JXWA 3QNCA 1PI5A 3V39A 3LCEA 4R3BA 4RX2A 5DFYA 1MZUA 4HY8A 2PDRA 2WKHA 2J80A 3FPVA 4OOLA 4ZJ3A 2QJ5A 4JF4A 2G7UA 3UDIA 1ONHA 3VP1A 3GDIA 3C7VA 2HDQA 2P9VA 4KUKA 2Y59A 1N9LA 3DWZA 1PW8A 4NXEA 4IJGA 1NLZA 4LLOB 1PNEA 3K3CA 3AGEA 4E3LA 4EEUA 4DMZA 1PZPA 1MPLA 5I5LA 5CGSA 4OPRA 4DN0A 4OOYA 3KSIA 4DDYA 1K6RA 3LEZA 4OQIA 1LSXA 1VEUB 2WZZA 2XFSA 3D9YA 3TE8A 3IF6A 4NKPA 1A0KA 4PM5A 2Y2IA 3F1NB 2X02A 5FSRA 3GV9A 3GVBA 3FKWA 3UPOA 4U0XA 1P9WA 2WGVA 4QWOA 5HDCA 4HP9A 1BLHA 3PBQA 1YMSA 1YM1A 4YINA 4MMNA 4WZ4A 3MQQA 4WELA 4I39A 2Y2JA 1BT5A 5HD5A 2P9VB 3G30A 3KYQA 3A3JA 1E4DA 2XK1A 4UA7A 3PAEA 4F94A 4WM9A 2ZM0A 1K54C 4GN2A 3S7QA 2VKSA 3TJZC 4HI4A 2ZOIA 3NC8A 1XP4A 5CECA 3VMAA 4DE2A 5FDHA 4QU3A 3TG9A 4DF6A 1O7EA 5CHUA 2Y2MA 3KO6A 1FR1A 3LR5A 1NXYA 3SS3A 3MJQA 3O3VA 4FD8A 4O7DA 3IF6B 4EQIA 5HAPA 2EX9A 3OZHA 3HLEA 3JVUA 3ZNTA 4WEKA 2PD7A 3LR0A 4IEDA 4MLLA 1IYQA 1PW1A 4S2NC 4R23A 4DKIA 4R1GA 1TF1A 1D7EA 4KENB 1KE3A 2X71A 3IXBA 4DXCA 1T18A 1LSWA 1YT4A 5FASA 2ZLYA 2I72A 1RCJA 3ZCZA 5HSQA 1E25A 1NRFA 2D01A 3MMHA 3UDFA 3G2YA 2KLIA 4FSFA 3O5YA 2IWDA 4GS9A 4S2PA 3N8LA 5DJTA 4EXOA 3KSHA 4HQAA 3LGOA 1FQGA 1FSYA 4X53A 4UEYA 5AQBA 5GLDA 2DCFA 1K55C 2XROA 2RL3A 1CJFA 3MKEA 4R6LA 2JCHA 5DTKA 5HARA 5GLBA 2EWVA 3QP2A 4K0XA 2Q9NA 1N9OA 1OT9A 4N9KA 1BLCA 4B4XA 4DJ3A 3IWQA 3CZDA 2HP5A 3LIAA 3T4SA 1C3BA 1MWTA 4JGQA 3OPHA 2B02A 4HHDA 4R70A 3UB9A 1UWNX 3JYIA 2IA2A 3RH8B 4BL3A 3NBLA 1OTDA 1OTIA 2EA9A 2P04A 3BW6A 3BYDA 1MKMA 2ZQ9A 5AJGA 3U4LP 3IXGA 3PBRA 4NK3A 3ZVWA 4EBLA 2O9AA 4UQIS 4LV1A 1FSWA 2ZD8A 3OPLA 4XT2B 1SKFA 1E3UA 2UV0E 1LL8A 5HW3A 1NWZA 4GHIA 3F1OA 4X55A 3Q81A 1K57C 2WKPA 5U47A 4WN5A 1IKGA 3S22A 4MBKA 4WZ5A 1L0FA 2ZC4B 1IFQA 3BQAA 5EVIA 3O86A 1SZVA 2K31A 5EVLA 5HWWA 4I3IA 3O88A 1CQAA 2J9OA 1ODVA 3H9WA 3WS5A 4EESA 5IU1A 2A2LA 1AXBA 1P97A 3R4KA 3ZHHA 1TS8A 4JKTA 4LRYC 3GMWA 2P74A 3NCKA 4WF0A 2XSSA 1FIKA 1SKOA 2B95A 2HPBA 4EBNA 4IVKA 2EX2A 4I38A 4OH0A 3RFBA 2L1MA 4WUJA 4GHIB 3F1OB 3IF6C 2YKFA 5TGFA 4M4XA 2HP9A 1N4OA 4GDNA 4FUWA 4OPZA 3HLFA 1S4RA 1XJ2A 1VB6A 5HPIA 1NZOA 1ALQA 5EVIB 4RX3A 4KZ7A 3S7OA 5JYOA 4O8GA 2IWBA 3ULFA 3N8RA 3QNBA 4JLFA 4I3JA 2C5WB 1ES3A 2DMWA 3E0YA 3TRCA 4B88A 4IHQA 4QJGA 1J3WA 2HP6A 5CHJA 2Y79A 1H0MA 1ZKJA 1F2KA 1L0EA 4OLGA 4HH2A 1ESUA 3SH7A 2VGLM 4CQHA 1XX2A 3W2ZA 1GHMA 2XH9A 4FH4A 1QMEA 5FDSA 1I5QA 4ZJ2A 3CPTB 3V3RA 4EW7A 4K0WA 4DJ2A 5HL1A 1W63Q 2V2FF 2Y2GA 4ZRRA 3ZNYA 3LI9A 5J7EA 5EM0A 4H8RA 5HWVA 3UY6A 1PRQA 3HLDA 3WS4A 4KZ6A 1EROA 3JPUA 2W3EA 4PAUA 2OWJA 4KQOA 4P0MA 3S4XA 1PWCA 4B9OA 3A0VA 1ZG6A 3MQOA 2INWA 2YKHA 1VETA 4LV0A 4LENA 3BQ8A 2V1BA 4OKPA 5G18A 3BECA 4PM7A 4UQIM 4LGWA 2J3TC 3Q07A 2JKTI 2H10A 3IF5A 4WMCA 1MWUA 2ZJ9A 3G32A 3V3SA 4S2NA 4LCLA 1O07A 2QPNA 2XEPA 5F1GA 1D06A 1UGUA 4QHCA 1XA1A 4E3MA 4AFIA 1GCEA 1JWZA 5GHXA 5K5BA 1I2SA 1WA9A 1LSVA 2MJ6A 2W0NA 4DE1A 4ETZA 2EFXA 4OQHA 3IXHA 1VM1A 4OQ0A 2EX6A 1S0WA 1XGJA 5TFQA 4JBFA 5HD3A 4WBGA 3IQAA 1CK3A 2AVXA 4MN5A 4Q0HA 1DRMA 3HCYA 5FQJA 1OTBA 4R3AA 2FFYA 1K55A 3GRJA 3OBFA 3DBAA 5F68A 3SZTA 4BENA 3EWKA 2BTFP 3BLSA 5L2FA 5A8BA 3CUEA 4S2LA 4HEFA 3S7PA 3LUQA 4BLMA 3UMEA 2WYXA 1I2WA 1YSQA 4PKYA 3TW8A 2PR6A 3VOLA 2Y2PA 3L7HA 1V9ZA 1VQQA 2Z2LB 1ZTUA 4Y15A 3NJAA 3QP4A 4II7A 2A24A 3P98A 4WZ5C 1Z09A 1M40A 2EXBA 4JXVA 2XRNA 1KVMA 2XA7S 3C30A 3T4OA 1W63M 5DF8A 5EVIC 1K4EA 3WS2A 3DW0A 3E4OA 4WL9A 1Y4OA 3VP3A 3FZCA 3MZFA 5G4YA 3UE1A 3FG8A 3ZG8B 5CXWA 4D60A 3DAVA 4NXGA 3GTCA 1VEUA 1H8YA 1CI8A 1E3UD 3ZYTA 2L4RA 5DKKA 5IHVA 4EWFA 4RYEA 1G6AA 5FAPA 2JKGA 2WZXA 4EUZA 4S2OA 2A24B 5EVID 5F82A 3EEHA 4KZ8A 4E6XA 2ZC5B 2Y55A 5EOOA 5DVAA 4OLDA 4PHTA 1STZA 1W5DA 3MKFA 2HV1A 3P7NA 2HDUA 5L09A 3UB6A 1XJ6A 4L0LA 2O9BA 1IYSA 3PYPA 4XXRA 3Q1FA 1LL5A 2JKTM 2OSUA 2XFTA 5E2EA 3SS5A 1YLPA 1ERQA 4G3KA 4Z9QA 3G35A 4IVIA 2EWWA 2ZM2A 3WS1A 3PBSA 1K56D 4P6ZS 5DTTA 2ZC7A 3BY8A 1KDWA 2Y8HA 4Y13A 2XD5A 3G6OA 5HDSA 4DE0A 4L9EA 3NHQA 2VEAA 3LICA 1TDGA 4M3KA 3LIDA 3PBOA 2NUPC 5AQ9A 3L9KA 3Q7VB 4QPRA 4KQRA 4GD8A 1XKZA 3S1YA 2PR5A 4E3OA 4JF6A 4FTXA 2ZMFA 1MXOA 1Y28A 3QP1A 4R0QA 4QY6A 2I9VA 3BEBA 4S2JA 3HREA 3UB5P 3PAGA 3NECA 1H3QA 3V50A 3ZG5A 4CLCC 1ACFA 3KSFA 2QMIA 2KOIA 1LL9A 2UWXA 4IBRA 3W8KA 2Y4AA 3HL9A 3IBRA 1HZOA 4IBXA 1FCOA 4HNBA 3BWLA 1LLBA 3C2WA 4E3KA 1NLYA 1W7FA 3IT9A 4NG2A 5GL9A 2R78A 3BJNA 3VFHA 5D3OA 4S2MA 3ZGAB 3WWXA 4BJPA 2JN7A 1UWPX 1U60A 2WUQA 3BM6A 4FCFA 2JE5A 1JTDA 4HBUA 1T1CA 1H5XA 1XA7A 4Q0IA 1YAXA 4LCMA 2WKRA 1L0DA 4H6JA 4R38A 4X1LA 2J9PA 2XA7M 2JBFA 1YPRA 4JXGA 2Z2MB 2PU2A 2H0TA 2K2NA 4KZ5A 2WK0A 2K7SA 2ZQDA 4LRZE 3T1RA 5J4EA 1YLWA 1KGEA 5FATA 1EW0A 2GZAA 3E2LA 2KX6A 3IBJA 4UA9A 2HF6A 1DY6A 1L2SA 2QJ7A 1K6SA 3MZDA 3E98A 4LPZA 4Y0OA 4UAAA 4WMCD 2FFFB 2VGLS 3GSGA 4OP8A 4R4RA 4CPKA 4LFUA 4A5RA 1P9RA 3HUMA 2PD8A 4XT2A 2Y2KA 3EGDC 4P6BA 3CUEC 3UE6A 3ZQ5A 1F5MA 4H6JB 2HZ5A 3OLOA 4GZBA 2XDMA 1YLJA 2J3WA 5FI2A 3FV7A 1F98A 2OLVA 3UNWA 1S67L 1WYBA 2HDSA 3CHWP 3M6BA 3A0RA 3A0SA 2OAQ1 3VP4A 5HWTA 3IX3A 3ISGA 3UB8A 5DJUA 2KDKA 2BASA 4K08A 1XGIA 3BY9A 2ZOHA 2VZWA 5KSHA 5F83A 4P6ZM 3H82A 5CRFA 5M1AA 2H5SA 5LBRA 2PBYA 1WE4A 2B18A 5EE8A 3KYEA 2GNXA 1PIOA 2VX8A 2Y2QA 3V67A 3VP2A 4PM6A 4ZDXA 4OONA 4EQ1A 2EXAA 4E6WA 1MY8A 1LHYA 5J3WA 3HLWA 4MCWA 3IWIA 1Q2PA 2ZQ7A 3CAXA 3EGXC 4KZ4A 1Q2QA 4FH2A 4ME4A 5L10A 2DNSA 3ZG0A 2V1ZA 5EV0A
chains in the Genus database with same CATH topology
4BBVA 2J80A 3NOTC 3FPVA 3EQVA 4OOLA 3KSGA 4Y3IA 1D06A 1UGUA 2QJ5A 5TBMA 2G7UA 3H82B 4F3LA 1TD5A 4AFIA 5K5BA 1OTAA 3GDIA 1GSWA 2W3FA 3UMDA 5AVFA 3U2AA 1WA9A 1LSVA 4KUKA 2MJ6A 3T4LA 2W0NA 4ETZA 1JNUA 1N9LA 2VA0A 4NXEA 4IJGA 1NLZA 4LLOB 3K3CA 3B47A 1BYWA 4EEUA 5HD3A 4DMZA 5I5LA 1MC0A 2H28A 3LFVA 3LR4A 5DF9A 4DN0A 3VV4A 4MN5A 4Q0HA 1DRMA 3KSIA 3HCYA 1LSXA 1S1YA 3TE8A 1OTBA 4R3AA 4NKPA 4BWIA 5CX7A 3MFXA 3OBFA 3DBAA 5F68A 3F1NB 4KUOA 3EWKA 3T4KA 4JGRA 3K2NA 3OCNA 4JGOA 1P9WA 5A8BA 3CUEA 2VV6A 2OAP1 3S7PA 3LUQA 2V9AA 5HDCA 3UMEA 4HP9A 1G28A 3PBQA 5TBMB 1YSQA 1KOUA 4PKYA 4MMNA 4F3LB 3TW8A 2O99A 2PR6A 3VOLA 3MQQA 4B93A 1XFNA 4NXBA 4WELA 4I39A 1V9ZA 3CWFA 4WLAA 1ZTUA 3NJAA 5HD5A 1GSXA 4II7A 2A24A 3KYQA 2P08A 4GS9B 4Q0JA 2XRNA 4GW9A 3UE3A 3S7QA 2XA7S 2VKSA 3C30A 3T4OA 1W63M 4Y5FA 4HI4A 3TJZC 1V9YA 2JKRI 2ZOIA 1GSVA 1N9NA 1P0ZA 3E4OA 5HDDA 4WL9A 2M1CA 1S66L 3MXQA 5G4YA 3S7NA 3KO6A 3LR5A 3FG8A 3MJQA 4CLCA 3JVUA 5DFXA 2GJ3A 3LI8A 4NXGA 5IS1A 3OC2A 4WEKA 2PD7A 3LR0A 2PYPA 3B33A 3VE4A 3CITA 3ZYTA 3D3OA 3HJIA 2L4RA 5DKKA 4HJ4A 3FPWA 1TF1A 5F69A 2Z6DA 1D7EA 4BBTA 4L9GA 5HL6A 2V0WA 2HJ9C 3UB7A 4OOMA 1F9IA 1T18A 1LSWA 2A24B 2P7JA 1S4SA 3IS2B 3EEHA 2W1TA 5HSQA 2M7VA 2D01A 3MMHA 2KLIA 2QKPA 4FSFA 4WEJA 3O5YA 1XJ3A 2QWSA 1OJGA 3GECA 4PHTA 1STZA 4GS9A 1DP6A 2HV1A 3P7NA 1TS6A 3UB6A 5DJTA 4EXOA 1XJ6A 3KSHA 4HQAA 5F6AA 4L0LA 4L9FA 4CLCB 4UEYA 2ZMVA 4HP4A 3EQUA 3EOIA 2O9BA 3PYPA 2J3TD 4YOFA 1YKDA 4ARZA 2PYRA 2XROA 4R6LA 4HJ6A 2VV8A 4Y2FA 4EUVA 3KYZA 5DKLA 2JKTM 3K3DA 1DP9A 3NOUC 2VJWA 4G3KA 1ZHHB 4HH3A 2EWVA 4RQ9A 3LIFA 1N9OA 1OT9A 2EWWA 4EETB 5L8MA 4DJ3A 3PBSA 4P6ZS 3T4QA 3BY8A 3LIAA 4KQDA 5F5YA 3T4SA 3PR6A 2W3HA 4JGQA 2Y8HA 5C5KA 2QYBA 2B02A 3G6OA 4HHDA 4IUKA 5HDSA 4L9EA 3NHQA 2VEAA 1UWNX 3LICA 4R70A 3UB9A 2W1TB 2D02A 3LIDA 1OJ5A 3LIBA 3PBOA 2NUPC 4QPRA 2IA2A 3JVVA 1OPXA 3ICYA 3RH8B 2PR5A 1OTDA 1OTIA 2EA9A 2ZMFA 1Y28A 3VE3A 3IS2A 4EERA 2OOLA 2P04A 3BW6A 1MKMA 2I9VA 5AJGA 3PBRA 4MN6A 1H3QA 2WKQA 4Z1WA 2O9AA 3KSFA 4CLCC 4UQIS 3T4JA 2M7UA 2KOIA 4I5SA 1NRJA 4ARZB 2OWHA 3IBRA 1OTEA 2O9CA 3PXPA 4G3VA 4HNBA 1H8MA 3BWLA 4XT2B 1LL8A 3C2WA 1NWZA 4GHIA 1NLYA 3F1OA 2WKPA 2L0WA 2PT7A 4WN5A 2QHKA 2R78A 3BJNA 2NUTC 4BJPA 4O0PA 2JN7A 4GLQA 1OT6A 1UWPX 1IFQA 3BQAA 2ZBBA 1T1CA 4JGPA 3KX0X 2K31A 4HJ3A 4Q0IA 1YAXA 4BBUA 5HWWA 2WKRA 1TS0A 3PBTA 4H6JA 3OCLA 4I3IA 3F1PA 2HGVA 2W3GA 4R38A 3CLOA 1ODVA 2FH5A 2XA7M 3E4QA 3H9WA 4BMWA 4EESA 1XFQA 2A2LA 5IU1A 1S1ZA 2K2NA 1P97A 3R4KA 1TS8A 4LRZE 2K7SA 4ETXA 4GCZA 4LRYC 2JKRM 5J4EA 2Z6CA 1EW0A 2GZAA 5MC7A 4LRXC 4WF0A 1XJ4A 4HIAA 2XSSA 4YNRA 2KX6A 4I3AA 3IBJA 5HZHA 4E04A 3C38A 4I38A 2HF6A 3RFBA 4EU0A 2JHEA 2QJ7A 3T4TA 3E98A 4LPZA 2L1MA 4WUJA 4GHIB 3F1OB 4NEED 2VGLS 4EEPA 2YKFA 4NXFA 2LB9A 4M4XA 3T50A 4O01A 3FC7A 5AVEA 1P9RA 4CLCE 1S4RA 1XJ2A 1VB6A 2PD8A 3LR3A 4XT2A 3LIEA 5HPIA 3EGDC 3MQ0A 4YWZA 3HJKA 2V0UA 3P01A 1T1BA 3CUEC 2VLGA 1VHMA 3S7OA 3UE6A 3ZQ5A 1F5MA 4O8GA 4H6JB 3ULFA 3F1PB 3EEAA 3OLOA 3PHYA 4I3JA 2HJEA 1YSPA 2DMWA 2J3WA 1F98A 2W3DA 3E0YA 3MF0A 3TRCA 4IHQA 3LYXA 2Y79A 2W1RA 1S67L 4HOIA 5KIZA 2GX5A 3R7WA 1X0OA 4HH2A 3A0RA 1T19A 3A0SA 2OAQ1 2VGLM 4PKYG 4CQHA 2CMNA 5HWTA 3CI6A 2W27A 3D72A 3W2ZA 3UB8A 1DP8A 4G3WA 4FOFA 1G6OA 5DJUA 5HPFA 3H7WA 3OOVA 2KDKA 2PHYA 1IOUA 4MDZA 2BASA 4GJ4A 4K08A 4EW7A 3BY9A 2ZOHA 4DJ2A 2VZWA 2FZ0A 5KSHA 4P6ZM 1W63Q 3H82A 4ZRRA 3LI9A 5FL3A 5J7EA 5LBRA 3SW1A 1T1AA 2B18A 5HWVA 2O0YA 2VV7A 2GNXA 2VX8A 4MN7A 3RTYA 5G4ZA 3V67A 3C8CA 2W3EA 4PAUA 1LT0A 2OWJA 4KQOA 5EFWA 4EQ1A 4B9OA 3A0VA 3MR0A 3MQOA 5TJJA 2INWA 2YKHA 5IT5A 3R7WB 2LB5A 3BQ8A 2V1BA 5J3WA 4IUHA 3PBNA 4UQIM 4MCWA 4CLCD 2J3TC 2JKTI 2V1AA 3NOPC 3B42A 3CAXA 3EGXC 3F1NA 1TS7A 3H7WB 4ME4A 3E4PA 5DFYA 1MZUA 4HY8A 2PDRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBV A;  2J80 A;  3NOT C;  1D06 A;  1UGU A;  2QJ5 A;  5TBM A;  3H82 B;  4F3L A;  1OTA A;  3GDI A;  1GSW A;  3UMD A;  5AVF A;  1WA9 A;  1LSV A;  4KUK A;  2W0N A;  1JNU A;  1N9L A;  4NXE A;  4LLO B;  3K3C A;  1BYW A;  4EEU A;  5HD3 A;  5I5L A;  2H28 A;  4MN5 A;  1DRM A;  1LSX A;  1S1Y A;  1OTB A;  4R3A A;  3MFX A;  5F68 A;  3F1N B;  4KUO A;  3EWK A;  4JGR A;  4JGO A;  5A8B A;  2VV6 A;  3LUQ A;  2V9A A;  5HDC A;  3UME A;  4HP9 A;  1G28 A;  5TBM B;  1KOU A;  4PKY A;  4F3L B;  2PR6 A;  3VOL A;  3MQQ A;  1XFN A;  4NXB A;  4I39 A;  1V9Z A;  3CWF A;  4WLA A;  3NJA A;  5HD5 A;  1GSX A;  2A24 A;  4GS9 B;  4GW9 A;  4HI4 A;  1V9Y A;  2ZOI A;  1GSV A;  1N9N A;  1P0Z A;  3E4O A;  5HDD A;  4WL9 A;  2M1C A;  1S66 L;  3MXQ A;  5G4Y A;  3FG8 A;  3MJQ A;  2GJ3 A;  3LI8 A;  4NXG A;  5IS1 A;  2PD7 A;  2PYP A;  3B33 A;  3VE4 A;  3HJI A;  2L4R A;  5DKK A;  4HJ4 A;  5F69 A;  2Z6D A;  1D7E A;  4BBT A;  4L9G A;  2V0W A;  3UB7 A;  1F9I A;  1T18 A;  1LSW A;  2A24 B;  2P7J A;  1S4S A;  3IS2 B;  3EEH A;  5HSQ A;  2D01 A;  2QKP A;  1XJ3 A;  2QWS A;  1OJG A;  3GEC A;  4GS9 A;  1DP6 A;  2HV1 A;  3P7N A;  1TS6 A;  3UB6 A;  5DJT A;  4EXO A;  1XJ6 A;  4HQA A;  5F6A A;  4L9F A;  4HP4 A;  3PYP A;  2PYR A;  4R6L A;  4HJ6 A;  2VV8 A;  5DKL A;  3K3D A;  1DP9 A;  3NOU C;  4HH3 A;  4RQ9 A;  3LIF A;  1N9O A;  1OT9 A;  4EET B;  4DJ3 A;  3BY8 A;  3LIA A;  4KQD A;  5F5Y A;  4JGQ A;  2B02 A;  3G6O A;  4HHD A;  5HDS A;  4R70 A;  3UB9 A;  3NHQ A;  2VEA A;  1UWN X;  3LIC A;  4L9E A;  2D02 A;  3LID A;  1OJ5 A;  3LIB A;  3ICY A;  3RH8 B;  2PR5 A;  1OTD A;  1OTI A;  2EA9 A;  1Y28 A;  3VE3 A;  3IS2 A;  4EER A;  2OOL A;  2I9V A;  4MN6 A;  2WKQ A;  4I5S A;  2OWH A;  3IBR A;  1OTE A;  4HNB A;  3BWL A;  4XT2 B;  1LL8 A;  3C2W A;  1NWZ A;  4GHI A;  3F1O A;  2WKP A;  2L0W A;  4WN5 A;  2QHK A;  2R78 A;  2JN7 A;  1OT6 A;  1UWP X;  2ZBB A;  1T1C A;  4JGP A;  3KX0 X;  4HJ3 A;  4BBU A;  5HWW A;  2WKR A;  1TS0 A;  4H6J A;  4I3I A;  3F1P A;  4R38 A;  3CLO A;  1ODV A;  3E4Q A;  3H9W A;  4EES A;  1XFQ A;  5IU1 A;  1S1Z A;  1P97 A;  1TS8 A;  4LRZ E;  2K7S A;  4GCZ A;  4LRY C;  5J4E A;  2Z6C A;  1EW0 A;  4LRX C;  4WF0 A;  1XJ4 A;  4HIA A;  2KX6 A;  4I3A A;  5HZH A;  4E04 A;  4I38 A;  2JHE A;  2QJ7 A;  4LPZ A;  2L1M A;  4WUJ A;  4GHI B;  3F1O B;  4EEP A;  2YKF A;  4NXF A;  4M4X A;  3T50 A;  3FC7 A;  5AVE A;  1S4R A;  1XJ2 A;  1VB6 A;  2PD8 A;  4XT2 A;  3LIE A;  4YWZ A;  3HJK A;  2V0U A;  1T1B A;  2VLG A;  3UE6 A;  3ZQ5 A;  4H6J B;  3ULF A;  3F1P B;  3OLO A;  3PHY A;  4I3J A;  1F98 A;  3LYX A;  1S67 L;  4HOI A;  5KIZ A;  1X0O A;  4HH2 A;  3A0R A;  1T19 A;  3A0S A;  4PKY G;  2CMN A;  5HWT A;  2W27 A;  3D72 A;  3UB8 A;  1DP8 A;  5DJU A;  3H7W A;  2KDK A;  2PHY A;  2BAS A;  4K08 A;  4EW7 A;  3BY9 A;  2ZOH A;  4DJ2 A;  3H82 A;  3LI9 A;  5J7E A;  3SW1 A;  1T1A A;  5HWV A;  2VV7 A;  3RTY A;  5G4Z A;  3C8C A;  1LT0 A;  2OWJ A;  5EFW A;  4EQ1 A;  4B9O A;  3A0V A;  3MR0 A;  3MQO A;  2INW A;  2YKH A;  2V1B A;  5J3W A;  2V1A A;  3NOP C;  3CAX A;  3F1N A;  1TS7 A;  3H7W B;  3E4P A;  1MZU A;  4HY8 A;  2PDR A; 
#chains in the Genus database with same CATH topology
 4GDB A;  3B3X A;  3EQV A;  1RP5 A;  3KSG A;  5TBM A;  3H82 B;  3MXR A;  3T1Q B;  5FQK A;  3N4I A;  3CPT A;  3QP8 A;  2C6W B;  3UMD A;  3U2A A;  1HTZ A;  1K56 A;  5FQQ A;  2Y91 A;  4MEZ A;  1IEL A;  4R3J A;  3FKV A;  1BYW A;  3VP0 A;  3Q82 A;  3G31 A;  5J8X A;  1FCN A;  1MC0 A;  3LR4 A;  5DF9 A;  3VV4 A;  1PWD A;  1BUE A;  1S1Y A;  2ZM8 A;  4U3T A;  3MFD A;  4BWI A;  3SS4 A;  5CX7 A;  4ZTK A;  3MFX A;  3LEQ A;  3NDE A;  3VSK A;  1GA0 A;  1J9M A;  3OPP A;  1JWV A;  4JGR A;  3OCN A;  4JGO A;  2J7V A;  2Y2N A;  4HBT A;  5HFO A;  4K91 A;  2VV6 A;  3DTM A;  2OAP 1;  1JVJ A;  5TBM B;  2ZQC A;  4DXB A;  2O99 A;  1LI9 A;  3HBR A;  4B93 A;  1KVL A;  1XFN A;  3CWF A;  4WLA A;  1M6K A;  3E2K A;  4C6Y A;  1GSX A;  3VOY A;  1OME A;  2WAD A;  5DF7 A;  4X1M A;  5E2G A;  4GW9 A;  3VOZ A;  4Y5F A;  1V9Y A;  2JKR I;  5CTN A;  1GSV A;  1N9N A;  1S66 L;  1BTL A;  3O87 A;  3S7N A;  4GD6 A;  4CLC A;  5FI6 A;  1BZA A;  5GLA A;  5DFX A;  3LI8 A;  4UA6 A;  1W8Q A;  5IS1 A;  4BL2 A;  2PYP A;  2IWC A;  3B33 A;  3VE4 A;  3IH9 A;  2RCX A;  4HJ4 A;  3FPW A;  4BBT A;  3IX4 A;  3NIA A;  1NJ4 A;  4PM9 A;  2V0W A;  3UB7 A;  1ONG A;  1F9I A;  4OQG A;  1SDN A;  3IS2 B;  2W1T A;  5FQM A;  5EEC A;  2M7V A;  2ZMA A;  4WEJ A;  3PTE A;  3A3I A;  1XJ3 A;  2QWS A;  1OJG A;  3GEC A;  1ZG4 A;  3ZVT A;  3DTE A;  2XR0 A;  5F6A A;  4CLC B;  5EOE A;  3NI9 A;  2ZMV A;  4HP4 A;  3BLM A;  2J3T D;  1G5U A;  2WAF A;  4ARZ A;  1YKD A;  5FA7 A;  5DKL A;  3DWK A;  2XGN A;  5I94 A;  3NOU C;  4U0T A;  2VJW A;  1ZHH B;  2A49 A;  4RQ9 A;  3LIF A;  1BSG A;  4MNR A;  4BQM A;  3T4Q A;  5CTM A;  4KQD A;  3PR6 A;  1PZO A;  5C5K A;  2QYB A;  5A92 A;  3DTK A;  4IUK A;  5DTS A;  2W1T B;  3D4F A;  1OJ5 A;  5GHY A;  3WRT A;  2Y2H A;  1OPX A;  3AGD A;  4ID4 A;  3HUN A;  1TEM A;  3VE3 A;  4EER A;  1KGF A;  4GOG A;  4Y17 A;  4WYY A;  3QP5 A;  3NDG A;  3A3E A;  4QB8 A;  3T4J A;  2M7U A;  5CED A;  4I5S A;  1NRJ A;  4ARZ B;  2OWH A;  3C4O A;  5KSC A;  1OTE A;  2O9C A;  3PXP A;  2CC1 A;  1H8M A;  1IYP A;  1NY0 A;  2QHK A;  2NUT C;  3MBZ A;  2XLN A;  1ZC2 A;  2PBD P;  4XUZ A;  2B5R A;  3RXW A;  2ZBB A;  3KX0 X;  3MZE A;  1TS0 A;  3PBT A;  3AGF A;  5CER A;  2W3G A;  3CLO A;  3E4Q A;  2ACG A;  4BMW A;  1XFQ A;  1S1Z A;  3QHY A;  1K25 A;  3WS0 A;  3Q7V A;  2JKR M;  2Z6C A;  5FAQ A;  5MC7 A;  4LV2 A;  1D1J A;  4LRX C;  4HIA A;  4YNR A;  1NYY A;  4I3A A;  5HZH A;  4E04 A;  3C38 A;  4EU0 A;  2V8C A;  3RJU A;  4C3Q A;  1TDL A;  3MSH A;  4EEP A;  3T50 A;  4X69 A;  4O01 A;  4BD0 A;  3FC7 A;  5AVE A;  4D2O A;  4N92 A;  1BLP A;  5EPH A;  4N9L A;  3LIE A;  5CGW A;  3MQ0 A;  1PYY A;  2V0U A;  3P01 A;  2ZC6 B;  1CEG A;  3EEA A;  3PHY A;  2J8Y A;  3UO9 A;  1KDS A;  1YSP A;  4YFM A;  1DJB A;  1ESI A;  2W1R A;  3IHA A;  4HOI A;  5KIZ A;  2GX5 A;  3A3D A;  1X0O A;  1TVF A;  1PI4 A;  1T19 A;  1HLU P;  4PKY G;  4RVA A;  1FCM A;  2CMN A;  3CI6 A;  3D72 A;  1S6R A;  2R9X A;  1QMF A;  3MS6 A;  3I7J A;  4FOF A;  1G6O A;  4Q8I A;  3OOV A;  4DDS A;  2G2U A;  3QP6 A;  4GB7 A;  4GJ4 A;  4GKU A;  2FZ0 A;  4OPQ A;  5HX9 A;  4Y0U A;  1T1A A;  5EM1 A;  4OVD A;  2O0Y A;  1FOF A;  2VV7 A;  3IXD A;  1FIL A;  1HD8 A;  4MN7 A;  3RTY A;  4EBP A;  3G34 A;  3UN7 A;  3C8C A;  1GHP A;  1IKI A;  3VSL A;  5TJJ A;  3ZG9 B;  3OPR A;  5EUA A;  2LB5 A;  3N8S A;  4Y7P A;  1GA9 A;  1BUL A;  4ESP A;  2ZL1 A;  4CLC D;  5F1F A;  2V1A A;  5FQ9 A;  3NOP C;  1RGZ A;  2HDR A;  3E4P A;  5CHM A;  3N6I A;  4BBV A;  3NOT C;  1FR6 A;  4Y3I A;  3T12 B;  4F3L A;  3FYZ A;  1TD5 A;  3N7W A;  1OTA A;  1GSW A;  2W3F A;  4KZ3 A;  5AVF A;  3T4L A;  1YMX A;  1JNU A;  2VA0 A;  5JYP A;  3B47 A;  3BRM A;  1ERM A;  5M19 A;  1Z6F A;  2H28 A;  3LFV A;  3SOI A;  3C7U A;  1YLZ A;  4MBF A;  4KZB A;  1DJA A;  2ZL1 B;  3CMZ A;  3BFC A;  4NET A;  4QD4 A;  4LV3 A;  5A93 A;  4KUO A;  1KE4 A;  1ES2 A;  3T4K A;  3K2N A;  3LY3 A;  2Y2L A;  3IHB A;  1PWG A;  3W4P A;  2V9A A;  1RGY A;  2Q9M A;  1G28 A;  3LO7 A;  1KOU A;  2ZC3 B;  4F3L B;  2XF3 A;  4NXB A;  1GHI A;  3IX8 A;  2QZ6 A;  5KMW A;  3CJM A;  4E3N A;  2P08 A;  4GS9 B;  4Q0J A;  5FEF A;  3UE3 A;  4N1H A;  3A3F A;  3G4P A;  2EX8 A;  1P0Z A;  2GDN A;  2XQZ A;  5HDD A;  2M1C A;  4Y0T A;  1G68 A;  4KG2 A;  3MXQ A;  3RXX A;  2X01 A;  1JWP A;  4DRT A;  3TOI A;  1MBL A;  3C5A A;  2WKE A;  3ITB A;  2R9W A;  2OV5 A;  2GJ3 A;  5AQA A;  1N9B A;  3ZFZ A;  3GR2 A;  3OC2 A;  3LY4 A;  3WRZ A;  3NUL A;  3CIT A;  3D3O A;  3HJI A;  1IEM A;  5L07 A;  1SHV A;  2WGI A;  4C75 A;  3P09 A;  5F69 A;  2Z6D A;  4L9G A;  5HL6 A;  3ZDJ A;  5BOH A;  4P85 A;  1KE0 A;  2HJ9 C;  4OOM A;  3IWO A;  2P7J A;  3CG5 A;  1SDE A;  1S4S A;  1NZU A;  3HLG A;  5A91 A;  5GLC A;  1BLS A;  2QKP A;  1DP6 A;  1TS6 A;  3T1S A;  2JKF A;  5GHZ A;  4L9F A;  4KZ9 A;  1ES5 A;  2WGW A;  3EQU A;  3FWL A;  4DE3 A;  2EFU A;  3EOI A;  5CEB A;  2E8J A;  4YOF A;  4S2I A;  2PYR A;  4HJ6 A;  2VV8 A;  4Y2F A;  4EUV A;  3KYZ A;  1ES4 A;  3K3D A;  5A90 A;  1DP9 A;  4X25 A;  3SH8 A;  4HH3 A;  4JXS A;  3TSG A;  3W4Q A;  2PAV P;  4X56 A;  3UE0 A;  5M18 A;  4EET B;  5L8M A;  5F5Y A;  1NYM A;  4ZJ1 A;  2W3H A;  3BFE A;  4EV4 A;  3T1X A;  4MBH A;  3UPP A;  2D02 A;  3LIB A;  2ZQ8 A;  1YLY A;  3JVV A;  2E8I A;  4R4S A;  1CF0 A;  3ICY A;  5FAO A;  3C4P A;  1K0K A;  1SKO B;  4OPY A;  2VGK A;  3M2J A;  3Q7Z A;  1L0G A;  3IS2 A;  2OOL A;  3ITA A;  4MN6 A;  2WKQ A;  4Z1W A;  4XUX A;  4ZBE A;  2WGW B;  4B4Z A;  5E2F A;  4G3V A;  4PM8 A;  5FQI A;  4JF5 A;  1CEF A;  3UDX A;  5CGX A;  1K4F A;  2L0W A;  2PT7 A;  5FI7 A;  1PFL A;  4KG5 A;  4P87 A;  1W8Y A;  4O0P A;  2JC7 A;  3HVF A;  3ZG7 B;  1AWI A;  1K54 A;  2XD1 A;  4GLQ A;  1OT6 A;  1LI0 A;  1EI5 A;  1L3L A;  3M6H A;  3MXS A;  4JGP A;  3W4O A;  4HJ3 A;  4BBU A;  4BD1 A;  3OCL A;  2WAE A;  3F1P A;  2HGV A;  1WYC A;  3NY4 A;  4GNU A;  2FH5 A;  1K38 A;  4X68 A;  1H8Z A;  4ETX A;  4GCZ A;  2V20 A;  5E2H A;  3HUO A;  1XJ4 A;  4N1X A;  3IH8 A;  2JHE A;  1HVB A;  3T4T A;  4JPM A;  1XXM A;  5AQ7 A;  5FEG A;  4NEE D;  4NXF A;  1YLT A;  2LB9 A;  2WKI A;  1IYO A;  4KG6 A;  4CLC E;  3BFD A;  1W79 A;  3LR3 A;  4RA7 A;  4KQQ A;  4YWZ A;  3HJK A;  1T1B A;  2VLG A;  4E3J A;  1VHM A;  2BLS A;  1XPB A;  3F1P B;  1MWR A;  3M2K A;  1VET B;  3GQZ A;  2HJE A;  5HAQ A;  2W3D A;  3MF0 A;  3LYX A;  2Q0O A;  2ZQA A;  3R7W A;  2PU4 A;  2DRW A;  2A3U A;  2VK3 A;  2Y2O A;  3DTI A;  1EWZ A;  2W27 A;  2PRF A;  2OLU A;  3SH9 A;  1DJC A;  1DP8 A;  3HLB A;  4G3W A;  5HPF A;  3H7W A;  4QY5 A;  4PMA A;  2PHY A;  1IOU A;  4MDZ A;  5EVE A;  1JTG A;  2BG1 A;  4KZA A;  3V5M A;  2VGJ A;  4ZAM A;  4CJN A;  4OP5 A;  5TR7 A;  5FL3 A;  3UPN A;  5KZH A;  1MWS A;  3VFF A;  4S2K A;  3SW1 A;  5HAI A;  3G2Z A;  4X6T A;  2V8F A;  5G4Z A;  4PPR A;  1KGG A;  1MKI A;  1YQS A;  5E43 A;  1CI9 A;  1LT0 A;  3BFG A;  5EFW A;  4UHU A;  3MR0 A;  1SCW A;  5IT5 A;  3R7W B;  3HLC A;  2H0Y A;  3BFF A;  4IUH A;  2G2W A;  4E3I A;  4HES A;  3PBN A;  1K57 A;  3B42 A;  3F1N A;  1TS7 A;  3H7W B;  1Y54 A;  4JXW A;  3QNC A;  1PI5 A;  3V39 A;  3LCE A;  4R3B A;  4RX2 A;  5DFY A;  1MZU A;  4HY8 A;  2PDR A;  2WKH A;  2J80 A;  3FPV A;  4OOL A;  4ZJ3 A;  2QJ5 A;  4JF4 A;  2G7U A;  3UDI A;  1ONH A;  3VP1 A;  3GDI A;  3C7V A;  2HDQ A;  2P9V A;  4KUK A;  2Y59 A;  1N9L A;  3DWZ A;  1PW8 A;  4NXE A;  4IJG A;  1NLZ A;  4LLO B;  1PNE A;  3K3C A;  3AGE A;  4E3L A;  4EEU A;  4DMZ A;  1PZP A;  1MPL A;  5I5L A;  5CGS A;  4OPR A;  4DN0 A;  4OOY A;  3KSI A;  4DDY A;  1K6R A;  3LEZ A;  4OQI A;  1LSX A;  1VEU B;  2WZZ A;  2XFS A;  3D9Y A;  3TE8 A;  3IF6 A;  4NKP A;  1A0K A;  4PM5 A;  2Y2I A;  3F1N B;  2X02 A;  5FSR A;  3GV9 A;  3GVB A;  3FKW A;  3UPO A;  4U0X A;  1P9W A;  2WGV A;  4QWO A;  5HDC A;  4HP9 A;  1BLH A;  3PBQ A;  1YMS A;  1YM1 A;  4YIN A;  4MMN A;  4WZ4 A;  3MQQ A;  4WEL A;  4I39 A;  2Y2J A;  1BT5 A;  5HD5 A;  2P9V B;  3G30 A;  3KYQ A;  3A3J A;  1E4D A;  2XK1 A;  4UA7 A;  3PAE A;  4F94 A;  4WM9 A;  2ZM0 A;  1K54 C;  4GN2 A;  3S7Q A;  2VKS A;  3TJZ C;  4HI4 A;  2ZOI A;  3NC8 A;  1XP4 A;  5CEC A;  3VMA A;  4DE2 A;  5FDH A;  4QU3 A;  3TG9 A;  4DF6 A;  1O7E A;  5CHU A;  2Y2M A;  3KO6 A;  1FR1 A;  3LR5 A;  1NXY A;  3SS3 A;  3MJQ A;  3O3V A;  4FD8 A;  4O7D A;  3IF6 B;  4EQI A;  5HAP A;  2EX9 A;  3OZH A;  3HLE A;  3JVU A;  3ZNT A;  4WEK A;  2PD7 A;  3LR0 A;  4IED A;  4MLL A;  1IYQ A;  1PW1 A;  4S2N C;  4R23 A;  4DKI A;  4R1G A;  1TF1 A;  1D7E A;  4KEN B;  1KE3 A;  2X71 A;  3IXB A;  4DXC A;  1T18 A;  1LSW A;  1YT4 A;  5FAS A;  2ZLY A;  2I72 A;  1RCJ A;  3ZCZ A;  5HSQ A;  1E25 A;  1NRF A;  2D01 A;  3MMH A;  3UDF A;  3G2Y A;  2KLI A;  4FSF A;  3O5Y A;  2IWD A;  4GS9 A;  4S2P A;  3N8L A;  5DJT A;  4EXO A;  3KSH A;  4HQA A;  3LGO A;  1FQG A;  1FSY A;  4X53 A;  4UEY A;  5AQB A;  5GLD A;  2DCF A;  1K55 C;  2XRO A;  2RL3 A;  1CJF A;  3MKE A;  4R6L A;  2JCH A;  5DTK A;  5HAR A;  5GLB A;  2EWV A;  3QP2 A;  4K0X A;  2Q9N A;  1N9O A;  1OT9 A;  4N9K A;  1BLC A;  4B4X A;  4DJ3 A;  3IWQ A;  3CZD A;  2HP5 A;  3LIA A;  3T4S A;  1C3B A;  1MWT A;  4JGQ A;  3OPH A;  2B02 A;  4HHD A;  4R70 A;  3UB9 A;  1UWN X;  3JYI A;  2IA2 A;  3RH8 B;  4BL3 A;  3NBL A;  1OTD A;  1OTI A;  2EA9 A;  2P04 A;  3BW6 A;  3BYD A;  1MKM A;  2ZQ9 A;  5AJG A;  3U4L P;  3IXG A;  3PBR A;  4NK3 A;  3ZVW A;  4EBL A;  2O9A A;  4UQI S;  4LV1 A;  1FSW A;  2ZD8 A;  3OPL A;  4XT2 B;  1SKF A;  1E3U A;  2UV0 E;  1LL8 A;  5HW3 A;  1NWZ A;  4GHI A;  3F1O A;  4X55 A;  3Q81 A;  1K57 C;  2WKP A;  5U47 A;  4WN5 A;  1IKG A;  3S22 A;  4MBK A;  4WZ5 A;  1L0F A;  2ZC4 B;  1IFQ A;  3BQA A;  5EVI A;  3O86 A;  1SZV A;  2K31 A;  5EVL A;  5HWW A;  4I3I A;  3O88 A;  1CQA A;  2J9O A;  1ODV A;  3H9W A;  3WS5 A;  4EES A;  5IU1 A;  2A2L A;  1AXB A;  1P97 A;  3R4K A;  3ZHH A;  1TS8 A;  4JKT A;  4LRY C;  3GMW A;  2P74 A;  3NCK A;  4WF0 A;  2XSS A;  1FIK A;  1SKO A;  2B95 A;  2HPB A;  4EBN A;  4IVK A;  2EX2 A;  4I38 A;  4OH0 A;  3RFB A;  2L1M A;  4WUJ A;  4GHI B;  3F1O B;  3IF6 C;  2YKF A;  5TGF A;  4M4X A;  2HP9 A;  1N4O A;  4GDN A;  4FUW A;  4OPZ A;  3HLF A;  1S4R A;  1XJ2 A;  1VB6 A;  5HPI A;  1NZO A;  1ALQ A;  5EVI B;  4RX3 A;  4KZ7 A;  3S7O A;  5JYO A;  4O8G A;  2IWB A;  3ULF A;  3N8R A;  3QNB A;  4JLF A;  4I3J A;  2C5W B;  1ES3 A;  2DMW A;  3E0Y A;  3TRC A;  4B88 A;  4IHQ A;  4QJG A;  1J3W A;  2HP6 A;  5CHJ A;  2Y79 A;  1H0M A;  1ZKJ A;  1F2K A;  1L0E A;  4OLG A;  4HH2 A;  1ESU A;  3SH7 A;  2VGL M;  4CQH A;  1XX2 A;  3W2Z A;  1GHM A;  2XH9 A;  4FH4 A;  1QME A;  5FDS A;  1I5Q A;  4ZJ2 A;  3CPT B;  3V3R A;  4EW7 A;  4K0W A;  4DJ2 A;  5HL1 A;  1W63 Q;  2V2F F;  2Y2G A;  4ZRR A;  3ZNY A;  3LI9 A;  5J7E A;  5EM0 A;  4H8R A;  5HWV A;  3UY6 A;  1PRQ A;  3HLD A;  3WS4 A;  4KZ6 A;  1ERO A;  3JPU A;  2W3E A;  4PAU A;  2OWJ A;  4KQO A;  4P0M A;  3S4X A;  1PWC A;  4B9O A;  3A0V A;  1ZG6 A;  3MQO A;  2INW A;  2YKH A;  1VET A;  4LV0 A;  4LEN A;  3BQ8 A;  2V1B A;  4OKP A;  5G18 A;  3BEC A;  4PM7 A;  4UQI M;  4LGW A;  2J3T C;  3Q07 A;  2JKT I;  2H10 A;  3IF5 A;  4WMC A;  1MWU A;  2ZJ9 A;  3G32 A;  3V3S A;  4S2N A;  4LCL A;  1O07 A;  2QPN A;  2XEP A;  5F1G A;  1D06 A;  1UGU A;  4QHC A;  1XA1 A;  4E3M A;  4AFI A;  1GCE A;  1JWZ A;  5GHX A;  5K5B A;  1I2S A;  1WA9 A;  1LSV A;  2MJ6 A;  2W0N A;  4DE1 A;  4ETZ A;  2EFX A;  4OQH A;  3IXH A;  1VM1 A;  4OQ0 A;  2EX6 A;  1S0W A;  1XGJ A;  5TFQ A;  4JBF A;  5HD3 A;  4WBG A;  3IQA A;  1CK3 A;  2AVX A;  4MN5 A;  4Q0H A;  1DRM A;  3HCY A;  5FQJ A;  1OTB A;  4R3A A;  2FFY A;  1K55 A;  3GRJ A;  3OBF A;  3DBA A;  5F68 A;  3SZT A;  4BEN A;  3EWK A;  2BTF P;  3BLS A;  5L2F A;  5A8B A;  3CUE A;  4S2L A;  4HEF A;  3S7P A;  3LUQ A;  4BLM A;  3UME A;  2WYX A;  1I2W A;  1YSQ A;  4PKY A;  3TW8 A;  2PR6 A;  3VOL A;  2Y2P A;  3L7H A;  1V9Z A;  1VQQ A;  2Z2L B;  1ZTU A;  4Y15 A;  3NJA A;  3QP4 A;  4II7 A;  2A24 A;  3P98 A;  4WZ5 C;  1Z09 A;  1M40 A;  2EXB A;  4JXV A;  2XRN A;  1KVM A;  2XA7 S;  3C30 A;  3T4O A;  1W63 M;  5DF8 A;  5EVI C;  1K4E A;  3WS2 A;  3DW0 A;  3E4O A;  4WL9 A;  1Y4O A;  3VP3 A;  3FZC A;  3MZF A;  5G4Y A;  3UE1 A;  3FG8 A;  3ZG8 B;  5CXW A;  4D60 A;  3DAV A;  4NXG A;  3GTC A;  1VEU A;  1H8Y A;  1CI8 A;  1E3U D;  3ZYT A;  2L4R A;  5DKK A;  5IHV A;  4EWF A;  4RYE A;  1G6A A;  5FAP A;  2JKG A;  2WZX A;  4EUZ A;  4S2O A;  2A24 B;  5EVI D;  5F82 A;  3EEH A;  4KZ8 A;  4E6X A;  2ZC5 B;  2Y55 A;  5EOO A;  5DVA A;  4OLD A;  4PHT A;  1STZ A;  1W5D A;  3MKF A;  2HV1 A;  3P7N A;  2HDU A;  5L09 A;  3UB6 A;  1XJ6 A;  4L0L A;  2O9B A;  1IYS A;  3PYP A;  4XXR A;  3Q1F A;  1LL5 A;  2JKT M;  2OSU A;  2XFT A;  5E2E A;  3SS5 A;  1YLP A;  1ERQ A;  4G3K A;  4Z9Q A;  3G35 A;  4IVI A;  2EWW A;  2ZM2 A;  3WS1 A;  3PBS A;  1K56 D;  4P6Z S;  5DTT A;  2ZC7 A;  3BY8 A;  1KDW A;  2Y8H A;  4Y13 A;  2XD5 A;  3G6O A;  5HDS A;  4DE0 A;  4L9E A;  3NHQ A;  2VEA A;  3LIC A;  1TDG A;  4M3K A;  3LID A;  3PBO A;  2NUP C;  5AQ9 A;  3L9K A;  3Q7V B;  4QPR A;  4KQR A;  4GD8 A;  1XKZ A;  3S1Y A;  2PR5 A;  4E3O A;  4JF6 A;  4FTX A;  2ZMF A;  1MXO A;  1Y28 A;  3QP1 A;  4R0Q A;  4QY6 A;  2I9V A;  3BEB A;  4S2J A;  3HRE A;  3UB5 P;  3PAG A;  3NEC A;  1H3Q A;  3V50 A;  3ZG5 A;  4CLC C;  1ACF A;  3KSF A;  2QMI A;  2KOI A;  1LL9 A;  2UWX A;  4IBR A;  3W8K A;  2Y4A A;  3HL9 A;  3IBR A;  1HZO A;  4IBX A;  1FCO A;  4HNB A;  3BWL A;  1LLB A;  3C2W A;  4E3K A;  1NLY A;  1W7F A;  3IT9 A;  4NG2 A;  5GL9 A;  2R78 A;  3BJN A;  3VFH A;  5D3O A;  4S2M A;  3ZGA B;  3WWX A;  4BJP A;  2JN7 A;  1UWP X;  1U60 A;  2WUQ A;  3BM6 A;  4FCF A;  2JE5 A;  1JTD A;  4HBU A;  1T1C A;  1H5X A;  1XA7 A;  4Q0I A;  1YAX A;  4LCM A;  2WKR A;  1L0D A;  4H6J A;  4R38 A;  4X1L A;  2J9P A;  2XA7 M;  2JBF A;  1YPR A;  4JXG A;  2Z2M B;  2PU2 A;  2H0T A;  2K2N A;  4KZ5 A;  2WK0 A;  2K7S A;  2ZQD A;  4LRZ E;  3T1R A;  5J4E A;  1YLW A;  1KGE A;  5FAT A;  1EW0 A;  2GZA A;  3E2L A;  2KX6 A;  3IBJ A;  4UA9 A;  2HF6 A;  1DY6 A;  1L2S A;  2QJ7 A;  1K6S A;  3MZD A;  3E98 A;  4LPZ A;  4Y0O A;  4UAA A;  4WMC D;  2FFF B;  2VGL S;  3GSG A;  4OP8 A;  4R4R A;  4CPK A;  4LFU A;  4A5R A;  1P9R A;  3HUM A;  2PD8 A;  4XT2 A;  2Y2K A;  3EGD C;  4P6B A;  3CUE C;  3UE6 A;  3ZQ5 A;  1F5M A;  4H6J B;  2HZ5 A;  3OLO A;  4GZB A;  2XDM A;  1YLJ A;  2J3W A;  5FI2 A;  3FV7 A;  1F98 A;  2OLV A;  3UNW A;  1S67 L;  1WYB A;  2HDS A;  3CHW P;  3M6B A;  3A0R A;  3A0S A;  2OAQ 1;  3VP4 A;  5HWT A;  3IX3 A;  3ISG A;  3UB8 A;  5DJU A;  2KDK A;  2BAS A;  4K08 A;  1XGI A;  3BY9 A;  2ZOH A;  2VZW A;  5KSH A;  5F83 A;  4P6Z M;  3H82 A;  5CRF A;  5M1A A;  2H5S A;  5LBR A;  2PBY A;  1WE4 A;  2B18 A;  5EE8 A;  3KYE A;  2GNX A;  1PIO A;  2VX8 A;  2Y2Q A;  3V67 A;  3VP2 A;  4PM6 A;  4ZDX A;  4OON A;  4EQ1 A;  2EXA A;  4E6W A;  1MY8 A;  1LHY A;  5J3W A;  3HLW A;  4MCW A;  3IWI A;  1Q2P A;  2ZQ7 A;  3CAX A;  3EGX C;  4KZ4 A;  1Q2Q A;  4FH2 A;  4ME4 A;  5L10 A;  2DNS A;  3ZG0 A;  2V1Z A;  5EV0 A; 
#chains in the Genus database with same CATH homology
 4BBV A;  2J80 A;  3NOT C;  3FPV A;  3EQV A;  4OOL A;  3KSG A;  4Y3I A;  1D06 A;  1UGU A;  2QJ5 A;  5TBM A;  2G7U A;  3H82 B;  4F3L A;  1TD5 A;  4AFI A;  5K5B A;  1OTA A;  3GDI A;  1GSW A;  2W3F A;  3UMD A;  5AVF A;  3U2A A;  1WA9 A;  1LSV A;  4KUK A;  2MJ6 A;  3T4L A;  2W0N A;  4ETZ A;  1JNU A;  1N9L A;  2VA0 A;  4NXE A;  4IJG A;  1NLZ A;  4LLO B;  3K3C A;  3B47 A;  1BYW A;  4EEU A;  5HD3 A;  4DMZ A;  5I5L A;  1MC0 A;  2H28 A;  3LFV A;  3LR4 A;  5DF9 A;  4DN0 A;  3VV4 A;  4MN5 A;  4Q0H A;  1DRM A;  3KSI A;  3HCY A;  1LSX A;  1S1Y A;  3TE8 A;  1OTB A;  4R3A A;  4NKP A;  4BWI A;  5CX7 A;  3MFX A;  3OBF A;  3DBA A;  5F68 A;  3F1N B;  4KUO A;  3EWK A;  3T4K A;  4JGR A;  3K2N A;  3OCN A;  4JGO A;  1P9W A;  5A8B A;  3CUE A;  2VV6 A;  2OAP 1;  3S7P A;  3LUQ A;  2V9A A;  5HDC A;  3UME A;  4HP9 A;  1G28 A;  3PBQ A;  5TBM B;  1YSQ A;  1KOU A;  4PKY A;  4MMN A;  4F3L B;  3TW8 A;  2O99 A;  2PR6 A;  3VOL A;  3MQQ A;  4B93 A;  1XFN A;  4NXB A;  4WEL A;  4I39 A;  1V9Z A;  3CWF A;  4WLA A;  1ZTU A;  3NJA A;  5HD5 A;  1GSX A;  4II7 A;  2A24 A;  3KYQ A;  2P08 A;  4GS9 B;  4Q0J A;  2XRN A;  4GW9 A;  3UE3 A;  3S7Q A;  2XA7 S;  2VKS A;  3C30 A;  3T4O A;  1W63 M;  4Y5F A;  4HI4 A;  3TJZ C;  1V9Y A;  2JKR I;  2ZOI A;  1GSV A;  1N9N A;  1P0Z A;  3E4O A;  5HDD A;  4WL9 A;  2M1C A;  1S66 L;  3MXQ A;  5G4Y A;  3S7N A;  3KO6 A;  3LR5 A;  3FG8 A;  3MJQ A;  4CLC A;  3JVU A;  5DFX A;  2GJ3 A;  3LI8 A;  4NXG A;  5IS1 A;  3OC2 A;  4WEK A;  2PD7 A;  3LR0 A;  2PYP A;  3B33 A;  3VE4 A;  3CIT A;  3ZYT A;  3D3O A;  3HJI A;  2L4R A;  5DKK A;  4HJ4 A;  3FPW A;  1TF1 A;  5F69 A;  2Z6D A;  1D7E A;  4BBT A;  4L9G A;  5HL6 A;  2V0W A;  2HJ9 C;  3UB7 A;  4OOM A;  1F9I A;  1T18 A;  1LSW A;  2A24 B;  2P7J A;  1S4S A;  3IS2 B;  3EEH A;  2W1T A;  5HSQ A;  2M7V A;  2D01 A;  3MMH A;  2KLI A;  2QKP A;  4FSF A;  4WEJ A;  3O5Y A;  1XJ3 A;  2QWS A;  1OJG A;  3GEC A;  4PHT A;  1STZ A;  4GS9 A;  1DP6 A;  2HV1 A;  3P7N A;  1TS6 A;  3UB6 A;  5DJT A;  4EXO A;  1XJ6 A;  3KSH A;  4HQA A;  5F6A A;  4L0L A;  4L9F A;  4CLC B;  4UEY A;  2ZMV A;  4HP4 A;  3EQU A;  3EOI A;  2O9B A;  3PYP A;  2J3T D;  4YOF A;  1YKD A;  4ARZ A;  2PYR A;  2XRO A;  4R6L A;  4HJ6 A;  2VV8 A;  4Y2F A;  4EUV A;  3KYZ A;  5DKL A;  2JKT M;  3K3D A;  1DP9 A;  3NOU C;  2VJW A;  4G3K A;  1ZHH B;  4HH3 A;  2EWV A;  4RQ9 A;  3LIF A;  1N9O A;  1OT9 A;  2EWW A;  4EET B;  5L8M A;  4DJ3 A;  3PBS A;  4P6Z S;  3T4Q A;  3BY8 A;  3LIA A;  4KQD A;  5F5Y A;  3T4S A;  3PR6 A;  2W3H A;  4JGQ A;  2Y8H A;  5C5K A;  2QYB A;  2B02 A;  3G6O A;  4HHD A;  4IUK A;  5HDS A;  4L9E A;  3NHQ A;  2VEA A;  1UWN X;  3LIC A;  4R70 A;  3UB9 A;  2W1T B;  2D02 A;  3LID A;  1OJ5 A;  3LIB A;  3PBO A;  2NUP C;  4QPR A;  2IA2 A;  3JVV A;  1OPX A;  3ICY A;  3RH8 B;  2PR5 A;  1OTD A;  1OTI A;  2EA9 A;  2ZMF A;  1Y28 A;  3VE3 A;  3IS2 A;  4EER A;  2OOL A;  2P04 A;  3BW6 A;  1MKM A;  2I9V A;  5AJG A;  3PBR A;  4MN6 A;  1H3Q A;  2WKQ A;  4Z1W A;  2O9A A;  3KSF A;  4CLC C;  4UQI S;  3T4J A;  2M7U A;  2KOI A;  4I5S A;  1NRJ A;  4ARZ B;  2OWH A;  3IBR A;  1OTE A;  2O9C A;  3PXP A;  4G3V A;  4HNB A;  1H8M A;  3BWL A;  4XT2 B;  1LL8 A;  3C2W A;  1NWZ A;  4GHI A;  1NLY A;  3F1O A;  2WKP A;  2L0W A;  2PT7 A;  4WN5 A;  2QHK A;  2R78 A;  3BJN A;  2NUT C;  4BJP A;  4O0P A;  2JN7 A;  4GLQ A;  1OT6 A;  1UWP X;  1IFQ A;  3BQA A;  2ZBB A;  1T1C A;  4JGP A;  3KX0 X;  2K31 A;  4HJ3 A;  4Q0I A;  1YAX A;  4BBU A;  5HWW A;  2WKR A;  1TS0 A;  3PBT A;  4H6J A;  3OCL A;  4I3I A;  3F1P A;  2HGV A;  2W3G A;  4R38 A;  3CLO A;  1ODV A;  2FH5 A;  2XA7 M;  3E4Q A;  3H9W A;  4BMW A;  4EES A;  1XFQ A;  2A2L A;  5IU1 A;  1S1Z A;  2K2N A;  1P97 A;  3R4K A;  1TS8 A;  4LRZ E;  2K7S A;  4ETX A;  4GCZ A;  4LRY C;  2JKR M;  5J4E A;  2Z6C A;  1EW0 A;  2GZA A;  5MC7 A;  4LRX C;  4WF0 A;  1XJ4 A;  4HIA A;  2XSS A;  4YNR A;  2KX6 A;  4I3A A;  3IBJ A;  5HZH A;  4E04 A;  3C38 A;  4I38 A;  2HF6 A;  3RFB A;  4EU0 A;  2JHE A;  2QJ7 A;  3T4T A;  3E98 A;  4LPZ A;  2L1M A;  4WUJ A;  4GHI B;  3F1O B;  4NEE D;  2VGL S;  4EEP A;  2YKF A;  4NXF A;  2LB9 A;  4M4X A;  3T50 A;  4O01 A;  3FC7 A;  5AVE A;  1P9R A;  4CLC E;  1S4R A;  1XJ2 A;  1VB6 A;  2PD8 A;  3LR3 A;  4XT2 A;  3LIE A;  5HPI A;  3EGD C;  3MQ0 A;  4YWZ A;  3HJK A;  2V0U A;  3P01 A;  1T1B A;  3CUE C;  2VLG A;  1VHM A;  3S7O A;  3UE6 A;  3ZQ5 A;  1F5M A;  4O8G A;  4H6J B;  3ULF A;  3F1P B;  3EEA A;  3OLO A;  3PHY A;  4I3J A;  2HJE A;  1YSP A;  2DMW A;  2J3W A;  1F98 A;  2W3D A;  3E0Y A;  3MF0 A;  3TRC A;  4IHQ A;  3LYX A;  2Y79 A;  2W1R A;  1S67 L;  4HOI A;  5KIZ A;  2GX5 A;  3R7W A;  1X0O A;  4HH2 A;  3A0R A;  1T19 A;  3A0S A;  2OAQ 1;  2VGL M;  4PKY G;  4CQH A;  2CMN A;  5HWT A;  3CI6 A;  2W27 A;  3D72 A;  3W2Z A;  3UB8 A;  1DP8 A;  4G3W A;  4FOF A;  1G6O A;  5DJU A;  5HPF A;  3H7W A;  3OOV A;  2KDK A;  2PHY A;  1IOU A;  4MDZ A;  2BAS A;  4GJ4 A;  4K08 A;  4EW7 A;  3BY9 A;  2ZOH A;  4DJ2 A;  2VZW A;  2FZ0 A;  5KSH A;  4P6Z M;  1W63 Q;  3H82 A;  4ZRR A;  3LI9 A;  5FL3 A;  5J7E A;  5LBR A;  3SW1 A;  1T1A A;  2B18 A;  5HWV A;  2O0Y A;  2VV7 A;  2GNX A;  2VX8 A;  4MN7 A;  3RTY A;  5G4Z A;  3V67 A;  3C8C A;  2W3E A;  4PAU A;  1LT0 A;  2OWJ A;  4KQO A;  5EFW A;  4EQ1 A;  4B9O A;  3A0V A;  3MR0 A;  3MQO A;  5TJJ A;  2INW A;  2YKH A;  5IT5 A;  3R7W B;  2LB5 A;  3BQ8 A;  2V1B A;  5J3W A;  4IUH A;  3PBN A;  4UQI M;  4MCW A;  4CLC D;  2J3T C;  2JKT I;  2V1A A;  3NOP C;  3B42 A;  3CAX A;  3EGX C;  3F1N A;  1TS7 A;  3H7W B;  4ME4 A;  3E4P A;  5DFY A;  1MZU A;  4HY8 A;  2PDR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...