3MQOA

The crystal structure of the pas domain in complex with isopropanol of a transcriptional regulator in the luxr family from burkholderia thailandensis to 1.7a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
113
structure length
113
Chain Sequence
IDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, LuxR family
publication title The Crystal Structure of the PAS domain in complex with isopropanol of a Transcriptional Regulator in the LuxR family from Burkholderia thailandensis to 1.7A
rcsb
source organism Burkholderia thailandensis
total genus 28
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3mqoA00
3EWKA 3MFXA 2QJ5A 4I5SA 3OLOA 3F1NA 5HD5A 2PHYA 2PYPA 3LIEA 3LICA 3LUQA 1VB6A 1DP8A 3B33A 2VEAA 2QWSA 2PD7A 3SW1A 3E4QA 1F9IA 1UWNX 4L9FA 3ULFA 2YKFA 1LSVA 2V0WA 3LIFA 3IS2A 3GDIA 3UE6A 4LRZE 2PD8A 3F1OB 4BBTA 2ZOIA 4BBUA 4GS9A 4NXBA 2WKQA 3LIBA 4XT2B 3A0SA 2ZBBA 3CAXA 4R38A 2JN7A 4WF0A 4I3IA 4R3AA 3T50A 3VE3A 4F3LA 1UGUA 5F69A 2V1BA 3BY9A 1XJ2A 4JGOA 3UMDA 4I3JA 5HWVA 2W0NA 1TS6A 2D02A 4KUKA 1S66L 2PR6A 5F68A 1XFQA 4L9EA 1G28A 5HWTA 3F1PB 3EEHA 4L9GA 4DJ2A 1T1CA 2B02A 4I3AA 4EQ1A 2HV1A 4RQ9A 1GSWA 3VE4A 3RTYA 4WL9A 2OWJA 3A0RA 1XJ6A 3PHYA 3UB7A 2P7JA 4EXOA 4MN6A 3GECA 4EEPA 3F1OA 4R6LA 4HJ3A 5DKKA 4XT2A 5HDSA 3IBRA 2INWA 4LRXC 5J3WA 4GW9A 1LSXA 3E4OA 1NWZA 1TS0A 2EA9A 1S4SA 1T19A 4EETB 5J7EA 3KX0X 3F1PA 1GSXA 5TBMB 3UMEA 5HD3A 1P0ZA 3NOTC 5AVEA 4M4XA 2W27A 2KX6A 2L0WA 1X0OA 1Y28A 1V9YA 2I9VA 1N9LA 1OTEA 4HNBA 4BBVA 3HJKA 1S67L 2Z6DA 1T1BA 2VV6A 3RH8B 3UB8A 3MQQA 4H6JB 3MXQA 2OOLA 4HY8A 5J4EA 4JGRA 2M1CA 1S1ZA 3K3CA 4K08A 2H28A 1DP6A 4LRYC 1LL8A 1OTDA 3ICYA 3H82B 4B9OA 5F5YA 1DP9A 4HI4A 4WN5A 5G4YA 3UB9A 1KOUA 2QHKA 1OJGA 3A0VA 3MJQA 1OT6A 2WKRA 5G4ZA 5TBMA 2QJ7A 4HJ4A 4JGPA 1S1YA 2VLGA 4KQDA 2ZOHA 3P7NA 4I38A 1OTBA 1XFNA 4HQAA 4E04A 4HH2A 5HDCA 1D06A 4I39A 3H9WA 3K3DA 2YKHA 1LT0A 3C2WA 3H7WB 4HHDA 2V9AA 1EW0A 2PYRA 3FG8A 3CWFA 4HJ6A 3MR0A 3UB6A 3E4PA 4H6JA 1JNUA 3LIDA 2R78A 3NOPC 4NXGA 3NOUC 1OTAA 3G6OA 1GSVA 4GHIB 4EW7A 4HP9A 5A8BA 1P97A 3H82A 5IU1A 2VV7A 3HJIA 4HH3A 5KIZA 4R70A 5HZHA 2V0UA 2CMNA 1T18A 4YWZA 1ODVA 2A24B 2VV8A 4JGQA 4GCZA 3VOLA 3C8CA 1LSWA 1N9OA 5DKLA 2JHEA 1MZUA 3CLOA 1OT9A 1S4RA 2J80A 2BASA 1D7EA 2L1MA 3LI9A 1WA9A 2V1AA 5HWWA 2KDKA 3LI8A 1T1AA 5I5LA 5DJUA 4EEUA 3F1NB 1N9NA 1XJ4A 4WUJA 5HSQA 3BWLA 2GJ3A 2PDRA 2QKPA 3H7WA 4HP4A 4PKYA 3NJAA 5HDDA 3FC7A 5DJTA 5F6AA 4DJ3A 1XJ3A 2D01A 4PKYG 5AVFA 3ZQ5A 4GHIA 1TS7A 3MQOA 2K7SA 4HIAA 3LIAA 3IS2B 3D72A 4LLOB 4NXEA 1DRMA 1UWPX 4GS9B 3PYPA 2OWHA 2L4RA 3BY8A 4MN5A 2A24A 2WKPA 3NHQA 4KUOA 2Z6CA 4NXFA 1OJ5A 4F3LB 5IS1A 1OTIA 1F98A 1V9ZA 2PR5A 3LYXA 4EESA 5EFWA 1BYWA 4EERA 4LPZA 4WLAA 4HOIA 1TS8A
chains in the Genus database with same CATH superfamily
1GHPA 3UPOA 1E4DA 3HUOA 3ZG9B 4WZ5A 4S2MA 2J3TD 1K6RA 5L10A 2XGNA 5HD5A 1GA9A 2A2LA 3NY4A 2PHYA 4RX3A 1QMFA 1OMEA 5DFXA 3MFDA 1L0FA 1DP8A 3B33A 4C3QA 2Y2QA 2PT7A 3Q7ZA 3SW1A 4PM9A 5AQ9A 2W1RA 5CHMA 5AJGA 3E4QA 5FQ9A 1NZOA 5AQ7A 2Z2MB 4MBFA 3ULFA 3ZG5A 1FR1A 1MWUA 3FYZA 3MZDA 4YFMA 1XGIA 3E0YA 3T4QA 1PFLA 1DJCA 4KG2A 3DTEA 3VMAA 1S6RA 4OH0A 2PD8A 1Z6FA 4O8GA 4GS9A 4XT2B 3LIBA 4DE2A 4Q0JA 4G3WA 5EOOA 2ZBBA 1FILA 1HVBA 3Q7VA 4I3IA 3T50A 4F3LA 3T4JA 5F69A 2OV5A 5F82A 4BL2A 3C7UA 4JGOA 3UMDA 4EV4A 2W0NA 3ITAA 4R4SA 1BSGA 1TS6A 4BL3A 3FKWA 1LI0A 2HDRA 1ONHA 2XA7M 3T1RA 3SH8A 3NI9A 1XFQA 5HWTA 5GLAA 4IUHA 5FAOA 3EEHA 3SS4A 4DJ2A 1T1CA 3EGDC 3UDIA 2O9BA 4LV2A 4EQ1A 3ISGA 5CEBA 1K57C 3RTYA 3S1YA 5CGXA 4DF6A 5CGSA 1BTLA 1KE4A 5CXWA 2V8FA 3A0RA 1XJ6A 2W3EA 5LBRA 2P7JA 5HFOA 1WYCA 4CLCC 4JF4A 3O5YA 5EVIC 3EEAA 5FQJA 3QNBA 3GECA 2XRNA 3RJUA 2XFTA 1A0KA 3C5AA 2V1ZA 4OP5A 1ES3A 5CGWA 1RP5A 4EBPA 1F5MA 3AGDA 1LSXA 1ZC2A 4E3KA 4D60A 3U4LP 2EA9A 3N7WA 4MDZA 1L3LA 4FH4A 1NRJA 2XF3A 3P09A 3PBOA 4N9KA 4JF6A 4XUZA 1XPBA 3HCYA 3F1PA 4K91A 5L09A 5TBMB 1YMXA 3IF6B 5HD3A 5EECA 4UQIM 1P0ZA 4UHUA 4GJ4A 2ZC5B 4M4XA 4IBRA 4ARZA 4CQHA 2R9WA 1L0EA 2XH9A 3MSHA 4PM7A 1ESIA 3KYZA 4X25A 3HJKA 3WS2A 2ZC6B 2Z6DA 2Y2MA 1MPLA 3IT9A 5M19A 2CC1A 1T1BA 3BJNA 5CRFA 1AXBA 3LR5A 2BTFP 2XK1A 4JLFA 3L7HA 2LB9A 3R4KA 1L0GA 3VSKA 5HL6A 2Y2NA 2OOLA 5A92A 2EX8A 3HVFA 4P87A 2VZWA 2P9VA 2H28A 4BJPA 3S22A 4EUZA 4NG2A 1SZVA 4R23A 5FASA 4Y5FA 1NRFA 4HBUA 4WEKA 4DXCA 3MJQA 4C75A 1OT6A 1YM1A 4JGPA 1VETA 3P7NA 1OTBA 4DDSA 2Y2KA 4HQAA 1XX2A 4E04A 1IELA 2WGWB 3FPWA 3LR4A 3OCNA 1CQAA 2Y91A 1Y4OA 1PWGA 5HAIA 1KDSA 2NUTC 2XA7S 5A91A 4JPMA 3ZCZA 4E3IA 3H7WB 2V9AA 3FG8A 3CWFA 4BD1A 3MR0A 3E4PA 4FOFA 1PI5A 2H0YA 3WRTA 3NOPC 3A3FA 3LR0A 4P6BA 4HESA 1MBLA 3OZHA 4CLCD 1O7EA 5EVID 2GX5A 2VGJA 4GHIB 1CEFA 3T12B 2WGIA 3W4QA 3NECA 1MWRA 3O87A 5IU1A 3EQUA 3M6BA 4R70A 3OCLA 4WYYA 2IWCA 2DMWA 1GHIA 2WKHA 4CLCE 2UV0E 4FCFA 3JVUA 2JE5A 1ODVA 5F1GA 4EQIA 3BFCA 4E3MA 3TJZC 5DKLA 3KSHA 4FUWA 1XGJA 1FOFA 4KG6A 2IA2A 1IYOA 1H5XA 1D7EA 4Q0HA 3MKFA 1IOUA 3G30A 3LCEA 4Y15A 3IXDA 3QP1A 4S2IA 3LI8A 1N9NA 1XJ4A 1HLUP 3C38A 1DY6A 1K57A 1K54C 4QB8A 3QNCA 5IHVA 1ES2A 3CG5A 3FC7A 4UQIS 3QP2A 3HLGA 4OVDA 1IKIA 4OP8A 2WAEA 2ACGA 3KSIA 1MXOA 3ZQ5A 1K4EA 1YMSA 2K7SA 3UE0A 3UPPA 3LIAA 1G6AA 2J3TC 2XD1A 4LLOB 4PAUA 1MC0A 1BLCA 1DRMA 1UWPX 5FAQA 4GS9B 1FSYA 2RL3A 2P08A 3BEBA 5MC7A 2Z6CA 1AWIA 3O3VA 4KZ3A 3Q7VB 3HLEA 4ETZA 4F3LB 4X53A 4NEED 4OPQA 1V9ZA 2PR5A 3LYXA 4EESA 4OQ0A 3LY3A 4U0XA 2ZL1B 4HOIA 1TS8A 3T4OA 3EWKA 3NULA 1I2WA 3EGXC 1G6OA 4O0PA 5HPIA 4Z9QA 4MMNA 3LICA 3G32A 2W3FA 2OAP1 2M7UA 4EU0A 3V50A 2Y2IA 1YSQA 4OPYA 1ERMA 1F9IA 1UWNX 5G18A 1ESUA 3JVVA 2YKFA 1LSVA 1VEUA 4D2OA 1GCEA 3ZVWA 4RVAA 1VQQA 1K25A 3IS2A 3GDIA 2PBYA 5F83A 4YINA 3UE6A 4LRZE 5GHZA 2AVXA 5GLDA 3CPTA 1ZKJA 4HEFA 5CERA 5F1FA 3T4TA 2XR0A 4NXBA 1H8MA 3A0SA 3BFDA 4U3TA 3MKEA 1TD5A 1ZG6A 4OLDA 5K5BA 1YPRA 3M6HA 1XJ2A 4ESPA 4I3JA 4ZJ2A 3UB5P 4IHQA 4OQHA 2ZMAA 1W8QA 4FD8A 1S66L 5CHJA 2ZC4B 1IYQA 5F68A 5GLCA 1CF0A 4L9EA 3F1PB 5J8XA 4L9GA 3IHAA 5FDHA 4BD0A 2B02A 2R9XA 4B93A 3N8LA 2EX9A 1KGGA 3C4PA 2VKSA 4ARZB 4NETA 3SS3A 2OWJA 2XDMA 3G35A 4Y7PA 1ZTUA 1H3QA 2J3WA 1JVJA 4RX2A 4IEDA 4EXOA 3R7WB 2Q0OA 3S7QA 3F1OA 5E43A 1PZOA 4HJ3A 4U0TA 1BLHA 3IH8A 5HDSA 1YSPA 3IBRA 2W3GA 3KSFA 5KZHA 2P9VB 3TE8A 4QD4A 5EVEA 3BLMA 4LRXC 1Q2QA 4JXGA 5D3OA 5E2GA 2VA0A 1D1JA 3E4OA 1NWZA 4IVKA 1MWSA 3PBSA 1HZOA 3N8SA 4LV0A 4Q0IA 3JYIA 4DN0A 2C5WB 5TR7A 1W63M 5HL1A 3KX0X 1GSXA 1BZAA 4O01A 5EUAA 1VETB 4QWOA 5FI6A 3NOTC 4OOMA 4JBFA 1YT4A 4E3OA 2W27A 1GHMA 4E3NA 1SDEA 1OTEA 4HNBA 5EE8A 1PZPA 4S2KA 4IBXA 1K54A 2VV6A 3AGFA 3RH8B 5FQKA 4N1XA 3UB8A 2Y2OA 1JWVA 1TF1A 3N8RA 3MQQA 3MXQA 3BQAA 4LFUA 3IBJA 4HY8A 5KSHA 3T4KA 3HL9A 4S2NC 4CJNA 1NZUA 4K08A 1DJBA 3RXWA 2DNSA 2W3DA 4GNUA 4O7DA 1LL8A 1F2KA 1CK3A 4E3LA 4WMCD 1CEGA 3VSLA 1MKIA 4QJGA 1DP9A 3UE3A 4OLGA 5CTMA 1LL5A 1LLBA 4GDNA 4MCWA 3VFHA 5CECA 3ZNYA 1SKOA 2ZC3B 1ES5A 1KOUA 1JWZA 2WKRA 4HJ4A 1S1YA 4KQDA 2VK3A 1FCOA 2JKGA 4I38A 4WEJA 3ZG8B 5EM1A 1I5QA 2Y55A 2G2WA 2Y2HA 3UE1A 3AGEA 3O86A 5HDCA 5DTSA 4GDBA 4FH2A 2RCXA 2X71A 3W8KA 3HUMA 4N1HA 3K3DA 4EBLA 3HUNA 2MJ6A 2YKHA 3T1QB 5DF8A 4B4XA 3OPRA 2UWXA 1EW0A 2KOIA 3DBAA 3N4IA 3E2LA 4Y0OA 3OPHA 2VX8A 3IF5A 2JKTI 3IX8A 3UPNA 4DKIA 5CTNA 3GMWA 4NXGA 5DTKA 5HAQA 2WAFA 1OTAA 1PWDA 3BFEA 3G6OA 1MKMA 1GSVA 1E3UD 3D3OA 2EWVA 5A8BA 3KYQA 3NDEA 3H82A 1RCJA 4PHTA 1YLYA 2J8YA 3ITBA 5HW3A 5HZHA 4KZBA 3T1XA 4ZBEA 1PRQA 4YWZA 5E2HA 4OPZA 2XQZA 3B3XA 3MS6A 3V3RA 3M2KA 4GCZA 1QMEA 3SZTA 3EOIA 3C8CA 3NIAA 1OPXA 2JHEA 1MZUA 1MWTA 3CUEA 3QP5A 3ZYTA 2QMIA 1TDLA 2L1MA 2H5SA 5HWWA 1CI8A 2XROA 1FCNA 3WS1A 5DJUA 3ZG0A 1K38A 4WUJA 5TFQA 3WWXA 2ZMFA 3CITA 2PDRA 1PW1A 2HDSA 5HDDA 3MQ0A 5FEGA 1IYPA 2K31A 4P0MA 2J9PA 3LR3A 5DJTA 2EFUA 3WS5A 1K55C 5F6AA 1XJ3A 2D01A 2WZZA 3T4LA 1VEUB 1W7FA 1KGEA 3V3SA 5HARA 4JXSA 3MQOA 2XD5A 5FQQA 2HGVA 3IS2B 3SH7A 3D72A 2WK0A 3BM6A 1O07A 2ZQAA 1FQGA 4A5RA 3CPTB 1J3WA 3LY4A 4MN5A 2DRWA 3G4PA 4PM5A 3NHQA 1H8ZA 2WKIA 3A3IA 3PR6A 2A49A 1CJFA 3BRMA 3HLWA 1K6SA 2H10A 1F98A 2OLUA 2HP9A 4OQIA 1M6KA 4YOFA 4LPZA 3BFGA 1BLSA 3T4SA 2QJ5A 4I5SA 3OLOA 1LI9A 1EI5A 2PYPA 5DFYA 3LUQA 2Q9NA 2OAQ1 2XEPA 2VEAA 3HREA 2QWSA 4MBKA 4XUXA 3UN7A 2ZQCA 2VGLM 3FPVA 3VOYA 1NJ4A 4R3JA 1H0MA 1J9MA 4G3VA 1XXMA 3PAEA 2O99A 4Y17A 4S2NA 3W4PA 3F1OB 1L0DA 3VP4A 1VHMA 4KZ4A 4BBTA 2OSUA 3CJMA 3TRCA 5KSCA 3CAXA 3MXSA 2JN7A 4EBNA 3VE3A 1UGUA 2PU4A 3HLCA 2V1BA 3RFBA 4H8RA 3BY9A 4DE1A 4UA7A 4IJGA 4ZTKA 3PTEA 5HWVA 1P9RA 2LB5A 2D02A 4KUKA 3LO7A 4MN7A 3OC2A 2PR6A 2IWBA 1G28A 2O0YA 4CLCA 2X02A 2FFYA 5EVIA 4QY5A 2EX2A 2WYXA 4I3AA 5FI7A 1N9BA 4UA6A 3WS0A 4JKTA 4RQ9A 1GSWA 3VE4A 4OONA 1YAXA 4ETXA 3NC8A 1ZHHB 3IH9A 3WS4A 5E2EA 2HJ9C 3T1SA 1MY8A 2Y4AA 1TEMA 3G2YA 2P74A 1NXYA 4P85A 3PHYA 3UB7A 1S0WA 3NBLA 5FATA 4EEPA 2G2UA 3IWIA 4R6LA 5DKKA 3FZCA 4X68A 3RXXA 1SCWA 4GOGA 2PBDP 1SHVA 5CHUA 4GD6A 5CX7A 4GW9A 1LHYA 3OBFA 2ZQ9A 4WZ4A 3E2KA 4MBHA 1TS0A 5GLBA 2FFFB 1KVLA 1HD8A 1SKFA 4EETB 1PW8A 5J7EA 3KYEA 3BW6A 3IWOA 1FIKA 2H0TA 3UMEA 3D9YA 2BLSA 1M40A 3HBRA 3G34A 3P01A 4GN2A 2V2FF 3OPPA 1K56D 1W8YA 1XA7A 2HDQA 1WE4A 5DF9A 1YLWA 1S67L 3OOVA 4X56A 2Y59A 3SH9A 5U47A 1HTZA 1PYYA 1Y54A 3LFVA 3KSGA 3DTIA 3GV9A 4L0LA 4KZ9A 3QP4A 1K55A 1W5DA 5DTTA 3MZEA 3EQVA 2PRFA 3A3EA 4UEYA 2E8JA 3V67A 4JGRA 2M1CA 2VGLS 3MXRA 3K3CA 1FCMA 3IX4A 3DAVA 1EWZA 4ZAMA 2JKTM 3H82B 2B18A 5F5YA 1IFQA 2ZM0A 3TOIA 2XLNA 3TW8A 1K4FA 4HI4A 3FV7A 4WN5A 1STZA 5GL9A 5EOEA 1EROA 4LENA 1NYYA 2QHKA 1OJGA 5FL3A 1BT5A 3LGOA 5EPHA 2ZD8A 4JXWA 2QJ7A 1KE3A 3K2NA 2VLGA 2ZOHA 4KG5A 2Z2LB 1BUEA 5BOHA 1XFNA 1ALQA 4WELA 2WUQA 2HF6A 2QPNA 5L07A 3SOIA 1KVMA 1D06A 2ZQDA 4G3KA 4DDYA 4B88A 3S7OA 2J9OA 2ZQ7A 2G7UA 1LT0A 5HAPA 2JKRI 3C2WA 3DWZA 4HHDA 3ZNTA 4HJ6A 4H6JA 2WZXA 4Y2FA 1JNUA 2R78A 1G68A 4P6ZM 4DMZA 3LEZA 1I2SA 3BFFA 4GD8A 4E6XA 1GA0A 2JC7A 2QYBA 1XA1A 4EW7A 4HP9A 4YNRA 4ZRRA 2Y2LA 1IEMA 3QP6A 4ID4A 2HP6A 2Y2PA 3HJIA 2Q9MA 4X6TA 2V0UA 5TGFA 1T18A 3IXBA 5C5KA 5L8MA 2OLVA 5DVAA 2W1TA 4OOYA 3TSGA 4S2OA 3VOLA 1LSWA 1N9OA 3BLSA 4HBTA 2ZQ8A 1H8YA 1NYMA 3CLOA 1OT9A 3MZFA 4XXRA 4AFIA 1XP4A 2J80A 2BASA 3VOZA 1WA9A 3PBQA 3CMZA 4FTXA 1PWCA 1PNEA 1RGYA 4KZ7A 4KENB 3BECA 1T1AA 3GVBA 2Y2JA 4EEUA 4QHCA 2GJ3A 5CEDA 5AQBA 2ZM2A 5A93A 3NJAA 4KQOA 2ZL1A 2P04A 3B42A 5E2FA 3ZVTA 3G2ZA 3IX3A 4KZ6A 3IXGA 4MLLA 2ZLYA 4DJ3A 4X55A 4PKYG 5AVFA 5AQAA 1U60A 4GLQA 1SDNA 1TS7A 4HIAA 4X1MA 5HPFA 2XSSA 1VM1A 4WM9A 4B4ZA 2I72A 1YLPA 3BQ8A 3ZFZA 4PPRA 1ERQA 2L4RA 3CZDA 2HDUA 2V20A 3IHBA 2A24A 3IXHA 2WKPA 4KUOA 4KZAA 4ME4A 1JTGA 3GR2A 4NXFA 1OJ5A 1YLJA 5EVLA 1OTIA 5IS1A 3MBZA 3TG9A 3IF6C 1IYSA 2V8CA 2GDNA 3MFXA 4UA9A 3V39A 2ZJ9A 4EUVA 3F1NA 2GNXA 3U2AA 1YLTA 3HLDA 4CLCB 3LIEA 5EVIB 1VB6A 4ZJ3A 3VFFA 1Q2PA 5FQIA 5M18A 2EWWA 2PD7A 4WMCA 2B95A 4S2JA 4JF5A 2ZMVA 1K0KA 4LV1A 1LL9A 2NUPC 4L9FA 3DW0A 3ZDJA 2V0WA 5GHXA 3N6IA 3LIFA 3SS5A 3C4OA 2ZOIA 3MF0A 3FWLA 3W4OA 4PMAA 4BBUA 2WKQA 4Z1WA 3HLFA 1RGZA 4DXBA 4R3BA 5EM0A 4R38A 4WF0A 4P6ZS 4QY6A 4R3AA 3QP8A 4X69A 4II7A 3R7WA 2B5RA 4FSFA 3CI6A 3VV4A 4IUKA 1ONGA 4BENA 2DCFA 2EX6A 3VP1A 2WGVA 3GSGA 4KQRA 1YQSA 4CPKA 1L2SA 3NDGA 4EWFA 1ZG4A 3D4FA 3I7JA 1E3UA 4Y0TA 1YKDA 2HV1A 1PIOA 2HPBA 3UDXA 4WL9A 4BMWA 3QHYA 4QU3A 4OKPA 5FQMA 3UDFA 3GQZA 2M7VA 3DWKA 2EXAA 3M2JA 4MN6A 4Q8IA 4R4RA 5FA7A 5FSRA 1WYBA 3MMHA 4OPRA 2X01A 4XT2A 1TVFA 1BLPA 3ZGAB 2INWA 4Y3IA 5J3WA 2C6WB 1CI9A 1KDWA 4DE0A 2HZ5A 3JPUA 3VP2A 5HX9A 3C30A 4BQMA 1S4SA 5FEFA 1T19A 2HP5A 5FI2A 2A3UA 3C7VA 3S7PA 5JYOA 4DE3A 1Z09A 4WZ5C 1JTDA 5JYPA 4BLMA 5AVEA 2KX6A 2L0WA 1FSWA 4N9LA 1X0OA 4QPRA 1Y28A 1KGFA 3UY6A 1V9YA 4ZDXA 2I9VA 1N9LA 4BBVA 4LV3A 3Q82A 4MNRA 1JWPA 3PBTA 1G5UA 2JBFA 3E98A 4LCMA 4OOLA 3A3DA 2IWDA 3DTKA 3DTMA 2ZM8A 3G31A 3UNWA 5IT5A 4H6JB 4OQGA 5J4EA 4Y13A 2JKRM 4PM6A 1S1ZA 4RA7A 3Q07A 3Q1FA 5TJJA 1DP6A 4LRYC 5GHYA 1OTDA 3L9KA 3ICYA 3GTCA 4B9OA 1N4OA 3LEQA 4IVIA 3V5MA 2JKFA 2ZC7A 2JCHA 3PBNA 1ACFA 2EFXA 4KZ8A 5G4YA 3UB9A 4GZBA 1PI4A 3A0VA 2W1TB 5FDSA 5G4ZA 5TBMA 2Y79A 3IF6A 2XFSA 2PU2A 1P9WA 3PBRA 2VGKA 4JXVA 3S7NA 4RYEA 4HH2A 4GB7A 2K2NA 1BULA 3IWQA 4I39A 4E3JA 3H9WA 4UAAA 3UO9A 3GRJA 2BG1A 2PYRA 3A3JA 2KLIA 3KO6A 2Y2GA 3OPLA 3UB6A 4R0QA 5FAPA 3LIDA 1YLZA 5A90A 1W63Q 4KZ5A 3S4XA 1SKOB 2WKEA 3NOUC 2QZ6A 1ES4A 5M1AA 3VP0A 2W3HA 4E6WA 1P97A 3CHWP 4WBGA 3FKVA 2VV7A 3PXPA 4C6YA 4HH3A 5L2FA 5KIZA 4Y0UA 2CMNA 3B47A 2A24B 2VV8A 1W79A 4JGQA 2E8IA 5EV0A 4BWIA 4R1GA 1DJAA 1S4RA 2O9AA 3P98A 3ZG7B 2WGWA 3LI9A 2V1AA 2VJWA 4KQQA 1FR6A 4K0XA 2KDKA 1KE0A 1E25A 5I5LA 3F1NB 3Q81A 4M3KA 3NCKA 5HSQA 3BWLA 2WADA 3O88A 4S2PA 2QKPA 3H7WA 4HP4A 4PKYA 4ZJ1A 2J7VA 4GKUA 4LGWA 3CUEC 3WRZA 4K0WA 2FZ0A 5I94A 3HLBA 3BYDA 4DRTA 4LCLA 1XKZA 2PAVP 2Y8HA 1NLYA 3PAGA 4GHIA 4PM8A 4NK3A 3VP3A 1C3BA 4S2LA 4NXEA 1K56A 3W2ZA 4NKPA 3PYPA 2OWHA 3BY8A 2O9CA 1NY0A 4X1LA 2GZAA 3ZHHA 4MEZA 1IKGA 2FH5A 2HJEA 4N92A 5DF7A 1NLZA 1TDGA 4F94A 5EFWA 1BYWA 4EERA 2EXBA 4WLAA 5KMWA 3IQAA
chains in the Genus database with same CATH topology
3EWKA 3MFXA 3EGXC 1G6OA 3T4SA 2QJ5A 4EUVA 2J3TD 4I5SA 4O0PA 3OLOA 3F1NA 5HD5A 2GNXA 3U2AA 2A2LA 5HPIA 2PHYA 4CLCB 2PYPA 5DFYA 3LIEA 4MMNA 3LICA 3LUQA 2OAQ1 1VB6A 5DFXA 1DP8A 3B33A 2W3FA 2VEAA 2QWSA 2PT7A 2EWWA 2PD7A 3SW1A 2VGLM 3FPVA 2OAP1 2W1RA 2M7UA 4EU0A 5AJGA 3E4QA 2ZMVA 1YSQA 1F9IA 1UWNX 2NUPC 4L9FA 3JVVA 3ULFA 2YKFA 1LSVA 2V0WA 4G3VA 3LIFA 3IS2A 3GDIA 2O99A 3E0YA 3T4QA 3UE6A 4LRZE 2PD8A 3F1OB 1VHMA 4BBTA 2ZOIA 3MF0A 4BBUA 4O8GA 3T4TA 4GS9A 4NXBA 1H8MA 2WKQA 3LIBA 4XT2B 3TRCA 3A0SA 4Z1WA 4Q0JA 1TD5A 4G3WA 2ZBBA 3CAXA 4R38A 2JN7A 4WF0A 4P6ZS 4I3IA 4R3AA 3T50A 3VE3A 4F3LA 3T4JA 4II7A 1UGUA 5F69A 5K5BA 2V1BA 3R7WA 3RFBA 3BY9A 1XJ2A 4FSFA 3CI6A 3VV4A 4IJGA 4IUKA 4JGOA 3UMDA 4I3JA 5HWVA 2W0NA 1P9RA 1TS6A 2LB5A 4IHQA 2D02A 4KUKA 4MN7A 2XA7M 3OC2A 1S66L 2PR6A 5F68A 1XFQA 4L9EA 1G28A 5HWTA 3F1PB 2O0YA 4CLCA 4IUHA 3EEHA 4L9GA 4DJ2A 1T1CA 2B02A 3EGDC 4B93A 2O9BA 4I3AA 1YKDA 4EQ1A 2HV1A 2VKSA 4ARZB 4RQ9A 1GSWA 3VE4A 1YAXA 4ETXA 3RTYA 4WL9A 4BMWA 2OWJA 1ZHHB 1ZTUA 1H3QA 2HJ9C 2J3WA 3A0RA 1XJ6A 2M7VA 3PHYA 2W3EA 5LBRA 2P7JA 3UB7A 4CLCC 4EXOA 3R7WB 4MN6A 3O5YA 3EEAA 3GECA 2XRNA 3S7QA 4EEPA 3F1OA 3MMHA 4R6LA 4HJ3A 5DKKA 4XT2A 5HDSA 1YSPA 3IBRA 2W3GA 3KSFA 2INWA 3TE8A 1F5MA 4Y3IA 4LRXC 5J3WA 5CX7A 4GW9A 1LSXA 3OBFA 2VA0A 3E4OA 1NWZA 1TS0A 3C30A 3PBSA 2EA9A 4MDZA 1S4SA 1NRJA 4Q0IA 1T19A 4DN0A 4EETB 5J7EA 3PBOA 3BW6A 1W63M 3HCYA 3S7PA 3KX0X 3F1PA 1GSXA 5TBMB 3UMEA 4O01A 5HD3A 3P01A 4UQIM 1P0ZA 4GJ4A 3NOTC 5AVEA 4M4XA 4OOMA 2W27A 2KX6A 4ARZA 2L0WA 4CQHA 1X0OA 4QPRA 1Y28A 1V9YA 2I9VA 1N9LA 1OTEA 5DF9A 4HNBA 4BBVA 3KYZA 3HJKA 1S67L 3OOVA 2Z6DA 3PBTA 1T1BA 3BJNA 2VV6A 3E98A 3LFVA 3LR5A 3KSGA 4OOLA 3RH8B 3UB8A 2LB9A 1TF1A 3R4KA 5HL6A 4L0LA 5IT5A 3MQQA 4H6JB 3EQVA 3MXQA 2OOLA 3BQAA 4UEYA 3IBJA 4HY8A 3V67A 5J4EA 2JKRM 3T4KA 5KSHA 4JGRA 2M1CA 1S1ZA 2VGLS 2VZWA 3K3CA 4K08A 2H28A 4BJPA 5TJJA 1DP6A 2W3DA 4LRYC 1LL8A 2JKTM 1OTDA 3ICYA 3H82B 4B9OA 2B18A 5F5YA 4Y5FA 1IFQA 1DP9A 3UE3A 3TW8A 4MCWA 4HI4A 4WN5A 1STZA 3PBNA 5G4YA 3UB9A 4WEKA 1KOUA 5FL3A 2QHKA 1OJGA 3A0VA 3MJQA 1OT6A 2WKRA 2W1TB 5G4ZA 5TBMA 2Y79A 2QJ7A 4HJ4A 3K2NA 4JGPA 1S1YA 2VLGA 4KQDA 2ZOHA 3P7NA 4I38A 1P9WA 3PBRA 4WEJA 1OTBA 1XFNA 4HQAA 4WELA 4E04A 2HF6A 3S7NA 4HH2A 3FPWA 3LR4A 3OCNA 2K2NA 5HDCA 1D06A 4I39A 4G3KA 3H9WA 3K3DA 3S7OA 2MJ6A 2G7UA 1LT0A 2NUTC 2YKHA 2JKRI 2XA7S 3C2WA 3H7WB 4HHDA 2V9AA 1EW0A 2KOIA 2PYRA 3DBAA 2KLIA 3KO6A 3FG8A 3CWFA 4HJ6A 3MR0A 3UB6A 3E4PA 4H6JA 4FOFA 4Y2FA 1JNUA 2VX8A 3LIDA 2JKTI 2R78A 1W63Q 4P6ZM 3NOPC 4DMZA 3LR0A 4NXGA 3NOUC 4CLCD 1OTAA 3G6OA 2GX5A 1MKMA 2W3HA 1GSVA 4GHIB 2QYBA 3D3OA 4EW7A 2EWVA 4HP9A 4YNRA 5A8BA 1P97A 3KYQA 4ZRRA 3H82A 4PHTA 5IU1A 2VV7A 3EQUA 3PXPA 3HJIA 4HH3A 5KIZA 4R70A 3OCLA 5HZHA 2V0UA 2DMWA 2CMNA 3B47A 1T18A 4CLCE 4YWZA 5C5KA 3JVUA 1ODVA 5L8MA 2A24B 2VV8A 4JGQA 2W1TA 4GCZA 3EOIA 3VOLA 3C8CA 3TJZC 1LSWA 4BWIA 1N9OA 5DKLA 1OPXA 3KSHA 2JHEA 1MZUA 3CUEA 3ZYTA 3CLOA 1OT9A 1S4RA 4AFIA 2O9AA 2IA2A 2J80A 2BASA 1D7EA 2L1MA 4Q0HA 3LI9A 1WA9A 2V1AA 5HWWA 2VJWA 3PBQA 1IOUA 2XROA 2KDKA 3LI8A 1T1AA 5DJUA 5I5LA 4EEUA 3F1NB 1N9NA 1XJ4A 3C38A 4WUJA 5HSQA 3BWLA 2ZMFA 3CITA 2GJ3A 2PDRA 2QKPA 3H7WA 4HP4A 4PKYA 3NJAA 5HDDA 3MQ0A 4KQOA 2P04A 3B42A 3FC7A 2K31A 3CUEC 4UQIS 3LR3A 2FZ0A 5DJTA 5F6AA 4DJ3A 3KSIA 1XJ3A 2D01A 4PKYG 3T4LA 5AVFA 2Y8HA 3ZQ5A 1NLYA 4GHIA 4GLQA 1TS7A 3MQOA 2K7SA 4HIAA 5HPFA 2HGVA 3IS2B 3LIAA 2XSSA 3D72A 2J3TC 4LLOB 3BQ8A 4NXEA 4PAUA 1MC0A 1DRMA 1UWPX 3W2ZA 4NKPA 4GS9B 3PYPA 2OWHA 2L4RA 3BY8A 4MN5A 2O9CA 2A24A 2P08A 2WKPA 3NHQA 2GZAA 5MC7A 4KUOA 2Z6CA 4ME4A 3PR6A 4NXFA 1OJ5A 4ETZA 4F3LB 1OTIA 5IS1A 4NEED 1F98A 1V9ZA 2FH5A 2HJEA 2PR5A 3LYXA 4EESA 1NLZA 5EFWA 1BYWA 4EERA 4YOFA 4LPZA 4WLAA 4HOIA 1TS8A 3T4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EWK A;  3MFX A;  2QJ5 A;  4I5S A;  3OLO A;  3F1N A;  5HD5 A;  2PHY A;  2PYP A;  3LIE A;  3LIC A;  3LUQ A;  1VB6 A;  1DP8 A;  3B33 A;  2VEA A;  2QWS A;  2PD7 A;  3SW1 A;  3E4Q A;  1F9I A;  1UWN X;  4L9F A;  3ULF A;  2YKF A;  1LSV A;  2V0W A;  3LIF A;  3IS2 A;  3GDI A;  3UE6 A;  4LRZ E;  2PD8 A;  3F1O B;  4BBT A;  2ZOI A;  4BBU A;  4GS9 A;  4NXB A;  2WKQ A;  3LIB A;  4XT2 B;  3A0S A;  2ZBB A;  3CAX A;  4R38 A;  2JN7 A;  4WF0 A;  4I3I A;  4R3A A;  3T50 A;  3VE3 A;  4F3L A;  1UGU A;  5F69 A;  2V1B A;  3BY9 A;  1XJ2 A;  4JGO A;  3UMD A;  4I3J A;  5HWV A;  2W0N A;  1TS6 A;  2D02 A;  4KUK A;  1S66 L;  2PR6 A;  5F68 A;  1XFQ A;  4L9E A;  1G28 A;  5HWT A;  3F1P B;  3EEH A;  4L9G A;  4DJ2 A;  1T1C A;  2B02 A;  4I3A A;  4EQ1 A;  2HV1 A;  4RQ9 A;  1GSW A;  3VE4 A;  3RTY A;  4WL9 A;  2OWJ A;  3A0R A;  1XJ6 A;  3PHY A;  3UB7 A;  2P7J A;  4EXO A;  4MN6 A;  3GEC A;  4EEP A;  3F1O A;  4R6L A;  4HJ3 A;  5DKK A;  4XT2 A;  5HDS A;  3IBR A;  2INW A;  4LRX C;  5J3W A;  4GW9 A;  1LSX A;  3E4O A;  1NWZ A;  1TS0 A;  2EA9 A;  1S4S A;  1T19 A;  4EET B;  5J7E A;  3KX0 X;  3F1P A;  1GSX A;  5TBM B;  3UME A;  5HD3 A;  1P0Z A;  3NOT C;  5AVE A;  4M4X A;  2W27 A;  2KX6 A;  2L0W A;  1X0O A;  1Y28 A;  1V9Y A;  2I9V A;  1N9L A;  1OTE A;  4HNB A;  4BBV A;  3HJK A;  1S67 L;  2Z6D A;  1T1B A;  2VV6 A;  3RH8 B;  3UB8 A;  3MQQ A;  4H6J B;  3MXQ A;  2OOL A;  4HY8 A;  5J4E A;  4JGR A;  2M1C A;  1S1Z A;  3K3C A;  4K08 A;  2H28 A;  1DP6 A;  4LRY C;  1LL8 A;  1OTD A;  3ICY A;  3H82 B;  4B9O A;  5F5Y A;  1DP9 A;  4HI4 A;  4WN5 A;  5G4Y A;  3UB9 A;  1KOU A;  2QHK A;  1OJG A;  3A0V A;  3MJQ A;  1OT6 A;  2WKR A;  5G4Z A;  5TBM A;  2QJ7 A;  4HJ4 A;  4JGP A;  1S1Y A;  2VLG A;  4KQD A;  2ZOH A;  3P7N A;  4I38 A;  1OTB A;  1XFN A;  4HQA A;  4E04 A;  4HH2 A;  5HDC A;  1D06 A;  4I39 A;  3H9W A;  3K3D A;  2YKH A;  1LT0 A;  3C2W A;  3H7W B;  4HHD A;  2V9A A;  1EW0 A;  2PYR A;  3FG8 A;  3CWF A;  4HJ6 A;  3MR0 A;  3UB6 A;  3E4P A;  4H6J A;  1JNU A;  3LID A;  2R78 A;  3NOP C;  4NXG A;  3NOU C;  1OTA A;  3G6O A;  1GSV A;  4GHI B;  4EW7 A;  4HP9 A;  5A8B A;  1P97 A;  3H82 A;  5IU1 A;  2VV7 A;  3HJI A;  4HH3 A;  5KIZ A;  4R70 A;  5HZH A;  2V0U A;  2CMN A;  1T18 A;  4YWZ A;  1ODV A;  2A24 B;  2VV8 A;  4JGQ A;  4GCZ A;  3VOL A;  3C8C A;  1LSW A;  1N9O A;  5DKL A;  2JHE A;  1MZU A;  3CLO A;  1OT9 A;  1S4R A;  2J80 A;  2BAS A;  1D7E A;  2L1M A;  3LI9 A;  1WA9 A;  2V1A A;  5HWW A;  2KDK A;  3LI8 A;  1T1A A;  5I5L A;  5DJU A;  4EEU A;  3F1N B;  1N9N A;  1XJ4 A;  4WUJ A;  5HSQ A;  3BWL A;  2GJ3 A;  2PDR A;  2QKP A;  3H7W A;  4HP4 A;  4PKY A;  3NJA A;  5HDD A;  3FC7 A;  5DJT A;  5F6A A;  4DJ3 A;  1XJ3 A;  2D01 A;  4PKY G;  5AVF A;  3ZQ5 A;  4GHI A;  1TS7 A;  3MQO A;  2K7S A;  4HIA A;  3LIA A;  3IS2 B;  3D72 A;  4LLO B;  4NXE A;  1DRM A;  1UWP X;  4GS9 B;  3PYP A;  2OWH A;  2L4R A;  3BY8 A;  4MN5 A;  2A24 A;  2WKP A;  3NHQ A;  4KUO A;  2Z6C A;  4NXF A;  1OJ5 A;  4F3L B;  5IS1 A;  1OTI A;  1F98 A;  1V9Z A;  2PR5 A;  3LYX A;  4EES A;  5EFW A;  1BYW A;  4EER A;  4LPZ A;  4WLA A;  4HOI A;  1TS8 A; 
#chains in the Genus database with same CATH topology
 1GHP A;  3UPO A;  1E4D A;  3HUO A;  3ZG9 B;  4WZ5 A;  4S2M A;  2J3T D;  1K6R A;  5L10 A;  2XGN A;  5HD5 A;  1GA9 A;  2A2L A;  3NY4 A;  2PHY A;  4RX3 A;  1QMF A;  1OME A;  5DFX A;  3MFD A;  1L0F A;  1DP8 A;  3B33 A;  4C3Q A;  2Y2Q A;  2PT7 A;  3Q7Z A;  3SW1 A;  4PM9 A;  5AQ9 A;  2W1R A;  5CHM A;  5AJG A;  3E4Q A;  5FQ9 A;  1NZO A;  5AQ7 A;  2Z2M B;  4MBF A;  3ULF A;  3ZG5 A;  1FR1 A;  1MWU A;  3FYZ A;  3MZD A;  4YFM A;  1XGI A;  3E0Y A;  3T4Q A;  1PFL A;  1DJC A;  4KG2 A;  3DTE A;  3VMA A;  1S6R A;  4OH0 A;  2PD8 A;  1Z6F A;  4O8G A;  4GS9 A;  4XT2 B;  3LIB A;  4DE2 A;  4Q0J A;  4G3W A;  5EOO A;  2ZBB A;  1FIL A;  1HVB A;  3Q7V A;  4I3I A;  3T50 A;  4F3L A;  3T4J A;  5F69 A;  2OV5 A;  5F82 A;  4BL2 A;  3C7U A;  4JGO A;  3UMD A;  4EV4 A;  2W0N A;  3ITA A;  4R4S A;  1BSG A;  1TS6 A;  4BL3 A;  3FKW A;  1LI0 A;  2HDR A;  1ONH A;  2XA7 M;  3T1R A;  3SH8 A;  3NI9 A;  1XFQ A;  5HWT A;  5GLA A;  4IUH A;  5FAO A;  3EEH A;  3SS4 A;  4DJ2 A;  1T1C A;  3EGD C;  3UDI A;  2O9B A;  4LV2 A;  4EQ1 A;  3ISG A;  5CEB A;  1K57 C;  3RTY A;  3S1Y A;  5CGX A;  4DF6 A;  5CGS A;  1BTL A;  1KE4 A;  5CXW A;  2V8F A;  3A0R A;  1XJ6 A;  2W3E A;  5LBR A;  2P7J A;  5HFO A;  1WYC A;  4CLC C;  4JF4 A;  3O5Y A;  5EVI C;  3EEA A;  5FQJ A;  3QNB A;  3GEC A;  2XRN A;  3RJU A;  2XFT A;  1A0K A;  3C5A A;  2V1Z A;  4OP5 A;  1ES3 A;  5CGW A;  1RP5 A;  4EBP A;  1F5M A;  3AGD A;  1LSX A;  1ZC2 A;  4E3K A;  4D60 A;  3U4L P;  2EA9 A;  3N7W A;  4MDZ A;  1L3L A;  4FH4 A;  1NRJ A;  2XF3 A;  3P09 A;  3PBO A;  4N9K A;  4JF6 A;  4XUZ A;  1XPB A;  3HCY A;  3F1P A;  4K91 A;  5L09 A;  5TBM B;  1YMX A;  3IF6 B;  5HD3 A;  5EEC A;  4UQI M;  1P0Z A;  4UHU A;  4GJ4 A;  2ZC5 B;  4M4X A;  4IBR A;  4ARZ A;  4CQH A;  2R9W A;  1L0E A;  2XH9 A;  3MSH A;  4PM7 A;  1ESI A;  3KYZ A;  4X25 A;  3HJK A;  3WS2 A;  2ZC6 B;  2Z6D A;  2Y2M A;  1MPL A;  3IT9 A;  5M19 A;  2CC1 A;  1T1B A;  3BJN A;  5CRF A;  1AXB A;  3LR5 A;  2BTF P;  2XK1 A;  4JLF A;  3L7H A;  2LB9 A;  3R4K A;  1L0G A;  3VSK A;  5HL6 A;  2Y2N A;  2OOL A;  5A92 A;  2EX8 A;  3HVF A;  4P87 A;  2VZW A;  2P9V A;  2H28 A;  4BJP A;  3S22 A;  4EUZ A;  4NG2 A;  1SZV A;  4R23 A;  5FAS A;  4Y5F A;  1NRF A;  4HBU A;  4WEK A;  4DXC A;  3MJQ A;  4C75 A;  1OT6 A;  1YM1 A;  4JGP A;  1VET A;  3P7N A;  1OTB A;  4DDS A;  2Y2K A;  4HQA A;  1XX2 A;  4E04 A;  1IEL A;  2WGW B;  3FPW A;  3LR4 A;  3OCN A;  1CQA A;  2Y91 A;  1Y4O A;  1PWG A;  5HAI A;  1KDS A;  2NUT C;  2XA7 S;  5A91 A;  4JPM A;  3ZCZ A;  4E3I A;  3H7W B;  2V9A A;  3FG8 A;  3CWF A;  4BD1 A;  3MR0 A;  3E4P A;  4FOF A;  1PI5 A;  2H0Y A;  3WRT A;  3NOP C;  3A3F A;  3LR0 A;  4P6B A;  4HES A;  1MBL A;  3OZH A;  4CLC D;  1O7E A;  5EVI D;  2GX5 A;  2VGJ A;  4GHI B;  1CEF A;  3T12 B;  2WGI A;  3W4Q A;  3NEC A;  1MWR A;  3O87 A;  5IU1 A;  3EQU A;  3M6B A;  4R70 A;  3OCL A;  4WYY A;  2IWC A;  2DMW A;  1GHI A;  2WKH A;  4CLC E;  2UV0 E;  4FCF A;  3JVU A;  2JE5 A;  1ODV A;  5F1G A;  4EQI A;  3BFC A;  4E3M A;  3TJZ C;  5DKL A;  3KSH A;  4FUW A;  1XGJ A;  1FOF A;  4KG6 A;  2IA2 A;  1IYO A;  1H5X A;  1D7E A;  4Q0H A;  3MKF A;  1IOU A;  3G30 A;  3LCE A;  4Y15 A;  3IXD A;  3QP1 A;  4S2I A;  3LI8 A;  1N9N A;  1XJ4 A;  1HLU P;  3C38 A;  1DY6 A;  1K57 A;  1K54 C;  4QB8 A;  3QNC A;  5IHV A;  1ES2 A;  3CG5 A;  3FC7 A;  4UQI S;  3QP2 A;  3HLG A;  4OVD A;  1IKI A;  4OP8 A;  2WAE A;  2ACG A;  3KSI A;  1MXO A;  3ZQ5 A;  1K4E A;  1YMS A;  2K7S A;  3UE0 A;  3UPP A;  3LIA A;  1G6A A;  2J3T C;  2XD1 A;  4LLO B;  4PAU A;  1MC0 A;  1BLC A;  1DRM A;  1UWP X;  5FAQ A;  4GS9 B;  1FSY A;  2RL3 A;  2P08 A;  3BEB A;  5MC7 A;  2Z6C A;  1AWI A;  3O3V A;  4KZ3 A;  3Q7V B;  3HLE A;  4ETZ A;  4F3L B;  4X53 A;  4NEE D;  4OPQ A;  1V9Z A;  2PR5 A;  3LYX A;  4EES A;  4OQ0 A;  3LY3 A;  4U0X A;  2ZL1 B;  4HOI A;  1TS8 A;  3T4O A;  3EWK A;  3NUL A;  1I2W A;  3EGX C;  1G6O A;  4O0P A;  5HPI A;  4Z9Q A;  4MMN A;  3LIC A;  3G32 A;  2W3F A;  2OAP 1;  2M7U A;  4EU0 A;  3V50 A;  2Y2I A;  1YSQ A;  4OPY A;  1ERM A;  1F9I A;  1UWN X;  5G18 A;  1ESU A;  3JVV A;  2YKF A;  1LSV A;  1VEU A;  4D2O A;  1GCE A;  3ZVW A;  4RVA A;  1VQQ A;  1K25 A;  3IS2 A;  3GDI A;  2PBY A;  5F83 A;  4YIN A;  3UE6 A;  4LRZ E;  5GHZ A;  2AVX A;  5GLD A;  3CPT A;  1ZKJ A;  4HEF A;  5CER A;  5F1F A;  3T4T A;  2XR0 A;  4NXB A;  1H8M A;  3A0S A;  3BFD A;  4U3T A;  3MKE A;  1TD5 A;  1ZG6 A;  4OLD A;  5K5B A;  1YPR A;  3M6H A;  1XJ2 A;  4ESP A;  4I3J A;  4ZJ2 A;  3UB5 P;  4IHQ A;  4OQH A;  2ZMA A;  1W8Q A;  4FD8 A;  1S66 L;  5CHJ A;  2ZC4 B;  1IYQ A;  5F68 A;  5GLC A;  1CF0 A;  4L9E A;  3F1P B;  5J8X A;  4L9G A;  3IHA A;  5FDH A;  4BD0 A;  2B02 A;  2R9X A;  4B93 A;  3N8L A;  2EX9 A;  1KGG A;  3C4P A;  2VKS A;  4ARZ B;  4NET A;  3SS3 A;  2OWJ A;  2XDM A;  3G35 A;  4Y7P A;  1ZTU A;  1H3Q A;  2J3W A;  1JVJ A;  4RX2 A;  4IED A;  4EXO A;  3R7W B;  2Q0O A;  3S7Q A;  3F1O A;  5E43 A;  1PZO A;  4HJ3 A;  4U0T A;  1BLH A;  3IH8 A;  5HDS A;  1YSP A;  3IBR A;  2W3G A;  3KSF A;  5KZH A;  2P9V B;  3TE8 A;  4QD4 A;  5EVE A;  3BLM A;  4LRX C;  1Q2Q A;  4JXG A;  5D3O A;  5E2G A;  2VA0 A;  1D1J A;  3E4O A;  1NWZ A;  4IVK A;  1MWS A;  3PBS A;  1HZO A;  3N8S A;  4LV0 A;  4Q0I A;  3JYI A;  4DN0 A;  2C5W B;  5TR7 A;  1W63 M;  5HL1 A;  3KX0 X;  1GSX A;  1BZA A;  4O01 A;  5EUA A;  1VET B;  4QWO A;  5FI6 A;  3NOT C;  4OOM A;  4JBF A;  1YT4 A;  4E3O A;  2W27 A;  1GHM A;  4E3N A;  1SDE A;  1OTE A;  4HNB A;  5EE8 A;  1PZP A;  4S2K A;  4IBX A;  1K54 A;  2VV6 A;  3AGF A;  3RH8 B;  5FQK A;  4N1X A;  3UB8 A;  2Y2O A;  1JWV A;  1TF1 A;  3N8R A;  3MQQ A;  3MXQ A;  3BQA A;  4LFU A;  3IBJ A;  4HY8 A;  5KSH A;  3T4K A;  3HL9 A;  4S2N C;  4CJN A;  1NZU A;  4K08 A;  1DJB A;  3RXW A;  2DNS A;  2W3D A;  4GNU A;  4O7D A;  1LL8 A;  1F2K A;  1CK3 A;  4E3L A;  4WMC D;  1CEG A;  3VSL A;  1MKI A;  4QJG A;  1DP9 A;  3UE3 A;  4OLG A;  5CTM A;  1LL5 A;  1LLB A;  4GDN A;  4MCW A;  3VFH A;  5CEC A;  3ZNY A;  1SKO A;  2ZC3 B;  1ES5 A;  1KOU A;  1JWZ A;  2WKR A;  4HJ4 A;  1S1Y A;  4KQD A;  2VK3 A;  1FCO A;  2JKG A;  4I38 A;  4WEJ A;  3ZG8 B;  5EM1 A;  1I5Q A;  2Y55 A;  2G2W A;  2Y2H A;  3UE1 A;  3AGE A;  3O86 A;  5HDC A;  5DTS A;  4GDB A;  4FH2 A;  2RCX A;  2X71 A;  3W8K A;  3HUM A;  4N1H A;  3K3D A;  4EBL A;  3HUN A;  2MJ6 A;  2YKH A;  3T1Q B;  5DF8 A;  4B4X A;  3OPR A;  2UWX A;  1EW0 A;  2KOI A;  3DBA A;  3N4I A;  3E2L A;  4Y0O A;  3OPH A;  2VX8 A;  3IF5 A;  2JKT I;  3IX8 A;  3UPN A;  4DKI A;  5CTN A;  3GMW A;  4NXG A;  5DTK A;  5HAQ A;  2WAF A;  1OTA A;  1PWD A;  3BFE A;  3G6O A;  1MKM A;  1GSV A;  1E3U D;  3D3O A;  2EWV A;  5A8B A;  3KYQ A;  3NDE A;  3H82 A;  1RCJ A;  4PHT A;  1YLY A;  2J8Y A;  3ITB A;  5HW3 A;  5HZH A;  4KZB A;  3T1X A;  4ZBE A;  1PRQ A;  4YWZ A;  5E2H A;  4OPZ A;  2XQZ A;  3B3X A;  3MS6 A;  3V3R A;  3M2K A;  4GCZ A;  1QME A;  3SZT A;  3EOI A;  3C8C A;  3NIA A;  1OPX A;  2JHE A;  1MZU A;  1MWT A;  3CUE A;  3QP5 A;  3ZYT A;  2QMI A;  1TDL A;  2L1M A;  2H5S A;  5HWW A;  1CI8 A;  2XRO A;  1FCN A;  3WS1 A;  5DJU A;  3ZG0 A;  1K38 A;  4WUJ A;  5TFQ A;  3WWX A;  2ZMF A;  3CIT A;  2PDR A;  1PW1 A;  2HDS A;  5HDD A;  3MQ0 A;  5FEG A;  1IYP A;  2K31 A;  4P0M A;  2J9P A;  3LR3 A;  5DJT A;  2EFU A;  3WS5 A;  1K55 C;  5F6A A;  1XJ3 A;  2D01 A;  2WZZ A;  3T4L A;  1VEU B;  1W7F A;  1KGE A;  3V3S A;  5HAR A;  4JXS A;  3MQO A;  2XD5 A;  5FQQ A;  2HGV A;  3IS2 B;  3SH7 A;  3D72 A;  2WK0 A;  3BM6 A;  1O07 A;  2ZQA A;  1FQG A;  4A5R A;  3CPT B;  1J3W A;  3LY4 A;  4MN5 A;  2DRW A;  3G4P A;  4PM5 A;  3NHQ A;  1H8Z A;  2WKI A;  3A3I A;  3PR6 A;  2A49 A;  1CJF A;  3BRM A;  3HLW A;  1K6S A;  2H10 A;  1F98 A;  2OLU A;  2HP9 A;  4OQI A;  1M6K A;  4YOF A;  4LPZ A;  3BFG A;  1BLS A;  3T4S A;  2QJ5 A;  4I5S A;  3OLO A;  1LI9 A;  1EI5 A;  2PYP A;  5DFY A;  3LUQ A;  2Q9N A;  2OAQ 1;  2XEP A;  2VEA A;  3HRE A;  2QWS A;  4MBK A;  4XUX A;  3UN7 A;  2ZQC A;  2VGL M;  3FPV A;  3VOY A;  1NJ4 A;  4R3J A;  1H0M A;  1J9M A;  4G3V A;  1XXM A;  3PAE A;  2O99 A;  4Y17 A;  4S2N A;  3W4P A;  3F1O B;  1L0D A;  3VP4 A;  1VHM A;  4KZ4 A;  4BBT A;  2OSU A;  3CJM A;  3TRC A;  5KSC A;  3CAX A;  3MXS A;  2JN7 A;  4EBN A;  3VE3 A;  1UGU A;  2PU4 A;  3HLC A;  2V1B A;  3RFB A;  4H8R A;  3BY9 A;  4DE1 A;  4UA7 A;  4IJG A;  4ZTK A;  3PTE A;  5HWV A;  1P9R A;  2LB5 A;  2D02 A;  4KUK A;  3LO7 A;  4MN7 A;  3OC2 A;  2PR6 A;  2IWB A;  1G28 A;  2O0Y A;  4CLC A;  2X02 A;  2FFY A;  5EVI A;  4QY5 A;  2EX2 A;  2WYX A;  4I3A A;  5FI7 A;  1N9B A;  4UA6 A;  3WS0 A;  4JKT A;  4RQ9 A;  1GSW A;  3VE4 A;  4OON A;  1YAX A;  4ETX A;  3NC8 A;  1ZHH B;  3IH9 A;  3WS4 A;  5E2E A;  2HJ9 C;  3T1S A;  1MY8 A;  2Y4A A;  1TEM A;  3G2Y A;  2P74 A;  1NXY A;  4P85 A;  3PHY A;  3UB7 A;  1S0W A;  3NBL A;  5FAT A;  4EEP A;  2G2U A;  3IWI A;  4R6L A;  5DKK A;  3FZC A;  4X68 A;  3RXX A;  1SCW A;  4GOG A;  2PBD P;  1SHV A;  5CHU A;  4GD6 A;  5CX7 A;  4GW9 A;  1LHY A;  3OBF A;  2ZQ9 A;  4WZ4 A;  3E2K A;  4MBH A;  1TS0 A;  5GLB A;  2FFF B;  1KVL A;  1HD8 A;  1SKF A;  4EET B;  1PW8 A;  5J7E A;  3KYE A;  3BW6 A;  3IWO A;  1FIK A;  2H0T A;  3UME A;  3D9Y A;  2BLS A;  1M40 A;  3HBR A;  3G34 A;  3P01 A;  4GN2 A;  2V2F F;  3OPP A;  1K56 D;  1W8Y A;  1XA7 A;  2HDQ A;  1WE4 A;  5DF9 A;  1YLW A;  1S67 L;  3OOV A;  4X56 A;  2Y59 A;  3SH9 A;  5U47 A;  1HTZ A;  1PYY A;  1Y54 A;  3LFV A;  3KSG A;  3DTI A;  3GV9 A;  4L0L A;  4KZ9 A;  3QP4 A;  1K55 A;  1W5D A;  5DTT A;  3MZE A;  3EQV A;  2PRF A;  3A3E A;  4UEY A;  2E8J A;  3V67 A;  4JGR A;  2M1C A;  2VGL S;  3MXR A;  3K3C A;  1FCM A;  3IX4 A;  3DAV A;  1EWZ A;  4ZAM A;  2JKT M;  3H82 B;  2B18 A;  5F5Y A;  1IFQ A;  2ZM0 A;  3TOI A;  2XLN A;  3TW8 A;  1K4F A;  4HI4 A;  3FV7 A;  4WN5 A;  1STZ A;  5GL9 A;  5EOE A;  1ERO A;  4LEN A;  1NYY A;  2QHK A;  1OJG A;  5FL3 A;  1BT5 A;  3LGO A;  5EPH A;  2ZD8 A;  4JXW A;  2QJ7 A;  1KE3 A;  3K2N A;  2VLG A;  2ZOH A;  4KG5 A;  2Z2L B;  1BUE A;  5BOH A;  1XFN A;  1ALQ A;  4WEL A;  2WUQ A;  2HF6 A;  2QPN A;  5L07 A;  3SOI A;  1KVM A;  1D06 A;  2ZQD A;  4G3K A;  4DDY A;  4B88 A;  3S7O A;  2J9O A;  2ZQ7 A;  2G7U A;  1LT0 A;  5HAP A;  2JKR I;  3C2W A;  3DWZ A;  4HHD A;  3ZNT A;  4HJ6 A;  4H6J A;  2WZX A;  4Y2F A;  1JNU A;  2R78 A;  1G68 A;  4P6Z M;  4DMZ A;  3LEZ A;  1I2S A;  3BFF A;  4GD8 A;  4E6X A;  1GA0 A;  2JC7 A;  2QYB A;  1XA1 A;  4EW7 A;  4HP9 A;  4YNR A;  4ZRR A;  2Y2L A;  1IEM A;  3QP6 A;  4ID4 A;  2HP6 A;  2Y2P A;  3HJI A;  2Q9M A;  4X6T A;  2V0U A;  5TGF A;  1T18 A;  3IXB A;  5C5K A;  5L8M A;  2OLV A;  5DVA A;  2W1T A;  4OOY A;  3TSG A;  4S2O A;  3VOL A;  1LSW A;  1N9O A;  3BLS A;  4HBT A;  2ZQ8 A;  1H8Y A;  1NYM A;  3CLO A;  1OT9 A;  3MZF A;  4XXR A;  4AFI A;  1XP4 A;  2J80 A;  2BAS A;  3VOZ A;  1WA9 A;  3PBQ A;  3CMZ A;  4FTX A;  1PWC A;  1PNE A;  1RGY A;  4KZ7 A;  4KEN B;  3BEC A;  1T1A A;  3GVB A;  2Y2J A;  4EEU A;  4QHC A;  2GJ3 A;  5CED A;  5AQB A;  2ZM2 A;  5A93 A;  3NJA A;  4KQO A;  2ZL1 A;  2P04 A;  3B42 A;  5E2F A;  3ZVT A;  3G2Z A;  3IX3 A;  4KZ6 A;  3IXG A;  4MLL A;  2ZLY A;  4DJ3 A;  4X55 A;  4PKY G;  5AVF A;  5AQA A;  1U60 A;  4GLQ A;  1SDN A;  1TS7 A;  4HIA A;  4X1M A;  5HPF A;  2XSS A;  1VM1 A;  4WM9 A;  4B4Z A;  2I72 A;  1YLP A;  3BQ8 A;  3ZFZ A;  4PPR A;  1ERQ A;  2L4R A;  3CZD A;  2HDU A;  2V20 A;  3IHB A;  2A24 A;  3IXH A;  2WKP A;  4KUO A;  4KZA A;  4ME4 A;  1JTG A;  3GR2 A;  4NXF A;  1OJ5 A;  1YLJ A;  5EVL A;  1OTI A;  5IS1 A;  3MBZ A;  3TG9 A;  3IF6 C;  1IYS A;  2V8C A;  2GDN A;  3MFX A;  4UA9 A;  3V39 A;  2ZJ9 A;  4EUV A;  3F1N A;  2GNX A;  3U2A A;  1YLT A;  3HLD A;  4CLC B;  3LIE A;  5EVI B;  1VB6 A;  4ZJ3 A;  3VFF A;  1Q2P A;  5FQI A;  5M18 A;  2EWW A;  2PD7 A;  4WMC A;  2B95 A;  4S2J A;  4JF5 A;  2ZMV A;  1K0K A;  4LV1 A;  1LL9 A;  2NUP C;  4L9F A;  3DW0 A;  3ZDJ A;  2V0W A;  5GHX A;  3N6I A;  3LIF A;  3SS5 A;  3C4O A;  2ZOI A;  3MF0 A;  3FWL A;  3W4O A;  4PMA A;  4BBU A;  2WKQ A;  4Z1W A;  3HLF A;  1RGZ A;  4DXB A;  4R3B A;  5EM0 A;  4R38 A;  4WF0 A;  4P6Z S;  4QY6 A;  4R3A A;  3QP8 A;  4X69 A;  4II7 A;  3R7W A;  2B5R A;  4FSF A;  3CI6 A;  3VV4 A;  4IUK A;  1ONG A;  4BEN A;  2DCF A;  2EX6 A;  3VP1 A;  2WGV A;  3GSG A;  4KQR A;  1YQS A;  4CPK A;  1L2S A;  3NDG A;  4EWF A;  1ZG4 A;  3D4F A;  3I7J A;  1E3U A;  4Y0T A;  1YKD A;  2HV1 A;  1PIO A;  2HPB A;  3UDX A;  4WL9 A;  4BMW A;  3QHY A;  4QU3 A;  4OKP A;  5FQM A;  3UDF A;  3GQZ A;  2M7V A;  3DWK A;  2EXA A;  3M2J A;  4MN6 A;  4Q8I A;  4R4R A;  5FA7 A;  5FSR A;  1WYB A;  3MMH A;  4OPR A;  2X01 A;  4XT2 A;  1TVF A;  1BLP A;  3ZGA B;  2INW A;  4Y3I A;  5J3W A;  2C6W B;  1CI9 A;  1KDW A;  4DE0 A;  2HZ5 A;  3JPU A;  3VP2 A;  5HX9 A;  3C30 A;  4BQM A;  1S4S A;  5FEF A;  1T19 A;  2HP5 A;  5FI2 A;  2A3U A;  3C7V A;  3S7P A;  5JYO A;  4DE3 A;  1Z09 A;  4WZ5 C;  1JTD A;  5JYP A;  4BLM A;  5AVE A;  2KX6 A;  2L0W A;  1FSW A;  4N9L A;  1X0O A;  4QPR A;  1Y28 A;  1KGF A;  3UY6 A;  1V9Y A;  4ZDX A;  2I9V A;  1N9L A;  4BBV A;  4LV3 A;  3Q82 A;  4MNR A;  1JWP A;  3PBT A;  1G5U A;  2JBF A;  3E98 A;  4LCM A;  4OOL A;  3A3D A;  2IWD A;  3DTK A;  3DTM A;  2ZM8 A;  3G31 A;  3UNW A;  5IT5 A;  4H6J B;  4OQG A;  5J4E A;  4Y13 A;  2JKR M;  4PM6 A;  1S1Z A;  4RA7 A;  3Q07 A;  3Q1F A;  5TJJ A;  1DP6 A;  4LRY C;  5GHY A;  1OTD A;  3L9K A;  3ICY A;  3GTC A;  4B9O A;  1N4O A;  3LEQ A;  4IVI A;  3V5M A;  2JKF A;  2ZC7 A;  2JCH A;  3PBN A;  1ACF A;  2EFX A;  4KZ8 A;  5G4Y A;  3UB9 A;  4GZB A;  1PI4 A;  3A0V A;  2W1T B;  5FDS A;  5G4Z A;  5TBM A;  2Y79 A;  3IF6 A;  2XFS A;  2PU2 A;  1P9W A;  3PBR A;  2VGK A;  4JXV A;  3S7N A;  4RYE A;  4HH2 A;  4GB7 A;  2K2N A;  1BUL A;  3IWQ A;  4I39 A;  4E3J A;  3H9W A;  4UAA A;  3UO9 A;  3GRJ A;  2BG1 A;  2PYR A;  3A3J A;  2KLI A;  3KO6 A;  2Y2G A;  3OPL A;  3UB6 A;  4R0Q A;  5FAP A;  3LID A;  1YLZ A;  5A90 A;  1W63 Q;  4KZ5 A;  3S4X A;  1SKO B;  2WKE A;  3NOU C;  2QZ6 A;  1ES4 A;  5M1A A;  3VP0 A;  2W3H A;  4E6W A;  1P97 A;  3CHW P;  4WBG A;  3FKV A;  2VV7 A;  3PXP A;  4C6Y A;  4HH3 A;  5L2F A;  5KIZ A;  4Y0U A;  2CMN A;  3B47 A;  2A24 B;  2VV8 A;  1W79 A;  4JGQ A;  2E8I A;  5EV0 A;  4BWI A;  4R1G A;  1DJA A;  1S4R A;  2O9A A;  3P98 A;  3ZG7 B;  2WGW A;  3LI9 A;  2V1A A;  2VJW A;  4KQQ A;  1FR6 A;  4K0X A;  2KDK A;  1KE0 A;  1E25 A;  5I5L A;  3F1N B;  3Q81 A;  4M3K A;  3NCK A;  5HSQ A;  3BWL A;  2WAD A;  3O88 A;  4S2P A;  2QKP A;  3H7W A;  4HP4 A;  4PKY A;  4ZJ1 A;  2J7V A;  4GKU A;  4LGW A;  3CUE C;  3WRZ A;  4K0W A;  2FZ0 A;  5I94 A;  3HLB A;  3BYD A;  4DRT A;  4LCL A;  1XKZ A;  2PAV P;  2Y8H A;  1NLY A;  3PAG A;  4GHI A;  4PM8 A;  4NK3 A;  3VP3 A;  1C3B A;  4S2L A;  4NXE A;  1K56 A;  3W2Z A;  4NKP A;  3PYP A;  2OWH A;  3BY8 A;  2O9C A;  1NY0 A;  4X1L A;  2GZA A;  3ZHH A;  4MEZ A;  1IKG A;  2FH5 A;  2HJE A;  4N92 A;  5DF7 A;  1NLZ A;  1TDG A;  4F94 A;  5EFW A;  1BYW A;  4EER A;  2EXB A;  4WLA A;  5KMW A;  3IQA A; 
#chains in the Genus database with same CATH homology
 3EWK A;  3MFX A;  3EGX C;  1G6O A;  3T4S A;  2QJ5 A;  4EUV A;  2J3T D;  4I5S A;  4O0P A;  3OLO A;  3F1N A;  5HD5 A;  2GNX A;  3U2A A;  2A2L A;  5HPI A;  2PHY A;  4CLC B;  2PYP A;  5DFY A;  3LIE A;  4MMN A;  3LIC A;  3LUQ A;  2OAQ 1;  1VB6 A;  5DFX A;  1DP8 A;  3B33 A;  2W3F A;  2VEA A;  2QWS A;  2PT7 A;  2EWW A;  2PD7 A;  3SW1 A;  2VGL M;  3FPV A;  2OAP 1;  2W1R A;  2M7U A;  4EU0 A;  5AJG A;  3E4Q A;  2ZMV A;  1YSQ A;  1F9I A;  1UWN X;  2NUP C;  4L9F A;  3JVV A;  3ULF A;  2YKF A;  1LSV A;  2V0W A;  4G3V A;  3LIF A;  3IS2 A;  3GDI A;  2O99 A;  3E0Y A;  3T4Q A;  3UE6 A;  4LRZ E;  2PD8 A;  3F1O B;  1VHM A;  4BBT A;  2ZOI A;  3MF0 A;  4BBU A;  4O8G A;  3T4T A;  4GS9 A;  4NXB A;  1H8M A;  2WKQ A;  3LIB A;  4XT2 B;  3TRC A;  3A0S A;  4Z1W A;  4Q0J A;  1TD5 A;  4G3W A;  2ZBB A;  3CAX A;  4R38 A;  2JN7 A;  4WF0 A;  4P6Z S;  4I3I A;  4R3A A;  3T50 A;  3VE3 A;  4F3L A;  3T4J A;  4II7 A;  1UGU A;  5F69 A;  5K5B A;  2V1B A;  3R7W A;  3RFB A;  3BY9 A;  1XJ2 A;  4FSF A;  3CI6 A;  3VV4 A;  4IJG A;  4IUK A;  4JGO A;  3UMD A;  4I3J A;  5HWV A;  2W0N A;  1P9R A;  1TS6 A;  2LB5 A;  4IHQ A;  2D02 A;  4KUK A;  4MN7 A;  2XA7 M;  3OC2 A;  1S66 L;  2PR6 A;  5F68 A;  1XFQ A;  4L9E A;  1G28 A;  5HWT A;  3F1P B;  2O0Y A;  4CLC A;  4IUH A;  3EEH A;  4L9G A;  4DJ2 A;  1T1C A;  2B02 A;  3EGD C;  4B93 A;  2O9B A;  4I3A A;  1YKD A;  4EQ1 A;  2HV1 A;  2VKS A;  4ARZ B;  4RQ9 A;  1GSW A;  3VE4 A;  1YAX A;  4ETX A;  3RTY A;  4WL9 A;  4BMW A;  2OWJ A;  1ZHH B;  1ZTU A;  1H3Q A;  2HJ9 C;  2J3W A;  3A0R A;  1XJ6 A;  2M7V A;  3PHY A;  2W3E A;  5LBR A;  2P7J A;  3UB7 A;  4CLC C;  4EXO A;  3R7W B;  4MN6 A;  3O5Y A;  3EEA A;  3GEC A;  2XRN A;  3S7Q A;  4EEP A;  3F1O A;  3MMH A;  4R6L A;  4HJ3 A;  5DKK A;  4XT2 A;  5HDS A;  1YSP A;  3IBR A;  2W3G A;  3KSF A;  2INW A;  3TE8 A;  1F5M A;  4Y3I A;  4LRX C;  5J3W A;  5CX7 A;  4GW9 A;  1LSX A;  3OBF A;  2VA0 A;  3E4O A;  1NWZ A;  1TS0 A;  3C30 A;  3PBS A;  2EA9 A;  4MDZ A;  1S4S A;  1NRJ A;  4Q0I A;  1T19 A;  4DN0 A;  4EET B;  5J7E A;  3PBO A;  3BW6 A;  1W63 M;  3HCY A;  3S7P A;  3KX0 X;  3F1P A;  1GSX A;  5TBM B;  3UME A;  4O01 A;  5HD3 A;  3P01 A;  4UQI M;  1P0Z A;  4GJ4 A;  3NOT C;  5AVE A;  4M4X A;  4OOM A;  2W27 A;  2KX6 A;  4ARZ A;  2L0W A;  4CQH A;  1X0O A;  4QPR A;  1Y28 A;  1V9Y A;  2I9V A;  1N9L A;  1OTE A;  5DF9 A;  4HNB A;  4BBV A;  3KYZ A;  3HJK A;  1S67 L;  3OOV A;  2Z6D A;  3PBT A;  1T1B A;  3BJN A;  2VV6 A;  3E98 A;  3LFV A;  3LR5 A;  3KSG A;  4OOL A;  3RH8 B;  3UB8 A;  2LB9 A;  1TF1 A;  3R4K A;  5HL6 A;  4L0L A;  5IT5 A;  3MQQ A;  4H6J B;  3EQV A;  3MXQ A;  2OOL A;  3BQA A;  4UEY A;  3IBJ A;  4HY8 A;  3V67 A;  5J4E A;  2JKR M;  3T4K A;  5KSH A;  4JGR A;  2M1C A;  1S1Z A;  2VGL S;  2VZW A;  3K3C A;  4K08 A;  2H28 A;  4BJP A;  5TJJ A;  1DP6 A;  2W3D A;  4LRY C;  1LL8 A;  2JKT M;  1OTD A;  3ICY A;  3H82 B;  4B9O A;  2B18 A;  5F5Y A;  4Y5F A;  1IFQ A;  1DP9 A;  3UE3 A;  3TW8 A;  4MCW A;  4HI4 A;  4WN5 A;  1STZ A;  3PBN A;  5G4Y A;  3UB9 A;  4WEK A;  1KOU A;  5FL3 A;  2QHK A;  1OJG A;  3A0V A;  3MJQ A;  1OT6 A;  2WKR A;  2W1T B;  5G4Z A;  5TBM A;  2Y79 A;  2QJ7 A;  4HJ4 A;  3K2N A;  4JGP A;  1S1Y A;  2VLG A;  4KQD A;  2ZOH A;  3P7N A;  4I38 A;  1P9W A;  3PBR A;  4WEJ A;  1OTB A;  1XFN A;  4HQA A;  4WEL A;  4E04 A;  2HF6 A;  3S7N A;  4HH2 A;  3FPW A;  3LR4 A;  3OCN A;  2K2N A;  5HDC A;  1D06 A;  4I39 A;  4G3K A;  3H9W A;  3K3D A;  3S7O A;  2MJ6 A;  2G7U A;  1LT0 A;  2NUT C;  2YKH A;  2JKR I;  2XA7 S;  3C2W A;  3H7W B;  4HHD A;  2V9A A;  1EW0 A;  2KOI A;  2PYR A;  3DBA A;  2KLI A;  3KO6 A;  3FG8 A;  3CWF A;  4HJ6 A;  3MR0 A;  3UB6 A;  3E4P A;  4H6J A;  4FOF A;  4Y2F A;  1JNU A;  2VX8 A;  3LID A;  2JKT I;  2R78 A;  1W63 Q;  4P6Z M;  3NOP C;  4DMZ A;  3LR0 A;  4NXG A;  3NOU C;  4CLC D;  1OTA A;  3G6O A;  2GX5 A;  1MKM A;  2W3H A;  1GSV A;  4GHI B;  2QYB A;  3D3O A;  4EW7 A;  2EWV A;  4HP9 A;  4YNR A;  5A8B A;  1P97 A;  3KYQ A;  4ZRR A;  3H82 A;  4PHT A;  5IU1 A;  2VV7 A;  3EQU A;  3PXP A;  3HJI A;  4HH3 A;  5KIZ A;  4R70 A;  3OCL A;  5HZH A;  2V0U A;  2DMW A;  2CMN A;  3B47 A;  1T18 A;  4CLC E;  4YWZ A;  5C5K A;  3JVU A;  1ODV A;  5L8M A;  2A24 B;  2VV8 A;  4JGQ A;  2W1T A;  4GCZ A;  3EOI A;  3VOL A;  3C8C A;  3TJZ C;  1LSW A;  4BWI A;  1N9O A;  5DKL A;  1OPX A;  3KSH A;  2JHE A;  1MZU A;  3CUE A;  3ZYT A;  3CLO A;  1OT9 A;  1S4R A;  4AFI A;  2O9A A;  2IA2 A;  2J80 A;  2BAS A;  1D7E A;  2L1M A;  4Q0H A;  3LI9 A;  1WA9 A;  2V1A A;  5HWW A;  2VJW A;  3PBQ A;  1IOU A;  2XRO A;  2KDK A;  3LI8 A;  1T1A A;  5DJU A;  5I5L A;  4EEU A;  3F1N B;  1N9N A;  1XJ4 A;  3C38 A;  4WUJ A;  5HSQ A;  3BWL A;  2ZMF A;  3CIT A;  2GJ3 A;  2PDR A;  2QKP A;  3H7W A;  4HP4 A;  4PKY A;  3NJA A;  5HDD A;  3MQ0 A;  4KQO A;  2P04 A;  3B42 A;  3FC7 A;  2K31 A;  3CUE C;  4UQI S;  3LR3 A;  2FZ0 A;  5DJT A;  5F6A A;  4DJ3 A;  3KSI A;  1XJ3 A;  2D01 A;  4PKY G;  3T4L A;  5AVF A;  2Y8H A;  3ZQ5 A;  1NLY A;  4GHI A;  4GLQ A;  1TS7 A;  3MQO A;  2K7S A;  4HIA A;  5HPF A;  2HGV A;  3IS2 B;  3LIA A;  2XSS A;  3D72 A;  2J3T C;  4LLO B;  3BQ8 A;  4NXE A;  4PAU A;  1MC0 A;  1DRM A;  1UWP X;  3W2Z A;  4NKP A;  4GS9 B;  3PYP A;  2OWH A;  2L4R A;  3BY8 A;  4MN5 A;  2O9C A;  2A24 A;  2P08 A;  2WKP A;  3NHQ A;  2GZA A;  5MC7 A;  4KUO A;  2Z6C A;  4ME4 A;  3PR6 A;  4NXF A;  1OJ5 A;  4ETZ A;  4F3L B;  1OTI A;  5IS1 A;  4NEE D;  1F98 A;  1V9Z A;  2FH5 A;  2HJE A;  2PR5 A;  3LYX A;  4EES A;  1NLZ A;  5EFW A;  1BYW A;  4EER A;  4YOF A;  4LPZ A;  4WLA A;  4HOI A;  1TS8 A;  3T4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...