3MQOA

The crystal structure of the pas domain in complex with isopropanol of a transcriptional regulator in the luxr family from burkholderia thailandensis to 1.7a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
113
structure length
113
Chain Sequence
IDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the PAS domain in complex with isopropanol of a Transcriptional Regulator in the LuxR family from Burkholderia thailandensis to 1.7A
rcsb
source organism Burkholderia thailandensis
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, LuxR family
total genus 28
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3mqoA00
2I9VA 3F1PB 3MJQA 5J7EA 3PHYA 3UMDA 1D7EA 2BASA 2VV7A 2ZBBA 5G4YA 2L1MA 1GSXA 2VV6A 3GDIA 3HJKA 4WLAA 5TBMB 5HWTA 1GSVA 5TBMA 4F3LB 3FG8A 2Z6CA 2OOLA 1TS7A 1N9LA 4WUJA 1P0ZA 4I3IA 2Z6DA 4KUOA 5F69A 1TS6A 3H82A 1XJ3A 5HWWA 4H6JA 4WN5A 1N9NA 2HV1A 2WKPA 4HP4A 3LI8A 3C8CA 2D01A 1BYWA 4WL9A 4DJ2A 5HDCA 3LIAA 5KIZA 3LIDA 1LSXA 2PHYA 4HIAA 1D06A 1DP9A 5J3WA 1T1BA 4L9GA 3LYXA 4HH3A 4BBTA 4L9FA 3MFXA 4LLOB 4KUKA 3OLOA 4H6JB 3A0VA 1NWZA 2QJ7A 2PYPA 3VE3A 1MZUA 1ODVA 1S67L 4NXGA 4BBUA 4XT2B 2H28A 3F1OA 3F1OB 2ZOHA 4EQ1A 2D02A 1UWPX 3IS2A 2KX6A 4GCZA 3RH8B 2L4RA 2QKPA 4I3JA 5HWVA 1KOUA 2QWSA 3B33A 3K3DA 3PYPA 1OJ5A 2YKFA 3UB7A 2ZOIA 1T1CA 4PKYA 5HD5A 1LSWA 4HH2A 1N9OA 5A8BA 4LRXC 1Y28A 2V0UA 3MR0A 2V9AA 1OTBA 1OTIA 4HJ4A 5F68A 2M1CA 4GHIA 2B02A 3LICA 4HJ3A 1OT6A 4GS9A 3CAXA 1OT9A 4PKYG 2JN7A 1LSVA 2W0NA 3H7WB 3BWLA 5F5YA 3SW1A 4JGRA 2VV8A 3E4QA 3MQOA 3UB8A 3IBRA 3BY9A 4BBVA 1GSWA 4XT2A 2CMNA 5EFWA 4L9EA 4YWZA 3D72A 4EW7A 3E4OA 5F6AA 2V0WA 1S4RA 2A24A 5J4EA 4MN5A 1VB6A 1XJ4A 4HI4A 1V9ZA 3H7WA 1DRMA 1OTDA 1T19A 1T18A 1EW0A 3VE4A 4R70A 2WKRA 2EA9A 1S1YA 3ULFA 1WA9A 2PR5A 3K3CA 4GHIB 4NXBA 2VLGA 5G4ZA 4NXFA 4LRZE 3CLOA 1DP6A 3NOTC 2OWHA 5DJUA 5DKKA 3UB6A 3ZQ5A 1S1ZA 1XJ2A 4RQ9A 2KDKA 4LPZA 2PYRA 1S66L 4R38A 1F9IA 5AVEA 4EEUA 1OJGA 4EESA 3E4PA 4JGOA 1JNUA 2W27A 1DP8A 5HD3A 4GW9A 3KX0X 4MN6A 3T50A 1T1AA 3IS2B 4M4XA 1OTEA 2L0WA 4K08A 4LRYC 4E04A 3C2WA 3A0SA 3EEHA 2J80A 3EWKA 3F1NA 2V1BA 3BY8A 2JHEA 3FC7A 4GS9B 4HHDA 3NOPC 4JGQA 2R78A 5DKLA 4R3AA 1S4SA 4I38A 4EXOA 5IU1A 3CWFA 3A0RA 4I39A 2VEAA 3P7NA 4B9OA 4HQAA 1P97A 3GECA 3LI9A 3MQQA 4KQDA 4WF0A 3HJIA 2K7SA 3F1NB 1LL8A 4F3LA 2PR6A 3VOLA 4EEPA 1TS0A 5IS1A 4EERA 2QJ5A 3UMEA 3H82B 4R6LA 2YKHA 2PD7A 3F1PA 3LIBA 5DJTA 2GJ3A 5I5LA 1XFQA 3LIFA 4EETB 3G6OA 4HP9A 2INWA 5HDSA 2PDRA 3NHQA 2WKQA 3RTYA 1V9YA 2V1AA 5HDDA 3UB9A 2P7JA 3ICYA 1OTAA 1UGUA 2PD8A 3H9WA 4HNBA 1UWNX 3UE6A 3MXQA 3NJAA 4JGPA 5AVFA 2QHKA 3LIEA 1XJ6A 4I5SA 3NOUC 4I3AA 5HZHA 2OWJA 3LUQA 1LT0A 4NXEA 1XFNA 1X0OA 1G28A 2A24B 1TS8A 4HJ6A 4HOIA 4HY8A 4DJ3A 5HSQA 1F98A
chains in the Genus database with same CATH superfamily
1SDEA 4D2OA 5FI7A 3PBOA 4N1HA 3DTIA 2PU2A 4Y2FA 5KSHA 1LL5A 3AGDA 1W63M 5HWWA 4B93A 4O7DA 5A90A 1D06A 5KMWA 1BULA 3MFXA 4OVDA 1IKIA 3D9YA 4FTXA 4EQ1A 1O07A 3QP1A 3T1SA 2BTFP 4UEYA 2PBDP 1G5UA 1S0WA 2B18A 1OTBA 3G30A 2IWBA 4UQIS 2QMIA 4GS9A 3WS4A 4PPRA 2RL3A 2JKTI 1F2KA 3MF0A 1LL9A 1WYCA 2ZD8A 1VB6A 3OPRA 4R70A 3T4SA 4UA6A 5CHMA 4ZBEA 4C75A 5G4ZA 3OPLA 3MZFA 2JKRM 1VHMA 1IYPA 1ZTUA 3P01A 3A3JA 2P9VA 2ZQ8A 3BLMA 4OP5A 5HAPA 2L0WA 1YSQA 4Q8IA 2H0YA 1ZKJA 3EEHA 3CJMA 3NOPC 4EXOA 3UNWA 5IU1A 1XGIA 3G2ZA 2LB9A 2ZC7A 2PR6A 5DJTA 4S2JA 2M7UA 4OOYA 3SH8A 5M1AA 2WK0A 4BD0A 3LIEA 4YNRA 1NXYA 5HZHA 3GV9A 2I9VA 1JWZA 1K4EA 1LI9A 4BBTA 1GSXA 3HJKA 2VGJA 3BLSA 3HUOA 4E3NA 2XEPA 4X1LA 3MZEA 4E3KA 1NY0A 3BFFA 1MKMA 3BJNA 3AGEA 4RX2A 3OLOA 4EUZA 5L2FA 3WRTA 5FQJA 4OPQA 1ZC2A 4R3JA 3PAEA 4ZDXA 1FSYA 3HLGA 2PAVP 2UWXA 2HDSA 3E4QA 3BRMA 3ZFZA 4R3BA 3IXBA 4QWOA 1VETA 3QNBA 3GRJA 1WA9A 4PM7A 5L10A 4GD6A 2DNSA 1NZOA 3W4QA 2XRNA 3GSGA 5AVEA 3E4PA 3E0YA 3WRZA 1YLJA 2Z2MB 5F1FA 1W79A 3BW6A 4IBRA 1P97A 3V39A 1K25A 4II7A 2O0YA 1OMEA 3PBTA 1RCJA 3VP0A 3LY3A 4NEED 1DY6A 2WAFA 3VP4A 2OLVA 4P6ZS 3IWIA 2XDMA 4RYEA 5EOOA 4AFIA 2PD8A 3W2ZA 3EQUA 1HVBA 1MC0A 3L7HA 4JPMA 4HOIA 3PAGA 3SS4A 3F1PB 4CLCA 3OCLA 3GDIA 4WEJA 2HP6A 4WUJA 4Y0OA 3RFBA 3UDFA 2HGVA 1NWZA 3VE3A 2E8IA 1ODVA 1S67L 1IFQA 3M6BA 1PW1A 2H28A 5GL9A 4EUVA 1UWPX 5HWVA 1Q2QA 2QKPA 3WS2A 3OZHA 3D4FA 2PRFA 3C7VA 2VK3A 2V0UA 1STZA 2B02A 1LSVA 3BQAA 3BWLA 3MQOA 3UB8A 1YQSA 1WYBA 4NETA 1K57A 2V0WA 2HDRA 3QP6A 1XJ2A 1I2SA 2DMWA 5FATA 2HZ5A 2J3TC 1GA9A 1MWUA 3L9KA 1G68A 3A0SA 2J80A 5DKLA 4Q0JA 1QMEA 1CJFA 3VSLA 4OLGA 4RVAA 1XXMA 4B9OA 1PZPA 3MKFA 3BFCA 4QPRA 1ACFA 3IF5A 1XKZA 4EERA 2ZLYA 1PNEA 3LIBA 5G18A 3RTYA 1V9YA 2IA2A 2JCHA 1PI5A 2J3WA 3IXHA 3C38A 2K31A 2HP5A 4KZBA 4DJ3A 4P6BA 4QB8A 5G4YA 3ZCZA 3MXSA 4ID4A 1L0GA 2OOLA 1FIKA 3G32A 3UPPA 3W4OA 4EBNA 2X02A 4G3WA 4KQOA 2V20A 4K0WA 3QP5A 4XT2B 3OC2A 1YM1A 1BTLA 3RH8B 2JBFA 5TR7A 3HLWA 1VM1A 2P9VB 2ZMAA 5EVLA 4IHQA 4LV0A 4X6TA 4B88A 4HBUA 4HJ3A 3SZTA 3NULA 3LO7A 3UO9A 2JC7A 4L9EA 4NK3A 4PHTA 1N4OA 3FPWA 4R4SA 4Q0HA 2OWHA 1YLTA 1OJGA 5FASA 4GW9A 4BQMA 3T4OA 1OTEA 4LRYC 4GJ4A 2HDUA 1PWCA 2A2LA 2ZJ9A 1L0EA 4QD4A 1K6SA 1I2WA 5FQKA 4F3LA 4DDYA 4DF6A 3D3OA 5IS1A 3LR5A 2EXBA 4K0XA 3PBRA 4S2OA 2B95A 1EROA 4JGPA 5GHXA 1SKOB 1YLYA 1RP5A 1TS8A 4HY8A 5HPIA 3ZGAB 3DW0A 4KZ4A 1N9BA 2A49A 2Y2MA 3UE3A 1MKIA 1N9LA 3ZG7B 2Y2OA 2Y2QA 4GKUA 1RGYA 1IYSA 1ES4A 3N7WA 5GLDA 5J3WA 3B3XA 4DE3A 3EGDC 3MQ0A 4L9FA 5CHJA 1AXBA 5EM1A 1MZUA 4NXGA 1PI4A 4WEKA 4DXBA 4QHCA 4Q0IA 4XXRA 1FQGA 1K4FA 4BENA 2JKRI 4GHIA 5U47A 1YLPA 5I94A 2ZC5B 4F94A 4UA9A 1A0KA 5CRFA 3OPPA 3ZG5A 2EA9A 3IX4A 3IF6C 3Q07A 3ZNYA 3KSGA 1S1ZA 4KQQA 3GR2A 4EEUA 2W3DA 3C4PA 4E3IA 3QHYA 3IQAA 3O86A 3FWLA 2WKHA 2WGIA 3MQQA 1LL8A 1NYMA 3O3VA 3T4JA 2J3TD 1H8MA 2GJ3A 2PDRA 4S2NA 1DJBA 2FFFB 2WGVA 3MXRA 2OAP1 4WM9A 3UE6A 1L0DA 4HEFA 3UDXA 3HVFA 2GDNA 2OLUA 3O5YA 2R9WA 4UAAA 5E2GA 1O7EA 1PIOA 3UB7A 2ZQCA 1TEMA 4MCWA 2Z6CA 2Y2HA 3FYZA 1FCNA 2J7VA 1J9MA 3GQZA 2Y91A 2WKIA 3IHBA 4DJ2A 1LSXA 4BD1A 3VMAA 3VOZA 2AVXA 1MBLA 3OPHA 4H6JB 4OOLA 1F5MA 5FQMA 1MXOA 5LBRA 2KLIA 2XROA 1Y54A 4R23A 2C5WB 3C4OA 5HD5A 3C5AA 4OP8A 2G2UA 5AQBA 2PBYA 3SH9A 3CUEC 2WZZA 2EX9A 5F5YA 3OCNA 1NZUA 1Y4OA 2XFSA 4XT2A 2Q9NA 2O9BA 3K2NA 3NECA 1MWSA 2J8YA 3C7UA 5TFQA 1EI5A 3QP8A 1JVJA 4GN2A 3VOYA 2G2WA 3CLOA 3ITAA 3NOTC 3OBFA 3ZQ5A 4LPZA 4WMCA 1IELA 4FUWA 4KG2A 3T50A 4M4XA 3IS2B 1H8YA 1CEGA 2JKGA 4KQRA 2V1BA 5EVEA 4GS9B 3I7JA 2ACGA 4R1GA 1JTGA 5FAPA 4N92A 2FH5A 4DKIA 5HX9A 4O8GA 3G6OA 5HDSA 3UB9A 2ZQAA 1D1JA 4EU0A 3RXXA 1X0OA 1G28A 2A24B 2QPNA 3PHYA 3T4LA 1E3UA 2BASA 2VV7A 1CF0A 4G3VA 5TBMB 4ZAMA 1AWIA 1TS7A 3V3SA 1I5QA 4HP4A 3M2JA 3E98A 4WL9A 4ZJ3A 1E25A 3LIDA 2PHYA 3A3FA 2QYBA 3EOIA 3LYXA 1ES3A 3VSKA 4GNUA 4BBUA 4I3JA 1KGEA 3GMWA 1T1CA 2Y2IA 1Y28A 1KE0A 3TE8A 4ZJ1A 3LICA 3H7WB 4OQ0A 3Q1FA 4PM6A 3ZG8B 3IBJA 1GSWA 5EFWA 3ZNTA 4C3QA 1TVFA 3A3DA 1SCWA 3M6HA 4HI4A 4XUXA 4QU3A 1GHIA 5CHUA 2EFUA 3BFGA 3V67A 3EEAA 5FQ9A 4EWFA 2ZQ9A 1ONHA 1KE4A 4K08A 1PWDA 2Q9MA 2ZQ7A 1W5DA 4EESA 3O88A 1S4SA 3BECA 3FKWA 4Y7PA 4P87A 2XA7S 3MBZA 3F1NB 4R0QA 1YPRA 2Y59A 3WS1A 4R6LA 2WZXA 3UPOA 5I5LA 2V1AA 1W63Q 4KG6A 3DWKA 3PBNA 3KO6A 5HL1A 2JKFA 4KZ5A 1TDLA 1YLZA 2ZM8A 3LUQA 3VFHA 3CZDA 3ISGA 3R4KA 4Z9QA 1PZOA 5L8MA 2WAEA 2H10A 4JF5A 4CLCD 2VGKA 1XJ3A 4H6JA 4E3OA 3TSGA 3NDEA 5KIZA 4JF4A 4HIAA 5FI6A 2XLNA 5GHZA 2D02A 3RJUA 2KX6A 4IEDA 1BUEA 3HUNA 1KOUA 2Y2LA 4U0XA 3T4TA 1LSWA 5A8BA 4IVKA 1JTDA 2VGLS 5JYOA 1YKDA 2M1CA 1OT6A 4PKYG 4OLDA 1K0KA 4S2IA 4YWZA 5FA7A 3JVVA 3V5MA 3SS3A 5F6AA 2ZM0A 1T19A 3IWQA 4IJGA 2WKRA 1H8ZA 3T1RA 2ZC6B 2Y2GA 4FH4A 5FQIA 3V50A 3CHWP 4CJNA 2ZC4B 3N8RA 3Q7VA 3ZVTA 1JNUA 3DBAA 1HLUP 5AJGA 3FV7A 3FC7A 1K38A 5FI2A 2R78A 3SOIA 4LV3A 1L3LA 4UQIM 1ERQA 3RXWA 4Y13A 3UN7A 4OOMA 5AQ9A 3KSFA 1KDSA 3BFDA 4HP9A 3UDIA 1OTAA 4WZ5C 1DJAA 2QHKA 3ZYTA 5J8XA 4GOGA 1RGZA 2HJEA 4HJ6A 4B4XA 3S4XA 1YAXA 3LGOA 4I3IA 1LI0A 4WZ4A 1QMFA 2GZAA 3KSIA 3CITA 4B4ZA 2Z2LB 3B42A 4ZTKA 2HF6A 4UHUA 5GLAA 4WYYA 3S22A 4JXSA 3F1OB 5CX7A 5CEBA 4JXVA 3HLBA 1Z6FA 3KYQA 2P04A 4PKYA 2X71A 5IT5A 4QY6A 4Z1WA 4HESA 5D3OA 3CAXA 2ZQDA 2W3FA 3W4PA 3CPTB 1XJ4A 1EW0A 1OTDA 5M18A 2PR5A 1NRFA 5DKKA 4EV4A 1BLSA 4DE2A 2P08A 2XFTA 4R38A 1MPLA 5EECA 5EVIB 4N9LA 4LENA 1DP8A 4LGWA 3Q82A 3EWKA 4JGQA 5FSRA 5DTKA 3BY8A 4X53A 5HARA 4MMNA 4PMAA 3NC8A 3CG5A 3MSHA 3LR3A 4EEPA 3MKEA 3CI6A 3F1PA 5A93A 3OOVA 3LIFA 2PT7A 3IF6B 1M6KA 5TGFA 3JPUA 1HZOA 4X68A 3ICYA 2P74A 1JWPA 4OPRA 4I3AA 2QZ6A 2EX6A 1CI8A 3P09A 2DCFA 5EV0A 5J7EA 5DTTA 1D7EA 3UY6A 2L1MA 2VV6A 4X56A 5HWTA 2KOIA 2NUPC 4Y3IA 3S7OA 5F69A 3R7WB 1W8YA 3AGFA 5CTMA 3G2YA 2E8JA 3C30A 4L9GA 2IWCA 2BLSA 5FQQA 1KE3A 3NI9A 4HH3A 2ZC3B 1Z09A 4DN0A 5CEDA 5CGXA 3F1OA 2XA7M 4HBTA 2ZOHA 4IUHA 1NLZA 2L4RA 4P6ZM 5CGWA 1SKOA 5F83A 2H5SA 1J3WA 1VEUB 5DTSA 2RCXA 1MWRA 3MR0A 3NIAA 4N1XA 4MEZA 2UV0E 5F68A 1SKFA 4H8RA 2PU4A 3DAVA 3FZCA 3VV4A 1KDWA 4CPKA 3IXDA 3LEQA 4E6XA 2K2NA 1DRMA 4X1MA 5A92A 3FKVA 5DF7A 1K6RA 4EQIA 1P9RA 2LB5A 2Y2JA 3FPVA 3MMHA 2W1RA 2XF3A 4KZ6A 5EM0A 5HD3A 1PW8A 4E04A 3C2WA 2Y8HA 1K56A 1NLYA 4K91A 5MC7A 3VP3A 4HQAA 5FEFA 4E3LA 1YLWA 1IKGA 5E2HA 3T1XA 5L09A 1HD8A 1TF1A 1FILA 3NHQA 1FCOA 3LEZA 1WE4A 3IHAA 3NJAA 3Q7ZA 1G6OA 3HUMA 4I5SA 2O9AA 1XFNA 1BT5A 5EUAA 4JLFA 3IX3A 4WELA 2WGWB 3LFVA 3TW8A 2Z6DA 1TS6A 3H82A 5FEGA 4WN5A 2FFYA 5CXWA 1BLHA 3UE1A 2WYXA 3N6IA 3PBQA 2XR0A 3HLCA 4OONA 4GCZA 1XPBA 4PM5A 1VEUA 4IUKA 3PYPA 2B5RA 2DRWA 4OKPA 2I72A 4UA7A 3H7WA 3G34A 3CMZA 2HJ9C 4NKPA 5JYPA 5KZHA 3TOIA 3DTEA 4ME4A 4DRTA 2VX8A 1H5XA 1KGGA 3GVBA 4LFUA 2XQZA 2WKEA 1XP4A 1MWTA 5EPHA 2GX5A 2IWDA 3A3EA 3JVUA 3M2KA 3F1NA 4CQHA 4X55A 3QNCA 4I39A 5IHVA 2K7SA 3VP1A 2ZMFA 2QJ5A 2OAQ1 2PD7A 4ETXA 3ZG0A 3DTMA 5HFOA 3V3RA 3ITBA 4EBPA 1OPXA 3KYEA 1FCMA 2VJWA 1IOUA 2JE5A 3UMDA 3PTEA 4WLAA 5TBMA 1GSVA 1ONGA 3N8LA 5F82A 1GHPA 1E3UD 4IBXA 5CERA 2JKTM 3LIAA 4MLLA 2FZ0A 3EGXC 2A3UA 4PM8A 4KG5A 3IS2A 4RX3A 1L0FA 3HLEA 3TJZC 3S7PA 5HAQA 2ZL1A 2W3HA 4KZ8A 4BMWA 5HAIA 4LV1A 3S7QA 5EVID 1XX2A 1CQAA 1ES2A 1S4RA 2A24A 1FSWA 4E6WA 1V9ZA 3VE4A 2XH9A 3BEBA 1PRQA 3K3CA 4GHIB 1W7FA 5AQ7A 2GNXA 1SZVA 4U0TA 1ZHHB 4EBLA 3UB5P 2ZMVA 2VGLM 2C6WB 1K55A 3S7NA 2BG1A 4U3TA 3UPNA 3HJIA 1W8QA 3VFFA 2XK1A 3BFEA 3U4LP 2WKQA 5HDDA 4Y17A 5M19A 3T4KA 2ZM2A 4YINA 4A5RA 2OV5A 2OWJA 3IWOA 1LT0A 4R3AA 1PWGA 2MJ6A 4P85A 1CEFA 3FG8A 4DMZA 2VA0A 1N9NA 4JKTA 4E3JA 3DWZA 4MBHA 3E2LA 1YMXA 4ARZA 2WUQA 1K55C 4LV2A 1H3QA 2W1TA 1OJ5A 2OSUA 2YKFA 1TD5A 4HH2A 1N9OA 2V9AA 4WZ5A 1OTIA 4LCLA 4FD8A 2HP9A 1CK3A 4JGRA 2VV8A 4MBKA 4BBVA 3VP2A 2CMNA 1ALQA 4L0LA 4YOFA 1BLCA 4JBFA 5HW3A 5J4EA 4ESPA 4BL3A 2G7UA 4NXBA 1BLPA 4LRZE 2Y55A 4Y5FA 2J9PA 3UE0A 5AQAA 4KZAA 1F9IA 3EQVA 2W27A 1XGJA 1T1AA 3KYZA 2XSSA 2JHEA 3PR6A 3P7NA 3GECA 3MS6A 3G4PA 3WS5A 1LLBA 3UMEA 3G31A 3HL9A 4R4RA 1KVMA 1ESIA 5DFYA 3B47A 4E3MA 4ETZA 1M40A 1G6AA 1ERMA 1UWNX 4C6YA 2EX2A 2V8CA 3LR4A 1XJ6A 5BOHA 4NXEA 5FDSA 2W3EA 2CC1A 1ES5A 3R7WA 5C5KA 4BWIA 3IH8A 4ARZB 5E2FA 1E4DA 3TRCA 2O9CA 2NUTC 3QP2A 1P0ZA 3N4IA 2HV1A 3C8CA 1BYWA 4GDNA 4QJGA 4G3KA 1DP9A 4X25A 1IYOA 2V8FA 4OPZA 4KUKA 1KGFA 4IVIA 3A0VA 3A3IA 3HBRA 5K5BA 3B33A 3K3DA 5DVAA 3LR0A 4FCFA 2EX8A 4QY5A 4HJ4A 4S2LA 3IF6A 2O99A 1OT9A 3S1YA 1BSGA 3ZDJA 3E2KA 3D72A 1YT4A 5FL3A 4EW7A 5E2EA 1YMSA 3IX8A 3ULFA 1GHMA 5EVIC 4NXFA 5DJUA 1K54A 4OQHA 2EWWA 4RQ9A 4O0PA 4N9KA 2KDKA 3ZVWA 3NDGA 3IXGA 1ZG4A 3QP4A 3LCEA 4Y0UA 4ZJ2A 4JGOA 3Q81A 1SHVA 3KSHA 4MN7A 1CI9A 2WADA 4JF6A 1XA7A 1XA1A 4GD8A 4I38A 3CWFA 3A0RA 4BJPA 4WF0A 4KQDA 3T1QB 3BYDA 3WWXA 1VETB 5KSCA 3VOLA 3MZDA 4YFMA 1EWZA 3H82B 4S2PA 1XFQA 1U60A 4EETB 2INWA 4FH2A 2EWVA 3HREA 4HNBA 2Q0OA 4KENB 5AVFA 3PXPA 5GLCA 3SS5A 3NOUC 1FR1A 4OQGA 2Y2KA 4MNRA 4D60A 1NYYA 4F3LB 2XD1A 5A91A 4WMCD 1GA0A 4KZ9A 2Y2NA 5HDCA 3P98A 1PFLA 3DTKA 5CGSA 1IYQA 1ESUA 1IEMA 5FAOA 4WBGA 2QWSA 4CLCB 2ZOIA 4GDBA 4BLMA 3LY4A 1LHYA 5HL6A 2HDQA 2JN7A 2W0NA 3ZG9B 2W3GA 5GHYA 4DDSA 3SW1A 3BM6A 3BY9A 5DFXA 4RA7A 2H0TA 4OH0A 1S1YA 4PM9A 4GB7A 2W1TB 2VLGA 5FAQA 1DJCA 4X69A 1NJ4A 1C3BA 2PYRA 4S2NC 2V1ZA 3KX0X 1K54C 4KZ7A 3G35A 3HLFA 5CTNA 1P9WA 3U2AA 1Q2PA 1YSPA 2VEAA 3LI9A 2M7VA 1K56D 5DF8A 4JXWA 3JYIA 4O01A 2Y79A 3IH9A 2YKHA 1TDGA 5EOEA 1H0MA 4DE1A 1MY8A 2Y4AA 3CUEA 2HPBA 2P7JA 5CECA 2XD5A 3W8KA 4MBFA 3Q7VB 1JWVA 5HSQA 1HTZA 1PYYA 1FOFA 1F98A 2VZWA 3MJQA 5F1GA 4JXGA 2ZBBA 2WGWA 4DE0A 5FDHA 4KUOA 4GLQA 2R9XA 3T12B 2WKPA 1FR6A 3SH7A 3LI8A 4CLCC 2D01A 1T1BA 3N8SA 4LLOB 4PAUA 1SDNA 2QJ7A 2PYPA 2VKSA 2ZL1B 4DXCA 2XGNA 3ZHHA 3HLDA 5GLBA 4P0MA 3GTCA 4LCMA 4FSFA 4LRXC 4MDZA 4Y0TA 4CLCE 5E43A 3MFDA 1ZG6A 3IBRA 5DF9A 3E4OA 3IT9A 3HCYA 4NG2A 4MN5A 2Y2PA 4S2KA 4GZBA 3TG9A 1T18A 3BQ8A 4XUZA 2EFXA 1KVLA 3UB6A 1DP6A 4KZ3A 4FOFA 1S66L 3O87A 3NBLA 4MN6A 5TJJA 4M3KA 2V2FF 4ZRRA 3CPTA 1L2SA 4HHDA 3NY4A 4S2MA 1GCEA 4OQIA 2EXAA 4Y15A 4BL2A 1VQQA 1S6RA 2X01A 1NRJA 1TS0A 1BZAA 5HPFA 3PBSA 3NCKA 3WS0A 3H9WA 1UGUA 5EE8A 1K57C 5EVIA 3MXQA 5L07A 4OPYA 3T4QA 2J9OA
chains in the Genus database with same CATH topology
2MJ6A 3UE3A 3PBOA 3FG8A 4Y2FA 1YAXA 4DMZA 5KSHA 1N9LA 4I3IA 2VA0A 1W63M 2GZAA 3KSIA 5HWWA 1N9NA 4B93A 3CITA 1D06A 5J3WA 3B42A 2HF6A 3EGDC 3MQ0A 4L9FA 3MFXA 4ARZA 1MZUA 4NXGA 4WEKA 3F1OB 5CX7A 4EQ1A 1H3QA 4Q0IA 2W1TA 1OJ5A 2YKFA 3KYQA 2P04A 1TD5A 4PKYA 4HH2A 1N9OA 4UEYA 2B18A 5IT5A 2V9AA 1OTBA 1OTIA 2JKRI 4Z1WA 4GHIA 4UQIS 4GS9A 3CAXA 4JGRA 2VV8A 2JKTI 4BBVA 2CMNA 3MF0A 4L0LA 2W3FA 4YOFA 5J4EA 1VB6A 1XJ4A 1OTDA 1EW0A 4R70A 3T4SA 2EA9A 2PR5A 2G7UA 4NXBA 5G4ZA 4LRZE 3KSGA 2JKRM 5DKKA 1VHMA 1S1ZA 4Y5FA 1ZTUA 3P01A 2P08A 4R38A 1F9IA 4EEUA 3EQVA 2W27A 1DP8A 2W3DA 1T1AA 2L0WA 1YSQA 2XSSA 3KYZA 3EEHA 3EWKA 4JGQA 3BY8A 2JHEA 3NOPC 4EXOA 3PR6A 5IU1A 4MMNA 3P7NA 3GECA 2LB9A 3MQQA 1LL8A 3LR3A 2PR6A 3T4JA 2J3TD 4EEPA 3CI6A 3UMEA 3F1PA 1H8MA 5DJTA 3OOVA 2M7UA 2GJ3A 3LIFA 5DFYA 3B47A 2PT7A 4ETZA 2PDRA 3ICYA 2OAP1 3UE6A 1UWNX 3LIEA 3LR4A 1XJ6A 4YNRA 5HZHA 4I3AA 3O5YA 4NXEA 2W3EA 3R7WA 2I9VA 5C5KA 4BWIA 5J7EA 4ARZB 1D7EA 3TRCA 3UB7A 2L1MA 1GSXA 2O9CA 2NUTC 2VV6A 3HJKA 4BBTA 5HWTA 4MCWA 2KOIA 2Z6CA 2NUPC 4Y3IA 3S7OA 1P0ZA 5F69A 3R7WB 2HV1A 3C8CA 1BYWA 4DJ2A 1MKMA 3BJNA 1LSXA 4G3KA 1DP9A 3C30A 4L9GA 4HH3A 4KUKA 3OLOA 4H6JB 4OOLA 3A0VA 1F5MA 4DN0A 3F1OA 2XA7M 4IUHA 2ZOHA 5LBRA 2KLIA 1NLZA 2L4RA 4P6ZM 2XROA 5K5BA 3B33A 3K3DA 5HD5A 3LR0A 3MR0A 4HJ4A 5F68A 2O99A 1OT9A 3CUEC 5F5YA 3E4QA 3OCNA 3VV4A 4XT2A 3D72A 5FL3A 4EW7A 2O9BA 2K2NA 3K2NA 1DRMA 3ULFA 1WA9A 1P9RA 2LB5A 4NXFA 3CLOA 3OBFA 3NOTC 5DJUA 3ZQ5A 2EWWA 4RQ9A 4O0PA 2KDKA 4LPZA 2XRNA 3FPVA 3MMHA 5AVEA 2W1RA 3E4PA 4JGOA 5HD3A 3T50A 3E0YA 4M4XA 3IS2B 4E04A 3KSHA 4MN7A 3C2WA 2Y8HA 2V1BA 4GS9B 4I38A 1NLYA 3CWFA 3A0RA 3BW6A 4BJPA 5MC7A 4HQAA 1P97A 2FH5A 4KQDA 4WF0A 4II7A 2O0YA 3VOLA 3PBTA 3H82B 4O8GA 4NEED 1XFQA 4EETB 3G6OA 1TF1A 2INWA 5HDSA 4P6ZS 3UB9A 3NHQA 2EWVA 4AFIA 4HNBA 2PD8A 3W2ZA 3NJAA 3EQUA 5AVFA 1MC0A 1G6OA 3PXPA 4I5SA 3NOUC 2O9AA 4EU0A 1XFNA 1X0OA 1G28A 2A24B 4HOIA 3F1PB 4CLCA 3PHYA 3T4LA 3OCLA 2BASA 2VV7A 4WELA 3GDIA 4G3VA 5TBMB 4F3LB 3LFVA 4WEJA 1TS7A 4WUJA 3TW8A 2Z6DA 1TS6A 3H82A 4WN5A 4HP4A 3E98A 4WL9A 3RFBA 5HDCA 3LIDA 2PHYA 2HGVA 2QYBA 3EOIA 3LYXA 1NWZA 3VE3A 4BBUA 1ODVA 1S67L 1IFQA 3PBQA 2H28A 4EUVA 1UWPX 4GCZA 5HWVA 2QKPA 4I3JA 4IUKA 2QWSA 3PYPA 4CLCB 2ZOIA 1T1CA 1Y28A 2V0UA 1STZA 3TE8A 2B02A 3LICA 5HL6A 2JN7A 1LSVA 2W0NA 3BQAA 2W3GA 3H7WB 3BWLA 3SW1A 3MQOA 3UB8A 3BY9A 5DFXA 3IBJA 1GSWA 5EFWA 2V0WA 4HI4A 3H7WA 2HJ9C 1S1YA 4NKPA 3V67A 2W1TB 2VLGA 4ME4A 2VX8A 3EEAA 1XJ2A 2DMWA 2PYRA 3KX0X 2J3TC 2GX5A 4K08A 3JVUA 3A0SA 4CQHA 2J80A 3F1NA 4EESA 1P9WA 5DKLA 3U2AA 1S4SA 4Q0JA 1YSPA 4I39A 2VEAA 4B9OA 3LI9A 2XA7S 2M7VA 2K7SA 3F1NB 2ZMFA 4QPRA 4EERA 2QJ5A 4O01A 2Y79A 4R6LA 2OAQ1 2PD7A 2YKHA 4ETXA 3LIBA 5I5LA 3CUEA 3RTYA 1V9YA 2V1AA 2IA2A 1W63Q 2P7JA 1OPXA 3PBNA 2J3WA 3KO6A 3C38A 2K31A 3LUQA 2VJWA 4DJ3A 1IOUA 5HSQA 2VZWA 1F98A 3R4KA 3MJQA 3UMDA 5G4YA 5L8MA 2ZBBA 4WLAA 5HPIA 5TBMA 1GSVA 2OOLA 4CLCD 4KUOA 4GLQA 1XJ3A 4H6JA 2WKPA 3LI8A 4CLCC 2JKTM 2D01A 5KIZA 3LIAA 4HIAA 2FZ0A 1T1BA 3EGXC 4LLOB 4G3WA 4PAUA 4KQOA 2QJ7A 2PYPA 2VKSA 4XT2B 3OC2A 2D02A 3IS2A 2KX6A 3RH8B 1KOUA 3TJZC 3S7PA 3T4TA 1LSWA 4FSFA 4IHQA 5A8BA 2W3HA 4LRXC 2VGLS 4BMWA 1YKDA 4MDZA 2M1CA 4HJ3A 1OT6A 3S7QA 4PKYG 4CLCE 3IBRA 4YWZA 4L9EA 5DF9A 3E4OA 3JVVA 4PHTA 5F6AA 1S4RA 3HCYA 2A24A 4MN5A 3FPWA 1V9ZA 3VE4A 1T19A 1T18A 3BQ8A 4IJGA 2WKRA 4Q0HA 3K3CA 4GHIB 3UB6A 1DP6A 2OWHA 2GNXA 4FOFA 1S66L 1ZHHB 1OJGA 1JNUA 4GW9A 4MN6A 2ZMVA 5TJJA 2VGLM 1OTEA 3T4OA 3DBAA 4LRYC 4ZRRA 4GJ4A 3S7NA 2A2LA 5AJGA 3FC7A 4HHDA 2R78A 4UQIM 3HJIA 4F3LA 3D3OA 1NRJA 1TS0A 4OOMA 3LR5A 5IS1A 3KSFA 4HP9A 3PBRA 5HPFA 2WKQA 5HDDA 3PBSA 3T4KA 1OTAA 1UGUA 3H9WA 3MXQA 4JGPA 2QHKA 3ZYTA 2OWJA 1LT0A 2HJEA 4R3AA 3T4QA 1TS8A 4HJ6A 4HY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I9V A;  3F1P B;  3MJQ A;  5J7E A;  3PHY A;  3UMD A;  1D7E A;  2BAS A;  2VV7 A;  2ZBB A;  5G4Y A;  2L1M A;  1GSX A;  2VV6 A;  3GDI A;  3HJK A;  4WLA A;  5TBM B;  5HWT A;  1GSV A;  5TBM A;  4F3L B;  3FG8 A;  2Z6C A;  2OOL A;  1TS7 A;  1N9L A;  4WUJ A;  1P0Z A;  4I3I A;  2Z6D A;  4KUO A;  5F69 A;  1TS6 A;  3H82 A;  1XJ3 A;  5HWW A;  4H6J A;  4WN5 A;  1N9N A;  2HV1 A;  2WKP A;  4HP4 A;  3LI8 A;  3C8C A;  2D01 A;  1BYW A;  4WL9 A;  4DJ2 A;  5HDC A;  3LIA A;  5KIZ A;  3LID A;  1LSX A;  2PHY A;  4HIA A;  1D06 A;  1DP9 A;  5J3W A;  1T1B A;  4L9G A;  3LYX A;  4HH3 A;  4BBT A;  4L9F A;  3MFX A;  4LLO B;  4KUK A;  3OLO A;  4H6J B;  3A0V A;  1NWZ A;  2QJ7 A;  2PYP A;  3VE3 A;  1MZU A;  1ODV A;  1S67 L;  4NXG A;  4BBU A;  4XT2 B;  2H28 A;  3F1O A;  3F1O B;  2ZOH A;  4EQ1 A;  2D02 A;  1UWP X;  3IS2 A;  2KX6 A;  4GCZ A;  3RH8 B;  2L4R A;  2QKP A;  4I3J A;  5HWV A;  1KOU A;  2QWS A;  3B33 A;  3K3D A;  3PYP A;  1OJ5 A;  2YKF A;  3UB7 A;  2ZOI A;  1T1C A;  4PKY A;  5HD5 A;  1LSW A;  4HH2 A;  1N9O A;  5A8B A;  4LRX C;  1Y28 A;  2V0U A;  3MR0 A;  2V9A A;  1OTB A;  1OTI A;  4HJ4 A;  5F68 A;  2M1C A;  4GHI A;  2B02 A;  3LIC A;  4HJ3 A;  1OT6 A;  4GS9 A;  3CAX A;  1OT9 A;  4PKY G;  2JN7 A;  1LSV A;  2W0N A;  3H7W B;  3BWL A;  5F5Y A;  3SW1 A;  4JGR A;  2VV8 A;  3E4Q A;  3MQO A;  3UB8 A;  3IBR A;  3BY9 A;  4BBV A;  1GSW A;  4XT2 A;  2CMN A;  5EFW A;  4L9E A;  4YWZ A;  3D72 A;  4EW7 A;  3E4O A;  5F6A A;  2V0W A;  1S4R A;  2A24 A;  5J4E A;  4MN5 A;  1VB6 A;  1XJ4 A;  4HI4 A;  1V9Z A;  3H7W A;  1DRM A;  1OTD A;  1T19 A;  1T18 A;  1EW0 A;  3VE4 A;  4R70 A;  2WKR A;  2EA9 A;  1S1Y A;  3ULF A;  1WA9 A;  2PR5 A;  3K3C A;  4GHI B;  4NXB A;  2VLG A;  5G4Z A;  4NXF A;  4LRZ E;  3CLO A;  1DP6 A;  3NOT C;  2OWH A;  5DJU A;  5DKK A;  3UB6 A;  3ZQ5 A;  1S1Z A;  1XJ2 A;  4RQ9 A;  2KDK A;  4LPZ A;  2PYR A;  1S66 L;  4R38 A;  1F9I A;  5AVE A;  4EEU A;  1OJG A;  4EES A;  3E4P A;  4JGO A;  1JNU A;  2W27 A;  1DP8 A;  5HD3 A;  4GW9 A;  3KX0 X;  4MN6 A;  3T50 A;  1T1A A;  3IS2 B;  4M4X A;  1OTE A;  2L0W A;  4K08 A;  4LRY C;  4E04 A;  3C2W A;  3A0S A;  3EEH A;  2J80 A;  3EWK A;  3F1N A;  2V1B A;  3BY8 A;  2JHE A;  3FC7 A;  4GS9 B;  4HHD A;  3NOP C;  4JGQ A;  2R78 A;  5DKL A;  4R3A A;  1S4S A;  4I38 A;  4EXO A;  5IU1 A;  3CWF A;  3A0R A;  4I39 A;  2VEA A;  3P7N A;  4B9O A;  4HQA A;  1P97 A;  3GEC A;  3LI9 A;  3MQQ A;  4KQD A;  4WF0 A;  3HJI A;  2K7S A;  3F1N B;  1LL8 A;  4F3L A;  2PR6 A;  3VOL A;  4EEP A;  1TS0 A;  5IS1 A;  4EER A;  2QJ5 A;  3UME A;  3H82 B;  4R6L A;  2YKH A;  2PD7 A;  3F1P A;  3LIB A;  5DJT A;  2GJ3 A;  5I5L A;  1XFQ A;  3LIF A;  4EET B;  3G6O A;  4HP9 A;  2INW A;  5HDS A;  2PDR A;  3NHQ A;  2WKQ A;  3RTY A;  1V9Y A;  2V1A A;  5HDD A;  3UB9 A;  2P7J A;  3ICY A;  1OTA A;  1UGU A;  2PD8 A;  3H9W A;  4HNB A;  1UWN X;  3UE6 A;  3MXQ A;  3NJA A;  4JGP A;  5AVF A;  2QHK A;  3LIE A;  1XJ6 A;  4I5S A;  3NOU C;  4I3A A;  5HZH A;  2OWJ A;  3LUQ A;  1LT0 A;  4NXE A;  1XFN A;  1X0O A;  1G28 A;  2A24 B;  1TS8 A;  4HJ6 A;  4HOI A;  4HY8 A;  4DJ3 A;  5HSQ A;  1F98 A; 
#chains in the Genus database with same CATH topology
 1SDE A;  4D2O A;  5FI7 A;  3PBO A;  4N1H A;  3DTI A;  2PU2 A;  4Y2F A;  5KSH A;  1LL5 A;  3AGD A;  1W63 M;  5HWW A;  4B93 A;  4O7D A;  5A90 A;  1D06 A;  5KMW A;  1BUL A;  3MFX A;  4OVD A;  1IKI A;  3D9Y A;  4FTX A;  4EQ1 A;  1O07 A;  3QP1 A;  3T1S A;  2BTF P;  4UEY A;  2PBD P;  1G5U A;  1S0W A;  2B18 A;  1OTB A;  3G30 A;  2IWB A;  4UQI S;  2QMI A;  4GS9 A;  3WS4 A;  4PPR A;  2RL3 A;  2JKT I;  1F2K A;  3MF0 A;  1LL9 A;  1WYC A;  2ZD8 A;  1VB6 A;  3OPR A;  4R70 A;  3T4S A;  4UA6 A;  5CHM A;  4ZBE A;  4C75 A;  5G4Z A;  3OPL A;  3MZF A;  2JKR M;  1VHM A;  1IYP A;  1ZTU A;  3P01 A;  3A3J A;  2P9V A;  2ZQ8 A;  3BLM A;  4OP5 A;  5HAP A;  2L0W A;  1YSQ A;  4Q8I A;  2H0Y A;  1ZKJ A;  3EEH A;  3CJM A;  3NOP C;  4EXO A;  3UNW A;  5IU1 A;  1XGI A;  3G2Z A;  2LB9 A;  2ZC7 A;  2PR6 A;  5DJT A;  4S2J A;  2M7U A;  4OOY A;  3SH8 A;  5M1A A;  2WK0 A;  4BD0 A;  3LIE A;  4YNR A;  1NXY A;  5HZH A;  3GV9 A;  2I9V A;  1JWZ A;  1K4E A;  1LI9 A;  4BBT A;  1GSX A;  3HJK A;  2VGJ A;  3BLS A;  3HUO A;  4E3N A;  2XEP A;  4X1L A;  3MZE A;  4E3K A;  1NY0 A;  3BFF A;  1MKM A;  3BJN A;  3AGE A;  4RX2 A;  3OLO A;  4EUZ A;  5L2F A;  3WRT A;  5FQJ A;  4OPQ A;  1ZC2 A;  4R3J A;  3PAE A;  4ZDX A;  1FSY A;  3HLG A;  2PAV P;  2UWX A;  2HDS A;  3E4Q A;  3BRM A;  3ZFZ A;  4R3B A;  3IXB A;  4QWO A;  1VET A;  3QNB A;  3GRJ A;  1WA9 A;  4PM7 A;  5L10 A;  4GD6 A;  2DNS A;  1NZO A;  3W4Q A;  2XRN A;  3GSG A;  5AVE A;  3E4P A;  3E0Y A;  3WRZ A;  1YLJ A;  2Z2M B;  5F1F A;  1W79 A;  3BW6 A;  4IBR A;  1P97 A;  3V39 A;  1K25 A;  4II7 A;  2O0Y A;  1OME A;  3PBT A;  1RCJ A;  3VP0 A;  3LY3 A;  4NEE D;  1DY6 A;  2WAF A;  3VP4 A;  2OLV A;  4P6Z S;  3IWI A;  2XDM A;  4RYE A;  5EOO A;  4AFI A;  2PD8 A;  3W2Z A;  3EQU A;  1HVB A;  1MC0 A;  3L7H A;  4JPM A;  4HOI A;  3PAG A;  3SS4 A;  3F1P B;  4CLC A;  3OCL A;  3GDI A;  4WEJ A;  2HP6 A;  4WUJ A;  4Y0O A;  3RFB A;  3UDF A;  2HGV A;  1NWZ A;  3VE3 A;  2E8I A;  1ODV A;  1S67 L;  1IFQ A;  3M6B A;  1PW1 A;  2H28 A;  5GL9 A;  4EUV A;  1UWP X;  5HWV A;  1Q2Q A;  2QKP A;  3WS2 A;  3OZH A;  3D4F A;  2PRF A;  3C7V A;  2VK3 A;  2V0U A;  1STZ A;  2B02 A;  1LSV A;  3BQA A;  3BWL A;  3MQO A;  3UB8 A;  1YQS A;  1WYB A;  4NET A;  1K57 A;  2V0W A;  2HDR A;  3QP6 A;  1XJ2 A;  1I2S A;  2DMW A;  5FAT A;  2HZ5 A;  2J3T C;  1GA9 A;  1MWU A;  3L9K A;  1G68 A;  3A0S A;  2J80 A;  5DKL A;  4Q0J A;  1QME A;  1CJF A;  3VSL A;  4OLG A;  4RVA A;  1XXM A;  4B9O A;  1PZP A;  3MKF A;  3BFC A;  4QPR A;  1ACF A;  3IF5 A;  1XKZ A;  4EER A;  2ZLY A;  1PNE A;  3LIB A;  5G18 A;  3RTY A;  1V9Y A;  2IA2 A;  2JCH A;  1PI5 A;  2J3W A;  3IXH A;  3C38 A;  2K31 A;  2HP5 A;  4KZB A;  4DJ3 A;  4P6B A;  4QB8 A;  5G4Y A;  3ZCZ A;  3MXS A;  4ID4 A;  1L0G A;  2OOL A;  1FIK A;  3G32 A;  3UPP A;  3W4O A;  4EBN A;  2X02 A;  4G3W A;  4KQO A;  2V20 A;  4K0W A;  3QP5 A;  4XT2 B;  3OC2 A;  1YM1 A;  1BTL A;  3RH8 B;  2JBF A;  5TR7 A;  3HLW A;  1VM1 A;  2P9V B;  2ZMA A;  5EVL A;  4IHQ A;  4LV0 A;  4X6T A;  4B88 A;  4HBU A;  4HJ3 A;  3SZT A;  3NUL A;  3LO7 A;  3UO9 A;  2JC7 A;  4L9E A;  4NK3 A;  4PHT A;  1N4O A;  3FPW A;  4R4S A;  4Q0H A;  2OWH A;  1YLT A;  1OJG A;  5FAS A;  4GW9 A;  4BQM A;  3T4O A;  1OTE A;  4LRY C;  4GJ4 A;  2HDU A;  1PWC A;  2A2L A;  2ZJ9 A;  1L0E A;  4QD4 A;  1K6S A;  1I2W A;  5FQK A;  4F3L A;  4DDY A;  4DF6 A;  3D3O A;  5IS1 A;  3LR5 A;  2EXB A;  4K0X A;  3PBR A;  4S2O A;  2B95 A;  1ERO A;  4JGP A;  5GHX A;  1SKO B;  1YLY A;  1RP5 A;  1TS8 A;  4HY8 A;  5HPI A;  3ZGA B;  3DW0 A;  4KZ4 A;  1N9B A;  2A49 A;  2Y2M A;  3UE3 A;  1MKI A;  1N9L A;  3ZG7 B;  2Y2O A;  2Y2Q A;  4GKU A;  1RGY A;  1IYS A;  1ES4 A;  3N7W A;  5GLD A;  5J3W A;  3B3X A;  4DE3 A;  3EGD C;  3MQ0 A;  4L9F A;  5CHJ A;  1AXB A;  5EM1 A;  1MZU A;  4NXG A;  1PI4 A;  4WEK A;  4DXB A;  4QHC A;  4Q0I A;  4XXR A;  1FQG A;  1K4F A;  4BEN A;  2JKR I;  4GHI A;  5U47 A;  1YLP A;  5I94 A;  2ZC5 B;  4F94 A;  4UA9 A;  1A0K A;  5CRF A;  3OPP A;  3ZG5 A;  2EA9 A;  3IX4 A;  3IF6 C;  3Q07 A;  3ZNY A;  3KSG A;  1S1Z A;  4KQQ A;  3GR2 A;  4EEU A;  2W3D A;  3C4P A;  4E3I A;  3QHY A;  3IQA A;  3O86 A;  3FWL A;  2WKH A;  2WGI A;  3MQQ A;  1LL8 A;  1NYM A;  3O3V A;  3T4J A;  2J3T D;  1H8M A;  2GJ3 A;  2PDR A;  4S2N A;  1DJB A;  2FFF B;  2WGV A;  3MXR A;  2OAP 1;  4WM9 A;  3UE6 A;  1L0D A;  4HEF A;  3UDX A;  3HVF A;  2GDN A;  2OLU A;  3O5Y A;  2R9W A;  4UAA A;  5E2G A;  1O7E A;  1PIO A;  3UB7 A;  2ZQC A;  1TEM A;  4MCW A;  2Z6C A;  2Y2H A;  3FYZ A;  1FCN A;  2J7V A;  1J9M A;  3GQZ A;  2Y91 A;  2WKI A;  3IHB A;  4DJ2 A;  1LSX A;  4BD1 A;  3VMA A;  3VOZ A;  2AVX A;  1MBL A;  3OPH A;  4H6J B;  4OOL A;  1F5M A;  5FQM A;  1MXO A;  5LBR A;  2KLI A;  2XRO A;  1Y54 A;  4R23 A;  2C5W B;  3C4O A;  5HD5 A;  3C5A A;  4OP8 A;  2G2U A;  5AQB A;  2PBY A;  3SH9 A;  3CUE C;  2WZZ A;  2EX9 A;  5F5Y A;  3OCN A;  1NZU A;  1Y4O A;  2XFS A;  4XT2 A;  2Q9N A;  2O9B A;  3K2N A;  3NEC A;  1MWS A;  2J8Y A;  3C7U A;  5TFQ A;  1EI5 A;  3QP8 A;  1JVJ A;  4GN2 A;  3VOY A;  2G2W A;  3CLO A;  3ITA A;  3NOT C;  3OBF A;  3ZQ5 A;  4LPZ A;  4WMC A;  1IEL A;  4FUW A;  4KG2 A;  3T50 A;  4M4X A;  3IS2 B;  1H8Y A;  1CEG A;  2JKG A;  4KQR A;  2V1B A;  5EVE A;  4GS9 B;  3I7J A;  2ACG A;  4R1G A;  1JTG A;  5FAP A;  4N92 A;  2FH5 A;  4DKI A;  5HX9 A;  4O8G A;  3G6O A;  5HDS A;  3UB9 A;  2ZQA A;  1D1J A;  4EU0 A;  3RXX A;  1X0O A;  1G28 A;  2A24 B;  2QPN A;  3PHY A;  3T4L A;  1E3U A;  2BAS A;  2VV7 A;  1CF0 A;  4G3V A;  5TBM B;  4ZAM A;  1AWI A;  1TS7 A;  3V3S A;  1I5Q A;  4HP4 A;  3M2J A;  3E98 A;  4WL9 A;  4ZJ3 A;  1E25 A;  3LID A;  2PHY A;  3A3F A;  2QYB A;  3EOI A;  3LYX A;  1ES3 A;  3VSK A;  4GNU A;  4BBU A;  4I3J A;  1KGE A;  3GMW A;  1T1C A;  2Y2I A;  1Y28 A;  1KE0 A;  3TE8 A;  4ZJ1 A;  3LIC A;  3H7W B;  4OQ0 A;  3Q1F A;  4PM6 A;  3ZG8 B;  3IBJ A;  1GSW A;  5EFW A;  3ZNT A;  4C3Q A;  1TVF A;  3A3D A;  1SCW A;  3M6H A;  4HI4 A;  4XUX A;  4QU3 A;  1GHI A;  5CHU A;  2EFU A;  3BFG A;  3V67 A;  3EEA A;  5FQ9 A;  4EWF A;  2ZQ9 A;  1ONH A;  1KE4 A;  4K08 A;  1PWD A;  2Q9M A;  2ZQ7 A;  1W5D A;  4EES A;  3O88 A;  1S4S A;  3BEC A;  3FKW A;  4Y7P A;  4P87 A;  2XA7 S;  3MBZ A;  3F1N B;  4R0Q A;  1YPR A;  2Y59 A;  3WS1 A;  4R6L A;  2WZX A;  3UPO A;  5I5L A;  2V1A A;  1W63 Q;  4KG6 A;  3DWK A;  3PBN A;  3KO6 A;  5HL1 A;  2JKF A;  4KZ5 A;  1TDL A;  1YLZ A;  2ZM8 A;  3LUQ A;  3VFH A;  3CZD A;  3ISG A;  3R4K A;  4Z9Q A;  1PZO A;  5L8M A;  2WAE A;  2H10 A;  4JF5 A;  4CLC D;  2VGK A;  1XJ3 A;  4H6J A;  4E3O A;  3TSG A;  3NDE A;  5KIZ A;  4JF4 A;  4HIA A;  5FI6 A;  2XLN A;  5GHZ A;  2D02 A;  3RJU A;  2KX6 A;  4IED A;  1BUE A;  3HUN A;  1KOU A;  2Y2L A;  4U0X A;  3T4T A;  1LSW A;  5A8B A;  4IVK A;  1JTD A;  2VGL S;  5JYO A;  1YKD A;  2M1C A;  1OT6 A;  4PKY G;  4OLD A;  1K0K A;  4S2I A;  4YWZ A;  5FA7 A;  3JVV A;  3V5M A;  3SS3 A;  5F6A A;  2ZM0 A;  1T19 A;  3IWQ A;  4IJG A;  2WKR A;  1H8Z A;  3T1R A;  2ZC6 B;  2Y2G A;  4FH4 A;  5FQI A;  3V50 A;  3CHW P;  4CJN A;  2ZC4 B;  3N8R A;  3Q7V A;  3ZVT A;  1JNU A;  3DBA A;  1HLU P;  5AJG A;  3FV7 A;  3FC7 A;  1K38 A;  5FI2 A;  2R78 A;  3SOI A;  4LV3 A;  1L3L A;  4UQI M;  1ERQ A;  3RXW A;  4Y13 A;  3UN7 A;  4OOM A;  5AQ9 A;  3KSF A;  1KDS A;  3BFD A;  4HP9 A;  3UDI A;  1OTA A;  4WZ5 C;  1DJA A;  2QHK A;  3ZYT A;  5J8X A;  4GOG A;  1RGZ A;  2HJE A;  4HJ6 A;  4B4X A;  3S4X A;  1YAX A;  3LGO A;  4I3I A;  1LI0 A;  4WZ4 A;  1QMF A;  2GZA A;  3KSI A;  3CIT A;  4B4Z A;  2Z2L B;  3B42 A;  4ZTK A;  2HF6 A;  4UHU A;  5GLA A;  4WYY A;  3S22 A;  4JXS A;  3F1O B;  5CX7 A;  5CEB A;  4JXV A;  3HLB A;  1Z6F A;  3KYQ A;  2P04 A;  4PKY A;  2X71 A;  5IT5 A;  4QY6 A;  4Z1W A;  4HES A;  5D3O A;  3CAX A;  2ZQD A;  2W3F A;  3W4P A;  3CPT B;  1XJ4 A;  1EW0 A;  1OTD A;  5M18 A;  2PR5 A;  1NRF A;  5DKK A;  4EV4 A;  1BLS A;  4DE2 A;  2P08 A;  2XFT A;  4R38 A;  1MPL A;  5EEC A;  5EVI B;  4N9L A;  4LEN A;  1DP8 A;  4LGW A;  3Q82 A;  3EWK A;  4JGQ A;  5FSR A;  5DTK A;  3BY8 A;  4X53 A;  5HAR A;  4MMN A;  4PMA A;  3NC8 A;  3CG5 A;  3MSH A;  3LR3 A;  4EEP A;  3MKE A;  3CI6 A;  3F1P A;  5A93 A;  3OOV A;  3LIF A;  2PT7 A;  3IF6 B;  1M6K A;  5TGF A;  3JPU A;  1HZO A;  4X68 A;  3ICY A;  2P74 A;  1JWP A;  4OPR A;  4I3A A;  2QZ6 A;  2EX6 A;  1CI8 A;  3P09 A;  2DCF A;  5EV0 A;  5J7E A;  5DTT A;  1D7E A;  3UY6 A;  2L1M A;  2VV6 A;  4X56 A;  5HWT A;  2KOI A;  2NUP C;  4Y3I A;  3S7O A;  5F69 A;  3R7W B;  1W8Y A;  3AGF A;  5CTM A;  3G2Y A;  2E8J A;  3C30 A;  4L9G A;  2IWC A;  2BLS A;  5FQQ A;  1KE3 A;  3NI9 A;  4HH3 A;  2ZC3 B;  1Z09 A;  4DN0 A;  5CED A;  5CGX A;  3F1O A;  2XA7 M;  4HBT A;  2ZOH A;  4IUH A;  1NLZ A;  2L4R A;  4P6Z M;  5CGW A;  1SKO A;  5F83 A;  2H5S A;  1J3W A;  1VEU B;  5DTS A;  2RCX A;  1MWR A;  3MR0 A;  3NIA A;  4N1X A;  4MEZ A;  2UV0 E;  5F68 A;  1SKF A;  4H8R A;  2PU4 A;  3DAV A;  3FZC A;  3VV4 A;  1KDW A;  4CPK A;  3IXD A;  3LEQ A;  4E6X A;  2K2N A;  1DRM A;  4X1M A;  5A92 A;  3FKV A;  5DF7 A;  1K6R A;  4EQI A;  1P9R A;  2LB5 A;  2Y2J A;  3FPV A;  3MMH A;  2W1R A;  2XF3 A;  4KZ6 A;  5EM0 A;  5HD3 A;  1PW8 A;  4E04 A;  3C2W A;  2Y8H A;  1K56 A;  1NLY A;  4K91 A;  5MC7 A;  3VP3 A;  4HQA A;  5FEF A;  4E3L A;  1YLW A;  1IKG A;  5E2H A;  3T1X A;  5L09 A;  1HD8 A;  1TF1 A;  1FIL A;  3NHQ A;  1FCO A;  3LEZ A;  1WE4 A;  3IHA A;  3NJA A;  3Q7Z A;  1G6O A;  3HUM A;  4I5S A;  2O9A A;  1XFN A;  1BT5 A;  5EUA A;  4JLF A;  3IX3 A;  4WEL A;  2WGW B;  3LFV A;  3TW8 A;  2Z6D A;  1TS6 A;  3H82 A;  5FEG A;  4WN5 A;  2FFY A;  5CXW A;  1BLH A;  3UE1 A;  2WYX A;  3N6I A;  3PBQ A;  2XR0 A;  3HLC A;  4OON A;  4GCZ A;  1XPB A;  4PM5 A;  1VEU A;  4IUK A;  3PYP A;  2B5R A;  2DRW A;  4OKP A;  2I72 A;  4UA7 A;  3H7W A;  3G34 A;  3CMZ A;  2HJ9 C;  4NKP A;  5JYP A;  5KZH A;  3TOI A;  3DTE A;  4ME4 A;  4DRT A;  2VX8 A;  1H5X A;  1KGG A;  3GVB A;  4LFU A;  2XQZ A;  2WKE A;  1XP4 A;  1MWT A;  5EPH A;  2GX5 A;  2IWD A;  3A3E A;  3JVU A;  3M2K A;  3F1N A;  4CQH A;  4X55 A;  3QNC A;  4I39 A;  5IHV A;  2K7S A;  3VP1 A;  2ZMF A;  2QJ5 A;  2OAQ 1;  2PD7 A;  4ETX A;  3ZG0 A;  3DTM A;  5HFO A;  3V3R A;  3ITB A;  4EBP A;  1OPX A;  3KYE A;  1FCM A;  2VJW A;  1IOU A;  2JE5 A;  3UMD A;  3PTE A;  4WLA A;  5TBM A;  1GSV A;  1ONG A;  3N8L A;  5F82 A;  1GHP A;  1E3U D;  4IBX A;  5CER A;  2JKT M;  3LIA A;  4MLL A;  2FZ0 A;  3EGX C;  2A3U A;  4PM8 A;  4KG5 A;  3IS2 A;  4RX3 A;  1L0F A;  3HLE A;  3TJZ C;  3S7P A;  5HAQ A;  2ZL1 A;  2W3H A;  4KZ8 A;  4BMW A;  5HAI A;  4LV1 A;  3S7Q A;  5EVI D;  1XX2 A;  1CQA A;  1ES2 A;  1S4R A;  2A24 A;  1FSW A;  4E6W A;  1V9Z A;  3VE4 A;  2XH9 A;  3BEB A;  1PRQ A;  3K3C A;  4GHI B;  1W7F A;  5AQ7 A;  2GNX A;  1SZV A;  4U0T A;  1ZHH B;  4EBL A;  3UB5 P;  2ZMV A;  2VGL M;  2C6W B;  1K55 A;  3S7N A;  2BG1 A;  4U3T A;  3UPN A;  3HJI A;  1W8Q A;  3VFF A;  2XK1 A;  3BFE A;  3U4L P;  2WKQ A;  5HDD A;  4Y17 A;  5M19 A;  3T4K A;  2ZM2 A;  4YIN A;  4A5R A;  2OV5 A;  2OWJ A;  3IWO A;  1LT0 A;  4R3A A;  1PWG A;  2MJ6 A;  4P85 A;  1CEF A;  3FG8 A;  4DMZ A;  2VA0 A;  1N9N A;  4JKT A;  4E3J A;  3DWZ A;  4MBH A;  3E2L A;  1YMX A;  4ARZ A;  2WUQ A;  1K55 C;  4LV2 A;  1H3Q A;  2W1T A;  1OJ5 A;  2OSU A;  2YKF A;  1TD5 A;  4HH2 A;  1N9O A;  2V9A A;  4WZ5 A;  1OTI A;  4LCL A;  4FD8 A;  2HP9 A;  1CK3 A;  4JGR A;  2VV8 A;  4MBK A;  4BBV A;  3VP2 A;  2CMN A;  1ALQ A;  4L0L A;  4YOF A;  1BLC A;  4JBF A;  5HW3 A;  5J4E A;  4ESP A;  4BL3 A;  2G7U A;  4NXB A;  1BLP A;  4LRZ E;  2Y55 A;  4Y5F A;  2J9P A;  3UE0 A;  5AQA A;  4KZA A;  1F9I A;  3EQV A;  2W27 A;  1XGJ A;  1T1A A;  3KYZ A;  2XSS A;  2JHE A;  3PR6 A;  3P7N A;  3GEC A;  3MS6 A;  3G4P A;  3WS5 A;  1LLB A;  3UME A;  3G31 A;  3HL9 A;  4R4R A;  1KVM A;  1ESI A;  5DFY A;  3B47 A;  4E3M A;  4ETZ A;  1M40 A;  1G6A A;  1ERM A;  1UWN X;  4C6Y A;  2EX2 A;  2V8C A;  3LR4 A;  1XJ6 A;  5BOH A;  4NXE A;  5FDS A;  2W3E A;  2CC1 A;  1ES5 A;  3R7W A;  5C5K A;  4BWI A;  3IH8 A;  4ARZ B;  5E2F A;  1E4D A;  3TRC A;  2O9C A;  2NUT C;  3QP2 A;  1P0Z A;  3N4I A;  2HV1 A;  3C8C A;  1BYW A;  4GDN A;  4QJG A;  4G3K A;  1DP9 A;  4X25 A;  1IYO A;  2V8F A;  4OPZ A;  4KUK A;  1KGF A;  4IVI A;  3A0V A;  3A3I A;  3HBR A;  5K5B A;  3B33 A;  3K3D A;  5DVA A;  3LR0 A;  4FCF A;  2EX8 A;  4QY5 A;  4HJ4 A;  4S2L A;  3IF6 A;  2O99 A;  1OT9 A;  3S1Y A;  1BSG A;  3ZDJ A;  3E2K A;  3D72 A;  1YT4 A;  5FL3 A;  4EW7 A;  5E2E A;  1YMS A;  3IX8 A;  3ULF A;  1GHM A;  5EVI C;  4NXF A;  5DJU A;  1K54 A;  4OQH A;  2EWW A;  4RQ9 A;  4O0P A;  4N9K A;  2KDK A;  3ZVW A;  3NDG A;  3IXG A;  1ZG4 A;  3QP4 A;  3LCE A;  4Y0U A;  4ZJ2 A;  4JGO A;  3Q81 A;  1SHV A;  3KSH A;  4MN7 A;  1CI9 A;  2WAD A;  4JF6 A;  1XA7 A;  1XA1 A;  4GD8 A;  4I38 A;  3CWF A;  3A0R A;  4BJP A;  4WF0 A;  4KQD A;  3T1Q B;  3BYD A;  3WWX A;  1VET B;  5KSC A;  3VOL A;  3MZD A;  4YFM A;  1EWZ A;  3H82 B;  4S2P A;  1XFQ A;  1U60 A;  4EET B;  2INW A;  4FH2 A;  2EWV A;  3HRE A;  4HNB A;  2Q0O A;  4KEN B;  5AVF A;  3PXP A;  5GLC A;  3SS5 A;  3NOU C;  1FR1 A;  4OQG A;  2Y2K A;  4MNR A;  4D60 A;  1NYY A;  4F3L B;  2XD1 A;  5A91 A;  4WMC D;  1GA0 A;  4KZ9 A;  2Y2N A;  5HDC A;  3P98 A;  1PFL A;  3DTK A;  5CGS A;  1IYQ A;  1ESU A;  1IEM A;  5FAO A;  4WBG A;  2QWS A;  4CLC B;  2ZOI A;  4GDB A;  4BLM A;  3LY4 A;  1LHY A;  5HL6 A;  2HDQ A;  2JN7 A;  2W0N A;  3ZG9 B;  2W3G A;  5GHY A;  4DDS A;  3SW1 A;  3BM6 A;  3BY9 A;  5DFX A;  4RA7 A;  2H0T A;  4OH0 A;  1S1Y A;  4PM9 A;  4GB7 A;  2W1T B;  2VLG A;  5FAQ A;  1DJC A;  4X69 A;  1NJ4 A;  1C3B A;  2PYR A;  4S2N C;  2V1Z A;  3KX0 X;  1K54 C;  4KZ7 A;  3G35 A;  3HLF A;  5CTN A;  1P9W A;  3U2A A;  1Q2P A;  1YSP A;  2VEA A;  3LI9 A;  2M7V A;  1K56 D;  5DF8 A;  4JXW A;  3JYI A;  4O01 A;  2Y79 A;  3IH9 A;  2YKH A;  1TDG A;  5EOE A;  1H0M A;  4DE1 A;  1MY8 A;  2Y4A A;  3CUE A;  2HPB A;  2P7J A;  5CEC A;  2XD5 A;  3W8K A;  4MBF A;  3Q7V B;  1JWV A;  5HSQ A;  1HTZ A;  1PYY A;  1FOF A;  1F98 A;  2VZW A;  3MJQ A;  5F1G A;  4JXG A;  2ZBB A;  2WGW A;  4DE0 A;  5FDH A;  4KUO A;  4GLQ A;  2R9X A;  3T12 B;  2WKP A;  1FR6 A;  3SH7 A;  3LI8 A;  4CLC C;  2D01 A;  1T1B A;  3N8S A;  4LLO B;  4PAU A;  1SDN A;  2QJ7 A;  2PYP A;  2VKS A;  2ZL1 B;  4DXC A;  2XGN A;  3ZHH A;  3HLD A;  5GLB A;  4P0M A;  3GTC A;  4LCM A;  4FSF A;  4LRX C;  4MDZ A;  4Y0T A;  4CLC E;  5E43 A;  3MFD A;  1ZG6 A;  3IBR A;  5DF9 A;  3E4O A;  3IT9 A;  3HCY A;  4NG2 A;  4MN5 A;  2Y2P A;  4S2K A;  4GZB A;  3TG9 A;  1T18 A;  3BQ8 A;  4XUZ A;  2EFX A;  1KVL A;  3UB6 A;  1DP6 A;  4KZ3 A;  4FOF A;  1S66 L;  3O87 A;  3NBL A;  4MN6 A;  5TJJ A;  4M3K A;  2V2F F;  4ZRR A;  3CPT A;  1L2S A;  4HHD A;  3NY4 A;  4S2M A;  1GCE A;  4OQI A;  2EXA A;  4Y15 A;  4BL2 A;  1VQQ A;  1S6R A;  2X01 A;  1NRJ A;  1TS0 A;  1BZA A;  5HPF A;  3PBS A;  3NCK A;  3WS0 A;  3H9W A;  1UGU A;  5EE8 A;  1K57 C;  5EVI A;  3MXQ A;  5L07 A;  4OPY A;  3T4Q A;  2J9O A; 
#chains in the Genus database with same CATH homology
 2MJ6 A;  3UE3 A;  3PBO A;  3FG8 A;  4Y2F A;  1YAX A;  4DMZ A;  5KSH A;  1N9L A;  4I3I A;  2VA0 A;  1W63 M;  2GZA A;  3KSI A;  5HWW A;  1N9N A;  4B93 A;  3CIT A;  1D06 A;  5J3W A;  3B42 A;  2HF6 A;  3EGD C;  3MQ0 A;  4L9F A;  3MFX A;  4ARZ A;  1MZU A;  4NXG A;  4WEK A;  3F1O B;  5CX7 A;  4EQ1 A;  1H3Q A;  4Q0I A;  2W1T A;  1OJ5 A;  2YKF A;  3KYQ A;  2P04 A;  1TD5 A;  4PKY A;  4HH2 A;  1N9O A;  4UEY A;  2B18 A;  5IT5 A;  2V9A A;  1OTB A;  1OTI A;  2JKR I;  4Z1W A;  4GHI A;  4UQI S;  4GS9 A;  3CAX A;  4JGR A;  2VV8 A;  2JKT I;  4BBV A;  2CMN A;  3MF0 A;  4L0L A;  2W3F A;  4YOF A;  5J4E A;  1VB6 A;  1XJ4 A;  1OTD A;  1EW0 A;  4R70 A;  3T4S A;  2EA9 A;  2PR5 A;  2G7U A;  4NXB A;  5G4Z A;  4LRZ E;  3KSG A;  2JKR M;  5DKK A;  1VHM A;  1S1Z A;  4Y5F A;  1ZTU A;  3P01 A;  2P08 A;  4R38 A;  1F9I A;  4EEU A;  3EQV A;  2W27 A;  1DP8 A;  2W3D A;  1T1A A;  2L0W A;  1YSQ A;  2XSS A;  3KYZ A;  3EEH A;  3EWK A;  4JGQ A;  3BY8 A;  2JHE A;  3NOP C;  4EXO A;  3PR6 A;  5IU1 A;  4MMN A;  3P7N A;  3GEC A;  2LB9 A;  3MQQ A;  1LL8 A;  3LR3 A;  2PR6 A;  3T4J A;  2J3T D;  4EEP A;  3CI6 A;  3UME A;  3F1P A;  1H8M A;  5DJT A;  3OOV A;  2M7U A;  2GJ3 A;  3LIF A;  5DFY A;  3B47 A;  2PT7 A;  4ETZ A;  2PDR A;  3ICY A;  2OAP 1;  3UE6 A;  1UWN X;  3LIE A;  3LR4 A;  1XJ6 A;  4YNR A;  5HZH A;  4I3A A;  3O5Y A;  4NXE A;  2W3E A;  3R7W A;  2I9V A;  5C5K A;  4BWI A;  5J7E A;  4ARZ B;  1D7E A;  3TRC A;  3UB7 A;  2L1M A;  1GSX A;  2O9C A;  2NUT C;  2VV6 A;  3HJK A;  4BBT A;  5HWT A;  4MCW A;  2KOI A;  2Z6C A;  2NUP C;  4Y3I A;  3S7O A;  1P0Z A;  5F69 A;  3R7W B;  2HV1 A;  3C8C A;  1BYW A;  4DJ2 A;  1MKM A;  3BJN A;  1LSX A;  4G3K A;  1DP9 A;  3C30 A;  4L9G A;  4HH3 A;  4KUK A;  3OLO A;  4H6J B;  4OOL A;  3A0V A;  1F5M A;  4DN0 A;  3F1O A;  2XA7 M;  4IUH A;  2ZOH A;  5LBR A;  2KLI A;  1NLZ A;  2L4R A;  4P6Z M;  2XRO A;  5K5B A;  3B33 A;  3K3D A;  5HD5 A;  3LR0 A;  3MR0 A;  4HJ4 A;  5F68 A;  2O99 A;  1OT9 A;  3CUE C;  5F5Y A;  3E4Q A;  3OCN A;  3VV4 A;  4XT2 A;  3D72 A;  5FL3 A;  4EW7 A;  2O9B A;  2K2N A;  3K2N A;  1DRM A;  3ULF A;  1WA9 A;  1P9R A;  2LB5 A;  4NXF A;  3CLO A;  3OBF A;  3NOT C;  5DJU A;  3ZQ5 A;  2EWW A;  4RQ9 A;  4O0P A;  2KDK A;  4LPZ A;  2XRN A;  3FPV A;  3MMH A;  5AVE A;  2W1R A;  3E4P A;  4JGO A;  5HD3 A;  3T50 A;  3E0Y A;  4M4X A;  3IS2 B;  4E04 A;  3KSH A;  4MN7 A;  3C2W A;  2Y8H A;  2V1B A;  4GS9 B;  4I38 A;  1NLY A;  3CWF A;  3A0R A;  3BW6 A;  4BJP A;  5MC7 A;  4HQA A;  1P97 A;  2FH5 A;  4KQD A;  4WF0 A;  4II7 A;  2O0Y A;  3VOL A;  3PBT A;  3H82 B;  4O8G A;  4NEE D;  1XFQ A;  4EET B;  3G6O A;  1TF1 A;  2INW A;  5HDS A;  4P6Z S;  3UB9 A;  3NHQ A;  2EWV A;  4AFI A;  4HNB A;  2PD8 A;  3W2Z A;  3NJA A;  3EQU A;  5AVF A;  1MC0 A;  1G6O A;  3PXP A;  4I5S A;  3NOU C;  2O9A A;  4EU0 A;  1XFN A;  1X0O A;  1G28 A;  2A24 B;  4HOI A;  3F1P B;  4CLC A;  3PHY A;  3T4L A;  3OCL A;  2BAS A;  2VV7 A;  4WEL A;  3GDI A;  4G3V A;  5TBM B;  4F3L B;  3LFV A;  4WEJ A;  1TS7 A;  4WUJ A;  3TW8 A;  2Z6D A;  1TS6 A;  3H82 A;  4WN5 A;  4HP4 A;  3E98 A;  4WL9 A;  3RFB A;  5HDC A;  3LID A;  2PHY A;  2HGV A;  2QYB A;  3EOI A;  3LYX A;  1NWZ A;  3VE3 A;  4BBU A;  1ODV A;  1S67 L;  1IFQ A;  3PBQ A;  2H28 A;  4EUV A;  1UWP X;  4GCZ A;  5HWV A;  2QKP A;  4I3J A;  4IUK A;  2QWS A;  3PYP A;  4CLC B;  2ZOI A;  1T1C A;  1Y28 A;  2V0U A;  1STZ A;  3TE8 A;  2B02 A;  3LIC A;  5HL6 A;  2JN7 A;  1LSV A;  2W0N A;  3BQA A;  2W3G A;  3H7W B;  3BWL A;  3SW1 A;  3MQO A;  3UB8 A;  3BY9 A;  5DFX A;  3IBJ A;  1GSW A;  5EFW A;  2V0W A;  4HI4 A;  3H7W A;  2HJ9 C;  1S1Y A;  4NKP A;  3V67 A;  2W1T B;  2VLG A;  4ME4 A;  2VX8 A;  3EEA A;  1XJ2 A;  2DMW A;  2PYR A;  3KX0 X;  2J3T C;  2GX5 A;  4K08 A;  3JVU A;  3A0S A;  4CQH A;  2J80 A;  3F1N A;  4EES A;  1P9W A;  5DKL A;  3U2A A;  1S4S A;  4Q0J A;  1YSP A;  4I39 A;  2VEA A;  4B9O A;  3LI9 A;  2XA7 S;  2M7V A;  2K7S A;  3F1N B;  2ZMF A;  4QPR A;  4EER A;  2QJ5 A;  4O01 A;  2Y79 A;  4R6L A;  2OAQ 1;  2PD7 A;  2YKH A;  4ETX A;  3LIB A;  5I5L A;  3CUE A;  3RTY A;  1V9Y A;  2V1A A;  2IA2 A;  1W63 Q;  2P7J A;  1OPX A;  3PBN A;  2J3W A;  3KO6 A;  3C38 A;  2K31 A;  3LUQ A;  2VJW A;  4DJ3 A;  1IOU A;  5HSQ A;  2VZW A;  1F98 A;  3R4K A;  3MJQ A;  3UMD A;  5G4Y A;  5L8M A;  2ZBB A;  4WLA A;  5HPI A;  5TBM A;  1GSV A;  2OOL A;  4CLC D;  4KUO A;  4GLQ A;  1XJ3 A;  4H6J A;  2WKP A;  3LI8 A;  4CLC C;  2JKT M;  2D01 A;  5KIZ A;  3LIA A;  4HIA A;  2FZ0 A;  1T1B A;  3EGX C;  4LLO B;  4G3W A;  4PAU A;  4KQO A;  2QJ7 A;  2PYP A;  2VKS A;  4XT2 B;  3OC2 A;  2D02 A;  3IS2 A;  2KX6 A;  3RH8 B;  1KOU A;  3TJZ C;  3S7P A;  3T4T A;  1LSW A;  4FSF A;  4IHQ A;  5A8B A;  2W3H A;  4LRX C;  2VGL S;  4BMW A;  1YKD A;  4MDZ A;  2M1C A;  4HJ3 A;  1OT6 A;  3S7Q A;  4PKY G;  4CLC E;  3IBR A;  4YWZ A;  4L9E A;  5DF9 A;  3E4O A;  3JVV A;  4PHT A;  5F6A A;  1S4R A;  3HCY A;  2A24 A;  4MN5 A;  3FPW A;  1V9Z A;  3VE4 A;  1T19 A;  1T18 A;  3BQ8 A;  4IJG A;  2WKR A;  4Q0H A;  3K3C A;  4GHI B;  3UB6 A;  1DP6 A;  2OWH A;  2GNX A;  4FOF A;  1S66 L;  1ZHH B;  1OJG A;  1JNU A;  4GW9 A;  4MN6 A;  2ZMV A;  5TJJ A;  2VGL M;  1OTE A;  3T4O A;  3DBA A;  4LRY C;  4ZRR A;  4GJ4 A;  3S7N A;  2A2L A;  5AJG A;  3FC7 A;  4HHD A;  2R78 A;  4UQI M;  3HJI A;  4F3L A;  3D3O A;  1NRJ A;  1TS0 A;  4OOM A;  3LR5 A;  5IS1 A;  3KSF A;  4HP9 A;  3PBR A;  5HPF A;  2WKQ A;  5HDD A;  3PBS A;  3T4K A;  1OTA A;  1UGU A;  3H9W A;  3MXQ A;  4JGP A;  2QHK A;  3ZYT A;  2OWJ A;  1LT0 A;  2HJE A;  4R3A A;  3T4Q A;  1TS8 A;  4HJ6 A;  4HY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...