3MQOA

The crystal structure of the pas domain in complex with isopropanol of a transcriptional regulator in the luxr family from burkholderia thailandensis to 1.7a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
113
structure length
113
Chain Sequence
IDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, LuxR family
publication title The Crystal Structure of the PAS domain in complex with isopropanol of a Transcriptional Regulator in the LuxR family from Burkholderia thailandensis to 1.7A
rcsb
source organism Burkholderia thailandensis
molecule tags Transcription regulator
total genus 28
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3mqoA00
3LIBA 5F69A 3UB8A 2YKFA 2VV6A 5DJTA 4GHIA 1MZUA 4I5SA 4PKYG 4WF0A 3BY9A 5G4ZA 1UWNX 4HJ4A 3BY8A 4MN6A 3NOTC 4HHDA 4I3JA 5HDDA 4KQDA 5F6AA 2D01A 2R78A 2INWA 2QJ5A 2W27A 1DRMA 2BASA 2KDKA 3CWFA 2M1CA 1OTBA 5DKKA 5HDCA 1N9LA 2JHEA 4EXOA 4R38A 5DKLA 4RQ9A 2VV8A 4EW7A 1ODVA 3C2WA 4NXGA 1XJ4A 5HSQA 3F1OA 1OJGA 3H82A 4KUKA 4NXEA 2PDRA 2QKPA 2V0WA 1VB6A 1OTAA 4DJ3A 3VOLA 1GSVA 3UMDA 4KUOA 5AVEA 4XT2A 3MR0A 5A8BA 3MJQA 4H6JB 3UE6A 3UB9A 3RH8B 4R70A 5HDSA 4MN5A 1DP8A 3FC7A 3MQQA 4L9GA 2QJ7A 3CAXA 2I9VA 4M4XA 4HOIA 2OOLA 2ZOIA 4EESA 3E4OA 1D06A 3H9WA 3OLOA 1N9OA 4R3AA 5HD3A 3T50A 3UB7A 1TS6A 3GDIA 1GSWA 1S1YA 2PYPA 4HIAA 1OTDA 3EWKA 3UB6A 1S66L 4EERA 4GS9A 2VEAA 1XFQA 3LIAA 4WUJA 1JNUA 1OTIA 1S4SA 4I39A 5HZHA 3IS2A 1T18A 5HD5A 1D7EA 4L9EA 3NOUC 4JGRA 1UGUA 2A24B 2EA9A 5F68A 2VLGA 3ULFA 4BBTA 4F3LB 1LT0A 5TBMA 1UWPX 1N9NA 4WLAA 4LRZE 4HP4A 5IU1A 4WL9A 4EEUA 3H7WB 2HV1A 1X0OA 2PHYA 1P97A 1XJ6A 4NXBA 4GW9A 3F1NB 4HJ6A 1TS8A 4HJ3A 1OT6A 3F1PA 1WA9A 3LUQA 4I38A 3MQOA 4L9FA 3KX0X 3HJIA 1F98A 3FG8A 1V9ZA 3EEHA 4GHIB 3A0SA 4HQAA 4K08A 1S1ZA 4JGPA 2VV7A 1F9IA 4HH2A 3ZQ5A 3MXQA 3LI8A 4HI4A 1T1BA 2KX6A 3K3DA 4LPZA 2OWHA 2PYRA 3P7NA 3UMEA 2V9AA 1BYWA 2PD7A 4E04A 1G28A 2CMNA 2YKHA 5HWVA 2PD8A 2QWSA 5IS1A 3CLOA 5I5LA 1TS7A 2QHKA 1V9YA 4LRYC 1DP9A 1LSVA 5J7EA 4GCZA 3NJAA 3BWLA 3SW1A 3GECA 3A0RA 1T1CA 1S67L 2L4RA 3LIFA 4HP9A 2L1MA 4I3IA 2ZBBA 4DJ2A 3F1OB 3H82B 2ZOHA 4YWZA 1LSWA 2PR6A 2K7SA 4EETB 1GSXA 1LSXA 4XT2B 3RTYA 2V1BA 4H6JA 1P0ZA 5HWTA 4JGQA 5J3WA 1T1AA 1S4RA 2D02A 3PYPA 4I3AA 3C8CA 1T19A 2Z6CA 2V1AA 4BBUA 2JN7A 5EFWA 2L0WA 1NWZA 4HNBA 4PKYA 3LICA 1DP6A 5F5YA 1EW0A 2OWJA 3E4PA 4WN5A 2V0UA 3A0VA 3NOPC 4LLOB 5J4EA 3LI9A 3PHYA 5AVFA 5KIZA 3ICYA 4GS9B 1XFNA 1XJ2A 2WKQA 5DJUA 3VE4A 4JGOA 2J80A 4HY8A 1KOUA 1TS0A 3IS2B 3E4QA 5HWWA 3LIDA 2PR5A 1OJ5A 1Y28A 3G6OA 2A24A 3LYXA 2W0NA 2Z6DA 1OTEA 3VE3A 4EQ1A 5G4YA 3LIEA 4B9OA 4BBVA 4F3LA 4LRXC 4NXFA 2P7JA 2WKPA 2WKRA 3MFXA 3HJKA 5TBMB 2B02A 1OT9A 3K3CA 3D72A 3IBRA 1XJ3A 3H7WA 2GJ3A 3NHQA 4EEPA 3F1NA 1LL8A 2H28A 3B33A 4HH3A 4R6LA 3F1PB
chains in the Genus database with same CATH superfamily
1NLYA 1ALQA 1YM1A 1K6RA 5FA7A 3IXGA 4DE1A 5KMWA 3S4XA 4UA7A 1BT5A 4WYYA 2ZC7A 2YKFA 2P04A 2BTFP 2ZM0A 1ES5A 2VV6A 3GRJA 5DJTA 4P0MA 1DJBA 4BL3A 2ZM8A 3BY9A 3BY8A 2KOIA 2H10A 4E3KA 4HHDA 5FAOA 3IF6C 5FEFA 4B93A 4QD4A 4KQDA 5F6AA 2M7UA 4E6WA 2WZXA 2M7VA 3O86A 2INWA 2W3GA 2QJ5A 2W27A 4BJPA 1VETB 1PZOA 4UA9A 1DRMA 5A92A 2KDKA 4CLCD 3VP2A 3BLMA 1M40A 5DKKA 1YSPA 3ZG8B 4MEZA 5D3OA 3LR0A 5DKLA 2Y2HA 4EW7A 1I2WA 3AGDA 1KE3A 1A0KA 1FQGA 1XJ4A 2O99A 1ZG4A 4NXEA 2XD1A 4YNRA 4DJ3A 3JPUA 5EVIA 1GSVA 2H0TA 4KQOA 4KUOA 4O0PA 1KE4A 4X6TA 2JBFA 1VM1A 4N1XA 1YT4A 5HDSA 3FPWA 1S0WA 4P6BA 3BECA 2XFTA 1PI5A 4DDYA 5EV0A 4DF6A 2G2UA 3CUEA 4XXRA 3CAXA 2HPBA 3G2ZA 5L2FA 2X01A 2V20A 3ZG7B 3T4SA 1D06A 4IBRA 4QJGA 3VSKA 5JYPA 2HDQA 5HD3A 4KG5A 1Z09A 3LGOA 1IEMA 1TS6A 3T4OA 3MF0A 2K2NA 2W1TB 1C3BA 2PYPA 5EECA 3MFDA 3EWKA 2X71A 3IQAA 4P87A 1OPXA 5FL3A 3T12B 3G32A 1GHPA 2WADA 3QP6A 4KQRA 4C6YA 1LHYA 5CGXA 3S7PA 5DF7A 1BLPA 4KENB 5HZHA 4HBTA 1NZOA 2A49A 5DFYA 1CF0A 4G3WA 3R4KA 2VGKA 3NOUC 3IXBA 3KSFA 3UDIA 4JF5A 3CUEC 4RVAA 4YINA 4JXVA 4IEDA 3BQ8A 3A3IA 3MS6A 3E2KA 4F3LB 3A3DA 1SKFA 3TW8A 5F82A 2WUQA 1TEMA 5CRFA 4FUWA 2V8FA 4WL9A 5EPHA 4R23A 1P97A 2AVXA 4NXBA 2E8IA 3L9KA 1PYYA 1TS8A 2BG1A 4PM9A 4I38A 1TDGA 3MQOA 4KG2A 1BLHA 4KZ6A 1ZKJA 3M6BA 3C38A 2XD5A 1S1ZA 3IX8A 4MLLA 3MZFA 5EOEA 5JYOA 3LI8A 5A90A 4X55A 4Y13A 1T1BA 3LR5A 4LCLA 4LPZA 2OWHA 2VGLS 3P7NA 1VETA 5CHMA 4HESA 5K5BA 3RFBA 3PBSA 4E04A 3KYQA 4E6XA 1MWTA 1MKMA 2Y2MA 1D1JA 1EI5A 3BJNA 2YKHA 1I2SA 5HWVA 2PD8A 2QWSA 1PRQA 1K4EA 5L8MA 3CLOA 2EWWA 1Q2PA 4OONA 1TS7A 2ZQCA 2J8YA 2Y2LA 1V9YA 5J7EA 1SDEA 4BQMA 2Y2KA 4X69A 3BWLA 3Q1FA 4MN7A 2XA7M 2EFXA 1HD8A 3F1OB 2ZOHA 3QHYA 3IHBA 4K0XA 3G35A 4QHCA 2J3TD 3VP3A 2ZC5B 3N8RA 1LSXA 5AQ7A 3KSGA 5FSRA 3RTYA 4DMZA 3HLGA 2V1BA 1P0ZA 1XGIA 5HWTA 5EM1A 4MMNA 4ZTKA 4BD0A 5GHXA 1S4RA 1JTDA 1LL5A 4DXBA 4RYEA 3HUOA 3Q07A 1NY0A 2PRFA 4O01A 1T19A 3DTEA 2Z6CA 1CJFA 4BBUA 1IYPA 1SKOB 3SS3A 4HNBA 4MDZA 3DTIA 5DTSA 3LICA 3OCNA 3R7WB 1TDLA 3KSHA 2E8JA 3M2KA 4WEJA 4LCMA 5F5YA 1ERQA 2V1ZA 2WYXA 2W1TA 3A0VA 3NOPC 1KVLA 4EWFA 4A5RA 5FAQA 4GN2A 3LI9A 4UEYA 4E3IA 4GS9B 5DJUA 3VE4A 1FR1A 4WMCD 5LBRA 3EEAA 2J80A 1CI9A 2O9CA 5KSCA 3DW0A 1S6RA 4GD8A 3QP4A 3IS2B 3LIDA 2HJEA 1OMEA 3S22A 3G6OA 5AJGA 3EQUA 4KQQA 2Z6DA 4OQ0A 4FH2A 3CHWP 3ZVTA 4F3LA 4LRXC 2WAFA 3G34A 4Q0IA 2WKRA 3PBNA 2GNXA 5GLDA 1JWVA 2UWXA 4OLDA 4ESPA 3K3CA 5BOHA 3D72A 3VP1A 4DDSA 5FDSA 4KZBA 1PWGA 1CI8A 4Y2FA 1K0KA 2P9VA 1P9RA 4HH3A 5C5KA 3E2LA 3T4QA 4KZ8A 4N1HA 2ZQDA 1MZUA 3BFEA 2ZMVA 4G3VA 4ID4A 1Y54A 4R0QA 5FASA 1NLZA 4CLCB 3A3EA 3T4JA 5HDDA 3ZG9B 3ISGA 5E2FA 3DWKA 1YKDA 3O3VA 2D01A 1K57A 3WRZA 3W8KA 3D3OA 4S2IA 1QMEA 3QP5A 3HLWA 3NDEA 2BASA 1IYSA 2M1CA 2VK3A 3IHAA 3FPVA 2XK1A 2JC7A 3HCYA 4R4SA 5HDCA 1TVFA 4HEFA 4Z9QA 4EXOA 1BUEA 2LB5A 2VGJA 3ITBA 1L2SA 3OCLA 3C2WA 3DBAA 3CI6A 4EBNA 1IELA 2XGNA 2XFSA 1ES3A 3WS0A 5DTTA 3F1OA 1OJGA 3G31A 4WEKA 1AWIA 2QKPA 3WS4A 3CPTB 1VB6A 3CG5A 1KE0A 3VOLA 4O7DA 2VZWA 4MCWA 5AVEA 4BMWA 3Q7VB 4H6JB 3RXXA 2WKIA 3RH8B 1K57C 4DN0A 2ZC3B 2Y2GA 5E2HA 3EGXC 1FSWA 4MN5A 3ZNYA 1WYBA 4OOLA 3E98A 5FQKA 1XA7A 2P74A 4ME4A 3SH7A 3T1RA 4JBFA 4NK3A 3T4LA 1SKOA 4M4XA 5GLCA 1G68A 1GA9A 2ZOIA 3EQVA 4OPRA 3R7WA 3ZVWA 4MNRA 3E4OA 1O07A 3OLOA 3IH9A 3PTEA 3T50A 3OPHA 3VOZA 2ZL1B 4OOMA 1F5MA 3GDIA 4ZJ1A 1S1YA 4WZ5A 4M3KA 2Q9NA 2MJ6A 4HIAA 1N9BA 1NZUA 1OTDA 5GHYA 2HGVA 3T4KA 2Y2QA 2PBYA 4GS9A 2HZ5A 3QP2A 1BZAA 3TSGA 1MWUA 1F2KA 4P6ZM 3G2YA 4Y15A 2C5WB 1OTIA 4XUXA 3IS2A 4GB7A 2G2WA 2CC1A 3SH9A 5HPFA 4KZ4A 2FZ0A 3BYDA 4JGRA 1UGUA 1WYCA 2A24B 1K55A 1FCNA 1K38A 5E43A 3I7JA 1KGFA 4LV1A 2JKGA 2Y79A 4ARZB 1N9NA 4MBFA 1ES2A 1XP4A 4LRZE 4JKTA 4EEUA 3NCKA 1XGJA 4E3NA 1XJ6A 4KZ7A 4GW9A 4HJ6A 4HJ3A 4MBHA 4EQIA 3N8SA 4N92A 4PAUA 1RGZA 3SOIA 4UQIM 5FQJA 4WZ4A 4O8GA 3B42A 4GHIB 4Z1WA 4QU3A 1VHMA 4R1GA 4HQAA 3FV7A 4JGPA 2J9PA 3JVVA 2HP5A 3BM6A 3PAGA 4EV4A 5L09A 3GVBA 1FR6A 1J3WA 3K3DA 2PYRA 3UDFA 3ZFZA 3UY6A 2IWCA 3RJUA 5TJJA 2PD7A 3LCEA 5FEGA 4LENA 2CMNA 5DVAA 2WK0A 1ZTUA 1FCOA 1PFLA 3BRMA 3N4IA 3MMHA 2ACGA 5GLAA 2Y8HA 4B4ZA 4PPRA 4JLFA 4N9LA 3KSIA 1FOFA 4X1MA 3NJAA 2DCFA 3QP1A 3SW1A 5EVIC 3GECA 4Y5FA 1S67L 3LIFA 2W3EA 4I3IA 2XR0A 3T1QB 3BQAA 4FH4A 3RXWA 4YWZA 3T1SA 3CPTA 2A2LA 4LFUA 4PMAA 3M2JA 5FATA 1MXOA 5AQAA 4ZBEA 4XT2B 3B3XA 3OBFA 5GHZA 3Q7VA 4H6JA 3LEZA 2J7VA 4LGWA 1MWSA 2PU2A 1SDNA 3IBJA 2B95A 3V50A 2EXBA 4R3JA 3VFFA 3PYPA 1E3UD 4CQHA 4FOFA 5HX9A 1K54A 1PIOA 2L0WA 2H5SA 2HDRA 3NULA 4X68A 2B18A 4G3KA 1DP6A 2HP9A 2ZL1A 3BW6A 2OAP1 4JXSA 3HBRA 1XKZA 4FTXA 4C3QA 5J4EA 2QZ6A 2PAVP 5HFOA 3ICYA 4WM9A 3D9YA 1XFNA 4JGOA 1ZHHB 4OPZA 3DAVA 3NIAA 4HY8A 4NG2A 4QWOA 3VMAA 1KOUA 3FYZA 5HPIA 3GV9A 3MQ0A 1H8YA 2Z2LB 3E4QA 5HWWA 3HLCA 5M18A 1Y28A 3PR6A 4S2KA 2A24A 2W0NA 3S7QA 2H0YA 3LIEA 3BFCA 2PT7A 3SS4A 1FCMA 2JKTI 3MSHA 2WKPA 4OQIA 3P01A 4ARZA 5AQBA 2ZMAA 5A93A 2B02A 1OT9A 3EOIA 3DTKA 5CTMA 1YPRA 2WGVA 5J8XA 3UE3A 3T4TA 1JVJA 4IUHA 2QPNA 3M6HA 1W8QA 2H28A 3B33A 4PM5A 2JKRM 4R6LA 3ZG0A 3GMWA 3CZDA 4OPQA 1XXMA 3LIBA 4GJ4A 1BULA 5F69A 2GDNA 1W5DA 3UNWA 3AGFA 1KDSA 3UB8A 3VP4A 3W4PA 4GHIA 3HL9A 5TFQA 4I5SA 4RX2A 4R4RA 3VOYA 3WWXA 4PKYG 5G4ZA 1UWNX 4GKUA 4HJ4A 4MN6A 3NOTC 4EU0A 1K4FA 3Q7ZA 4EUZA 4Y17A 3NY4A 3GR2A 2ZQ7A 3WS1A 2OAQ1 3UPPA 3IF6B 1XPBA 1OTBA 3V39A 1MPLA 5U47A 1N9LA 3Q81A 2JHEA 4KG6A 4NKPA 3HLEA 3Q82A 4IUKA 5HW3A 2VV8A 2XROA 3LO7A 4ZAMA 1ODVA 2WKEA 5F1GA 4BENA 4HBUA 4B88A 2PU4A 1PW1A 2XA7S 5IHVA 5HSQA 2PBDP 1VQQA 4DE0A 2V0WA 3HLDA 1OTAA 4DKIA 3UMDA 2WKHA 1NRJA 4XT2A 3MR0A 2HP6A 3MZDA 4UAAA 5A8BA 3MJQA 3UE6A 2KLIA 3KO6A 2C6WB 4OQHA 4S2MA 2OLVA 4OP8A 4S2OA 3FC7A 3IX4A 4MBKA 1YQSA 1IKIA 1G5UA 3NI9A 2W1RA 2RL3A 3UB5P 2QJ7A 1M6KA 2GX5A 4HOIA 2OOLA 3P98A 3LFVA 4EESA 4YFMA 4OPYA 1N9OA 3MKFA 5EVEA 4GD6A 4WBGA 4R3AA 5CXWA 1MWRA 3C7UA 4WMCA 1I5QA 4GDBA 2J9OA 1YMSA 3MBZA 5CX7A 1HLUP 3ZNTA 1PW8A 4RX3A 3BEBA 4EERA 3JVUA 2VEAA 5L07A 4C75A 1FILA 1TF1A 3LIAA 1JWZA 3P09A 2ZM2A 4PM7A 1S4SA 3A3FA 2HDSA 5AQ9A 4U3TA 2WGIA 1T18A 1E25A 1D7EA 2NUPC 3W4QA 4KZ9A 4L9EA 3NBLA 2ZQ8A 5KZHA 1K56D 1SCWA 2EA9A 4BD1A 1W79A 1ERMA 4Y7PA 2VKSA 4NETA 3ULFA 3IWOA 1JTGA 2EWVA 4E3OA 4ZJ3A 1SHVA 3NDGA 3VSLA 4HP4A 1H8ZA 2Y2NA 4YOFA 1YLTA 3GQZA 3V3SA 2HV1A 2O9BA 1X0OA 3MXRA 1O7EA 3AGEA 2QYBA 4U0XA 3UE1A 3LUQA 3KX0X 2XEPA 3HJIA 3FG8A 1V9ZA 1DY6A 3EEHA 3UE0A 3C30A 5EE8A 4K08A 3VFHA 4R3BA 2I72A 2EXAA 4HH2A 4S2PA 3PBQA 3T1XA 2Y2IA 4HI4A 2QMIA 2KX6A 2Y59A 3SZTA 3LR4A 2DMWA 4KZ5A 3UMEA 1BYWA 3IF6A 2ZJ9A 1G28A 3NECA 4GNUA 4DXCA 4X56A 2ZMFA 1ZG6A 1XX2A 1YMXA 5IS1A 5I5LA 3C4PA 1GCEA 2QHKA 5G18A 4LRYC 1DP9A 1LSVA 1YLPA 3FZCA 4GCZA 4AFIA 5GL9A 2XDMA 3A0RA 3JYIA 3IF5A 2L1MA 4DJ2A 2Y2PA 1ONGA 3E0YA 3H82B 2VA0A 3N8LA 4X1LA 5M19A 5CHUA 1H0MA 2G7UA 3ZHHA 2R9XA 4P85A 1Z6FA 3FKVA 2XF3A 4QPRA 2DNSA 2V2FF 3B47A 4JGQA 5EVID 3C4OA 1T1AA 4I3AA 4JXGA 1CEGA 4L0LA 4X25A 3ZGAB 1KDWA 3ZCZA 2JN7A 4GZBA 4ZJ2A 3PBOA 4PKYA 4OKPA 3L7HA 4OP5A 1YAXA 4WZ5C 2IWBA 3CJMA 1PZPA 1IYQA 1EROA 5DTKA 4F94A 3IH8A 2OLUA 3U4LP 2OWJA 3KYZA 3E4PA 5FQQA 3IWIA 4WN5A 3DTMA 2V0UA 2XQZA 3UDXA 4BL2A 1Y4OA 3UPNA 2W3HA 4CLCE 4LLOB 1LI9A 3PHYA 5KIZA 2JE5A 2EX6A 1XJ2A 3HVFA 3WS5A 1ES4A 4P6ZS 3LY4A 5CHJA 3HLBA 4K91A 4CLCA 1BSGA 3TJZC 5CGSA 1K55C 2OSUA 1IKGA 5FQIA 4ETXA 3IXHA 2HJ9C 1SZVA 5CGWA 3UO9A 3LYXA 1ESIA 2ZC4B 2Y2JA 3ZDJA 5G4YA 3TOIA 4B9OA 4BBVA 4NXFA 4DRTA 2P7JA 4S2LA 1CEFA 1NRFA 3MFXA 3HJKA 5TBMB 1HTZA 3MKEA 3QP8A 1KVMA 2B5RA 2JCHA 4ZRRA 3C5AA 3C7VA 5F83A 3SH8A 1QMFA 4GOGA 2FFYA 2GJ3A 1BTLA 3NHQA 5EOOA 4EEPA 1LL9A 2EFUA 2Q0OA 1LL8A 4N9KA 3F1PB 3U2AA 2W3DA 4UQIS 4CLCC 2DRWA 1IYOA 2FFFB 3HUMA 4JF6A 4WF0A 1L3LA 1YLZA 1YLYA 4Q0JA 3G30A 4EUVA 5E2GA 2IWDA 4I3JA 4S2JA 3KYEA 1BLSA 3HUNA 3IWQA 4OLGA 2R78A 2VGLM 4D60A 1W8YA 1FIKA 3PAEA 4OQGA 1L0EA 3CWFA 2NUTC 4Y0UA 1L0FA 1P9WA 4OH0A 2X02A 1MC0A 4R38A 1PWDA 3BFGA 4RQ9A 5DFXA 1CQAA 4NXGA 1KGGA 2ZC6B 5L10A 4KZ3A 4X53A 5E2EA 1NYYA 3A3JA 1ZC2A 4EBPA 3H82A 4KUKA 5HL6A 2PDRA 1AXBA 1N4OA 2P9VB 2EX8A 3S1YA 2ZQAA 2EX9A 1ESUA 3PBTA 2Z2MB 2W3FA 1E3UA 4UHUA 3GSGA 4D2OA 4RA7A 2VJWA 3N7WA 3BFFA 3UB9A 2XRNA 2ZQ9A 4R70A 3BFDA 1K54C 1XA1A 3ITAA 3O88A 1DP8A 2HDUA 5CTNA 3MQQA 4L9GA 2ZLYA 1LLBA 2I9VA 4FD8A 5FI7A 1DJCA 1IFQA 1FSYA 1YSQA 3H9WA 3UN7A 4JPMA 3FWLA 5F1FA 3G4PA 1WE4A 2UV0E 3TRCA 3UB7A 1GSWA 3IXDA 2Y4AA 1VEUB 3UB6A 4IJGA 4Q8IA 1L0DA 1LI0A 5CERA 2WGWB 1S66L 1J9MA 3QNBA 1GHMA 1XFQA 2XSSA 1K6SA 3WRTA 4S2NA 4WUJA 4Q0HA 1NYMA 1JNUA 5HAIA 1EWZA 4I39A 5HAPA 3D4FA 3W2ZA 5MC7A 4QY6A 4JXWA 2XH9A 1STZA 5HD5A 3V67A 3OOVA 3ZG5A 2Y2OA 4IHQA 4U0TA 4PM8A 4CJNA 1RP5A 1NJ4A 4DE2A 5F68A 2RCXA 5EVLA 2VLGA 4BBTA 3CMZA 5FI2A 1LT0A 5EM0A 5TBMA 1UWPX 1PI4A 4WLAA 2FH5A 5HAQA 5FAPA 5IU1A 4UA6A 4LV2A 3H7WB 5CECA 3S7NA 2PHYA 4PHTA 1DJAA 3WS2A 4ZDXA 3F1NB 5TGFA 3SS5A 3VV4A 1OT6A 3F1PA 1WA9A 3OPPA 3BLSA 4L9FA 1PWCA 3QNCA 1F98A 3MZEA 2Y55A 4GDNA 4S2NC 4FCFA 2OV5A 4Y3IA 3A0SA 1HZOA 1Q2QA 3N6IA 4QB8A 3CITA 2VV7A 1F9IA 3TG9A 3ZQ5A 1ACFA 3MXQA 1MBLA 2EX2A 3W4OA 3OC2A 2V9AA 4QY5A 5FDHA 4IBXA 2K31A 4CPKA 1YLWA 3O5YA 4IVKA 3OZHA 4EBLA 2J3TC 1RCJA 2O9AA 4NEED 1E4DA 2HF6A 1H3QA 3VP0A 1CK3A 1H5XA 1T1CA 2L4RA 4H8RA 2ZD8A 4II7A 4HP9A 2ZBBA 3GTCA 4E3MA 3FKWA 1LSWA 2PR6A 4B4XA 5I94A 5EVIB 2K7SA 4EETB 1GSXA 2Q9MA 3K2NA 3EGDC 1GA0A 5KSHA 3OPRA 4IVIA 3UPOA 4E3JA 1NXYA 5J3WA 5FQMA 1K25A 4LV3A 4LV0A 2BLSA 2D02A 3C8CA 4Y0TA 1BLCA 3LEQA 1TD5A 2JKFA 2V1AA 1H8MA 3S7OA 5EFWA 1NWZA 4WELA 1GHIA 3PBRA 4PM6A 4K0WA 2V8CA 1KGEA 1W63M 1U60A 1EW0A 3O87A 2A3UA 5CEDA 4Y0OA 5TR7A 3HLFA 1VEUA 4JF4A 3MXSA 1YLJA 1W63Q 2WGWA 5EUAA 5M1AA 2XLNA 5AVFA 3LR3A 3OPLA 5FQ9A 3PXPA 2WAEA 5DF9A 2WKQA 3NC8A 2P08A 3IT9A 3ZYTA 1MY8A 2O0YA 5A91A 1MKIA 1K56A 4BLMA 2WZZA 1W7FA 4OOYA 1RGYA 5DF8A 4XUZA 1PNEA 1TS0A 4OVDA 4KZAA 1ONHA 3TE8A 2PR5A 1OJ5A 4ETZA 3V3RA 2IA2A 1OTEA 1JWPA 3VE3A 4E3LA 4FSFA 1HVBA 4EQ1A 3IX3A 3HREA 4BWIA 3LY3A 2GZAA 2LB9A 2R9WA 5HARA 5GLBA 3DWZA 1IOUA 1G6AA 2JKRI 5CEBA 3IBRA 5IT5A 1XJ3A 3H7WA 4DE3A 2JKTM 2Y91A 3V5MA 2J3WA 5HL1A 4GLQA 5FI6A 3F1NA 1G6OA 2VX8A 1L0GA
chains in the Genus database with same CATH topology
1NLYA 3LIBA 4GJ4A 3T4QA 3U2AA 5F69A 2W3DA 4UQIS 3UB8A 2YKFA 2P04A 4CLCC 2VV6A 5DJTA 4GHIA 1MZUA 2ZMVA 4G3VA 4I5SA 4PKYG 4WF0A 3BY9A 5G4ZA 1UWNX 4HJ4A 3BY8A 4MN6A 3NOTC 2KOIA 4Q0JA 4EU0A 1NLZA 4CLCB 4EUVA 4HHDA 4I3JA 3T4JA 5HDDA 4B93A 1YKDA 4KQDA 5F6AA 2M7UA 2M7VA 2D01A 2R78A 2INWA 2W3GA 3D3OA 2QJ5A 2VGLM 2W27A 4BJPA 1DRMA 2OAQ1 2BASA 2KDKA 4CLCD 3CWFA 2NUTC 2M1CA 3FPVA 1OTBA 5DKKA 3HCYA 1P9WA 1YSPA 5HDCA 1N9LA 2JHEA 4EXOA 3LR0A 1MC0A 2LB5A 4R38A 4NKPA 4IUKA 5DKLA 4RQ9A 2VV8A 5DFXA 2XROA 3OCLA 4EW7A 1ODVA 3C2WA 4NXGA 3DBAA 3CI6A 1XJ4A 2XA7S 5HSQA 2O99A 3F1OA 1OJGA 3H82A 4KUKA 4NXEA 2PDRA 5HL6A 4WEKA 4YNRA 2QKPA 2V0WA 1VB6A 1OTAA 4DJ3A 3VOLA 1GSVA 2VZWA 4MCWA 3UMDA 4KQOA 3PBTA 1NRJA 4KUOA 5AVEA 2W3FA 4XT2A 3MR0A 4O0PA 4BMWA 2VJWA 5A8BA 3MJQA 4H6JB 3UE6A 2KLIA 3KO6A 3UB9A 3RH8B 2XRNA 4DN0A 4R70A 3EGXC 3FPWA 5HDSA 4MN5A 4OOLA 1DP8A 3E98A 3FC7A 3MQQA 4ME4A 4L9GA 2W1RA 3CUEA 3T4LA 2QJ7A 3CAXA 2I9VA 2GX5A 4M4XA 4HOIA 2OOLA 2ZOIA 3EQVA 1IFQA 3LFVA 3R7WA 4EESA 3E4OA 3T4SA 1D06A 1YSQA 3H9WA 3OLOA 1N9OA 4R3AA 5HD3A 3T50A 4OOMA 3TRCA 3UB7A 1TS6A 1F5MA 3GDIA 1GSWA 3T4OA 3MF0A 2K2NA 2W1TB 1S1YA 2MJ6A 2PYPA 4HIAA 5CX7A 1OTDA 3EWKA 3UB6A 4IJGA 2HGVA 3T4KA 1S66L 1OPXA 4EERA 3JVUA 4GS9A 2VEAA 5FL3A 1XFQA 4P6ZM 2XSSA 1TF1A 3LIAA 4WUJA 3S7PA 4Q0HA 1JNUA 1OTIA 1S4SA 4I39A 5HZHA 3IS2A 3W2ZA 5MC7A 1T18A 1STZA 5HD5A 5DFYA 3V67A 1D7EA 2NUPC 3OOVA 4G3WA 5HPFA 3R4KA 4L9EA 2FZ0A 3NOUC 4JGRA 1UGUA 3KSFA 2A24B 4IHQA 2EA9A 3CUEC 2VKSA 5F68A 3BQ8A 2VLGA 3ULFA 4BBTA 4F3LB 1LT0A 2Y79A 5TBMA 1UWPX 2EWVA 3TW8A 4ARZB 1N9NA 4WLAA 2FH5A 4LRZE 4HP4A 5IU1A 4WL9A 4EEUA 4YOFA 3H7WB 2HV1A 2O9BA 1X0OA 3S7NA 2PHYA 1P97A 1XJ6A 4NXBA 4PHTA 4GW9A 3F1NB 4HJ6A 3VV4A 1TS8A 4HJ3A 2QYBA 1OT6A 3F1PA 1WA9A 3LUQA 4I38A 3MQOA 4L9FA 3KX0X 4PAUA 3HJIA 1F98A 3FG8A 4UQIM 1V9ZA 3C38A 4O8GA 3B42A 4Y3IA 3EEHA 4GHIB 3A0SA 3C30A 4Z1WA 1VHMA 4HQAA 4K08A 1S1ZA 4JGPA 3JVVA 3CITA 2VV7A 1F9IA 4HH2A 3ZQ5A 3MXQA 3PBQA 3LI8A 4HI4A 1T1BA 3LR5A 2KX6A 3K3DA 4LPZA 2OWHA 2PYRA 2VGLS 3P7NA 3OC2A 3LR4A 2DMWA 3UMEA 2V9AA 5K5BA 1BYWA 3RFBA 5TJJA 3PBSA 2PD7A 4E04A 1G28A 2CMNA 3KYQA 2K31A 1MKMA 3BJNA 3O5YA 2ZMFA 2YKHA 5HWVA 1ZTUA 2PD8A 2J3TC 2QWSA 2O9AA 4NEED 5L8MA 5IS1A 3CLOA 5I5LA 2EWWA 1TS7A 2QHKA 3MMHA 1V9YA 4LRYC 1DP9A 2HF6A 2Y8HA 1LSVA 3KSIA 5J7EA 1H3QA 4GCZA 4AFIA 3NJAA 3BWLA 3SW1A 3GECA 4MN7A 3A0RA 1T1CA 1S67L 2L4RA 3LIFA 4Y5FA 2W3EA 2XA7M 4II7A 2L1MA 4HP9A 4I3IA 2ZBBA 4DJ2A 3BQAA 3F1OB 3E0YA 3H82B 2ZOHA 4YWZA 1LSWA 2VA0A 2PR6A 2A2LA 2G7UA 2K7SA 4EETB 2J3TD 1GSXA 1LSXA 3KSGA 3K2NA 4XT2B 3EGDC 3RTYA 4DMZA 3OBFA 2V1BA 4H6JA 5KSHA 4QPRA 1P0ZA 3B47A 5HWTA 4MMNA 4JGQA 3IBJA 5J3WA 1T1AA 1S4RA 2D02A 3PYPA 4I3AA 3C8CA 4CQHA 4FOFA 4L0LA 1TD5A 4O01A 1T19A 2Z6CA 2V1AA 4BBUA 1H8MA 3S7OA 2JN7A 5EFWA 2L0WA 1NWZA 4WELA 4HNBA 3PBOA 4PKYA 4MDZA 3LICA 3OCNA 3PBRA 3R7WB 2B18A 4G3KA 1YAXA 1DP6A 3KSHA 1W63M 4WEJA 3BW6A 2OAP1 5F5YA 1EW0A 2OWJA 3KYZA 3E4PA 2W1TA 4WN5A 2V0UA 3A0VA 3NOPC 2W3HA 4CLCE 4LLOB 1W63Q 5J4EA 3LI9A 3PHYA 5AVFA 4UEYA 3LR3A 5KIZA 3PXPA 3ICYA 4GS9B 5DF9A 1XFNA 1XJ2A 2WKQA 5DJUA 3VE4A 4JGOA 1ZHHB 2P08A 4P6ZS 3ZYTA 5LBRA 3EEAA 2J80A 2O0YA 2O9CA 4HY8A 4CLCA 1KOUA 3TJZC 5HPIA 3MQ0A 1TS0A 3IS2B 3E4QA 5HWWA 4ETXA 3LIDA 3TE8A 2HJEA 2HJ9C 2PR5A 1OJ5A 1Y28A 3PR6A 3G6OA 5AJGA 3EQUA 4ETZA 2A24A 3LYXA 2W0NA 2Z6DA 2IA2A 1OTEA 3VE3A 3S7QA 4FSFA 4EQ1A 5G4YA 3LIEA 4BWIA 2GZAA 2LB9A 4B9OA 4BBVA 2PT7A 4F3LA 4LRXC 4NXFA 2P7JA 2JKTI 2WKPA 3P01A 4Q0IA 4ARZA 2WKRA 3MFXA 3PBNA 3HJKA 2GNXA 5TBMB 2B02A 1OT9A 3EOIA 3K3CA 4ZRRA 1IOUA 3D72A 2JKRI 3IBRA 5IT5A 1XJ3A 3H7WA 2JKTM 3UE3A 2GJ3A 2J3WA 3T4TA 3NHQA 4IUHA 4EEPA 4Y2FA 4GLQA 1P9RA 3F1NA 1LL8A 1G6OA 2H28A 3B33A 4HH3A 5C5KA 2JKRM 4R6LA 2VX8A 3F1PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIB A;  5F69 A;  3UB8 A;  2YKF A;  2VV6 A;  5DJT A;  4GHI A;  1MZU A;  4I5S A;  4PKY G;  4WF0 A;  3BY9 A;  5G4Z A;  1UWN X;  4HJ4 A;  3BY8 A;  4MN6 A;  3NOT C;  4HHD A;  4I3J A;  5HDD A;  4KQD A;  5F6A A;  2D01 A;  2R78 A;  2INW A;  2QJ5 A;  2W27 A;  1DRM A;  2BAS A;  2KDK A;  3CWF A;  2M1C A;  1OTB A;  5DKK A;  5HDC A;  1N9L A;  2JHE A;  4EXO A;  4R38 A;  5DKL A;  4RQ9 A;  2VV8 A;  4EW7 A;  1ODV A;  3C2W A;  4NXG A;  1XJ4 A;  5HSQ A;  3F1O A;  1OJG A;  3H82 A;  4KUK A;  4NXE A;  2PDR A;  2QKP A;  2V0W A;  1VB6 A;  1OTA A;  4DJ3 A;  3VOL A;  1GSV A;  3UMD A;  4KUO A;  5AVE A;  4XT2 A;  3MR0 A;  5A8B A;  3MJQ A;  4H6J B;  3UE6 A;  3UB9 A;  3RH8 B;  4R70 A;  5HDS A;  4MN5 A;  1DP8 A;  3FC7 A;  3MQQ A;  4L9G A;  2QJ7 A;  3CAX A;  2I9V A;  4M4X A;  4HOI A;  2OOL A;  2ZOI A;  4EES A;  3E4O A;  1D06 A;  3H9W A;  3OLO A;  1N9O A;  4R3A A;  5HD3 A;  3T50 A;  3UB7 A;  1TS6 A;  3GDI A;  1GSW A;  1S1Y A;  2PYP A;  4HIA A;  1OTD A;  3EWK A;  3UB6 A;  1S66 L;  4EER A;  4GS9 A;  2VEA A;  1XFQ A;  3LIA A;  4WUJ A;  1JNU A;  1OTI A;  1S4S A;  4I39 A;  5HZH A;  3IS2 A;  1T18 A;  5HD5 A;  1D7E A;  4L9E A;  3NOU C;  4JGR A;  1UGU A;  2A24 B;  2EA9 A;  5F68 A;  2VLG A;  3ULF A;  4BBT A;  4F3L B;  1LT0 A;  5TBM A;  1UWP X;  1N9N A;  4WLA A;  4LRZ E;  4HP4 A;  5IU1 A;  4WL9 A;  4EEU A;  3H7W B;  2HV1 A;  1X0O A;  2PHY A;  1P97 A;  1XJ6 A;  4NXB A;  4GW9 A;  3F1N B;  4HJ6 A;  1TS8 A;  4HJ3 A;  1OT6 A;  3F1P A;  1WA9 A;  3LUQ A;  4I38 A;  3MQO A;  4L9F A;  3KX0 X;  3HJI A;  1F98 A;  3FG8 A;  1V9Z A;  3EEH A;  4GHI B;  3A0S A;  4HQA A;  4K08 A;  1S1Z A;  4JGP A;  2VV7 A;  1F9I A;  4HH2 A;  3ZQ5 A;  3MXQ A;  3LI8 A;  4HI4 A;  1T1B A;  2KX6 A;  3K3D A;  4LPZ A;  2OWH A;  2PYR A;  3P7N A;  3UME A;  2V9A A;  1BYW A;  2PD7 A;  4E04 A;  1G28 A;  2CMN A;  2YKH A;  5HWV A;  2PD8 A;  2QWS A;  5IS1 A;  3CLO A;  5I5L A;  1TS7 A;  2QHK A;  1V9Y A;  4LRY C;  1DP9 A;  1LSV A;  5J7E A;  4GCZ A;  3NJA A;  3BWL A;  3SW1 A;  3GEC A;  3A0R A;  1T1C A;  1S67 L;  2L4R A;  3LIF A;  4HP9 A;  2L1M A;  4I3I A;  2ZBB A;  4DJ2 A;  3F1O B;  3H82 B;  2ZOH A;  4YWZ A;  1LSW A;  2PR6 A;  2K7S A;  4EET B;  1GSX A;  1LSX A;  4XT2 B;  3RTY A;  2V1B A;  4H6J A;  1P0Z A;  5HWT A;  4JGQ A;  5J3W A;  1T1A A;  1S4R A;  2D02 A;  3PYP A;  4I3A A;  3C8C A;  1T19 A;  2Z6C A;  2V1A A;  4BBU A;  2JN7 A;  5EFW A;  2L0W A;  1NWZ A;  4HNB A;  4PKY A;  3LIC A;  1DP6 A;  5F5Y A;  1EW0 A;  2OWJ A;  3E4P A;  4WN5 A;  2V0U A;  3A0V A;  3NOP C;  4LLO B;  5J4E A;  3LI9 A;  3PHY A;  5AVF A;  5KIZ A;  3ICY A;  4GS9 B;  1XFN A;  1XJ2 A;  2WKQ A;  5DJU A;  3VE4 A;  4JGO A;  2J80 A;  4HY8 A;  1KOU A;  1TS0 A;  3IS2 B;  3E4Q A;  5HWW A;  3LID A;  2PR5 A;  1OJ5 A;  1Y28 A;  3G6O A;  2A24 A;  3LYX A;  2W0N A;  2Z6D A;  1OTE A;  3VE3 A;  4EQ1 A;  5G4Y A;  3LIE A;  4B9O A;  4BBV A;  4F3L A;  4LRX C;  4NXF A;  2P7J A;  2WKP A;  2WKR A;  3MFX A;  3HJK A;  5TBM B;  2B02 A;  1OT9 A;  3K3C A;  3D72 A;  3IBR A;  1XJ3 A;  3H7W A;  2GJ3 A;  3NHQ A;  4EEP A;  3F1N A;  1LL8 A;  2H28 A;  3B33 A;  4HH3 A;  4R6L A;  3F1P B; 
#chains in the Genus database with same CATH topology
 1NLY A;  1ALQ A;  1YM1 A;  1K6R A;  5FA7 A;  3IXG A;  4DE1 A;  5KMW A;  3S4X A;  4UA7 A;  1BT5 A;  4WYY A;  2ZC7 A;  2YKF A;  2P04 A;  2BTF P;  2ZM0 A;  1ES5 A;  2VV6 A;  3GRJ A;  5DJT A;  4P0M A;  1DJB A;  4BL3 A;  2ZM8 A;  3BY9 A;  3BY8 A;  2KOI A;  2H10 A;  4E3K A;  4HHD A;  5FAO A;  3IF6 C;  5FEF A;  4B93 A;  4QD4 A;  4KQD A;  5F6A A;  2M7U A;  4E6W A;  2WZX A;  2M7V A;  3O86 A;  2INW A;  2W3G A;  2QJ5 A;  2W27 A;  4BJP A;  1VET B;  1PZO A;  4UA9 A;  1DRM A;  5A92 A;  2KDK A;  4CLC D;  3VP2 A;  3BLM A;  1M40 A;  5DKK A;  1YSP A;  3ZG8 B;  4MEZ A;  5D3O A;  3LR0 A;  5DKL A;  2Y2H A;  4EW7 A;  1I2W A;  3AGD A;  1KE3 A;  1A0K A;  1FQG A;  1XJ4 A;  2O99 A;  1ZG4 A;  4NXE A;  2XD1 A;  4YNR A;  4DJ3 A;  3JPU A;  5EVI A;  1GSV A;  2H0T A;  4KQO A;  4KUO A;  4O0P A;  1KE4 A;  4X6T A;  2JBF A;  1VM1 A;  4N1X A;  1YT4 A;  5HDS A;  3FPW A;  1S0W A;  4P6B A;  3BEC A;  2XFT A;  1PI5 A;  4DDY A;  5EV0 A;  4DF6 A;  2G2U A;  3CUE A;  4XXR A;  3CAX A;  2HPB A;  3G2Z A;  5L2F A;  2X01 A;  2V20 A;  3ZG7 B;  3T4S A;  1D06 A;  4IBR A;  4QJG A;  3VSK A;  5JYP A;  2HDQ A;  5HD3 A;  4KG5 A;  1Z09 A;  3LGO A;  1IEM A;  1TS6 A;  3T4O A;  3MF0 A;  2K2N A;  2W1T B;  1C3B A;  2PYP A;  5EEC A;  3MFD A;  3EWK A;  2X71 A;  3IQA A;  4P87 A;  1OPX A;  5FL3 A;  3T12 B;  3G32 A;  1GHP A;  2WAD A;  3QP6 A;  4KQR A;  4C6Y A;  1LHY A;  5CGX A;  3S7P A;  5DF7 A;  1BLP A;  4KEN B;  5HZH A;  4HBT A;  1NZO A;  2A49 A;  5DFY A;  1CF0 A;  4G3W A;  3R4K A;  2VGK A;  3NOU C;  3IXB A;  3KSF A;  3UDI A;  4JF5 A;  3CUE C;  4RVA A;  4YIN A;  4JXV A;  4IED A;  3BQ8 A;  3A3I A;  3MS6 A;  3E2K A;  4F3L B;  3A3D A;  1SKF A;  3TW8 A;  5F82 A;  2WUQ A;  1TEM A;  5CRF A;  4FUW A;  2V8F A;  4WL9 A;  5EPH A;  4R23 A;  1P97 A;  2AVX A;  4NXB A;  2E8I A;  3L9K A;  1PYY A;  1TS8 A;  2BG1 A;  4PM9 A;  4I38 A;  1TDG A;  3MQO A;  4KG2 A;  1BLH A;  4KZ6 A;  1ZKJ A;  3M6B A;  3C38 A;  2XD5 A;  1S1Z A;  3IX8 A;  4MLL A;  3MZF A;  5EOE A;  5JYO A;  3LI8 A;  5A90 A;  4X55 A;  4Y13 A;  1T1B A;  3LR5 A;  4LCL A;  4LPZ A;  2OWH A;  2VGL S;  3P7N A;  1VET A;  5CHM A;  4HES A;  5K5B A;  3RFB A;  3PBS A;  4E04 A;  3KYQ A;  4E6X A;  1MWT A;  1MKM A;  2Y2M A;  1D1J A;  1EI5 A;  3BJN A;  2YKH A;  1I2S A;  5HWV A;  2PD8 A;  2QWS A;  1PRQ A;  1K4E A;  5L8M A;  3CLO A;  2EWW A;  1Q2P A;  4OON A;  1TS7 A;  2ZQC A;  2J8Y A;  2Y2L A;  1V9Y A;  5J7E A;  1SDE A;  4BQM A;  2Y2K A;  4X69 A;  3BWL A;  3Q1F A;  4MN7 A;  2XA7 M;  2EFX A;  1HD8 A;  3F1O B;  2ZOH A;  3QHY A;  3IHB A;  4K0X A;  3G35 A;  4QHC A;  2J3T D;  3VP3 A;  2ZC5 B;  3N8R A;  1LSX A;  5AQ7 A;  3KSG A;  5FSR A;  3RTY A;  4DMZ A;  3HLG A;  2V1B A;  1P0Z A;  1XGI A;  5HWT A;  5EM1 A;  4MMN A;  4ZTK A;  4BD0 A;  5GHX A;  1S4R A;  1JTD A;  1LL5 A;  4DXB A;  4RYE A;  3HUO A;  3Q07 A;  1NY0 A;  2PRF A;  4O01 A;  1T19 A;  3DTE A;  2Z6C A;  1CJF A;  4BBU A;  1IYP A;  1SKO B;  3SS3 A;  4HNB A;  4MDZ A;  3DTI A;  5DTS A;  3LIC A;  3OCN A;  3R7W B;  1TDL A;  3KSH A;  2E8J A;  3M2K A;  4WEJ A;  4LCM A;  5F5Y A;  1ERQ A;  2V1Z A;  2WYX A;  2W1T A;  3A0V A;  3NOP C;  1KVL A;  4EWF A;  4A5R A;  5FAQ A;  4GN2 A;  3LI9 A;  4UEY A;  4E3I A;  4GS9 B;  5DJU A;  3VE4 A;  1FR1 A;  4WMC D;  5LBR A;  3EEA A;  2J80 A;  1CI9 A;  2O9C A;  5KSC A;  3DW0 A;  1S6R A;  4GD8 A;  3QP4 A;  3IS2 B;  3LID A;  2HJE A;  1OME A;  3S22 A;  3G6O A;  5AJG A;  3EQU A;  4KQQ A;  2Z6D A;  4OQ0 A;  4FH2 A;  3CHW P;  3ZVT A;  4F3L A;  4LRX C;  2WAF A;  3G34 A;  4Q0I A;  2WKR A;  3PBN A;  2GNX A;  5GLD A;  1JWV A;  2UWX A;  4OLD A;  4ESP A;  3K3C A;  5BOH A;  3D72 A;  3VP1 A;  4DDS A;  5FDS A;  4KZB A;  1PWG A;  1CI8 A;  4Y2F A;  1K0K A;  2P9V A;  1P9R A;  4HH3 A;  5C5K A;  3E2L A;  3T4Q A;  4KZ8 A;  4N1H A;  2ZQD A;  1MZU A;  3BFE A;  2ZMV A;  4G3V A;  4ID4 A;  1Y54 A;  4R0Q A;  5FAS A;  1NLZ A;  4CLC B;  3A3E A;  3T4J A;  5HDD A;  3ZG9 B;  3ISG A;  5E2F A;  3DWK A;  1YKD A;  3O3V A;  2D01 A;  1K57 A;  3WRZ A;  3W8K A;  3D3O A;  4S2I A;  1QME A;  3QP5 A;  3HLW A;  3NDE A;  2BAS A;  1IYS A;  2M1C A;  2VK3 A;  3IHA A;  3FPV A;  2XK1 A;  2JC7 A;  3HCY A;  4R4S A;  5HDC A;  1TVF A;  4HEF A;  4Z9Q A;  4EXO A;  1BUE A;  2LB5 A;  2VGJ A;  3ITB A;  1L2S A;  3OCL A;  3C2W A;  3DBA A;  3CI6 A;  4EBN A;  1IEL A;  2XGN A;  2XFS A;  1ES3 A;  3WS0 A;  5DTT A;  3F1O A;  1OJG A;  3G31 A;  4WEK A;  1AWI A;  2QKP A;  3WS4 A;  3CPT B;  1VB6 A;  3CG5 A;  1KE0 A;  3VOL A;  4O7D A;  2VZW A;  4MCW A;  5AVE A;  4BMW A;  3Q7V B;  4H6J B;  3RXX A;  2WKI A;  3RH8 B;  1K57 C;  4DN0 A;  2ZC3 B;  2Y2G A;  5E2H A;  3EGX C;  1FSW A;  4MN5 A;  3ZNY A;  1WYB A;  4OOL A;  3E98 A;  5FQK A;  1XA7 A;  2P74 A;  4ME4 A;  3SH7 A;  3T1R A;  4JBF A;  4NK3 A;  3T4L A;  1SKO A;  4M4X A;  5GLC A;  1G68 A;  1GA9 A;  2ZOI A;  3EQV A;  4OPR A;  3R7W A;  3ZVW A;  4MNR A;  3E4O A;  1O07 A;  3OLO A;  3IH9 A;  3PTE A;  3T50 A;  3OPH A;  3VOZ A;  2ZL1 B;  4OOM A;  1F5M A;  3GDI A;  4ZJ1 A;  1S1Y A;  4WZ5 A;  4M3K A;  2Q9N A;  2MJ6 A;  4HIA A;  1N9B A;  1NZU A;  1OTD A;  5GHY A;  2HGV A;  3T4K A;  2Y2Q A;  2PBY A;  4GS9 A;  2HZ5 A;  3QP2 A;  1BZA A;  3TSG A;  1MWU A;  1F2K A;  4P6Z M;  3G2Y A;  4Y15 A;  2C5W B;  1OTI A;  4XUX A;  3IS2 A;  4GB7 A;  2G2W A;  2CC1 A;  3SH9 A;  5HPF A;  4KZ4 A;  2FZ0 A;  3BYD A;  4JGR A;  1UGU A;  1WYC A;  2A24 B;  1K55 A;  1FCN A;  1K38 A;  5E43 A;  3I7J A;  1KGF A;  4LV1 A;  2JKG A;  2Y79 A;  4ARZ B;  1N9N A;  4MBF A;  1ES2 A;  1XP4 A;  4LRZ E;  4JKT A;  4EEU A;  3NCK A;  1XGJ A;  4E3N A;  1XJ6 A;  4KZ7 A;  4GW9 A;  4HJ6 A;  4HJ3 A;  4MBH A;  4EQI A;  3N8S A;  4N92 A;  4PAU A;  1RGZ A;  3SOI A;  4UQI M;  5FQJ A;  4WZ4 A;  4O8G A;  3B42 A;  4GHI B;  4Z1W A;  4QU3 A;  1VHM A;  4R1G A;  4HQA A;  3FV7 A;  4JGP A;  2J9P A;  3JVV A;  2HP5 A;  3BM6 A;  3PAG A;  4EV4 A;  5L09 A;  3GVB A;  1FR6 A;  1J3W A;  3K3D A;  2PYR A;  3UDF A;  3ZFZ A;  3UY6 A;  2IWC A;  3RJU A;  5TJJ A;  2PD7 A;  3LCE A;  5FEG A;  4LEN A;  2CMN A;  5DVA A;  2WK0 A;  1ZTU A;  1FCO A;  1PFL A;  3BRM A;  3N4I A;  3MMH A;  2ACG A;  5GLA A;  2Y8H A;  4B4Z A;  4PPR A;  4JLF A;  4N9L A;  3KSI A;  1FOF A;  4X1M A;  3NJA A;  2DCF A;  3QP1 A;  3SW1 A;  5EVI C;  3GEC A;  4Y5F A;  1S67 L;  3LIF A;  2W3E A;  4I3I A;  2XR0 A;  3T1Q B;  3BQA A;  4FH4 A;  3RXW A;  4YWZ A;  3T1S A;  3CPT A;  2A2L A;  4LFU A;  4PMA A;  3M2J A;  5FAT A;  1MXO A;  5AQA A;  4ZBE A;  4XT2 B;  3B3X A;  3OBF A;  5GHZ A;  3Q7V A;  4H6J A;  3LEZ A;  2J7V A;  4LGW A;  1MWS A;  2PU2 A;  1SDN A;  3IBJ A;  2B95 A;  3V50 A;  2EXB A;  4R3J A;  3VFF A;  3PYP A;  1E3U D;  4CQH A;  4FOF A;  5HX9 A;  1K54 A;  1PIO A;  2L0W A;  2H5S A;  2HDR A;  3NUL A;  4X68 A;  2B18 A;  4G3K A;  1DP6 A;  2HP9 A;  2ZL1 A;  3BW6 A;  2OAP 1;  4JXS A;  3HBR A;  1XKZ A;  4FTX A;  4C3Q A;  5J4E A;  2QZ6 A;  2PAV P;  5HFO A;  3ICY A;  4WM9 A;  3D9Y A;  1XFN A;  4JGO A;  1ZHH B;  4OPZ A;  3DAV A;  3NIA A;  4HY8 A;  4NG2 A;  4QWO A;  3VMA A;  1KOU A;  3FYZ A;  5HPI A;  3GV9 A;  3MQ0 A;  1H8Y A;  2Z2L B;  3E4Q A;  5HWW A;  3HLC A;  5M18 A;  1Y28 A;  3PR6 A;  4S2K A;  2A24 A;  2W0N A;  3S7Q A;  2H0Y A;  3LIE A;  3BFC A;  2PT7 A;  3SS4 A;  1FCM A;  2JKT I;  3MSH A;  2WKP A;  4OQI A;  3P01 A;  4ARZ A;  5AQB A;  2ZMA A;  5A93 A;  2B02 A;  1OT9 A;  3EOI A;  3DTK A;  5CTM A;  1YPR A;  2WGV A;  5J8X A;  3UE3 A;  3T4T A;  1JVJ A;  4IUH A;  2QPN A;  3M6H A;  1W8Q A;  2H28 A;  3B33 A;  4PM5 A;  2JKR M;  4R6L A;  3ZG0 A;  3GMW A;  3CZD A;  4OPQ A;  1XXM A;  3LIB A;  4GJ4 A;  1BUL A;  5F69 A;  2GDN A;  1W5D A;  3UNW A;  3AGF A;  1KDS A;  3UB8 A;  3VP4 A;  3W4P A;  4GHI A;  3HL9 A;  5TFQ A;  4I5S A;  4RX2 A;  4R4R A;  3VOY A;  3WWX A;  4PKY G;  5G4Z A;  1UWN X;  4GKU A;  4HJ4 A;  4MN6 A;  3NOT C;  4EU0 A;  1K4F A;  3Q7Z A;  4EUZ A;  4Y17 A;  3NY4 A;  3GR2 A;  2ZQ7 A;  3WS1 A;  2OAQ 1;  3UPP A;  3IF6 B;  1XPB A;  1OTB A;  3V39 A;  1MPL A;  5U47 A;  1N9L A;  3Q81 A;  2JHE A;  4KG6 A;  4NKP A;  3HLE A;  3Q82 A;  4IUK A;  5HW3 A;  2VV8 A;  2XRO A;  3LO7 A;  4ZAM A;  1ODV A;  2WKE A;  5F1G A;  4BEN A;  4HBU A;  4B88 A;  2PU4 A;  1PW1 A;  2XA7 S;  5IHV A;  5HSQ A;  2PBD P;  1VQQ A;  4DE0 A;  2V0W A;  3HLD A;  1OTA A;  4DKI A;  3UMD A;  2WKH A;  1NRJ A;  4XT2 A;  3MR0 A;  2HP6 A;  3MZD A;  4UAA A;  5A8B A;  3MJQ A;  3UE6 A;  2KLI A;  3KO6 A;  2C6W B;  4OQH A;  4S2M A;  2OLV A;  4OP8 A;  4S2O A;  3FC7 A;  3IX4 A;  4MBK A;  1YQS A;  1IKI A;  1G5U A;  3NI9 A;  2W1R A;  2RL3 A;  3UB5 P;  2QJ7 A;  1M6K A;  2GX5 A;  4HOI A;  2OOL A;  3P98 A;  3LFV A;  4EES A;  4YFM A;  4OPY A;  1N9O A;  3MKF A;  5EVE A;  4GD6 A;  4WBG A;  4R3A A;  5CXW A;  1MWR A;  3C7U A;  4WMC A;  1I5Q A;  4GDB A;  2J9O A;  1YMS A;  3MBZ A;  5CX7 A;  1HLU P;  3ZNT A;  1PW8 A;  4RX3 A;  3BEB A;  4EER A;  3JVU A;  2VEA A;  5L07 A;  4C75 A;  1FIL A;  1TF1 A;  3LIA A;  1JWZ A;  3P09 A;  2ZM2 A;  4PM7 A;  1S4S A;  3A3F A;  2HDS A;  5AQ9 A;  4U3T A;  2WGI A;  1T18 A;  1E25 A;  1D7E A;  2NUP C;  3W4Q A;  4KZ9 A;  4L9E A;  3NBL A;  2ZQ8 A;  5KZH A;  1K56 D;  1SCW A;  2EA9 A;  4BD1 A;  1W79 A;  1ERM A;  4Y7P A;  2VKS A;  4NET A;  3ULF A;  3IWO A;  1JTG A;  2EWV A;  4E3O A;  4ZJ3 A;  1SHV A;  3NDG A;  3VSL A;  4HP4 A;  1H8Z A;  2Y2N A;  4YOF A;  1YLT A;  3GQZ A;  3V3S A;  2HV1 A;  2O9B A;  1X0O A;  3MXR A;  1O7E A;  3AGE A;  2QYB A;  4U0X A;  3UE1 A;  3LUQ A;  3KX0 X;  2XEP A;  3HJI A;  3FG8 A;  1V9Z A;  1DY6 A;  3EEH A;  3UE0 A;  3C30 A;  5EE8 A;  4K08 A;  3VFH A;  4R3B A;  2I72 A;  2EXA A;  4HH2 A;  4S2P A;  3PBQ A;  3T1X A;  2Y2I A;  4HI4 A;  2QMI A;  2KX6 A;  2Y59 A;  3SZT A;  3LR4 A;  2DMW A;  4KZ5 A;  3UME A;  1BYW A;  3IF6 A;  2ZJ9 A;  1G28 A;  3NEC A;  4GNU A;  4DXC A;  4X56 A;  2ZMF A;  1ZG6 A;  1XX2 A;  1YMX A;  5IS1 A;  5I5L A;  3C4P A;  1GCE A;  2QHK A;  5G18 A;  4LRY C;  1DP9 A;  1LSV A;  1YLP A;  3FZC A;  4GCZ A;  4AFI A;  5GL9 A;  2XDM A;  3A0R A;  3JYI A;  3IF5 A;  2L1M A;  4DJ2 A;  2Y2P A;  1ONG A;  3E0Y A;  3H82 B;  2VA0 A;  3N8L A;  4X1L A;  5M19 A;  5CHU A;  1H0M A;  2G7U A;  3ZHH A;  2R9X A;  4P85 A;  1Z6F A;  3FKV A;  2XF3 A;  4QPR A;  2DNS A;  2V2F F;  3B47 A;  4JGQ A;  5EVI D;  3C4O A;  1T1A A;  4I3A A;  4JXG A;  1CEG A;  4L0L A;  4X25 A;  3ZGA B;  1KDW A;  3ZCZ A;  2JN7 A;  4GZB A;  4ZJ2 A;  3PBO A;  4PKY A;  4OKP A;  3L7H A;  4OP5 A;  1YAX A;  4WZ5 C;  2IWB A;  3CJM A;  1PZP A;  1IYQ A;  1ERO A;  5DTK A;  4F94 A;  3IH8 A;  2OLU A;  3U4L P;  2OWJ A;  3KYZ A;  3E4P A;  5FQQ A;  3IWI A;  4WN5 A;  3DTM A;  2V0U A;  2XQZ A;  3UDX A;  4BL2 A;  1Y4O A;  3UPN A;  2W3H A;  4CLC E;  4LLO B;  1LI9 A;  3PHY A;  5KIZ A;  2JE5 A;  2EX6 A;  1XJ2 A;  3HVF A;  3WS5 A;  1ES4 A;  4P6Z S;  3LY4 A;  5CHJ A;  3HLB A;  4K91 A;  4CLC A;  1BSG A;  3TJZ C;  5CGS A;  1K55 C;  2OSU A;  1IKG A;  5FQI A;  4ETX A;  3IXH A;  2HJ9 C;  1SZV A;  5CGW A;  3UO9 A;  3LYX A;  1ESI A;  2ZC4 B;  2Y2J A;  3ZDJ A;  5G4Y A;  3TOI A;  4B9O A;  4BBV A;  4NXF A;  4DRT A;  2P7J A;  4S2L A;  1CEF A;  1NRF A;  3MFX A;  3HJK A;  5TBM B;  1HTZ A;  3MKE A;  3QP8 A;  1KVM A;  2B5R A;  2JCH A;  4ZRR A;  3C5A A;  3C7V A;  5F83 A;  3SH8 A;  1QMF A;  4GOG A;  2FFY A;  2GJ3 A;  1BTL A;  3NHQ A;  5EOO A;  4EEP A;  1LL9 A;  2EFU A;  2Q0O A;  1LL8 A;  4N9K A;  3F1P B;  3U2A A;  2W3D A;  4UQI S;  4CLC C;  2DRW A;  1IYO A;  2FFF B;  3HUM A;  4JF6 A;  4WF0 A;  1L3L A;  1YLZ A;  1YLY A;  4Q0J A;  3G30 A;  4EUV A;  5E2G A;  2IWD A;  4I3J A;  4S2J A;  3KYE A;  1BLS A;  3HUN A;  3IWQ A;  4OLG A;  2R78 A;  2VGL M;  4D60 A;  1W8Y A;  1FIK A;  3PAE A;  4OQG A;  1L0E A;  3CWF A;  2NUT C;  4Y0U A;  1L0F A;  1P9W A;  4OH0 A;  2X02 A;  1MC0 A;  4R38 A;  1PWD A;  3BFG A;  4RQ9 A;  5DFX A;  1CQA A;  4NXG A;  1KGG A;  2ZC6 B;  5L10 A;  4KZ3 A;  4X53 A;  5E2E A;  1NYY A;  3A3J A;  1ZC2 A;  4EBP A;  3H82 A;  4KUK A;  5HL6 A;  2PDR A;  1AXB A;  1N4O A;  2P9V B;  2EX8 A;  3S1Y A;  2ZQA A;  2EX9 A;  1ESU A;  3PBT A;  2Z2M B;  2W3F A;  1E3U A;  4UHU A;  3GSG A;  4D2O A;  4RA7 A;  2VJW A;  3N7W A;  3BFF A;  3UB9 A;  2XRN A;  2ZQ9 A;  4R70 A;  3BFD A;  1K54 C;  1XA1 A;  3ITA A;  3O88 A;  1DP8 A;  2HDU A;  5CTN A;  3MQQ A;  4L9G A;  2ZLY A;  1LLB A;  2I9V A;  4FD8 A;  5FI7 A;  1DJC A;  1IFQ A;  1FSY A;  1YSQ A;  3H9W A;  3UN7 A;  4JPM A;  3FWL A;  5F1F A;  3G4P A;  1WE4 A;  2UV0 E;  3TRC A;  3UB7 A;  1GSW A;  3IXD A;  2Y4A A;  1VEU B;  3UB6 A;  4IJG A;  4Q8I A;  1L0D A;  1LI0 A;  5CER A;  2WGW B;  1S66 L;  1J9M A;  3QNB A;  1GHM A;  1XFQ A;  2XSS A;  1K6S A;  3WRT A;  4S2N A;  4WUJ A;  4Q0H A;  1NYM A;  1JNU A;  5HAI A;  1EWZ A;  4I39 A;  5HAP A;  3D4F A;  3W2Z A;  5MC7 A;  4QY6 A;  4JXW A;  2XH9 A;  1STZ A;  5HD5 A;  3V67 A;  3OOV A;  3ZG5 A;  2Y2O A;  4IHQ A;  4U0T A;  4PM8 A;  4CJN A;  1RP5 A;  1NJ4 A;  4DE2 A;  5F68 A;  2RCX A;  5EVL A;  2VLG A;  4BBT A;  3CMZ A;  5FI2 A;  1LT0 A;  5EM0 A;  5TBM A;  1UWP X;  1PI4 A;  4WLA A;  2FH5 A;  5HAQ A;  5FAP A;  5IU1 A;  4UA6 A;  4LV2 A;  3H7W B;  5CEC A;  3S7N A;  2PHY A;  4PHT A;  1DJA A;  3WS2 A;  4ZDX A;  3F1N B;  5TGF A;  3SS5 A;  3VV4 A;  1OT6 A;  3F1P A;  1WA9 A;  3OPP A;  3BLS A;  4L9F A;  1PWC A;  3QNC A;  1F98 A;  3MZE A;  2Y55 A;  4GDN A;  4S2N C;  4FCF A;  2OV5 A;  4Y3I A;  3A0S A;  1HZO A;  1Q2Q A;  3N6I A;  4QB8 A;  3CIT A;  2VV7 A;  1F9I A;  3TG9 A;  3ZQ5 A;  1ACF A;  3MXQ A;  1MBL A;  2EX2 A;  3W4O A;  3OC2 A;  2V9A A;  4QY5 A;  5FDH A;  4IBX A;  2K31 A;  4CPK A;  1YLW A;  3O5Y A;  4IVK A;  3OZH A;  4EBL A;  2J3T C;  1RCJ A;  2O9A A;  4NEE D;  1E4D A;  2HF6 A;  1H3Q A;  3VP0 A;  1CK3 A;  1H5X A;  1T1C A;  2L4R A;  4H8R A;  2ZD8 A;  4II7 A;  4HP9 A;  2ZBB A;  3GTC A;  4E3M A;  3FKW A;  1LSW A;  2PR6 A;  4B4X A;  5I94 A;  5EVI B;  2K7S A;  4EET B;  1GSX A;  2Q9M A;  3K2N A;  3EGD C;  1GA0 A;  5KSH A;  3OPR A;  4IVI A;  3UPO A;  4E3J A;  1NXY A;  5J3W A;  5FQM A;  1K25 A;  4LV3 A;  4LV0 A;  2BLS A;  2D02 A;  3C8C A;  4Y0T A;  1BLC A;  3LEQ A;  1TD5 A;  2JKF A;  2V1A A;  1H8M A;  3S7O A;  5EFW A;  1NWZ A;  4WEL A;  1GHI A;  3PBR A;  4PM6 A;  4K0W A;  2V8C A;  1KGE A;  1W63 M;  1U60 A;  1EW0 A;  3O87 A;  2A3U A;  5CED A;  4Y0O A;  5TR7 A;  3HLF A;  1VEU A;  4JF4 A;  3MXS A;  1YLJ A;  1W63 Q;  2WGW A;  5EUA A;  5M1A A;  2XLN A;  5AVF A;  3LR3 A;  3OPL A;  5FQ9 A;  3PXP A;  2WAE A;  5DF9 A;  2WKQ A;  3NC8 A;  2P08 A;  3IT9 A;  3ZYT A;  1MY8 A;  2O0Y A;  5A91 A;  1MKI A;  1K56 A;  4BLM A;  2WZZ A;  1W7F A;  4OOY A;  1RGY A;  5DF8 A;  4XUZ A;  1PNE A;  1TS0 A;  4OVD A;  4KZA A;  1ONH A;  3TE8 A;  2PR5 A;  1OJ5 A;  4ETZ A;  3V3R A;  2IA2 A;  1OTE A;  1JWP A;  3VE3 A;  4E3L A;  4FSF A;  1HVB A;  4EQ1 A;  3IX3 A;  3HRE A;  4BWI A;  3LY3 A;  2GZA A;  2LB9 A;  2R9W A;  5HAR A;  5GLB A;  3DWZ A;  1IOU A;  1G6A A;  2JKR I;  5CEB A;  3IBR A;  5IT5 A;  1XJ3 A;  3H7W A;  4DE3 A;  2JKT M;  2Y91 A;  3V5M A;  2J3W A;  5HL1 A;  4GLQ A;  5FI6 A;  3F1N A;  1G6O A;  2VX8 A;  1L0G A; 
#chains in the Genus database with same CATH homology
 1NLY A;  3LIB A;  4GJ4 A;  3T4Q A;  3U2A A;  5F69 A;  2W3D A;  4UQI S;  3UB8 A;  2YKF A;  2P04 A;  4CLC C;  2VV6 A;  5DJT A;  4GHI A;  1MZU A;  2ZMV A;  4G3V A;  4I5S A;  4PKY G;  4WF0 A;  3BY9 A;  5G4Z A;  1UWN X;  4HJ4 A;  3BY8 A;  4MN6 A;  3NOT C;  2KOI A;  4Q0J A;  4EU0 A;  1NLZ A;  4CLC B;  4EUV A;  4HHD A;  4I3J A;  3T4J A;  5HDD A;  4B93 A;  1YKD A;  4KQD A;  5F6A A;  2M7U A;  2M7V A;  2D01 A;  2R78 A;  2INW A;  2W3G A;  3D3O A;  2QJ5 A;  2VGL M;  2W27 A;  4BJP A;  1DRM A;  2OAQ 1;  2BAS A;  2KDK A;  4CLC D;  3CWF A;  2NUT C;  2M1C A;  3FPV A;  1OTB A;  5DKK A;  3HCY A;  1P9W A;  1YSP A;  5HDC A;  1N9L A;  2JHE A;  4EXO A;  3LR0 A;  1MC0 A;  2LB5 A;  4R38 A;  4NKP A;  4IUK A;  5DKL A;  4RQ9 A;  2VV8 A;  5DFX A;  2XRO A;  3OCL A;  4EW7 A;  1ODV A;  3C2W A;  4NXG A;  3DBA A;  3CI6 A;  1XJ4 A;  2XA7 S;  5HSQ A;  2O99 A;  3F1O A;  1OJG A;  3H82 A;  4KUK A;  4NXE A;  2PDR A;  5HL6 A;  4WEK A;  4YNR A;  2QKP A;  2V0W A;  1VB6 A;  1OTA A;  4DJ3 A;  3VOL A;  1GSV A;  2VZW A;  4MCW A;  3UMD A;  4KQO A;  3PBT A;  1NRJ A;  4KUO A;  5AVE A;  2W3F A;  4XT2 A;  3MR0 A;  4O0P A;  4BMW A;  2VJW A;  5A8B A;  3MJQ A;  4H6J B;  3UE6 A;  2KLI A;  3KO6 A;  3UB9 A;  3RH8 B;  2XRN A;  4DN0 A;  4R70 A;  3EGX C;  3FPW A;  5HDS A;  4MN5 A;  4OOL A;  1DP8 A;  3E98 A;  3FC7 A;  3MQQ A;  4ME4 A;  4L9G A;  2W1R A;  3CUE A;  3T4L A;  2QJ7 A;  3CAX A;  2I9V A;  2GX5 A;  4M4X A;  4HOI A;  2OOL A;  2ZOI A;  3EQV A;  1IFQ A;  3LFV A;  3R7W A;  4EES A;  3E4O A;  3T4S A;  1D06 A;  1YSQ A;  3H9W A;  3OLO A;  1N9O A;  4R3A A;  5HD3 A;  3T50 A;  4OOM A;  3TRC A;  3UB7 A;  1TS6 A;  1F5M A;  3GDI A;  1GSW A;  3T4O A;  3MF0 A;  2K2N A;  2W1T B;  1S1Y A;  2MJ6 A;  2PYP A;  4HIA A;  5CX7 A;  1OTD A;  3EWK A;  3UB6 A;  4IJG A;  2HGV A;  3T4K A;  1S66 L;  1OPX A;  4EER A;  3JVU A;  4GS9 A;  2VEA A;  5FL3 A;  1XFQ A;  4P6Z M;  2XSS A;  1TF1 A;  3LIA A;  4WUJ A;  3S7P A;  4Q0H A;  1JNU A;  1OTI A;  1S4S A;  4I39 A;  5HZH A;  3IS2 A;  3W2Z A;  5MC7 A;  1T18 A;  1STZ A;  5HD5 A;  5DFY A;  3V67 A;  1D7E A;  2NUP C;  3OOV A;  4G3W A;  5HPF A;  3R4K A;  4L9E A;  2FZ0 A;  3NOU C;  4JGR A;  1UGU A;  3KSF A;  2A24 B;  4IHQ A;  2EA9 A;  3CUE C;  2VKS A;  5F68 A;  3BQ8 A;  2VLG A;  3ULF A;  4BBT A;  4F3L B;  1LT0 A;  2Y79 A;  5TBM A;  1UWP X;  2EWV A;  3TW8 A;  4ARZ B;  1N9N A;  4WLA A;  2FH5 A;  4LRZ E;  4HP4 A;  5IU1 A;  4WL9 A;  4EEU A;  4YOF A;  3H7W B;  2HV1 A;  2O9B A;  1X0O A;  3S7N A;  2PHY A;  1P97 A;  1XJ6 A;  4NXB A;  4PHT A;  4GW9 A;  3F1N B;  4HJ6 A;  3VV4 A;  1TS8 A;  4HJ3 A;  2QYB A;  1OT6 A;  3F1P A;  1WA9 A;  3LUQ A;  4I38 A;  3MQO A;  4L9F A;  3KX0 X;  4PAU A;  3HJI A;  1F98 A;  3FG8 A;  4UQI M;  1V9Z A;  3C38 A;  4O8G A;  3B42 A;  4Y3I A;  3EEH A;  4GHI B;  3A0S A;  3C30 A;  4Z1W A;  1VHM A;  4HQA A;  4K08 A;  1S1Z A;  4JGP A;  3JVV A;  3CIT A;  2VV7 A;  1F9I A;  4HH2 A;  3ZQ5 A;  3MXQ A;  3PBQ A;  3LI8 A;  4HI4 A;  1T1B A;  3LR5 A;  2KX6 A;  3K3D A;  4LPZ A;  2OWH A;  2PYR A;  2VGL S;  3P7N A;  3OC2 A;  3LR4 A;  2DMW A;  3UME A;  2V9A A;  5K5B A;  1BYW A;  3RFB A;  5TJJ A;  3PBS A;  2PD7 A;  4E04 A;  1G28 A;  2CMN A;  3KYQ A;  2K31 A;  1MKM A;  3BJN A;  3O5Y A;  2ZMF A;  2YKH A;  5HWV A;  1ZTU A;  2PD8 A;  2J3T C;  2QWS A;  2O9A A;  4NEE D;  5L8M A;  5IS1 A;  3CLO A;  5I5L A;  2EWW A;  1TS7 A;  2QHK A;  3MMH A;  1V9Y A;  4LRY C;  1DP9 A;  2HF6 A;  2Y8H A;  1LSV A;  3KSI A;  5J7E A;  1H3Q A;  4GCZ A;  4AFI A;  3NJA A;  3BWL A;  3SW1 A;  3GEC A;  4MN7 A;  3A0R A;  1T1C A;  1S67 L;  2L4R A;  3LIF A;  4Y5F A;  2W3E A;  2XA7 M;  4II7 A;  2L1M A;  4HP9 A;  4I3I A;  2ZBB A;  4DJ2 A;  3BQA A;  3F1O B;  3E0Y A;  3H82 B;  2ZOH A;  4YWZ A;  1LSW A;  2VA0 A;  2PR6 A;  2A2L A;  2G7U A;  2K7S A;  4EET B;  2J3T D;  1GSX A;  1LSX A;  3KSG A;  3K2N A;  4XT2 B;  3EGD C;  3RTY A;  4DMZ A;  3OBF A;  2V1B A;  4H6J A;  5KSH A;  4QPR A;  1P0Z A;  3B47 A;  5HWT A;  4MMN A;  4JGQ A;  3IBJ A;  5J3W A;  1T1A A;  1S4R A;  2D02 A;  3PYP A;  4I3A A;  3C8C A;  4CQH A;  4FOF A;  4L0L A;  1TD5 A;  4O01 A;  1T19 A;  2Z6C A;  2V1A A;  4BBU A;  1H8M A;  3S7O A;  2JN7 A;  5EFW A;  2L0W A;  1NWZ A;  4WEL A;  4HNB A;  3PBO A;  4PKY A;  4MDZ A;  3LIC A;  3OCN A;  3PBR A;  3R7W B;  2B18 A;  4G3K A;  1YAX A;  1DP6 A;  3KSH A;  1W63 M;  4WEJ A;  3BW6 A;  2OAP 1;  5F5Y A;  1EW0 A;  2OWJ A;  3KYZ A;  3E4P A;  2W1T A;  4WN5 A;  2V0U A;  3A0V A;  3NOP C;  2W3H A;  4CLC E;  4LLO B;  1W63 Q;  5J4E A;  3LI9 A;  3PHY A;  5AVF A;  4UEY A;  3LR3 A;  5KIZ A;  3PXP A;  3ICY A;  4GS9 B;  5DF9 A;  1XFN A;  1XJ2 A;  2WKQ A;  5DJU A;  3VE4 A;  4JGO A;  1ZHH B;  2P08 A;  4P6Z S;  3ZYT A;  5LBR A;  3EEA A;  2J80 A;  2O0Y A;  2O9C A;  4HY8 A;  4CLC A;  1KOU A;  3TJZ C;  5HPI A;  3MQ0 A;  1TS0 A;  3IS2 B;  3E4Q A;  5HWW A;  4ETX A;  3LID A;  3TE8 A;  2HJE A;  2HJ9 C;  2PR5 A;  1OJ5 A;  1Y28 A;  3PR6 A;  3G6O A;  5AJG A;  3EQU A;  4ETZ A;  2A24 A;  3LYX A;  2W0N A;  2Z6D A;  2IA2 A;  1OTE A;  3VE3 A;  3S7Q A;  4FSF A;  4EQ1 A;  5G4Y A;  3LIE A;  4BWI A;  2GZA A;  2LB9 A;  4B9O A;  4BBV A;  2PT7 A;  4F3L A;  4LRX C;  4NXF A;  2P7J A;  2JKT I;  2WKP A;  3P01 A;  4Q0I A;  4ARZ A;  2WKR A;  3MFX A;  3PBN A;  3HJK A;  2GNX A;  5TBM B;  2B02 A;  1OT9 A;  3EOI A;  3K3C A;  4ZRR A;  1IOU A;  3D72 A;  2JKR I;  3IBR A;  5IT5 A;  1XJ3 A;  3H7W A;  2JKT M;  3UE3 A;  2GJ3 A;  2J3W A;  3T4T A;  3NHQ A;  4IUH A;  4EEP A;  4Y2F A;  4GLQ A;  1P9R A;  3F1N A;  1LL8 A;  1G6O A;  2H28 A;  3B33 A;  4HH3 A;  5C5K A;  2JKR M;  4R6L A;  2VX8 A;  3F1P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...