5TFQA

Crystal structure of a representative of class a beta-lactamase from bacteroides cellulosilyticus dsm 14838
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
277
structure length
277
Chain Sequence
NRTPKQKIEQQIDSLLKDKKATVGVAVLANDETVAVYNNQIHFPLLSVFKFHVGLAVLDKMDKGHIALDSLIEVKSSQLKSNTYSPLRDKFPDQDITISLGELLKYTISKSDNNTCDILIEYVGGIDQVNEYVKSLGIKDCNLAATETLMHTSGDTDLNWSTPEEVVRLLNIADKQPLFGTQYKDFLQAIMQETSTGKDKLKGQLPADVIVGHKTGSSDRTPEGIKIADNDAGFVILPNGQKYYIAVFVMESQETDADNAAIIASISKIVYDTLNSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Crystal structure of a representative of class A beta-lactamase from Bacteroides cellulosilyticus DSM 14838
rcsb
source organism Bacteroides cellulosilyticus dsm 14838
molecule tags Hydrolase
total genus 96
structure length 277
sequence length 277
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5tfqA00
5EECA 4S2IA 4JF6A 4OOMA 1K6SA 3S22A 3NY4A 1E3UA 4K91A 3PBRA 2EXAA 3ZG0A 2EX2A 1KDSA 4K0XA 5GHZA 3PTEA 2ZQDA 5EPHA 2ZQAA 1ZG4A 3WWXA 3A3JA 2HPBA 3WS4A 5BOHA 1KGFA 1XGIA 4GZBA 1BT5A 3BYDA 1MKIA 3N7WA 1O7EA 1FCNA 2EXBA 5I94A 3FWLA 3GQZA 1HZOA 1GA0A 3IHBA 3G2ZA 5HAPA 5HW3A 5CGSA 3HVFA 3UDIA 3PBQA 3IF6C 4EBPA 4JKTA 5CHUA 3TOIA 1O07A 4R0QA 2J7VA 4OOYA 2Z2LB 1GA9A 4GOGA 3ZCZA 3EQUA 4FD8A 3M6HA 5L2FA 1FCOA 1K6RA 1NRFA 1ONHA 4R1GA 3ZDJA 2WAEA 4BQMA 4C3QA 3BLMA 1K38A 1GHIA 3UDFA 4DKIA 4P85A 4WMCA 2OV5A 1YM1A 3ITBA 4PM9A 5EVID 4R4RA 4GNUA 1FQGA 2ZQ7A 4NK3A 5CEBA 4OH0A 1XKZA 1K4FA 1XA1A 2Y2IA 1ES2A 3CMZA 4JLFA 1PZOA 3C7VA 3O88A 5EOEA 4CPKA 3QHYA 5FQIA 2RL3A 2WUQA 3OCLA 4HBUA 3SS4A 3SH9A 2XK1A 5DTSA 1LI0A 3FZCA 1VM1A 1PWDA 3OPHA 4MEZA 4UHUA 5EOOA 1MWRA 4M3KA 3Q82A 1CEGA 1YLWA 4E3MA 1LL9A 3GR2A 5EVIB 4CJNA 1PI4A 2Q9NA 2VGKA 4R23A 3C5AA 5GHYA 3BFDA 3Q07A 5GLAA 1U60A 3C4OA 4LV1A 3ITAA 1DJBA 1W79A 2HDSA 3UPOA 5FSRA 1BUEA 2PU4A 5DTTA 3WRTA 4BLMA 1E3UD 1QMEA 1YLPA 3MXRA 1XX2A 2ZLYA 4FH2A 1KGEA 1ERMA 5DF7A 1BLCA 4HESA 3C7UA 4UA6A 5CEDA 1L0EA 3GRJA 4F94A 5CTMA 4BD0A 1FOFA 1LHYA 3OPRA 1XPBA 5GLDA 1K55A 2IWCA 5EUAA 4BL2A 1FR1A 2WGWA 4PM7A 4N9KA 3DWZA 4DDYA 4WM9A 3HLWA 2WYXA 4OQGA 3UE1A 4OPQA 5J8XA 3W4QA 1W7FA 4WYYA 5KSHA 2QZ6A 4O7DA 2EFUA 3D4FA 3CZDA 4OKPA 4LV0A 5FI6A 4OQ0A 2WKEA 3O86A 5M18A 2IWBA 1BTLA 1IEMA 1M6KA 1W8QA 2WZZA 2ZM0A 2P9VB 3E2LA 1CI9A 4FH4A 2Y2MA 3SOIA 1K56A 4DE2A 3IXHA 2EX6A 3BECA 3JYIA 5HL1A 1LI9A 4KZBA 3HUMA 1BLHA 3EQVA 2FFYA 1PZPA 3Q7ZA 1IYSA 2J9OA 4R3JA 1BULA 2R9WA 4S2KA 4KZ5A 4EV4A 2DCFA 4JF4A 3IXDA 1YT4A 1JWZA 3NCKA 4KZ7A 5HX9A 3BEBA 2XD1A 3OCNA 3PBTA 2HP5A 3ZG8B 5GL9A 3GV9A 1HTZA 4R4SA 4EBNA 2ZM2A 2X02A 4FCFA 2RCXA 3GTCA 2ZC4B 3V3SA 5CHMA 5F83A 4RX2A 4MBFA 4N92A 1ESUA 3ZNTA 3HREA 2WGVA 2ZC5B 4S2NC 3BRMA 3ISGA 5F1GA 4ZBEA 1NZOA 3M2KA 2Y2PA 3UNWA 3BFGA 3IXBA 3G30A 1PYYA 2OSUA 1SDNA 1AXBA 1DY6A 4QY6A 5FDHA 3VSKA 3ZFZA 4ZJ2A 2XD5A 3NDEA 4X56A 4X53A 3BFCA 1RCJA 3MFDA 3OPLA 4P6BA 4EQIA 1KE0A 1K4EA 1NJ4A 1NYMA 4S2NA 3ZNYA 1LLBA 5F1FA 1ZG6A 2HDQA 2Y2HA 5TGFA 1ESIA 3VSLA 4EWFA 3W8KA 3ZG7B 1SHVA 3PBNA 2XFTA 5A93A 3Q81A 5FASA 3HLFA 1K57C 1JVJA 2Y91A 3HBRA 2Y2GA 1KE3A 1WYBA 1YLYA 1SKFA 1YMSA 4E6WA 3WS0A 3GVBA 4H8RA 4KZ4A 3ZG5A 2XH9A 2HDRA 1LL5A 3MZEA 4BL3A 2WKIA 3IF6A 1PWGA 2C5WB 1FSWA 3WS1A 3PBSA 2FFFB 2V20A 4S2OA 2QMIA 4XUXA 1ES3A 1SDEA 3AGEA 3BLSA 3BFEA 1KDWA 4KG2A 4QY5A 5GLCA 3W4PA 3WS5A 5A90A 3PAGA 4LV3A 3G35A 4MLLA 5DF9A 1BZAA 4UA9A 4R3BA 5FAQA 1NZUA 1H8YA 2WGWB 4OQHA 5HARA 4NETA 1VQQA 3HLGA 5EE8A 1IYOA 4OVDA 3HLCA 1E4DA 4KQOA 4S2PA 2V2FF 5HFOA 5CGWA 5FI7A 2EX8A 4OONA 1TEMA 2XF3A 3G31A 4S2LA 3HLEA 4JF5A 2G2WA 5TR7A 3SS3A 2QPNA 3MKFA 2PBYA 3NDGA 1MWUA 3SH7A 4E3JA 4GKUA 4HBTA 4C75A 4BENA 1ERQA 1ONGA 1ES4A 4QJGA 4A5RA 2BLSA 1IKIA 3HLBA 4N9LA 3E2KA 4DF6A 3AGFA 2H0YA 5KSCA 1C3BA 3A3EA 4QB8A 2H0TA 2E8IA 5AQAA 4GDBA 3BM6A 4L0LA 4OPZA 2HDUA 2ZMAA 2Y2NA 3G2YA 3VP4A 3VP0A 4WELA 1ZKJA 4JXWA 3LEZA 1KGGA 2UWXA 1W8YA 4X68A 4OP5A 3MKEA 3VP1A 5E2EA 4MBHA 5DVAA 3RJUA 2XQZA 2WKHA 4U0TA 4B4ZA 2ZD8A 3PAEA 4JPMA 4MBKA 2WZXA 3CJMA 3FKWA 2P74A 1KE4A 4ZDXA 5E2FA 3LY4A 4KG5A 3Q1FA 1Q2PA 1HVBA 1G6AA 4S2JA 3CG5A 3FV7A 4QD4A 3N4IA 4IBXA 1XP4A 5E2GA 1L2SA 3UE0A 3V3RA 5EVIC 3QNCA 1DJAA 4N1XA 3FYZA 1NYYA 1MBLA 1KVLA 2Z2MB 4JBFA 5JYOA 4C6YA 1NY0A 4WMCD 5AQ7A 2OLUA 1M40A 2X01A 1RGZA 1YQSA 5CECA 3OC2A 1H8ZA 2ZM8A 4ZAMA 5IHVA 2ZC6B 3VP2A 4PM8A 1S6RA 4DXBA 2V1ZA 3ZG9B 4DE0A 3TG9A 4GB7A 1BSGA 4PMAA 3V39A 2I72A 3LO7A 4ZTKA 1Q2QA 5FQQA 2WADA 2ZQ8A 4E3OA 3HL9A 2JBFA 5AQ9A 3SS5A 5FQ9A 4DDSA 3IF6B 3OZHA 4Y0OA 3IWOA 3TSGA 1N9BA 1TVFA 1IYQA 1MXOA 1I2WA 1Z6FA 4KZ8A 3V5MA 5FQMA 3Q7VA 1IELA 3VFHA 1YLTA 4KZ6A 4B88A 3AGDA 3VOZA 2PU2A 1YMXA 4ZJ3A 4GN2A 1H5XA 3N6IA 4LV2A 4OQIA 4EBLA 3ZHHA 2DRWA 1I2SA 3BFFA 4QU3A 5E43A 4OLDA 3ZVTA 1FCMA 4OLGA 2BG1A 3WS2A 4N1HA 3C4PA 4Z9QA 4RX3A 1YLZA 5FATA 5CERA 4E3IA 2Y2JA 3UE3A 4MNRA 4K0WA 5G18A 3A3FA 1WYCA 1GHMA 1G68A 4JXGA 1GCEA 4DE1A 1OMEA 3DTMA 5FAOA 4BD1A 1BLSA 2XGNA 3VP3A 2IWDA 2XEPA 3IF5A 3LY3A 2P9VA 4WEKA 3IT9A 4LENA 4E3LA 2ZQCA 3IWIA 3DW0A 1J9MA 1RGYA 1KVMA 1PW1A 1XA7A 2G2UA 3HUOA 1TDGA 3LCEA 4IBRA 4KZ3A 5U47A 3VOYA 2Q9MA 5CRFA 2ZQ9A 3UPPA 2J8YA 3UPNA 4WZ5C 3MXSA 4KZAA 3VFFA 2Y59A 1K57A 1PIOA 4JXSA 3SH8A 1JTGA 4OPRA 4ZJ1A 1JTDA 2XLNA 1MPLA 1PI5A 1I5QA 4GD6A 1WE4A 3RXWA 4D2OA 4UAAA 4Y0TA 1K56D 1IKGA 2J9PA 4LCLA 1EWZA 1CI8A 2CC1A 5FAPA 1EROA 1BLPA 1IYPA 4WEJA 3NBLA 5JYPA 4WZ5A 5CXWA 2XFSA 2JE5A 1CEFA 2WGIA 5FI2A 3RXXA 1PWCA 1Y54A 4PM5A 1JWVA 3DWKA 3NC8A 1S0WA 3NI9A 4GD8A 5EVLA 2B5RA 3MZFA 4KQRA 4U3TA 5GLBA 1GHPA 4E3NA 1FR6A 3UY6A 3G4PA 3MZDA 5M1AA 2Y2OA 3M6BA 4FSFA 1EI5A 4IVKA 3IH8A 4RVAA 4S2MA 1JWPA 3P09A 1XXMA 2Y2KA 5A92A 2XDMA 2OLVA 3A3DA 2Y2QA 3HLDA 4DXCA 2H5SA 5KZHA 2GDNA 2X71A 4KZ9A 2C6WB 2R9XA 1K25A 4XUZA 5CTNA 4RA7A 3ZGAB 1N4OA 3PBOA 3FKVA 4UA7A 4JXVA 1K55C 2JC7A 4KQQA 5DF8A 5D3OA 4E3KA 3P98A 1MWSA 1ZC2A 5A91A 4Y0UA 4BJPA 1W5DA 4IVIA 4Y7PA 5FA7A 3S4XA 2EFXA 1K54C 2Y55A 3Q7VB 5M19A 4X55A 4EUZA 5DTKA 4OP8A 3W4OA 4Q8IA 3IQAA 2EX9A 3MBZA 4GDNA 5E2HA 1SCWA 4KG6A 1L0GA 1NXYA 2WK0A 3N8RA 2A3UA 4YFMA 4LCMA 2HP6A 5HAIA 2A49A 4X69A 3I7JA 4KENB 1XGJA 1DJCA 3HUNA 3NIAA 4X6TA 4OOLA 3WRZA 2HP9A 2ZC3B 5FQKA 1K54A 4P0MA 5F82A 1MY8A 4U0XA 3GSGA 5FQJA 3UN7A 2Y2LA 2Y4AA 5GHXA 3UO9A 5CHJA 3N8LA 3M2JA 5EVIA 5TFQA 3UDXA 3VMAA 4E6XA 2DNSA 4ID4A 4DRTA 1L0DA 3B3XA 4PPRA 3IHAA 1CK3A 1RP5A 4WBGA 1L0FA 3S1YA 4P87A 2JCHA 5KMWA 3O87A 3IWQA 3N8SA 1YLJA 4WZ4A 4XXRA 1HD8A 3G34A 5AQBA 1E25A 1FSYA 4YINA 3IH9A 3O3VA 3V50A 4DE3A 2VGJA 4OPYA 3ZVWA 2ZJ9A 1MWTA 1PW8A 5HAQA 4RYEA 1ALQA 3IXGA 2WAFA 4QHCA 3GMWA 2H10A 4PM6A 4B4XA 1QMFA 3QNBA 4HEFA 2ZC7A 3OPPA 1ES5A 4IEDA 1TDLA 3A3IA 2XR0A 5CGXA 3G32A
chains in the Genus database with same CATH superfamily
2GJ3A 5HL6A 3NY4A 4HNBA 2EX2A 1KDSA 1Y28A 2ZQAA 4GZBA 1BT5A 3BYDA 1AWIA 3KSIA 1O7EA 2EXBA 1HZOA 5HAPA 5CGSA 3HVFA 3UDIA 4JKTA 1O07A 2W3HA 4R0QA 4P6ZS 2Z2LB 4MDZA 2OAQ1 4BQMA 4C3QA 4LGWA 1PRQA 3C30A 4FUWA 2FZ0A 4DKIA 4P85A 4GHIB 2CMNA 4R4RA 5MC7A 5CEBA 2ZQ7A 4GS9A 4RQ9A 2OAP1 3O88A 1P97A 4QPRA 3QHYA 4Y2FA 3SH9A 2XK1A 1LI0A 1LSWA 3FZCA 5EM0A 1VM1A 4MEZA 3U4LP 1CEGA 1LL9A 5GHYA 2XA7M 3GDIA 3C4OA 4LV1A 2HDSA 4F3LA 2ZL1A 4BLMA 1QMEA 3MXRA 5DF7A 1KGEA 1ERMA 4HESA 4UA6A 4F94A 5CTMA 4JGRA 1FOFA 4BD0A 1K55A 4HP4A 4PM7A 3DWZA 2WYXA 3W4QA 5KSHA 2QZ6A 3A0RA 4UQIM 4OKPA 4OQ0A 2YKFA 5M18A 3LR0A 2W1RA 1M6KA 3QP6A 1K56A 4EU0A 4BBVA 3L9KA 1BLHA 3EQVA 2FFYA 3KO6A 1PZPA 1YSPA 1IYSA 3IS2B 5J7EA 4KZ5A 3IXDA 3NCKA 3PBTA 3KSHA 2Z6CA 4MBFA 4N92A 2PR5A 3ZNTA 4ZBEA 1XJ2A 1VEUB 3BW6A 5F1GA 3M2KA 4BBUA 3IXBA 2QYBA 4O8GA 4X56A 3OPLA 3LIBA 1KE0A 1K4EA 4LRYC 5LBRA 5IT5A 4EWFA 1ESIA 3VSLA 3PBNA 3T4SA 3H7WB 1NLYA 2XA7S 1K57C 5TBMB 4JGQA 4E6WA 1N9NA 2XH9A 3MZEA 4BL3A 3K2NA 3T1XA 1FSWA 4XUXA 3AGEA 2J80A 3BLSA 3ICYA 3BFEA 5GLCA 3PAGA 4MLLA 5DF9A 1H8YA 3HLCA 4S2PA 3MMHA 4II7A 3JPUA 4UQIS 3R4KA 5TR7A 4HJ6A 1CF0A 2A24B 3NDGA 1MWUA 3SH7A 2QJ7A 4HBTA 5F68A 4PHTA 4A5RA 2BLSA 1IKIA 3HLBA 4WUJA 1TS8A 3BY8A 2H0TA 4R38A 2PYPA 4GDBA 4OPZA 3G2YA 4G3KA 4JGPA 4XT2B 3VP0A 1KGGA 1NWZA 2UWXA 3NHQA 3NOTC 3OLOA 4U0TA 2ZD8A 2WZXA 2V0UA 3CJMA 2OWHA 2ZMVA 1HVBA 1G6AA 4S2JA 2WKRA 2VA0A 4IBXA 3UE0A 3JVUA 4HQAA 2FH5A 5EVIC 4NG2A 1MBLA 2LB5A 1IFQA 4WMCD 1N9LA 2PD8A 4Y15A 3NOPC 3T4TA 4L9EA 4DE0A 3LO7A 2JBFA 2PD7A 3OZHA 3IWOA 1N9BA 3MQ0A 1GSXA 1IYQA 5J3WA 2DMWA 1IELA 3VFHA 5AVFA 3DTEA 1IOUA 1YMXA 4GN2A 4OQIA 3N6IA 2Q0OA 4EBLA 3BFFA 2G7UA 4OLDA 3WS2A 5CERA 4DMZA 4YWZA 2OWJA 1VETA 1OMEA 5FAOA 3KSGA 4EXOA 4NXEA 2XGNA 3VP3A 4DJ2A 2XEPA 3IF5A 3LR3A 3LICA 3OOVA 3IT9A 4LENA 3UB7A 4K08A 3D72A 1RGYA 2G2UA 2VZWA 3LCEA 2Q9MA 2VV8A 3UPPA 2J8YA 5L8MA 3UPNA 3MXSA 3EEAA 4EEUA 3CHWP 3SH8A 4ZJ1A 1MPLA 1WE4A 5L07A 4Y0TA 4LCLA 1CI8A 1UGUA 2CC1A 2P7JA 5FAPA 3EGXC 5CXWA 4Y13A 5F6AA 1Y54A 3SW1A 1JWVA 1F5MA 1S0WA 4GD8A 5F5YA 2B5RA 3MXQA 5GLBA 1GHPA 4E3NA 3UY6A 3S7OA 5FDSA 4KUOA 4RVAA 2Y2KA 3PHYA 1PFLA 5DJTA 2D01A 1K0KA 4XUZA 3ZGAB 1N4OA 4DJ3A 3LI9A 4UA7A 4JXVA 1K55C 2JC7A 3F1PB 3F1NB 5A91A 5FL3A 2K7SA 5M19A 4OP8A 3W4OA 4CLCD 4Q8IA 5E2HA 4YFMA 2A3UA 4NXFA 3I7JA 1XGJA 4OOLA 3OBFA 5J4EA 2V1BA 5TFQA 4E6XA 4ID4A 2GNXA 4LPZA 4DRTA 1L0DA 1RP5A 1L0FA 3S1YA 1TS7A 4O0PA 3T4JA 1HD8A 1FSYA 2QWSA 3O3VA 4OPYA 1PW8A 1ALQA 2EWWA 4IUHA 4QHCA 2KOIA 5EFWA 1QMFA 2XR0A 3QP8A 2IA2A 4KUKA 2EXAA 1T18A 2QJ5A 1ZG4A 3A3JA 3WS4A 5EV0A 3MJQA 3GQZA 1GA0A 3IHBA 5HW3A 4GW9A 3IS2A 3NULA 3PBQA 4EBPA 5CHUA 4OOYA 3ZCZA 4GOGA 3EQUA 2Y79A 1FCOA 4R1GA 2PHYA 4WF0A 1GHIA 3UDFA 4WMCA 1VEUA 3T1RA 3CITA 4NK3A 2O9AA 4OH0A 1K4FA 1ES2A 1DRMA 5FQIA 2RL3A 5IU1A 4EERA 1LSVA 4UHUA 3KYEA 4L9GA 3Q82A 1YLWA 4E3MA 4CJNA 3GR2A 4P6ZM 2WKPA 3Q07A 5K5BA 3ITAA 3UPOA 2V8FA 3HCYA 2PU4A 4G3VA 4PKYG 1E3UD 1LHYA 3G6OA 5EUAA 4Y3IA 4OQGA 1EW0A 1W7FA 4I3IA 4O7DA 2EFUA 2A24A 2WKEA 3O86A 3EOIA 2L1MA 4H6JB 1BTLA 2K31A 1CI9A 1P0ZA 2EX6A 3JYIA 3CI6A 3Q7ZA 4Q0HA 1D7EA 2ZBBA 3RH8B 3B33A 2R9WA 4JF4A 5HX9A 1NRJA 2XD1A 4EBNA 4I3AA 2X02A 3RFBA 3GTCA 2ZC4B 1SKOB 5CHMA 3UE6A 5F83A 1ESUA 3T1SA 2ZC5B 4S2NC 3ISGA 1NZOA 4IUKA 1UWPX 4HJ3A 1P9RA 3G30A 4Q0JA 2OSUA 3VSKA 3ZFZA 3NDEA 3BFCA 4EQIA 1LLBA 3T4LA 1MKMA 2HDQA 3ZG7B 2EWVA 1SHVA 5A93A 3Q81A 5FASA 3RTYA 4Y17A 2Y91A 4CLCA 2Y2GA 1WYBA 1SKFA 2W3DA 1BYWA 2VJWA 3ZQ5A 4KZ4A 3E4QA 2WKIA 2J3TD 2C5WB 4X25A 3WS1A 3PBSA 2FFFB 4S2OA 1KDWA 3W4PA 5A90A 2B18A 3WS5A 1X0OA 3G35A 1OTBA 4UA9A 3FC7A 4NETA 5EE8A 3HLGA 2GZAA 1IYOA 4KQOA 3EWKA 1VB6A 5CGWA 4WN5A 3G31A 4IHQA 4JF5A 1G6OA 3MKFA 3QP4A 2PBYA 1KOUA 3CUEA 1H3QA 4BENA 1ERQA 1ONGA 1ES4A 4DF6A 3LEQA 3AGFA 2XROA 5AQAA 3BM6A 3VP4A 1L3LA 4X68A 1W8YA 3CWFA 5E2EA 2WKHA 4LFUA 4NEED 3FKWA 3ULFA 3LY4A 4KG5A 5EVEA 3IX8A 3CG5A 5HPIA 3N4IA 3CPTA 4GJ4A 5C5KA 3FPVA 3QNCA 1DJAA 1FILA 4N1XA 1OJ5A 1NYYA 3FYZA 4UEYA 3TW8A 5CECA 3OC2A 4ZAMA 5IHVA 2W3GA 2V1ZA 4PMAA 1D06A 3V39A 2QHKA 1DP9A 3PR6A 4ETXA 3F1PA 3HL9A 5AQ9A 3F1NA 3KX0X 3IF6B 4Y0OA 1GSVA 1MXOA 3MS6A 5AVEA 3V5MA 5FEFA 4KZ6A 3AGDA 1OJGA 3DBAA 1YPRA 1I2SA 3IX4A 3ZVTA 1FCMA 4OLGA 2BG1A 4N1HA 5FATA 4RX3A 2BASA 2Y2JA 4K0WA 5AJGA 1BLSA 2IWDA 3BQAA 3JVVA 3IWIA 4IBRA 5G4YA 1KVMA 1PW1A 3VOYA 5CRFA 3VV4A 4WZ5C 5DFXA 1PIOA 1PI5A 5HPFA 1IKGA 1F2KA 2J9PA 1EROA 1IYPA 4WEJA 2V8CA 1SZVA 5JYPA 2MJ6A 2XFSA 1PWCA 2PYRA 3NI9A 5EVLA 4CQHA 1STZA 3T4OA 4L9FA 3DTKA 3M6BA 1JWPA 3LIDA 2HJ9C 5A92A 2XDMA 2OLVA 4R70A 2Y2QA 2H5SA 3E4PA 5KZHA 2GDNA 2X71A 2C6WB 1K25A 1CJFA 4RA7A 4EUVA 1XFNA 4E3KA 4Z1WA 3P98A 1MWSA 1ZC2A 5F69A 3C2WA 1W5DA 4Y7PA 5FA7A 3S4XA 2EFXA 4EESA 4X55A 4EUZA 5DTKA 2EX9A 3MBZA 2VV7A 3N8RA 4LCMA 3VE3A 3QP1A 3NIAA 2ZC3B 1K54A 4YNRA 4U0XA 3UMEA 5GHXA 4MN5A 2K2NA 5CHJA 3M2JA 3UDXA 4CLCB 3D9YA 3IHAA 1CK3A 4WBGA 4P87A 3UB5P 2VX8A 5KMWA 3N8SA 1YLJA 1A0KA 1E25A 3TE8A 1OT9A 2VGJA 4DE3A 2W3EA 4RYEA 3IXGA 3MSHA 3GMWA 4LLOB 4QWOA 5DKKA 4B4XA 4IEDA 1ES5A 5CGXA 3G32A 3UMDA 4JF6A 4OOMA 3CLOA 3B42A 4WL9A 1K6SA 3PBRA 3BJNA 4K0XA 5GHZA 3PTEA 5EPHA 4H6JA 3T4KA 3WWXA 5BOHA 2HPBA 1NLZA 1LL8A 1FCNA 5I94A 3C8CA 3QP2A 1S4SA 3TOIA 3MQOA 2J7VA 1HLUP 2M7UA 1K6RA 2ZOHA 1ONHA 2P04A 2WAEA 1SKOA 3GECA 4HOIA 1K38A 3IBRA 1YM1A 2BTFP 3A0SA 3ITBA 1OTIA 5EVID 1F9IA 4GNUA 1FQGA 2L4RA 3CPTB 2Y2IA 5EOEA 4CPKA 2WUQA 3SS4A 2OOLA 5DTSA 1V9YA 3MR0A 4M3KA 1PI4A 4PAUA 2Q9NA 4R23A 3C5AA 4LRXC 1DJBA 1W79A 5FSRA 1BUEA 5DFYA 2JKTI 1YLPA 3MFXA 1XX2A 2ZLYA 4FH2A 1BLCA 3C7UA 3MQQA 3OPRA 5GLDA 4BL2A 4N9KA 2M1CA 4DDYA 4WM9A 5J8XA 4JGOA 1F98A 1LSXA 3LFVA 3SZTA 5FI6A 1T1CA 1IEMA 1W8QA 2WZZA 2ZM0A 3SOIA 4FH4A 2Y2MA 3BECA 5L09A 5HL1A 1LI9A 3H82B 2INWA 4NKPA 2J9OA 1BULA 4S2KA 1H0MA 1JWZA 4MN7A 4KZ7A 3E98A 5GL9A 3GV9A 1HTZA 4R4SA 2RCXA 1OTDA 2ZMFA 2P08A 1YKDA 3HREA 3UNWA 3BFGA 1SDNA 1DY6A 2B95A 4QY6A 5FDHA 4ZJ2A 3T1QB 3L7HA 4X53A 3U2AA 1RCJA 3MFDA 1NJ4A 1NYMA 3PYPA 5HWTA 3LYXA 2V0WA 1J3WA 1ZG6A 5TGFA 3W8KA 2XSSA 3HLFA 2WKQA 1KE3A 1YLYA 4GCZA 3WS0A 1XJ6A 3GVBA 4H8RA 1LL5A 3IF6A 2V20A 2QMIA 1SDEA 4KG2A 1ACFA 4LV3A 2LB9A 1BZAA 4R3BA 5FAQA 2WGWB 5HARA 4G3WA 4OVDA 2V2FF 2PT7A 5FI7A 3FG8A 2EX8A 4OONA 2XF3A 4S2LA 2G2WA 2HF6A 3SS3A 2QPNA 1LT0A 4C75A 1YSQA 4BBTA 2R78A 4N9LA 3E2KA 1C3BA 3T12B 3K3DA 3A3EA 2W0NA 5HD5A 4ESPA 4L0LA 2HDUA 2ZMAA 4X1MA 1S66L 1ZKJA 3LEZA 2AVXA 3MKEA 2M7VA 3VP1A 5DVAA 4B4ZA 2NUPC 4JPMA 2P74A 1KE4A 4ZDXA 2JKTM 5E2FA 1XP4A 3V3RA 3LI8A 5HSQA 2Z2MB 4JBFA 4HHDA 4C6YA 1NY0A 1P9WA 1M40A 2X01A 1RGZA 4DXBA 2W27A 3ZG9B 4GB7A 1BSGA 1TS6A 4ZTKA 3T4QA 4E3OA 4I39A 2XRNA 5FQ9A 4DDSA 3TSGA 1Z6FA 3P7NA 2O99A 4KZ8A 3VE4A 4B88A 4LV2A 4QU3A 4Z9QA 1WA9A 3UE3A 4MNRA 2VEAA 5G18A 3A3FA 1WYCA 1G68A 1ZTUA 2V9AA 2NUTC 4DE1A 3NJAA 4BD1A 2D02A 4HH2A 5HD3A 3LY3A 3NOUC 2P9VA 4E3LA 2ZQCA 1J9MA 1XA7A 4X1LA 1TDGA 5G4ZA 2GX5A 5U47A 3CAXA 2ZQ9A 2VGLS 4B93A 4OPRA 1JTDA 1I5QA 4GD6A 1S1ZA 1S4RA 1EWZA 1D1JA 2VLGA 3T50A 1BLPA 3NBLA 2JE5A 2WGIA 1PNEA 2O9CA 4PM5A 2PDRA 4YOFA 3MZFA 4R6LA 1FR6A 2Y2OA 1EI5A 4IVKA 4S2MA 2JKRI 3W2ZA 5EM1A 3P09A 2V1AA 3A3DA 4DXCA 5A8BA 4ME4A 1XJ3A 3PBOA 5DF8A 5D3OA 1ODVA 2VV6A 4Q0IA 4ARZA 1MZUA 3V67A 2E8JA 3Q7VB 4KQDA 4AFIA 4KG6A 4R3AA 2WK0A 2HP6A 4EETB 5HAIA 2A49A 4KENB 3ZYTA 1DJCA 3PXPA 5FQKA 5F82A 3F1OB 3GSGA 5FQJA 3QP5A 3UN7A 3UO9A 3N8LA 5KIZA 4PPRA 4D60A 3LR4A 3E4OA 2PAVP 4I38A 2Z6DA 4XXRA 3G34A 5AQBA 3LR5A 3IH9A 5HAQA 4PKYA 3KYZA 4Y5FA 4HEFA 2ZC7A 1CQAA 3FPWA 1TDLA 4HI4A 5L2FA 5EECA 4S2IA 5CX7A 3S22A 1E3UA 4MMNA 4K91A 3ZG0A 3P01A 2ZQDA 1GSWA 1KGFA 1XGIA 1MKIA 3N7WA 3FWLA 4HP9A 2VK3A 4GLQA 3H82A 1OPXA 2YKHA 3G2ZA 3BQ8A 3IF6C 1TF1A 2W3FA 1GA9A 2JN7A 4FD8A 3M6HA 1NRFA 3ZDJA 1T1BA 3BLMA 1H8MA 2OV5A 2J3WA 2JHEA 4PM9A 3BWLA 1XKZA 4EQ1A 1XA1A 3CMZA 4JLFA 1PZOA 3C7VA 4HH3A 3OCLA 4HBUA 2W1TA 1PWDA 3OPHA 5EOOA 3A0VA 1MWRA 5EVIB 2O9BA 2VGKA 3BFDA 3O5YA 5GLAA 1U60A 3TRCA 4FOFA 3HJIA 5DTTA 3WRTA 4LRZE 2JKRM 5CEDA 1L0EA 3GRJA 3LUQA 5HDSA 1T19A 1XJ4A 1XPBA 2IWCA 1FR1A 2WGWA 4O01A 1S67L 3HLWA 3UE1A 4OPQA 4NXBA 4WYYA 3D4FA 5HWWA 3CZDA 4LV0A 3R7WA 4ETZA 2IWBA 5I5LA 2JKGA 2P9VB 2A2LA 3E2LA 3B47A 4DE2A 3IXHA 4BMWA 2PRFA 4KZBA 3HUMA 5HDDA 4R3JA 4EV4A 2DCFA 3S7NA 1YT4A 5DJUA 1YAXA 3BEBA 3OCNA 3ZG8B 2HP5A 1G5UA 2ZM2A 4FCFA 4E04A 3C38A 3DTIA 1UWNX 3V3SA 4RX2A 3TJZC 5HWVA 2WGVA 3BRMA 3HJKA 2Y2PA 5HZHA 1OTEA 1PYYA 4GS9B 1AXBA 1FIKA 2XD5A 4CLCC 4P6BA 4S2NA 3ZNYA 3UB8A 5F1FA 2Y2HA 4ZRRA 2XFTA 2KX6A 3HBRA 1JVJA 1YMSA 3ZG5A 2HDRA 1V9ZA 2ZOIA 4F3LB 2ZL1B 4ARZB 1PWGA 3UB6A 2HZ5A 3IX3A 1ES3A 4QY5A 4HJ4A 1NZUA 4OQHA 1VQQA 2EA9A 3CUEC 1E4DA 5HFOA 3KSFA 1TEMA 3HLEA 4E3JA 4GKUA 4QJGA 2HV1A 2H0YA 4FTXA 5KSCA 1S1YA 4EW7A 4QB8A 3LIEA 1G28A 2E8IA 2Y2NA 1JNUA 4WELA 4JXWA 4OP5A 4BWIA 4MBHA 5FEGA 3RJUA 2XQZA 3PAEA 4MBKA 1TS0A 5TJJA 4GHIA 3Q1FA 1Q2PA 5IS1A 3FV7A 4QD4A 5E2GA 1L2SA 3D3OA 3S7QA 5JYOA 1KVLA 2I9VA 5L10A 1T1AA 3MF0A 5AQ7A 2OLUA 1TD5A 3UB9A 4I3JA 1YQSA 1H8ZA 2ZM8A 1XFQA 2ZC6B 5HDCA 4PM8A 3VP2A 1S6RA 3TG9A 1OTAA 2I72A 1Q2QA 5FQQA 2WADA 2ZQ8A 2H28A 3SS5A 1DP8A 4EEPA 3NECA 1TVFA 1I2WA 2JKFA 3S7PA 1W63M 5FQMA 3Q7VA 4IJGA 1YLTA 3VOZA 2PU2A 4ZJ3A 1H5XA 3ZHHA 2DRWA 5E43A 1MC0A 2W1TB 3C4PA 1YLZA 4E3IA 2KLIA 3F1OA 1GHMA 4JXGA 1GCEA 3DTMA 4CLCE 4WEKA 2HGVA 3DW0A 3HUOA 4KZ3A 4KZAA 3VFFA 2Y59A 1K57A 4JXSA 1JTGA 4MN6A 4D2OA 2XLNA 3RXWA 4UAAA 1K56D 3DAVA 3IBJA 3EEHA 2QKPA 3KYQA 4WZ5A 2O0YA 1CEFA 2HJEA 3H9WA 5FI2A 3RXXA 1VHMA 3R7WB 3DWKA 3NC8A 5DKLA 3LGOA 4KQRA 4U3TA 4DN0A 2B02A 3G4PA 2PBDP 3MZDA 5M1AA 4FSFA 3IH8A 1XXMA 2L0WA 2VGLM 3HLDA 3H7WA 4KZ9A 2R9XA 5CTNA 3FKVA 5TBMA 4KQQA 1Y4OA 2Y8HA 3BY9A 2PR6A 4Y0UA 4BJPA 4IVIA 4B9OA 1K54C 2Y55A 3VOLA 2J3TC 4NXGA 3IQAA 4GDNA 3E0YA 1Z09A 1SCWA 1L0GA 1NXYA 1OT6A 4X69A 2UV0E 3HUNA 4MCWA 4X6TA 3WRZA 2HP9A 4P0MA 4WLAA 2KDKA 1MY8A 3EGDC 2Y2LA 2Y4AA 1VETB 2ACGA 5EVIA 3VMAA 1DP6A 2DNSA 1N9OA 2VKSA 3LIFA 3B3XA 4I5SA 1W63Q 2JCHA 3O87A 3IWQA 4WZ4A 4M4XA 4YINA 4HY8A 1ZHHB 3V50A 3ZVWA 2ZJ9A 1MWTA 4XT2A 2WAFA 2H10A 4PM6A 3QNBA 3LIAA 3OPPA 3K3CA 4HIAA 3A3IA
chains in the Genus database with same CATH topology
5EECA 4S2IA 4JF6A 4OOMA 1K6SA 3S22A 3NY4A 1E3UA 4K91A 3PBRA 2EXAA 3ZG0A 2EX2A 1KDSA 4K0XA 5GHZA 3PTEA 2ZQDA 5EPHA 2ZQAA 1ZG4A 3WWXA 3A3JA 2HPBA 3WS4A 5BOHA 1KGFA 1XGIA 4GZBA 1BT5A 3BYDA 1MKIA 3N7WA 1O7EA 1FCNA 2EXBA 5I94A 3FWLA 3GQZA 1HZOA 1GA0A 3IHBA 3G2ZA 5HAPA 5HW3A 5CGSA 3HVFA 3UDIA 3PBQA 3IF6C 4EBPA 4JKTA 5CHUA 3TOIA 1O07A 4R0QA 2J7VA 4OOYA 2Z2LB 1GA9A 4GOGA 3ZCZA 3EQUA 4FD8A 3M6HA 5L2FA 1FCOA 1K6RA 1NRFA 1ONHA 4R1GA 3ZDJA 2WAEA 4BQMA 4C3QA 3BLMA 1K38A 1GHIA 3UDFA 4DKIA 4P85A 4WMCA 2OV5A 1YM1A 3ITBA 4PM9A 5EVID 4R4RA 4GNUA 1FQGA 2ZQ7A 4NK3A 5CEBA 4OH0A 1XKZA 1K4FA 1XA1A 2Y2IA 1ES2A 3CMZA 4JLFA 1PZOA 3C7VA 3O88A 5EOEA 4CPKA 3QHYA 5FQIA 2RL3A 2WUQA 3OCLA 4HBUA 3SS4A 3SH9A 2XK1A 5DTSA 1LI0A 3FZCA 1VM1A 1PWDA 3OPHA 4MEZA 4UHUA 5EOOA 1MWRA 4M3KA 3Q82A 1CEGA 1YLWA 4E3MA 1LL9A 3GR2A 5EVIB 4CJNA 1PI4A 2Q9NA 2VGKA 4R23A 3C5AA 5GHYA 3BFDA 3Q07A 5GLAA 1U60A 3C4OA 4LV1A 3ITAA 1DJBA 1W79A 2HDSA 3UPOA 5FSRA 1BUEA 2PU4A 5DTTA 3WRTA 4BLMA 1E3UD 1QMEA 1YLPA 3MXRA 1XX2A 2ZLYA 4FH2A 1KGEA 1ERMA 5DF7A 1BLCA 4HESA 3C7UA 4UA6A 5CEDA 1L0EA 3GRJA 4F94A 5CTMA 4BD0A 1FOFA 1LHYA 3OPRA 1XPBA 5GLDA 1K55A 2IWCA 5EUAA 4BL2A 1FR1A 2WGWA 4PM7A 4N9KA 3DWZA 4DDYA 4WM9A 3HLWA 2WYXA 4OQGA 3UE1A 4OPQA 5J8XA 3W4QA 1W7FA 4WYYA 5KSHA 2QZ6A 4O7DA 2EFUA 3D4FA 3CZDA 4OKPA 4LV0A 5FI6A 4OQ0A 2WKEA 3O86A 5M18A 2IWBA 1BTLA 1IEMA 1M6KA 1W8QA 2WZZA 2ZM0A 2P9VB 3E2LA 1CI9A 4FH4A 2Y2MA 3SOIA 1K56A 4DE2A 3IXHA 2EX6A 3BECA 3JYIA 5HL1A 1LI9A 4KZBA 3HUMA 1BLHA 3EQVA 2FFYA 1PZPA 3Q7ZA 1IYSA 2J9OA 4R3JA 1BULA 2R9WA 4S2KA 4KZ5A 4EV4A 2DCFA 4JF4A 3IXDA 1YT4A 1JWZA 3NCKA 4KZ7A 5HX9A 3BEBA 2XD1A 3OCNA 3PBTA 2HP5A 3ZG8B 5GL9A 3GV9A 1HTZA 4R4SA 4EBNA 2ZM2A 2X02A 4FCFA 2RCXA 3GTCA 2ZC4B 3V3SA 5CHMA 5F83A 4RX2A 4MBFA 4N92A 1ESUA 3ZNTA 3HREA 2WGVA 2ZC5B 4S2NC 3BRMA 3ISGA 5F1GA 4ZBEA 1NZOA 3M2KA 2Y2PA 3UNWA 3BFGA 3IXBA 3G30A 1PYYA 2OSUA 1SDNA 1AXBA 1DY6A 4QY6A 5FDHA 3VSKA 3ZFZA 4ZJ2A 2XD5A 3NDEA 4X56A 4X53A 3BFCA 1RCJA 3MFDA 3OPLA 4P6BA 4EQIA 1KE0A 1K4EA 1NJ4A 1NYMA 4S2NA 3ZNYA 1LLBA 5F1FA 1ZG6A 2HDQA 2Y2HA 5TGFA 1ESIA 3VSLA 4EWFA 3W8KA 3ZG7B 1SHVA 3PBNA 2XFTA 5A93A 3Q81A 5FASA 3HLFA 1K57C 1JVJA 2Y91A 3HBRA 2Y2GA 1KE3A 1WYBA 1YLYA 1SKFA 1YMSA 4E6WA 3WS0A 3GVBA 4H8RA 4KZ4A 3ZG5A 2XH9A 2HDRA 1LL5A 3MZEA 4BL3A 2WKIA 3IF6A 1PWGA 2C5WB 1FSWA 3WS1A 3PBSA 2FFFB 2V20A 4S2OA 2QMIA 4XUXA 1ES3A 1SDEA 3AGEA 3BLSA 3BFEA 1KDWA 4KG2A 4QY5A 5GLCA 3W4PA 3WS5A 5A90A 3PAGA 4LV3A 3G35A 4MLLA 5DF9A 1BZAA 4UA9A 4R3BA 5FAQA 1NZUA 1H8YA 2WGWB 4OQHA 5HARA 4NETA 1VQQA 3HLGA 5EE8A 1IYOA 4OVDA 3HLCA 1E4DA 4KQOA 4S2PA 2V2FF 5HFOA 5CGWA 5FI7A 2EX8A 4OONA 1TEMA 2XF3A 3G31A 4S2LA 3HLEA 4JF5A 2G2WA 5TR7A 3SS3A 2QPNA 3MKFA 2PBYA 3NDGA 1MWUA 3SH7A 4E3JA 4GKUA 4HBTA 4C75A 4BENA 1ERQA 1ONGA 1ES4A 4QJGA 4A5RA 2BLSA 1IKIA 3HLBA 4N9LA 3E2KA 4DF6A 3AGFA 2H0YA 5KSCA 1C3BA 3A3EA 4QB8A 2H0TA 2E8IA 5AQAA 4GDBA 3BM6A 4L0LA 4OPZA 2HDUA 2ZMAA 2Y2NA 3G2YA 3VP4A 3VP0A 4WELA 1ZKJA 4JXWA 3LEZA 1KGGA 2UWXA 1W8YA 4X68A 4OP5A 3MKEA 3VP1A 5E2EA 4MBHA 5DVAA 3RJUA 2XQZA 2WKHA 4U0TA 4B4ZA 2ZD8A 3PAEA 4JPMA 4MBKA 2WZXA 3CJMA 3FKWA 2P74A 1KE4A 4ZDXA 5E2FA 3LY4A 4KG5A 3Q1FA 1Q2PA 1HVBA 1G6AA 4S2JA 3CG5A 3FV7A 4QD4A 3N4IA 4IBXA 1XP4A 5E2GA 1L2SA 3UE0A 3V3RA 5EVIC 3QNCA 1DJAA 4N1XA 3FYZA 1NYYA 1MBLA 1KVLA 2Z2MB 4JBFA 5JYOA 4C6YA 1NY0A 4WMCD 5AQ7A 2OLUA 1M40A 2X01A 1RGZA 1YQSA 5CECA 3OC2A 1H8ZA 2ZM8A 4ZAMA 5IHVA 2ZC6B 3VP2A 4PM8A 1S6RA 4DXBA 2V1ZA 3ZG9B 4DE0A 3TG9A 4GB7A 1BSGA 4PMAA 3V39A 2I72A 3LO7A 4ZTKA 1Q2QA 5FQQA 2WADA 2ZQ8A 4E3OA 3HL9A 2JBFA 5AQ9A 3SS5A 5FQ9A 4DDSA 3IF6B 3OZHA 4Y0OA 3IWOA 3TSGA 1N9BA 1TVFA 1IYQA 1MXOA 1I2WA 1Z6FA 4KZ8A 3V5MA 5FQMA 3Q7VA 1IELA 3VFHA 1YLTA 4KZ6A 4B88A 3AGDA 3VOZA 2PU2A 1YMXA 4ZJ3A 4GN2A 1H5XA 3N6IA 4LV2A 4OQIA 4EBLA 3ZHHA 2DRWA 1I2SA 3BFFA 4QU3A 5E43A 4OLDA 3ZVTA 1FCMA 4OLGA 2BG1A 3WS2A 4N1HA 3C4PA 4Z9QA 4RX3A 1YLZA 5FATA 5CERA 4E3IA 2Y2JA 3UE3A 4MNRA 4K0WA 5G18A 3A3FA 1WYCA 1GHMA 1G68A 4JXGA 1GCEA 4DE1A 1OMEA 3DTMA 5FAOA 4BD1A 1BLSA 2XGNA 3VP3A 2IWDA 2XEPA 3IF5A 3LY3A 2P9VA 4WEKA 3IT9A 4LENA 4E3LA 2ZQCA 3IWIA 3DW0A 1J9MA 1RGYA 1KVMA 1PW1A 1XA7A 2G2UA 3HUOA 1TDGA 3LCEA 4IBRA 4KZ3A 5U47A 3VOYA 2Q9MA 5CRFA 2ZQ9A 3UPPA 2J8YA 3UPNA 4WZ5C 3MXSA 4KZAA 3VFFA 2Y59A 1K57A 1PIOA 4JXSA 3SH8A 1JTGA 4OPRA 4ZJ1A 1JTDA 2XLNA 1MPLA 1PI5A 1I5QA 4GD6A 1WE4A 3RXWA 4D2OA 4UAAA 4Y0TA 1K56D 1IKGA 2J9PA 4LCLA 1EWZA 1CI8A 2CC1A 5FAPA 1EROA 1BLPA 1IYPA 4WEJA 3NBLA 5JYPA 4WZ5A 5CXWA 2XFSA 2JE5A 1CEFA 2WGIA 5FI2A 3RXXA 1PWCA 1Y54A 4PM5A 1JWVA 3DWKA 3NC8A 1S0WA 3NI9A 4GD8A 5EVLA 2B5RA 3MZFA 4KQRA 4U3TA 5GLBA 1GHPA 4E3NA 1FR6A 3UY6A 3G4PA 3MZDA 5M1AA 2Y2OA 3M6BA 4FSFA 1EI5A 4IVKA 3IH8A 4RVAA 4S2MA 1JWPA 3P09A 1XXMA 2Y2KA 5A92A 2XDMA 2OLVA 3A3DA 2Y2QA 3HLDA 4DXCA 2H5SA 5KZHA 2GDNA 2X71A 4KZ9A 2C6WB 2R9XA 1K25A 4XUZA 5CTNA 4RA7A 3ZGAB 1N4OA 3PBOA 3FKVA 4UA7A 4JXVA 1K55C 2JC7A 4KQQA 5DF8A 5D3OA 4E3KA 3P98A 1MWSA 1ZC2A 5A91A 4Y0UA 4BJPA 1W5DA 4IVIA 4Y7PA 5FA7A 3S4XA 2EFXA 1K54C 2Y55A 3Q7VB 5M19A 4X55A 4EUZA 5DTKA 4OP8A 3W4OA 4Q8IA 3IQAA 2EX9A 3MBZA 4GDNA 5E2HA 1SCWA 4KG6A 1L0GA 1NXYA 2WK0A 3N8RA 2A3UA 4YFMA 4LCMA 2HP6A 5HAIA 2A49A 4X69A 3I7JA 4KENB 1XGJA 1DJCA 3HUNA 3NIAA 4X6TA 4OOLA 3WRZA 2HP9A 2ZC3B 5FQKA 1K54A 4P0MA 5F82A 1MY8A 4U0XA 3GSGA 5FQJA 3UN7A 2Y2LA 2Y4AA 5GHXA 3UO9A 5CHJA 3N8LA 3M2JA 5EVIA 5TFQA 3UDXA 3VMAA 4E6XA 2DNSA 4ID4A 4DRTA 1L0DA 3B3XA 4PPRA 3IHAA 1CK3A 1RP5A 4WBGA 1L0FA 3S1YA 4P87A 2JCHA 5KMWA 3O87A 3IWQA 3N8SA 1YLJA 4WZ4A 4XXRA 1HD8A 3G34A 5AQBA 1E25A 1FSYA 4YINA 3IH9A 3O3VA 3V50A 4DE3A 2VGJA 4OPYA 3ZVWA 2ZJ9A 1MWTA 1PW8A 5HAQA 4RYEA 1ALQA 3IXGA 2WAFA 4QHCA 3GMWA 2H10A 4PM6A 4B4XA 1QMFA 3QNBA 4HEFA 2ZC7A 3OPPA 1ES5A 4IEDA 1TDLA 3A3IA 2XR0A 5CGXA 3G32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EEC A;  4S2I A;  4JF6 A;  4OOM A;  1K6S A;  3S22 A;  3NY4 A;  1E3U A;  4K91 A;  3PBR A;  2EXA A;  3ZG0 A;  2EX2 A;  1KDS A;  4K0X A;  5GHZ A;  3PTE A;  2ZQD A;  5EPH A;  2ZQA A;  1ZG4 A;  3WWX A;  3A3J A;  2HPB A;  3WS4 A;  5BOH A;  1KGF A;  1XGI A;  4GZB A;  1BT5 A;  3BYD A;  1MKI A;  3N7W A;  1O7E A;  1FCN A;  2EXB A;  5I94 A;  3FWL A;  3GQZ A;  1HZO A;  1GA0 A;  3IHB A;  3G2Z A;  5HAP A;  5HW3 A;  5CGS A;  3HVF A;  3UDI A;  3PBQ A;  3IF6 C;  4EBP A;  4JKT A;  5CHU A;  3TOI A;  1O07 A;  4R0Q A;  2J7V A;  4OOY A;  2Z2L B;  1GA9 A;  4GOG A;  3ZCZ A;  3EQU A;  4FD8 A;  3M6H A;  5L2F A;  1FCO A;  1K6R A;  1NRF A;  1ONH A;  4R1G A;  3ZDJ A;  2WAE A;  4BQM A;  4C3Q A;  3BLM A;  1K38 A;  1GHI A;  3UDF A;  4DKI A;  4P85 A;  4WMC A;  2OV5 A;  1YM1 A;  3ITB A;  4PM9 A;  5EVI D;  4R4R A;  4GNU A;  1FQG A;  2ZQ7 A;  4NK3 A;  5CEB A;  4OH0 A;  1XKZ A;  1K4F A;  1XA1 A;  2Y2I A;  1ES2 A;  3CMZ A;  4JLF A;  1PZO A;  3C7V A;  3O88 A;  5EOE A;  4CPK A;  3QHY A;  5FQI A;  2RL3 A;  2WUQ A;  3OCL A;  4HBU A;  3SS4 A;  3SH9 A;  2XK1 A;  5DTS A;  1LI0 A;  3FZC A;  1VM1 A;  1PWD A;  3OPH A;  4MEZ A;  4UHU A;  5EOO A;  1MWR A;  4M3K A;  3Q82 A;  1CEG A;  1YLW A;  4E3M A;  1LL9 A;  3GR2 A;  5EVI B;  4CJN A;  1PI4 A;  2Q9N A;  2VGK A;  4R23 A;  3C5A A;  5GHY A;  3BFD A;  3Q07 A;  5GLA A;  1U60 A;  3C4O A;  4LV1 A;  3ITA A;  1DJB A;  1W79 A;  2HDS A;  3UPO A;  5FSR A;  1BUE A;  2PU4 A;  5DTT A;  3WRT A;  4BLM A;  1E3U D;  1QME A;  1YLP A;  3MXR A;  1XX2 A;  2ZLY A;  4FH2 A;  1KGE A;  1ERM A;  5DF7 A;  1BLC A;  4HES A;  3C7U A;  4UA6 A;  5CED A;  1L0E A;  3GRJ A;  4F94 A;  5CTM A;  4BD0 A;  1FOF A;  1LHY A;  3OPR A;  1XPB A;  5GLD A;  1K55 A;  2IWC A;  5EUA A;  4BL2 A;  1FR1 A;  2WGW A;  4PM7 A;  4N9K A;  3DWZ A;  4DDY A;  4WM9 A;  3HLW A;  2WYX A;  4OQG A;  3UE1 A;  4OPQ A;  5J8X A;  3W4Q A;  1W7F A;  4WYY A;  5KSH A;  2QZ6 A;  4O7D A;  2EFU A;  3D4F A;  3CZD A;  4OKP A;  4LV0 A;  5FI6 A;  4OQ0 A;  2WKE A;  3O86 A;  5M18 A;  2IWB A;  1BTL A;  1IEM A;  1M6K A;  1W8Q A;  2WZZ A;  2ZM0 A;  2P9V B;  3E2L A;  1CI9 A;  4FH4 A;  2Y2M A;  3SOI A;  1K56 A;  4DE2 A;  3IXH A;  2EX6 A;  3BEC A;  3JYI A;  5HL1 A;  1LI9 A;  4KZB A;  3HUM A;  1BLH A;  3EQV A;  2FFY A;  1PZP A;  3Q7Z A;  1IYS A;  2J9O A;  4R3J A;  1BUL A;  2R9W A;  4S2K A;  4KZ5 A;  4EV4 A;  2DCF A;  4JF4 A;  3IXD A;  1YT4 A;  1JWZ A;  3NCK A;  4KZ7 A;  5HX9 A;  3BEB A;  2XD1 A;  3OCN A;  3PBT A;  2HP5 A;  3ZG8 B;  5GL9 A;  3GV9 A;  1HTZ A;  4R4S A;  4EBN A;  2ZM2 A;  2X02 A;  4FCF A;  2RCX A;  3GTC A;  2ZC4 B;  3V3S A;  5CHM A;  5F83 A;  4RX2 A;  4MBF A;  4N92 A;  1ESU A;  3ZNT A;  3HRE A;  2WGV A;  2ZC5 B;  4S2N C;  3BRM A;  3ISG A;  5F1G A;  4ZBE A;  1NZO A;  3M2K A;  2Y2P A;  3UNW A;  3BFG A;  3IXB A;  3G30 A;  1PYY A;  2OSU A;  1SDN A;  1AXB A;  1DY6 A;  4QY6 A;  5FDH A;  3VSK A;  3ZFZ A;  4ZJ2 A;  2XD5 A;  3NDE A;  4X56 A;  4X53 A;  3BFC A;  1RCJ A;  3MFD A;  3OPL A;  4P6B A;  4EQI A;  1KE0 A;  1K4E A;  1NJ4 A;  1NYM A;  4S2N A;  3ZNY A;  1LLB A;  5F1F A;  1ZG6 A;  2HDQ A;  2Y2H A;  5TGF A;  1ESI A;  3VSL A;  4EWF A;  3W8K A;  3ZG7 B;  1SHV A;  3PBN A;  2XFT A;  5A93 A;  3Q81 A;  5FAS A;  3HLF A;  1K57 C;  1JVJ A;  2Y91 A;  3HBR A;  2Y2G A;  1KE3 A;  1WYB A;  1YLY A;  1SKF A;  1YMS A;  4E6W A;  3WS0 A;  3GVB A;  4H8R A;  4KZ4 A;  3ZG5 A;  2XH9 A;  2HDR A;  1LL5 A;  3MZE A;  4BL3 A;  2WKI A;  3IF6 A;  1PWG A;  2C5W B;  1FSW A;  3WS1 A;  3PBS A;  2FFF B;  2V20 A;  4S2O A;  2QMI A;  4XUX A;  1ES3 A;  1SDE A;  3AGE A;  3BLS A;  3BFE A;  1KDW A;  4KG2 A;  4QY5 A;  5GLC A;  3W4P A;  3WS5 A;  5A90 A;  3PAG A;  4LV3 A;  3G35 A;  4MLL A;  5DF9 A;  1BZA A;  4UA9 A;  4R3B A;  5FAQ A;  1NZU A;  1H8Y A;  2WGW B;  4OQH A;  5HAR A;  4NET A;  1VQQ A;  3HLG A;  5EE8 A;  1IYO A;  4OVD A;  3HLC A;  1E4D A;  4KQO A;  4S2P A;  2V2F F;  5HFO A;  5CGW A;  5FI7 A;  2EX8 A;  4OON A;  1TEM A;  2XF3 A;  3G31 A;  4S2L A;  3HLE A;  4JF5 A;  2G2W A;  5TR7 A;  3SS3 A;  2QPN A;  3MKF A;  2PBY A;  3NDG A;  1MWU A;  3SH7 A;  4E3J A;  4GKU A;  4HBT A;  4C75 A;  4BEN A;  1ERQ A;  1ONG A;  1ES4 A;  4QJG A;  4A5R A;  2BLS A;  1IKI A;  3HLB A;  4N9L A;  3E2K A;  4DF6 A;  3AGF A;  2H0Y A;  5KSC A;  1C3B A;  3A3E A;  4QB8 A;  2H0T A;  2E8I A;  5AQA A;  4GDB A;  3BM6 A;  4L0L A;  4OPZ A;  2HDU A;  2ZMA A;  2Y2N A;  3G2Y A;  3VP4 A;  3VP0 A;  4WEL A;  1ZKJ A;  4JXW A;  3LEZ A;  1KGG A;  2UWX A;  1W8Y A;  4X68 A;  4OP5 A;  3MKE A;  3VP1 A;  5E2E A;  4MBH A;  5DVA A;  3RJU A;  2XQZ A;  2WKH A;  4U0T A;  4B4Z A;  2ZD8 A;  3PAE A;  4JPM A;  4MBK A;  2WZX A;  3CJM A;  3FKW A;  2P74 A;  1KE4 A;  4ZDX A;  5E2F A;  3LY4 A;  4KG5 A;  3Q1F A;  1Q2P A;  1HVB A;  1G6A A;  4S2J A;  3CG5 A;  3FV7 A;  4QD4 A;  3N4I A;  4IBX A;  1XP4 A;  5E2G A;  1L2S A;  3UE0 A;  3V3R A;  5EVI C;  3QNC A;  1DJA A;  4N1X A;  3FYZ A;  1NYY A;  1MBL A;  1KVL A;  2Z2M B;  4JBF A;  5JYO A;  4C6Y A;  1NY0 A;  4WMC D;  5AQ7 A;  2OLU A;  1M40 A;  2X01 A;  1RGZ A;  1YQS A;  5CEC A;  3OC2 A;  1H8Z A;  2ZM8 A;  4ZAM A;  5IHV A;  2ZC6 B;  3VP2 A;  4PM8 A;  1S6R A;  4DXB A;  2V1Z A;  3ZG9 B;  4DE0 A;  3TG9 A;  4GB7 A;  1BSG A;  4PMA A;  3V39 A;  2I72 A;  3LO7 A;  4ZTK A;  1Q2Q A;  5FQQ A;  2WAD A;  2ZQ8 A;  4E3O A;  3HL9 A;  2JBF A;  5AQ9 A;  3SS5 A;  5FQ9 A;  4DDS A;  3IF6 B;  3OZH A;  4Y0O A;  3IWO A;  3TSG A;  1N9B A;  1TVF A;  1IYQ A;  1MXO A;  1I2W A;  1Z6F A;  4KZ8 A;  3V5M A;  5FQM A;  3Q7V A;  1IEL A;  3VFH A;  1YLT A;  4KZ6 A;  4B88 A;  3AGD A;  3VOZ A;  2PU2 A;  1YMX A;  4ZJ3 A;  4GN2 A;  1H5X A;  3N6I A;  4LV2 A;  4OQI A;  4EBL A;  3ZHH A;  2DRW A;  1I2S A;  3BFF A;  4QU3 A;  5E43 A;  4OLD A;  3ZVT A;  1FCM A;  4OLG A;  2BG1 A;  3WS2 A;  4N1H A;  3C4P A;  4Z9Q A;  4RX3 A;  1YLZ A;  5FAT A;  5CER A;  4E3I A;  2Y2J A;  3UE3 A;  4MNR A;  4K0W A;  5G18 A;  3A3F A;  1WYC A;  1GHM A;  1G68 A;  4JXG A;  1GCE A;  4DE1 A;  1OME A;  3DTM A;  5FAO A;  4BD1 A;  1BLS A;  2XGN A;  3VP3 A;  2IWD A;  2XEP A;  3IF5 A;  3LY3 A;  2P9V A;  4WEK A;  3IT9 A;  4LEN A;  4E3L A;  2ZQC A;  3IWI A;  3DW0 A;  1J9M A;  1RGY A;  1KVM A;  1PW1 A;  1XA7 A;  2G2U A;  3HUO A;  1TDG A;  3LCE A;  4IBR A;  4KZ3 A;  5U47 A;  3VOY A;  2Q9M A;  5CRF A;  2ZQ9 A;  3UPP A;  2J8Y A;  3UPN A;  4WZ5 C;  3MXS A;  4KZA A;  3VFF A;  2Y59 A;  1K57 A;  1PIO A;  4JXS A;  3SH8 A;  1JTG A;  4OPR A;  4ZJ1 A;  1JTD A;  2XLN A;  1MPL A;  1PI5 A;  1I5Q A;  4GD6 A;  1WE4 A;  3RXW A;  4D2O A;  4UAA A;  4Y0T A;  1K56 D;  1IKG A;  2J9P A;  4LCL A;  1EWZ A;  1CI8 A;  2CC1 A;  5FAP A;  1ERO A;  1BLP A;  1IYP A;  4WEJ A;  3NBL A;  5JYP A;  4WZ5 A;  5CXW A;  2XFS A;  2JE5 A;  1CEF A;  2WGI A;  5FI2 A;  3RXX A;  1PWC A;  1Y54 A;  4PM5 A;  1JWV A;  3DWK A;  3NC8 A;  1S0W A;  3NI9 A;  4GD8 A;  5EVL A;  2B5R A;  3MZF A;  4KQR A;  4U3T A;  5GLB A;  1GHP A;  4E3N A;  1FR6 A;  3UY6 A;  3G4P A;  3MZD A;  5M1A A;  2Y2O A;  3M6B A;  4FSF A;  1EI5 A;  4IVK A;  3IH8 A;  4RVA A;  4S2M A;  1JWP A;  3P09 A;  1XXM A;  2Y2K A;  5A92 A;  2XDM A;  2OLV A;  3A3D A;  2Y2Q A;  3HLD A;  4DXC A;  2H5S A;  5KZH A;  2GDN A;  2X71 A;  4KZ9 A;  2C6W B;  2R9X A;  1K25 A;  4XUZ A;  5CTN A;  4RA7 A;  3ZGA B;  1N4O A;  3PBO A;  3FKV A;  4UA7 A;  4JXV A;  1K55 C;  2JC7 A;  4KQQ A;  5DF8 A;  5D3O A;  4E3K A;  3P98 A;  1MWS A;  1ZC2 A;  5A91 A;  4Y0U A;  4BJP A;  1W5D A;  4IVI A;  4Y7P A;  5FA7 A;  3S4X A;  2EFX A;  1K54 C;  2Y55 A;  3Q7V B;  5M19 A;  4X55 A;  4EUZ A;  5DTK A;  4OP8 A;  3W4O A;  4Q8I A;  3IQA A;  2EX9 A;  3MBZ A;  4GDN A;  5E2H A;  1SCW A;  4KG6 A;  1L0G A;  1NXY A;  2WK0 A;  3N8R A;  2A3U A;  4YFM A;  4LCM A;  2HP6 A;  5HAI A;  2A49 A;  4X69 A;  3I7J A;  4KEN B;  1XGJ A;  1DJC A;  3HUN A;  3NIA A;  4X6T A;  4OOL A;  3WRZ A;  2HP9 A;  2ZC3 B;  5FQK A;  1K54 A;  4P0M A;  5F82 A;  1MY8 A;  4U0X A;  3GSG A;  5FQJ A;  3UN7 A;  2Y2L A;  2Y4A A;  5GHX A;  3UO9 A;  5CHJ A;  3N8L A;  3M2J A;  5EVI A;  5TFQ A;  3UDX A;  3VMA A;  4E6X A;  2DNS A;  4ID4 A;  4DRT A;  1L0D A;  3B3X A;  4PPR A;  3IHA A;  1CK3 A;  1RP5 A;  4WBG A;  1L0F A;  3S1Y A;  4P87 A;  2JCH A;  5KMW A;  3O87 A;  3IWQ A;  3N8S A;  1YLJ A;  4WZ4 A;  4XXR A;  1HD8 A;  3G34 A;  5AQB A;  1E25 A;  1FSY A;  4YIN A;  3IH9 A;  3O3V A;  3V50 A;  4DE3 A;  2VGJ A;  4OPY A;  3ZVW A;  2ZJ9 A;  1MWT A;  1PW8 A;  5HAQ A;  4RYE A;  1ALQ A;  3IXG A;  2WAF A;  4QHC A;  3GMW A;  2H10 A;  4PM6 A;  4B4X A;  1QMF A;  3QNB A;  4HEF A;  2ZC7 A;  3OPP A;  1ES5 A;  4IED A;  1TDL A;  3A3I A;  2XR0 A;  5CGX A;  3G32 A; 
#chains in the Genus database with same CATH topology
 2GJ3 A;  5HL6 A;  3NY4 A;  4HNB A;  2EX2 A;  1KDS A;  1Y28 A;  2ZQA A;  4GZB A;  1BT5 A;  3BYD A;  1AWI A;  3KSI A;  1O7E A;  2EXB A;  1HZO A;  5HAP A;  5CGS A;  3HVF A;  3UDI A;  4JKT A;  1O07 A;  2W3H A;  4R0Q A;  4P6Z S;  2Z2L B;  4MDZ A;  2OAQ 1;  4BQM A;  4C3Q A;  4LGW A;  1PRQ A;  3C30 A;  4FUW A;  2FZ0 A;  4DKI A;  4P85 A;  4GHI B;  2CMN A;  4R4R A;  5MC7 A;  5CEB A;  2ZQ7 A;  4GS9 A;  4RQ9 A;  2OAP 1;  3O88 A;  1P97 A;  4QPR A;  3QHY A;  4Y2F A;  3SH9 A;  2XK1 A;  1LI0 A;  1LSW A;  3FZC A;  5EM0 A;  1VM1 A;  4MEZ A;  3U4L P;  1CEG A;  1LL9 A;  5GHY A;  2XA7 M;  3GDI A;  3C4O A;  4LV1 A;  2HDS A;  4F3L A;  2ZL1 A;  4BLM A;  1QME A;  3MXR A;  5DF7 A;  1KGE A;  1ERM A;  4HES A;  4UA6 A;  4F94 A;  5CTM A;  4JGR A;  1FOF A;  4BD0 A;  1K55 A;  4HP4 A;  4PM7 A;  3DWZ A;  2WYX A;  3W4Q A;  5KSH A;  2QZ6 A;  3A0R A;  4UQI M;  4OKP A;  4OQ0 A;  2YKF A;  5M18 A;  3LR0 A;  2W1R A;  1M6K A;  3QP6 A;  1K56 A;  4EU0 A;  4BBV A;  3L9K A;  1BLH A;  3EQV A;  2FFY A;  3KO6 A;  1PZP A;  1YSP A;  1IYS A;  3IS2 B;  5J7E A;  4KZ5 A;  3IXD A;  3NCK A;  3PBT A;  3KSH A;  2Z6C A;  4MBF A;  4N92 A;  2PR5 A;  3ZNT A;  4ZBE A;  1XJ2 A;  1VEU B;  3BW6 A;  5F1G A;  3M2K A;  4BBU A;  3IXB A;  2QYB A;  4O8G A;  4X56 A;  3OPL A;  3LIB A;  1KE0 A;  1K4E A;  4LRY C;  5LBR A;  5IT5 A;  4EWF A;  1ESI A;  3VSL A;  3PBN A;  3T4S A;  3H7W B;  1NLY A;  2XA7 S;  1K57 C;  5TBM B;  4JGQ A;  4E6W A;  1N9N A;  2XH9 A;  3MZE A;  4BL3 A;  3K2N A;  3T1X A;  1FSW A;  4XUX A;  3AGE A;  2J80 A;  3BLS A;  3ICY A;  3BFE A;  5GLC A;  3PAG A;  4MLL A;  5DF9 A;  1H8Y A;  3HLC A;  4S2P A;  3MMH A;  4II7 A;  3JPU A;  4UQI S;  3R4K A;  5TR7 A;  4HJ6 A;  1CF0 A;  2A24 B;  3NDG A;  1MWU A;  3SH7 A;  2QJ7 A;  4HBT A;  5F68 A;  4PHT A;  4A5R A;  2BLS A;  1IKI A;  3HLB A;  4WUJ A;  1TS8 A;  3BY8 A;  2H0T A;  4R38 A;  2PYP A;  4GDB A;  4OPZ A;  3G2Y A;  4G3K A;  4JGP A;  4XT2 B;  3VP0 A;  1KGG A;  1NWZ A;  2UWX A;  3NHQ A;  3NOT C;  3OLO A;  4U0T A;  2ZD8 A;  2WZX A;  2V0U A;  3CJM A;  2OWH A;  2ZMV A;  1HVB A;  1G6A A;  4S2J A;  2WKR A;  2VA0 A;  4IBX A;  3UE0 A;  3JVU A;  4HQA A;  2FH5 A;  5EVI C;  4NG2 A;  1MBL A;  2LB5 A;  1IFQ A;  4WMC D;  1N9L A;  2PD8 A;  4Y15 A;  3NOP C;  3T4T A;  4L9E A;  4DE0 A;  3LO7 A;  2JBF A;  2PD7 A;  3OZH A;  3IWO A;  1N9B A;  3MQ0 A;  1GSX A;  1IYQ A;  5J3W A;  2DMW A;  1IEL A;  3VFH A;  5AVF A;  3DTE A;  1IOU A;  1YMX A;  4GN2 A;  4OQI A;  3N6I A;  2Q0O A;  4EBL A;  3BFF A;  2G7U A;  4OLD A;  3WS2 A;  5CER A;  4DMZ A;  4YWZ A;  2OWJ A;  1VET A;  1OME A;  5FAO A;  3KSG A;  4EXO A;  4NXE A;  2XGN A;  3VP3 A;  4DJ2 A;  2XEP A;  3IF5 A;  3LR3 A;  3LIC A;  3OOV A;  3IT9 A;  4LEN A;  3UB7 A;  4K08 A;  3D72 A;  1RGY A;  2G2U A;  2VZW A;  3LCE A;  2Q9M A;  2VV8 A;  3UPP A;  2J8Y A;  5L8M A;  3UPN A;  3MXS A;  3EEA A;  4EEU A;  3CHW P;  3SH8 A;  4ZJ1 A;  1MPL A;  1WE4 A;  5L07 A;  4Y0T A;  4LCL A;  1CI8 A;  1UGU A;  2CC1 A;  2P7J A;  5FAP A;  3EGX C;  5CXW A;  4Y13 A;  5F6A A;  1Y54 A;  3SW1 A;  1JWV A;  1F5M A;  1S0W A;  4GD8 A;  5F5Y A;  2B5R A;  3MXQ A;  5GLB A;  1GHP A;  4E3N A;  3UY6 A;  3S7O A;  5FDS A;  4KUO A;  4RVA A;  2Y2K A;  3PHY A;  1PFL A;  5DJT A;  2D01 A;  1K0K A;  4XUZ A;  3ZGA B;  1N4O A;  4DJ3 A;  3LI9 A;  4UA7 A;  4JXV A;  1K55 C;  2JC7 A;  3F1P B;  3F1N B;  5A91 A;  5FL3 A;  2K7S A;  5M19 A;  4OP8 A;  3W4O A;  4CLC D;  4Q8I A;  5E2H A;  4YFM A;  2A3U A;  4NXF A;  3I7J A;  1XGJ A;  4OOL A;  3OBF A;  5J4E A;  2V1B A;  5TFQ A;  4E6X A;  4ID4 A;  2GNX A;  4LPZ A;  4DRT A;  1L0D A;  1RP5 A;  1L0F A;  3S1Y A;  1TS7 A;  4O0P A;  3T4J A;  1HD8 A;  1FSY A;  2QWS A;  3O3V A;  4OPY A;  1PW8 A;  1ALQ A;  2EWW A;  4IUH A;  4QHC A;  2KOI A;  5EFW A;  1QMF A;  2XR0 A;  3QP8 A;  2IA2 A;  4KUK A;  2EXA A;  1T18 A;  2QJ5 A;  1ZG4 A;  3A3J A;  3WS4 A;  5EV0 A;  3MJQ A;  3GQZ A;  1GA0 A;  3IHB A;  5HW3 A;  4GW9 A;  3IS2 A;  3NUL A;  3PBQ A;  4EBP A;  5CHU A;  4OOY A;  3ZCZ A;  4GOG A;  3EQU A;  2Y79 A;  1FCO A;  4R1G A;  2PHY A;  4WF0 A;  1GHI A;  3UDF A;  4WMC A;  1VEU A;  3T1R A;  3CIT A;  4NK3 A;  2O9A A;  4OH0 A;  1K4F A;  1ES2 A;  1DRM A;  5FQI A;  2RL3 A;  5IU1 A;  4EER A;  1LSV A;  4UHU A;  3KYE A;  4L9G A;  3Q82 A;  1YLW A;  4E3M A;  4CJN A;  3GR2 A;  4P6Z M;  2WKP A;  3Q07 A;  5K5B A;  3ITA A;  3UPO A;  2V8F A;  3HCY A;  2PU4 A;  4G3V A;  4PKY G;  1E3U D;  1LHY A;  3G6O A;  5EUA A;  4Y3I A;  4OQG A;  1EW0 A;  1W7F A;  4I3I A;  4O7D A;  2EFU A;  2A24 A;  2WKE A;  3O86 A;  3EOI A;  2L1M A;  4H6J B;  1BTL A;  2K31 A;  1CI9 A;  1P0Z A;  2EX6 A;  3JYI A;  3CI6 A;  3Q7Z A;  4Q0H A;  1D7E A;  2ZBB A;  3RH8 B;  3B33 A;  2R9W A;  4JF4 A;  5HX9 A;  1NRJ A;  2XD1 A;  4EBN A;  4I3A A;  2X02 A;  3RFB A;  3GTC A;  2ZC4 B;  1SKO B;  5CHM A;  3UE6 A;  5F83 A;  1ESU A;  3T1S A;  2ZC5 B;  4S2N C;  3ISG A;  1NZO A;  4IUK A;  1UWP X;  4HJ3 A;  1P9R A;  3G30 A;  4Q0J A;  2OSU A;  3VSK A;  3ZFZ A;  3NDE A;  3BFC A;  4EQI A;  1LLB A;  3T4L A;  1MKM A;  2HDQ A;  3ZG7 B;  2EWV A;  1SHV A;  5A93 A;  3Q81 A;  5FAS A;  3RTY A;  4Y17 A;  2Y91 A;  4CLC A;  2Y2G A;  1WYB A;  1SKF A;  2W3D A;  1BYW A;  2VJW A;  3ZQ5 A;  4KZ4 A;  3E4Q A;  2WKI A;  2J3T D;  2C5W B;  4X25 A;  3WS1 A;  3PBS A;  2FFF B;  4S2O A;  1KDW A;  3W4P A;  5A90 A;  2B18 A;  3WS5 A;  1X0O A;  3G35 A;  1OTB A;  4UA9 A;  3FC7 A;  4NET A;  5EE8 A;  3HLG A;  2GZA A;  1IYO A;  4KQO A;  3EWK A;  1VB6 A;  5CGW A;  4WN5 A;  3G31 A;  4IHQ A;  4JF5 A;  1G6O A;  3MKF A;  3QP4 A;  2PBY A;  1KOU A;  3CUE A;  1H3Q A;  4BEN A;  1ERQ A;  1ONG A;  1ES4 A;  4DF6 A;  3LEQ A;  3AGF A;  2XRO A;  5AQA A;  3BM6 A;  3VP4 A;  1L3L A;  4X68 A;  1W8Y A;  3CWF A;  5E2E A;  2WKH A;  4LFU A;  4NEE D;  3FKW A;  3ULF A;  3LY4 A;  4KG5 A;  5EVE A;  3IX8 A;  3CG5 A;  5HPI A;  3N4I A;  3CPT A;  4GJ4 A;  5C5K A;  3FPV A;  3QNC A;  1DJA A;  1FIL A;  4N1X A;  1OJ5 A;  1NYY A;  3FYZ A;  4UEY A;  3TW8 A;  5CEC A;  3OC2 A;  4ZAM A;  5IHV A;  2W3G A;  2V1Z A;  4PMA A;  1D06 A;  3V39 A;  2QHK A;  1DP9 A;  3PR6 A;  4ETX A;  3F1P A;  3HL9 A;  5AQ9 A;  3F1N A;  3KX0 X;  3IF6 B;  4Y0O A;  1GSV A;  1MXO A;  3MS6 A;  5AVE A;  3V5M A;  5FEF A;  4KZ6 A;  3AGD A;  1OJG A;  3DBA A;  1YPR A;  1I2S A;  3IX4 A;  3ZVT A;  1FCM A;  4OLG A;  2BG1 A;  4N1H A;  5FAT A;  4RX3 A;  2BAS A;  2Y2J A;  4K0W A;  5AJG A;  1BLS A;  2IWD A;  3BQA A;  3JVV A;  3IWI A;  4IBR A;  5G4Y A;  1KVM A;  1PW1 A;  3VOY A;  5CRF A;  3VV4 A;  4WZ5 C;  5DFX A;  1PIO A;  1PI5 A;  5HPF A;  1IKG A;  1F2K A;  2J9P A;  1ERO A;  1IYP A;  4WEJ A;  2V8C A;  1SZV A;  5JYP A;  2MJ6 A;  2XFS A;  1PWC A;  2PYR A;  3NI9 A;  5EVL A;  4CQH A;  1STZ A;  3T4O A;  4L9F A;  3DTK A;  3M6B A;  1JWP A;  3LID A;  2HJ9 C;  5A92 A;  2XDM A;  2OLV A;  4R70 A;  2Y2Q A;  2H5S A;  3E4P A;  5KZH A;  2GDN A;  2X71 A;  2C6W B;  1K25 A;  1CJF A;  4RA7 A;  4EUV A;  1XFN A;  4E3K A;  4Z1W A;  3P98 A;  1MWS A;  1ZC2 A;  5F69 A;  3C2W A;  1W5D A;  4Y7P A;  5FA7 A;  3S4X A;  2EFX A;  4EES A;  4X55 A;  4EUZ A;  5DTK A;  2EX9 A;  3MBZ A;  2VV7 A;  3N8R A;  4LCM A;  3VE3 A;  3QP1 A;  3NIA A;  2ZC3 B;  1K54 A;  4YNR A;  4U0X A;  3UME A;  5GHX A;  4MN5 A;  2K2N A;  5CHJ A;  3M2J A;  3UDX A;  4CLC B;  3D9Y A;  3IHA A;  1CK3 A;  4WBG A;  4P87 A;  3UB5 P;  2VX8 A;  5KMW A;  3N8S A;  1YLJ A;  1A0K A;  1E25 A;  3TE8 A;  1OT9 A;  2VGJ A;  4DE3 A;  2W3E A;  4RYE A;  3IXG A;  3MSH A;  3GMW A;  4LLO B;  4QWO A;  5DKK A;  4B4X A;  4IED A;  1ES5 A;  5CGX A;  3G32 A;  3UMD A;  4JF6 A;  4OOM A;  3CLO A;  3B42 A;  4WL9 A;  1K6S A;  3PBR A;  3BJN A;  4K0X A;  5GHZ A;  3PTE A;  5EPH A;  4H6J A;  3T4K A;  3WWX A;  5BOH A;  2HPB A;  1NLZ A;  1LL8 A;  1FCN A;  5I94 A;  3C8C A;  3QP2 A;  1S4S A;  3TOI A;  3MQO A;  2J7V A;  1HLU P;  2M7U A;  1K6R A;  2ZOH A;  1ONH A;  2P04 A;  2WAE A;  1SKO A;  3GEC A;  4HOI A;  1K38 A;  3IBR A;  1YM1 A;  2BTF P;  3A0S A;  3ITB A;  1OTI A;  5EVI D;  1F9I A;  4GNU A;  1FQG A;  2L4R A;  3CPT B;  2Y2I A;  5EOE A;  4CPK A;  2WUQ A;  3SS4 A;  2OOL A;  5DTS A;  1V9Y A;  3MR0 A;  4M3K A;  1PI4 A;  4PAU A;  2Q9N A;  4R23 A;  3C5A A;  4LRX C;  1DJB A;  1W79 A;  5FSR A;  1BUE A;  5DFY A;  2JKT I;  1YLP A;  3MFX A;  1XX2 A;  2ZLY A;  4FH2 A;  1BLC A;  3C7U A;  3MQQ A;  3OPR A;  5GLD A;  4BL2 A;  4N9K A;  2M1C A;  4DDY A;  4WM9 A;  5J8X A;  4JGO A;  1F98 A;  1LSX A;  3LFV A;  3SZT A;  5FI6 A;  1T1C A;  1IEM A;  1W8Q A;  2WZZ A;  2ZM0 A;  3SOI A;  4FH4 A;  2Y2M A;  3BEC A;  5L09 A;  5HL1 A;  1LI9 A;  3H82 B;  2INW A;  4NKP A;  2J9O A;  1BUL A;  4S2K A;  1H0M A;  1JWZ A;  4MN7 A;  4KZ7 A;  3E98 A;  5GL9 A;  3GV9 A;  1HTZ A;  4R4S A;  2RCX A;  1OTD A;  2ZMF A;  2P08 A;  1YKD A;  3HRE A;  3UNW A;  3BFG A;  1SDN A;  1DY6 A;  2B95 A;  4QY6 A;  5FDH A;  4ZJ2 A;  3T1Q B;  3L7H A;  4X53 A;  3U2A A;  1RCJ A;  3MFD A;  1NJ4 A;  1NYM A;  3PYP A;  5HWT A;  3LYX A;  2V0W A;  1J3W A;  1ZG6 A;  5TGF A;  3W8K A;  2XSS A;  3HLF A;  2WKQ A;  1KE3 A;  1YLY A;  4GCZ A;  3WS0 A;  1XJ6 A;  3GVB A;  4H8R A;  1LL5 A;  3IF6 A;  2V20 A;  2QMI A;  1SDE A;  4KG2 A;  1ACF A;  4LV3 A;  2LB9 A;  1BZA A;  4R3B A;  5FAQ A;  2WGW B;  5HAR A;  4G3W A;  4OVD A;  2V2F F;  2PT7 A;  5FI7 A;  3FG8 A;  2EX8 A;  4OON A;  2XF3 A;  4S2L A;  2G2W A;  2HF6 A;  3SS3 A;  2QPN A;  1LT0 A;  4C75 A;  1YSQ A;  4BBT A;  2R78 A;  4N9L A;  3E2K A;  1C3B A;  3T12 B;  3K3D A;  3A3E A;  2W0N A;  5HD5 A;  4ESP A;  4L0L A;  2HDU A;  2ZMA A;  4X1M A;  1S66 L;  1ZKJ A;  3LEZ A;  2AVX A;  3MKE A;  2M7V A;  3VP1 A;  5DVA A;  4B4Z A;  2NUP C;  4JPM A;  2P74 A;  1KE4 A;  4ZDX A;  2JKT M;  5E2F A;  1XP4 A;  3V3R A;  3LI8 A;  5HSQ A;  2Z2M B;  4JBF A;  4HHD A;  4C6Y A;  1NY0 A;  1P9W A;  1M40 A;  2X01 A;  1RGZ A;  4DXB A;  2W27 A;  3ZG9 B;  4GB7 A;  1BSG A;  1TS6 A;  4ZTK A;  3T4Q A;  4E3O A;  4I39 A;  2XRN A;  5FQ9 A;  4DDS A;  3TSG A;  1Z6F A;  3P7N A;  2O99 A;  4KZ8 A;  3VE4 A;  4B88 A;  4LV2 A;  4QU3 A;  4Z9Q A;  1WA9 A;  3UE3 A;  4MNR A;  2VEA A;  5G18 A;  3A3F A;  1WYC A;  1G68 A;  1ZTU A;  2V9A A;  2NUT C;  4DE1 A;  3NJA A;  4BD1 A;  2D02 A;  4HH2 A;  5HD3 A;  3LY3 A;  3NOU C;  2P9V A;  4E3L A;  2ZQC A;  1J9M A;  1XA7 A;  4X1L A;  1TDG A;  5G4Z A;  2GX5 A;  5U47 A;  3CAX A;  2ZQ9 A;  2VGL S;  4B93 A;  4OPR A;  1JTD A;  1I5Q A;  4GD6 A;  1S1Z A;  1S4R A;  1EWZ A;  1D1J A;  2VLG A;  3T50 A;  1BLP A;  3NBL A;  2JE5 A;  2WGI A;  1PNE A;  2O9C A;  4PM5 A;  2PDR A;  4YOF A;  3MZF A;  4R6L A;  1FR6 A;  2Y2O A;  1EI5 A;  4IVK A;  4S2M A;  2JKR I;  3W2Z A;  5EM1 A;  3P09 A;  2V1A A;  3A3D A;  4DXC A;  5A8B A;  4ME4 A;  1XJ3 A;  3PBO A;  5DF8 A;  5D3O A;  1ODV A;  2VV6 A;  4Q0I A;  4ARZ A;  1MZU A;  3V67 A;  2E8J A;  3Q7V B;  4KQD A;  4AFI A;  4KG6 A;  4R3A A;  2WK0 A;  2HP6 A;  4EET B;  5HAI A;  2A49 A;  4KEN B;  3ZYT A;  1DJC A;  3PXP A;  5FQK A;  5F82 A;  3F1O B;  3GSG A;  5FQJ A;  3QP5 A;  3UN7 A;  3UO9 A;  3N8L A;  5KIZ A;  4PPR A;  4D60 A;  3LR4 A;  3E4O A;  2PAV P;  4I38 A;  2Z6D A;  4XXR A;  3G34 A;  5AQB A;  3LR5 A;  3IH9 A;  5HAQ A;  4PKY A;  3KYZ A;  4Y5F A;  4HEF A;  2ZC7 A;  1CQA A;  3FPW A;  1TDL A;  4HI4 A;  5L2F A;  5EEC A;  4S2I A;  5CX7 A;  3S22 A;  1E3U A;  4MMN A;  4K91 A;  3ZG0 A;  3P01 A;  2ZQD A;  1GSW A;  1KGF A;  1XGI A;  1MKI A;  3N7W A;  3FWL A;  4HP9 A;  2VK3 A;  4GLQ A;  3H82 A;  1OPX A;  2YKH A;  3G2Z A;  3BQ8 A;  3IF6 C;  1TF1 A;  2W3F A;  1GA9 A;  2JN7 A;  4FD8 A;  3M6H A;  1NRF A;  3ZDJ A;  1T1B A;  3BLM A;  1H8M A;  2OV5 A;  2J3W A;  2JHE A;  4PM9 A;  3BWL A;  1XKZ A;  4EQ1 A;  1XA1 A;  3CMZ A;  4JLF A;  1PZO A;  3C7V A;  4HH3 A;  3OCL A;  4HBU A;  2W1T A;  1PWD A;  3OPH A;  5EOO A;  3A0V A;  1MWR A;  5EVI B;  2O9B A;  2VGK A;  3BFD A;  3O5Y A;  5GLA A;  1U60 A;  3TRC A;  4FOF A;  3HJI A;  5DTT A;  3WRT A;  4LRZ E;  2JKR M;  5CED A;  1L0E A;  3GRJ A;  3LUQ A;  5HDS A;  1T19 A;  1XJ4 A;  1XPB A;  2IWC A;  1FR1 A;  2WGW A;  4O01 A;  1S67 L;  3HLW A;  3UE1 A;  4OPQ A;  4NXB A;  4WYY A;  3D4F A;  5HWW A;  3CZD A;  4LV0 A;  3R7W A;  4ETZ A;  2IWB A;  5I5L A;  2JKG A;  2P9V B;  2A2L A;  3E2L A;  3B47 A;  4DE2 A;  3IXH A;  4BMW A;  2PRF A;  4KZB A;  3HUM A;  5HDD A;  4R3J A;  4EV4 A;  2DCF A;  3S7N A;  1YT4 A;  5DJU A;  1YAX A;  3BEB A;  3OCN A;  3ZG8 B;  2HP5 A;  1G5U A;  2ZM2 A;  4FCF A;  4E04 A;  3C38 A;  3DTI A;  1UWN X;  3V3S A;  4RX2 A;  3TJZ C;  5HWV A;  2WGV A;  3BRM A;  3HJK A;  2Y2P A;  5HZH A;  1OTE A;  1PYY A;  4GS9 B;  1AXB A;  1FIK A;  2XD5 A;  4CLC C;  4P6B A;  4S2N A;  3ZNY A;  3UB8 A;  5F1F A;  2Y2H A;  4ZRR A;  2XFT A;  2KX6 A;  3HBR A;  1JVJ A;  1YMS A;  3ZG5 A;  2HDR A;  1V9Z A;  2ZOI A;  4F3L B;  2ZL1 B;  4ARZ B;  1PWG A;  3UB6 A;  2HZ5 A;  3IX3 A;  1ES3 A;  4QY5 A;  4HJ4 A;  1NZU A;  4OQH A;  1VQQ A;  2EA9 A;  3CUE C;  1E4D A;  5HFO A;  3KSF A;  1TEM A;  3HLE A;  4E3J A;  4GKU A;  4QJG A;  2HV1 A;  2H0Y A;  4FTX A;  5KSC A;  1S1Y A;  4EW7 A;  4QB8 A;  3LIE A;  1G28 A;  2E8I A;  2Y2N A;  1JNU A;  4WEL A;  4JXW A;  4OP5 A;  4BWI A;  4MBH A;  5FEG A;  3RJU A;  2XQZ A;  3PAE A;  4MBK A;  1TS0 A;  5TJJ A;  4GHI A;  3Q1F A;  1Q2P A;  5IS1 A;  3FV7 A;  4QD4 A;  5E2G A;  1L2S A;  3D3O A;  3S7Q A;  5JYO A;  1KVL A;  2I9V A;  5L10 A;  1T1A A;  3MF0 A;  5AQ7 A;  2OLU A;  1TD5 A;  3UB9 A;  4I3J A;  1YQS A;  1H8Z A;  2ZM8 A;  1XFQ A;  2ZC6 B;  5HDC A;  4PM8 A;  3VP2 A;  1S6R A;  3TG9 A;  1OTA A;  2I72 A;  1Q2Q A;  5FQQ A;  2WAD A;  2ZQ8 A;  2H28 A;  3SS5 A;  1DP8 A;  4EEP A;  3NEC A;  1TVF A;  1I2W A;  2JKF A;  3S7P A;  1W63 M;  5FQM A;  3Q7V A;  4IJG A;  1YLT A;  3VOZ A;  2PU2 A;  4ZJ3 A;  1H5X A;  3ZHH A;  2DRW A;  5E43 A;  1MC0 A;  2W1T B;  3C4P A;  1YLZ A;  4E3I A;  2KLI A;  3F1O A;  1GHM A;  4JXG A;  1GCE A;  3DTM A;  4CLC E;  4WEK A;  2HGV A;  3DW0 A;  3HUO A;  4KZ3 A;  4KZA A;  3VFF A;  2Y59 A;  1K57 A;  4JXS A;  1JTG A;  4MN6 A;  4D2O A;  2XLN A;  3RXW A;  4UAA A;  1K56 D;  3DAV A;  3IBJ A;  3EEH A;  2QKP A;  3KYQ A;  4WZ5 A;  2O0Y A;  1CEF A;  2HJE A;  3H9W A;  5FI2 A;  3RXX A;  1VHM A;  3R7W B;  3DWK A;  3NC8 A;  5DKL A;  3LGO A;  4KQR A;  4U3T A;  4DN0 A;  2B02 A;  3G4P A;  2PBD P;  3MZD A;  5M1A A;  4FSF A;  3IH8 A;  1XXM A;  2L0W A;  2VGL M;  3HLD A;  3H7W A;  4KZ9 A;  2R9X A;  5CTN A;  3FKV A;  5TBM A;  4KQQ A;  1Y4O A;  2Y8H A;  3BY9 A;  2PR6 A;  4Y0U A;  4BJP A;  4IVI A;  4B9O A;  1K54 C;  2Y55 A;  3VOL A;  2J3T C;  4NXG A;  3IQA A;  4GDN A;  3E0Y A;  1Z09 A;  1SCW A;  1L0G A;  1NXY A;  1OT6 A;  4X69 A;  2UV0 E;  3HUN A;  4MCW A;  4X6T A;  3WRZ A;  2HP9 A;  4P0M A;  4WLA A;  2KDK A;  1MY8 A;  3EGD C;  2Y2L A;  2Y4A A;  1VET B;  2ACG A;  5EVI A;  3VMA A;  1DP6 A;  2DNS A;  1N9O A;  2VKS A;  3LIF A;  3B3X A;  4I5S A;  1W63 Q;  2JCH A;  3O87 A;  3IWQ A;  4WZ4 A;  4M4X A;  4YIN A;  4HY8 A;  1ZHH B;  3V50 A;  3ZVW A;  2ZJ9 A;  1MWT A;  4XT2 A;  2WAF A;  2H10 A;  4PM6 A;  3QNB A;  3LIA A;  3OPP A;  3K3C A;  4HIA A;  3A3I A; 
#chains in the Genus database with same CATH homology
 5EEC A;  4S2I A;  4JF6 A;  4OOM A;  1K6S A;  3S22 A;  3NY4 A;  1E3U A;  4K91 A;  3PBR A;  2EXA A;  3ZG0 A;  2EX2 A;  1KDS A;  4K0X A;  5GHZ A;  3PTE A;  2ZQD A;  5EPH A;  2ZQA A;  1ZG4 A;  3WWX A;  3A3J A;  2HPB A;  3WS4 A;  5BOH A;  1KGF A;  1XGI A;  4GZB A;  1BT5 A;  3BYD A;  1MKI A;  3N7W A;  1O7E A;  1FCN A;  2EXB A;  5I94 A;  3FWL A;  3GQZ A;  1HZO A;  1GA0 A;  3IHB A;  3G2Z A;  5HAP A;  5HW3 A;  5CGS A;  3HVF A;  3UDI A;  3PBQ A;  3IF6 C;  4EBP A;  4JKT A;  5CHU A;  3TOI A;  1O07 A;  4R0Q A;  2J7V A;  4OOY A;  2Z2L B;  1GA9 A;  4GOG A;  3ZCZ A;  3EQU A;  4FD8 A;  3M6H A;  5L2F A;  1FCO A;  1K6R A;  1NRF A;  1ONH A;  4R1G A;  3ZDJ A;  2WAE A;  4BQM A;  4C3Q A;  3BLM A;  1K38 A;  1GHI A;  3UDF A;  4DKI A;  4P85 A;  4WMC A;  2OV5 A;  1YM1 A;  3ITB A;  4PM9 A;  5EVI D;  4R4R A;  4GNU A;  1FQG A;  2ZQ7 A;  4NK3 A;  5CEB A;  4OH0 A;  1XKZ A;  1K4F A;  1XA1 A;  2Y2I A;  1ES2 A;  3CMZ A;  4JLF A;  1PZO A;  3C7V A;  3O88 A;  5EOE A;  4CPK A;  3QHY A;  5FQI A;  2RL3 A;  2WUQ A;  3OCL A;  4HBU A;  3SS4 A;  3SH9 A;  2XK1 A;  5DTS A;  1LI0 A;  3FZC A;  1VM1 A;  1PWD A;  3OPH A;  4MEZ A;  4UHU A;  5EOO A;  1MWR A;  4M3K A;  3Q82 A;  1CEG A;  1YLW A;  4E3M A;  1LL9 A;  3GR2 A;  5EVI B;  4CJN A;  1PI4 A;  2Q9N A;  2VGK A;  4R23 A;  3C5A A;  5GHY A;  3BFD A;  3Q07 A;  5GLA A;  1U60 A;  3C4O A;  4LV1 A;  3ITA A;  1DJB A;  1W79 A;  2HDS A;  3UPO A;  5FSR A;  1BUE A;  2PU4 A;  5DTT A;  3WRT A;  4BLM A;  1E3U D;  1QME A;  1YLP A;  3MXR A;  1XX2 A;  2ZLY A;  4FH2 A;  1KGE A;  1ERM A;  5DF7 A;  1BLC A;  4HES A;  3C7U A;  4UA6 A;  5CED A;  1L0E A;  3GRJ A;  4F94 A;  5CTM A;  4BD0 A;  1FOF A;  1LHY A;  3OPR A;  1XPB A;  5GLD A;  1K55 A;  2IWC A;  5EUA A;  4BL2 A;  1FR1 A;  2WGW A;  4PM7 A;  4N9K A;  3DWZ A;  4DDY A;  4WM9 A;  3HLW A;  2WYX A;  4OQG A;  3UE1 A;  4OPQ A;  5J8X A;  3W4Q A;  1W7F A;  4WYY A;  5KSH A;  2QZ6 A;  4O7D A;  2EFU A;  3D4F A;  3CZD A;  4OKP A;  4LV0 A;  5FI6 A;  4OQ0 A;  2WKE A;  3O86 A;  5M18 A;  2IWB A;  1BTL A;  1IEM A;  1M6K A;  1W8Q A;  2WZZ A;  2ZM0 A;  2P9V B;  3E2L A;  1CI9 A;  4FH4 A;  2Y2M A;  3SOI A;  1K56 A;  4DE2 A;  3IXH A;  2EX6 A;  3BEC A;  3JYI A;  5HL1 A;  1LI9 A;  4KZB A;  3HUM A;  1BLH A;  3EQV A;  2FFY A;  1PZP A;  3Q7Z A;  1IYS A;  2J9O A;  4R3J A;  1BUL A;  2R9W A;  4S2K A;  4KZ5 A;  4EV4 A;  2DCF A;  4JF4 A;  3IXD A;  1YT4 A;  1JWZ A;  3NCK A;  4KZ7 A;  5HX9 A;  3BEB A;  2XD1 A;  3OCN A;  3PBT A;  2HP5 A;  3ZG8 B;  5GL9 A;  3GV9 A;  1HTZ A;  4R4S A;  4EBN A;  2ZM2 A;  2X02 A;  4FCF A;  2RCX A;  3GTC A;  2ZC4 B;  3V3S A;  5CHM A;  5F83 A;  4RX2 A;  4MBF A;  4N92 A;  1ESU A;  3ZNT A;  3HRE A;  2WGV A;  2ZC5 B;  4S2N C;  3BRM A;  3ISG A;  5F1G A;  4ZBE A;  1NZO A;  3M2K A;  2Y2P A;  3UNW A;  3BFG A;  3IXB A;  3G30 A;  1PYY A;  2OSU A;  1SDN A;  1AXB A;  1DY6 A;  4QY6 A;  5FDH A;  3VSK A;  3ZFZ A;  4ZJ2 A;  2XD5 A;  3NDE A;  4X56 A;  4X53 A;  3BFC A;  1RCJ A;  3MFD A;  3OPL A;  4P6B A;  4EQI A;  1KE0 A;  1K4E A;  1NJ4 A;  1NYM A;  4S2N A;  3ZNY A;  1LLB A;  5F1F A;  1ZG6 A;  2HDQ A;  2Y2H A;  5TGF A;  1ESI A;  3VSL A;  4EWF A;  3W8K A;  3ZG7 B;  1SHV A;  3PBN A;  2XFT A;  5A93 A;  3Q81 A;  5FAS A;  3HLF A;  1K57 C;  1JVJ A;  2Y91 A;  3HBR A;  2Y2G A;  1KE3 A;  1WYB A;  1YLY A;  1SKF A;  1YMS A;  4E6W A;  3WS0 A;  3GVB A;  4H8R A;  4KZ4 A;  3ZG5 A;  2XH9 A;  2HDR A;  1LL5 A;  3MZE A;  4BL3 A;  2WKI A;  3IF6 A;  1PWG A;  2C5W B;  1FSW A;  3WS1 A;  3PBS A;  2FFF B;  2V20 A;  4S2O A;  2QMI A;  4XUX A;  1ES3 A;  1SDE A;  3AGE A;  3BLS A;  3BFE A;  1KDW A;  4KG2 A;  4QY5 A;  5GLC A;  3W4P A;  3WS5 A;  5A90 A;  3PAG A;  4LV3 A;  3G35 A;  4MLL A;  5DF9 A;  1BZA A;  4UA9 A;  4R3B A;  5FAQ A;  1NZU A;  1H8Y A;  2WGW B;  4OQH A;  5HAR A;  4NET A;  1VQQ A;  3HLG A;  5EE8 A;  1IYO A;  4OVD A;  3HLC A;  1E4D A;  4KQO A;  4S2P A;  2V2F F;  5HFO A;  5CGW A;  5FI7 A;  2EX8 A;  4OON A;  1TEM A;  2XF3 A;  3G31 A;  4S2L A;  3HLE A;  4JF5 A;  2G2W A;  5TR7 A;  3SS3 A;  2QPN A;  3MKF A;  2PBY A;  3NDG A;  1MWU A;  3SH7 A;  4E3J A;  4GKU A;  4HBT A;  4C75 A;  4BEN A;  1ERQ A;  1ONG A;  1ES4 A;  4QJG A;  4A5R A;  2BLS A;  1IKI A;  3HLB A;  4N9L A;  3E2K A;  4DF6 A;  3AGF A;  2H0Y A;  5KSC A;  1C3B A;  3A3E A;  4QB8 A;  2H0T A;  2E8I A;  5AQA A;  4GDB A;  3BM6 A;  4L0L A;  4OPZ A;  2HDU A;  2ZMA A;  2Y2N A;  3G2Y A;  3VP4 A;  3VP0 A;  4WEL A;  1ZKJ A;  4JXW A;  3LEZ A;  1KGG A;  2UWX A;  1W8Y A;  4X68 A;  4OP5 A;  3MKE A;  3VP1 A;  5E2E A;  4MBH A;  5DVA A;  3RJU A;  2XQZ A;  2WKH A;  4U0T A;  4B4Z A;  2ZD8 A;  3PAE A;  4JPM A;  4MBK A;  2WZX A;  3CJM A;  3FKW A;  2P74 A;  1KE4 A;  4ZDX A;  5E2F A;  3LY4 A;  4KG5 A;  3Q1F A;  1Q2P A;  1HVB A;  1G6A A;  4S2J A;  3CG5 A;  3FV7 A;  4QD4 A;  3N4I A;  4IBX A;  1XP4 A;  5E2G A;  1L2S A;  3UE0 A;  3V3R A;  5EVI C;  3QNC A;  1DJA A;  4N1X A;  3FYZ A;  1NYY A;  1MBL A;  1KVL A;  2Z2M B;  4JBF A;  5JYO A;  4C6Y A;  1NY0 A;  4WMC D;  5AQ7 A;  2OLU A;  1M40 A;  2X01 A;  1RGZ A;  1YQS A;  5CEC A;  3OC2 A;  1H8Z A;  2ZM8 A;  4ZAM A;  5IHV A;  2ZC6 B;  3VP2 A;  4PM8 A;  1S6R A;  4DXB A;  2V1Z A;  3ZG9 B;  4DE0 A;  3TG9 A;  4GB7 A;  1BSG A;  4PMA A;  3V39 A;  2I72 A;  3LO7 A;  4ZTK A;  1Q2Q A;  5FQQ A;  2WAD A;  2ZQ8 A;  4E3O A;  3HL9 A;  2JBF A;  5AQ9 A;  3SS5 A;  5FQ9 A;  4DDS A;  3IF6 B;  3OZH A;  4Y0O A;  3IWO A;  3TSG A;  1N9B A;  1TVF A;  1IYQ A;  1MXO A;  1I2W A;  1Z6F A;  4KZ8 A;  3V5M A;  5FQM A;  3Q7V A;  1IEL A;  3VFH A;  1YLT A;  4KZ6 A;  4B88 A;  3AGD A;  3VOZ A;  2PU2 A;  1YMX A;  4ZJ3 A;  4GN2 A;  1H5X A;  3N6I A;  4LV2 A;  4OQI A;  4EBL A;  3ZHH A;  2DRW A;  1I2S A;  3BFF A;  4QU3 A;  5E43 A;  4OLD A;  3ZVT A;  1FCM A;  4OLG A;  2BG1 A;  3WS2 A;  4N1H A;  3C4P A;  4Z9Q A;  4RX3 A;  1YLZ A;  5FAT A;  5CER A;  4E3I A;  2Y2J A;  3UE3 A;  4MNR A;  4K0W A;  5G18 A;  3A3F A;  1WYC A;  1GHM A;  1G68 A;  4JXG A;  1GCE A;  4DE1 A;  1OME A;  3DTM A;  5FAO A;  4BD1 A;  1BLS A;  2XGN A;  3VP3 A;  2IWD A;  2XEP A;  3IF5 A;  3LY3 A;  2P9V A;  4WEK A;  3IT9 A;  4LEN A;  4E3L A;  2ZQC A;  3IWI A;  3DW0 A;  1J9M A;  1RGY A;  1KVM A;  1PW1 A;  1XA7 A;  2G2U A;  3HUO A;  1TDG A;  3LCE A;  4IBR A;  4KZ3 A;  5U47 A;  3VOY A;  2Q9M A;  5CRF A;  2ZQ9 A;  3UPP A;  2J8Y A;  3UPN A;  4WZ5 C;  3MXS A;  4KZA A;  3VFF A;  2Y59 A;  1K57 A;  1PIO A;  4JXS A;  3SH8 A;  1JTG A;  4OPR A;  4ZJ1 A;  1JTD A;  2XLN A;  1MPL A;  1PI5 A;  1I5Q A;  4GD6 A;  1WE4 A;  3RXW A;  4D2O A;  4UAA A;  4Y0T A;  1K56 D;  1IKG A;  2J9P A;  4LCL A;  1EWZ A;  1CI8 A;  2CC1 A;  5FAP A;  1ERO A;  1BLP A;  1IYP A;  4WEJ A;  3NBL A;  5JYP A;  4WZ5 A;  5CXW A;  2XFS A;  2JE5 A;  1CEF A;  2WGI A;  5FI2 A;  3RXX A;  1PWC A;  1Y54 A;  4PM5 A;  1JWV A;  3DWK A;  3NC8 A;  1S0W A;  3NI9 A;  4GD8 A;  5EVL A;  2B5R A;  3MZF A;  4KQR A;  4U3T A;  5GLB A;  1GHP A;  4E3N A;  1FR6 A;  3UY6 A;  3G4P A;  3MZD A;  5M1A A;  2Y2O A;  3M6B A;  4FSF A;  1EI5 A;  4IVK A;  3IH8 A;  4RVA A;  4S2M A;  1JWP A;  3P09 A;  1XXM A;  2Y2K A;  5A92 A;  2XDM A;  2OLV A;  3A3D A;  2Y2Q A;  3HLD A;  4DXC A;  2H5S A;  5KZH A;  2GDN A;  2X71 A;  4KZ9 A;  2C6W B;  2R9X A;  1K25 A;  4XUZ A;  5CTN A;  4RA7 A;  3ZGA B;  1N4O A;  3PBO A;  3FKV A;  4UA7 A;  4JXV A;  1K55 C;  2JC7 A;  4KQQ A;  5DF8 A;  5D3O A;  4E3K A;  3P98 A;  1MWS A;  1ZC2 A;  5A91 A;  4Y0U A;  4BJP A;  1W5D A;  4IVI A;  4Y7P A;  5FA7 A;  3S4X A;  2EFX A;  1K54 C;  2Y55 A;  3Q7V B;  5M19 A;  4X55 A;  4EUZ A;  5DTK A;  4OP8 A;  3W4O A;  4Q8I A;  3IQA A;  2EX9 A;  3MBZ A;  4GDN A;  5E2H A;  1SCW A;  4KG6 A;  1L0G A;  1NXY A;  2WK0 A;  3N8R A;  2A3U A;  4YFM A;  4LCM A;  2HP6 A;  5HAI A;  2A49 A;  4X69 A;  3I7J A;  4KEN B;  1XGJ A;  1DJC A;  3HUN A;  3NIA A;  4X6T A;  4OOL A;  3WRZ A;  2HP9 A;  2ZC3 B;  5FQK A;  1K54 A;  4P0M A;  5F82 A;  1MY8 A;  4U0X A;  3GSG A;  5FQJ A;  3UN7 A;  2Y2L A;  2Y4A A;  5GHX A;  3UO9 A;  5CHJ A;  3N8L A;  3M2J A;  5EVI A;  5TFQ A;  3UDX A;  3VMA A;  4E6X A;  2DNS A;  4ID4 A;  4DRT A;  1L0D A;  3B3X A;  4PPR A;  3IHA A;  1CK3 A;  1RP5 A;  4WBG A;  1L0F A;  3S1Y A;  4P87 A;  2JCH A;  5KMW A;  3O87 A;  3IWQ A;  3N8S A;  1YLJ A;  4WZ4 A;  4XXR A;  1HD8 A;  3G34 A;  5AQB A;  1E25 A;  1FSY A;  4YIN A;  3IH9 A;  3O3V A;  3V50 A;  4DE3 A;  2VGJ A;  4OPY A;  3ZVW A;  2ZJ9 A;  1MWT A;  1PW8 A;  5HAQ A;  4RYE A;  1ALQ A;  3IXG A;  2WAF A;  4QHC A;  3GMW A;  2H10 A;  4PM6 A;  4B4X A;  1QMF A;  3QNB A;  4HEF A;  2ZC7 A;  3OPP A;  1ES5 A;  4IED A;  1TDL A;  3A3I A;  2XR0 A;  5CGX A;  3G32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...