5TFQA

Crystal structure of a representative of class a beta-lactamase from bacteroides cellulosilyticus dsm 14838
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
277
structure length
277
Chain Sequence
NRTPKQKIEQQIDSLLKDKKATVGVAVLANDETVAVYNNQIHFPLLSVFKFHVGLAVLDKMDKGHIALDSLIEVKSSQLKSNTYSPLRDKFPDQDITISLGELLKYTISKSDNNTCDILIEYVGGIDQVNEYVKSLGIKDCNLAATETLMHTSGDTDLNWSTPEEVVRLLNIADKQPLFGTQYKDFLQAIMQETSTGKDKLKGQLPADVIVGHKTGSSDRTPEGIKIADNDAGFVILPNGQKYYIAVFVMESQETDADNAAIIASISKIVYDTLNSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Crystal structure of a representative of class A beta-lactamase from Bacteroides cellulosilyticus DSM 14838
rcsb
source organism Bacteroides cellulosilyticus dsm 14838
molecule tags Hydrolase
total genus 96
structure length 277
sequence length 277
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5tfqA00
1MPLA 2X02A 3IF6A 1NJ4A 4JBFA 1PWGA 2ZC4B 5FDHA 3UPPA 5L2FA 2WKIA 5IHVA 3LEZA 2HDRA 3FV7A 3W8KA 4FH4A 1Y54A 3TG9A 3ZG5A 4KQQA 3G31A 2Y2NA 5FQ9A 1LL9A 2J8YA 3VFHA 4S2OA 2CC1A 3C5AA 4Z9QA 1L0FA 3O3VA 5EUAA 1LL5A 4BL3A 1GHMA 1L0DA 4BD1A 3BYDA 2X01A 5E43A 1NY0A 2I72A 3DWZA 5CGWA 2HDQA 1Q2QA 1JVJA 1RCJA 2ZQ9A 3HUNA 4OKPA 4WELA 3ZG7B 3IHAA 4FD8A 1W8YA 2E8IA 4WBGA 1S0WA 1N9BA 3FYZA 1VQQA 1HTZA 3M6HA 5EVIB 5FQIA 4D2OA 2IWBA 2XLNA 5E2GA 1FSWA 2BLSA 5TFQA 5HX9A 2ZQ7A 3BECA 1DY6A 1MXOA 2WGWB 5FI7A 3LY4A 3VP3A 1K6SA 3IXDA 2PU4A 3OPRA 3N8SA 4JF4A 3GSGA 1KVMA 3S4XA 4RA7A 4B88A 4C3QA 3HLGA 1LI9A 4JLFA 4OOMA 4R3BA 4S2PA 3GR2A 1TDLA 4HESA 4MBFA 2FFFB 2WGVA 4R0QA 1ONHA 1AXBA 5GL9A 1CEFA 1XP4A 3ZVWA 5KMWA 4ZBEA 1L0GA 1BLSA 3IH8A 1RP5A 2Q9MA 4DDSA 2A3UA 4EBNA 3PAGA 4WZ5C 4Y7PA 5CTNA 1Q2PA 1GA9A 1PYYA 3CG5A 3OCLA 3PTEA 4K91A 3ZFZA 3HLDA 1K25A 4LV2A 1BLCA 5FATA 5CHMA 4H8RA 4Y0OA 4GD8A 3PAEA 3V3SA 4X56A 5F83A 1LLBA 5A93A 4JXVA 3M6BA 3BM6A 2ZD8A 3OCNA 4ZTKA 4OQGA 3AGEA 1LI0A 3G4PA 3RXWA 3HL9A 1GCEA 1YLWA 4B4XA 1QMFA 3OPLA 1E4DA 1H5XA 1ES4A 4GNUA 5M18A 2JC7A 1FCOA 3BLMA 4N9KA 3MZFA 3WWXA 1G6AA 2RCXA 4FCFA 1KGFA 3C7UA 5EVLA 4LV1A 1JWPA 2Z2LB 1L0EA 3WS5A 1G68A 4ZDXA 2Y2IA 4IEDA 3WS0A 4BQMA 1E3UD 4EV4A 2OSUA 5DF9A 2Y2HA 4KZAA 5EOOA 2R9WA 3BLSA 4LCLA 4A5RA 1K56D 3IXHA 4JKTA 4Y0UA 2Y4AA 3WRTA 2H0TA 4F94A 2Y2JA 1IYPA 4DE2A 3M2JA 1BSGA 3Q7VA 4OOLA 2EFXA 1HD8A 4KZ3A 5E2EA 1MY8A 5JYPA 1FCMA 3UPNA 3OC2A 2IWCA 4C75A 1XA1A 4JXWA 4OLDA 4UHUA 3E2LA 1NRFA 5TGFA 1SDNA 3NC8A 3IWQA 4GZBA 3HVFA 3SH9A 4PPRA 4E3IA 1CI9A 4OPRA 2OLUA 3IH9A 4GD6A 2XGNA 3GQZA 3IXGA 3Q81A 5EECA 4P87A 2WUQA 2HP6A 5GLCA 3IXBA 2Y2PA 4WEKA 5CGSA 3ISGA 2QMIA 4KG6A 3BEBA 1PIOA 3GMWA 1IKIA 2V1ZA 4E6WA 3FKWA 3W4OA 4K0WA 4X68A 3QNBA 3FKVA 3UDFA 1JWZA 1XXMA 3WS2A 3N6IA 2P74A 3S22A 3BFGA 5M19A 2XDMA 4WMCA 2J7VA 5EVIA 2XFSA 3VOYA 4DKIA 4N9LA 2XFTA 1RGYA 5FQQA 3ZG9B 5FI2A 2UWXA 1QMEA 2WGWA 2ZQ8A 3ZDJA 4KZBA 3NDEA 1IEMA 3A3JA 1L2SA 1XX2A 4QY6A 1PI4A 3VP4A 4BJPA 4DE3A 3OPHA 5AQ7A 1MWRA 5FA7A 4MNRA 1ERQA 5DVAA 2P9VA 2JCHA 2XD5A 5FQJA 5BOHA 4CJNA 1MWSA 5HL1A 1IELA 3G32A 3VSLA 4QU3A 4E3JA 5U47A 1ALQA 5FI6A 4HBUA 2JBFA 5EPHA 1DJCA 1EI5A 2XF3A 4N1XA 1SKFA 5J8XA 1GA0A 3W4PA 1BLHA 5D3OA 4S2NC 5G18A 4PMAA 3GTCA 3P98A 4BD0A 3GRJA 3IQAA 1I2SA 4JF6A 4L0LA 2ZJ9A 3HREA 4PM5A 4IBRA 1YLTA 3ZCZA 1IYSA 4KG5A 1NZUA 4QB8A 1YT4A 1PWCA 4OH0A 4S2NA 4XUXA 2WZZA 3E2KA 5FSRA 4DE1A 1FR6A 1SCWA 2Y59A 3FZCA 4JXGA 1ES2A 4MLLA 2Y2QA 2WAEA 1WYBA 3O86A 2VGJA 5GHXA 3LY3A 4OPQA 4RX2A 4Y0TA 4UA6A 3Q82A 4FH2A 5CHJA 4E3KA 4KZ8A 2Y2MA 4XUZA 1ES5A 1FOFA 2Y2KA 3IHBA 2VGKA 4DXCA 3IF6B 4XXRA 4KG2A 3BFCA 3ZHHA 1M40A 4KQOA 4MEZA 4S2LA 1TVFA 2XH9A 5CRFA 5FAOA 4OOYA 3Q1FA 4KENB 5KSHA 1KE3A 5DF8A 2WKHA 3BRMA 1EWZA 1LHYA 3HLFA 4R23A 3ZG8B 4BL2A 2BG1A 5E2HA 2OV5A 2DCFA 4KZ9A 1KGGA 4UA7A 1SDEA 1BLPA 2OLVA 1YQSA 2IWDA 4P0MA 5F1GA 1GHPA 4IBXA 4X55A 4U0XA 4BENA 2ZQDA 1JTDA 2ZM8A 2V2FF 3FWLA 4E3LA 3SS4A 1XGIA 5KZHA 4QY5A 4U0TA 1TDGA 1KDWA 1YLPA 3A3DA 3UY6A 5M1AA 5FAQA 1BUEA 3DWKA 4QJGA 1SHVA 4X69A 5AQAA 3LCEA 3A3FA 5JYOA 1KE0A 1I5QA 1W79A 2B5RA 1YMSA 5GHZA 5CEBA 2G2UA 2V20A 4HBTA 1KE4A 3D4FA 3NIAA 4OP5A 4KQRA 3VP1A 1M6KA 4S2MA 2QPNA 1CI8A 1FR1A 4OPYA 3UDXA 2X71A 3G34A 3HBRA 2WKEA 1ZG6A 4GOGA 5A92A 5DF7A 1O7EA 4EUZA 2Q9NA 4S2IA 2XD1A 3MZEA 1W8QA 3MKFA 2ZMAA 1PW1A 4LCMA 4P85A 1XPBA 1KDSA 5A90A 4X6TA 4E6XA 1TEMA 4NETA 2ZC5B 1E25A 3V39A 3C4PA 3PBOA 5HAQA 5HAPA 1BT5A 1ZC2A 1FSYA 3BFDA 3HLEA 4ID4A 4WYYA 3UE0A 2RL3A 2ZLYA 3RJUA 4IVKA 1KVLA 5EVIC 2C6WB 3V50A 1YLJA 4PM7A 3Q7ZA 2Y55A 1K38A 4JPMA 5FAPA 4OLGA 4DE0A 3HLBA 5FQKA 4JXSA 5FQMA 3O87A 3MZDA 1K55A 3ZNTA 5DTKA 3UE1A 1YMXA 3VP2A 5AQBA 2DNSA 1XA7A 5CXWA 4R4SA 5GLDA 4QHCA 2XK1A 3IT9A 1S6RA 3OPPA 5GHYA 5HFOA 1YLZA 3NCKA 3SH7A 4E3NA 3UDIA 3S1YA 1HVBA 3MFDA 4DXBA 5F1FA 1N4OA 2GDNA 3HUOA 2J9OA 4HEFA 1K4FA 2HP9A 4QD4A 1WE4A 3G2ZA 4YFMA 2EX9A 1NYMA 3NI9A 2JE5A 3C4OA 3N8RA 3Q7VB 3PBNA 3ZVTA 4E3OA 5HW3A 1GHIA 3HUMA 3G2YA 1ESIA 3VMAA 3ZGAB 5GLBA 3AGDA 3ZG0A 1CK3A 5I94A 4FSFA 3NY4A 1CEGA 3B3XA 3QHYA 1MKIA 3SH8A 1BTLA 4M3KA 4GDNA 1BULA 2HP5A 4NK3A 4N92A 1MWUA 2EXBA 4OP8A 1ES3A 2XQZA 3NBLA 4LV0A 4N1HA 1NXYA 5HARA 4ZJ3A 3N8LA 3DW0A 3QNCA 4X53A 2HPBA 3A3EA 4GKUA 4U3TA 3MKEA 4LV3A 1KGEA 1K6RA 1JWVA 3EQVA 3O88A 4LENA 2Y91A 3WS4A 3PBSA 2A49A 3N4IA 4WMCD 5EVID 3OZHA 4O7DA 4Q8IA 4KZ6A 3TSGA 1FQGA 3NDGA 2WADA 4RYEA 1PW8A 3JYIA 2Y2LA 1ZKJA 2WAFA 4R4RA 4GB7A 4P6BA 4PM9A 2ZC3B 3WS1A 4DDYA 1MWTA 3MXRA 4MBHA 5KSCA 3RXXA 4OVDA 5HAIA 4IVIA 5DTSA 5E2FA 3UPOA 4EQIA 3CMZA 3SOIA 1E3UA 2P9VB 1XKZA 2Y2OA 3PBTA 4MBKA 4WM9A 5TR7A 1K56A 1WYCA 1PZPA 1EROA 4EWFA 1ERMA 1PWDA 3IF5A 5AQ9A 5FASA 4OQHA 3V5MA 4WZ4A 2R9XA 2Z2MB 4DF6A 4OPZA 4EBLA 2PU2A 2ZC7A 1FCNA 3IWIA 4GN2A 3MXSA 2ZQCA 3DTMA 2EX8A 4KZ7A 3CJMA 1ONGA 4S2KA 2EXAA 2ZM0A 4PM8A 4WZ5A 2PBYA 1MBLA 3C7VA 3HLCA 1J9MA 2ZM2A 3HLWA 3ZNYA 5F82A 1IKGA 1JTGA 2HDSA 4CPKA 1IYQA 3VFFA 2WGIA 3AGFA 4K0XA 2Y2GA 3P09A 1K54C 1NYYA 1H8ZA 4ZJ2A 1C3BA 2H0YA 4OQ0A 1YLYA 3CZDA 4S2JA 3VOZA 1U60A 5CGXA 2WYXA 5EOEA 4B4ZA 1OMEA 1W5DA 1K4EA 2WK0A 4C6YA 3A3IA 1DJAA 1H8YA 2J9PA 4WEJA 1K55C 2G2WA 3Q07A 1VM1A 1K54A 1DJBA 3SS5A 2EX6A 1BZAA 2ZC6B 4KZ4A 3UN7A 4UA9A 4DRTA 1RGZA 5CTMA 4RVAA 3M2KA 3SS3A 2WZXA 5CECA 3N7WA 3LO7A 4R1GA 1ZG4A 1PI5A 1IYOA 3IWOA 4YINA 3PBQA 3W4QA 5CHUA 1NZOA 3ITBA 5A91A 2ZQAA 1K57C 3WRZA 2QZ6A 3BFFA 2FFYA 4UAAA 3GVBA 3UE3A 3PBRA 4ZAMA 3V3RA 3UNWA 3MBZA 3EQUA 2HDUA 3UO9A 3ITAA 2XEPA 4OONA 1XGJA 5DTTA 3TOIA 3VP0A 4OQIA 4JF5A 5CERA 5GLAA 1O07A 1K57A 2EX2A 4KZ5A 1HZOA 3G35A 2H5SA 3IF6C 3GV9A 3I7JA 1PZOA 2DRWA 4RX3A 4R3JA 2C5WB 1ESUA 4PM6A 5CEDA 2XR0A 4ZJ1A 1W7FA 3BFEA 1YM1A 2H10A 4GDBA 3G30A 5EE8A 3VSKA 1I2WA 4EBPA 4BLMA 1Z6FA 4E3MA 2EFUA
chains in the Genus database with same CATH superfamily
1NJ4A 1PWGA 2HDRA 3FV7A 3TG9A 5FQ9A 3VFHA 3S7PA 4S2OA 5IT5A 3O3VA 5HWTA 2JKRI 1LL5A 4BD1A 3CHWP 2AVXA 4HI4A 5CGWA 2HDQA 3D9YA 4FD8A 5EM0A 3FYZA 1VQQA 3M6HA 5EVIB 4MN6A 1YPRA 2IWBA 2ACGA 1FSWA 5HX9A 3BECA 4HNBA 4L9EA 4C3QA 3DBAA 2WKPA 4R0QA 5GL9A 1ONHA 1AXBA 4HHDA 4BWIA 4EW7A 1L0GA 4DDSA 4WZ5C 5CTNA 3CG5A 1T19A 1BLCA 4Y0OA 3GECA 4X56A 1KOUA 5F83A 2VJWA 4I3AA 2PD8A 3G4PA 3RXWA 3HL9A 1YLWA 3OPLA 4GNUA 3BLMA 4N9KA 2K2NA 3WWXA 5EVLA 3CITA 4LV1A 3WS5A 1G68A 4ZDXA 4BQMA 4EV4A 2OSUA 2Y2HA 3BLSA 1K56D 3ICYA 2A2LA 2B18A 2V8FA 1NWZA 4OOLA 1HD8A 4FUWA 4R70A 1OTAA 3KX0X 1FCMA 3UPNA 3OC2A 1S67L 1XFNA 3IWQA 3SH9A 2R78A 3HVFA 1GSVA 2OLUA 3T4QA 3B47A 2HP6A 5GLCA 2Y2PA 5CGSA 5DFYA 2V1ZA 4E6WA 1JWZA 1CJFA 1XXMA 3WS2A 1MZUA 2P74A 3V67A 3F1PB 4N9LA 2XFTA 1RGYA 2UWXA 3ZDJA 3MQQA 1PI4A 2A24A 2W3FA 4BJPA 2PR6A 1OTDA 5FQJA 1K0KA 3QP6A 1MWSA 5HL1A 1IELA 3G32A 3VSLA 3LYXA 5U47A 4HOIA 2O9CA 4R38A 1GA0A 2ZL1A 1BLHA 5D3OA 3T1XA 4Y2FA 1ZTUA 3NOUC 3GTCA 4BD0A 4PM5A 3MQOA 5HPIA 5L07A 1IYSA 1NZUA 2P04A 1YT4A 3C30A 4S2NA 2WZZA 1SCWA 2Y2QA 3DAVA 3LY3A 4OPQA 3IF6B 4XXRA 3ZHHA 1M40A 4KQOA 4HJ6A 1TVFA 5CRFA 5FAOA 4OOYA 3Q1FA 5DF8A 2PYPA 3HLFA 3UE6A 4R23A 5IU1A 4PKYG 3OOVA 3T12B 5E2HA 2OV5A 1CF0A 2DCFA 1VHMA 1BLPA 2IWDA 5F1GA 5EM1A 2ZQDA 2ZM8A 2V2FF 4E3LA 2O9AA 1P9RA 4NKPA 1XGIA 1NLZA 5HDSA 1KDWA 1YLPA 4HIAA 3UY6A 5M1AA 1BUEA 3LCEA 3A3FA 1KE0A 1W79A 2B5RA 2J3WA 5J3WA 5DKLA 3CPTB 3VP1A 2QPNA 4OPYA 1S1YA 3ULFA 1UWNX 4LCMA 1XPBA 5A90A 2PD7A 4NETA 2ZC5B 3V39A 5K5BA 2YKFA 5HAPA 3BFDA 4WYYA 3ZYTA 3IX3A 1W63Q 4IVKA 2C6WB 1YLJA 3TRCA 2BASA 1YSPA 3ZNTA 5DTKA 5GLDA 5GHYA 3NCKA 2VZWA 2DMWA 3VOLA 1TS8A 3S1YA 2JKRM 2J9OA 4HEFA 4QD4A 4UQIS 3G2ZA 4YFMA 3NI9A 4KUKA 4LRYC 4PHTA 3VMAA 2W3DA 4F3LA 3DTIA 3NY4A 3HJKA 3QHYA 2V1BA 2EWVA 4KUOA 2EXBA 4OP8A 4ZJ3A 3DW0A 4X53A 1OTEA 4U3TA 4GS9A 3D3OA 3PBSA 5EVID 3OZHA 3NOPC 4EU0A 4RYEA 2LB5A 3H82B 4Y15A 3JYIA 3T4JA 4P6BA 4PM9A 2ZC3B 3T4SA 3RXXA 3FPWA 5E2FA 5L8MA 4EQIA 1XKZA 2Y2OA 4WM9A 4JGOA 5TR7A 2L1MA 1VEUB 4LPZA 1K56A 2VEAA 4OQHA 4P6ZS 4Z1WA 3CJMA 4ETZA 4ARZB 1MBLA 1J9MA 3ZNYA 1DP6A 2OAQ1 1IKGA 5J4EA 1Y4OA 4L9FA 3QP2A 4BBVA 1GSXA 1H8ZA 1YLYA 4JGPA 1J3WA 2WYXA 1W5DA 1K55C 5F5YA 1VM1A 1K54A 3SS5A 5CTMA 4RVAA 2WZXA 5CECA 3BJNA 3LO7A 4QWOA 4K08A 4YINA 3PBQA 5CHUA 1NZOA 3ITBA 5A91A 2QZ6A 2FFYA 3H7WA 4UAAA 3UE3A 1T1CA 3PBRA 3V3RA 3MBZA 3EQUA 2O0YA 5DTTA 3TOIA 3IBRA 2EX2A 1HZOA 2H5SA 4RX3A 1A0KA 3LR3A 4PM6A 1Z6FA 2W1RA 3VSKA 5EE8A 2QWSA 4BLMA 4IUHA 3PR6A 4B9OA 2EFUA 1P9WA 3UPPA 2WKIA 4HP9A 3UB7A 3LEZA 3W8KA 4FH4A 4KQQA 2Y2NA 2XA7S 2CC1A 3C5AA 4BL3A 1N9NA 3BYDA 5E43A 1Q2QA 3DTKA 2Q0OA 1LSXA 1W8YA 3K3DA 5HD5A 3T4KA 2KOIA 1N9BA 2HJEA 4HH3A 1HTZA 3CWFA 3BY9A 2K31A 2XLNA 2BLSA 4NXFA 5E2GA 4DJ3A 1DY6A 1MXOA 3G6OA 3LY4A 1SKOB 3VP3A 1K6SA 2PU4A 3N8SA 4JF4A 3S4XA 1KVMA 4R3BA 4OOMA 2JKFA 1XP4A 4ZBEA 1BLSA 3IH8A 2Q9MA 3S7QA 4K91A 3OCLA 3ZFZA 2EWWA 3HLDA 3IS2B 5FATA 4WLAA 4GD8A 4NXEA 2W1TA 4JXVA 3OLOA 2PYRA 2ZD8A 1P0ZA 3AGEA 3F1OA 1GCEA 4Q0IA 1QMFA 3LUQA 2JC7A 1FCOA 4MMNA 2RCXA 3C7UA 1JWPA 2Z2LB 1DRMA 2Y2IA 3QP4A 3A0RA 4IEDA 3UMEA 1E3UD 4KZAA 4A5RA 4JKTA 2Y4AA 1F5MA 3Q7VA 1BSGA 4Y3IA 4WF0A 1MY8A 5JYPA 5FEGA 5HZHA 1XA1A 5AVFA 3E2LA 5TGFA 2EA9A 1DP9A 4DMZA 4PPRA 1CI9A 4OPRA 3IH9A 1LL8A 3Q81A 5EECA 4WEKA 4KG6A 3BEBA 3CLOA 3L7HA 3FKWA 5TBMA 3W4OA 3P7NA 3FKVA 5F68A 4YNRA 4IJGA 3BY8A 2XDMA 5EVIA 5FI2A 5EV0A 4R6LA 4QY6A 1L2SA 1XX2A 4DE3A 5FA7A 1PRQA 2XD5A 5BOHA 1V9YA 4CJNA 4XT2B 2INWA 4E3JA 3EGXC 1ALQA 3UB6A 1SKFA 5AJGA 4ME4A 1VETA 4S2NC 5TJJA 4RQ9A 4L0LA 3HREA 2QJ5A 5FL3A 4DE1A 1FR6A 4MLLA 3RFBA 1ES2A 2WAEA 1WYBA 3O86A 1TS7A 1ES5A 1FOFA 4DXCA 3MSHA 4KG2A 3LI8A 4S2LA 3S7OA 1IFQA 2E8JA 3BRMA 1EWZA 2PAVP 3W2ZA 5HDDA 4JGRA 1KGGA 4P0MA 4X55A 4U0XA 1JTDA 5DKKA 1P97A 3FWLA 4U0TA 1TDGA 3A3DA 2W3GA 5FAQA 5L09A 3DWKA 4QJGA 1SHVA 1N9LA 3JPUA 5JYOA 3NIAA 1M6KA 2KLIA 3UDXA 2X71A 3HBRA 2WKEA 1ZG6A 4GLQA 2Q9NA 1W8QA 4MDZA 3RH8B 1XJ2A 2ZMAA 3F1PA 3LIBA 1KDSA 1TEMA 1E25A 2VX8A 2M7UA 3UB5P 3C4PA 4NXBA 1Z09A 2ZBBA 3NULA 2W3EA 2RL3A 2V1AA 1D06A 4PM7A 3Q7ZA 5FQKA 1OPXA 3K3CA 2L4RA 1XA7A 5C5KA 4H6JA 3T1RA 1G6OA 2K7SA 1D1JA 3MFDA 3U4LP 3FC7A 1K4FA 2HP9A 1WE4A 1T18A 1TD5A 3E4OA 1S4SA 4EETB 3ZVTA 2PT7A 3ZGAB 3AGDA 1CK3A 2HF6A 4M3KA 4GDNA 1BULA 1MWUA 4LGWA 2XQZA 3NBLA 4LV0A 4X25A 5HARA 2HPBA 3IX8A 4LV3A 1KGEA 1K6RA 4LFUA 1JWVA 3EQVA 4I38A 4WMCD 4D60A 4LRZE 1PW8A 2WAFA 4WUJA 3WS1A 4DDYA 5KSCA 5FDSA 2O99A 5F69A 4IVIA 3UPOA 3CPTA 3CMZA 3SOIA 1E3UA 4MBKA 1SZVA 3VE4A 1WYCA 4CLCD 3LICA 1EROA 4EWFA 3IF5A 4NXGA 5FASA 3RTYA 4PKYA 4OPZA 1YAXA 2ZC7A 4GN2A 3MXSA 3TW8A 2ZQCA 3T1SA 4MN5A 4S2KA 2EXAA 4WZ5A 1CQAA 2ZM2A 3E0YA 5F82A 4CPKA 1IYQA 1LSWA 3VFFA 3AGFA 1T1AA 3P09A 1K54C 5DFXA 4ZJ2A 1C3BA 1AWIA 3CZDA 3VOZA 4LRXC 4I3IA 2QKPA 5EOEA 2J9PA 4WEJA 3LGOA 1RGZA 4I3JA 3M2KA 3N7WA 1ZG4A 1EW0A 1YKDA 3PHYA 3WRZA 4GW9A 3BFFA 4FOFA 3BQAA 3VE3A 3ITAA 2IA2A 3BWLA 2XEPA 2YKHA 4GCZA 3VP0A 3KYZA 4OQIA 4JF5A 3LIDA 3QP8A 3R7WA 1O07A 1K57A 4EQ1A 1F2KA 4R3JA 2C5WB 5CEDA 1W7FA 5A8BA 1T1BA 3H82A 1MPLA 2X02A 4JBFA 2ZC4B 5FDHA 5IHVA 3O5YA 1Y54A 1LL9A 1JNUA 5DJTA 1NY0A 2I72A 3P01A 4WELA 3ZG7B 4HQAA 4Y5FA 4WBGA 2GZAA 1S0WA 3JVUA 5FQIA 2ZQ7A 2WGWB 3MF0A 5FI7A 2XROA 4ZRRA 4EUVA 3FG8A 2CMNA 3OPRA 3GSGA 4RA7A 4B88A 4JLFA 3GR2A 4NG2A 1TDLA 4HESA 4MBFA 2WGVA 1CEFA 3ZVWA 3PAGA 4Y7PA 1Q2PA 1PYYA 3MXQA 1OJ5A 4H8RA 4F3LB 3PAEA 2HJ9C 3V3SA 2MJ6A 2Z6DA 3M6BA 2VK3A 3BM6A 3LR0A 4ZTKA 4OQGA 4WN5A 4B93A 4BMWA 1S1ZA 2W0NA 5F6AA 4B4XA 4GS9B 4R3AA 1H5XA 1ES4A 1OT9A 3MZFA 3EWKA 4WL9A 3CUEC 4FCFA 2LB9A 3LEQA 2J80A 5DF9A 2R9WA 4LCLA 3IXHA 4Y0UA 3LR4A 4F94A 3CAXA 3DTEA 1IYPA 1STZA 3LFVA 3M2JA 4DE2A 4DN0A 2EFXA 3BQ8A 5E2EA 5AVEA 2IWCA 1OTBA 5IS1A 1NRFA 1GSWA 2PBDP 3C2WA 5HDCA 4E3IA 2XGNA 3GQZA 4MN7A 2WUQA 4P87A 3IXBA 1PIOA 3GMWA 4Y17A 1IKIA 4EEUA 3UDFA 4G3WA 3N6IA 1G5UA 3FPVA 5M19A 4WMCA 2J7VA 3VOYA 1VB6A 3EEAA 5FQQA 3ZG9B 2GNXA 2ZQ8A 3NDEA 1IEMA 3A3JA 3A0SA 3NOTC 2JKTM 1IOUA 1ERQA 4HH2A 2P9VA 2JCHA 1PFLA 2VGLM 4IUKA 4CLCA 2P7JA 5EPHA 4EEPA 3IS2A 3H7WB 1BYWA 5J8XA 2W27A 3LIAA 4PMAA 3GRJA 3GDIA 3VV4A 2ZOIA 2O9BA 4GHIB 4JF6A 2ZJ9A 1OTIA 4IBRA 1YLTA 4QB8A 1PWCA 3E2KA 2B95A 2Y59A 2XA7M 2VGJA 5GHXA 4UA6A 4FH2A 5CHJA 4E3KA 4G3VA 3IHBA 2VGKA 3QP1A 1F98A 4MEZA 2L0WA 2XH9A 1KE3A 2WKHA 1LHYA 3H9WA 3IX4A 2BG1A 3F1NA 4KZ9A 1YQSA 1LSVA 3C38A 1LT0A 4X1MA 2VLGA 5KZHA 4QY5A 3EOIA 2QYBA 4X69A 5AQAA 5KIZA 3K2NA 1I5QA 5GHZA 5CEBA 4HBTA 4OP5A 2J3TC 4S2MA 1CI8A 1ZHHB 1FR1A 4GOGA 5A92A 5DF7A 1O7EA 3B33A 4S2IA 2XD1A 3MZEA 4Q0HA 3MKFA 4UEYA 4X6TA 4E6XA 1OJGA 3PBOA 2W1TB 5HAQA 1BT5A 1ZC2A 1FSYA 3HLEA 2GJ3A 2WKQA 3RJUA 4CLCE 4HJ4A 3TE8A 3V50A 1V9ZA 2Y55A 4OLGA 3HLBA 5FQMA 3O87A 1K55A 3B42A 1YMXA 3VP2A 2DNSA 3L9KA 4R4SA 4QHCA 1S6RA 5HFOA 1W63M 3LI9A 3A0VA 5F1FA 3UB8A 1N4OA 4ESPA 1NYMA 2UV0E 1PNEA 3Q7VB 2VKSA 3MR0A 4Y13A 3T50A 5I5LA 3G2YA 5I94A 3MMHA 5CX7A 4LLOB 1MKIA 3KSIA 1BTLA 2HP5A 4I5SA 4L9GA 4GKUA 5TBMB 3MKEA 3O88A 3WS4A 2V0WA 3NDGA 4R4RA 4GB7A 1MWTA 3BW6A 4OVDA 4X1LA 5HD3A 1PZPA 3E4QA 4HJ3A 1ERMA 5AQ9A 3E4PA 3V5MA 4WZ4A 4M4XA 2JHEA 1VETB 1XJ3A 2EX8A 1ONGA 3D72A 4PM8A 3C7VA 2PR5A 1NLYA 3HLWA 1TS0A 1JTGA 3T4TA 1H0MA 2HDSA 2WGIA 4K0XA 1NYYA 3NECA 1OMEA 1S4RA 1K4EA 2WK0A 4C6YA 1TS6A 3A3IA 2I9VA 1Y28A 4AFIA 4G3KA 1DJBA 2EX6A 1BZAA 4UA9A 4DRTA 2KX6A 2XSSA 3SS3A 3UMDA 2ZMFA 1K57C 2GX5A 3UNWA 3IBJA 5EVEA 3UO9A 3MFXA 4YOFA 5CERA 5GLAA 1UWPX 3G35A 2DRWA 5J7EA 1ESUA 2XR0A 3OBFA 2HV1A 2W3HA 3S7NA 4EBPA 3G30A 4KENB 2M7VA 4E3MA 3IF6A 5L2FA 4GJ4A 3ZG5A 2JKGA 2PHYA 2B02A 3G31A 3LIEA 2J8YA 4Z9QA 1L0FA 5EUAA 3MQ0A 2JKTI 1GHMA 1L0DA 2Z6CA 5DJUA 2X01A 3DWZA 3WRTA 2ZQ9A 1JVJA 1RCJA 3HUNA 2V0UA 4HY8A 4OKPA 3IHAA 2E8IA 3JVVA 4D2OA 4H6JB 5TFQA 3T1QB 2A24B 3IXDA 1WA9A 4PAUA 3HLGA 1LI9A 4S2PA 2FFFB 4II7A 5KMWA 1RP5A 4EBNA 2A3UA 1GA9A 3PTEA 1K25A 4LV2A 2ZL1B 5CHMA 2FH5A 1LLBA 5A93A 3EGDC 3OCNA 1LI0A 2OAP1 3KO6A 4JGQA 5HL6A 1E4DA 3PYPA 5M18A 1G6AA 1KGFA 4NEED 2VA0A 1L0EA 1G28A 3E98A 3WS0A 2Y8HA 5G4YA 5EOOA 2H0TA 2Y2JA 1N9OA 4KZ3A 4Q0JA 3MS6A 2G7UA 4C75A 4JXWA 4OLDA 4UHUA 1HLUP 1SDNA 3NC8A 4GZBA 4DJ2A 3T4LA 4GD6A 3IXGA 5MC7A 3NHQA 3ISGA 2QMIA 4K0WA 4X68A 3QNBA 5L10A 3KYEA 3S22A 3BFGA 2XFSA 4DKIA 4BBTA 3SW1A 3HCYA 1QMEA 2WGWA 4KZBA 4CLCC 3VP4A 3OPHA 5AQ7A 1MWRA 1FILA 4MNRA 5DVAA 2P08A 1VEUA 1S66L 4YWZA 4QU3A 2Y79A 5FI6A 1MKMA 4HBUA 2JBFA 1DJCA 4UQIM 1EI5A 2XF3A 4N1XA 1XJ6A 3W4PA 5G18A 3P98A 1ACFA 3IQAA 1I2SA 4ARZA 1UGUA 3R7WB 3SZTA 4FTXA 3ZCZA 4KG5A 2PDRA 4OH0A 4XUXA 5FSRA 3FZCA 2D01A 1D7EA 4JXGA 3LIFA 1YSQA 4Y0TA 4RX2A 3Q82A 4KZ8A 2Y2MA 4XUZA 2Y2KA 2XRNA 2KDKA 3BFCA 4E04A 5KSHA 2HZ5A 3ZG8B 4BL2A 3MJQA 2PRFA 4UA7A 1SDEA 2OLVA 3QP5A 1GHPA 4IBXA 4BENA 3SS4A 2OWHA 4EESA 5HPFA 4P6ZM 1YMSA 2G2UA 2V20A 1KE4A 3D4FA 3LR5A 4KQRA 2D02A 3G34A 2QJ7A 4EUZA 2VV8A 1PW1A 2VV7A 4P85A 1ODVA 2V8CA 2FZ0A 4ID4A 3UE0A 2ZLYA 3ZQ5A 1KVLA 1OT6A 5EVIC 4O8GA 5FEFA 1DP8A 1K38A 4JPMA 5FAPA 4DE0A 3MZDA 4KQDA 5G4ZA 3UE1A 5AQBA 3PXPA 5CXWA 3C8CA 2XK1A 3IT9A 3OPPA 1L3LA 1YLZA 3SH7A 4GHIA 4E3NA 2VGLS 3UDIA 1TF1A 2V9AA 1SKOA 1HVBA 4DXBA 1H8MA 2GDNA 3HUOA 4BBUA 2EX9A 2JE5A 3C4OA 3KSFA 3N8RA 3UB9A 4EERA 3PBNA 4E3OA 5HW3A 2JN7A 2J3TD 1GHIA 3HUMA 1ESIA 5GLBA 4MCWA 3ZG0A 4FSFA 1CEGA 1H3QA 3B3XA 2HGVA 3SH8A 2OWJA 4NK3A 4N92A 1ES3A 4N1HA 2VV6A 1NXYA 3N8LA 3QNCA 3A3EA 4LENA 2Y91A 3KSHA 2A49A 3N4IA 4O7DA 5LBRA 4Q8IA 4KZ6A 3TSGA 1FQGA 2WADA 3NJAA 2Y2LA 1ZKJA 3MXRA 4MBHA 3TJZC 5HAIA 5DTSA 4O01A 5EFWA 2P9VB 3PBTA 3KYQA 1PWDA 4IHQA 4CLCB 2R9XA 2Z2MB 4DF6A 2BTFP 4EBLA 2PU2A 1FCNA 3IWIA 3DTMA 5HSQA 2ZOHA 4KZ7A 2ZM0A 2QHKA 2PBYA 3HLCA 4O0PA 2WKRA 2Y2GA 2H0YA 4OQ0A 4ETXA 1NRJA 4S2JA 1FIKA 1X0OA 1U60A 5CGXA 4B4ZA 3U2AA 2ZMVA 1MC0A 1DJAA 1H8YA 1F9IA 2G2WA 3Q07A 5HWWA 2ZC6B 4KZ4A 3UN7A 2NUPC 3CUEA 4QPRA 4XT2A 3F1NB 2OOLA 3T4OA 4R1GA 1PI5A 3F1OB 1IYOA 3IWOA 3W4QA 2ZQAA 5HWVA 3KSGA 3GVBA 4ZAMA 2H28A 2NUTC 3HJIA 3EEHA 2HDUA 4OONA 1XGJA 3CI6A 4EXOA 4CQHA 4KZ5A 3IF6C 3GV9A 3I7JA 1PZOA 1XJ4A 3R4KA 4ZJ1A 3BFEA 1YM1A 4HP4A 2H10A 4GDBA 4I39A 2M1CA 1I2WA 1XFQA 4JXSA
chains in the Genus database with same CATH topology
1MPLA 2X02A 3IF6A 1NJ4A 4JBFA 1PWGA 2ZC4B 5FDHA 3UPPA 5L2FA 2WKIA 5IHVA 3LEZA 2HDRA 3FV7A 3W8KA 4FH4A 1Y54A 3TG9A 3ZG5A 4KQQA 3G31A 2Y2NA 5FQ9A 1LL9A 2J8YA 3VFHA 4S2OA 2CC1A 3C5AA 4Z9QA 1L0FA 3O3VA 5EUAA 1LL5A 4BL3A 1GHMA 1L0DA 4BD1A 3BYDA 2X01A 5E43A 1NY0A 2I72A 3DWZA 5CGWA 2HDQA 1Q2QA 1JVJA 1RCJA 2ZQ9A 3HUNA 4OKPA 4WELA 3ZG7B 3IHAA 4FD8A 1W8YA 2E8IA 4WBGA 1S0WA 1N9BA 3FYZA 1VQQA 1HTZA 3M6HA 5EVIB 5FQIA 4D2OA 2IWBA 2XLNA 5E2GA 1FSWA 2BLSA 5TFQA 5HX9A 2ZQ7A 3BECA 1DY6A 1MXOA 2WGWB 5FI7A 3LY4A 3VP3A 1K6SA 3IXDA 2PU4A 3OPRA 3N8SA 4JF4A 3GSGA 1KVMA 3S4XA 4RA7A 4B88A 4C3QA 3HLGA 1LI9A 4JLFA 4OOMA 4R3BA 4S2PA 3GR2A 1TDLA 4HESA 4MBFA 2FFFB 2WGVA 4R0QA 1ONHA 1AXBA 5GL9A 1CEFA 1XP4A 3ZVWA 5KMWA 4ZBEA 1L0GA 1BLSA 3IH8A 1RP5A 2Q9MA 4DDSA 2A3UA 4EBNA 3PAGA 4WZ5C 4Y7PA 5CTNA 1Q2PA 1GA9A 1PYYA 3CG5A 3OCLA 3PTEA 4K91A 3ZFZA 3HLDA 1K25A 4LV2A 1BLCA 5FATA 5CHMA 4H8RA 4Y0OA 4GD8A 3PAEA 3V3SA 4X56A 5F83A 1LLBA 5A93A 4JXVA 3M6BA 3BM6A 2ZD8A 3OCNA 4ZTKA 4OQGA 3AGEA 1LI0A 3G4PA 3RXWA 3HL9A 1GCEA 1YLWA 4B4XA 1QMFA 3OPLA 1E4DA 1H5XA 1ES4A 4GNUA 5M18A 2JC7A 1FCOA 3BLMA 4N9KA 3MZFA 3WWXA 1G6AA 2RCXA 4FCFA 1KGFA 3C7UA 5EVLA 4LV1A 1JWPA 2Z2LB 1L0EA 3WS5A 1G68A 4ZDXA 2Y2IA 4IEDA 3WS0A 4BQMA 1E3UD 4EV4A 2OSUA 5DF9A 2Y2HA 4KZAA 5EOOA 2R9WA 3BLSA 4LCLA 4A5RA 1K56D 3IXHA 4JKTA 4Y0UA 2Y4AA 3WRTA 2H0TA 4F94A 2Y2JA 1IYPA 4DE2A 3M2JA 1BSGA 3Q7VA 4OOLA 2EFXA 1HD8A 4KZ3A 5E2EA 1MY8A 5JYPA 1FCMA 3UPNA 3OC2A 2IWCA 4C75A 1XA1A 4JXWA 4OLDA 4UHUA 3E2LA 1NRFA 5TGFA 1SDNA 3NC8A 3IWQA 4GZBA 3HVFA 3SH9A 4PPRA 4E3IA 1CI9A 4OPRA 2OLUA 3IH9A 4GD6A 2XGNA 3GQZA 3IXGA 3Q81A 5EECA 4P87A 2WUQA 2HP6A 5GLCA 3IXBA 2Y2PA 4WEKA 5CGSA 3ISGA 2QMIA 4KG6A 3BEBA 1PIOA 3GMWA 1IKIA 2V1ZA 4E6WA 3FKWA 3W4OA 4K0WA 4X68A 3QNBA 3FKVA 3UDFA 1JWZA 1XXMA 3WS2A 3N6IA 2P74A 3S22A 3BFGA 5M19A 2XDMA 4WMCA 2J7VA 5EVIA 2XFSA 3VOYA 4DKIA 4N9LA 2XFTA 1RGYA 5FQQA 3ZG9B 5FI2A 2UWXA 1QMEA 2WGWA 2ZQ8A 3ZDJA 4KZBA 3NDEA 1IEMA 3A3JA 1L2SA 1XX2A 4QY6A 1PI4A 3VP4A 4BJPA 4DE3A 3OPHA 5AQ7A 1MWRA 5FA7A 4MNRA 1ERQA 5DVAA 2P9VA 2JCHA 2XD5A 5FQJA 5BOHA 4CJNA 1MWSA 5HL1A 1IELA 3G32A 3VSLA 4QU3A 4E3JA 5U47A 1ALQA 5FI6A 4HBUA 2JBFA 5EPHA 1DJCA 1EI5A 2XF3A 4N1XA 1SKFA 5J8XA 1GA0A 3W4PA 1BLHA 5D3OA 4S2NC 5G18A 4PMAA 3GTCA 3P98A 4BD0A 3GRJA 3IQAA 1I2SA 4JF6A 4L0LA 2ZJ9A 3HREA 4PM5A 4IBRA 1YLTA 3ZCZA 1IYSA 4KG5A 1NZUA 4QB8A 1YT4A 1PWCA 4OH0A 4S2NA 4XUXA 2WZZA 3E2KA 5FSRA 4DE1A 1FR6A 1SCWA 2Y59A 3FZCA 4JXGA 1ES2A 4MLLA 2Y2QA 2WAEA 1WYBA 3O86A 2VGJA 5GHXA 3LY3A 4OPQA 4RX2A 4Y0TA 4UA6A 3Q82A 4FH2A 5CHJA 4E3KA 4KZ8A 2Y2MA 4XUZA 1ES5A 1FOFA 2Y2KA 3IHBA 2VGKA 4DXCA 3IF6B 4XXRA 4KG2A 3BFCA 3ZHHA 1M40A 4KQOA 4MEZA 4S2LA 1TVFA 2XH9A 5CRFA 5FAOA 4OOYA 3Q1FA 4KENB 5KSHA 1KE3A 5DF8A 2WKHA 3BRMA 1EWZA 1LHYA 3HLFA 4R23A 3ZG8B 4BL2A 2BG1A 5E2HA 2OV5A 2DCFA 4KZ9A 1KGGA 4UA7A 1SDEA 1BLPA 2OLVA 1YQSA 2IWDA 4P0MA 5F1GA 1GHPA 4IBXA 4X55A 4U0XA 4BENA 2ZQDA 1JTDA 2ZM8A 2V2FF 3FWLA 4E3LA 3SS4A 1XGIA 5KZHA 4QY5A 4U0TA 1TDGA 1KDWA 1YLPA 3A3DA 3UY6A 5M1AA 5FAQA 1BUEA 3DWKA 4QJGA 1SHVA 4X69A 5AQAA 3LCEA 3A3FA 5JYOA 1KE0A 1I5QA 1W79A 2B5RA 1YMSA 5GHZA 5CEBA 2G2UA 2V20A 4HBTA 1KE4A 3D4FA 3NIAA 4OP5A 4KQRA 3VP1A 1M6KA 4S2MA 2QPNA 1CI8A 1FR1A 4OPYA 3UDXA 2X71A 3G34A 3HBRA 2WKEA 1ZG6A 4GOGA 5A92A 5DF7A 1O7EA 4EUZA 2Q9NA 4S2IA 2XD1A 3MZEA 1W8QA 3MKFA 2ZMAA 1PW1A 4LCMA 4P85A 1XPBA 1KDSA 5A90A 4X6TA 4E6XA 1TEMA 4NETA 2ZC5B 1E25A 3V39A 3C4PA 3PBOA 5HAQA 5HAPA 1BT5A 1ZC2A 1FSYA 3BFDA 3HLEA 4ID4A 4WYYA 3UE0A 2RL3A 2ZLYA 3RJUA 4IVKA 1KVLA 5EVIC 2C6WB 3V50A 1YLJA 4PM7A 3Q7ZA 2Y55A 1K38A 4JPMA 5FAPA 4OLGA 4DE0A 3HLBA 5FQKA 4JXSA 5FQMA 3O87A 3MZDA 1K55A 3ZNTA 5DTKA 3UE1A 1YMXA 3VP2A 5AQBA 2DNSA 1XA7A 5CXWA 4R4SA 5GLDA 4QHCA 2XK1A 3IT9A 1S6RA 3OPPA 5GHYA 5HFOA 1YLZA 3NCKA 3SH7A 4E3NA 3UDIA 3S1YA 1HVBA 3MFDA 4DXBA 5F1FA 1N4OA 2GDNA 3HUOA 2J9OA 4HEFA 1K4FA 2HP9A 4QD4A 1WE4A 3G2ZA 4YFMA 2EX9A 1NYMA 3NI9A 2JE5A 3C4OA 3N8RA 3Q7VB 3PBNA 3ZVTA 4E3OA 5HW3A 1GHIA 3HUMA 3G2YA 1ESIA 3VMAA 3ZGAB 5GLBA 3AGDA 3ZG0A 1CK3A 5I94A 4FSFA 3NY4A 1CEGA 3B3XA 3QHYA 1MKIA 3SH8A 1BTLA 4M3KA 4GDNA 1BULA 2HP5A 4NK3A 4N92A 1MWUA 2EXBA 4OP8A 1ES3A 2XQZA 3NBLA 4LV0A 4N1HA 1NXYA 5HARA 4ZJ3A 3N8LA 3DW0A 3QNCA 4X53A 2HPBA 3A3EA 4GKUA 4U3TA 3MKEA 4LV3A 1KGEA 1K6RA 1JWVA 3EQVA 3O88A 4LENA 2Y91A 3WS4A 3PBSA 2A49A 3N4IA 4WMCD 5EVID 3OZHA 4O7DA 4Q8IA 4KZ6A 3TSGA 1FQGA 3NDGA 2WADA 4RYEA 1PW8A 3JYIA 2Y2LA 1ZKJA 2WAFA 4R4RA 4GB7A 4P6BA 4PM9A 2ZC3B 3WS1A 4DDYA 1MWTA 3MXRA 4MBHA 5KSCA 3RXXA 4OVDA 5HAIA 4IVIA 5DTSA 5E2FA 3UPOA 4EQIA 3CMZA 3SOIA 1E3UA 2P9VB 1XKZA 2Y2OA 3PBTA 4MBKA 4WM9A 5TR7A 1K56A 1WYCA 1PZPA 1EROA 4EWFA 1ERMA 1PWDA 3IF5A 5AQ9A 5FASA 4OQHA 3V5MA 4WZ4A 2R9XA 2Z2MB 4DF6A 4OPZA 4EBLA 2PU2A 2ZC7A 1FCNA 3IWIA 4GN2A 3MXSA 2ZQCA 3DTMA 2EX8A 4KZ7A 3CJMA 1ONGA 4S2KA 2EXAA 2ZM0A 4PM8A 4WZ5A 2PBYA 1MBLA 3C7VA 3HLCA 1J9MA 2ZM2A 3HLWA 3ZNYA 5F82A 1IKGA 1JTGA 2HDSA 4CPKA 1IYQA 3VFFA 2WGIA 3AGFA 4K0XA 2Y2GA 3P09A 1K54C 1NYYA 1H8ZA 4ZJ2A 1C3BA 2H0YA 4OQ0A 1YLYA 3CZDA 4S2JA 3VOZA 1U60A 5CGXA 2WYXA 5EOEA 4B4ZA 1OMEA 1W5DA 1K4EA 2WK0A 4C6YA 3A3IA 1DJAA 1H8YA 2J9PA 4WEJA 1K55C 2G2WA 3Q07A 1VM1A 1K54A 1DJBA 3SS5A 2EX6A 1BZAA 2ZC6B 4KZ4A 3UN7A 4UA9A 4DRTA 1RGZA 5CTMA 4RVAA 3M2KA 3SS3A 2WZXA 5CECA 3N7WA 3LO7A 4R1GA 1ZG4A 1PI5A 1IYOA 3IWOA 4YINA 3PBQA 3W4QA 5CHUA 1NZOA 3ITBA 5A91A 2ZQAA 1K57C 3WRZA 2QZ6A 3BFFA 2FFYA 4UAAA 3GVBA 3UE3A 3PBRA 4ZAMA 3V3RA 3UNWA 3MBZA 3EQUA 2HDUA 3UO9A 3ITAA 2XEPA 4OONA 1XGJA 5DTTA 3TOIA 3VP0A 4OQIA 4JF5A 5CERA 5GLAA 1O07A 1K57A 2EX2A 4KZ5A 1HZOA 3G35A 2H5SA 3IF6C 3GV9A 3I7JA 1PZOA 2DRWA 4RX3A 4R3JA 2C5WB 1ESUA 4PM6A 5CEDA 2XR0A 4ZJ1A 1W7FA 3BFEA 1YM1A 2H10A 4GDBA 3G30A 5EE8A 3VSKA 1I2WA 4EBPA 4BLMA 1Z6FA 4E3MA 2EFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MPL A;  2X02 A;  3IF6 A;  1NJ4 A;  4JBF A;  1PWG A;  2ZC4 B;  5FDH A;  3UPP A;  5L2F A;  2WKI A;  5IHV A;  3LEZ A;  2HDR A;  3FV7 A;  3W8K A;  4FH4 A;  1Y54 A;  3TG9 A;  3ZG5 A;  4KQQ A;  3G31 A;  2Y2N A;  5FQ9 A;  1LL9 A;  2J8Y A;  3VFH A;  4S2O A;  2CC1 A;  3C5A A;  4Z9Q A;  1L0F A;  3O3V A;  5EUA A;  1LL5 A;  4BL3 A;  1GHM A;  1L0D A;  4BD1 A;  3BYD A;  2X01 A;  5E43 A;  1NY0 A;  2I72 A;  3DWZ A;  5CGW A;  2HDQ A;  1Q2Q A;  1JVJ A;  1RCJ A;  2ZQ9 A;  3HUN A;  4OKP A;  4WEL A;  3ZG7 B;  3IHA A;  4FD8 A;  1W8Y A;  2E8I A;  4WBG A;  1S0W A;  1N9B A;  3FYZ A;  1VQQ A;  1HTZ A;  3M6H A;  5EVI B;  5FQI A;  4D2O A;  2IWB A;  2XLN A;  5E2G A;  1FSW A;  2BLS A;  5TFQ A;  5HX9 A;  2ZQ7 A;  3BEC A;  1DY6 A;  1MXO A;  2WGW B;  5FI7 A;  3LY4 A;  3VP3 A;  1K6S A;  3IXD A;  2PU4 A;  3OPR A;  3N8S A;  4JF4 A;  3GSG A;  1KVM A;  3S4X A;  4RA7 A;  4B88 A;  4C3Q A;  3HLG A;  1LI9 A;  4JLF A;  4OOM A;  4R3B A;  4S2P A;  3GR2 A;  1TDL A;  4HES A;  4MBF A;  2FFF B;  2WGV A;  4R0Q A;  1ONH A;  1AXB A;  5GL9 A;  1CEF A;  1XP4 A;  3ZVW A;  5KMW A;  4ZBE A;  1L0G A;  1BLS A;  3IH8 A;  1RP5 A;  2Q9M A;  4DDS A;  2A3U A;  4EBN A;  3PAG A;  4WZ5 C;  4Y7P A;  5CTN A;  1Q2P A;  1GA9 A;  1PYY A;  3CG5 A;  3OCL A;  3PTE A;  4K91 A;  3ZFZ A;  3HLD A;  1K25 A;  4LV2 A;  1BLC A;  5FAT A;  5CHM A;  4H8R A;  4Y0O A;  4GD8 A;  3PAE A;  3V3S A;  4X56 A;  5F83 A;  1LLB A;  5A93 A;  4JXV A;  3M6B A;  3BM6 A;  2ZD8 A;  3OCN A;  4ZTK A;  4OQG A;  3AGE A;  1LI0 A;  3G4P A;  3RXW A;  3HL9 A;  1GCE A;  1YLW A;  4B4X A;  1QMF A;  3OPL A;  1E4D A;  1H5X A;  1ES4 A;  4GNU A;  5M18 A;  2JC7 A;  1FCO A;  3BLM A;  4N9K A;  3MZF A;  3WWX A;  1G6A A;  2RCX A;  4FCF A;  1KGF A;  3C7U A;  5EVL A;  4LV1 A;  1JWP A;  2Z2L B;  1L0E A;  3WS5 A;  1G68 A;  4ZDX A;  2Y2I A;  4IED A;  3WS0 A;  4BQM A;  1E3U D;  4EV4 A;  2OSU A;  5DF9 A;  2Y2H A;  4KZA A;  5EOO A;  2R9W A;  3BLS A;  4LCL A;  4A5R A;  1K56 D;  3IXH A;  4JKT A;  4Y0U A;  2Y4A A;  3WRT A;  2H0T A;  4F94 A;  2Y2J A;  1IYP A;  4DE2 A;  3M2J A;  1BSG A;  3Q7V A;  4OOL A;  2EFX A;  1HD8 A;  4KZ3 A;  5E2E A;  1MY8 A;  5JYP A;  1FCM A;  3UPN A;  3OC2 A;  2IWC A;  4C75 A;  1XA1 A;  4JXW A;  4OLD A;  4UHU A;  3E2L A;  1NRF A;  5TGF A;  1SDN A;  3NC8 A;  3IWQ A;  4GZB A;  3HVF A;  3SH9 A;  4PPR A;  4E3I A;  1CI9 A;  4OPR A;  2OLU A;  3IH9 A;  4GD6 A;  2XGN A;  3GQZ A;  3IXG A;  3Q81 A;  5EEC A;  4P87 A;  2WUQ A;  2HP6 A;  5GLC A;  3IXB A;  2Y2P A;  4WEK A;  5CGS A;  3ISG A;  2QMI A;  4KG6 A;  3BEB A;  1PIO A;  3GMW A;  1IKI A;  2V1Z A;  4E6W A;  3FKW A;  3W4O A;  4K0W A;  4X68 A;  3QNB A;  3FKV A;  3UDF A;  1JWZ A;  1XXM A;  3WS2 A;  3N6I A;  2P74 A;  3S22 A;  3BFG A;  5M19 A;  2XDM A;  4WMC A;  2J7V A;  5EVI A;  2XFS A;  3VOY A;  4DKI A;  4N9L A;  2XFT A;  1RGY A;  5FQQ A;  3ZG9 B;  5FI2 A;  2UWX A;  1QME A;  2WGW A;  2ZQ8 A;  3ZDJ A;  4KZB A;  3NDE A;  1IEM A;  3A3J A;  1L2S A;  1XX2 A;  4QY6 A;  1PI4 A;  3VP4 A;  4BJP A;  4DE3 A;  3OPH A;  5AQ7 A;  1MWR A;  5FA7 A;  4MNR A;  1ERQ A;  5DVA A;  2P9V A;  2JCH A;  2XD5 A;  5FQJ A;  5BOH A;  4CJN A;  1MWS A;  5HL1 A;  1IEL A;  3G32 A;  3VSL A;  4QU3 A;  4E3J A;  5U47 A;  1ALQ A;  5FI6 A;  4HBU A;  2JBF A;  5EPH A;  1DJC A;  1EI5 A;  2XF3 A;  4N1X A;  1SKF A;  5J8X A;  1GA0 A;  3W4P A;  1BLH A;  5D3O A;  4S2N C;  5G18 A;  4PMA A;  3GTC A;  3P98 A;  4BD0 A;  3GRJ A;  3IQA A;  1I2S A;  4JF6 A;  4L0L A;  2ZJ9 A;  3HRE A;  4PM5 A;  4IBR A;  1YLT A;  3ZCZ A;  1IYS A;  4KG5 A;  1NZU A;  4QB8 A;  1YT4 A;  1PWC A;  4OH0 A;  4S2N A;  4XUX A;  2WZZ A;  3E2K A;  5FSR A;  4DE1 A;  1FR6 A;  1SCW A;  2Y59 A;  3FZC A;  4JXG A;  1ES2 A;  4MLL A;  2Y2Q A;  2WAE A;  1WYB A;  3O86 A;  2VGJ A;  5GHX A;  3LY3 A;  4OPQ A;  4RX2 A;  4Y0T A;  4UA6 A;  3Q82 A;  4FH2 A;  5CHJ A;  4E3K A;  4KZ8 A;  2Y2M A;  4XUZ A;  1ES5 A;  1FOF A;  2Y2K A;  3IHB A;  2VGK A;  4DXC A;  3IF6 B;  4XXR A;  4KG2 A;  3BFC A;  3ZHH A;  1M40 A;  4KQO A;  4MEZ A;  4S2L A;  1TVF A;  2XH9 A;  5CRF A;  5FAO A;  4OOY A;  3Q1F A;  4KEN B;  5KSH A;  1KE3 A;  5DF8 A;  2WKH A;  3BRM A;  1EWZ A;  1LHY A;  3HLF A;  4R23 A;  3ZG8 B;  4BL2 A;  2BG1 A;  5E2H A;  2OV5 A;  2DCF A;  4KZ9 A;  1KGG A;  4UA7 A;  1SDE A;  1BLP A;  2OLV A;  1YQS A;  2IWD A;  4P0M A;  5F1G A;  1GHP A;  4IBX A;  4X55 A;  4U0X A;  4BEN A;  2ZQD A;  1JTD A;  2ZM8 A;  2V2F F;  3FWL A;  4E3L A;  3SS4 A;  1XGI A;  5KZH A;  4QY5 A;  4U0T A;  1TDG A;  1KDW A;  1YLP A;  3A3D A;  3UY6 A;  5M1A A;  5FAQ A;  1BUE A;  3DWK A;  4QJG A;  1SHV A;  4X69 A;  5AQA A;  3LCE A;  3A3F A;  5JYO A;  1KE0 A;  1I5Q A;  1W79 A;  2B5R A;  1YMS A;  5GHZ A;  5CEB A;  2G2U A;  2V20 A;  4HBT A;  1KE4 A;  3D4F A;  3NIA A;  4OP5 A;  4KQR A;  3VP1 A;  1M6K A;  4S2M A;  2QPN A;  1CI8 A;  1FR1 A;  4OPY A;  3UDX A;  2X71 A;  3G34 A;  3HBR A;  2WKE A;  1ZG6 A;  4GOG A;  5A92 A;  5DF7 A;  1O7E A;  4EUZ A;  2Q9N A;  4S2I A;  2XD1 A;  3MZE A;  1W8Q A;  3MKF A;  2ZMA A;  1PW1 A;  4LCM A;  4P85 A;  1XPB A;  1KDS A;  5A90 A;  4X6T A;  4E6X A;  1TEM A;  4NET A;  2ZC5 B;  1E25 A;  3V39 A;  3C4P A;  3PBO A;  5HAQ A;  5HAP A;  1BT5 A;  1ZC2 A;  1FSY A;  3BFD A;  3HLE A;  4ID4 A;  4WYY A;  3UE0 A;  2RL3 A;  2ZLY A;  3RJU A;  4IVK A;  1KVL A;  5EVI C;  2C6W B;  3V50 A;  1YLJ A;  4PM7 A;  3Q7Z A;  2Y55 A;  1K38 A;  4JPM A;  5FAP A;  4OLG A;  4DE0 A;  3HLB A;  5FQK A;  4JXS A;  5FQM A;  3O87 A;  3MZD A;  1K55 A;  3ZNT A;  5DTK A;  3UE1 A;  1YMX A;  3VP2 A;  5AQB A;  2DNS A;  1XA7 A;  5CXW A;  4R4S A;  5GLD A;  4QHC A;  2XK1 A;  3IT9 A;  1S6R A;  3OPP A;  5GHY A;  5HFO A;  1YLZ A;  3NCK A;  3SH7 A;  4E3N A;  3UDI A;  3S1Y A;  1HVB A;  3MFD A;  4DXB A;  5F1F A;  1N4O A;  2GDN A;  3HUO A;  2J9O A;  4HEF A;  1K4F A;  2HP9 A;  4QD4 A;  1WE4 A;  3G2Z A;  4YFM A;  2EX9 A;  1NYM A;  3NI9 A;  2JE5 A;  3C4O A;  3N8R A;  3Q7V B;  3PBN A;  3ZVT A;  4E3O A;  5HW3 A;  1GHI A;  3HUM A;  3G2Y A;  1ESI A;  3VMA A;  3ZGA B;  5GLB A;  3AGD A;  3ZG0 A;  1CK3 A;  5I94 A;  4FSF A;  3NY4 A;  1CEG A;  3B3X A;  3QHY A;  1MKI A;  3SH8 A;  1BTL A;  4M3K A;  4GDN A;  1BUL A;  2HP5 A;  4NK3 A;  4N92 A;  1MWU A;  2EXB A;  4OP8 A;  1ES3 A;  2XQZ A;  3NBL A;  4LV0 A;  4N1H A;  1NXY A;  5HAR A;  4ZJ3 A;  3N8L A;  3DW0 A;  3QNC A;  4X53 A;  2HPB A;  3A3E A;  4GKU A;  4U3T A;  3MKE A;  4LV3 A;  1KGE A;  1K6R A;  1JWV A;  3EQV A;  3O88 A;  4LEN A;  2Y91 A;  3WS4 A;  3PBS A;  2A49 A;  3N4I A;  4WMC D;  5EVI D;  3OZH A;  4O7D A;  4Q8I A;  4KZ6 A;  3TSG A;  1FQG A;  3NDG A;  2WAD A;  4RYE A;  1PW8 A;  3JYI A;  2Y2L A;  1ZKJ A;  2WAF A;  4R4R A;  4GB7 A;  4P6B A;  4PM9 A;  2ZC3 B;  3WS1 A;  4DDY A;  1MWT A;  3MXR A;  4MBH A;  5KSC A;  3RXX A;  4OVD A;  5HAI A;  4IVI A;  5DTS A;  5E2F A;  3UPO A;  4EQI A;  3CMZ A;  3SOI A;  1E3U A;  2P9V B;  1XKZ A;  2Y2O A;  3PBT A;  4MBK A;  4WM9 A;  5TR7 A;  1K56 A;  1WYC A;  1PZP A;  1ERO A;  4EWF A;  1ERM A;  1PWD A;  3IF5 A;  5AQ9 A;  5FAS A;  4OQH A;  3V5M A;  4WZ4 A;  2R9X A;  2Z2M B;  4DF6 A;  4OPZ A;  4EBL A;  2PU2 A;  2ZC7 A;  1FCN A;  3IWI A;  4GN2 A;  3MXS A;  2ZQC A;  3DTM A;  2EX8 A;  4KZ7 A;  3CJM A;  1ONG A;  4S2K A;  2EXA A;  2ZM0 A;  4PM8 A;  4WZ5 A;  2PBY A;  1MBL A;  3C7V A;  3HLC A;  1J9M A;  2ZM2 A;  3HLW A;  3ZNY A;  5F82 A;  1IKG A;  1JTG A;  2HDS A;  4CPK A;  1IYQ A;  3VFF A;  2WGI A;  3AGF A;  4K0X A;  2Y2G A;  3P09 A;  1K54 C;  1NYY A;  1H8Z A;  4ZJ2 A;  1C3B A;  2H0Y A;  4OQ0 A;  1YLY A;  3CZD A;  4S2J A;  3VOZ A;  1U60 A;  5CGX A;  2WYX A;  5EOE A;  4B4Z A;  1OME A;  1W5D A;  1K4E A;  2WK0 A;  4C6Y A;  3A3I A;  1DJA A;  1H8Y A;  2J9P A;  4WEJ A;  1K55 C;  2G2W A;  3Q07 A;  1VM1 A;  1K54 A;  1DJB A;  3SS5 A;  2EX6 A;  1BZA A;  2ZC6 B;  4KZ4 A;  3UN7 A;  4UA9 A;  4DRT A;  1RGZ A;  5CTM A;  4RVA A;  3M2K A;  3SS3 A;  2WZX A;  5CEC A;  3N7W A;  3LO7 A;  4R1G A;  1ZG4 A;  1PI5 A;  1IYO A;  3IWO A;  4YIN A;  3PBQ A;  3W4Q A;  5CHU A;  1NZO A;  3ITB A;  5A91 A;  2ZQA A;  1K57 C;  3WRZ A;  2QZ6 A;  3BFF A;  2FFY A;  4UAA A;  3GVB A;  3UE3 A;  3PBR A;  4ZAM A;  3V3R A;  3UNW A;  3MBZ A;  3EQU A;  2HDU A;  3UO9 A;  3ITA A;  2XEP A;  4OON A;  1XGJ A;  5DTT A;  3TOI A;  3VP0 A;  4OQI A;  4JF5 A;  5CER A;  5GLA A;  1O07 A;  1K57 A;  2EX2 A;  4KZ5 A;  1HZO A;  3G35 A;  2H5S A;  3IF6 C;  3GV9 A;  3I7J A;  1PZO A;  2DRW A;  4RX3 A;  4R3J A;  2C5W B;  1ESU A;  4PM6 A;  5CED A;  2XR0 A;  4ZJ1 A;  1W7F A;  3BFE A;  1YM1 A;  2H10 A;  4GDB A;  3G30 A;  5EE8 A;  3VSK A;  1I2W A;  4EBP A;  4BLM A;  1Z6F A;  4E3M A;  2EFU A; 
#chains in the Genus database with same CATH topology
 1NJ4 A;  1PWG A;  2HDR A;  3FV7 A;  3TG9 A;  5FQ9 A;  3VFH A;  3S7P A;  4S2O A;  5IT5 A;  3O3V A;  5HWT A;  2JKR I;  1LL5 A;  4BD1 A;  3CHW P;  2AVX A;  4HI4 A;  5CGW A;  2HDQ A;  3D9Y A;  4FD8 A;  5EM0 A;  3FYZ A;  1VQQ A;  3M6H A;  5EVI B;  4MN6 A;  1YPR A;  2IWB A;  2ACG A;  1FSW A;  5HX9 A;  3BEC A;  4HNB A;  4L9E A;  4C3Q A;  3DBA A;  2WKP A;  4R0Q A;  5GL9 A;  1ONH A;  1AXB A;  4HHD A;  4BWI A;  4EW7 A;  1L0G A;  4DDS A;  4WZ5 C;  5CTN A;  3CG5 A;  1T19 A;  1BLC A;  4Y0O A;  3GEC A;  4X56 A;  1KOU A;  5F83 A;  2VJW A;  4I3A A;  2PD8 A;  3G4P A;  3RXW A;  3HL9 A;  1YLW A;  3OPL A;  4GNU A;  3BLM A;  4N9K A;  2K2N A;  3WWX A;  5EVL A;  3CIT A;  4LV1 A;  3WS5 A;  1G68 A;  4ZDX A;  4BQM A;  4EV4 A;  2OSU A;  2Y2H A;  3BLS A;  1K56 D;  3ICY A;  2A2L A;  2B18 A;  2V8F A;  1NWZ A;  4OOL A;  1HD8 A;  4FUW A;  4R70 A;  1OTA A;  3KX0 X;  1FCM A;  3UPN A;  3OC2 A;  1S67 L;  1XFN A;  3IWQ A;  3SH9 A;  2R78 A;  3HVF A;  1GSV A;  2OLU A;  3T4Q A;  3B47 A;  2HP6 A;  5GLC A;  2Y2P A;  5CGS A;  5DFY A;  2V1Z A;  4E6W A;  1JWZ A;  1CJF A;  1XXM A;  3WS2 A;  1MZU A;  2P74 A;  3V67 A;  3F1P B;  4N9L A;  2XFT A;  1RGY A;  2UWX A;  3ZDJ A;  3MQQ A;  1PI4 A;  2A24 A;  2W3F A;  4BJP A;  2PR6 A;  1OTD A;  5FQJ A;  1K0K A;  3QP6 A;  1MWS A;  5HL1 A;  1IEL A;  3G32 A;  3VSL A;  3LYX A;  5U47 A;  4HOI A;  2O9C A;  4R38 A;  1GA0 A;  2ZL1 A;  1BLH A;  5D3O A;  3T1X A;  4Y2F A;  1ZTU A;  3NOU C;  3GTC A;  4BD0 A;  4PM5 A;  3MQO A;  5HPI A;  5L07 A;  1IYS A;  1NZU A;  2P04 A;  1YT4 A;  3C30 A;  4S2N A;  2WZZ A;  1SCW A;  2Y2Q A;  3DAV A;  3LY3 A;  4OPQ A;  3IF6 B;  4XXR A;  3ZHH A;  1M40 A;  4KQO A;  4HJ6 A;  1TVF A;  5CRF A;  5FAO A;  4OOY A;  3Q1F A;  5DF8 A;  2PYP A;  3HLF A;  3UE6 A;  4R23 A;  5IU1 A;  4PKY G;  3OOV A;  3T12 B;  5E2H A;  2OV5 A;  1CF0 A;  2DCF A;  1VHM A;  1BLP A;  2IWD A;  5F1G A;  5EM1 A;  2ZQD A;  2ZM8 A;  2V2F F;  4E3L A;  2O9A A;  1P9R A;  4NKP A;  1XGI A;  1NLZ A;  5HDS A;  1KDW A;  1YLP A;  4HIA A;  3UY6 A;  5M1A A;  1BUE A;  3LCE A;  3A3F A;  1KE0 A;  1W79 A;  2B5R A;  2J3W A;  5J3W A;  5DKL A;  3CPT B;  3VP1 A;  2QPN A;  4OPY A;  1S1Y A;  3ULF A;  1UWN X;  4LCM A;  1XPB A;  5A90 A;  2PD7 A;  4NET A;  2ZC5 B;  3V39 A;  5K5B A;  2YKF A;  5HAP A;  3BFD A;  4WYY A;  3ZYT A;  3IX3 A;  1W63 Q;  4IVK A;  2C6W B;  1YLJ A;  3TRC A;  2BAS A;  1YSP A;  3ZNT A;  5DTK A;  5GLD A;  5GHY A;  3NCK A;  2VZW A;  2DMW A;  3VOL A;  1TS8 A;  3S1Y A;  2JKR M;  2J9O A;  4HEF A;  4QD4 A;  4UQI S;  3G2Z A;  4YFM A;  3NI9 A;  4KUK A;  4LRY C;  4PHT A;  3VMA A;  2W3D A;  4F3L A;  3DTI A;  3NY4 A;  3HJK A;  3QHY A;  2V1B A;  2EWV A;  4KUO A;  2EXB A;  4OP8 A;  4ZJ3 A;  3DW0 A;  4X53 A;  1OTE A;  4U3T A;  4GS9 A;  3D3O A;  3PBS A;  5EVI D;  3OZH A;  3NOP C;  4EU0 A;  4RYE A;  2LB5 A;  3H82 B;  4Y15 A;  3JYI A;  3T4J A;  4P6B A;  4PM9 A;  2ZC3 B;  3T4S A;  3RXX A;  3FPW A;  5E2F A;  5L8M A;  4EQI A;  1XKZ A;  2Y2O A;  4WM9 A;  4JGO A;  5TR7 A;  2L1M A;  1VEU B;  4LPZ A;  1K56 A;  2VEA A;  4OQH A;  4P6Z S;  4Z1W A;  3CJM A;  4ETZ A;  4ARZ B;  1MBL A;  1J9M A;  3ZNY A;  1DP6 A;  2OAQ 1;  1IKG A;  5J4E A;  1Y4O A;  4L9F A;  3QP2 A;  4BBV A;  1GSX A;  1H8Z A;  1YLY A;  4JGP A;  1J3W A;  2WYX A;  1W5D A;  1K55 C;  5F5Y A;  1VM1 A;  1K54 A;  3SS5 A;  5CTM A;  4RVA A;  2WZX A;  5CEC A;  3BJN A;  3LO7 A;  4QWO A;  4K08 A;  4YIN A;  3PBQ A;  5CHU A;  1NZO A;  3ITB A;  5A91 A;  2QZ6 A;  2FFY A;  3H7W A;  4UAA A;  3UE3 A;  1T1C A;  3PBR A;  3V3R A;  3MBZ A;  3EQU A;  2O0Y A;  5DTT A;  3TOI A;  3IBR A;  2EX2 A;  1HZO A;  2H5S A;  4RX3 A;  1A0K A;  3LR3 A;  4PM6 A;  1Z6F A;  2W1R A;  3VSK A;  5EE8 A;  2QWS A;  4BLM A;  4IUH A;  3PR6 A;  4B9O A;  2EFU A;  1P9W A;  3UPP A;  2WKI A;  4HP9 A;  3UB7 A;  3LEZ A;  3W8K A;  4FH4 A;  4KQQ A;  2Y2N A;  2XA7 S;  2CC1 A;  3C5A A;  4BL3 A;  1N9N A;  3BYD A;  5E43 A;  1Q2Q A;  3DTK A;  2Q0O A;  1LSX A;  1W8Y A;  3K3D A;  5HD5 A;  3T4K A;  2KOI A;  1N9B A;  2HJE A;  4HH3 A;  1HTZ A;  3CWF A;  3BY9 A;  2K31 A;  2XLN A;  2BLS A;  4NXF A;  5E2G A;  4DJ3 A;  1DY6 A;  1MXO A;  3G6O A;  3LY4 A;  1SKO B;  3VP3 A;  1K6S A;  2PU4 A;  3N8S A;  4JF4 A;  3S4X A;  1KVM A;  4R3B A;  4OOM A;  2JKF A;  1XP4 A;  4ZBE A;  1BLS A;  3IH8 A;  2Q9M A;  3S7Q A;  4K91 A;  3OCL A;  3ZFZ A;  2EWW A;  3HLD A;  3IS2 B;  5FAT A;  4WLA A;  4GD8 A;  4NXE A;  2W1T A;  4JXV A;  3OLO A;  2PYR A;  2ZD8 A;  1P0Z A;  3AGE A;  3F1O A;  1GCE A;  4Q0I A;  1QMF A;  3LUQ A;  2JC7 A;  1FCO A;  4MMN A;  2RCX A;  3C7U A;  1JWP A;  2Z2L B;  1DRM A;  2Y2I A;  3QP4 A;  3A0R A;  4IED A;  3UME A;  1E3U D;  4KZA A;  4A5R A;  4JKT A;  2Y4A A;  1F5M A;  3Q7V A;  1BSG A;  4Y3I A;  4WF0 A;  1MY8 A;  5JYP A;  5FEG A;  5HZH A;  1XA1 A;  5AVF A;  3E2L A;  5TGF A;  2EA9 A;  1DP9 A;  4DMZ A;  4PPR A;  1CI9 A;  4OPR A;  3IH9 A;  1LL8 A;  3Q81 A;  5EEC A;  4WEK A;  4KG6 A;  3BEB A;  3CLO A;  3L7H A;  3FKW A;  5TBM A;  3W4O A;  3P7N A;  3FKV A;  5F68 A;  4YNR A;  4IJG A;  3BY8 A;  2XDM A;  5EVI A;  5FI2 A;  5EV0 A;  4R6L A;  4QY6 A;  1L2S A;  1XX2 A;  4DE3 A;  5FA7 A;  1PRQ A;  2XD5 A;  5BOH A;  1V9Y A;  4CJN A;  4XT2 B;  2INW A;  4E3J A;  3EGX C;  1ALQ A;  3UB6 A;  1SKF A;  5AJG A;  4ME4 A;  1VET A;  4S2N C;  5TJJ A;  4RQ9 A;  4L0L A;  3HRE A;  2QJ5 A;  5FL3 A;  4DE1 A;  1FR6 A;  4MLL A;  3RFB A;  1ES2 A;  2WAE A;  1WYB A;  3O86 A;  1TS7 A;  1ES5 A;  1FOF A;  4DXC A;  3MSH A;  4KG2 A;  3LI8 A;  4S2L A;  3S7O A;  1IFQ A;  2E8J A;  3BRM A;  1EWZ A;  2PAV P;  3W2Z A;  5HDD A;  4JGR A;  1KGG A;  4P0M A;  4X55 A;  4U0X A;  1JTD A;  5DKK A;  1P97 A;  3FWL A;  4U0T A;  1TDG A;  3A3D A;  2W3G A;  5FAQ A;  5L09 A;  3DWK A;  4QJG A;  1SHV A;  1N9L A;  3JPU A;  5JYO A;  3NIA A;  1M6K A;  2KLI A;  3UDX A;  2X71 A;  3HBR A;  2WKE A;  1ZG6 A;  4GLQ A;  2Q9N A;  1W8Q A;  4MDZ A;  3RH8 B;  1XJ2 A;  2ZMA A;  3F1P A;  3LIB A;  1KDS A;  1TEM A;  1E25 A;  2VX8 A;  2M7U A;  3UB5 P;  3C4P A;  4NXB A;  1Z09 A;  2ZBB A;  3NUL A;  2W3E A;  2RL3 A;  2V1A A;  1D06 A;  4PM7 A;  3Q7Z A;  5FQK A;  1OPX A;  3K3C A;  2L4R A;  1XA7 A;  5C5K A;  4H6J A;  3T1R A;  1G6O A;  2K7S A;  1D1J A;  3MFD A;  3U4L P;  3FC7 A;  1K4F A;  2HP9 A;  1WE4 A;  1T18 A;  1TD5 A;  3E4O A;  1S4S A;  4EET B;  3ZVT A;  2PT7 A;  3ZGA B;  3AGD A;  1CK3 A;  2HF6 A;  4M3K A;  4GDN A;  1BUL A;  1MWU A;  4LGW A;  2XQZ A;  3NBL A;  4LV0 A;  4X25 A;  5HAR A;  2HPB A;  3IX8 A;  4LV3 A;  1KGE A;  1K6R A;  4LFU A;  1JWV A;  3EQV A;  4I38 A;  4WMC D;  4D60 A;  4LRZ E;  1PW8 A;  2WAF A;  4WUJ A;  3WS1 A;  4DDY A;  5KSC A;  5FDS A;  2O99 A;  5F69 A;  4IVI A;  3UPO A;  3CPT A;  3CMZ A;  3SOI A;  1E3U A;  4MBK A;  1SZV A;  3VE4 A;  1WYC A;  4CLC D;  3LIC A;  1ERO A;  4EWF A;  3IF5 A;  4NXG A;  5FAS A;  3RTY A;  4PKY A;  4OPZ A;  1YAX A;  2ZC7 A;  4GN2 A;  3MXS A;  3TW8 A;  2ZQC A;  3T1S A;  4MN5 A;  4S2K A;  2EXA A;  4WZ5 A;  1CQA A;  2ZM2 A;  3E0Y A;  5F82 A;  4CPK A;  1IYQ A;  1LSW A;  3VFF A;  3AGF A;  1T1A A;  3P09 A;  1K54 C;  5DFX A;  4ZJ2 A;  1C3B A;  1AWI A;  3CZD A;  3VOZ A;  4LRX C;  4I3I A;  2QKP A;  5EOE A;  2J9P A;  4WEJ A;  3LGO A;  1RGZ A;  4I3J A;  3M2K A;  3N7W A;  1ZG4 A;  1EW0 A;  1YKD A;  3PHY A;  3WRZ A;  4GW9 A;  3BFF A;  4FOF A;  3BQA A;  3VE3 A;  3ITA A;  2IA2 A;  3BWL A;  2XEP A;  2YKH A;  4GCZ A;  3VP0 A;  3KYZ A;  4OQI A;  4JF5 A;  3LID A;  3QP8 A;  3R7W A;  1O07 A;  1K57 A;  4EQ1 A;  1F2K A;  4R3J A;  2C5W B;  5CED A;  1W7F A;  5A8B A;  1T1B A;  3H82 A;  1MPL A;  2X02 A;  4JBF A;  2ZC4 B;  5FDH A;  5IHV A;  3O5Y A;  1Y54 A;  1LL9 A;  1JNU A;  5DJT A;  1NY0 A;  2I72 A;  3P01 A;  4WEL A;  3ZG7 B;  4HQA A;  4Y5F A;  4WBG A;  2GZA A;  1S0W A;  3JVU A;  5FQI A;  2ZQ7 A;  2WGW B;  3MF0 A;  5FI7 A;  2XRO A;  4ZRR A;  4EUV A;  3FG8 A;  2CMN A;  3OPR A;  3GSG A;  4RA7 A;  4B88 A;  4JLF A;  3GR2 A;  4NG2 A;  1TDL A;  4HES A;  4MBF A;  2WGV A;  1CEF A;  3ZVW A;  3PAG A;  4Y7P A;  1Q2P A;  1PYY A;  3MXQ A;  1OJ5 A;  4H8R A;  4F3L B;  3PAE A;  2HJ9 C;  3V3S A;  2MJ6 A;  2Z6D A;  3M6B A;  2VK3 A;  3BM6 A;  3LR0 A;  4ZTK A;  4OQG A;  4WN5 A;  4B93 A;  4BMW A;  1S1Z A;  2W0N A;  5F6A A;  4B4X A;  4GS9 B;  4R3A A;  1H5X A;  1ES4 A;  1OT9 A;  3MZF A;  3EWK A;  4WL9 A;  3CUE C;  4FCF A;  2LB9 A;  3LEQ A;  2J80 A;  5DF9 A;  2R9W A;  4LCL A;  3IXH A;  4Y0U A;  3LR4 A;  4F94 A;  3CAX A;  3DTE A;  1IYP A;  1STZ A;  3LFV A;  3M2J A;  4DE2 A;  4DN0 A;  2EFX A;  3BQ8 A;  5E2E A;  5AVE A;  2IWC A;  1OTB A;  5IS1 A;  1NRF A;  1GSW A;  2PBD P;  3C2W A;  5HDC A;  4E3I A;  2XGN A;  3GQZ A;  4MN7 A;  2WUQ A;  4P87 A;  3IXB A;  1PIO A;  3GMW A;  4Y17 A;  1IKI A;  4EEU A;  3UDF A;  4G3W A;  3N6I A;  1G5U A;  3FPV A;  5M19 A;  4WMC A;  2J7V A;  3VOY A;  1VB6 A;  3EEA A;  5FQQ A;  3ZG9 B;  2GNX A;  2ZQ8 A;  3NDE A;  1IEM A;  3A3J A;  3A0S A;  3NOT C;  2JKT M;  1IOU A;  1ERQ A;  4HH2 A;  2P9V A;  2JCH A;  1PFL A;  2VGL M;  4IUK A;  4CLC A;  2P7J A;  5EPH A;  4EEP A;  3IS2 A;  3H7W B;  1BYW A;  5J8X A;  2W27 A;  3LIA A;  4PMA A;  3GRJ A;  3GDI A;  3VV4 A;  2ZOI A;  2O9B A;  4GHI B;  4JF6 A;  2ZJ9 A;  1OTI A;  4IBR A;  1YLT A;  4QB8 A;  1PWC A;  3E2K A;  2B95 A;  2Y59 A;  2XA7 M;  2VGJ A;  5GHX A;  4UA6 A;  4FH2 A;  5CHJ A;  4E3K A;  4G3V A;  3IHB A;  2VGK A;  3QP1 A;  1F98 A;  4MEZ A;  2L0W A;  2XH9 A;  1KE3 A;  2WKH A;  1LHY A;  3H9W A;  3IX4 A;  2BG1 A;  3F1N A;  4KZ9 A;  1YQS A;  1LSV A;  3C38 A;  1LT0 A;  4X1M A;  2VLG A;  5KZH A;  4QY5 A;  3EOI A;  2QYB A;  4X69 A;  5AQA A;  5KIZ A;  3K2N A;  1I5Q A;  5GHZ A;  5CEB A;  4HBT A;  4OP5 A;  2J3T C;  4S2M A;  1CI8 A;  1ZHH B;  1FR1 A;  4GOG A;  5A92 A;  5DF7 A;  1O7E A;  3B33 A;  4S2I A;  2XD1 A;  3MZE A;  4Q0H A;  3MKF A;  4UEY A;  4X6T A;  4E6X A;  1OJG A;  3PBO A;  2W1T B;  5HAQ A;  1BT5 A;  1ZC2 A;  1FSY A;  3HLE A;  2GJ3 A;  2WKQ A;  3RJU A;  4CLC E;  4HJ4 A;  3TE8 A;  3V50 A;  1V9Z A;  2Y55 A;  4OLG A;  3HLB A;  5FQM A;  3O87 A;  1K55 A;  3B42 A;  1YMX A;  3VP2 A;  2DNS A;  3L9K A;  4R4S A;  4QHC A;  1S6R A;  5HFO A;  1W63 M;  3LI9 A;  3A0V A;  5F1F A;  3UB8 A;  1N4O A;  4ESP A;  1NYM A;  2UV0 E;  1PNE A;  3Q7V B;  2VKS A;  3MR0 A;  4Y13 A;  3T50 A;  5I5L A;  3G2Y A;  5I94 A;  3MMH A;  5CX7 A;  4LLO B;  1MKI A;  3KSI A;  1BTL A;  2HP5 A;  4I5S A;  4L9G A;  4GKU A;  5TBM B;  3MKE A;  3O88 A;  3WS4 A;  2V0W A;  3NDG A;  4R4R A;  4GB7 A;  1MWT A;  3BW6 A;  4OVD A;  4X1L A;  5HD3 A;  1PZP A;  3E4Q A;  4HJ3 A;  1ERM A;  5AQ9 A;  3E4P A;  3V5M A;  4WZ4 A;  4M4X A;  2JHE A;  1VET B;  1XJ3 A;  2EX8 A;  1ONG A;  3D72 A;  4PM8 A;  3C7V A;  2PR5 A;  1NLY A;  3HLW A;  1TS0 A;  1JTG A;  3T4T A;  1H0M A;  2HDS A;  2WGI A;  4K0X A;  1NYY A;  3NEC A;  1OME A;  1S4R A;  1K4E A;  2WK0 A;  4C6Y A;  1TS6 A;  3A3I A;  2I9V A;  1Y28 A;  4AFI A;  4G3K A;  1DJB A;  2EX6 A;  1BZA A;  4UA9 A;  4DRT A;  2KX6 A;  2XSS A;  3SS3 A;  3UMD A;  2ZMF A;  1K57 C;  2GX5 A;  3UNW A;  3IBJ A;  5EVE A;  3UO9 A;  3MFX A;  4YOF A;  5CER A;  5GLA A;  1UWP X;  3G35 A;  2DRW A;  5J7E A;  1ESU A;  2XR0 A;  3OBF A;  2HV1 A;  2W3H A;  3S7N A;  4EBP A;  3G30 A;  4KEN B;  2M7V A;  4E3M A;  3IF6 A;  5L2F A;  4GJ4 A;  3ZG5 A;  2JKG A;  2PHY A;  2B02 A;  3G31 A;  3LIE A;  2J8Y A;  4Z9Q A;  1L0F A;  5EUA A;  3MQ0 A;  2JKT I;  1GHM A;  1L0D A;  2Z6C A;  5DJU A;  2X01 A;  3DWZ A;  3WRT A;  2ZQ9 A;  1JVJ A;  1RCJ A;  3HUN A;  2V0U A;  4HY8 A;  4OKP A;  3IHA A;  2E8I A;  3JVV A;  4D2O A;  4H6J B;  5TFQ A;  3T1Q B;  2A24 B;  3IXD A;  1WA9 A;  4PAU A;  3HLG A;  1LI9 A;  4S2P A;  2FFF B;  4II7 A;  5KMW A;  1RP5 A;  4EBN A;  2A3U A;  1GA9 A;  3PTE A;  1K25 A;  4LV2 A;  2ZL1 B;  5CHM A;  2FH5 A;  1LLB A;  5A93 A;  3EGD C;  3OCN A;  1LI0 A;  2OAP 1;  3KO6 A;  4JGQ A;  5HL6 A;  1E4D A;  3PYP A;  5M18 A;  1G6A A;  1KGF A;  4NEE D;  2VA0 A;  1L0E A;  1G28 A;  3E98 A;  3WS0 A;  2Y8H A;  5G4Y A;  5EOO A;  2H0T A;  2Y2J A;  1N9O A;  4KZ3 A;  4Q0J A;  3MS6 A;  2G7U A;  4C75 A;  4JXW A;  4OLD A;  4UHU A;  1HLU P;  1SDN A;  3NC8 A;  4GZB A;  4DJ2 A;  3T4L A;  4GD6 A;  3IXG A;  5MC7 A;  3NHQ A;  3ISG A;  2QMI A;  4K0W A;  4X68 A;  3QNB A;  5L10 A;  3KYE A;  3S22 A;  3BFG A;  2XFS A;  4DKI A;  4BBT A;  3SW1 A;  3HCY A;  1QME A;  2WGW A;  4KZB A;  4CLC C;  3VP4 A;  3OPH A;  5AQ7 A;  1MWR A;  1FIL A;  4MNR A;  5DVA A;  2P08 A;  1VEU A;  1S66 L;  4YWZ A;  4QU3 A;  2Y79 A;  5FI6 A;  1MKM A;  4HBU A;  2JBF A;  1DJC A;  4UQI M;  1EI5 A;  2XF3 A;  4N1X A;  1XJ6 A;  3W4P A;  5G18 A;  3P98 A;  1ACF A;  3IQA A;  1I2S A;  4ARZ A;  1UGU A;  3R7W B;  3SZT A;  4FTX A;  3ZCZ A;  4KG5 A;  2PDR A;  4OH0 A;  4XUX A;  5FSR A;  3FZC A;  2D01 A;  1D7E A;  4JXG A;  3LIF A;  1YSQ A;  4Y0T A;  4RX2 A;  3Q82 A;  4KZ8 A;  2Y2M A;  4XUZ A;  2Y2K A;  2XRN A;  2KDK A;  3BFC A;  4E04 A;  5KSH A;  2HZ5 A;  3ZG8 B;  4BL2 A;  3MJQ A;  2PRF A;  4UA7 A;  1SDE A;  2OLV A;  3QP5 A;  1GHP A;  4IBX A;  4BEN A;  3SS4 A;  2OWH A;  4EES A;  5HPF A;  4P6Z M;  1YMS A;  2G2U A;  2V20 A;  1KE4 A;  3D4F A;  3LR5 A;  4KQR A;  2D02 A;  3G34 A;  2QJ7 A;  4EUZ A;  2VV8 A;  1PW1 A;  2VV7 A;  4P85 A;  1ODV A;  2V8C A;  2FZ0 A;  4ID4 A;  3UE0 A;  2ZLY A;  3ZQ5 A;  1KVL A;  1OT6 A;  5EVI C;  4O8G A;  5FEF A;  1DP8 A;  1K38 A;  4JPM A;  5FAP A;  4DE0 A;  3MZD A;  4KQD A;  5G4Z A;  3UE1 A;  5AQB A;  3PXP A;  5CXW A;  3C8C A;  2XK1 A;  3IT9 A;  3OPP A;  1L3L A;  1YLZ A;  3SH7 A;  4GHI A;  4E3N A;  2VGL S;  3UDI A;  1TF1 A;  2V9A A;  1SKO A;  1HVB A;  4DXB A;  1H8M A;  2GDN A;  3HUO A;  4BBU A;  2EX9 A;  2JE5 A;  3C4O A;  3KSF A;  3N8R A;  3UB9 A;  4EER A;  3PBN A;  4E3O A;  5HW3 A;  2JN7 A;  2J3T D;  1GHI A;  3HUM A;  1ESI A;  5GLB A;  4MCW A;  3ZG0 A;  4FSF A;  1CEG A;  1H3Q A;  3B3X A;  2HGV A;  3SH8 A;  2OWJ A;  4NK3 A;  4N92 A;  1ES3 A;  4N1H A;  2VV6 A;  1NXY A;  3N8L A;  3QNC A;  3A3E A;  4LEN A;  2Y91 A;  3KSH A;  2A49 A;  3N4I A;  4O7D A;  5LBR A;  4Q8I A;  4KZ6 A;  3TSG A;  1FQG A;  2WAD A;  3NJA A;  2Y2L A;  1ZKJ A;  3MXR A;  4MBH A;  3TJZ C;  5HAI A;  5DTS A;  4O01 A;  5EFW A;  2P9V B;  3PBT A;  3KYQ A;  1PWD A;  4IHQ A;  4CLC B;  2R9X A;  2Z2M B;  4DF6 A;  2BTF P;  4EBL A;  2PU2 A;  1FCN A;  3IWI A;  3DTM A;  5HSQ A;  2ZOH A;  4KZ7 A;  2ZM0 A;  2QHK A;  2PBY A;  3HLC A;  4O0P A;  2WKR A;  2Y2G A;  2H0Y A;  4OQ0 A;  4ETX A;  1NRJ A;  4S2J A;  1FIK A;  1X0O A;  1U60 A;  5CGX A;  4B4Z A;  3U2A A;  2ZMV A;  1MC0 A;  1DJA A;  1H8Y A;  1F9I A;  2G2W A;  3Q07 A;  5HWW A;  2ZC6 B;  4KZ4 A;  3UN7 A;  2NUP C;  3CUE A;  4QPR A;  4XT2 A;  3F1N B;  2OOL A;  3T4O A;  4R1G A;  1PI5 A;  3F1O B;  1IYO A;  3IWO A;  3W4Q A;  2ZQA A;  5HWV A;  3KSG A;  3GVB A;  4ZAM A;  2H28 A;  2NUT C;  3HJI A;  3EEH A;  2HDU A;  4OON A;  1XGJ A;  3CI6 A;  4EXO A;  4CQH A;  4KZ5 A;  3IF6 C;  3GV9 A;  3I7J A;  1PZO A;  1XJ4 A;  3R4K A;  4ZJ1 A;  3BFE A;  1YM1 A;  4HP4 A;  2H10 A;  4GDB A;  4I39 A;  2M1C A;  1I2W A;  1XFQ A;  4JXS A; 
#chains in the Genus database with same CATH homology
 1MPL A;  2X02 A;  3IF6 A;  1NJ4 A;  4JBF A;  1PWG A;  2ZC4 B;  5FDH A;  3UPP A;  5L2F A;  2WKI A;  5IHV A;  3LEZ A;  2HDR A;  3FV7 A;  3W8K A;  4FH4 A;  1Y54 A;  3TG9 A;  3ZG5 A;  4KQQ A;  3G31 A;  2Y2N A;  5FQ9 A;  1LL9 A;  2J8Y A;  3VFH A;  4S2O A;  2CC1 A;  3C5A A;  4Z9Q A;  1L0F A;  3O3V A;  5EUA A;  1LL5 A;  4BL3 A;  1GHM A;  1L0D A;  4BD1 A;  3BYD A;  2X01 A;  5E43 A;  1NY0 A;  2I72 A;  3DWZ A;  5CGW A;  2HDQ A;  1Q2Q A;  1JVJ A;  1RCJ A;  2ZQ9 A;  3HUN A;  4OKP A;  4WEL A;  3ZG7 B;  3IHA A;  4FD8 A;  1W8Y A;  2E8I A;  4WBG A;  1S0W A;  1N9B A;  3FYZ A;  1VQQ A;  1HTZ A;  3M6H A;  5EVI B;  5FQI A;  4D2O A;  2IWB A;  2XLN A;  5E2G A;  1FSW A;  2BLS A;  5TFQ A;  5HX9 A;  2ZQ7 A;  3BEC A;  1DY6 A;  1MXO A;  2WGW B;  5FI7 A;  3LY4 A;  3VP3 A;  1K6S A;  3IXD A;  2PU4 A;  3OPR A;  3N8S A;  4JF4 A;  3GSG A;  1KVM A;  3S4X A;  4RA7 A;  4B88 A;  4C3Q A;  3HLG A;  1LI9 A;  4JLF A;  4OOM A;  4R3B A;  4S2P A;  3GR2 A;  1TDL A;  4HES A;  4MBF A;  2FFF B;  2WGV A;  4R0Q A;  1ONH A;  1AXB A;  5GL9 A;  1CEF A;  1XP4 A;  3ZVW A;  5KMW A;  4ZBE A;  1L0G A;  1BLS A;  3IH8 A;  1RP5 A;  2Q9M A;  4DDS A;  2A3U A;  4EBN A;  3PAG A;  4WZ5 C;  4Y7P A;  5CTN A;  1Q2P A;  1GA9 A;  1PYY A;  3CG5 A;  3OCL A;  3PTE A;  4K91 A;  3ZFZ A;  3HLD A;  1K25 A;  4LV2 A;  1BLC A;  5FAT A;  5CHM A;  4H8R A;  4Y0O A;  4GD8 A;  3PAE A;  3V3S A;  4X56 A;  5F83 A;  1LLB A;  5A93 A;  4JXV A;  3M6B A;  3BM6 A;  2ZD8 A;  3OCN A;  4ZTK A;  4OQG A;  3AGE A;  1LI0 A;  3G4P A;  3RXW A;  3HL9 A;  1GCE A;  1YLW A;  4B4X A;  1QMF A;  3OPL A;  1E4D A;  1H5X A;  1ES4 A;  4GNU A;  5M18 A;  2JC7 A;  1FCO A;  3BLM A;  4N9K A;  3MZF A;  3WWX A;  1G6A A;  2RCX A;  4FCF A;  1KGF A;  3C7U A;  5EVL A;  4LV1 A;  1JWP A;  2Z2L B;  1L0E A;  3WS5 A;  1G68 A;  4ZDX A;  2Y2I A;  4IED A;  3WS0 A;  4BQM A;  1E3U D;  4EV4 A;  2OSU A;  5DF9 A;  2Y2H A;  4KZA A;  5EOO A;  2R9W A;  3BLS A;  4LCL A;  4A5R A;  1K56 D;  3IXH A;  4JKT A;  4Y0U A;  2Y4A A;  3WRT A;  2H0T A;  4F94 A;  2Y2J A;  1IYP A;  4DE2 A;  3M2J A;  1BSG A;  3Q7V A;  4OOL A;  2EFX A;  1HD8 A;  4KZ3 A;  5E2E A;  1MY8 A;  5JYP A;  1FCM A;  3UPN A;  3OC2 A;  2IWC A;  4C75 A;  1XA1 A;  4JXW A;  4OLD A;  4UHU A;  3E2L A;  1NRF A;  5TGF A;  1SDN A;  3NC8 A;  3IWQ A;  4GZB A;  3HVF A;  3SH9 A;  4PPR A;  4E3I A;  1CI9 A;  4OPR A;  2OLU A;  3IH9 A;  4GD6 A;  2XGN A;  3GQZ A;  3IXG A;  3Q81 A;  5EEC A;  4P87 A;  2WUQ A;  2HP6 A;  5GLC A;  3IXB A;  2Y2P A;  4WEK A;  5CGS A;  3ISG A;  2QMI A;  4KG6 A;  3BEB A;  1PIO A;  3GMW A;  1IKI A;  2V1Z A;  4E6W A;  3FKW A;  3W4O A;  4K0W A;  4X68 A;  3QNB A;  3FKV A;  3UDF A;  1JWZ A;  1XXM A;  3WS2 A;  3N6I A;  2P74 A;  3S22 A;  3BFG A;  5M19 A;  2XDM A;  4WMC A;  2J7V A;  5EVI A;  2XFS A;  3VOY A;  4DKI A;  4N9L A;  2XFT A;  1RGY A;  5FQQ A;  3ZG9 B;  5FI2 A;  2UWX A;  1QME A;  2WGW A;  2ZQ8 A;  3ZDJ A;  4KZB A;  3NDE A;  1IEM A;  3A3J A;  1L2S A;  1XX2 A;  4QY6 A;  1PI4 A;  3VP4 A;  4BJP A;  4DE3 A;  3OPH A;  5AQ7 A;  1MWR A;  5FA7 A;  4MNR A;  1ERQ A;  5DVA A;  2P9V A;  2JCH A;  2XD5 A;  5FQJ A;  5BOH A;  4CJN A;  1MWS A;  5HL1 A;  1IEL A;  3G32 A;  3VSL A;  4QU3 A;  4E3J A;  5U47 A;  1ALQ A;  5FI6 A;  4HBU A;  2JBF A;  5EPH A;  1DJC A;  1EI5 A;  2XF3 A;  4N1X A;  1SKF A;  5J8X A;  1GA0 A;  3W4P A;  1BLH A;  5D3O A;  4S2N C;  5G18 A;  4PMA A;  3GTC A;  3P98 A;  4BD0 A;  3GRJ A;  3IQA A;  1I2S A;  4JF6 A;  4L0L A;  2ZJ9 A;  3HRE A;  4PM5 A;  4IBR A;  1YLT A;  3ZCZ A;  1IYS A;  4KG5 A;  1NZU A;  4QB8 A;  1YT4 A;  1PWC A;  4OH0 A;  4S2N A;  4XUX A;  2WZZ A;  3E2K A;  5FSR A;  4DE1 A;  1FR6 A;  1SCW A;  2Y59 A;  3FZC A;  4JXG A;  1ES2 A;  4MLL A;  2Y2Q A;  2WAE A;  1WYB A;  3O86 A;  2VGJ A;  5GHX A;  3LY3 A;  4OPQ A;  4RX2 A;  4Y0T A;  4UA6 A;  3Q82 A;  4FH2 A;  5CHJ A;  4E3K A;  4KZ8 A;  2Y2M A;  4XUZ A;  1ES5 A;  1FOF A;  2Y2K A;  3IHB A;  2VGK A;  4DXC A;  3IF6 B;  4XXR A;  4KG2 A;  3BFC A;  3ZHH A;  1M40 A;  4KQO A;  4MEZ A;  4S2L A;  1TVF A;  2XH9 A;  5CRF A;  5FAO A;  4OOY A;  3Q1F A;  4KEN B;  5KSH A;  1KE3 A;  5DF8 A;  2WKH A;  3BRM A;  1EWZ A;  1LHY A;  3HLF A;  4R23 A;  3ZG8 B;  4BL2 A;  2BG1 A;  5E2H A;  2OV5 A;  2DCF A;  4KZ9 A;  1KGG A;  4UA7 A;  1SDE A;  1BLP A;  2OLV A;  1YQS A;  2IWD A;  4P0M A;  5F1G A;  1GHP A;  4IBX A;  4X55 A;  4U0X A;  4BEN A;  2ZQD A;  1JTD A;  2ZM8 A;  2V2F F;  3FWL A;  4E3L A;  3SS4 A;  1XGI A;  5KZH A;  4QY5 A;  4U0T A;  1TDG A;  1KDW A;  1YLP A;  3A3D A;  3UY6 A;  5M1A A;  5FAQ A;  1BUE A;  3DWK A;  4QJG A;  1SHV A;  4X69 A;  5AQA A;  3LCE A;  3A3F A;  5JYO A;  1KE0 A;  1I5Q A;  1W79 A;  2B5R A;  1YMS A;  5GHZ A;  5CEB A;  2G2U A;  2V20 A;  4HBT A;  1KE4 A;  3D4F A;  3NIA A;  4OP5 A;  4KQR A;  3VP1 A;  1M6K A;  4S2M A;  2QPN A;  1CI8 A;  1FR1 A;  4OPY A;  3UDX A;  2X71 A;  3G34 A;  3HBR A;  2WKE A;  1ZG6 A;  4GOG A;  5A92 A;  5DF7 A;  1O7E A;  4EUZ A;  2Q9N A;  4S2I A;  2XD1 A;  3MZE A;  1W8Q A;  3MKF A;  2ZMA A;  1PW1 A;  4LCM A;  4P85 A;  1XPB A;  1KDS A;  5A90 A;  4X6T A;  4E6X A;  1TEM A;  4NET A;  2ZC5 B;  1E25 A;  3V39 A;  3C4P A;  3PBO A;  5HAQ A;  5HAP A;  1BT5 A;  1ZC2 A;  1FSY A;  3BFD A;  3HLE A;  4ID4 A;  4WYY A;  3UE0 A;  2RL3 A;  2ZLY A;  3RJU A;  4IVK A;  1KVL A;  5EVI C;  2C6W B;  3V50 A;  1YLJ A;  4PM7 A;  3Q7Z A;  2Y55 A;  1K38 A;  4JPM A;  5FAP A;  4OLG A;  4DE0 A;  3HLB A;  5FQK A;  4JXS A;  5FQM A;  3O87 A;  3MZD A;  1K55 A;  3ZNT A;  5DTK A;  3UE1 A;  1YMX A;  3VP2 A;  5AQB A;  2DNS A;  1XA7 A;  5CXW A;  4R4S A;  5GLD A;  4QHC A;  2XK1 A;  3IT9 A;  1S6R A;  3OPP A;  5GHY A;  5HFO A;  1YLZ A;  3NCK A;  3SH7 A;  4E3N A;  3UDI A;  3S1Y A;  1HVB A;  3MFD A;  4DXB A;  5F1F A;  1N4O A;  2GDN A;  3HUO A;  2J9O A;  4HEF A;  1K4F A;  2HP9 A;  4QD4 A;  1WE4 A;  3G2Z A;  4YFM A;  2EX9 A;  1NYM A;  3NI9 A;  2JE5 A;  3C4O A;  3N8R A;  3Q7V B;  3PBN A;  3ZVT A;  4E3O A;  5HW3 A;  1GHI A;  3HUM A;  3G2Y A;  1ESI A;  3VMA A;  3ZGA B;  5GLB A;  3AGD A;  3ZG0 A;  1CK3 A;  5I94 A;  4FSF A;  3NY4 A;  1CEG A;  3B3X A;  3QHY A;  1MKI A;  3SH8 A;  1BTL A;  4M3K A;  4GDN A;  1BUL A;  2HP5 A;  4NK3 A;  4N92 A;  1MWU A;  2EXB A;  4OP8 A;  1ES3 A;  2XQZ A;  3NBL A;  4LV0 A;  4N1H A;  1NXY A;  5HAR A;  4ZJ3 A;  3N8L A;  3DW0 A;  3QNC A;  4X53 A;  2HPB A;  3A3E A;  4GKU A;  4U3T A;  3MKE A;  4LV3 A;  1KGE A;  1K6R A;  1JWV A;  3EQV A;  3O88 A;  4LEN A;  2Y91 A;  3WS4 A;  3PBS A;  2A49 A;  3N4I A;  4WMC D;  5EVI D;  3OZH A;  4O7D A;  4Q8I A;  4KZ6 A;  3TSG A;  1FQG A;  3NDG A;  2WAD A;  4RYE A;  1PW8 A;  3JYI A;  2Y2L A;  1ZKJ A;  2WAF A;  4R4R A;  4GB7 A;  4P6B A;  4PM9 A;  2ZC3 B;  3WS1 A;  4DDY A;  1MWT A;  3MXR A;  4MBH A;  5KSC A;  3RXX A;  4OVD A;  5HAI A;  4IVI A;  5DTS A;  5E2F A;  3UPO A;  4EQI A;  3CMZ A;  3SOI A;  1E3U A;  2P9V B;  1XKZ A;  2Y2O A;  3PBT A;  4MBK A;  4WM9 A;  5TR7 A;  1K56 A;  1WYC A;  1PZP A;  1ERO A;  4EWF A;  1ERM A;  1PWD A;  3IF5 A;  5AQ9 A;  5FAS A;  4OQH A;  3V5M A;  4WZ4 A;  2R9X A;  2Z2M B;  4DF6 A;  4OPZ A;  4EBL A;  2PU2 A;  2ZC7 A;  1FCN A;  3IWI A;  4GN2 A;  3MXS A;  2ZQC A;  3DTM A;  2EX8 A;  4KZ7 A;  3CJM A;  1ONG A;  4S2K A;  2EXA A;  2ZM0 A;  4PM8 A;  4WZ5 A;  2PBY A;  1MBL A;  3C7V A;  3HLC A;  1J9M A;  2ZM2 A;  3HLW A;  3ZNY A;  5F82 A;  1IKG A;  1JTG A;  2HDS A;  4CPK A;  1IYQ A;  3VFF A;  2WGI A;  3AGF A;  4K0X A;  2Y2G A;  3P09 A;  1K54 C;  1NYY A;  1H8Z A;  4ZJ2 A;  1C3B A;  2H0Y A;  4OQ0 A;  1YLY A;  3CZD A;  4S2J A;  3VOZ A;  1U60 A;  5CGX A;  2WYX A;  5EOE A;  4B4Z A;  1OME A;  1W5D A;  1K4E A;  2WK0 A;  4C6Y A;  3A3I A;  1DJA A;  1H8Y A;  2J9P A;  4WEJ A;  1K55 C;  2G2W A;  3Q07 A;  1VM1 A;  1K54 A;  1DJB A;  3SS5 A;  2EX6 A;  1BZA A;  2ZC6 B;  4KZ4 A;  3UN7 A;  4UA9 A;  4DRT A;  1RGZ A;  5CTM A;  4RVA A;  3M2K A;  3SS3 A;  2WZX A;  5CEC A;  3N7W A;  3LO7 A;  4R1G A;  1ZG4 A;  1PI5 A;  1IYO A;  3IWO A;  4YIN A;  3PBQ A;  3W4Q A;  5CHU A;  1NZO A;  3ITB A;  5A91 A;  2ZQA A;  1K57 C;  3WRZ A;  2QZ6 A;  3BFF A;  2FFY A;  4UAA A;  3GVB A;  3UE3 A;  3PBR A;  4ZAM A;  3V3R A;  3UNW A;  3MBZ A;  3EQU A;  2HDU A;  3UO9 A;  3ITA A;  2XEP A;  4OON A;  1XGJ A;  5DTT A;  3TOI A;  3VP0 A;  4OQI A;  4JF5 A;  5CER A;  5GLA A;  1O07 A;  1K57 A;  2EX2 A;  4KZ5 A;  1HZO A;  3G35 A;  2H5S A;  3IF6 C;  3GV9 A;  3I7J A;  1PZO A;  2DRW A;  4RX3 A;  4R3J A;  2C5W B;  1ESU A;  4PM6 A;  5CED A;  2XR0 A;  4ZJ1 A;  1W7F A;  3BFE A;  1YM1 A;  2H10 A;  4GDB A;  3G30 A;  5EE8 A;  3VSK A;  1I2W A;  4EBP A;  4BLM A;  1Z6F A;  4E3M A;  2EFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...