5TFQA

Crystal structure of a representative of class a beta-lactamase from bacteroides cellulosilyticus dsm 14838
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
277
structure length
277
Chain Sequence
NRTPKQKIEQQIDSLLKDKKATVGVAVLANDETVAVYNNQIHFPLLSVFKFHVGLAVLDKMDKGHIALDSLIEVKSSQLKSNTYSPLRDKFPDQDITISLGELLKYTISKSDNNTCDILIEYVGGIDQVNEYVKSLGIKDCNLAATETLMHTSGDTDLNWSTPEEVVRLLNIADKQPLFGTQYKDFLQAIMQETSTGKDKLKGQLPADVIVGHKTGSSDRTPEGIKIADNDAGFVILPNGQKYYIAVFVMESQETDADNAAIIASISKIVYDTLNSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Crystal structure of a representative of class A beta-lactamase from Bacteroides cellulosilyticus DSM 14838
rcsb
source organism Bacteroides cellulosilyticus dsm 14838
total genus 96
structure length 277
sequence length 277
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5tfqA00
1K54C 3IWIA 4QY5A 1E3UD 5FI7A 1XA7A 3S1YA 4U0XA 5EVIB 1LI0A 2X71A 4QD4A 4Y7PA 5HAQA 2ZC3B 4OPYA 4P0MA 2ZQ7A 4BD1A 5E43A 5EOOA 1NJ4A 4JBFA 2WKIA 4B4ZA 2HPBA 5BOHA 3N8SA 3BYDA 4R3JA 1L0EA 2X01A 2EX2A 5KSHA 4HBTA 4A5RA 1BZAA 2QMIA 2HP6A 4Z9QA 1K55A 1K4FA 1BSGA 3VP4A 1RGYA 3E2KA 3UDIA 2JBFA 5FQMA 3OZHA 3GTCA 3RJUA 3FKVA 4OQIA 1VQQA 4P87A 3PBSA 3HUMA 5F1FA 3HVFA 3G4PA 1BUEA 3QNBA 2DCFA 3C4OA 4DE0A 3NIAA 4PMAA 4CPKA 4MBKA 1GA0A 4GB7A 2IWBA 3O86A 3VP2A 3OC2A 4N1HA 4ZJ3A 1GHMA 4E3LA 2ZC4B 3HL9A 4LV1A 5DTSA 3DW0A 3PBTA 1YLPA 4OLGA 2Y2GA 3V5MA 1I2WA 5F83A 1LHYA 3RXXA 1KGEA 3ZVWA 2Y2HA 1PW1A 3BFFA 4S2IA 3VSLA 3HUOA 1KGFA 2HP9A 2RL3A 3W4PA 1MWRA 3UE1A 1MXOA 3N4IA 3VMAA 1W8QA 5CHUA 1S0WA 1K25A 2J8YA 3HLCA 4N9LA 1M40A 4HESA 5FDHA 5DTTA 1PW8A 3Q7VB 2XEPA 1IYQA 4FSFA 1LLBA 3Q7VA 3B3XA 5CGXA 3BM6A 2XLNA 3EQUA 4O7DA 4S2LA 1K56A 3BFEA 2ZM2A 3PBQA 3TSGA 2FFYA 5EVID 3TG9A 3GMWA 4N92A 2R9WA 4IVIA 4ZTKA 1ES2A 1XA1A 4KENB 2WGWB 1KVLA 4IVKA 5E2EA 5FI2A 4WYYA 1AXBA 4E3MA 5I94A 2G2WA 3FZCA 1XP4A 4RA7A 1YMXA 4JXVA 1E3UA 4CJNA 2JC7A 2EXAA 4IBRA 3AGFA 1RGZA 2H0YA 4OLDA 2A49A 1YLWA 2PU4A 1L0FA 5EOEA 1PWDA 3IF6B 3C4PA 4OH0A 2Y55A 3GR2A 3HLFA 4MLLA 1BLCA 3SH9A 4WBGA 4PPRA 3UNWA 3QNCA 4E3IA 4S2KA 1LL5A 1H8YA 2XQZA 3FKWA 2HDQA 1DY6A 1E25A 3HLWA 3IT9A 5DF8A 4BENA 5KSCA 3IXBA 3NCKA 5GL9A 5IHVA 2HDRA 4KZ8A 3WS2A 1BT5A 4JF6A 4S2OA 1EI5A 2DNSA 4X55A 1JWZA 1CI9A 3CJMA 4GDBA 4OKPA 4KZ6A 4P6BA 4Q8IA 4K91A 3NC8A 5G18A 3V3SA 1FQGA 5FQJA 4BJPA 3PTEA 1IYOA 2HDSA 2Y2IA 3D4FA 3GVBA 3ZFZA 5FASA 3WS5A 4X6TA 5KMWA 1NYMA 3BFGA 3C7UA 5CTNA 5HW3A 3GSGA 4DDSA 2QPNA 2PBYA 5FAPA 5AQ7A 3ZNTA 2QZ6A 4WEJA 4RVAA 4MBHA 5DTKA 1EROA 1HZOA 4LCMA 2CC1A 3Q1FA 1I2SA 4Y0UA 3W4OA 2DRWA 4GNUA 3HBRA 2Y2QA 2Z2MB 2P9VB 4KZ3A 1XGIA 2ZD8A 2ZQAA 1DJBA 3PBOA 4ZJ1A 2EX9A 4KZBA 4LV0A 4BQMA 1M6KA 1Q2PA 3WS0A 4P85A 3GQZA 4R0QA 4X53A 5TR7A 2WZZA 3TOIA 3MKEA 5EVIA 3IF6C 4FCFA 5CERA 1ESIA 3BRMA 1U60A 2OV5A 2H10A 2H5SA 3ZNYA 3CMZA 4KG5A 4PM8A 3G30A 3M2KA 5M18A 3BLMA 3G35A 1MBLA 3GV9A 2RCXA 5GHXA 2Y2NA 4GD6A 1KDWA 3ZG8B 1PI5A 1SDEA 3N8RA 1PI4A 1JVJA 1SDNA 1WYCA 2ZMAA 3IXGA 1C3BA 1KDSA 3N6IA 4RX3A 5EECA 4FD8A 1YM1A 3OCLA 4F94A 5CXWA 2IWDA 1XPBA 1MWTA 3MZEA 3G2YA 1HTZA 3IF5A 4QB8A 2WAEA 5FAOA 1K38A 1MWUA 3V39A 3GRJA 1EWZA 4QU3A 4S2PA 4Y0OA 2PU2A 5CGSA 3P09A 4DE1A 3N7WA 5JYOA 2Y2LA 1NXYA 2ZC5B 5GLBA 2OLUA 3C5AA 2EXBA 3SOIA 3ITAA 1IKGA 4R3BA 3Q82A 1TDLA 3MXRA 1DJCA 3W8KA 3V3RA 1L0DA 4KQOA 4UA9A 5CECA 1ZC2A 3N8LA 4S2NC 4EBPA 3AGEA 3BFDA 5L2FA 4KZ5A 3UPPA 4HEFA 1NYYA 4UHUA 1FOFA 4E3OA 1BTLA 4OVDA 3O3VA 4UA7A 2JE5A 4PM5A 5FSRA 2XD1A 3ZGAB 1NZOA 2GDNA 4ZJ2A 3VSKA 2VGKA 3LEZA 5CHMA 1H8ZA 1JTDA 1ONHA 2EFUA 4GDNA 1MPLA 4UA6A 4GD8A 1FCMA 1JWVA 5E2FA 5JYPA 5CTMA 1I5QA 4XXRA 5CRFA 2ZQ8A 5FATA 2WGWA 4QY6A 5J8XA 4WM9A 2C5WB 4EBNA 1KGGA 1XGJA 4C6YA 4FH4A 1K6RA 3ITBA 2BG1A 2Z2LB 3OPLA 4H8RA 3WS4A 4S2JA 4PM6A 4BL3A 1FR6A 1K57C 3HLGA 1K54A 3Q7ZA 4JKTA 2ZQCA 3VFFA 2A3UA 5FQQA 3ZG9B 4OOMA 2H0TA 4WZ5C 5U47A 4MBFA 1TVFA 3HUNA 3IF6A 4X56A 4XUXA 3UE3A 5AQAA 4JPMA 1ZG6A 2B5RA 2Y2PA 4OQGA 1PIOA 2ZM8A 4NETA 3SS5A 1YLZA 4IBXA 4OP8A 2XK1A 5FQIA 3VP1A 3ZVTA 2XF3A 1IELA 3NDEA 1GA9A 1SCWA 3HLDA 5E2GA 3VP3A 1KVMA 2EX8A 2Y4AA 3BEBA 1NRFA 4OQ0A 2OLVA 2J7VA 1WYBA 4GKUA 3P98A 5CHJA 5A92A 1YQSA 2HP5A 5AQBA 3EQVA 4DF6A 1ZKJA 2JCHA 4K0WA 1SKFA 2VGJA 4DKIA 1H5XA 1JTGA 3Q81A 1N9BA 4LV2A 4DE2A 2ZC7A 1CEFA 3OCNA 3S22A 4KZ9A 3M6HA 1G6AA 5EPHA 3ISGA 4DXBA 1KE4A 4GZBA 5FAQA 4JF4A 1CEGA 4EUZA 1ESUA 1GHIA 4YFMA 3WRTA 4PM9A 3ZG0A 3BECA 5HX9A 1VM1A 5F82A 3A3IA 1J9MA 3JYIA 2P9VA 5DF7A 2Y2OA 4E3NA 1PYYA 3IH8A 3MKFA 1G68A 4UAAA 1Z6FA 2Y2MA 1FSYA 1BULA 4QHCA 4S2NA 3DTMA 2ZC6B 2ZLYA 4JXSA 5HFOA 2WZXA 2WGVA 4R23A 4RX2A 4E3JA 4C75A 5EVLA 5EUAA 3UPOA 3UO9A 3ZHHA 4U0TA 3IH9A 3FWLA 3Q07A 4GN2A 2J9PA 2WK0A 2XDMA 4JLFA 1IYPA 5A91A 3UN7A 5CGWA 2V20A 5F1GA 4X69A 5A90A 5EE8A 1IEMA 1LL9A 5A93A 1YLJA 2ZQ9A 4OOYA 2Y91A 4HBUA 5FQ9A 3IHAA 3SH7A 1MKIA 5GHYA 2C6WB 4KQQA 4R4RA 3VP0A 5CEDA 4M3KA 1BLSA 3O87A 2X02A 4JXGA 4DRTA 4KG2A 1WE4A 1YLTA 5GLDA 4RYEA 3AGDA 3OPRA 3G34A 1FSWA 4BD0A 1L2SA 1K57A 4WZ4A 4PM7A 5AQ9A 4WMCD 4B88A 4K0XA 3I7JA 1OMEA 3IXDA 3MFDA 4EWFA 4WEKA 4WZ5A 4D2OA 4Y0TA 5HARA 3OPPA 3PBNA 1YMSA 2Q9NA 4MEZA 3SS3A 2WGIA 1FCOA 3WRZA 1QMEA 3LY3A 1K4EA 1SHVA 3A3EA 1YLYA 1ES4A 4KZ7A 3UE0A 4OONA 5CEBA 1E4DA 3VOYA 4WELA 4LCLA 4R1GA 3W4QA 3S4XA 2OSUA 2WUQA 1KE3A 5HAIA 4KQRA 1ERQA 1FCNA 4R4SA 2XH9A 3ZG7B 3BFCA 2Y2KA 4ZDXA 1LI9A 3HLBA 4OOLA 1ES3A 3UDFA 4IEDA 2FFFB 1MWSA 1ZG4A 1JWPA 1N4OA 2WKHA 3MZDA 5FQKA 1NY0A 3PAEA 4KZAA 2ZJ9A 4YINA 2IWCA 2J9OA 3LCEA 3IHBA 5EVIC 1W7FA 2ZQDA 4KG6A 1QMFA 4U3TA 1GCEA 2G2UA 3NI9A 5M19A 3A3DA 3QHYA 5M1AA 1ALQA 3CZDA 1KE0A 3IWQA 4S2MA 2Y59A 3MZFA 4EV4A 4N9KA 5KZHA 1ES5A 1K6SA 4NK3A 3O88A 4E6XA 2WADA 1PZOA 4LENA 1K55C 3OPHA 1PWGA 5FI6A 3C7VA 1CI8A 4OPZA 4DE3A 1Q2QA 3A3FA 3G31A 3UDXA 4DDYA 5TFQA 3ZCZA 2WYXA 3G32A 1RP5A 1TDGA 4ZBEA 1BLHA 4JF5A 4E6WA 3UPNA 5FA7A 2R9XA 2Q9MA 5HAPA 3VOZA 5TGFA 2ZM0A 3SH8A 2I72A 1ERMA 1W8YA 1XX2A 5D3OA 1MY8A 2EFXA 2XFSA 1RCJA 4BLMA 3HREA 1FR1A 4JXWA 4OQHA 1IKIA 1IYSA 3NDGA 4WMCA 3WWXA 5GHZA 4LV3A 4FH2A 3PAGA 3G2ZA 4EQIA 3ZDJA 1XKZA 2XGNA 4EBLA 1O07A 3MXSA 1ONGA 4ID4A 1TEMA 2BLSA 2V1ZA 3E2LA 3SS4A 3A3JA 4E3KA 3M2JA 3FV7A 3BLSA 3IWOA 3V50A 2Y2JA 4OP5A 3HLEA 2WAFA 1W79A 1GHPA 3NY4A 1CK3A 2E8IA 2XFTA 1L0GA 3UY6A 1PZPA 4ZAMA 4L0LA 1S6RA 4B4XA 3DWZA 5GLCA 3FYZA 3DWKA 4KZ4A 2P74A 5DVAA 5E2HA 3ZG5A 4C3QA 3NBLA 4OPRA 1W5DA 1K56D 3LY4A 3IQAA 5GLAA 1NZUA 2EX6A 1YT4A 1HVBA 3LO7A 1HD8A 3IXHA 1Y54A 3VFHA 2XR0A 4OPQA 3PBRA 1PWCA 2HDUA 2WKEA 2XD5A 3CG5A 4MNRA 1DJAA 4DXCA 5DF9A 3RXWA 3WS1A 1BLPA 2V2FF 4GOGA 2UWXA 4QJGA 4BL2A 4XUZA 1XXMA 3MBZA 3M6BA 5HL1A 1O7EA 4N1XA 4X68A
chains in the Genus database with same CATH superfamily
3IWIA 5G4ZA 1XA7A 5EVIB 1LI0A 4Y7PA 4P0MA 3MFXA 4BD1A 2WKIA 1L0EA 2X01A 2EX2A 4JGQA 2VGLM 1BSGA 3VP4A 1RGYA 3FKVA 1VQQA 4P87A 3HVFA 3G4PA 4PMAA 5HDCA 4MBKA 3FC7A 5J7EA 2VK3A 3OC2A 4ZJ3A 1GHMA 4IUKA 3T4LA 5F5YA 3UB7A 3DW0A 4OLGA 2Y2GA 3DBAA 3ZVWA 2Y2HA 3VSLA 1KGFA 3IS2B 4BBTA 4O8GA 3N4IA 1K25A 4N9LA 2WKQA 2ZOHA 1IYQA 4FSFA 1LLBA 3Q7VA 3JVUA 3B3XA 3EQUA 1K56A 3LI9A 2A24B 4CLCE 4WL9A 3TG9A 3CUEC 1XA1A 5E2EA 1KOUA 3BJNA 4HH2A 4E3MA 3FZCA 1E3UA 3QP1A 4CJNA 1IOUA 3E4OA 1UGUA 3IF6B 1K0KA 1D1JA 2PAVP 3UNWA 4E3IA 4O01A 1S67L 2HDQA 2V8FA 3IT9A 3MQ0A 2D02A 5DF8A 4BENA 2HDRA 2W3DA 1OTEA 2O99A 4K91A 2XA7M 3S7PA 1Z09A 3V3SA 4BJPA 3NOUC 3PTEA 4KUKA 3GVBA 1FILA 5KMWA 5CTNA 4X25A 2QPNA 2PYRA 5AQ7A 4WEJA 2PYPA 4GCZA 5DTKA 1EROA 4LCMA 3HBRA 2Z2MB 1A0KA 4KZ3A 1XGIA 2XROA 1DJBA 3PBOA 4ZJ1A 1M6KA 3KSFA 4R0QA 4X53A 3TOIA 2M1CA 5CERA 3MF0A 2K7SA 3ZNYA 3CMZA 4HH3A 3K2NA 5M18A 4D60A 3BLMA 3ZG8B 3N8RA 1JVJA 1C3BA 3UB8A 1DP9A 3OCLA 4DJ2A 3L9KA 2IWDA 3G2YA 5FAOA 3F1NB 2PU2A 4HY8A 3N7WA 2VJWA 2EXBA 3BWLA 3Q82A 1PRQA 1WA9A 2VEAA 4KQOA 4UA9A 2PR5A 4KZ5A 4HEFA 4PKYA 2PDRA 2JE5A 5EM0A 3ZGAB 1NZOA 3LEZA 2GJ3A 2ZL1A 1FCMA 1JWVA 5E2FA 5JYPA 3T1SA 2VLGA 2WGWA 3S7OA 3LIEA 4EBNA 1XGJA 4FH4A 3FG8A 2QKPA 3WS4A 4PM6A 1FR6A 3Q7ZA 2A3UA 2H0TA 5U47A 4MBFA 2Z6DA 4X56A 1VETB 3D72A 1PIOA 4IBXA 3EEAA 4CLCD 2W1TB 3ZVTA 2XF3A 1SCWA 3HLDA 3LIAA 4X1MA 2J7VA 4GKUA 3P98A 1SKOA 5HWWA 4YNRA 1UWNX 3EQVA 2AVXA 2VGJA 3LGOA 1OTDA 3Q81A 2ZC7A 4EEUA 4Y5FA 4G3WA 1G6AA 2OOLA 4EUZA 1T19A 4YFMA 2ACGA 5DF7A 1Z6FA 3VE4A 4S2NA 4RQ9A 2XRNA 2ZC6B 2WZXA 2WGVA 4R23A 4C75A 5EVLA 4EUVA 5EUAA 3UPOA 3IH9A 3FWLA 4HJ4A 2XDMA 1OJ5A 5CGWA 3DAVA 3LIDA 5A93A 1TS8A 1MKIA 5GHYA 2B18A 3O87A 5C5KA 1YLTA 4LRZE 3AGDA 4BD0A 1FSWA 4GS9B 4K0XA 3MFDA 2FH5A 3KYEA 5HD3A 2GNXA 3IX4A 4Y2FA 4PHTA 1OTBA 3SS3A 4LRXC 4HJ3A 3BQ8A 1YLYA 5DFXA 4LCLA 3S4XA 4EERA 2WUQA 4KQRA 1FCNA 3BFCA 2VA0A 1MWSA 1ZG4A 1OTIA 2HGVA 5FQKA 3PAEA 3LICA 1OTAA 2IWCA 2J9OA 3BW6A 1W7FA 2G2UA 3T4TA 3CZDA 3CLOA 3IWQA 4H6JA 1XFNA 2WADA 4LENA 4MCWA 1PWGA 2H28A 4DDYA 2YKFA 1LT0A 5TFQA 3TW8A 1TDGA 3KSGA 4JF5A 2Q9MA 5TGFA 3FPWA 4II7A 1N9LA 2M7UA 1ERMA 3D3OA 3EOIA 1MY8A 2XFSA 5D3OA 4OQHA 1IKIA 3GECA 3NDGA 3WWXA 4FH2A 2VX8A 3PAGA 3ULFA 4XT2B 3A0SA 5EFWA 3IX8A 5A8BA 3SW1A 3NHQA 1YPRA 3SS4A 4HOIA 1NLYA 3A3JA 3M2JA 2Y2JA 4OP5A 1W79A 3NY4A 2E8IA 2XFTA 1PZPA 4P6ZS 4L0LA 4ZAMA 5GLCA 1F2KA 1GSVA 4UEYA 4WUJA 4BBUA 1K56D 3LO7A 1V9YA 3LYXA 2WKEA 4DXCA 3RXWA 2J3WA 3B33A 1K54C 1E3UD 4MN7A 3LUQA 5HAQA 2X71A 4QD4A 4OPYA 5EOOA 1NJ4A 4LRYC 4B4ZA 5BOHA 3BYDA 2P04A 4A5RA 2V0UA 3H7WB 4Y17A 1EW0A 2JBFA 3OZHA 3UB6A 3R7WB 4OQIA 4Y13A 3QNBA 1J3WA 4HHDA 1GA0A 4GB7A 3VP2A 4N1HA 4B9OA 3HL9A 3F1OA 3V5MA 1LHYA 1KGEA 4NXFA 1PW1A 3HUOA 4JGPA 3W4PA 1W8QA 2J8YA 3MJQA 1M40A 4HESA 5DTTA 3D9YA 4I3JA 3BM6A 3BFEA 3KO6A 2R9WA 1ES2A 3G6OA 4R70A 1AXBA 5I94A 1XP4A 1YMXA 2A2LA 3CAXA 4WF0A 5IU1A 2LB9A 3L7HA 2H0YA 5EOEA 4OH0A 1BLCA 3MQQA 2BTFP 2XQZA 3FKWA 3R4KA 3NCKA 3WS2A 2W3GA 1JWZA 3CJMA 3F1PB 4GDBA 3EEHA 2HZ5A 1FQGA 1IYOA 3H82A 4DN0A 3BFGA 3U4LP 2JN7A 1OPXA 3LR0A 4RVAA 1HZOA 2CC1A 2DRWA 2P9VB 5LBRA 2ZQAA 4LV0A 5DKLA 4P85A 3GQZA 4ETZA 3MKEA 3IF6C 4FCFA 2OV5A 2H5SA 1F5MA 4KG5A 1XJ2A 3G30A 3DTIA 2JHEA 5IT5A 5GHXA 2Y79A 3CUEA 5F68A 2Q0OA 2Y2NA 4GD6A 1KDWA 1PI5A 4MDZA 2ZMAA 3IXGA 4FD8A 4YWZA 4GHIB 5CXWA 1XPBA 1MWTA 3B42A 1HTZA 4QB8A 3V39A 3GRJA 4CLCB 1VEUA 4QU3A 3P09A 5TBMB 2Y2LA 2ZC5B 5GLBA 3SOIA 2PT7A 3ITAA 4R3BA 1TDLA 3MXRA 2BASA 3EWKA 1DP6A 1NYYA 4UHUA 5G4YA 5FSRA 2QJ7A 2XD1A 5CHMA 5AJGA 2EFUA 4I3IA 2KDKA 1P9RA 2CMNA 1K6RA 3OPLA 4S2JA 4BL3A 2ZQCA 4X1LA 5FQQA 3ZG9B 4OOMA 3TRCA 4WZ5C 3UE3A 2V0WA 5AQAA 4JPMA 2HV1A 2ZM8A 3SS5A 1YLZA 3VP1A 4GW9A 1GA9A 5E2GA 5F69A 3VP3A 2Y4AA 2EX8A 2OLVA 4PAUA 1WYBA 3A0VA 1YQSA 5AQBA 4K0WA 1JTGA 2INWA 1CEFA 2J3TC 3OCNA 4KZ9A 3S22A 2G7UA 1KE4A 3KYQA 4JF4A 1GHIA 3ZG0A 4F3LB 2I9VA 5HX9A 1VM1A 1Y4OA 5F82A 1J9MA 5TJJA 2Y2MA 3DTMA 5L09A 4JXSA 4RX2A 4E3JA 3UO9A 3Q07A 2WK0A 5A91A 3QP6A 4X69A 5EE8A 1YLJA 3PYPA 2Y91A 2WKRA 5FQ9A 1IFQA 3UB9A 2C6WB 3H9WA 4M3KA 2X02A 2QYBA 4QPRA 5GLDA 1CQAA 4WZ4A 3I7JA 1OMEA 4I39A 4EWFA 4D2OA 3RH8B 1YMSA 1TF1A 2Q9NA 1D06A 2WGIA 2P7JA 3LY3A 1K4EA 4L9GA 3A3EA 1ES4A 3UE0A 4WELA 3QP8A 2W3EA 2PHYA 1ERQA 4R4SA 3ZG7B 2EA9A 4ARZA 3CITA 1LI9A 3HLBA 4HP9A 1ES3A 2FFFB 2OWHA 4P6ZM 1NY0A 1P0ZA 2ZJ9A 4YINA 3LCEA 4EQ1A 1QMFA 3S7NA 1GCEA 3NI9A 3QHYA 1ALQA 4S2MA 3MZFA 4I38A 3O88A 4UQIS 1PZOA 1K55C 5FI6A 5HSQA 1CI8A 3HJIA 1HLUP 3A3FA 2WYXA 3G32A 1T1BA 4NKPA 2FZ0A 2I72A 3UMEA 1FR1A 4WLAA 2Y8HA 3MQOA 4ID4A 5HD5A 3E2LA 3QP5A 4E3KA 4ME4A 4LLOB 1GHPA 1CK3A 3T50A 1L0GA 3UY6A 4FOFA 1S4SA 1H3QA 3DWKA 5DVAA 1PFLA 3ZG5A 4OPRA 3LY4A 3C2WA 2VZWA 3IQAA 3MS6A 1NZUA 3P01A 1HD8A 3VFHA 1V9ZA 3PBRA 1PWCA 4MNRA 1BLPA 3T1XA 4QJGA 4BL2A 3JVVA 1O7EA 1LL8A 3S1YA 5FEFA 2ZC3B 2ZBBA 3JPUA 5E43A 5AVEA 5KSHA 4R3JA 5L07A 1BZAA 2QMIA 2GX5A 4Z9QA 3KSIA 3H7WA 4HIAA 3UDIA 2JKGA 5FQMA 3RJUA 4YOFA 5DJUA 3PBSA 5F1FA 1BUEA 2DCFA 3C4OA 1L3LA 2JKFA 4LV1A 1YLPA 3RXXA 5F83A 3BFFA 2L0WA 3T1RA 2HP9A 3UE1A 1MXOA 5CHUA 4BWIA 1S0WA 3HLCA 1PW8A 2KOIA 2PD7A 3QP4A 5CGXA 2XLNA 4Z1WA 4O7DA 4K08A 2FFYA 1X0OA 3MXQA 3GMWA 1NRJA 4N92A 4ZTKA 2WGWB 4IVKA 5FI2A 4WYYA 2G2WA 4RA7A 2EWVA 4JXVA 3TJZC 1NLZA 5EVEA 1L0FA 1PWDA 2Y55A 3GR2A 3HLFA 4WBGA 2B02A 1MC0A 5HWTA 4PPRA 3MR0A 3VE3A 4S2KA 1LL5A 5KSCA 5IHVA 4KZ8A 1BT5A 4JF6A 1EI5A 4NG2A 4X55A 3SZTA 3LEQA 4OKPA 4KZ6A 4P6BA 3F1PA 2HDSA 2O9CA 4X6TA 3ICYA 1NYMA 3C7UA 3OLOA 4DDSA 2PBYA 5CX7A 1ODVA 2V1BA 2V9AA 3ZNTA 1MKMA 3ZYTA 3Q1FA 1I2SA 3W4OA 5FEGA 2ZD8A 4BMWA 2EX9A 4KZBA 3RTYA 3WS0A 2XSSA 5EVIA 4MN5A 3CPTB 2H10A 4PM8A 4M4XA 2W27A 3G35A 1MBLA 3GV9A 2WKPA 1VHMA 1AWIA 1SDEA 3HCYA 1VB6A 1PI4A 1WYCA 4WN5A 1KDSA 1YM1A 3LI8A 4F94A 4GHIA 3MZEA 5J4EA 3LR5A 3E0YA 2MJ6A 5EM1A 1EWZA 4Y0OA 2JKTI 3LIFA 3NULA 4DE1A 3MMHA 1NXYA 2B95A 2OLUA 5TBMA 3NECA 2ZOIA 3IS2A 3N8LA 4EBPA 1XJ6A 4G3KA 3BFDA 4E3OA 3E4PA 3K3CA 4OVDA 3O3VA 4UA7A 2VV7A 4PM5A 2GDNA 2VGKA 4LFUA 2A24A 1ONHA 1MPLA 5DJTA 5CTMA 5CRFA 2ZQ8A 1T18A 4QY6A 4WM9A 4KQDA 1KGGA 2OAQ1 4C6YA 2QWSA 2Z2LB 4H6JB 3T4KA 1K57C 4JKTA 1LSWA 5HL6A 1ZHHB 4NXEA 4CLCC 1TVFA 3IF6A 4XUXA 5F6AA 1ZG6A 2B5RA 3C8CA 4NETA 5FQIA 3MSHA 5HWVA 1KVMA 2O0YA 5A92A 5HZHA 4DF6A 2JCHA 4DKIA 1H5XA 1N9BA 4IJGA 4DXBA 4GZBA 1ESUA 3EGXC 3WRTA 3OBFA 3A3IA 1MZUA 3JYIA 3IH8A 3MKFA 1XJ4A 1FSYA 3W2ZA 1P97A 3LR3A 2ZLYA 3ZQ5A 4GN2A 2J9PA 1IYPA 3UN7A 4EU0A 1GSXA 4R3AA 4ETXA 1IEMA 1LL9A 1T1AA 3CHWP 3BY8A 4HBUA 3A0RA 4UQIM 3DTKA 4R4RA 3VP0A 1BLSA 3T12B 4JXGA 4DRTA 4KG2A 1WE4A 4RYEA 3OPRA 3IXDA 3F1NA 4WEKA 4WZ5A 5HARA 3OPPA 3NOTC 1S1ZA 1S1YA 1JNUA 1QMEA 1SHVA 4L9FA 5HPFA 3DTEA 4OONA 4NXGA 3VOYA 5CEBA 3LIBA 4R1GA 2OSUA 3EGDC 3F1OB 2XH9A 2VV6A 2Y2KA 4ZDXA 3BY9A 4OOLA 4O0PA 1JWPA 1F98A 1N4OA 2NUTC 4ZRRA 3O5YA 1S66L 1YAXA 3IHBA 4KG6A 4U3TA 5M19A 2JKTM 1KE0A 2Y59A 4EV4A 5KZHA 4N9KA 1K6SA 4E6XA 2ZMVA 3C7VA 3G31A 1VETA 3ZCZA 1RP5A 4ZBEA 3V67A 2W1TA 4Q0JA 5HAPA 3VOZA 1DP8A 4JGRA 4L9EA 1W8YA 1XX2A 2EFXA 4FUWA 3NOPC 4E04A 4WMCA 5GHZA 5K5BA 3G2ZA 1FIKA 2XGNA 1YKDA 1O07A 3MXSA 4ESPA 2BLSA 2V1ZA 2E8JA 1TS6A 3BLSA 3V50A 3HLEA 2WAFA 4EEPA 2VKSA 2DMWA 4HJ6A 4B4XA 4KZ4A 2P74A 3H82B 5E2HA 3K3DA 4C3QA 3NBLA 5FL3A 1W5DA 1XJ3A 1CJFA 4G3VA 1YT4A 1HVBA 4Q0HA 3IXHA 2XR0A 4OPQA 2HDUA 2XD5A 3CG5A 1F9IA 1DJAA 3WS1A 4GOGA 2UWXA 1XXMA 3M6BA 3BQAA 5HL1A 4X68A 4QY5A 5FI7A 2LB5A 1LSVA 4U0XA 1H0MA 2ZQ7A 1CF0A 4JBFA 2HPBA 3N8SA 3P7NA 4HBTA 3S7QA 4GS9A 2HP6A 1K55A 1K4FA 3E2KA 3GTCA 3HUMA 4IHQA 3CI6A 4DE0A 3NIAA 4CPKA 3LFVA 2IWBA 3O86A 4E3LA 1VEUB 2YKHA 2ZC4B 2QJ5A 5DTSA 3PBTA 5L8MA 1I2WA 4S2IA 2RL3A 1MWRA 3VMAA 5FDHA 3Q7VB 2XEPA 4EESA 4S2LA 2ZM2A 3PBQA 3TSGA 4LPZA 5EVID 2KLIA 4IVIA 4GLQA 1GSWA 4KENB 1KVLA 2JC7A 2EXAA 4IBRA 2VGLS 3AGFA 3PHYA 1RGZA 4OLDA 2A49A 1YLWA 2PU4A 1TS7A 3C4PA 4MLLA 3SH9A 3RFBA 4HQAA 4XT2A 3QNCA 1H8YA 1DY6A 1E25A 3HLWA 3IXBA 5GL9A 3NJAA 1TD5A 4S2OA 2DNSA 1OJGA 4QWOA 1CI9A 2GZAA 4Q8IA 3NC8A 5G18A 5FQJA 3D4FA 2Y2IA 3ZFZA 5FASA 2O9AA 3WS5A 5L10A 4R6LA 5HW3A 3GSGA 5FAPA 2QZ6A 4MBHA 1N9NA 4Y0UA 5HPIA 4GNUA 5AVFA 2Y2QA 2NUPC 2W3FA 5I5LA 4BQMA 1TS0A 1Q2PA 3FPVA 5TR7A 2WZZA 3PXPA 1ESIA 3BRMA 1U60A 3CPTA 4AFIA 3IBRA 3M2KA 4IUHA 2PR6A 4NXBA 2RCXA 3UB5P 3E98A 1DRMA 3R7WA 1SDNA 3KSHA 3N6IA 4RX3A 5EECA 3GDIA 1SZVA 3IF5A 2OAP1 2WAEA 1K38A 2M7VA 1MWUA 3T4QA 4S2PA 3IX3A 5CGSA 2XA7S 5JYOA 3IBJA 3C5AA 3OOVA 2JKRI 1IKGA 2UV0E 1DJCA 3W8KA 2L1MA 4MN6A 3V3RA 1L0DA 2V1AA 5CECA 1ZC2A 4S2NC 3AGEA 5L2FA 3UPPA 1FOFA 1BTLA 4PKYG 3VOLA 1W63M 4ZJ2A 3VSKA 4ARZB 2W3HA 2ZL1B 1H8ZA 1JTDA 4UA6A 3E4QA 4GDNA 3PR6A 4GD8A 4HP4A 1I5QA 4XXRA 5FATA 1OT6A 5J8XA 2C5WB 3TE8A 3C30A 3ITBA 2BG1A 4H8RA 3HLGA 1K54A 1H8MA 4EW7A 2K2NA 3VFFA 3HUNA 2Y2PA 4OQGA 2KX6A 1LSXA 4OP8A 2XK1A 1BYWA 1IELA 3NDEA 3LR4A 3BEBA 1NRFA 4OQ0A 1SKOB 5CHJA 4JGOA 2HP5A 1ZKJA 2W1RA 2HJEA 1SKFA 4LV2A 4DE2A 5KIZA 3VV4A 2L4RA 5DFYA 4HI4A 3M6HA 5EPHA 1PNEA 3ISGA 2PD8A 5IS1A 2W0NA 3T4OA 5FAQA 1CEGA 2ZMFA 2PRFA 4PM9A 3BECA 2J3TD 2P9VA 2Y2OA 4E3NA 1PYYA 4UAAA 3CWFA 1G68A 3UE6A 4B93A 1BULA 4QHCA 3KYZA 5HFOA 1G5UA 3ZHHA 4U0TA 1STZA 4JLFA 2V20A 5F1GA 5A90A 5J3WA 2V8CA 3UMDA 2Z6CA 1W63Q 2ZQ9A 4OOYA 3IHAA 3SH7A 1S4RA 2P08A 4KQQA 2D01A 5CEDA 1Y28A 3G34A 4Q0IA 1L2SA 1K57A 5AQ9A 4PM7A 4B88A 4WMCD 4CLCA 2J80A 4Y0TA 4LGWA 3PBNA 1YSQA 4MEZA 1XFQA 4CQHA 5DKKA 1FCOA 3WRZA 4MMNA 4KZ7A 1E4DA 3W4QA 4Y3IA 5FDSA 1KE3A 5HAIA 2QHKA 2IA2A 3UDFA 4IEDA 2WKHA 4KUOA 4EETB 3MZDA 4KZAA 1N9OA 5EVIC 2ZQDA 1P9WA 3A3DA 5M1AA 4R38A 3T1QB 1ES5A 4NK3A 2HJ9C 4I3AA 3T4JA 3OPHA 2PBDP 2JKRM 4OPZA 4DE3A 1Q2QA 3UDXA 4Y15A 2R78A 1BLHA 3C38A 4E6WA 3UPNA 5FA7A 2R9XA 4DMZA 2ZM0A 3SH8A 4FTXA 2EWWA 1OT9A 1RCJA 3HREA 4BLMA 4JXWA 1IYSA 1D7EA 4BBVA 1G6OA 4LV3A 1NWZA 5MC7A 4NEED 4EQIA 3ZDJA 1XKZA 4HNBA 4EBLA 1ZTUA 3T4SA 3KX0X 3U2AA 1ONGA 1TEMA 2K31A 3FV7A 3IWOA 3B47A 4F3LA 1G28A 4I5SA 1S6RA 3DWZA 3FYZA 2VV8A 4GJ4A 5GLAA 2EX6A 1YSPA 2O9BA 3QP2A 1Y54A 3HJKA 2OWJA 5HDDA 1ACFA 4EXOA 1T1CA 5DF9A 2V2FF 5HDSA 4DJ3A 4XUZA 3MBZA 5EV0A 4N1XA 2HF6A 1UWPX
chains in the Genus database with same CATH topology
1K54C 3IWIA 4QY5A 1E3UD 5FI7A 1XA7A 3S1YA 4U0XA 5EVIB 1LI0A 2X71A 4QD4A 4Y7PA 5HAQA 2ZC3B 4OPYA 4P0MA 2ZQ7A 4BD1A 5E43A 5EOOA 1NJ4A 4JBFA 2WKIA 4B4ZA 2HPBA 5BOHA 3N8SA 3BYDA 4R3JA 1L0EA 2X01A 2EX2A 5KSHA 4HBTA 4A5RA 1BZAA 2QMIA 2HP6A 4Z9QA 1K55A 1K4FA 1BSGA 3VP4A 1RGYA 3E2KA 3UDIA 2JBFA 5FQMA 3OZHA 3GTCA 3RJUA 3FKVA 4OQIA 1VQQA 4P87A 3PBSA 3HUMA 5F1FA 3HVFA 3G4PA 1BUEA 3QNBA 2DCFA 3C4OA 4DE0A 3NIAA 4PMAA 4CPKA 4MBKA 1GA0A 4GB7A 2IWBA 3O86A 3VP2A 3OC2A 4N1HA 4ZJ3A 1GHMA 4E3LA 2ZC4B 3HL9A 4LV1A 5DTSA 3DW0A 3PBTA 1YLPA 4OLGA 2Y2GA 3V5MA 1I2WA 5F83A 1LHYA 3RXXA 1KGEA 3ZVWA 2Y2HA 1PW1A 3BFFA 4S2IA 3VSLA 3HUOA 1KGFA 2HP9A 2RL3A 3W4PA 1MWRA 3UE1A 1MXOA 3N4IA 3VMAA 1W8QA 5CHUA 1S0WA 1K25A 2J8YA 3HLCA 4N9LA 1M40A 4HESA 5FDHA 5DTTA 1PW8A 3Q7VB 2XEPA 1IYQA 4FSFA 1LLBA 3Q7VA 3B3XA 5CGXA 3BM6A 2XLNA 3EQUA 4O7DA 4S2LA 1K56A 3BFEA 2ZM2A 3PBQA 3TSGA 2FFYA 5EVID 3TG9A 3GMWA 4N92A 2R9WA 4IVIA 4ZTKA 1ES2A 1XA1A 4KENB 2WGWB 1KVLA 4IVKA 5E2EA 5FI2A 4WYYA 1AXBA 4E3MA 5I94A 2G2WA 3FZCA 1XP4A 4RA7A 1YMXA 4JXVA 1E3UA 4CJNA 2JC7A 2EXAA 4IBRA 3AGFA 1RGZA 2H0YA 4OLDA 2A49A 1YLWA 2PU4A 1L0FA 5EOEA 1PWDA 3IF6B 3C4PA 4OH0A 2Y55A 3GR2A 3HLFA 4MLLA 1BLCA 3SH9A 4WBGA 4PPRA 3UNWA 3QNCA 4E3IA 4S2KA 1LL5A 1H8YA 2XQZA 3FKWA 2HDQA 1DY6A 1E25A 3HLWA 3IT9A 5DF8A 4BENA 5KSCA 3IXBA 3NCKA 5GL9A 5IHVA 2HDRA 4KZ8A 3WS2A 1BT5A 4JF6A 4S2OA 1EI5A 2DNSA 4X55A 1JWZA 1CI9A 3CJMA 4GDBA 4OKPA 4KZ6A 4P6BA 4Q8IA 4K91A 3NC8A 5G18A 3V3SA 1FQGA 5FQJA 4BJPA 3PTEA 1IYOA 2HDSA 2Y2IA 3D4FA 3GVBA 3ZFZA 5FASA 3WS5A 4X6TA 5KMWA 1NYMA 3BFGA 3C7UA 5CTNA 5HW3A 3GSGA 4DDSA 2QPNA 2PBYA 5FAPA 5AQ7A 3ZNTA 2QZ6A 4WEJA 4RVAA 4MBHA 5DTKA 1EROA 1HZOA 4LCMA 2CC1A 3Q1FA 1I2SA 4Y0UA 3W4OA 2DRWA 4GNUA 3HBRA 2Y2QA 2Z2MB 2P9VB 4KZ3A 1XGIA 2ZD8A 2ZQAA 1DJBA 3PBOA 4ZJ1A 2EX9A 4KZBA 4LV0A 4BQMA 1M6KA 1Q2PA 3WS0A 4P85A 3GQZA 4R0QA 4X53A 5TR7A 2WZZA 3TOIA 3MKEA 5EVIA 3IF6C 4FCFA 5CERA 1ESIA 3BRMA 1U60A 2OV5A 2H10A 2H5SA 3ZNYA 3CMZA 4KG5A 4PM8A 3G30A 3M2KA 5M18A 3BLMA 3G35A 1MBLA 3GV9A 2RCXA 5GHXA 2Y2NA 4GD6A 1KDWA 3ZG8B 1PI5A 1SDEA 3N8RA 1PI4A 1JVJA 1SDNA 1WYCA 2ZMAA 3IXGA 1C3BA 1KDSA 3N6IA 4RX3A 5EECA 4FD8A 1YM1A 3OCLA 4F94A 5CXWA 2IWDA 1XPBA 1MWTA 3MZEA 3G2YA 1HTZA 3IF5A 4QB8A 2WAEA 5FAOA 1K38A 1MWUA 3V39A 3GRJA 1EWZA 4QU3A 4S2PA 4Y0OA 2PU2A 5CGSA 3P09A 4DE1A 3N7WA 5JYOA 2Y2LA 1NXYA 2ZC5B 5GLBA 2OLUA 3C5AA 2EXBA 3SOIA 3ITAA 1IKGA 4R3BA 3Q82A 1TDLA 3MXRA 1DJCA 3W8KA 3V3RA 1L0DA 4KQOA 4UA9A 5CECA 1ZC2A 3N8LA 4S2NC 4EBPA 3AGEA 3BFDA 5L2FA 4KZ5A 3UPPA 4HEFA 1NYYA 4UHUA 1FOFA 4E3OA 1BTLA 4OVDA 3O3VA 4UA7A 2JE5A 4PM5A 5FSRA 2XD1A 3ZGAB 1NZOA 2GDNA 4ZJ2A 3VSKA 2VGKA 3LEZA 5CHMA 1H8ZA 1JTDA 1ONHA 2EFUA 4GDNA 1MPLA 4UA6A 4GD8A 1FCMA 1JWVA 5E2FA 5JYPA 5CTMA 1I5QA 4XXRA 5CRFA 2ZQ8A 5FATA 2WGWA 4QY6A 5J8XA 4WM9A 2C5WB 4EBNA 1KGGA 1XGJA 4C6YA 4FH4A 1K6RA 3ITBA 2BG1A 2Z2LB 3OPLA 4H8RA 3WS4A 4S2JA 4PM6A 4BL3A 1FR6A 1K57C 3HLGA 1K54A 3Q7ZA 4JKTA 2ZQCA 3VFFA 2A3UA 5FQQA 3ZG9B 4OOMA 2H0TA 4WZ5C 5U47A 4MBFA 1TVFA 3HUNA 3IF6A 4X56A 4XUXA 3UE3A 5AQAA 4JPMA 1ZG6A 2B5RA 2Y2PA 4OQGA 1PIOA 2ZM8A 4NETA 3SS5A 1YLZA 4IBXA 4OP8A 2XK1A 5FQIA 3VP1A 3ZVTA 2XF3A 1IELA 3NDEA 1GA9A 1SCWA 3HLDA 5E2GA 3VP3A 1KVMA 2EX8A 2Y4AA 3BEBA 1NRFA 4OQ0A 2OLVA 2J7VA 1WYBA 4GKUA 3P98A 5CHJA 5A92A 1YQSA 2HP5A 5AQBA 3EQVA 4DF6A 1ZKJA 2JCHA 4K0WA 1SKFA 2VGJA 4DKIA 1H5XA 1JTGA 3Q81A 1N9BA 4LV2A 4DE2A 2ZC7A 1CEFA 3OCNA 3S22A 4KZ9A 3M6HA 1G6AA 5EPHA 3ISGA 4DXBA 1KE4A 4GZBA 5FAQA 4JF4A 1CEGA 4EUZA 1ESUA 1GHIA 4YFMA 3WRTA 4PM9A 3ZG0A 3BECA 5HX9A 1VM1A 5F82A 3A3IA 1J9MA 3JYIA 2P9VA 5DF7A 2Y2OA 4E3NA 1PYYA 3IH8A 3MKFA 1G68A 4UAAA 1Z6FA 2Y2MA 1FSYA 1BULA 4QHCA 4S2NA 3DTMA 2ZC6B 2ZLYA 4JXSA 5HFOA 2WZXA 2WGVA 4R23A 4RX2A 4E3JA 4C75A 5EVLA 5EUAA 3UPOA 3UO9A 3ZHHA 4U0TA 3IH9A 3FWLA 3Q07A 4GN2A 2J9PA 2WK0A 2XDMA 4JLFA 1IYPA 5A91A 3UN7A 5CGWA 2V20A 5F1GA 4X69A 5A90A 5EE8A 1IEMA 1LL9A 5A93A 1YLJA 2ZQ9A 4OOYA 2Y91A 4HBUA 5FQ9A 3IHAA 3SH7A 1MKIA 5GHYA 2C6WB 4KQQA 4R4RA 3VP0A 5CEDA 4M3KA 1BLSA 3O87A 2X02A 4JXGA 4DRTA 4KG2A 1WE4A 1YLTA 5GLDA 4RYEA 3AGDA 3OPRA 3G34A 1FSWA 4BD0A 1L2SA 1K57A 4WZ4A 4PM7A 5AQ9A 4WMCD 4B88A 4K0XA 3I7JA 1OMEA 3IXDA 3MFDA 4EWFA 4WEKA 4WZ5A 4D2OA 4Y0TA 5HARA 3OPPA 3PBNA 1YMSA 2Q9NA 4MEZA 3SS3A 2WGIA 1FCOA 3WRZA 1QMEA 3LY3A 1K4EA 1SHVA 3A3EA 1YLYA 1ES4A 4KZ7A 3UE0A 4OONA 5CEBA 1E4DA 3VOYA 4WELA 4LCLA 4R1GA 3W4QA 3S4XA 2OSUA 2WUQA 1KE3A 5HAIA 4KQRA 1ERQA 1FCNA 4R4SA 2XH9A 3ZG7B 3BFCA 2Y2KA 4ZDXA 1LI9A 3HLBA 4OOLA 1ES3A 3UDFA 4IEDA 2FFFB 1MWSA 1ZG4A 1JWPA 1N4OA 2WKHA 3MZDA 5FQKA 1NY0A 3PAEA 4KZAA 2ZJ9A 4YINA 2IWCA 2J9OA 3LCEA 3IHBA 5EVIC 1W7FA 2ZQDA 4KG6A 1QMFA 4U3TA 1GCEA 2G2UA 3NI9A 5M19A 3A3DA 3QHYA 5M1AA 1ALQA 3CZDA 1KE0A 3IWQA 4S2MA 2Y59A 3MZFA 4EV4A 4N9KA 5KZHA 1ES5A 1K6SA 4NK3A 3O88A 4E6XA 2WADA 1PZOA 4LENA 1K55C 3OPHA 1PWGA 5FI6A 3C7VA 1CI8A 4OPZA 4DE3A 1Q2QA 3A3FA 3G31A 3UDXA 4DDYA 5TFQA 3ZCZA 2WYXA 3G32A 1RP5A 1TDGA 4ZBEA 1BLHA 4JF5A 4E6WA 3UPNA 5FA7A 2R9XA 2Q9MA 5HAPA 3VOZA 5TGFA 2ZM0A 3SH8A 2I72A 1ERMA 1W8YA 1XX2A 5D3OA 1MY8A 2EFXA 2XFSA 1RCJA 4BLMA 3HREA 1FR1A 4JXWA 4OQHA 1IKIA 1IYSA 3NDGA 4WMCA 3WWXA 5GHZA 4LV3A 4FH2A 3PAGA 3G2ZA 4EQIA 3ZDJA 1XKZA 2XGNA 4EBLA 1O07A 3MXSA 1ONGA 4ID4A 1TEMA 2BLSA 2V1ZA 3E2LA 3SS4A 3A3JA 4E3KA 3M2JA 3FV7A 3BLSA 3IWOA 3V50A 2Y2JA 4OP5A 3HLEA 2WAFA 1W79A 1GHPA 3NY4A 1CK3A 2E8IA 2XFTA 1L0GA 3UY6A 1PZPA 4ZAMA 4L0LA 1S6RA 4B4XA 3DWZA 5GLCA 3FYZA 3DWKA 4KZ4A 2P74A 5DVAA 5E2HA 3ZG5A 4C3QA 3NBLA 4OPRA 1W5DA 1K56D 3LY4A 3IQAA 5GLAA 1NZUA 2EX6A 1YT4A 1HVBA 3LO7A 1HD8A 3IXHA 1Y54A 3VFHA 2XR0A 4OPQA 3PBRA 1PWCA 2HDUA 2WKEA 2XD5A 3CG5A 4MNRA 1DJAA 4DXCA 5DF9A 3RXWA 3WS1A 1BLPA 2V2FF 4GOGA 2UWXA 4QJGA 4BL2A 4XUZA 1XXMA 3MBZA 3M6BA 5HL1A 1O7EA 4N1XA 4X68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K54 C;  3IWI A;  4QY5 A;  1E3U D;  5FI7 A;  1XA7 A;  3S1Y A;  4U0X A;  5EVI B;  1LI0 A;  2X71 A;  4QD4 A;  4Y7P A;  5HAQ A;  2ZC3 B;  4OPY A;  4P0M A;  2ZQ7 A;  4BD1 A;  5E43 A;  5EOO A;  1NJ4 A;  4JBF A;  2WKI A;  4B4Z A;  2HPB A;  5BOH A;  3N8S A;  3BYD A;  4R3J A;  1L0E A;  2X01 A;  2EX2 A;  5KSH A;  4HBT A;  4A5R A;  1BZA A;  2QMI A;  2HP6 A;  4Z9Q A;  1K55 A;  1K4F A;  1BSG A;  3VP4 A;  1RGY A;  3E2K A;  3UDI A;  2JBF A;  5FQM A;  3OZH A;  3GTC A;  3RJU A;  3FKV A;  4OQI A;  1VQQ A;  4P87 A;  3PBS A;  3HUM A;  5F1F A;  3HVF A;  3G4P A;  1BUE A;  3QNB A;  2DCF A;  3C4O A;  4DE0 A;  3NIA A;  4PMA A;  4CPK A;  4MBK A;  1GA0 A;  4GB7 A;  2IWB A;  3O86 A;  3VP2 A;  3OC2 A;  4N1H A;  4ZJ3 A;  1GHM A;  4E3L A;  2ZC4 B;  3HL9 A;  4LV1 A;  5DTS A;  3DW0 A;  3PBT A;  1YLP A;  4OLG A;  2Y2G A;  3V5M A;  1I2W A;  5F83 A;  1LHY A;  3RXX A;  1KGE A;  3ZVW A;  2Y2H A;  1PW1 A;  3BFF A;  4S2I A;  3VSL A;  3HUO A;  1KGF A;  2HP9 A;  2RL3 A;  3W4P A;  1MWR A;  3UE1 A;  1MXO A;  3N4I A;  3VMA A;  1W8Q A;  5CHU A;  1S0W A;  1K25 A;  2J8Y A;  3HLC A;  4N9L A;  1M40 A;  4HES A;  5FDH A;  5DTT A;  1PW8 A;  3Q7V B;  2XEP A;  1IYQ A;  4FSF A;  1LLB A;  3Q7V A;  3B3X A;  5CGX A;  3BM6 A;  2XLN A;  3EQU A;  4O7D A;  4S2L A;  1K56 A;  3BFE A;  2ZM2 A;  3PBQ A;  3TSG A;  2FFY A;  5EVI D;  3TG9 A;  3GMW A;  4N92 A;  2R9W A;  4IVI A;  4ZTK A;  1ES2 A;  1XA1 A;  4KEN B;  2WGW B;  1KVL A;  4IVK A;  5E2E A;  5FI2 A;  4WYY A;  1AXB A;  4E3M A;  5I94 A;  2G2W A;  3FZC A;  1XP4 A;  4RA7 A;  1YMX A;  4JXV A;  1E3U A;  4CJN A;  2JC7 A;  2EXA A;  4IBR A;  3AGF A;  1RGZ A;  2H0Y A;  4OLD A;  2A49 A;  1YLW A;  2PU4 A;  1L0F A;  5EOE A;  1PWD A;  3IF6 B;  3C4P A;  4OH0 A;  2Y55 A;  3GR2 A;  3HLF A;  4MLL A;  1BLC A;  3SH9 A;  4WBG A;  4PPR A;  3UNW A;  3QNC A;  4E3I A;  4S2K A;  1LL5 A;  1H8Y A;  2XQZ A;  3FKW A;  2HDQ A;  1DY6 A;  1E25 A;  3HLW A;  3IT9 A;  5DF8 A;  4BEN A;  5KSC A;  3IXB A;  3NCK A;  5GL9 A;  5IHV A;  2HDR A;  4KZ8 A;  3WS2 A;  1BT5 A;  4JF6 A;  4S2O A;  1EI5 A;  2DNS A;  4X55 A;  1JWZ A;  1CI9 A;  3CJM A;  4GDB A;  4OKP A;  4KZ6 A;  4P6B A;  4Q8I A;  4K91 A;  3NC8 A;  5G18 A;  3V3S A;  1FQG A;  5FQJ A;  4BJP A;  3PTE A;  1IYO A;  2HDS A;  2Y2I A;  3D4F A;  3GVB A;  3ZFZ A;  5FAS A;  3WS5 A;  4X6T A;  5KMW A;  1NYM A;  3BFG A;  3C7U A;  5CTN A;  5HW3 A;  3GSG A;  4DDS A;  2QPN A;  2PBY A;  5FAP A;  5AQ7 A;  3ZNT A;  2QZ6 A;  4WEJ A;  4RVA A;  4MBH A;  5DTK A;  1ERO A;  1HZO A;  4LCM A;  2CC1 A;  3Q1F A;  1I2S A;  4Y0U A;  3W4O A;  2DRW A;  4GNU A;  3HBR A;  2Y2Q A;  2Z2M B;  2P9V B;  4KZ3 A;  1XGI A;  2ZD8 A;  2ZQA A;  1DJB A;  3PBO A;  4ZJ1 A;  2EX9 A;  4KZB A;  4LV0 A;  4BQM A;  1M6K A;  1Q2P A;  3WS0 A;  4P85 A;  3GQZ A;  4R0Q A;  4X53 A;  5TR7 A;  2WZZ A;  3TOI A;  3MKE A;  5EVI A;  3IF6 C;  4FCF A;  5CER A;  1ESI A;  3BRM A;  1U60 A;  2OV5 A;  2H10 A;  2H5S A;  3ZNY A;  3CMZ A;  4KG5 A;  4PM8 A;  3G30 A;  3M2K A;  5M18 A;  3BLM A;  3G35 A;  1MBL A;  3GV9 A;  2RCX A;  5GHX A;  2Y2N A;  4GD6 A;  1KDW A;  3ZG8 B;  1PI5 A;  1SDE A;  3N8R A;  1PI4 A;  1JVJ A;  1SDN A;  1WYC A;  2ZMA A;  3IXG A;  1C3B A;  1KDS A;  3N6I A;  4RX3 A;  5EEC A;  4FD8 A;  1YM1 A;  3OCL A;  4F94 A;  5CXW A;  2IWD A;  1XPB A;  1MWT A;  3MZE A;  3G2Y A;  1HTZ A;  3IF5 A;  4QB8 A;  2WAE A;  5FAO A;  1K38 A;  1MWU A;  3V39 A;  3GRJ A;  1EWZ A;  4QU3 A;  4S2P A;  4Y0O A;  2PU2 A;  5CGS A;  3P09 A;  4DE1 A;  3N7W A;  5JYO A;  2Y2L A;  1NXY A;  2ZC5 B;  5GLB A;  2OLU A;  3C5A A;  2EXB A;  3SOI A;  3ITA A;  1IKG A;  4R3B A;  3Q82 A;  1TDL A;  3MXR A;  1DJC A;  3W8K A;  3V3R A;  1L0D A;  4KQO A;  4UA9 A;  5CEC A;  1ZC2 A;  3N8L A;  4S2N C;  4EBP A;  3AGE A;  3BFD A;  5L2F A;  4KZ5 A;  3UPP A;  4HEF A;  1NYY A;  4UHU A;  1FOF A;  4E3O A;  1BTL A;  4OVD A;  3O3V A;  4UA7 A;  2JE5 A;  4PM5 A;  5FSR A;  2XD1 A;  3ZGA B;  1NZO A;  2GDN A;  4ZJ2 A;  3VSK A;  2VGK A;  3LEZ A;  5CHM A;  1H8Z A;  1JTD A;  1ONH A;  2EFU A;  4GDN A;  1MPL A;  4UA6 A;  4GD8 A;  1FCM A;  1JWV A;  5E2F A;  5JYP A;  5CTM A;  1I5Q A;  4XXR A;  5CRF A;  2ZQ8 A;  5FAT A;  2WGW A;  4QY6 A;  5J8X A;  4WM9 A;  2C5W B;  4EBN A;  1KGG A;  1XGJ A;  4C6Y A;  4FH4 A;  1K6R A;  3ITB A;  2BG1 A;  2Z2L B;  3OPL A;  4H8R A;  3WS4 A;  4S2J A;  4PM6 A;  4BL3 A;  1FR6 A;  1K57 C;  3HLG A;  1K54 A;  3Q7Z A;  4JKT A;  2ZQC A;  3VFF A;  2A3U A;  5FQQ A;  3ZG9 B;  4OOM A;  2H0T A;  4WZ5 C;  5U47 A;  4MBF A;  1TVF A;  3HUN A;  3IF6 A;  4X56 A;  4XUX A;  3UE3 A;  5AQA A;  4JPM A;  1ZG6 A;  2B5R A;  2Y2P A;  4OQG A;  1PIO A;  2ZM8 A;  4NET A;  3SS5 A;  1YLZ A;  4IBX A;  4OP8 A;  2XK1 A;  5FQI A;  3VP1 A;  3ZVT A;  2XF3 A;  1IEL A;  3NDE A;  1GA9 A;  1SCW A;  3HLD A;  5E2G A;  3VP3 A;  1KVM A;  2EX8 A;  2Y4A A;  3BEB A;  1NRF A;  4OQ0 A;  2OLV A;  2J7V A;  1WYB A;  4GKU A;  3P98 A;  5CHJ A;  5A92 A;  1YQS A;  2HP5 A;  5AQB A;  3EQV A;  4DF6 A;  1ZKJ A;  2JCH A;  4K0W A;  1SKF A;  2VGJ A;  4DKI A;  1H5X A;  1JTG A;  3Q81 A;  1N9B A;  4LV2 A;  4DE2 A;  2ZC7 A;  1CEF A;  3OCN A;  3S22 A;  4KZ9 A;  3M6H A;  1G6A A;  5EPH A;  3ISG A;  4DXB A;  1KE4 A;  4GZB A;  5FAQ A;  4JF4 A;  1CEG A;  4EUZ A;  1ESU A;  1GHI A;  4YFM A;  3WRT A;  4PM9 A;  3ZG0 A;  3BEC A;  5HX9 A;  1VM1 A;  5F82 A;  3A3I A;  1J9M A;  3JYI A;  2P9V A;  5DF7 A;  2Y2O A;  4E3N A;  1PYY A;  3IH8 A;  3MKF A;  1G68 A;  4UAA A;  1Z6F A;  2Y2M A;  1FSY A;  1BUL A;  4QHC A;  4S2N A;  3DTM A;  2ZC6 B;  2ZLY A;  4JXS A;  5HFO A;  2WZX A;  2WGV A;  4R23 A;  4RX2 A;  4E3J A;  4C75 A;  5EVL A;  5EUA A;  3UPO A;  3UO9 A;  3ZHH A;  4U0T A;  3IH9 A;  3FWL A;  3Q07 A;  4GN2 A;  2J9P A;  2WK0 A;  2XDM A;  4JLF A;  1IYP A;  5A91 A;  3UN7 A;  5CGW A;  2V20 A;  5F1G A;  4X69 A;  5A90 A;  5EE8 A;  1IEM A;  1LL9 A;  5A93 A;  1YLJ A;  2ZQ9 A;  4OOY A;  2Y91 A;  4HBU A;  5FQ9 A;  3IHA A;  3SH7 A;  1MKI A;  5GHY A;  2C6W B;  4KQQ A;  4R4R A;  3VP0 A;  5CED A;  4M3K A;  1BLS A;  3O87 A;  2X02 A;  4JXG A;  4DRT A;  4KG2 A;  1WE4 A;  1YLT A;  5GLD A;  4RYE A;  3AGD A;  3OPR A;  3G34 A;  1FSW A;  4BD0 A;  1L2S A;  1K57 A;  4WZ4 A;  4PM7 A;  5AQ9 A;  4WMC D;  4B88 A;  4K0X A;  3I7J A;  1OME A;  3IXD A;  3MFD A;  4EWF A;  4WEK A;  4WZ5 A;  4D2O A;  4Y0T A;  5HAR A;  3OPP A;  3PBN A;  1YMS A;  2Q9N A;  4MEZ A;  3SS3 A;  2WGI A;  1FCO A;  3WRZ A;  1QME A;  3LY3 A;  1K4E A;  1SHV A;  3A3E A;  1YLY A;  1ES4 A;  4KZ7 A;  3UE0 A;  4OON A;  5CEB A;  1E4D A;  3VOY A;  4WEL A;  4LCL A;  4R1G A;  3W4Q A;  3S4X A;  2OSU A;  2WUQ A;  1KE3 A;  5HAI A;  4KQR A;  1ERQ A;  1FCN A;  4R4S A;  2XH9 A;  3ZG7 B;  3BFC A;  2Y2K A;  4ZDX A;  1LI9 A;  3HLB A;  4OOL A;  1ES3 A;  3UDF A;  4IED A;  2FFF B;  1MWS A;  1ZG4 A;  1JWP A;  1N4O A;  2WKH A;  3MZD A;  5FQK A;  1NY0 A;  3PAE A;  4KZA A;  2ZJ9 A;  4YIN A;  2IWC A;  2J9O A;  3LCE A;  3IHB A;  5EVI C;  1W7F A;  2ZQD A;  4KG6 A;  1QMF A;  4U3T A;  1GCE A;  2G2U A;  3NI9 A;  5M19 A;  3A3D A;  3QHY A;  5M1A A;  1ALQ A;  3CZD A;  1KE0 A;  3IWQ A;  4S2M A;  2Y59 A;  3MZF A;  4EV4 A;  4N9K A;  5KZH A;  1ES5 A;  1K6S A;  4NK3 A;  3O88 A;  4E6X A;  2WAD A;  1PZO A;  4LEN A;  1K55 C;  3OPH A;  1PWG A;  5FI6 A;  3C7V A;  1CI8 A;  4OPZ A;  4DE3 A;  1Q2Q A;  3A3F A;  3G31 A;  3UDX A;  4DDY A;  5TFQ A;  3ZCZ A;  2WYX A;  3G32 A;  1RP5 A;  1TDG A;  4ZBE A;  1BLH A;  4JF5 A;  4E6W A;  3UPN A;  5FA7 A;  2R9X A;  2Q9M A;  5HAP A;  3VOZ A;  5TGF A;  2ZM0 A;  3SH8 A;  2I72 A;  1ERM A;  1W8Y A;  1XX2 A;  5D3O A;  1MY8 A;  2EFX A;  2XFS A;  1RCJ A;  4BLM A;  3HRE A;  1FR1 A;  4JXW A;  4OQH A;  1IKI A;  1IYS A;  3NDG A;  4WMC A;  3WWX A;  5GHZ A;  4LV3 A;  4FH2 A;  3PAG A;  3G2Z A;  4EQI A;  3ZDJ A;  1XKZ A;  2XGN A;  4EBL A;  1O07 A;  3MXS A;  1ONG A;  4ID4 A;  1TEM A;  2BLS A;  2V1Z A;  3E2L A;  3SS4 A;  3A3J A;  4E3K A;  3M2J A;  3FV7 A;  3BLS A;  3IWO A;  3V50 A;  2Y2J A;  4OP5 A;  3HLE A;  2WAF A;  1W79 A;  1GHP A;  3NY4 A;  1CK3 A;  2E8I A;  2XFT A;  1L0G A;  3UY6 A;  1PZP A;  4ZAM A;  4L0L A;  1S6R A;  4B4X A;  3DWZ A;  5GLC A;  3FYZ A;  3DWK A;  4KZ4 A;  2P74 A;  5DVA A;  5E2H A;  3ZG5 A;  4C3Q A;  3NBL A;  4OPR A;  1W5D A;  1K56 D;  3LY4 A;  3IQA A;  5GLA A;  1NZU A;  2EX6 A;  1YT4 A;  1HVB A;  3LO7 A;  1HD8 A;  3IXH A;  1Y54 A;  3VFH A;  2XR0 A;  4OPQ A;  3PBR A;  1PWC A;  2HDU A;  2WKE A;  2XD5 A;  3CG5 A;  4MNR A;  1DJA A;  4DXC A;  5DF9 A;  3RXW A;  3WS1 A;  1BLP A;  2V2F F;  4GOG A;  2UWX A;  4QJG A;  4BL2 A;  4XUZ A;  1XXM A;  3MBZ A;  3M6B A;  5HL1 A;  1O7E A;  4N1X A;  4X68 A; 
#chains in the Genus database with same CATH topology
 3IWI A;  5G4Z A;  1XA7 A;  5EVI B;  1LI0 A;  4Y7P A;  4P0M A;  3MFX A;  4BD1 A;  2WKI A;  1L0E A;  2X01 A;  2EX2 A;  4JGQ A;  2VGL M;  1BSG A;  3VP4 A;  1RGY A;  3FKV A;  1VQQ A;  4P87 A;  3HVF A;  3G4P A;  4PMA A;  5HDC A;  4MBK A;  3FC7 A;  5J7E A;  2VK3 A;  3OC2 A;  4ZJ3 A;  1GHM A;  4IUK A;  3T4L A;  5F5Y A;  3UB7 A;  3DW0 A;  4OLG A;  2Y2G A;  3DBA A;  3ZVW A;  2Y2H A;  3VSL A;  1KGF A;  3IS2 B;  4BBT A;  4O8G A;  3N4I A;  1K25 A;  4N9L A;  2WKQ A;  2ZOH A;  1IYQ A;  4FSF A;  1LLB A;  3Q7V A;  3JVU A;  3B3X A;  3EQU A;  1K56 A;  3LI9 A;  2A24 B;  4CLC E;  4WL9 A;  3TG9 A;  3CUE C;  1XA1 A;  5E2E A;  1KOU A;  3BJN A;  4HH2 A;  4E3M A;  3FZC A;  1E3U A;  3QP1 A;  4CJN A;  1IOU A;  3E4O A;  1UGU A;  3IF6 B;  1K0K A;  1D1J A;  2PAV P;  3UNW A;  4E3I A;  4O01 A;  1S67 L;  2HDQ A;  2V8F A;  3IT9 A;  3MQ0 A;  2D02 A;  5DF8 A;  4BEN A;  2HDR A;  2W3D A;  1OTE A;  2O99 A;  4K91 A;  2XA7 M;  3S7P A;  1Z09 A;  3V3S A;  4BJP A;  3NOU C;  3PTE A;  4KUK A;  3GVB A;  1FIL A;  5KMW A;  5CTN A;  4X25 A;  2QPN A;  2PYR A;  5AQ7 A;  4WEJ A;  2PYP A;  4GCZ A;  5DTK A;  1ERO A;  4LCM A;  3HBR A;  2Z2M B;  1A0K A;  4KZ3 A;  1XGI A;  2XRO A;  1DJB A;  3PBO A;  4ZJ1 A;  1M6K A;  3KSF A;  4R0Q A;  4X53 A;  3TOI A;  2M1C A;  5CER A;  3MF0 A;  2K7S A;  3ZNY A;  3CMZ A;  4HH3 A;  3K2N A;  5M18 A;  4D60 A;  3BLM A;  3ZG8 B;  3N8R A;  1JVJ A;  1C3B A;  3UB8 A;  1DP9 A;  3OCL A;  4DJ2 A;  3L9K A;  2IWD A;  3G2Y A;  5FAO A;  3F1N B;  2PU2 A;  4HY8 A;  3N7W A;  2VJW A;  2EXB A;  3BWL A;  3Q82 A;  1PRQ A;  1WA9 A;  2VEA A;  4KQO A;  4UA9 A;  2PR5 A;  4KZ5 A;  4HEF A;  4PKY A;  2PDR A;  2JE5 A;  5EM0 A;  3ZGA B;  1NZO A;  3LEZ A;  2GJ3 A;  2ZL1 A;  1FCM A;  1JWV A;  5E2F A;  5JYP A;  3T1S A;  2VLG A;  2WGW A;  3S7O A;  3LIE A;  4EBN A;  1XGJ A;  4FH4 A;  3FG8 A;  2QKP A;  3WS4 A;  4PM6 A;  1FR6 A;  3Q7Z A;  2A3U A;  2H0T A;  5U47 A;  4MBF A;  2Z6D A;  4X56 A;  1VET B;  3D72 A;  1PIO A;  4IBX A;  3EEA A;  4CLC D;  2W1T B;  3ZVT A;  2XF3 A;  1SCW A;  3HLD A;  3LIA A;  4X1M A;  2J7V A;  4GKU A;  3P98 A;  1SKO A;  5HWW A;  4YNR A;  1UWN X;  3EQV A;  2AVX A;  2VGJ A;  3LGO A;  1OTD A;  3Q81 A;  2ZC7 A;  4EEU A;  4Y5F A;  4G3W A;  1G6A A;  2OOL A;  4EUZ A;  1T19 A;  4YFM A;  2ACG A;  5DF7 A;  1Z6F A;  3VE4 A;  4S2N A;  4RQ9 A;  2XRN A;  2ZC6 B;  2WZX A;  2WGV A;  4R23 A;  4C75 A;  5EVL A;  4EUV A;  5EUA A;  3UPO A;  3IH9 A;  3FWL A;  4HJ4 A;  2XDM A;  1OJ5 A;  5CGW A;  3DAV A;  3LID A;  5A93 A;  1TS8 A;  1MKI A;  5GHY A;  2B18 A;  3O87 A;  5C5K A;  1YLT A;  4LRZ E;  3AGD A;  4BD0 A;  1FSW A;  4GS9 B;  4K0X A;  3MFD A;  2FH5 A;  3KYE A;  5HD3 A;  2GNX A;  3IX4 A;  4Y2F A;  4PHT A;  1OTB A;  3SS3 A;  4LRX C;  4HJ3 A;  3BQ8 A;  1YLY A;  5DFX A;  4LCL A;  3S4X A;  4EER A;  2WUQ A;  4KQR A;  1FCN A;  3BFC A;  2VA0 A;  1MWS A;  1ZG4 A;  1OTI A;  2HGV A;  5FQK A;  3PAE A;  3LIC A;  1OTA A;  2IWC A;  2J9O A;  3BW6 A;  1W7F A;  2G2U A;  3T4T A;  3CZD A;  3CLO A;  3IWQ A;  4H6J A;  1XFN A;  2WAD A;  4LEN A;  4MCW A;  1PWG A;  2H28 A;  4DDY A;  2YKF A;  1LT0 A;  5TFQ A;  3TW8 A;  1TDG A;  3KSG A;  4JF5 A;  2Q9M A;  5TGF A;  3FPW A;  4II7 A;  1N9L A;  2M7U A;  1ERM A;  3D3O A;  3EOI A;  1MY8 A;  2XFS A;  5D3O A;  4OQH A;  1IKI A;  3GEC A;  3NDG A;  3WWX A;  4FH2 A;  2VX8 A;  3PAG A;  3ULF A;  4XT2 B;  3A0S A;  5EFW A;  3IX8 A;  5A8B A;  3SW1 A;  3NHQ A;  1YPR A;  3SS4 A;  4HOI A;  1NLY A;  3A3J A;  3M2J A;  2Y2J A;  4OP5 A;  1W79 A;  3NY4 A;  2E8I A;  2XFT A;  1PZP A;  4P6Z S;  4L0L A;  4ZAM A;  5GLC A;  1F2K A;  1GSV A;  4UEY A;  4WUJ A;  4BBU A;  1K56 D;  3LO7 A;  1V9Y A;  3LYX A;  2WKE A;  4DXC A;  3RXW A;  2J3W A;  3B33 A;  1K54 C;  1E3U D;  4MN7 A;  3LUQ A;  5HAQ A;  2X71 A;  4QD4 A;  4OPY A;  5EOO A;  1NJ4 A;  4LRY C;  4B4Z A;  5BOH A;  3BYD A;  2P04 A;  4A5R A;  2V0U A;  3H7W B;  4Y17 A;  1EW0 A;  2JBF A;  3OZH A;  3UB6 A;  3R7W B;  4OQI A;  4Y13 A;  3QNB A;  1J3W A;  4HHD A;  1GA0 A;  4GB7 A;  3VP2 A;  4N1H A;  4B9O A;  3HL9 A;  3F1O A;  3V5M A;  1LHY A;  1KGE A;  4NXF A;  1PW1 A;  3HUO A;  4JGP A;  3W4P A;  1W8Q A;  2J8Y A;  3MJQ A;  1M40 A;  4HES A;  5DTT A;  3D9Y A;  4I3J A;  3BM6 A;  3BFE A;  3KO6 A;  2R9W A;  1ES2 A;  3G6O A;  4R70 A;  1AXB A;  5I94 A;  1XP4 A;  1YMX A;  2A2L A;  3CAX A;  4WF0 A;  5IU1 A;  2LB9 A;  3L7H A;  2H0Y A;  5EOE A;  4OH0 A;  1BLC A;  3MQQ A;  2BTF P;  2XQZ A;  3FKW A;  3R4K A;  3NCK A;  3WS2 A;  2W3G A;  1JWZ A;  3CJM A;  3F1P B;  4GDB A;  3EEH A;  2HZ5 A;  1FQG A;  1IYO A;  3H82 A;  4DN0 A;  3BFG A;  3U4L P;  2JN7 A;  1OPX A;  3LR0 A;  4RVA A;  1HZO A;  2CC1 A;  2DRW A;  2P9V B;  5LBR A;  2ZQA A;  4LV0 A;  5DKL A;  4P85 A;  3GQZ A;  4ETZ A;  3MKE A;  3IF6 C;  4FCF A;  2OV5 A;  2H5S A;  1F5M A;  4KG5 A;  1XJ2 A;  3G30 A;  3DTI A;  2JHE A;  5IT5 A;  5GHX A;  2Y79 A;  3CUE A;  5F68 A;  2Q0O A;  2Y2N A;  4GD6 A;  1KDW A;  1PI5 A;  4MDZ A;  2ZMA A;  3IXG A;  4FD8 A;  4YWZ A;  4GHI B;  5CXW A;  1XPB A;  1MWT A;  3B42 A;  1HTZ A;  4QB8 A;  3V39 A;  3GRJ A;  4CLC B;  1VEU A;  4QU3 A;  3P09 A;  5TBM B;  2Y2L A;  2ZC5 B;  5GLB A;  3SOI A;  2PT7 A;  3ITA A;  4R3B A;  1TDL A;  3MXR A;  2BAS A;  3EWK A;  1DP6 A;  1NYY A;  4UHU A;  5G4Y A;  5FSR A;  2QJ7 A;  2XD1 A;  5CHM A;  5AJG A;  2EFU A;  4I3I A;  2KDK A;  1P9R A;  2CMN A;  1K6R A;  3OPL A;  4S2J A;  4BL3 A;  2ZQC A;  4X1L A;  5FQQ A;  3ZG9 B;  4OOM A;  3TRC A;  4WZ5 C;  3UE3 A;  2V0W A;  5AQA A;  4JPM A;  2HV1 A;  2ZM8 A;  3SS5 A;  1YLZ A;  3VP1 A;  4GW9 A;  1GA9 A;  5E2G A;  5F69 A;  3VP3 A;  2Y4A A;  2EX8 A;  2OLV A;  4PAU A;  1WYB A;  3A0V A;  1YQS A;  5AQB A;  4K0W A;  1JTG A;  2INW A;  1CEF A;  2J3T C;  3OCN A;  4KZ9 A;  3S22 A;  2G7U A;  1KE4 A;  3KYQ A;  4JF4 A;  1GHI A;  3ZG0 A;  4F3L B;  2I9V A;  5HX9 A;  1VM1 A;  1Y4O A;  5F82 A;  1J9M A;  5TJJ A;  2Y2M A;  3DTM A;  5L09 A;  4JXS A;  4RX2 A;  4E3J A;  3UO9 A;  3Q07 A;  2WK0 A;  5A91 A;  3QP6 A;  4X69 A;  5EE8 A;  1YLJ A;  3PYP A;  2Y91 A;  2WKR A;  5FQ9 A;  1IFQ A;  3UB9 A;  2C6W B;  3H9W A;  4M3K A;  2X02 A;  2QYB A;  4QPR A;  5GLD A;  1CQA A;  4WZ4 A;  3I7J A;  1OME A;  4I39 A;  4EWF A;  4D2O A;  3RH8 B;  1YMS A;  1TF1 A;  2Q9N A;  1D06 A;  2WGI A;  2P7J A;  3LY3 A;  1K4E A;  4L9G A;  3A3E A;  1ES4 A;  3UE0 A;  4WEL A;  3QP8 A;  2W3E A;  2PHY A;  1ERQ A;  4R4S A;  3ZG7 B;  2EA9 A;  4ARZ A;  3CIT A;  1LI9 A;  3HLB A;  4HP9 A;  1ES3 A;  2FFF B;  2OWH A;  4P6Z M;  1NY0 A;  1P0Z A;  2ZJ9 A;  4YIN A;  3LCE A;  4EQ1 A;  1QMF A;  3S7N A;  1GCE A;  3NI9 A;  3QHY A;  1ALQ A;  4S2M A;  3MZF A;  4I38 A;  3O88 A;  4UQI S;  1PZO A;  1K55 C;  5FI6 A;  5HSQ A;  1CI8 A;  3HJI A;  1HLU P;  3A3F A;  2WYX A;  3G32 A;  1T1B A;  4NKP A;  2FZ0 A;  2I72 A;  3UME A;  1FR1 A;  4WLA A;  2Y8H A;  3MQO A;  4ID4 A;  5HD5 A;  3E2L A;  3QP5 A;  4E3K A;  4ME4 A;  4LLO B;  1GHP A;  1CK3 A;  3T50 A;  1L0G A;  3UY6 A;  4FOF A;  1S4S A;  1H3Q A;  3DWK A;  5DVA A;  1PFL A;  3ZG5 A;  4OPR A;  3LY4 A;  3C2W A;  2VZW A;  3IQA A;  3MS6 A;  1NZU A;  3P01 A;  1HD8 A;  3VFH A;  1V9Z A;  3PBR A;  1PWC A;  4MNR A;  1BLP A;  3T1X A;  4QJG A;  4BL2 A;  3JVV A;  1O7E A;  1LL8 A;  3S1Y A;  5FEF A;  2ZC3 B;  2ZBB A;  3JPU A;  5E43 A;  5AVE A;  5KSH A;  4R3J A;  5L07 A;  1BZA A;  2QMI A;  2GX5 A;  4Z9Q A;  3KSI A;  3H7W A;  4HIA A;  3UDI A;  2JKG A;  5FQM A;  3RJU A;  4YOF A;  5DJU A;  3PBS A;  5F1F A;  1BUE A;  2DCF A;  3C4O A;  1L3L A;  2JKF A;  4LV1 A;  1YLP A;  3RXX A;  5F83 A;  3BFF A;  2L0W A;  3T1R A;  2HP9 A;  3UE1 A;  1MXO A;  5CHU A;  4BWI A;  1S0W A;  3HLC A;  1PW8 A;  2KOI A;  2PD7 A;  3QP4 A;  5CGX A;  2XLN A;  4Z1W A;  4O7D A;  4K08 A;  2FFY A;  1X0O A;  3MXQ A;  3GMW A;  1NRJ A;  4N92 A;  4ZTK A;  2WGW B;  4IVK A;  5FI2 A;  4WYY A;  2G2W A;  4RA7 A;  2EWV A;  4JXV A;  3TJZ C;  1NLZ A;  5EVE A;  1L0F A;  1PWD A;  2Y55 A;  3GR2 A;  3HLF A;  4WBG A;  2B02 A;  1MC0 A;  5HWT A;  4PPR A;  3MR0 A;  3VE3 A;  4S2K A;  1LL5 A;  5KSC A;  5IHV A;  4KZ8 A;  1BT5 A;  4JF6 A;  1EI5 A;  4NG2 A;  4X55 A;  3SZT A;  3LEQ A;  4OKP A;  4KZ6 A;  4P6B A;  3F1P A;  2HDS A;  2O9C A;  4X6T A;  3ICY A;  1NYM A;  3C7U A;  3OLO A;  4DDS A;  2PBY A;  5CX7 A;  1ODV A;  2V1B A;  2V9A A;  3ZNT A;  1MKM A;  3ZYT A;  3Q1F A;  1I2S A;  3W4O A;  5FEG A;  2ZD8 A;  4BMW A;  2EX9 A;  4KZB A;  3RTY A;  3WS0 A;  2XSS A;  5EVI A;  4MN5 A;  3CPT B;  2H10 A;  4PM8 A;  4M4X A;  2W27 A;  3G35 A;  1MBL A;  3GV9 A;  2WKP A;  1VHM A;  1AWI A;  1SDE A;  3HCY A;  1VB6 A;  1PI4 A;  1WYC A;  4WN5 A;  1KDS A;  1YM1 A;  3LI8 A;  4F94 A;  4GHI A;  3MZE A;  5J4E A;  3LR5 A;  3E0Y A;  2MJ6 A;  5EM1 A;  1EWZ A;  4Y0O A;  2JKT I;  3LIF A;  3NUL A;  4DE1 A;  3MMH A;  1NXY A;  2B95 A;  2OLU A;  5TBM A;  3NEC A;  2ZOI A;  3IS2 A;  3N8L A;  4EBP A;  1XJ6 A;  4G3K A;  3BFD A;  4E3O A;  3E4P A;  3K3C A;  4OVD A;  3O3V A;  4UA7 A;  2VV7 A;  4PM5 A;  2GDN A;  2VGK A;  4LFU A;  2A24 A;  1ONH A;  1MPL A;  5DJT A;  5CTM A;  5CRF A;  2ZQ8 A;  1T18 A;  4QY6 A;  4WM9 A;  4KQD A;  1KGG A;  2OAQ 1;  4C6Y A;  2QWS A;  2Z2L B;  4H6J B;  3T4K A;  1K57 C;  4JKT A;  1LSW A;  5HL6 A;  1ZHH B;  4NXE A;  4CLC C;  1TVF A;  3IF6 A;  4XUX A;  5F6A A;  1ZG6 A;  2B5R A;  3C8C A;  4NET A;  5FQI A;  3MSH A;  5HWV A;  1KVM A;  2O0Y A;  5A92 A;  5HZH A;  4DF6 A;  2JCH A;  4DKI A;  1H5X A;  1N9B A;  4IJG A;  4DXB A;  4GZB A;  1ESU A;  3EGX C;  3WRT A;  3OBF A;  3A3I A;  1MZU A;  3JYI A;  3IH8 A;  3MKF A;  1XJ4 A;  1FSY A;  3W2Z A;  1P97 A;  3LR3 A;  2ZLY A;  3ZQ5 A;  4GN2 A;  2J9P A;  1IYP A;  3UN7 A;  4EU0 A;  1GSX A;  4R3A A;  4ETX A;  1IEM A;  1LL9 A;  1T1A A;  3CHW P;  3BY8 A;  4HBU A;  3A0R A;  4UQI M;  3DTK A;  4R4R A;  3VP0 A;  1BLS A;  3T12 B;  4JXG A;  4DRT A;  4KG2 A;  1WE4 A;  4RYE A;  3OPR A;  3IXD A;  3F1N A;  4WEK A;  4WZ5 A;  5HAR A;  3OPP A;  3NOT C;  1S1Z A;  1S1Y A;  1JNU A;  1QME A;  1SHV A;  4L9F A;  5HPF A;  3DTE A;  4OON A;  4NXG A;  3VOY A;  5CEB A;  3LIB A;  4R1G A;  2OSU A;  3EGD C;  3F1O B;  2XH9 A;  2VV6 A;  2Y2K A;  4ZDX A;  3BY9 A;  4OOL A;  4O0P A;  1JWP A;  1F98 A;  1N4O A;  2NUT C;  4ZRR A;  3O5Y A;  1S66 L;  1YAX A;  3IHB A;  4KG6 A;  4U3T A;  5M19 A;  2JKT M;  1KE0 A;  2Y59 A;  4EV4 A;  5KZH A;  4N9K A;  1K6S A;  4E6X A;  2ZMV A;  3C7V A;  3G31 A;  1VET A;  3ZCZ A;  1RP5 A;  4ZBE A;  3V67 A;  2W1T A;  4Q0J A;  5HAP A;  3VOZ A;  1DP8 A;  4JGR A;  4L9E A;  1W8Y A;  1XX2 A;  2EFX A;  4FUW A;  3NOP C;  4E04 A;  4WMC A;  5GHZ A;  5K5B A;  3G2Z A;  1FIK A;  2XGN A;  1YKD A;  1O07 A;  3MXS A;  4ESP A;  2BLS A;  2V1Z A;  2E8J A;  1TS6 A;  3BLS A;  3V50 A;  3HLE A;  2WAF A;  4EEP A;  2VKS A;  2DMW A;  4HJ6 A;  4B4X A;  4KZ4 A;  2P74 A;  3H82 B;  5E2H A;  3K3D A;  4C3Q A;  3NBL A;  5FL3 A;  1W5D A;  1XJ3 A;  1CJF A;  4G3V A;  1YT4 A;  1HVB A;  4Q0H A;  3IXH A;  2XR0 A;  4OPQ A;  2HDU A;  2XD5 A;  3CG5 A;  1F9I A;  1DJA A;  3WS1 A;  4GOG A;  2UWX A;  1XXM A;  3M6B A;  3BQA A;  5HL1 A;  4X68 A;  4QY5 A;  5FI7 A;  2LB5 A;  1LSV A;  4U0X A;  1H0M A;  2ZQ7 A;  1CF0 A;  4JBF A;  2HPB A;  3N8S A;  3P7N A;  4HBT A;  3S7Q A;  4GS9 A;  2HP6 A;  1K55 A;  1K4F A;  3E2K A;  3GTC A;  3HUM A;  4IHQ A;  3CI6 A;  4DE0 A;  3NIA A;  4CPK A;  3LFV A;  2IWB A;  3O86 A;  4E3L A;  1VEU B;  2YKH A;  2ZC4 B;  2QJ5 A;  5DTS A;  3PBT A;  5L8M A;  1I2W A;  4S2I A;  2RL3 A;  1MWR A;  3VMA A;  5FDH A;  3Q7V B;  2XEP A;  4EES A;  4S2L A;  2ZM2 A;  3PBQ A;  3TSG A;  4LPZ A;  5EVI D;  2KLI A;  4IVI A;  4GLQ A;  1GSW A;  4KEN B;  1KVL A;  2JC7 A;  2EXA A;  4IBR A;  2VGL S;  3AGF A;  3PHY A;  1RGZ A;  4OLD A;  2A49 A;  1YLW A;  2PU4 A;  1TS7 A;  3C4P A;  4MLL A;  3SH9 A;  3RFB A;  4HQA A;  4XT2 A;  3QNC A;  1H8Y A;  1DY6 A;  1E25 A;  3HLW A;  3IXB A;  5GL9 A;  3NJA A;  1TD5 A;  4S2O A;  2DNS A;  1OJG A;  4QWO A;  1CI9 A;  2GZA A;  4Q8I A;  3NC8 A;  5G18 A;  5FQJ A;  3D4F A;  2Y2I A;  3ZFZ A;  5FAS A;  2O9A A;  3WS5 A;  5L10 A;  4R6L A;  5HW3 A;  3GSG A;  5FAP A;  2QZ6 A;  4MBH A;  1N9N A;  4Y0U A;  5HPI A;  4GNU A;  5AVF A;  2Y2Q A;  2NUP C;  2W3F A;  5I5L A;  4BQM A;  1TS0 A;  1Q2P A;  3FPV A;  5TR7 A;  2WZZ A;  3PXP A;  1ESI A;  3BRM A;  1U60 A;  3CPT A;  4AFI A;  3IBR A;  3M2K A;  4IUH A;  2PR6 A;  4NXB A;  2RCX A;  3UB5 P;  3E98 A;  1DRM A;  3R7W A;  1SDN A;  3KSH A;  3N6I A;  4RX3 A;  5EEC A;  3GDI A;  1SZV A;  3IF5 A;  2OAP 1;  2WAE A;  1K38 A;  2M7V A;  1MWU A;  3T4Q A;  4S2P A;  3IX3 A;  5CGS A;  2XA7 S;  5JYO A;  3IBJ A;  3C5A A;  3OOV A;  2JKR I;  1IKG A;  2UV0 E;  1DJC A;  3W8K A;  2L1M A;  4MN6 A;  3V3R A;  1L0D A;  2V1A A;  5CEC A;  1ZC2 A;  4S2N C;  3AGE A;  5L2F A;  3UPP A;  1FOF A;  1BTL A;  4PKY G;  3VOL A;  1W63 M;  4ZJ2 A;  3VSK A;  4ARZ B;  2W3H A;  2ZL1 B;  1H8Z A;  1JTD A;  4UA6 A;  3E4Q A;  4GDN A;  3PR6 A;  4GD8 A;  4HP4 A;  1I5Q A;  4XXR A;  5FAT A;  1OT6 A;  5J8X A;  2C5W B;  3TE8 A;  3C30 A;  3ITB A;  2BG1 A;  4H8R A;  3HLG A;  1K54 A;  1H8M A;  4EW7 A;  2K2N A;  3VFF A;  3HUN A;  2Y2P A;  4OQG A;  2KX6 A;  1LSX A;  4OP8 A;  2XK1 A;  1BYW A;  1IEL A;  3NDE A;  3LR4 A;  3BEB A;  1NRF A;  4OQ0 A;  1SKO B;  5CHJ A;  4JGO A;  2HP5 A;  1ZKJ A;  2W1R A;  2HJE A;  1SKF A;  4LV2 A;  4DE2 A;  5KIZ A;  3VV4 A;  2L4R A;  5DFY A;  4HI4 A;  3M6H A;  5EPH A;  1PNE A;  3ISG A;  2PD8 A;  5IS1 A;  2W0N A;  3T4O A;  5FAQ A;  1CEG A;  2ZMF A;  2PRF A;  4PM9 A;  3BEC A;  2J3T D;  2P9V A;  2Y2O A;  4E3N A;  1PYY A;  4UAA A;  3CWF A;  1G68 A;  3UE6 A;  4B93 A;  1BUL A;  4QHC A;  3KYZ A;  5HFO A;  1G5U A;  3ZHH A;  4U0T A;  1STZ A;  4JLF A;  2V20 A;  5F1G A;  5A90 A;  5J3W A;  2V8C A;  3UMD A;  2Z6C A;  1W63 Q;  2ZQ9 A;  4OOY A;  3IHA A;  3SH7 A;  1S4R A;  2P08 A;  4KQQ A;  2D01 A;  5CED A;  1Y28 A;  3G34 A;  4Q0I A;  1L2S A;  1K57 A;  5AQ9 A;  4PM7 A;  4B88 A;  4WMC D;  4CLC A;  2J80 A;  4Y0T A;  4LGW A;  3PBN A;  1YSQ A;  4MEZ A;  1XFQ A;  4CQH A;  5DKK A;  1FCO A;  3WRZ A;  4MMN A;  4KZ7 A;  1E4D A;  3W4Q A;  4Y3I A;  5FDS A;  1KE3 A;  5HAI A;  2QHK A;  2IA2 A;  3UDF A;  4IED A;  2WKH A;  4KUO A;  4EET B;  3MZD A;  4KZA A;  1N9O A;  5EVI C;  2ZQD A;  1P9W A;  3A3D A;  5M1A A;  4R38 A;  3T1Q B;  1ES5 A;  4NK3 A;  2HJ9 C;  4I3A A;  3T4J A;  3OPH A;  2PBD P;  2JKR M;  4OPZ A;  4DE3 A;  1Q2Q A;  3UDX A;  4Y15 A;  2R78 A;  1BLH A;  3C38 A;  4E6W A;  3UPN A;  5FA7 A;  2R9X A;  4DMZ A;  2ZM0 A;  3SH8 A;  4FTX A;  2EWW A;  1OT9 A;  1RCJ A;  3HRE A;  4BLM A;  4JXW A;  1IYS A;  1D7E A;  4BBV A;  1G6O A;  4LV3 A;  1NWZ A;  5MC7 A;  4NEE D;  4EQI A;  3ZDJ A;  1XKZ A;  4HNB A;  4EBL A;  1ZTU A;  3T4S A;  3KX0 X;  3U2A A;  1ONG A;  1TEM A;  2K31 A;  3FV7 A;  3IWO A;  3B47 A;  4F3L A;  1G28 A;  4I5S A;  1S6R A;  3DWZ A;  3FYZ A;  2VV8 A;  4GJ4 A;  5GLA A;  2EX6 A;  1YSP A;  2O9B A;  3QP2 A;  1Y54 A;  3HJK A;  2OWJ A;  5HDD A;  1ACF A;  4EXO A;  1T1C A;  5DF9 A;  2V2F F;  5HDS A;  4DJ3 A;  4XUZ A;  3MBZ A;  5EV0 A;  4N1X A;  2HF6 A;  1UWP X; 
#chains in the Genus database with same CATH homology
 1K54 C;  3IWI A;  4QY5 A;  1E3U D;  5FI7 A;  1XA7 A;  3S1Y A;  4U0X A;  5EVI B;  1LI0 A;  2X71 A;  4QD4 A;  4Y7P A;  5HAQ A;  2ZC3 B;  4OPY A;  4P0M A;  2ZQ7 A;  4BD1 A;  5E43 A;  5EOO A;  1NJ4 A;  4JBF A;  2WKI A;  4B4Z A;  2HPB A;  5BOH A;  3N8S A;  3BYD A;  4R3J A;  1L0E A;  2X01 A;  2EX2 A;  5KSH A;  4HBT A;  4A5R A;  1BZA A;  2QMI A;  2HP6 A;  4Z9Q A;  1K55 A;  1K4F A;  1BSG A;  3VP4 A;  1RGY A;  3E2K A;  3UDI A;  2JBF A;  5FQM A;  3OZH A;  3GTC A;  3RJU A;  3FKV A;  4OQI A;  1VQQ A;  4P87 A;  3PBS A;  3HUM A;  5F1F A;  3HVF A;  3G4P A;  1BUE A;  3QNB A;  2DCF A;  3C4O A;  4DE0 A;  3NIA A;  4PMA A;  4CPK A;  4MBK A;  1GA0 A;  4GB7 A;  2IWB A;  3O86 A;  3VP2 A;  3OC2 A;  4N1H A;  4ZJ3 A;  1GHM A;  4E3L A;  2ZC4 B;  3HL9 A;  4LV1 A;  5DTS A;  3DW0 A;  3PBT A;  1YLP A;  4OLG A;  2Y2G A;  3V5M A;  1I2W A;  5F83 A;  1LHY A;  3RXX A;  1KGE A;  3ZVW A;  2Y2H A;  1PW1 A;  3BFF A;  4S2I A;  3VSL A;  3HUO A;  1KGF A;  2HP9 A;  2RL3 A;  3W4P A;  1MWR A;  3UE1 A;  1MXO A;  3N4I A;  3VMA A;  1W8Q A;  5CHU A;  1S0W A;  1K25 A;  2J8Y A;  3HLC A;  4N9L A;  1M40 A;  4HES A;  5FDH A;  5DTT A;  1PW8 A;  3Q7V B;  2XEP A;  1IYQ A;  4FSF A;  1LLB A;  3Q7V A;  3B3X A;  5CGX A;  3BM6 A;  2XLN A;  3EQU A;  4O7D A;  4S2L A;  1K56 A;  3BFE A;  2ZM2 A;  3PBQ A;  3TSG A;  2FFY A;  5EVI D;  3TG9 A;  3GMW A;  4N92 A;  2R9W A;  4IVI A;  4ZTK A;  1ES2 A;  1XA1 A;  4KEN B;  2WGW B;  1KVL A;  4IVK A;  5E2E A;  5FI2 A;  4WYY A;  1AXB A;  4E3M A;  5I94 A;  2G2W A;  3FZC A;  1XP4 A;  4RA7 A;  1YMX A;  4JXV A;  1E3U A;  4CJN A;  2JC7 A;  2EXA A;  4IBR A;  3AGF A;  1RGZ A;  2H0Y A;  4OLD A;  2A49 A;  1YLW A;  2PU4 A;  1L0F A;  5EOE A;  1PWD A;  3IF6 B;  3C4P A;  4OH0 A;  2Y55 A;  3GR2 A;  3HLF A;  4MLL A;  1BLC A;  3SH9 A;  4WBG A;  4PPR A;  3UNW A;  3QNC A;  4E3I A;  4S2K A;  1LL5 A;  1H8Y A;  2XQZ A;  3FKW A;  2HDQ A;  1DY6 A;  1E25 A;  3HLW A;  3IT9 A;  5DF8 A;  4BEN A;  5KSC A;  3IXB A;  3NCK A;  5GL9 A;  5IHV A;  2HDR A;  4KZ8 A;  3WS2 A;  1BT5 A;  4JF6 A;  4S2O A;  1EI5 A;  2DNS A;  4X55 A;  1JWZ A;  1CI9 A;  3CJM A;  4GDB A;  4OKP A;  4KZ6 A;  4P6B A;  4Q8I A;  4K91 A;  3NC8 A;  5G18 A;  3V3S A;  1FQG A;  5FQJ A;  4BJP A;  3PTE A;  1IYO A;  2HDS A;  2Y2I A;  3D4F A;  3GVB A;  3ZFZ A;  5FAS A;  3WS5 A;  4X6T A;  5KMW A;  1NYM A;  3BFG A;  3C7U A;  5CTN A;  5HW3 A;  3GSG A;  4DDS A;  2QPN A;  2PBY A;  5FAP A;  5AQ7 A;  3ZNT A;  2QZ6 A;  4WEJ A;  4RVA A;  4MBH A;  5DTK A;  1ERO A;  1HZO A;  4LCM A;  2CC1 A;  3Q1F A;  1I2S A;  4Y0U A;  3W4O A;  2DRW A;  4GNU A;  3HBR A;  2Y2Q A;  2Z2M B;  2P9V B;  4KZ3 A;  1XGI A;  2ZD8 A;  2ZQA A;  1DJB A;  3PBO A;  4ZJ1 A;  2EX9 A;  4KZB A;  4LV0 A;  4BQM A;  1M6K A;  1Q2P A;  3WS0 A;  4P85 A;  3GQZ A;  4R0Q A;  4X53 A;  5TR7 A;  2WZZ A;  3TOI A;  3MKE A;  5EVI A;  3IF6 C;  4FCF A;  5CER A;  1ESI A;  3BRM A;  1U60 A;  2OV5 A;  2H10 A;  2H5S A;  3ZNY A;  3CMZ A;  4KG5 A;  4PM8 A;  3G30 A;  3M2K A;  5M18 A;  3BLM A;  3G35 A;  1MBL A;  3GV9 A;  2RCX A;  5GHX A;  2Y2N A;  4GD6 A;  1KDW A;  3ZG8 B;  1PI5 A;  1SDE A;  3N8R A;  1PI4 A;  1JVJ A;  1SDN A;  1WYC A;  2ZMA A;  3IXG A;  1C3B A;  1KDS A;  3N6I A;  4RX3 A;  5EEC A;  4FD8 A;  1YM1 A;  3OCL A;  4F94 A;  5CXW A;  2IWD A;  1XPB A;  1MWT A;  3MZE A;  3G2Y A;  1HTZ A;  3IF5 A;  4QB8 A;  2WAE A;  5FAO A;  1K38 A;  1MWU A;  3V39 A;  3GRJ A;  1EWZ A;  4QU3 A;  4S2P A;  4Y0O A;  2PU2 A;  5CGS A;  3P09 A;  4DE1 A;  3N7W A;  5JYO A;  2Y2L A;  1NXY A;  2ZC5 B;  5GLB A;  2OLU A;  3C5A A;  2EXB A;  3SOI A;  3ITA A;  1IKG A;  4R3B A;  3Q82 A;  1TDL A;  3MXR A;  1DJC A;  3W8K A;  3V3R A;  1L0D A;  4KQO A;  4UA9 A;  5CEC A;  1ZC2 A;  3N8L A;  4S2N C;  4EBP A;  3AGE A;  3BFD A;  5L2F A;  4KZ5 A;  3UPP A;  4HEF A;  1NYY A;  4UHU A;  1FOF A;  4E3O A;  1BTL A;  4OVD A;  3O3V A;  4UA7 A;  2JE5 A;  4PM5 A;  5FSR A;  2XD1 A;  3ZGA B;  1NZO A;  2GDN A;  4ZJ2 A;  3VSK A;  2VGK A;  3LEZ A;  5CHM A;  1H8Z A;  1JTD A;  1ONH A;  2EFU A;  4GDN A;  1MPL A;  4UA6 A;  4GD8 A;  1FCM A;  1JWV A;  5E2F A;  5JYP A;  5CTM A;  1I5Q A;  4XXR A;  5CRF A;  2ZQ8 A;  5FAT A;  2WGW A;  4QY6 A;  5J8X A;  4WM9 A;  2C5W B;  4EBN A;  1KGG A;  1XGJ A;  4C6Y A;  4FH4 A;  1K6R A;  3ITB A;  2BG1 A;  2Z2L B;  3OPL A;  4H8R A;  3WS4 A;  4S2J A;  4PM6 A;  4BL3 A;  1FR6 A;  1K57 C;  3HLG A;  1K54 A;  3Q7Z A;  4JKT A;  2ZQC A;  3VFF A;  2A3U A;  5FQQ A;  3ZG9 B;  4OOM A;  2H0T A;  4WZ5 C;  5U47 A;  4MBF A;  1TVF A;  3HUN A;  3IF6 A;  4X56 A;  4XUX A;  3UE3 A;  5AQA A;  4JPM A;  1ZG6 A;  2B5R A;  2Y2P A;  4OQG A;  1PIO A;  2ZM8 A;  4NET A;  3SS5 A;  1YLZ A;  4IBX A;  4OP8 A;  2XK1 A;  5FQI A;  3VP1 A;  3ZVT A;  2XF3 A;  1IEL A;  3NDE A;  1GA9 A;  1SCW A;  3HLD A;  5E2G A;  3VP3 A;  1KVM A;  2EX8 A;  2Y4A A;  3BEB A;  1NRF A;  4OQ0 A;  2OLV A;  2J7V A;  1WYB A;  4GKU A;  3P98 A;  5CHJ A;  5A92 A;  1YQS A;  2HP5 A;  5AQB A;  3EQV A;  4DF6 A;  1ZKJ A;  2JCH A;  4K0W A;  1SKF A;  2VGJ A;  4DKI A;  1H5X A;  1JTG A;  3Q81 A;  1N9B A;  4LV2 A;  4DE2 A;  2ZC7 A;  1CEF A;  3OCN A;  3S22 A;  4KZ9 A;  3M6H A;  1G6A A;  5EPH A;  3ISG A;  4DXB A;  1KE4 A;  4GZB A;  5FAQ A;  4JF4 A;  1CEG A;  4EUZ A;  1ESU A;  1GHI A;  4YFM A;  3WRT A;  4PM9 A;  3ZG0 A;  3BEC A;  5HX9 A;  1VM1 A;  5F82 A;  3A3I A;  1J9M A;  3JYI A;  2P9V A;  5DF7 A;  2Y2O A;  4E3N A;  1PYY A;  3IH8 A;  3MKF A;  1G68 A;  4UAA A;  1Z6F A;  2Y2M A;  1FSY A;  1BUL A;  4QHC A;  4S2N A;  3DTM A;  2ZC6 B;  2ZLY A;  4JXS A;  5HFO A;  2WZX A;  2WGV A;  4R23 A;  4RX2 A;  4E3J A;  4C75 A;  5EVL A;  5EUA A;  3UPO A;  3UO9 A;  3ZHH A;  4U0T A;  3IH9 A;  3FWL A;  3Q07 A;  4GN2 A;  2J9P A;  2WK0 A;  2XDM A;  4JLF A;  1IYP A;  5A91 A;  3UN7 A;  5CGW A;  2V20 A;  5F1G A;  4X69 A;  5A90 A;  5EE8 A;  1IEM A;  1LL9 A;  5A93 A;  1YLJ A;  2ZQ9 A;  4OOY A;  2Y91 A;  4HBU A;  5FQ9 A;  3IHA A;  3SH7 A;  1MKI A;  5GHY A;  2C6W B;  4KQQ A;  4R4R A;  3VP0 A;  5CED A;  4M3K A;  1BLS A;  3O87 A;  2X02 A;  4JXG A;  4DRT A;  4KG2 A;  1WE4 A;  1YLT A;  5GLD A;  4RYE A;  3AGD A;  3OPR A;  3G34 A;  1FSW A;  4BD0 A;  1L2S A;  1K57 A;  4WZ4 A;  4PM7 A;  5AQ9 A;  4WMC D;  4B88 A;  4K0X A;  3I7J A;  1OME A;  3IXD A;  3MFD A;  4EWF A;  4WEK A;  4WZ5 A;  4D2O A;  4Y0T A;  5HAR A;  3OPP A;  3PBN A;  1YMS A;  2Q9N A;  4MEZ A;  3SS3 A;  2WGI A;  1FCO A;  3WRZ A;  1QME A;  3LY3 A;  1K4E A;  1SHV A;  3A3E A;  1YLY A;  1ES4 A;  4KZ7 A;  3UE0 A;  4OON A;  5CEB A;  1E4D A;  3VOY A;  4WEL A;  4LCL A;  4R1G A;  3W4Q A;  3S4X A;  2OSU A;  2WUQ A;  1KE3 A;  5HAI A;  4KQR A;  1ERQ A;  1FCN A;  4R4S A;  2XH9 A;  3ZG7 B;  3BFC A;  2Y2K A;  4ZDX A;  1LI9 A;  3HLB A;  4OOL A;  1ES3 A;  3UDF A;  4IED A;  2FFF B;  1MWS A;  1ZG4 A;  1JWP A;  1N4O A;  2WKH A;  3MZD A;  5FQK A;  1NY0 A;  3PAE A;  4KZA A;  2ZJ9 A;  4YIN A;  2IWC A;  2J9O A;  3LCE A;  3IHB A;  5EVI C;  1W7F A;  2ZQD A;  4KG6 A;  1QMF A;  4U3T A;  1GCE A;  2G2U A;  3NI9 A;  5M19 A;  3A3D A;  3QHY A;  5M1A A;  1ALQ A;  3CZD A;  1KE0 A;  3IWQ A;  4S2M A;  2Y59 A;  3MZF A;  4EV4 A;  4N9K A;  5KZH A;  1ES5 A;  1K6S A;  4NK3 A;  3O88 A;  4E6X A;  2WAD A;  1PZO A;  4LEN A;  1K55 C;  3OPH A;  1PWG A;  5FI6 A;  3C7V A;  1CI8 A;  4OPZ A;  4DE3 A;  1Q2Q A;  3A3F A;  3G31 A;  3UDX A;  4DDY A;  5TFQ A;  3ZCZ A;  2WYX A;  3G32 A;  1RP5 A;  1TDG A;  4ZBE A;  1BLH A;  4JF5 A;  4E6W A;  3UPN A;  5FA7 A;  2R9X A;  2Q9M A;  5HAP A;  3VOZ A;  5TGF A;  2ZM0 A;  3SH8 A;  2I72 A;  1ERM A;  1W8Y A;  1XX2 A;  5D3O A;  1MY8 A;  2EFX A;  2XFS A;  1RCJ A;  4BLM A;  3HRE A;  1FR1 A;  4JXW A;  4OQH A;  1IKI A;  1IYS A;  3NDG A;  4WMC A;  3WWX A;  5GHZ A;  4LV3 A;  4FH2 A;  3PAG A;  3G2Z A;  4EQI A;  3ZDJ A;  1XKZ A;  2XGN A;  4EBL A;  1O07 A;  3MXS A;  1ONG A;  4ID4 A;  1TEM A;  2BLS A;  2V1Z A;  3E2L A;  3SS4 A;  3A3J A;  4E3K A;  3M2J A;  3FV7 A;  3BLS A;  3IWO A;  3V50 A;  2Y2J A;  4OP5 A;  3HLE A;  2WAF A;  1W79 A;  1GHP A;  3NY4 A;  1CK3 A;  2E8I A;  2XFT A;  1L0G A;  3UY6 A;  1PZP A;  4ZAM A;  4L0L A;  1S6R A;  4B4X A;  3DWZ A;  5GLC A;  3FYZ A;  3DWK A;  4KZ4 A;  2P74 A;  5DVA A;  5E2H A;  3ZG5 A;  4C3Q A;  3NBL A;  4OPR A;  1W5D A;  1K56 D;  3LY4 A;  3IQA A;  5GLA A;  1NZU A;  2EX6 A;  1YT4 A;  1HVB A;  3LO7 A;  1HD8 A;  3IXH A;  1Y54 A;  3VFH A;  2XR0 A;  4OPQ A;  3PBR A;  1PWC A;  2HDU A;  2WKE A;  2XD5 A;  3CG5 A;  4MNR A;  1DJA A;  4DXC A;  5DF9 A;  3RXW A;  3WS1 A;  1BLP A;  2V2F F;  4GOG A;  2UWX A;  4QJG A;  4BL2 A;  4XUZ A;  1XXM A;  3MBZ A;  3M6B A;  5HL1 A;  1O7E A;  4N1X A;  4X68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...