3ZNTA

Crystal structure of oxa-24 class d beta-lactamase with tazobactam
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
245
structure length
244
Chain Sequence
FHISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE
publication title Crystal Structure of Oxa-24 Beta-Lactamase Inhibited by Tazobactam
rcsb
source organism Acinetobacter baumannii
total genus 75
structure length 244
sequence length 245
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3zntA00
4Y0UA 1NZOA 3IXDA 4ZDXA 1TVFA 1I2WA 5EVID 3G32A 3IF6B 1CK3A 4WZ5A 1G68A 3ITAA 1LHYA 4CPKA 2ZQDA 4UAAA 1BT5A 3IXGA 4OPRA 3V3RA 4OKPA 4Z9QA 2OV5A 4R3JA 5U47A 1MWSA 1BLCA 2ZC4B 5E2FA 4BLMA 4GN2A 3NBLA 1CI8A 4EBLA 1L2SA 3MKFA 4KQQA 3RXWA 1K4EA 3GV9A 5TR7A 5I94A 2XD5A 1QMFA 5CHUA 4MBHA 1ERMA 3UE3A 1H8ZA 4GZBA 3P98A 3BFCA 2Y2LA 3QHYA 5EVIB 1L0FA 4ZAMA 3WWXA 2IWDA 2H10A 4GD8A 4IBRA 3VSKA 3M2JA 1Y54A 2Y91A 4XUXA 3WS2A 5KZHA 2WGWA 3C4PA 3W4OA 1LI0A 2ZC3B 3IF5A 1ERQA 5IHVA 2IWCA 3GQZA 4GD6A 4JXSA 1BSGA 3ZDJA 3HLEA 5J8XA 5JYOA 2DNSA 4E6WA 2J7VA 4QY6A 3S22A 3N8LA 3LY4A 4KZ4A 5EOEA 1YLJA 3IWIA 4P87A 5DTKA 2EX2A 3SOIA 3BLSA 1DJCA 2EX8A 2HDRA 4JF6A 2XGNA 4N92A 1SCWA 5EVLA 1XA7A 1W8QA 4JF5A 3HUNA 4X68A 4R23A 2ZQAA 1ALQA 1K4FA 1KGEA 3Q7VA 3N7WA 4GOGA 1K57A 3HUMA 1S0WA 4DE1A 3UDIA 3UDFA 2HP5A 2Y59A 3N6IA 3G4PA 2H0TA 2Z2LB 5TGFA 4KZ6A 3UPNA 2V2FF 4E6XA 2XK1A 3FWLA 2Y2OA 2WZXA 4JPMA 5TFQA 1XX2A 4WZ5C 1NXYA 3FZCA 3PBSA 4R4SA 5EOOA 5E2HA 1XKZA 2WAEA 3PBTA 4LV3A 3HLDA 4X6TA 3BFFA 2J8YA 3VP3A 3ZCZA 2Y4AA 3BM6A 3LEZA 1PWCA 5FI7A 2R9XA 1HTZA 5GHYA 3UN7A 4S2LA 5M1AA 1XXMA 4PM5A 5CEBA 4OH0A 2XFTA 3ZVWA 4LV0A 4MBKA 1ES3A 5GLBA 1W5DA 4EUZA 4GDNA 2HPBA 2J9PA 3E2LA 4U0TA 2ZMAA 4RA7A 4XUZA 4PM6A 1GA9A 3IXHA 3BYDA 3G31A 3FKWA 2WAFA 3PBRA 3IWQA 3SS5A 1DJAA 4BL3A 3Q81A 5HFOA 4BD0A 1MPLA 2WADA 2RL3A 3NDGA 2Y2IA 3DW0A 3OCLA 4OOYA 4F94A 1TDLA 4S2JA 5CRFA 5AQBA 3VMAA 4BQMA 4R1GA 4JXWA 4HEFA 1C3BA 4DE2A 1FR6A 1YT4A 3CZDA 1JTGA 4OQ0A 3DTMA 1M40A 5DVAA 1BTLA 2X71A 3IT9A 3NY4A 4EBNA 3OCNA 1BULA 3IWOA 2Y2QA 3EQUA 3E2KA 1GHMA 1K57C 3AGEA 3C5AA 3MZEA 1ONGA 4WM9A 4WZ4A 4B4XA 1ZKJA 1E3UA 2EFXA 2ZJ9A 3UO9A 2P9VA 3I7JA 5FQIA 5EE8A 4LCLA 4E3OA 5HAQA 1PIOA 2ZC7A 4X53A 1OMEA 1KVMA 3IQAA 3W8KA 2ZQCA 3TSGA 1Q2QA 3GTCA 1BLHA 3ZNTA 1HD8A 3Q1FA 4OONA 5F1FA 2WKIA 4C75A 1H8YA 2P74A 4P6BA 5FATA 5DF7A 5M19A 1M6KA 1NRFA 3ZFZA 4QB8A 3FKVA 3IF6A 4LV2A 3HLBA 1KE4A 4EV4A 4FSFA 4OLDA 5HL1A 1ZC2A 4OOLA 5DF8A 1FSWA 1MBLA 1GA0A 1E25A 2Y2PA 4S2OA 1IYPA 3A3DA 4FH2A 3M6HA 3GSGA 2HP9A 1SHVA 2HDSA 4DKIA 5HAPA 3HLCA 4OPZA 4KZ5A 2X02A 1BLSA 1IYSA 1FSYA 5F1GA 2QPNA 4Y0TA 1K6RA 4KZ8A 1MWUA 2WKHA 3IH9A 5EECA 3RJUA 3VP0A 5CXWA 3HL9A 4S2NA 4WYYA 5FAQA 3WS0A 4KG2A 4DDSA 1I2SA 3BRMA 4KG6A 5BOHA 5GLDA 4GNUA 3SH9A 1Q2PA 4OVDA 4JKTA 3GR2A 3MZDA 5FQKA 3NCKA 4PPRA 1K56D 2FFYA 4GB7A 1ZG6A 1K54A 2Q9MA 4QU3A 4S2KA 3IHBA 4X69A 1ONHA 1XGIA 4IVKA 1ES5A 2PBYA 3OPPA 2WKEA 3EQVA 3HVFA 3HLFA 2OLVA 4RX3A 5GLAA 3WS4A 1E4DA 3GRJA 4GDBA 1K6SA 1CEGA 2JC7A 1LLBA 4LENA 2ZQ9A 3G34A 1QMEA 4KQOA 3MBZA 5CHMA 3VP1A 2XH9A 4P85A 2I72A 1RP5A 4BJPA 4X56A 1JWZA 1PYYA 1IELA 1LL9A 3IF6C 3O87A 1PI4A 2G2UA 4OP5A 2ZQ8A 3NC8A 3IH8A 1K55A 4KZ3A 1PW1A 1Z6FA 2EXBA 2Y2GA 4L0LA 2BLSA 4R0QA 4MLLA 5L2FA 1BUEA 1PZPA 3GMWA 2HDUA 3V39A 1DJBA 4MBFA 3ZG8B 4E3KA 2Z2MB 4R3BA 4FH4A 3Q82A 3UY6A 5FI2A 4UHUA 5KSHA 1GCEA 1ZG4A 1CEFA 4S2NC 4UA7A 3UPPA 1JTDA 4S2MA 1KVLA 2Y2KA 5CECA 5HX9A 3VOZA 1JWVA 4NETA 4C3QA 3CMZA 3JYIA 1SKFA 5HARA 2XLNA 4XXRA 4D2OA 4HESA 4E3IA 1XGJA 1K54C 2IWBA 2ZD8A 4HBUA 2Y2HA 2XR0A 2GDNA 3Q07A 2WGVA 1EI5A 1IKGA 2EXAA 5AQ7A 2H5SA 3ZG5A 3M6BA 3A3EA 4NK3A 1YLWA 4Y7PA 1FR1A 2ZC5B 4WMCA 5FQJA 3WS5A 4E3LA 1EWZA 4PM9A 1O07A 2OLUA 1YQSA 2JBFA 3MFDA 3PBNA 5FSRA 4EQIA 5CGWA 4U0XA 4DE3A 5DTSA 1E3UD 1SDEA 2Y2MA 2WGIA 4OP8A 2ZM8A 1KE3A 2ZM0A 3UE1A 1PWDA 1HVBA 1CI9A 2EX6A 2J9OA 3OZHA 1K38A 3HLWA 4ZJ3A 3A3IA 3WS1A 5M18A 1FOFA 1K55C 3CG5A 3HUOA 4E3MA 1YLPA 3N8SA 4K91A 5E43A 1NY0A 4OPYA 5FA7A 4MNRA 3IXBA 5D3OA 3VP4A 5FAOA 2JCHA 3V5MA 1SDNA 2XQZA 4WEKA 3UE0A 4E3JA 5AQAA 4E3NA 2WZZA 3FV7A 3PAEA 4CJNA 1YMXA 5CEDA 3G2ZA 4EBPA 4C6YA 1FCMA 1KGFA 5HAIA 4IEDA 4JLFA 4S2PA 5GL9A 3S1YA 2R9WA 1G6AA 2UWXA 3AGDA 1VM1A 3O3VA 4JXGA 4BD1A 2Y55A 1BLPA 4KZBA 4ZBEA 4WBGA 4DRTA 3BECA 4JF4A 1ES4A 3CJMA 5F83A 3N4IA 3BEBA 2EX9A 1YLZA 1NJ4A 5EVIA 4BL2A 1YLYA 4LCMA 1RGYA 2XDMA 2Q9NA 3V3SA 1RCJA 1HZOA 1GHIA 3PAGA 3A3JA 1ESIA 4QY5A 1BZAA 1NZUA 3ZG9B 2CC1A 3PTEA 3OPHA 1NYYA 3W4QA 1XA1A 4B88A 5CGXA 5DF9A 1EROA 1J9MA 4U3TA 1IYOA 2QZ6A 2DRWA 4KQRA 3RXXA 4K0XA 1RGZA 5HW3A 3PBOA 3NDEA 4PMAA 4RVAA 2V1ZA 4JXVA 1IYQA 2XD1A 1W79A 1TDGA 4QHCA 3ITBA 4R4RA 4KG5A 4X55A 3TG9A 3W4PA 3VP2A 3GVBA 2VGJA 2WGWB 5CTNA 4DDYA 3NIAA 5GHZA 3SS3A 3TOIA 1KGGA 3IHAA 1LL5A 3O86A 4RX2A 1U60A 3HBRA 1L0EA 1PI5A 1YLTA 1PW8A 2Y2JA 5A90A 1FQGA 4UA9A 1K56A 3G30A 4ZTKA 2H0YA 1VQQA 1MWTA 4MEZA 4H8RA 5FQ9A 4ZJ2A 2XFSA 3QNBA 4UA6A 1KE0A 1WYCA 3LO7A 4HBTA 5CHJA 5FAPA 3VOYA 3OPLA 4KZ7A 4QJGA 3Q7VB 3ZG7B 5CTMA 5A91A 3LCEA 1W8YA 3ZVTA 5CGSA 3UNWA 4N1XA 4OQIA 5KMWA 1L0GA 5EUAA 2OSUA 4WEJA 3ISGA 4M3KA 4OQHA 1KDWA 4QD4A 4N1HA 4ZJ1A 2WYXA 5DTTA 1MWRA 1W7FA 3LY3A 5KSCA 5EVIC 3G2YA 4FD8A 4O7DA 1LI9A 2HP6A 2PU2A 3MXRA 5A92A 5F82A 1WE4A 5E2EA 3HLGA 5FASA 2QMIA 2Y2NA 1TEMA 5AQ9A 2A3UA 4IVIA 2WK0A 3NI9A 3D4FA 1IEMA 2PU4A 1S6RA 3SH8A 1PWGA 3S4XA 3VFHA 3O88A 1YMSA 3WRTA 3ZNYA 4BENA 4EWFA 1JVJA 4GKUA 1H5XA 4DF6A 1XPBA 3N8RA 1NYMA 4PM8A 4Q8IA 4ID4A 1JWPA 2WUQA 5E2GA 3AGFA 1ESUA 3DWZA 3MXSA 2G2WA 3SS4A 1N4OA 4IBXA 1IKIA 4Y0OA 3BFEA 3QNCA 4KENB 3G35A 1GHPA 2X01A 1WYBA 1PZOA 2A49A 4WMCD 1I5QA 3BLMA 1MKIA 1N9BA 1FCOA 4KZ9A 4YINA 3C7UA 5GLCA 4B4ZA 4DE0A 3HREA 2B5RA 5FQQA 4A5RA 3WRZA 2DCFA 4YFMA 2VGKA 3UDXA 3P09A 5FQMA 2C5WB 2BG1A 1AXBA 1KDSA 3BFDA 2RCXA 1FCNA 4JBFA 4WELA 4N9LA 1DY6A 1O7EA 4PM7A 1YM1A 5GHXA 5JYPA 2FFFB 2E8IA 3Q7ZA 3VSLA 4DXBA 3UPOA 3ZG0A 3M2KA 3VFFA 3V50A 4S2IA 2HDQA 2XF3A 2ZQ7A 3SH7A 1K25A 4P0MA 1XP4A 4RYEA 4KZAA 1ES2A 5FI6A 3MKEA 1MY8A 2P9VB 3MZFA 4OQGA 4K0WA 5A93A 3OC2A 2XEPA 3PBQA 1L0DA 2ZC6B 2ZM2A 3C4OA 4FCFA 5CERA 3C7VA 5FDHA 2V20A 3B3XA 3BFGA 4N9KA 2ZLYA 2C6WB 4OOMA 4OLGA 3DWKA 5G18A 4DXCA 5EPHA 3OPRA 4OPQA 3ZGAB 3ZHHA 3FYZA 2JE5A 1MXOA 3A3FA 2EFUA 4LV1A
chains in the Genus database with same CATH superfamily
3D72A 1LSVA 1NZOA 1N9OA 3IS2A 1I2WA 1T1BA 4CLCC 1OT9A 1G68A 1LHYA 4CPKA 2ZQDA 4UAAA 1BT5A 1A0KA 3MMHA 4GN2A 1CI8A 3VV4A 1L2SA 5TR7A 2XD5A 4MBHA 1ERMA 3BFCA 1Y4OA 5EVIB 1L0FA 5KZHA 2WGWA 1LI0A 2ZC3B 2OWHA 5IHVA 1BSGA 3ZYTA 3KYZA 5J8XA 2DNSA 2J7VA 3S22A 2V0WA 1YLJA 5DTKA 3SOIA 3BLSA 2EX8A 2HDRA 2XGNA 3T1QB 3HUNA 4R23A 2ZQAA 1K4FA 3A0RA 4DE1A 2Y59A 3G4PA 5AVEA 3VOLA 2GX5A 2V2FF 2Y79A 2Y2OA 4JPMA 3O5YA 4GS9B 5FEFA 2J3WA 5E2HA 3H9WA 3BFFA 1ACFA 4HIAA 3LEZA 3UN7A 3K3CA 4S2LA 1XXMA 5EM0A 4PM5A 4OH0A 5IU1A 2L4RA 2Y8HA 4LV0A 2GJ3A 2J9PA 4XUZA 3SS5A 3IWQA 4BL3A 5HFOA 4H6JB 4F94A 4F3LB 1BYWA 3VMAA 4JXWA 3QP4A 1MKMA 1FR6A 1YT4A 4GCZA 2PAVP 3HCYA 4OQ0A 1GSWA 4L9GA 1BULA 3GECA 3IWOA 3EQUA 2H28A 5TBMA 3AGEA 2OAQ1 2EFXA 2ZJ9A 4I3JA 4WN5A 2P9VA 1OJ5A 4NKPA 1KOUA 2O9AA 3GTCA 4C75A 1H8YA 3PXPA 2O9BA 4LV2A 4HH2A 4BBTA 1LSXA 1YPRA 1MBLA 3M6HA 3HLCA 4OPZA 3LR3A 5G4ZA 3RTYA 5FAQA 5L09A 4DDSA 1OTIA 5BOHA 4GNUA 2PD8A 1Q2PA 4OVDA 5FQKA 2FFYA 2XSSA 2Q9MA 2PBYA 1OTAA 2OLVA 1E4DA 4MN6A 2JC7A 4LENA 1QMEA 2XH9A 2I9VA 2I72A 5K5BA 1PYYA 3DBAA 1LL9A 2G2UA 1N9LA 2ZQ8A 3NC8A 3IH8A 3UB6A 1Z6FA 4XT2A 2EXBA 3UE6A 4L0LA 2BLSA 4MLLA 4RQ9A 3NULA 2VJWA 3BY9A 1DJBA 4MBFA 5L10A 4FH4A 3QP2A 3UY6A 4L9EA 5J3WA 1JTDA 5HX9A 2M7UA 3CMZA 3JYIA 1YAXA 3T4TA 2XLNA 4XXRA 4D2OA 4HESA 4O01A 4EEPA 2XR0A 3Q07A 2EXAA 2Q0OA 3ZG5A 4NK3A 4BBUA 2ZC5B 5FQJA 3WS5A 4G3WA 2OLUA 5FSRA 4EQIA 1E3UD 4FUWA 3LIBA 1SDEA 2Z6DA 4LRZE 2WGIA 4X1LA 3UE1A 1PWDA 5HWWA 1CI9A 2DMWA 3WS1A 3UMDA 4MN7A 2W1TB 2W3FA 4OPYA 5G4YA 1P97A 5EFWA 1SDNA 2XQZA 3S7PA 2IA2A 3G2ZA 4C6YA 4JGRA 4S2PA 3S1YA 2UWXA 3O3VA 1VM1A 5HDCA 3KYQA 3F1OB 3T4LA 3UB9A 1SKOA 1YLYA 5HZHA 3C8CA 1F2KA 2A24B 4QY5A 1BZAA 2GZAA 1J3WA 3ZG9B 1P9WA 1NWZA 4E04A 1EROA 3LR5A 5HPFA 1PNEA 2QZ6A 3RXXA 3EGDC 3F1PA 3BW6A 4PMAA 2V1ZA 4O0PA 4QHCA 3W4PA 3GVBA 2L1MA 2VGJA 3CPTB 2WKRA 3PHYA 1K56A 4ZJ2A 2XFSA 3QNBA 3R7WA 3H7WB 4Y17A 1WYCA 4HBTA 3UB7A 4OQHA 1KDWA 3G6OA 4QD4A 1MWRA 4FD8A 3LIEA 5A92A 4IVIA 2FZ0A 2WK0A 4LFUA 2PU4A 1PWGA 3VFHA 1G28A 1H5XA 5EV0A 4PM8A 4Q8IA 4ID4A 1JWPA 5E2GA 2WUQA 3SS4A 3MXSA 1N4OA 4IBXA 2OWJA 4QWOA 2X01A 3CAXA 1FCOA 4KZ9A 3CWFA 4B4ZA 3HREA 5FQQA 2DCFA 3UDXA 4ARZB 5MC7A 5FQMA 1AXBA 3IX3A 1S1ZA 4JGOA 1YM1A 5JYPA 4DXBA 3ZG0A 3FPWA 3A0VA 1K25A 1XP4A 4KZAA 2HF6A 1XJ3A 4HNBA 2ZC6B 4KUOA 3F1NA 5CERA 3BFGA 4N9KA 2ZLYA 2C6WB 4OLGA 2YKFA 4DXCA 5EPHA 3OPRA 3ZHHA 2P08A 3U2AA 3FYZA 4II7A 3UE0A 4MDZA 2PT7A 2V1BA 3IXDA 4ZDXA 1TVFA 5EVID 3IF6B 4OPRA 4Z9QA 3OLOA 2ZC4B 4GHIA 1OTDA 4KQQA 3RXWA 5I94A 1H8ZA 3P98A 1TS6A 3QHYA 3WWXA 2IWDA 2H10A 4GD8A 4IBRA 3WS2A 3GQZA 1YSQA 1DP8A 5JYOA 5EOEA 4PAUA 1LL8A 2INWA 3F1PB 4JF6A 1SCWA 1XA7A 4EXOA 4X68A 1FIKA 2OOLA 3N7WA 2OAP1 1S0WA 3UDIA 3N6IA 1UGUA 4E6XA 2XK1A 3FWLA 4WZ5C 1NXYA 2PDRA 3PBTA 4X6TA 3VP3A 3BM6A 5FI7A 1Y28A 4MBKA 5GLBA 1W5DA 3H82A 3CHWP 1GA9A 3IXHA 3BYDA 1XJ2A 3G31A 1CJFA 2W3EA 2WAFA 3FKWA 3PBRA 1NRJA 4R6LA 3Q81A 1NLYA 4BD0A 2UV0E 3DW0A 3OCLA 2VV6A 4OOYA 4Q0JA 2PR5A 3VE4A 1S4RA 1C3BA 4DE2A 1P9RA 2G7UA 3DTMA 1M40A 2X71A 2KX6A 2HJEA 1GHMA 1K57C 4B4XA 1ZKJA 3I7JA 2YKHA 5FQIA 4LCLA 4E3OA 2ZC7A 1OMEA 3NJAA 3TSGA 1Q2QA 1BLHA 3ZNTA 1HD8A 3Q1FA 4OONA 2WKIA 2P74A 3DTKA 3HLBA 4O8GA 1ZC2A 3LEQA 1FSWA 1GA0A 1E25A 2Y2PA 2EWWA 1K0KA 2HP9A 1SHVA 2HDSA 4DKIA 5HAPA 1K6RA 1MWUA 3IH9A 2FH5A 5CXWA 4WYYA 1ZTUA 3LI8A 4I38A 1I2SA 5GLDA 2K7SA 3SH9A 4JKTA 4PPRA 3RFBA 4BWIA 1ZG6A 2VK3A 3JPUA 1K54A 3T1RA 3W2ZA 4IVKA 2K2NA 5HL6A 2WKEA 4RX3A 4YWZA 4R38A 1MZUA 1LLBA 3G34A 3MBZA 2JHEA 4X56A 1IELA 3IF6C 3O87A 1PI4A 4MN5A 1K55A 2J3TD 4R0QA 3IX8A 2QJ5A 1GSVA 1PZPA 3V39A 4E3KA 2Z2MB 4R3BA 2ZL1A 4UHUA 2B95A 1ZG4A 1CEFA 3KO6A 4DMZA 4S2NC 4UA7A 3FG8A 3UPPA 3ULFA 1KVLA 2Y2KA 5CECA 3HJIA 2VZWA 4E3IA 1XGJA 4HBUA 4I5SA 2GDNA 1IKGA 4PKYG 3H82B 3P7NA 2NUTC 1D1JA 5FEGA 1FR1A 4PM9A 1O07A 2Y2MA 2NUPC 3OZHA 2J9OA 1K38A 3HLWA 1F98A 3A3IA 1FOFA 4E3MA 3N8SA 2VX8A 4K91A 4CLCE 4MNRA 3IXBA 3VP4A 5FAOA 5A8BA 3V5MA 1ZHHB 4IUHA 2XROA 3FV7A 1FCMA 1KGFA 3CUEA 3FPVA 2KOIA 4BBVA 5GL9A 3AGDA 4JXGA 3R4KA 4BD1A 2Y55A 3T4QA 1T19A 3CJMA 3IS2B 3BEBA 1NJ4A 1RGYA 3MSHA 1RCJA 1NZUA 1XA1A 5CGXA 3IX4A 3JVUA 1XJ4A 2DRWA 3PBOA 3DTEA 4R4RA 3VP2A 2WGWB 3DAVA 3B42A 4DDYA 3TOIA 1KGGA 3IHAA 2VKSA 4RX2A 3HBRA 4UA9A 3G30A 2H0YA 4B93A 2HV1A 1KE0A 3LO7A 1DP9A 3E4QA 4KZ7A 2W3GA 4FTXA 5CTMA 1TS8A 3UNWA 4N1XA 5KMWA 1L0GA 2OSUA 5LBRA 4WEJA 4WL9A 4ZJ1A 2WYXA 5DTTA 3LY3A 5EVIC 4O7DA 5FASA 2QMIA 2Y2NA 1TEMA 3QP5A 2A3UA 4LPZA 1TD5A 3NI9A 3EEAA 2D01A 3E4PA 3S4XA 3WRTA 1YMSA 3ZNYA 3BQ8A 4BENA 3MQ0A 4CLCA 4DF6A 3N8RA 3TE8A 3AGFA 1ESUA 3DWZA 2G2WA 4DN0A 4Y0OA 1IKIA 3BFEA 1OTEA 4KENB 2ZOHA 4PKYA 2HJ9C 2A49A 4EUVA 3BLMA 1MKIA 4YINA 3EEHA 3EWKA 2JKTM 4A5RA 2C5WB 5TJJA 5HDSA 1FCNA 1P0ZA 3LFVA 4PM7A 4UQIM 2FFFB 4MMNA 5I5LA 3UPOA 3FC7A 3SH7A 2HDQA 5TBMB 2ZQ7A 4L9FA 2J80A 4P0MA 3EGXC 3T4JA 1MY8A 2P9VB 3MZFA 4OQGA 2AVXA 3QP1A 2PD7A 5A93A 4P6ZM 2ZM2A 3S7OA 5HPIA 4FCFA 4HP4A 5G18A 4OPQA 5DFXA 3ZGAB 1TS7A 2JE5A 4WELA 1AWIA 5AJGA 4UQIS 3ITAA 3IXGA 1CF0A 3V3RA 2PYPA 4R3JA 1MWSA 5E2FA 3T1XA 4Y15A 3NBLA 3MKFA 3K2NA 1K4EA 3GV9A 3IBJA 3IBRA 1MC0A 4GZBA 5KIZA 4P6ZS 2Y2LA 4ZAMA 1OTBA 1OT6A 3VSKA 3M2JA 1Y54A 2Y91A 4EW7A 3W4OA 3IF5A 2IWCA 2PHYA 1CQAA 3ZDJA 3HLEA 4IJGA 3N8LA 3IWIA 4R3AA 1DJCA 5EVLA 5HD3A 1KGEA 3Q7VA 4GOGA 3HUMA 3UDFA 2H0TA 5TGFA 3UPNA 5TFQA 2WZXA 1XX2A 3FZCA 3PBSA 4R4SA 1OJGA 4HH3A 4XT2B 3LGOA 3U4LP 4LV3A 3HLDA 3ZCZA 2Y4AA 1VB6A 5CEBA 5IS1A 5CX7A 1ES3A 4GDNA 2HPBA 3GDIA 3E2LA 2ZMAA 5HDDA 1DJAA 3B47A 1T18A 1MPLA 2RL3A 3NDGA 4EU0A 4I3IA 5AQBA 4R1GA 4HEFA 2LB5A 3CZDA 1JTGA 3MFXA 4K08A 1BTLA 5DVAA 3IT9A 3NY4A 3OCNA 4X1MA 2Y2QA 3E2KA 3C5AA 3D3OA 3ZQ5A 1ONGA 4WM9A 4WZ4A 3UO9A 5EE8A 5HAQA 4EESA 1PIOA 4EQ1A 4HQAA 2WKPA 1TF1A 3IQAA 3W8KA 2ZQCA 2J3TC 5F1FA 2V1AA 3TRCA 4P6BA 5DF7A 5M19A 1M6KA 4DJ2A 3ZFZA 4QB8A 3FKVA 3MR0A 1WA9A 2VEAA 4EV4A 2B02A 3T50A 4HOIA 4OOLA 5DF8A 2JKTI 4FH2A 2ZBBA 3GSGA 2QKPA 3T4SA 4Y13A 1BLSA 1IYSA 5DJUA 1FSYA 1SKOB 4KZ8A 5HSQA 3RJUA 3HL9A 3T4OA 3WS0A 2VGLS 3BRMA 4KG6A 4R70A 1VETA 3GR2A 3MZDA 3NCKA 2MJ6A 3MS6A 4IHQA 4GB7A 4S2KA 3IHBA 4X69A 1ONHA 1ES5A 2PBDP 3EQVA 3BQAA 3HLFA 1V9YA 4HI4A 3GRJA 1Z09A 2ZQ9A 4KQOA 4BJPA 2BASA 5HWTA 4Y2FA 4GS9A 4OP5A 3R7WB 5DFYA 2CMNA 4BMWA 2W0NA 2HDUA 3VE3A 3ZG8B 5FI2A 2JKGA 5KSHA 1GCEA 3MQOA 1IFQA 5EM1A 3VOZA 1JWVA 4UEYA 4H6JA 4C3QA 1SKFA 5HARA 4F3LA 4CQHA 2IWBA 2ZD8A 2WGVA 1EI5A 5AQ7A 2H5SA 3M6BA 3KSHA 1YLWA 3MXQA 4WMCA 1UWPX 1EWZA 3ICYA 2VLGA 4HY8A 2JBFA 2EA9A 4U0XA 4M4XA 1KE3A 2EX6A 4ZJ3A 3CG5A 3C30A 1YLPA 1N9NA 4GW9A 5FA7A 3KX0X 4LRYC 2JCHA 3OOVA 4WEKA 3TJZC 4E3JA 5AQAA 4E3NA 2ZMFA 5CEDA 4EBPA 5HAIA 4JLFA 3F1NB 2JKFA 5J4EA 2R9WA 1DRMA 4KZBA 4WBGA 4DRTA 5F83A 1YLZA 4D60A 4BL2A 4LCMA 4NXGA 3CLOA 2KLIA 3V3SA 1HZOA 3A3JA 3T1SA 2PYRA 3MQQA 3PTEA 3OPHA 3W4QA 4GHIB 4B88A 5F69A 1J9MA 1IYOA 4FOFA 4KQRA 5HW3A 3NDEA 4RVAA 1IYQA 1W79A 3ITBA 4KG5A 4Q0HA 4WLAA 5CTNA 4HJ3A 1LL5A 3O86A 1VETB 3E4OA 1L0EA 1PW8A 1FQGA 3L9KA 4ZTKA 5HD5A 1MWTA 4MEZA 4H8RA 4UA6A 1L3LA 3B33A 3ZG7B 3LCEA 3NOTC 2JN7A 5EUAA 4M3KA 4B9OA 3KSGA 4N1HA 5KSCA 1W7FA 2LB9A 2HP6A 3MXRA 5F82A 5E2EA 5J7EA 3HLGA 5AQ9A 4MCWA 3D4FA 2VV8A 1IEMA 3SH8A 4GJ4A 4EWFA 1JVJA 5IT5A 1NYMA 3BJNA 2V8FA 1XFQA 2HGVA 3S7NA 2XRNA 3CI6A 3QNCA 1GHPA 1PZOA 1I5QA 1N9BA 3KSIA 2B5RA 3WRZA 2VGKA 3P09A 4ME4A 3BFDA 1KDSA 4JBFA 4LLOB 1DY6A 1O7EA 2W27A 3HJKA 5GHXA 1YSPA 2W1TA 3Q7ZA 3VSLA 2P04A 3C38A 3V50A 4S2IA 2XF3A 2Z6CA 4RYEA 2JKRM 5FI6A 3MKEA 1D06A 3LICA 1OPXA 3PBQA 4Y3IA 3C4OA 2R78A 3C7VA 5F5YA 3B3XA 4EETB 2W1RA 5F6AA 1X0OA 3A3FA 3F1OA 2EFUA 4Y0UA 4NXFA 3G32A 4ETXA 1CK3A 4WZ5A 3PR6A 2A24A 4Z1WA 3L7HA 5DKKA 4OKPA 2OV5A 1STZA 5U47A 1BLCA 4BLMA 4EBLA 2V0UA 3NOPC 5EVEA 1QMFA 5CHUA 3UE3A 4QPRA 2QYBA 4XUXA 3C4PA 3CPTA 1ERQA 4JXSA 4GD6A 2PR6A 4E6WA 2M1CA 4QY6A 3LY4A 4KZ4A 4WF0A 4P87A 3V67A 2EX2A 2GNXA 2KDKA 1H0MA 4JGPA 4N92A 4EEUA 3H7WA 3LR4A 2QWSA 1W8QA 4JF5A 4YNRA 1ALQA 2A2LA 3NHQA 4GLQA 1K57A 2HP5A 2Z2LB 4KZ6A 3QP8A 5EOOA 3UB8A 1XKZA 2WAEA 2E8JA 2J8YA 4I3AA 1PWCA 5GHYA 2R9XA 1HTZA 5M1AA 3E0YA 2P7JA 2XFTA 3ZVWA 4CLCD 2HZ5A 4EUZA 4AFIA 4LGWA 2ZL1B 4U0TA 3DTIA 3QP6A 4RA7A 1VHMA 4PM6A 5L07A 2WADA 2Y2IA 3LUQA 1PRQA 2V9AA 3P01A 4ARZA 1TDLA 4Q0IA 5CRFA 4BQMA 1VEUA 2O99A 4EBNA 2PRFA 3LIDA 3MZEA 3A0SA 1E3UA 4X53A 1KVMA 3LIAA 4Y5FA 3T4KA 1SZVA 4NXEA 5FATA 1NRFA 4NEED 3LIFA 3CITA 3IF6A 1DP6A 4HHDA 1KE4A 4FSFA 4OLDA 2XA7M 5HL1A 1S67L 4G3VA 4S2OA 1IYPA 3A3DA 4HJ4A 2QHKA 4KZ5A 2X02A 5F1GA 2QPNA 4Y0TA 2WKHA 5EECA 3VP0A 4S2NA 2V8CA 3KYEA 4KG2A 4ETZA 1W63M 1UWNX 2JKRI 3EOIA 1IOUA 1K56D 4QU3A 2XA7S 1XGIA 4X25A 3OPPA 5FDSA 3HVFA 5GLAA 3WS4A 4GDBA 1G6OA 1K6SA 1CEGA 3E98A 1LT0A 5CHMA 3VP1A 4P85A 1RP5A 2O0YA 2L0WA 1JWZA 4ESPA 1T1CA 4NXBA 4KZ3A 1PW1A 2Y2GA 5F68A 1FILA 5L2FA 1BUEA 3GMWA 4JGQA 4DJ3A 3Q82A 2D02A 5DJTA 4WUJA 4S2MA 4NETA 1S4SA 4CLCB 1K54C 1XFNA 1S1YA 2Y2HA 5FL3A 4LRXC 3LR0A 3A3EA 1H8MA 3UB5P 4Y7PA 4E3LA 5L8MA 1YQSA 3PBNA 3MFDA 4KUKA 3JVVA 5CGWA 4DE3A 5DTSA 2BTFP 4OP8A 4G3KA 2ZM8A 2ZM0A 2ZMVA 1HVBA 5M18A 1VEUB 3SZTA 1K55C 3HUOA 2K31A 4YOFA 3S7QA 5E43A 1NY0A 5C5KA 5D3OA 2VGLM 2WZZA 3KSFA 1XJ6A 2VV7A 3PAEA 4PHTA 4CJNA 1YMXA 4IEDA 3LYXA 1G6AA 3BY8A 1BLPA 4ZBEA 3BECA 4JF4A 1ES4A 3N4IA 2EX9A 5EVIA 1W63Q 2XDMA 2Q9NA 3PAGA 1GHIA 1ESIA 1F9IA 2CC1A 4NG2A 1NYYA 1G5UA 1V9ZA 5DF9A 3PYPA 4U3TA 2VA0A 5HWVA 4K0XA 1RGZA 4JXVA 2XD1A 1TDGA 4X55A 3TG9A 3NIAA 5GHZA 1NLZA 3MJQA 3SS3A 1T1AA 1U60A 1PI5A 1YLTA 1LSWA 2Y2JA 5A90A 1S66L 1VQQA 5FQ9A 3C2WA 3CUEC 5CHJA 4EERA 4KQDA 5FAPA 3VOYA 3OPLA 4QJGA 3Q7VB 1EW0A 1H3QA 5A91A 1D7EA 1W8YA 3ZVTA 5CGSA 4OQIA 3T12B 2ZOIA 3ISGA 3MF0A 3G2YA 1LI9A 2PU2A 2EWVA 1WE4A 1TS0A 2ACGA 2B18A 1S6RA 4LV1A 3SW1A 3O88A 4HJ6A 1PFLA 4GKUA 3OBFA 1XPBA 4ZRRA 4HP9A 3LI9A 4IUKA 3G35A 1WYBA 3NOUC 4WMCD 1YKDA 5GLCA 3C7UA 3UMEA 4DE0A 4YFMA 2O9CA 2BG1A 2RCXA 4N9LA 1ODVA 2M7VA 1HLUP 2E8IA 3M2KA 3VFFA 5AVFA 1ES2A 2WKQA 2QJ7A 2W3HA 3D9YA 4K0WA 3NECA 2XEPA 3OC2A 1L0DA 1GSXA 3RH8B 5FDHA 3TW8A 2V20A 3DWKA 4I39A 5DKLA 2W3DA 3BWLA 1JNUA 1F5MA 1MXOA 4OOMA 4S2JA 3K3DA
chains in the Genus database with same CATH topology
4Y0UA 1NZOA 3IXDA 4ZDXA 1TVFA 1I2WA 5EVID 3G32A 3IF6B 1CK3A 4WZ5A 1G68A 3ITAA 1LHYA 4CPKA 2ZQDA 4UAAA 1BT5A 3IXGA 4OPRA 3V3RA 4OKPA 4Z9QA 2OV5A 4R3JA 5U47A 1MWSA 1BLCA 2ZC4B 5E2FA 4BLMA 4GN2A 3NBLA 1CI8A 4EBLA 1L2SA 3MKFA 4KQQA 3RXWA 1K4EA 3GV9A 5TR7A 5I94A 2XD5A 1QMFA 5CHUA 4MBHA 1ERMA 3UE3A 1H8ZA 4GZBA 3P98A 3BFCA 2Y2LA 3QHYA 5EVIB 1L0FA 4ZAMA 3WWXA 2IWDA 2H10A 4GD8A 4IBRA 3VSKA 3M2JA 1Y54A 2Y91A 4XUXA 3WS2A 5KZHA 2WGWA 3C4PA 3W4OA 1LI0A 2ZC3B 3IF5A 1ERQA 5IHVA 2IWCA 3GQZA 4GD6A 4JXSA 1BSGA 3ZDJA 3HLEA 5J8XA 5JYOA 2DNSA 4E6WA 2J7VA 4QY6A 3S22A 3N8LA 3LY4A 4KZ4A 5EOEA 1YLJA 3IWIA 4P87A 5DTKA 2EX2A 3SOIA 3BLSA 1DJCA 2EX8A 2HDRA 4JF6A 2XGNA 4N92A 1SCWA 5EVLA 1XA7A 1W8QA 4JF5A 3HUNA 4X68A 4R23A 2ZQAA 1ALQA 1K4FA 1KGEA 3Q7VA 3N7WA 4GOGA 1K57A 3HUMA 1S0WA 4DE1A 3UDIA 3UDFA 2HP5A 2Y59A 3N6IA 3G4PA 2H0TA 2Z2LB 5TGFA 4KZ6A 3UPNA 2V2FF 4E6XA 2XK1A 3FWLA 2Y2OA 2WZXA 4JPMA 5TFQA 1XX2A 4WZ5C 1NXYA 3FZCA 3PBSA 4R4SA 5EOOA 5E2HA 1XKZA 2WAEA 3PBTA 4LV3A 3HLDA 4X6TA 3BFFA 2J8YA 3VP3A 3ZCZA 2Y4AA 3BM6A 3LEZA 1PWCA 5FI7A 2R9XA 1HTZA 5GHYA 3UN7A 4S2LA 5M1AA 1XXMA 4PM5A 5CEBA 4OH0A 2XFTA 3ZVWA 4LV0A 4MBKA 1ES3A 5GLBA 1W5DA 4EUZA 4GDNA 2HPBA 2J9PA 3E2LA 4U0TA 2ZMAA 4RA7A 4XUZA 4PM6A 1GA9A 3IXHA 3BYDA 3G31A 3FKWA 2WAFA 3PBRA 3IWQA 3SS5A 1DJAA 4BL3A 3Q81A 5HFOA 4BD0A 1MPLA 2WADA 2RL3A 3NDGA 2Y2IA 3DW0A 3OCLA 4OOYA 4F94A 1TDLA 4S2JA 5CRFA 5AQBA 3VMAA 4BQMA 4R1GA 4JXWA 4HEFA 1C3BA 4DE2A 1FR6A 1YT4A 3CZDA 1JTGA 4OQ0A 3DTMA 1M40A 5DVAA 1BTLA 2X71A 3IT9A 3NY4A 4EBNA 3OCNA 1BULA 3IWOA 2Y2QA 3EQUA 3E2KA 1GHMA 1K57C 3AGEA 3C5AA 3MZEA 1ONGA 4WM9A 4WZ4A 4B4XA 1ZKJA 1E3UA 2EFXA 2ZJ9A 3UO9A 2P9VA 3I7JA 5FQIA 5EE8A 4LCLA 4E3OA 5HAQA 1PIOA 2ZC7A 4X53A 1OMEA 1KVMA 3IQAA 3W8KA 2ZQCA 3TSGA 1Q2QA 3GTCA 1BLHA 3ZNTA 1HD8A 3Q1FA 4OONA 5F1FA 2WKIA 4C75A 1H8YA 2P74A 4P6BA 5FATA 5DF7A 5M19A 1M6KA 1NRFA 3ZFZA 4QB8A 3FKVA 3IF6A 4LV2A 3HLBA 1KE4A 4EV4A 4FSFA 4OLDA 5HL1A 1ZC2A 4OOLA 5DF8A 1FSWA 1MBLA 1GA0A 1E25A 2Y2PA 4S2OA 1IYPA 3A3DA 4FH2A 3M6HA 3GSGA 2HP9A 1SHVA 2HDSA 4DKIA 5HAPA 3HLCA 4OPZA 4KZ5A 2X02A 1BLSA 1IYSA 1FSYA 5F1GA 2QPNA 4Y0TA 1K6RA 4KZ8A 1MWUA 2WKHA 3IH9A 5EECA 3RJUA 3VP0A 5CXWA 3HL9A 4S2NA 4WYYA 5FAQA 3WS0A 4KG2A 4DDSA 1I2SA 3BRMA 4KG6A 5BOHA 5GLDA 4GNUA 3SH9A 1Q2PA 4OVDA 4JKTA 3GR2A 3MZDA 5FQKA 3NCKA 4PPRA 1K56D 2FFYA 4GB7A 1ZG6A 1K54A 2Q9MA 4QU3A 4S2KA 3IHBA 4X69A 1ONHA 1XGIA 4IVKA 1ES5A 2PBYA 3OPPA 2WKEA 3EQVA 3HVFA 3HLFA 2OLVA 4RX3A 5GLAA 3WS4A 1E4DA 3GRJA 4GDBA 1K6SA 1CEGA 2JC7A 1LLBA 4LENA 2ZQ9A 3G34A 1QMEA 4KQOA 3MBZA 5CHMA 3VP1A 2XH9A 4P85A 2I72A 1RP5A 4BJPA 4X56A 1JWZA 1PYYA 1IELA 1LL9A 3IF6C 3O87A 1PI4A 2G2UA 4OP5A 2ZQ8A 3NC8A 3IH8A 1K55A 4KZ3A 1PW1A 1Z6FA 2EXBA 2Y2GA 4L0LA 2BLSA 4R0QA 4MLLA 5L2FA 1BUEA 1PZPA 3GMWA 2HDUA 3V39A 1DJBA 4MBFA 3ZG8B 4E3KA 2Z2MB 4R3BA 4FH4A 3Q82A 3UY6A 5FI2A 4UHUA 5KSHA 1GCEA 1ZG4A 1CEFA 4S2NC 4UA7A 3UPPA 1JTDA 4S2MA 1KVLA 2Y2KA 5CECA 5HX9A 3VOZA 1JWVA 4NETA 4C3QA 3CMZA 3JYIA 1SKFA 5HARA 2XLNA 4XXRA 4D2OA 4HESA 4E3IA 1XGJA 1K54C 2IWBA 2ZD8A 4HBUA 2Y2HA 2XR0A 2GDNA 3Q07A 2WGVA 1EI5A 1IKGA 2EXAA 5AQ7A 2H5SA 3ZG5A 3M6BA 3A3EA 4NK3A 1YLWA 4Y7PA 1FR1A 2ZC5B 4WMCA 5FQJA 3WS5A 4E3LA 1EWZA 4PM9A 1O07A 2OLUA 1YQSA 2JBFA 3MFDA 3PBNA 5FSRA 4EQIA 5CGWA 4U0XA 4DE3A 5DTSA 1E3UD 1SDEA 2Y2MA 2WGIA 4OP8A 2ZM8A 1KE3A 2ZM0A 3UE1A 1PWDA 1HVBA 1CI9A 2EX6A 2J9OA 3OZHA 1K38A 3HLWA 4ZJ3A 3A3IA 3WS1A 5M18A 1FOFA 1K55C 3CG5A 3HUOA 4E3MA 1YLPA 3N8SA 4K91A 5E43A 1NY0A 4OPYA 5FA7A 4MNRA 3IXBA 5D3OA 3VP4A 5FAOA 2JCHA 3V5MA 1SDNA 2XQZA 4WEKA 3UE0A 4E3JA 5AQAA 4E3NA 2WZZA 3FV7A 3PAEA 4CJNA 1YMXA 5CEDA 3G2ZA 4EBPA 4C6YA 1FCMA 1KGFA 5HAIA 4IEDA 4JLFA 4S2PA 5GL9A 3S1YA 2R9WA 1G6AA 2UWXA 3AGDA 1VM1A 3O3VA 4JXGA 4BD1A 2Y55A 1BLPA 4KZBA 4ZBEA 4WBGA 4DRTA 3BECA 4JF4A 1ES4A 3CJMA 5F83A 3N4IA 3BEBA 2EX9A 1YLZA 1NJ4A 5EVIA 4BL2A 1YLYA 4LCMA 1RGYA 2XDMA 2Q9NA 3V3SA 1RCJA 1HZOA 1GHIA 3PAGA 3A3JA 1ESIA 4QY5A 1BZAA 1NZUA 3ZG9B 2CC1A 3PTEA 3OPHA 1NYYA 3W4QA 1XA1A 4B88A 5CGXA 5DF9A 1EROA 1J9MA 4U3TA 1IYOA 2QZ6A 2DRWA 4KQRA 3RXXA 4K0XA 1RGZA 5HW3A 3PBOA 3NDEA 4PMAA 4RVAA 2V1ZA 4JXVA 1IYQA 2XD1A 1W79A 1TDGA 4QHCA 3ITBA 4R4RA 4KG5A 4X55A 3TG9A 3W4PA 3VP2A 3GVBA 2VGJA 2WGWB 5CTNA 4DDYA 3NIAA 5GHZA 3SS3A 3TOIA 1KGGA 3IHAA 1LL5A 3O86A 4RX2A 1U60A 3HBRA 1L0EA 1PI5A 1YLTA 1PW8A 2Y2JA 5A90A 1FQGA 4UA9A 1K56A 3G30A 4ZTKA 2H0YA 1VQQA 1MWTA 4MEZA 4H8RA 5FQ9A 4ZJ2A 2XFSA 3QNBA 4UA6A 1KE0A 1WYCA 3LO7A 4HBTA 5CHJA 5FAPA 3VOYA 3OPLA 4KZ7A 4QJGA 3Q7VB 3ZG7B 5CTMA 5A91A 3LCEA 1W8YA 3ZVTA 5CGSA 3UNWA 4N1XA 4OQIA 5KMWA 1L0GA 5EUAA 2OSUA 4WEJA 3ISGA 4M3KA 4OQHA 1KDWA 4QD4A 4N1HA 4ZJ1A 2WYXA 5DTTA 1MWRA 1W7FA 3LY3A 5KSCA 5EVIC 3G2YA 4FD8A 4O7DA 1LI9A 2HP6A 2PU2A 3MXRA 5A92A 5F82A 1WE4A 5E2EA 3HLGA 5FASA 2QMIA 2Y2NA 1TEMA 5AQ9A 2A3UA 4IVIA 2WK0A 3NI9A 3D4FA 1IEMA 2PU4A 1S6RA 3SH8A 1PWGA 3S4XA 3VFHA 3O88A 1YMSA 3WRTA 3ZNYA 4BENA 4EWFA 1JVJA 4GKUA 1H5XA 4DF6A 1XPBA 3N8RA 1NYMA 4PM8A 4Q8IA 4ID4A 1JWPA 2WUQA 5E2GA 3AGFA 1ESUA 3DWZA 3MXSA 2G2WA 3SS4A 1N4OA 4IBXA 1IKIA 4Y0OA 3BFEA 3QNCA 4KENB 3G35A 1GHPA 2X01A 1WYBA 1PZOA 2A49A 4WMCD 1I5QA 3BLMA 1MKIA 1N9BA 1FCOA 4KZ9A 4YINA 3C7UA 5GLCA 4B4ZA 4DE0A 3HREA 2B5RA 5FQQA 4A5RA 3WRZA 2DCFA 4YFMA 2VGKA 3UDXA 3P09A 5FQMA 2C5WB 2BG1A 1AXBA 1KDSA 3BFDA 2RCXA 1FCNA 4JBFA 4WELA 4N9LA 1DY6A 1O7EA 4PM7A 1YM1A 5GHXA 5JYPA 2FFFB 2E8IA 3Q7ZA 3VSLA 4DXBA 3UPOA 3ZG0A 3M2KA 3VFFA 3V50A 4S2IA 2HDQA 2XF3A 2ZQ7A 3SH7A 1K25A 4P0MA 1XP4A 4RYEA 4KZAA 1ES2A 5FI6A 3MKEA 1MY8A 2P9VB 3MZFA 4OQGA 4K0WA 5A93A 3OC2A 2XEPA 3PBQA 1L0DA 2ZC6B 2ZM2A 3C4OA 4FCFA 5CERA 3C7VA 5FDHA 2V20A 3B3XA 3BFGA 4N9KA 2ZLYA 2C6WB 4OOMA 4OLGA 3DWKA 5G18A 4DXCA 5EPHA 3OPRA 4OPQA 3ZGAB 3ZHHA 3FYZA 2JE5A 1MXOA 3A3FA 2EFUA 4LV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y0U A;  1NZO A;  3IXD A;  4ZDX A;  1TVF A;  1I2W A;  5EVI D;  3G32 A;  3IF6 B;  1CK3 A;  4WZ5 A;  1G68 A;  3ITA A;  1LHY A;  4CPK A;  2ZQD A;  4UAA A;  1BT5 A;  3IXG A;  4OPR A;  3V3R A;  4OKP A;  4Z9Q A;  2OV5 A;  4R3J A;  5U47 A;  1MWS A;  1BLC A;  2ZC4 B;  5E2F A;  4BLM A;  4GN2 A;  3NBL A;  1CI8 A;  4EBL A;  1L2S A;  3MKF A;  4KQQ A;  3RXW A;  1K4E A;  3GV9 A;  5TR7 A;  5I94 A;  2XD5 A;  1QMF A;  5CHU A;  4MBH A;  1ERM A;  3UE3 A;  1H8Z A;  4GZB A;  3P98 A;  3BFC A;  2Y2L A;  3QHY A;  5EVI B;  1L0F A;  4ZAM A;  3WWX A;  2IWD A;  2H10 A;  4GD8 A;  4IBR A;  3VSK A;  3M2J A;  1Y54 A;  2Y91 A;  4XUX A;  3WS2 A;  5KZH A;  2WGW A;  3C4P A;  3W4O A;  1LI0 A;  2ZC3 B;  3IF5 A;  1ERQ A;  5IHV A;  2IWC A;  3GQZ A;  4GD6 A;  4JXS A;  1BSG A;  3ZDJ A;  3HLE A;  5J8X A;  5JYO A;  2DNS A;  4E6W A;  2J7V A;  4QY6 A;  3S22 A;  3N8L A;  3LY4 A;  4KZ4 A;  5EOE A;  1YLJ A;  3IWI A;  4P87 A;  5DTK A;  2EX2 A;  3SOI A;  3BLS A;  1DJC A;  2EX8 A;  2HDR A;  4JF6 A;  2XGN A;  4N92 A;  1SCW A;  5EVL A;  1XA7 A;  1W8Q A;  4JF5 A;  3HUN A;  4X68 A;  4R23 A;  2ZQA A;  1ALQ A;  1K4F A;  1KGE A;  3Q7V A;  3N7W A;  4GOG A;  1K57 A;  3HUM A;  1S0W A;  4DE1 A;  3UDI A;  3UDF A;  2HP5 A;  2Y59 A;  3N6I A;  3G4P A;  2H0T A;  2Z2L B;  5TGF A;  4KZ6 A;  3UPN A;  2V2F F;  4E6X A;  2XK1 A;  3FWL A;  2Y2O A;  2WZX A;  4JPM A;  5TFQ A;  1XX2 A;  4WZ5 C;  1NXY A;  3FZC A;  3PBS A;  4R4S A;  5EOO A;  5E2H A;  1XKZ A;  2WAE A;  3PBT A;  4LV3 A;  3HLD A;  4X6T A;  3BFF A;  2J8Y A;  3VP3 A;  3ZCZ A;  2Y4A A;  3BM6 A;  3LEZ A;  1PWC A;  5FI7 A;  2R9X A;  1HTZ A;  5GHY A;  3UN7 A;  4S2L A;  5M1A A;  1XXM A;  4PM5 A;  5CEB A;  4OH0 A;  2XFT A;  3ZVW A;  4LV0 A;  4MBK A;  1ES3 A;  5GLB A;  1W5D A;  4EUZ A;  4GDN A;  2HPB A;  2J9P A;  3E2L A;  4U0T A;  2ZMA A;  4RA7 A;  4XUZ A;  4PM6 A;  1GA9 A;  3IXH A;  3BYD A;  3G31 A;  3FKW A;  2WAF A;  3PBR A;  3IWQ A;  3SS5 A;  1DJA A;  4BL3 A;  3Q81 A;  5HFO A;  4BD0 A;  1MPL A;  2WAD A;  2RL3 A;  3NDG A;  2Y2I A;  3DW0 A;  3OCL A;  4OOY A;  4F94 A;  1TDL A;  4S2J A;  5CRF A;  5AQB A;  3VMA A;  4BQM A;  4R1G A;  4JXW A;  4HEF A;  1C3B A;  4DE2 A;  1FR6 A;  1YT4 A;  3CZD A;  1JTG A;  4OQ0 A;  3DTM A;  1M40 A;  5DVA A;  1BTL A;  2X71 A;  3IT9 A;  3NY4 A;  4EBN A;  3OCN A;  1BUL A;  3IWO A;  2Y2Q A;  3EQU A;  3E2K A;  1GHM A;  1K57 C;  3AGE A;  3C5A A;  3MZE A;  1ONG A;  4WM9 A;  4WZ4 A;  4B4X A;  1ZKJ A;  1E3U A;  2EFX A;  2ZJ9 A;  3UO9 A;  2P9V A;  3I7J A;  5FQI A;  5EE8 A;  4LCL A;  4E3O A;  5HAQ A;  1PIO A;  2ZC7 A;  4X53 A;  1OME A;  1KVM A;  3IQA A;  3W8K A;  2ZQC A;  3TSG A;  1Q2Q A;  3GTC A;  1BLH A;  3ZNT A;  1HD8 A;  3Q1F A;  4OON A;  5F1F A;  2WKI A;  4C75 A;  1H8Y A;  2P74 A;  4P6B A;  5FAT A;  5DF7 A;  5M19 A;  1M6K A;  1NRF A;  3ZFZ A;  4QB8 A;  3FKV A;  3IF6 A;  4LV2 A;  3HLB A;  1KE4 A;  4EV4 A;  4FSF A;  4OLD A;  5HL1 A;  1ZC2 A;  4OOL A;  5DF8 A;  1FSW A;  1MBL A;  1GA0 A;  1E25 A;  2Y2P A;  4S2O A;  1IYP A;  3A3D A;  4FH2 A;  3M6H A;  3GSG A;  2HP9 A;  1SHV A;  2HDS A;  4DKI A;  5HAP A;  3HLC A;  4OPZ A;  4KZ5 A;  2X02 A;  1BLS A;  1IYS A;  1FSY A;  5F1G A;  2QPN A;  4Y0T A;  1K6R A;  4KZ8 A;  1MWU A;  2WKH A;  3IH9 A;  5EEC A;  3RJU A;  3VP0 A;  5CXW A;  3HL9 A;  4S2N A;  4WYY A;  5FAQ A;  3WS0 A;  4KG2 A;  4DDS A;  1I2S A;  3BRM A;  4KG6 A;  5BOH A;  5GLD A;  4GNU A;  3SH9 A;  1Q2P A;  4OVD A;  4JKT A;  3GR2 A;  3MZD A;  5FQK A;  3NCK A;  4PPR A;  1K56 D;  2FFY A;  4GB7 A;  1ZG6 A;  1K54 A;  2Q9M A;  4QU3 A;  4S2K A;  3IHB A;  4X69 A;  1ONH A;  1XGI A;  4IVK A;  1ES5 A;  2PBY A;  3OPP A;  2WKE A;  3EQV A;  3HVF A;  3HLF A;  2OLV A;  4RX3 A;  5GLA A;  3WS4 A;  1E4D A;  3GRJ A;  4GDB A;  1K6S A;  1CEG A;  2JC7 A;  1LLB A;  4LEN A;  2ZQ9 A;  3G34 A;  1QME A;  4KQO A;  3MBZ A;  5CHM A;  3VP1 A;  2XH9 A;  4P85 A;  2I72 A;  1RP5 A;  4BJP A;  4X56 A;  1JWZ A;  1PYY A;  1IEL A;  1LL9 A;  3IF6 C;  3O87 A;  1PI4 A;  2G2U A;  4OP5 A;  2ZQ8 A;  3NC8 A;  3IH8 A;  1K55 A;  4KZ3 A;  1PW1 A;  1Z6F A;  2EXB A;  2Y2G A;  4L0L A;  2BLS A;  4R0Q A;  4MLL A;  5L2F A;  1BUE A;  1PZP A;  3GMW A;  2HDU A;  3V39 A;  1DJB A;  4MBF A;  3ZG8 B;  4E3K A;  2Z2M B;  4R3B A;  4FH4 A;  3Q82 A;  3UY6 A;  5FI2 A;  4UHU A;  5KSH A;  1GCE A;  1ZG4 A;  1CEF A;  4S2N C;  4UA7 A;  3UPP A;  1JTD A;  4S2M A;  1KVL A;  2Y2K A;  5CEC A;  5HX9 A;  3VOZ A;  1JWV A;  4NET A;  4C3Q A;  3CMZ A;  3JYI A;  1SKF A;  5HAR A;  2XLN A;  4XXR A;  4D2O A;  4HES A;  4E3I A;  1XGJ A;  1K54 C;  2IWB A;  2ZD8 A;  4HBU A;  2Y2H A;  2XR0 A;  2GDN A;  3Q07 A;  2WGV A;  1EI5 A;  1IKG A;  2EXA A;  5AQ7 A;  2H5S A;  3ZG5 A;  3M6B A;  3A3E A;  4NK3 A;  1YLW A;  4Y7P A;  1FR1 A;  2ZC5 B;  4WMC A;  5FQJ A;  3WS5 A;  4E3L A;  1EWZ A;  4PM9 A;  1O07 A;  2OLU A;  1YQS A;  2JBF A;  3MFD A;  3PBN A;  5FSR A;  4EQI A;  5CGW A;  4U0X A;  4DE3 A;  5DTS A;  1E3U D;  1SDE A;  2Y2M A;  2WGI A;  4OP8 A;  2ZM8 A;  1KE3 A;  2ZM0 A;  3UE1 A;  1PWD A;  1HVB A;  1CI9 A;  2EX6 A;  2J9O A;  3OZH A;  1K38 A;  3HLW A;  4ZJ3 A;  3A3I A;  3WS1 A;  5M18 A;  1FOF A;  1K55 C;  3CG5 A;  3HUO A;  4E3M A;  1YLP A;  3N8S A;  4K91 A;  5E43 A;  1NY0 A;  4OPY A;  5FA7 A;  4MNR A;  3IXB A;  5D3O A;  3VP4 A;  5FAO A;  2JCH A;  3V5M A;  1SDN A;  2XQZ A;  4WEK A;  3UE0 A;  4E3J A;  5AQA A;  4E3N A;  2WZZ A;  3FV7 A;  3PAE A;  4CJN A;  1YMX A;  5CED A;  3G2Z A;  4EBP A;  4C6Y A;  1FCM A;  1KGF A;  5HAI A;  4IED A;  4JLF A;  4S2P A;  5GL9 A;  3S1Y A;  2R9W A;  1G6A A;  2UWX A;  3AGD A;  1VM1 A;  3O3V A;  4JXG A;  4BD1 A;  2Y55 A;  1BLP A;  4KZB A;  4ZBE A;  4WBG A;  4DRT A;  3BEC A;  4JF4 A;  1ES4 A;  3CJM A;  5F83 A;  3N4I A;  3BEB A;  2EX9 A;  1YLZ A;  1NJ4 A;  5EVI A;  4BL2 A;  1YLY A;  4LCM A;  1RGY A;  2XDM A;  2Q9N A;  3V3S A;  1RCJ A;  1HZO A;  1GHI A;  3PAG A;  3A3J A;  1ESI A;  4QY5 A;  1BZA A;  1NZU A;  3ZG9 B;  2CC1 A;  3PTE A;  3OPH A;  1NYY A;  3W4Q A;  1XA1 A;  4B88 A;  5CGX A;  5DF9 A;  1ERO A;  1J9M A;  4U3T A;  1IYO A;  2QZ6 A;  2DRW A;  4KQR A;  3RXX A;  4K0X A;  1RGZ A;  5HW3 A;  3PBO A;  3NDE A;  4PMA A;  4RVA A;  2V1Z A;  4JXV A;  1IYQ A;  2XD1 A;  1W79 A;  1TDG A;  4QHC A;  3ITB A;  4R4R A;  4KG5 A;  4X55 A;  3TG9 A;  3W4P A;  3VP2 A;  3GVB A;  2VGJ A;  2WGW B;  5CTN A;  4DDY A;  3NIA A;  5GHZ A;  3SS3 A;  3TOI A;  1KGG A;  3IHA A;  1LL5 A;  3O86 A;  4RX2 A;  1U60 A;  3HBR A;  1L0E A;  1PI5 A;  1YLT A;  1PW8 A;  2Y2J A;  5A90 A;  1FQG A;  4UA9 A;  1K56 A;  3G30 A;  4ZTK A;  2H0Y A;  1VQQ A;  1MWT A;  4MEZ A;  4H8R A;  5FQ9 A;  4ZJ2 A;  2XFS A;  3QNB A;  4UA6 A;  1KE0 A;  1WYC A;  3LO7 A;  4HBT A;  5CHJ A;  5FAP A;  3VOY A;  3OPL A;  4KZ7 A;  4QJG A;  3Q7V B;  3ZG7 B;  5CTM A;  5A91 A;  3LCE A;  1W8Y A;  3ZVT A;  5CGS A;  3UNW A;  4N1X A;  4OQI A;  5KMW A;  1L0G A;  5EUA A;  2OSU A;  4WEJ A;  3ISG A;  4M3K A;  4OQH A;  1KDW A;  4QD4 A;  4N1H A;  4ZJ1 A;  2WYX A;  5DTT A;  1MWR A;  1W7F A;  3LY3 A;  5KSC A;  5EVI C;  3G2Y A;  4FD8 A;  4O7D A;  1LI9 A;  2HP6 A;  2PU2 A;  3MXR A;  5A92 A;  5F82 A;  1WE4 A;  5E2E A;  3HLG A;  5FAS A;  2QMI A;  2Y2N A;  1TEM A;  5AQ9 A;  2A3U A;  4IVI A;  2WK0 A;  3NI9 A;  3D4F A;  1IEM A;  2PU4 A;  1S6R A;  3SH8 A;  1PWG A;  3S4X A;  3VFH A;  3O88 A;  1YMS A;  3WRT A;  3ZNY A;  4BEN A;  4EWF A;  1JVJ A;  4GKU A;  1H5X A;  4DF6 A;  1XPB A;  3N8R A;  1NYM A;  4PM8 A;  4Q8I A;  4ID4 A;  1JWP A;  2WUQ A;  5E2G A;  3AGF A;  1ESU A;  3DWZ A;  3MXS A;  2G2W A;  3SS4 A;  1N4O A;  4IBX A;  1IKI A;  4Y0O A;  3BFE A;  3QNC A;  4KEN B;  3G35 A;  1GHP A;  2X01 A;  1WYB A;  1PZO A;  2A49 A;  4WMC D;  1I5Q A;  3BLM A;  1MKI A;  1N9B A;  1FCO A;  4KZ9 A;  4YIN A;  3C7U A;  5GLC A;  4B4Z A;  4DE0 A;  3HRE A;  2B5R A;  5FQQ A;  4A5R A;  3WRZ A;  2DCF A;  4YFM A;  2VGK A;  3UDX A;  3P09 A;  5FQM A;  2C5W B;  2BG1 A;  1AXB A;  1KDS A;  3BFD A;  2RCX A;  1FCN A;  4JBF A;  4WEL A;  4N9L A;  1DY6 A;  1O7E A;  4PM7 A;  1YM1 A;  5GHX A;  5JYP A;  2FFF B;  2E8I A;  3Q7Z A;  3VSL A;  4DXB A;  3UPO A;  3ZG0 A;  3M2K A;  3VFF A;  3V50 A;  4S2I A;  2HDQ A;  2XF3 A;  2ZQ7 A;  3SH7 A;  1K25 A;  4P0M A;  1XP4 A;  4RYE A;  4KZA A;  1ES2 A;  5FI6 A;  3MKE A;  1MY8 A;  2P9V B;  3MZF A;  4OQG A;  4K0W A;  5A93 A;  3OC2 A;  2XEP A;  3PBQ A;  1L0D A;  2ZC6 B;  2ZM2 A;  3C4O A;  4FCF A;  5CER A;  3C7V A;  5FDH A;  2V20 A;  3B3X A;  3BFG A;  4N9K A;  2ZLY A;  2C6W B;  4OOM A;  4OLG A;  3DWK A;  5G18 A;  4DXC A;  5EPH A;  3OPR A;  4OPQ A;  3ZGA B;  3ZHH A;  3FYZ A;  2JE5 A;  1MXO A;  3A3F A;  2EFU A;  4LV1 A; 
#chains in the Genus database with same CATH topology
 3D72 A;  1LSV A;  1NZO A;  1N9O A;  3IS2 A;  1I2W A;  1T1B A;  4CLC C;  1OT9 A;  1G68 A;  1LHY A;  4CPK A;  2ZQD A;  4UAA A;  1BT5 A;  1A0K A;  3MMH A;  4GN2 A;  1CI8 A;  3VV4 A;  1L2S A;  5TR7 A;  2XD5 A;  4MBH A;  1ERM A;  3BFC A;  1Y4O A;  5EVI B;  1L0F A;  5KZH A;  2WGW A;  1LI0 A;  2ZC3 B;  2OWH A;  5IHV A;  1BSG A;  3ZYT A;  3KYZ A;  5J8X A;  2DNS A;  2J7V A;  3S22 A;  2V0W A;  1YLJ A;  5DTK A;  3SOI A;  3BLS A;  2EX8 A;  2HDR A;  2XGN A;  3T1Q B;  3HUN A;  4R23 A;  2ZQA A;  1K4F A;  3A0R A;  4DE1 A;  2Y59 A;  3G4P A;  5AVE A;  3VOL A;  2GX5 A;  2V2F F;  2Y79 A;  2Y2O A;  4JPM A;  3O5Y A;  4GS9 B;  5FEF A;  2J3W A;  5E2H A;  3H9W A;  3BFF A;  1ACF A;  4HIA A;  3LEZ A;  3UN7 A;  3K3C A;  4S2L A;  1XXM A;  5EM0 A;  4PM5 A;  4OH0 A;  5IU1 A;  2L4R A;  2Y8H A;  4LV0 A;  2GJ3 A;  2J9P A;  4XUZ A;  3SS5 A;  3IWQ A;  4BL3 A;  5HFO A;  4H6J B;  4F94 A;  4F3L B;  1BYW A;  3VMA A;  4JXW A;  3QP4 A;  1MKM A;  1FR6 A;  1YT4 A;  4GCZ A;  2PAV P;  3HCY A;  4OQ0 A;  1GSW A;  4L9G A;  1BUL A;  3GEC A;  3IWO A;  3EQU A;  2H28 A;  5TBM A;  3AGE A;  2OAQ 1;  2EFX A;  2ZJ9 A;  4I3J A;  4WN5 A;  2P9V A;  1OJ5 A;  4NKP A;  1KOU A;  2O9A A;  3GTC A;  4C75 A;  1H8Y A;  3PXP A;  2O9B A;  4LV2 A;  4HH2 A;  4BBT A;  1LSX A;  1YPR A;  1MBL A;  3M6H A;  3HLC A;  4OPZ A;  3LR3 A;  5G4Z A;  3RTY A;  5FAQ A;  5L09 A;  4DDS A;  1OTI A;  5BOH A;  4GNU A;  2PD8 A;  1Q2P A;  4OVD A;  5FQK A;  2FFY A;  2XSS A;  2Q9M A;  2PBY A;  1OTA A;  2OLV A;  1E4D A;  4MN6 A;  2JC7 A;  4LEN A;  1QME A;  2XH9 A;  2I9V A;  2I72 A;  5K5B A;  1PYY A;  3DBA A;  1LL9 A;  2G2U A;  1N9L A;  2ZQ8 A;  3NC8 A;  3IH8 A;  3UB6 A;  1Z6F A;  4XT2 A;  2EXB A;  3UE6 A;  4L0L A;  2BLS A;  4MLL A;  4RQ9 A;  3NUL A;  2VJW A;  3BY9 A;  1DJB A;  4MBF A;  5L10 A;  4FH4 A;  3QP2 A;  3UY6 A;  4L9E A;  5J3W A;  1JTD A;  5HX9 A;  2M7U A;  3CMZ A;  3JYI A;  1YAX A;  3T4T A;  2XLN A;  4XXR A;  4D2O A;  4HES A;  4O01 A;  4EEP A;  2XR0 A;  3Q07 A;  2EXA A;  2Q0O A;  3ZG5 A;  4NK3 A;  4BBU A;  2ZC5 B;  5FQJ A;  3WS5 A;  4G3W A;  2OLU A;  5FSR A;  4EQI A;  1E3U D;  4FUW A;  3LIB A;  1SDE A;  2Z6D A;  4LRZ E;  2WGI A;  4X1L A;  3UE1 A;  1PWD A;  5HWW A;  1CI9 A;  2DMW A;  3WS1 A;  3UMD A;  4MN7 A;  2W1T B;  2W3F A;  4OPY A;  5G4Y A;  1P97 A;  5EFW A;  1SDN A;  2XQZ A;  3S7P A;  2IA2 A;  3G2Z A;  4C6Y A;  4JGR A;  4S2P A;  3S1Y A;  2UWX A;  3O3V A;  1VM1 A;  5HDC A;  3KYQ A;  3F1O B;  3T4L A;  3UB9 A;  1SKO A;  1YLY A;  5HZH A;  3C8C A;  1F2K A;  2A24 B;  4QY5 A;  1BZA A;  2GZA A;  1J3W A;  3ZG9 B;  1P9W A;  1NWZ A;  4E04 A;  1ERO A;  3LR5 A;  5HPF A;  1PNE A;  2QZ6 A;  3RXX A;  3EGD C;  3F1P A;  3BW6 A;  4PMA A;  2V1Z A;  4O0P A;  4QHC A;  3W4P A;  3GVB A;  2L1M A;  2VGJ A;  3CPT B;  2WKR A;  3PHY A;  1K56 A;  4ZJ2 A;  2XFS A;  3QNB A;  3R7W A;  3H7W B;  4Y17 A;  1WYC A;  4HBT A;  3UB7 A;  4OQH A;  1KDW A;  3G6O A;  4QD4 A;  1MWR A;  4FD8 A;  3LIE A;  5A92 A;  4IVI A;  2FZ0 A;  2WK0 A;  4LFU A;  2PU4 A;  1PWG A;  3VFH A;  1G28 A;  1H5X A;  5EV0 A;  4PM8 A;  4Q8I A;  4ID4 A;  1JWP A;  5E2G A;  2WUQ A;  3SS4 A;  3MXS A;  1N4O A;  4IBX A;  2OWJ A;  4QWO A;  2X01 A;  3CAX A;  1FCO A;  4KZ9 A;  3CWF A;  4B4Z A;  3HRE A;  5FQQ A;  2DCF A;  3UDX A;  4ARZ B;  5MC7 A;  5FQM A;  1AXB A;  3IX3 A;  1S1Z A;  4JGO A;  1YM1 A;  5JYP A;  4DXB A;  3ZG0 A;  3FPW A;  3A0V A;  1K25 A;  1XP4 A;  4KZA A;  2HF6 A;  1XJ3 A;  4HNB A;  2ZC6 B;  4KUO A;  3F1N A;  5CER A;  3BFG A;  4N9K A;  2ZLY A;  2C6W B;  4OLG A;  2YKF A;  4DXC A;  5EPH A;  3OPR A;  3ZHH A;  2P08 A;  3U2A A;  3FYZ A;  4II7 A;  3UE0 A;  4MDZ A;  2PT7 A;  2V1B A;  3IXD A;  4ZDX A;  1TVF A;  5EVI D;  3IF6 B;  4OPR A;  4Z9Q A;  3OLO A;  2ZC4 B;  4GHI A;  1OTD A;  4KQQ A;  3RXW A;  5I94 A;  1H8Z A;  3P98 A;  1TS6 A;  3QHY A;  3WWX A;  2IWD A;  2H10 A;  4GD8 A;  4IBR A;  3WS2 A;  3GQZ A;  1YSQ A;  1DP8 A;  5JYO A;  5EOE A;  4PAU A;  1LL8 A;  2INW A;  3F1P B;  4JF6 A;  1SCW A;  1XA7 A;  4EXO A;  4X68 A;  1FIK A;  2OOL A;  3N7W A;  2OAP 1;  1S0W A;  3UDI A;  3N6I A;  1UGU A;  4E6X A;  2XK1 A;  3FWL A;  4WZ5 C;  1NXY A;  2PDR A;  3PBT A;  4X6T A;  3VP3 A;  3BM6 A;  5FI7 A;  1Y28 A;  4MBK A;  5GLB A;  1W5D A;  3H82 A;  3CHW P;  1GA9 A;  3IXH A;  3BYD A;  1XJ2 A;  3G31 A;  1CJF A;  2W3E A;  2WAF A;  3FKW A;  3PBR A;  1NRJ A;  4R6L A;  3Q81 A;  1NLY A;  4BD0 A;  2UV0 E;  3DW0 A;  3OCL A;  2VV6 A;  4OOY A;  4Q0J A;  2PR5 A;  3VE4 A;  1S4R A;  1C3B A;  4DE2 A;  1P9R A;  2G7U A;  3DTM A;  1M40 A;  2X71 A;  2KX6 A;  2HJE A;  1GHM A;  1K57 C;  4B4X A;  1ZKJ A;  3I7J A;  2YKH A;  5FQI A;  4LCL A;  4E3O A;  2ZC7 A;  1OME A;  3NJA A;  3TSG A;  1Q2Q A;  1BLH A;  3ZNT A;  1HD8 A;  3Q1F A;  4OON A;  2WKI A;  2P74 A;  3DTK A;  3HLB A;  4O8G A;  1ZC2 A;  3LEQ A;  1FSW A;  1GA0 A;  1E25 A;  2Y2P A;  2EWW A;  1K0K A;  2HP9 A;  1SHV A;  2HDS A;  4DKI A;  5HAP A;  1K6R A;  1MWU A;  3IH9 A;  2FH5 A;  5CXW A;  4WYY A;  1ZTU A;  3LI8 A;  4I38 A;  1I2S A;  5GLD A;  2K7S A;  3SH9 A;  4JKT A;  4PPR A;  3RFB A;  4BWI A;  1ZG6 A;  2VK3 A;  3JPU A;  1K54 A;  3T1R A;  3W2Z A;  4IVK A;  2K2N A;  5HL6 A;  2WKE A;  4RX3 A;  4YWZ A;  4R38 A;  1MZU A;  1LLB A;  3G34 A;  3MBZ A;  2JHE A;  4X56 A;  1IEL A;  3IF6 C;  3O87 A;  1PI4 A;  4MN5 A;  1K55 A;  2J3T D;  4R0Q A;  3IX8 A;  2QJ5 A;  1GSV A;  1PZP A;  3V39 A;  4E3K A;  2Z2M B;  4R3B A;  2ZL1 A;  4UHU A;  2B95 A;  1ZG4 A;  1CEF A;  3KO6 A;  4DMZ A;  4S2N C;  4UA7 A;  3FG8 A;  3UPP A;  3ULF A;  1KVL A;  2Y2K A;  5CEC A;  3HJI A;  2VZW A;  4E3I A;  1XGJ A;  4HBU A;  4I5S A;  2GDN A;  1IKG A;  4PKY G;  3H82 B;  3P7N A;  2NUT C;  1D1J A;  5FEG A;  1FR1 A;  4PM9 A;  1O07 A;  2Y2M A;  2NUP C;  3OZH A;  2J9O A;  1K38 A;  3HLW A;  1F98 A;  3A3I A;  1FOF A;  4E3M A;  3N8S A;  2VX8 A;  4K91 A;  4CLC E;  4MNR A;  3IXB A;  3VP4 A;  5FAO A;  5A8B A;  3V5M A;  1ZHH B;  4IUH A;  2XRO A;  3FV7 A;  1FCM A;  1KGF A;  3CUE A;  3FPV A;  2KOI A;  4BBV A;  5GL9 A;  3AGD A;  4JXG A;  3R4K A;  4BD1 A;  2Y55 A;  3T4Q A;  1T19 A;  3CJM A;  3IS2 B;  3BEB A;  1NJ4 A;  1RGY A;  3MSH A;  1RCJ A;  1NZU A;  1XA1 A;  5CGX A;  3IX4 A;  3JVU A;  1XJ4 A;  2DRW A;  3PBO A;  3DTE A;  4R4R A;  3VP2 A;  2WGW B;  3DAV A;  3B42 A;  4DDY A;  3TOI A;  1KGG A;  3IHA A;  2VKS A;  4RX2 A;  3HBR A;  4UA9 A;  3G30 A;  2H0Y A;  4B93 A;  2HV1 A;  1KE0 A;  3LO7 A;  1DP9 A;  3E4Q A;  4KZ7 A;  2W3G A;  4FTX A;  5CTM A;  1TS8 A;  3UNW A;  4N1X A;  5KMW A;  1L0G A;  2OSU A;  5LBR A;  4WEJ A;  4WL9 A;  4ZJ1 A;  2WYX A;  5DTT A;  3LY3 A;  5EVI C;  4O7D A;  5FAS A;  2QMI A;  2Y2N A;  1TEM A;  3QP5 A;  2A3U A;  4LPZ A;  1TD5 A;  3NI9 A;  3EEA A;  2D01 A;  3E4P A;  3S4X A;  3WRT A;  1YMS A;  3ZNY A;  3BQ8 A;  4BEN A;  3MQ0 A;  4CLC A;  4DF6 A;  3N8R A;  3TE8 A;  3AGF A;  1ESU A;  3DWZ A;  2G2W A;  4DN0 A;  4Y0O A;  1IKI A;  3BFE A;  1OTE A;  4KEN B;  2ZOH A;  4PKY A;  2HJ9 C;  2A49 A;  4EUV A;  3BLM A;  1MKI A;  4YIN A;  3EEH A;  3EWK A;  2JKT M;  4A5R A;  2C5W B;  5TJJ A;  5HDS A;  1FCN A;  1P0Z A;  3LFV A;  4PM7 A;  4UQI M;  2FFF B;  4MMN A;  5I5L A;  3UPO A;  3FC7 A;  3SH7 A;  2HDQ A;  5TBM B;  2ZQ7 A;  4L9F A;  2J80 A;  4P0M A;  3EGX C;  3T4J A;  1MY8 A;  2P9V B;  3MZF A;  4OQG A;  2AVX A;  3QP1 A;  2PD7 A;  5A93 A;  4P6Z M;  2ZM2 A;  3S7O A;  5HPI A;  4FCF A;  4HP4 A;  5G18 A;  4OPQ A;  5DFX A;  3ZGA B;  1TS7 A;  2JE5 A;  4WEL A;  1AWI A;  5AJG A;  4UQI S;  3ITA A;  3IXG A;  1CF0 A;  3V3R A;  2PYP A;  4R3J A;  1MWS A;  5E2F A;  3T1X A;  4Y15 A;  3NBL A;  3MKF A;  3K2N A;  1K4E A;  3GV9 A;  3IBJ A;  3IBR A;  1MC0 A;  4GZB A;  5KIZ A;  4P6Z S;  2Y2L A;  4ZAM A;  1OTB A;  1OT6 A;  3VSK A;  3M2J A;  1Y54 A;  2Y91 A;  4EW7 A;  3W4O A;  3IF5 A;  2IWC A;  2PHY A;  1CQA A;  3ZDJ A;  3HLE A;  4IJG A;  3N8L A;  3IWI A;  4R3A A;  1DJC A;  5EVL A;  5HD3 A;  1KGE A;  3Q7V A;  4GOG A;  3HUM A;  3UDF A;  2H0T A;  5TGF A;  3UPN A;  5TFQ A;  2WZX A;  1XX2 A;  3FZC A;  3PBS A;  4R4S A;  1OJG A;  4HH3 A;  4XT2 B;  3LGO A;  3U4L P;  4LV3 A;  3HLD A;  3ZCZ A;  2Y4A A;  1VB6 A;  5CEB A;  5IS1 A;  5CX7 A;  1ES3 A;  4GDN A;  2HPB A;  3GDI A;  3E2L A;  2ZMA A;  5HDD A;  1DJA A;  3B47 A;  1T18 A;  1MPL A;  2RL3 A;  3NDG A;  4EU0 A;  4I3I A;  5AQB A;  4R1G A;  4HEF A;  2LB5 A;  3CZD A;  1JTG A;  3MFX A;  4K08 A;  1BTL A;  5DVA A;  3IT9 A;  3NY4 A;  3OCN A;  4X1M A;  2Y2Q A;  3E2K A;  3C5A A;  3D3O A;  3ZQ5 A;  1ONG A;  4WM9 A;  4WZ4 A;  3UO9 A;  5EE8 A;  5HAQ A;  4EES A;  1PIO A;  4EQ1 A;  4HQA A;  2WKP A;  1TF1 A;  3IQA A;  3W8K A;  2ZQC A;  2J3T C;  5F1F A;  2V1A A;  3TRC A;  4P6B A;  5DF7 A;  5M19 A;  1M6K A;  4DJ2 A;  3ZFZ A;  4QB8 A;  3FKV A;  3MR0 A;  1WA9 A;  2VEA A;  4EV4 A;  2B02 A;  3T50 A;  4HOI A;  4OOL A;  5DF8 A;  2JKT I;  4FH2 A;  2ZBB A;  3GSG A;  2QKP A;  3T4S A;  4Y13 A;  1BLS A;  1IYS A;  5DJU A;  1FSY A;  1SKO B;  4KZ8 A;  5HSQ A;  3RJU A;  3HL9 A;  3T4O A;  3WS0 A;  2VGL S;  3BRM A;  4KG6 A;  4R70 A;  1VET A;  3GR2 A;  3MZD A;  3NCK A;  2MJ6 A;  3MS6 A;  4IHQ A;  4GB7 A;  4S2K A;  3IHB A;  4X69 A;  1ONH A;  1ES5 A;  2PBD P;  3EQV A;  3BQA A;  3HLF A;  1V9Y A;  4HI4 A;  3GRJ A;  1Z09 A;  2ZQ9 A;  4KQO A;  4BJP A;  2BAS A;  5HWT A;  4Y2F A;  4GS9 A;  4OP5 A;  3R7W B;  5DFY A;  2CMN A;  4BMW A;  2W0N A;  2HDU A;  3VE3 A;  3ZG8 B;  5FI2 A;  2JKG A;  5KSH A;  1GCE A;  3MQO A;  1IFQ A;  5EM1 A;  3VOZ A;  1JWV A;  4UEY A;  4H6J A;  4C3Q A;  1SKF A;  5HAR A;  4F3L A;  4CQH A;  2IWB A;  2ZD8 A;  2WGV A;  1EI5 A;  5AQ7 A;  2H5S A;  3M6B A;  3KSH A;  1YLW A;  3MXQ A;  4WMC A;  1UWP X;  1EWZ A;  3ICY A;  2VLG A;  4HY8 A;  2JBF A;  2EA9 A;  4U0X A;  4M4X A;  1KE3 A;  2EX6 A;  4ZJ3 A;  3CG5 A;  3C30 A;  1YLP A;  1N9N A;  4GW9 A;  5FA7 A;  3KX0 X;  4LRY C;  2JCH A;  3OOV A;  4WEK A;  3TJZ C;  4E3J A;  5AQA A;  4E3N A;  2ZMF A;  5CED A;  4EBP A;  5HAI A;  4JLF A;  3F1N B;  2JKF A;  5J4E A;  2R9W A;  1DRM A;  4KZB A;  4WBG A;  4DRT A;  5F83 A;  1YLZ A;  4D60 A;  4BL2 A;  4LCM A;  4NXG A;  3CLO A;  2KLI A;  3V3S A;  1HZO A;  3A3J A;  3T1S A;  2PYR A;  3MQQ A;  3PTE A;  3OPH A;  3W4Q A;  4GHI B;  4B88 A;  5F69 A;  1J9M A;  1IYO A;  4FOF A;  4KQR A;  5HW3 A;  3NDE A;  4RVA A;  1IYQ A;  1W79 A;  3ITB A;  4KG5 A;  4Q0H A;  4WLA A;  5CTN A;  4HJ3 A;  1LL5 A;  3O86 A;  1VET B;  3E4O A;  1L0E A;  1PW8 A;  1FQG A;  3L9K A;  4ZTK A;  5HD5 A;  1MWT A;  4MEZ A;  4H8R A;  4UA6 A;  1L3L A;  3B33 A;  3ZG7 B;  3LCE A;  3NOT C;  2JN7 A;  5EUA A;  4M3K A;  4B9O A;  3KSG A;  4N1H A;  5KSC A;  1W7F A;  2LB9 A;  2HP6 A;  3MXR A;  5F82 A;  5E2E A;  5J7E A;  3HLG A;  5AQ9 A;  4MCW A;  3D4F A;  2VV8 A;  1IEM A;  3SH8 A;  4GJ4 A;  4EWF A;  1JVJ A;  5IT5 A;  1NYM A;  3BJN A;  2V8F A;  1XFQ A;  2HGV A;  3S7N A;  2XRN A;  3CI6 A;  3QNC A;  1GHP A;  1PZO A;  1I5Q A;  1N9B A;  3KSI A;  2B5R A;  3WRZ A;  2VGK A;  3P09 A;  4ME4 A;  3BFD A;  1KDS A;  4JBF A;  4LLO B;  1DY6 A;  1O7E A;  2W27 A;  3HJK A;  5GHX A;  1YSP A;  2W1T A;  3Q7Z A;  3VSL A;  2P04 A;  3C38 A;  3V50 A;  4S2I A;  2XF3 A;  2Z6C A;  4RYE A;  2JKR M;  5FI6 A;  3MKE A;  1D06 A;  3LIC A;  1OPX A;  3PBQ A;  4Y3I A;  3C4O A;  2R78 A;  3C7V A;  5F5Y A;  3B3X A;  4EET B;  2W1R A;  5F6A A;  1X0O A;  3A3F A;  3F1O A;  2EFU A;  4Y0U A;  4NXF A;  3G32 A;  4ETX A;  1CK3 A;  4WZ5 A;  3PR6 A;  2A24 A;  4Z1W A;  3L7H A;  5DKK A;  4OKP A;  2OV5 A;  1STZ A;  5U47 A;  1BLC A;  4BLM A;  4EBL A;  2V0U A;  3NOP C;  5EVE A;  1QMF A;  5CHU A;  3UE3 A;  4QPR A;  2QYB A;  4XUX A;  3C4P A;  3CPT A;  1ERQ A;  4JXS A;  4GD6 A;  2PR6 A;  4E6W A;  2M1C A;  4QY6 A;  3LY4 A;  4KZ4 A;  4WF0 A;  4P87 A;  3V67 A;  2EX2 A;  2GNX A;  2KDK A;  1H0M A;  4JGP A;  4N92 A;  4EEU A;  3H7W A;  3LR4 A;  2QWS A;  1W8Q A;  4JF5 A;  4YNR A;  1ALQ A;  2A2L A;  3NHQ A;  4GLQ A;  1K57 A;  2HP5 A;  2Z2L B;  4KZ6 A;  3QP8 A;  5EOO A;  3UB8 A;  1XKZ A;  2WAE A;  2E8J A;  2J8Y A;  4I3A A;  1PWC A;  5GHY A;  2R9X A;  1HTZ A;  5M1A A;  3E0Y A;  2P7J A;  2XFT A;  3ZVW A;  4CLC D;  2HZ5 A;  4EUZ A;  4AFI A;  4LGW A;  2ZL1 B;  4U0T A;  3DTI A;  3QP6 A;  4RA7 A;  1VHM A;  4PM6 A;  5L07 A;  2WAD A;  2Y2I A;  3LUQ A;  1PRQ A;  2V9A A;  3P01 A;  4ARZ A;  1TDL A;  4Q0I A;  5CRF A;  4BQM A;  1VEU A;  2O99 A;  4EBN A;  2PRF A;  3LID A;  3MZE A;  3A0S A;  1E3U A;  4X53 A;  1KVM A;  3LIA A;  4Y5F A;  3T4K A;  1SZV A;  4NXE A;  5FAT A;  1NRF A;  4NEE D;  3LIF A;  3CIT A;  3IF6 A;  1DP6 A;  4HHD A;  1KE4 A;  4FSF A;  4OLD A;  2XA7 M;  5HL1 A;  1S67 L;  4G3V A;  4S2O A;  1IYP A;  3A3D A;  4HJ4 A;  2QHK A;  4KZ5 A;  2X02 A;  5F1G A;  2QPN A;  4Y0T A;  2WKH A;  5EEC A;  3VP0 A;  4S2N A;  2V8C A;  3KYE A;  4KG2 A;  4ETZ A;  1W63 M;  1UWN X;  2JKR I;  3EOI A;  1IOU A;  1K56 D;  4QU3 A;  2XA7 S;  1XGI A;  4X25 A;  3OPP A;  5FDS A;  3HVF A;  5GLA A;  3WS4 A;  4GDB A;  1G6O A;  1K6S A;  1CEG A;  3E98 A;  1LT0 A;  5CHM A;  3VP1 A;  4P85 A;  1RP5 A;  2O0Y A;  2L0W A;  1JWZ A;  4ESP A;  1T1C A;  4NXB A;  4KZ3 A;  1PW1 A;  2Y2G A;  5F68 A;  1FIL A;  5L2F A;  1BUE A;  3GMW A;  4JGQ A;  4DJ3 A;  3Q82 A;  2D02 A;  5DJT A;  4WUJ A;  4S2M A;  4NET A;  1S4S A;  4CLC B;  1K54 C;  1XFN A;  1S1Y A;  2Y2H A;  5FL3 A;  4LRX C;  3LR0 A;  3A3E A;  1H8M A;  3UB5 P;  4Y7P A;  4E3L A;  5L8M A;  1YQS A;  3PBN A;  3MFD A;  4KUK A;  3JVV A;  5CGW A;  4DE3 A;  5DTS A;  2BTF P;  4OP8 A;  4G3K A;  2ZM8 A;  2ZM0 A;  2ZMV A;  1HVB A;  5M18 A;  1VEU B;  3SZT A;  1K55 C;  3HUO A;  2K31 A;  4YOF A;  3S7Q A;  5E43 A;  1NY0 A;  5C5K A;  5D3O A;  2VGL M;  2WZZ A;  3KSF A;  1XJ6 A;  2VV7 A;  3PAE A;  4PHT A;  4CJN A;  1YMX A;  4IED A;  3LYX A;  1G6A A;  3BY8 A;  1BLP A;  4ZBE A;  3BEC A;  4JF4 A;  1ES4 A;  3N4I A;  2EX9 A;  5EVI A;  1W63 Q;  2XDM A;  2Q9N A;  3PAG A;  1GHI A;  1ESI A;  1F9I A;  2CC1 A;  4NG2 A;  1NYY A;  1G5U A;  1V9Z A;  5DF9 A;  3PYP A;  4U3T A;  2VA0 A;  5HWV A;  4K0X A;  1RGZ A;  4JXV A;  2XD1 A;  1TDG A;  4X55 A;  3TG9 A;  3NIA A;  5GHZ A;  1NLZ A;  3MJQ A;  3SS3 A;  1T1A A;  1U60 A;  1PI5 A;  1YLT A;  1LSW A;  2Y2J A;  5A90 A;  1S66 L;  1VQQ A;  5FQ9 A;  3C2W A;  3CUE C;  5CHJ A;  4EER A;  4KQD A;  5FAP A;  3VOY A;  3OPL A;  4QJG A;  3Q7V B;  1EW0 A;  1H3Q A;  5A91 A;  1D7E A;  1W8Y A;  3ZVT A;  5CGS A;  4OQI A;  3T12 B;  2ZOI A;  3ISG A;  3MF0 A;  3G2Y A;  1LI9 A;  2PU2 A;  2EWV A;  1WE4 A;  1TS0 A;  2ACG A;  2B18 A;  1S6R A;  4LV1 A;  3SW1 A;  3O88 A;  4HJ6 A;  1PFL A;  4GKU A;  3OBF A;  1XPB A;  4ZRR A;  4HP9 A;  3LI9 A;  4IUK A;  3G35 A;  1WYB A;  3NOU C;  4WMC D;  1YKD A;  5GLC A;  3C7U A;  3UME A;  4DE0 A;  4YFM A;  2O9C A;  2BG1 A;  2RCX A;  4N9L A;  1ODV A;  2M7V A;  1HLU P;  2E8I A;  3M2K A;  3VFF A;  5AVF A;  1ES2 A;  2WKQ A;  2QJ7 A;  2W3H A;  3D9Y A;  4K0W A;  3NEC A;  2XEP A;  3OC2 A;  1L0D A;  1GSX A;  3RH8 B;  5FDH A;  3TW8 A;  2V20 A;  3DWK A;  4I39 A;  5DKL A;  2W3D A;  3BWL A;  1JNU A;  1F5M A;  1MXO A;  4OOM A;  4S2J A;  3K3D A; 
#chains in the Genus database with same CATH homology
 4Y0U A;  1NZO A;  3IXD A;  4ZDX A;  1TVF A;  1I2W A;  5EVI D;  3G32 A;  3IF6 B;  1CK3 A;  4WZ5 A;  1G68 A;  3ITA A;  1LHY A;  4CPK A;  2ZQD A;  4UAA A;  1BT5 A;  3IXG A;  4OPR A;  3V3R A;  4OKP A;  4Z9Q A;  2OV5 A;  4R3J A;  5U47 A;  1MWS A;  1BLC A;  2ZC4 B;  5E2F A;  4BLM A;  4GN2 A;  3NBL A;  1CI8 A;  4EBL A;  1L2S A;  3MKF A;  4KQQ A;  3RXW A;  1K4E A;  3GV9 A;  5TR7 A;  5I94 A;  2XD5 A;  1QMF A;  5CHU A;  4MBH A;  1ERM A;  3UE3 A;  1H8Z A;  4GZB A;  3P98 A;  3BFC A;  2Y2L A;  3QHY A;  5EVI B;  1L0F A;  4ZAM A;  3WWX A;  2IWD A;  2H10 A;  4GD8 A;  4IBR A;  3VSK A;  3M2J A;  1Y54 A;  2Y91 A;  4XUX A;  3WS2 A;  5KZH A;  2WGW A;  3C4P A;  3W4O A;  1LI0 A;  2ZC3 B;  3IF5 A;  1ERQ A;  5IHV A;  2IWC A;  3GQZ A;  4GD6 A;  4JXS A;  1BSG A;  3ZDJ A;  3HLE A;  5J8X A;  5JYO A;  2DNS A;  4E6W A;  2J7V A;  4QY6 A;  3S22 A;  3N8L A;  3LY4 A;  4KZ4 A;  5EOE A;  1YLJ A;  3IWI A;  4P87 A;  5DTK A;  2EX2 A;  3SOI A;  3BLS A;  1DJC A;  2EX8 A;  2HDR A;  4JF6 A;  2XGN A;  4N92 A;  1SCW A;  5EVL A;  1XA7 A;  1W8Q A;  4JF5 A;  3HUN A;  4X68 A;  4R23 A;  2ZQA A;  1ALQ A;  1K4F A;  1KGE A;  3Q7V A;  3N7W A;  4GOG A;  1K57 A;  3HUM A;  1S0W A;  4DE1 A;  3UDI A;  3UDF A;  2HP5 A;  2Y59 A;  3N6I A;  3G4P A;  2H0T A;  2Z2L B;  5TGF A;  4KZ6 A;  3UPN A;  2V2F F;  4E6X A;  2XK1 A;  3FWL A;  2Y2O A;  2WZX A;  4JPM A;  5TFQ A;  1XX2 A;  4WZ5 C;  1NXY A;  3FZC A;  3PBS A;  4R4S A;  5EOO A;  5E2H A;  1XKZ A;  2WAE A;  3PBT A;  4LV3 A;  3HLD A;  4X6T A;  3BFF A;  2J8Y A;  3VP3 A;  3ZCZ A;  2Y4A A;  3BM6 A;  3LEZ A;  1PWC A;  5FI7 A;  2R9X A;  1HTZ A;  5GHY A;  3UN7 A;  4S2L A;  5M1A A;  1XXM A;  4PM5 A;  5CEB A;  4OH0 A;  2XFT A;  3ZVW A;  4LV0 A;  4MBK A;  1ES3 A;  5GLB A;  1W5D A;  4EUZ A;  4GDN A;  2HPB A;  2J9P A;  3E2L A;  4U0T A;  2ZMA A;  4RA7 A;  4XUZ A;  4PM6 A;  1GA9 A;  3IXH A;  3BYD A;  3G31 A;  3FKW A;  2WAF A;  3PBR A;  3IWQ A;  3SS5 A;  1DJA A;  4BL3 A;  3Q81 A;  5HFO A;  4BD0 A;  1MPL A;  2WAD A;  2RL3 A;  3NDG A;  2Y2I A;  3DW0 A;  3OCL A;  4OOY A;  4F94 A;  1TDL A;  4S2J A;  5CRF A;  5AQB A;  3VMA A;  4BQM A;  4R1G A;  4JXW A;  4HEF A;  1C3B A;  4DE2 A;  1FR6 A;  1YT4 A;  3CZD A;  1JTG A;  4OQ0 A;  3DTM A;  1M40 A;  5DVA A;  1BTL A;  2X71 A;  3IT9 A;  3NY4 A;  4EBN A;  3OCN A;  1BUL A;  3IWO A;  2Y2Q A;  3EQU A;  3E2K A;  1GHM A;  1K57 C;  3AGE A;  3C5A A;  3MZE A;  1ONG A;  4WM9 A;  4WZ4 A;  4B4X A;  1ZKJ A;  1E3U A;  2EFX A;  2ZJ9 A;  3UO9 A;  2P9V A;  3I7J A;  5FQI A;  5EE8 A;  4LCL A;  4E3O A;  5HAQ A;  1PIO A;  2ZC7 A;  4X53 A;  1OME A;  1KVM A;  3IQA A;  3W8K A;  2ZQC A;  3TSG A;  1Q2Q A;  3GTC A;  1BLH A;  3ZNT A;  1HD8 A;  3Q1F A;  4OON A;  5F1F A;  2WKI A;  4C75 A;  1H8Y A;  2P74 A;  4P6B A;  5FAT A;  5DF7 A;  5M19 A;  1M6K A;  1NRF A;  3ZFZ A;  4QB8 A;  3FKV A;  3IF6 A;  4LV2 A;  3HLB A;  1KE4 A;  4EV4 A;  4FSF A;  4OLD A;  5HL1 A;  1ZC2 A;  4OOL A;  5DF8 A;  1FSW A;  1MBL A;  1GA0 A;  1E25 A;  2Y2P A;  4S2O A;  1IYP A;  3A3D A;  4FH2 A;  3M6H A;  3GSG A;  2HP9 A;  1SHV A;  2HDS A;  4DKI A;  5HAP A;  3HLC A;  4OPZ A;  4KZ5 A;  2X02 A;  1BLS A;  1IYS A;  1FSY A;  5F1G A;  2QPN A;  4Y0T A;  1K6R A;  4KZ8 A;  1MWU A;  2WKH A;  3IH9 A;  5EEC A;  3RJU A;  3VP0 A;  5CXW A;  3HL9 A;  4S2N A;  4WYY A;  5FAQ A;  3WS0 A;  4KG2 A;  4DDS A;  1I2S A;  3BRM A;  4KG6 A;  5BOH A;  5GLD A;  4GNU A;  3SH9 A;  1Q2P A;  4OVD A;  4JKT A;  3GR2 A;  3MZD A;  5FQK A;  3NCK A;  4PPR A;  1K56 D;  2FFY A;  4GB7 A;  1ZG6 A;  1K54 A;  2Q9M A;  4QU3 A;  4S2K A;  3IHB A;  4X69 A;  1ONH A;  1XGI A;  4IVK A;  1ES5 A;  2PBY A;  3OPP A;  2WKE A;  3EQV A;  3HVF A;  3HLF A;  2OLV A;  4RX3 A;  5GLA A;  3WS4 A;  1E4D A;  3GRJ A;  4GDB A;  1K6S A;  1CEG A;  2JC7 A;  1LLB A;  4LEN A;  2ZQ9 A;  3G34 A;  1QME A;  4KQO A;  3MBZ A;  5CHM A;  3VP1 A;  2XH9 A;  4P85 A;  2I72 A;  1RP5 A;  4BJP A;  4X56 A;  1JWZ A;  1PYY A;  1IEL A;  1LL9 A;  3IF6 C;  3O87 A;  1PI4 A;  2G2U A;  4OP5 A;  2ZQ8 A;  3NC8 A;  3IH8 A;  1K55 A;  4KZ3 A;  1PW1 A;  1Z6F A;  2EXB A;  2Y2G A;  4L0L A;  2BLS A;  4R0Q A;  4MLL A;  5L2F A;  1BUE A;  1PZP A;  3GMW A;  2HDU A;  3V39 A;  1DJB A;  4MBF A;  3ZG8 B;  4E3K A;  2Z2M B;  4R3B A;  4FH4 A;  3Q82 A;  3UY6 A;  5FI2 A;  4UHU A;  5KSH A;  1GCE A;  1ZG4 A;  1CEF A;  4S2N C;  4UA7 A;  3UPP A;  1JTD A;  4S2M A;  1KVL A;  2Y2K A;  5CEC A;  5HX9 A;  3VOZ A;  1JWV A;  4NET A;  4C3Q A;  3CMZ A;  3JYI A;  1SKF A;  5HAR A;  2XLN A;  4XXR A;  4D2O A;  4HES A;  4E3I A;  1XGJ A;  1K54 C;  2IWB A;  2ZD8 A;  4HBU A;  2Y2H A;  2XR0 A;  2GDN A;  3Q07 A;  2WGV A;  1EI5 A;  1IKG A;  2EXA A;  5AQ7 A;  2H5S A;  3ZG5 A;  3M6B A;  3A3E A;  4NK3 A;  1YLW A;  4Y7P A;  1FR1 A;  2ZC5 B;  4WMC A;  5FQJ A;  3WS5 A;  4E3L A;  1EWZ A;  4PM9 A;  1O07 A;  2OLU A;  1YQS A;  2JBF A;  3MFD A;  3PBN A;  5FSR A;  4EQI A;  5CGW A;  4U0X A;  4DE3 A;  5DTS A;  1E3U D;  1SDE A;  2Y2M A;  2WGI A;  4OP8 A;  2ZM8 A;  1KE3 A;  2ZM0 A;  3UE1 A;  1PWD A;  1HVB A;  1CI9 A;  2EX6 A;  2J9O A;  3OZH A;  1K38 A;  3HLW A;  4ZJ3 A;  3A3I A;  3WS1 A;  5M18 A;  1FOF A;  1K55 C;  3CG5 A;  3HUO A;  4E3M A;  1YLP A;  3N8S A;  4K91 A;  5E43 A;  1NY0 A;  4OPY A;  5FA7 A;  4MNR A;  3IXB A;  5D3O A;  3VP4 A;  5FAO A;  2JCH A;  3V5M A;  1SDN A;  2XQZ A;  4WEK A;  3UE0 A;  4E3J A;  5AQA A;  4E3N A;  2WZZ A;  3FV7 A;  3PAE A;  4CJN A;  1YMX A;  5CED A;  3G2Z A;  4EBP A;  4C6Y A;  1FCM A;  1KGF A;  5HAI A;  4IED A;  4JLF A;  4S2P A;  5GL9 A;  3S1Y A;  2R9W A;  1G6A A;  2UWX A;  3AGD A;  1VM1 A;  3O3V A;  4JXG A;  4BD1 A;  2Y55 A;  1BLP A;  4KZB A;  4ZBE A;  4WBG A;  4DRT A;  3BEC A;  4JF4 A;  1ES4 A;  3CJM A;  5F83 A;  3N4I A;  3BEB A;  2EX9 A;  1YLZ A;  1NJ4 A;  5EVI A;  4BL2 A;  1YLY A;  4LCM A;  1RGY A;  2XDM A;  2Q9N A;  3V3S A;  1RCJ A;  1HZO A;  1GHI A;  3PAG A;  3A3J A;  1ESI A;  4QY5 A;  1BZA A;  1NZU A;  3ZG9 B;  2CC1 A;  3PTE A;  3OPH A;  1NYY A;  3W4Q A;  1XA1 A;  4B88 A;  5CGX A;  5DF9 A;  1ERO A;  1J9M A;  4U3T A;  1IYO A;  2QZ6 A;  2DRW A;  4KQR A;  3RXX A;  4K0X A;  1RGZ A;  5HW3 A;  3PBO A;  3NDE A;  4PMA A;  4RVA A;  2V1Z A;  4JXV A;  1IYQ A;  2XD1 A;  1W79 A;  1TDG A;  4QHC A;  3ITB A;  4R4R A;  4KG5 A;  4X55 A;  3TG9 A;  3W4P A;  3VP2 A;  3GVB A;  2VGJ A;  2WGW B;  5CTN A;  4DDY A;  3NIA A;  5GHZ A;  3SS3 A;  3TOI A;  1KGG A;  3IHA A;  1LL5 A;  3O86 A;  4RX2 A;  1U60 A;  3HBR A;  1L0E A;  1PI5 A;  1YLT A;  1PW8 A;  2Y2J A;  5A90 A;  1FQG A;  4UA9 A;  1K56 A;  3G30 A;  4ZTK A;  2H0Y A;  1VQQ A;  1MWT A;  4MEZ A;  4H8R A;  5FQ9 A;  4ZJ2 A;  2XFS A;  3QNB A;  4UA6 A;  1KE0 A;  1WYC A;  3LO7 A;  4HBT A;  5CHJ A;  5FAP A;  3VOY A;  3OPL A;  4KZ7 A;  4QJG A;  3Q7V B;  3ZG7 B;  5CTM A;  5A91 A;  3LCE A;  1W8Y A;  3ZVT A;  5CGS A;  3UNW A;  4N1X A;  4OQI A;  5KMW A;  1L0G A;  5EUA A;  2OSU A;  4WEJ A;  3ISG A;  4M3K A;  4OQH A;  1KDW A;  4QD4 A;  4N1H A;  4ZJ1 A;  2WYX A;  5DTT A;  1MWR A;  1W7F A;  3LY3 A;  5KSC A;  5EVI C;  3G2Y A;  4FD8 A;  4O7D A;  1LI9 A;  2HP6 A;  2PU2 A;  3MXR A;  5A92 A;  5F82 A;  1WE4 A;  5E2E A;  3HLG A;  5FAS A;  2QMI A;  2Y2N A;  1TEM A;  5AQ9 A;  2A3U A;  4IVI A;  2WK0 A;  3NI9 A;  3D4F A;  1IEM A;  2PU4 A;  1S6R A;  3SH8 A;  1PWG A;  3S4X A;  3VFH A;  3O88 A;  1YMS A;  3WRT A;  3ZNY A;  4BEN A;  4EWF A;  1JVJ A;  4GKU A;  1H5X A;  4DF6 A;  1XPB A;  3N8R A;  1NYM A;  4PM8 A;  4Q8I A;  4ID4 A;  1JWP A;  2WUQ A;  5E2G A;  3AGF A;  1ESU A;  3DWZ A;  3MXS A;  2G2W A;  3SS4 A;  1N4O A;  4IBX A;  1IKI A;  4Y0O A;  3BFE A;  3QNC A;  4KEN B;  3G35 A;  1GHP A;  2X01 A;  1WYB A;  1PZO A;  2A49 A;  4WMC D;  1I5Q A;  3BLM A;  1MKI A;  1N9B A;  1FCO A;  4KZ9 A;  4YIN A;  3C7U A;  5GLC A;  4B4Z A;  4DE0 A;  3HRE A;  2B5R A;  5FQQ A;  4A5R A;  3WRZ A;  2DCF A;  4YFM A;  2VGK A;  3UDX A;  3P09 A;  5FQM A;  2C5W B;  2BG1 A;  1AXB A;  1KDS A;  3BFD A;  2RCX A;  1FCN A;  4JBF A;  4WEL A;  4N9L A;  1DY6 A;  1O7E A;  4PM7 A;  1YM1 A;  5GHX A;  5JYP A;  2FFF B;  2E8I A;  3Q7Z A;  3VSL A;  4DXB A;  3UPO A;  3ZG0 A;  3M2K A;  3VFF A;  3V50 A;  4S2I A;  2HDQ A;  2XF3 A;  2ZQ7 A;  3SH7 A;  1K25 A;  4P0M A;  1XP4 A;  4RYE A;  4KZA A;  1ES2 A;  5FI6 A;  3MKE A;  1MY8 A;  2P9V B;  3MZF A;  4OQG A;  4K0W A;  5A93 A;  3OC2 A;  2XEP A;  3PBQ A;  1L0D A;  2ZC6 B;  2ZM2 A;  3C4O A;  4FCF A;  5CER A;  3C7V A;  5FDH A;  2V20 A;  3B3X A;  3BFG A;  4N9K A;  2ZLY A;  2C6W B;  4OOM A;  4OLG A;  3DWK A;  5G18 A;  4DXC A;  5EPH A;  3OPR A;  4OPQ A;  3ZGA B;  3ZHH A;  3FYZ A;  2JE5 A;  1MXO A;  3A3F A;  2EFU A;  4LV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...