4LLOB

Structure of the eag domain-cnbhd complex of the mouse eag1 channel
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
121
structure length
121
Chain Sequence
TFLENIVRRSNDTNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSACSFMYGELTDKDTVEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Potassium voltage-gated channel subfamily H member 1
publication title The structural mechanism of KCNH-channel regulation by the eag domain.
pubmed doi rcsb
source organism Mus musculus
total genus 35
structure length 121
sequence length 121
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4lloB00
2W0NA 4I3IA 4DJ3A 4HQAA 4HJ4A 1LSVA 3A0VA 3MJQA 2YKFA 3H82A 2M1CA 2L4RA 5G4ZA 2YKHA 4EQ1A 1T1CA 4WLAA 4I3AA 4BBVA 1P0ZA 4R6LA 2OWJA 4NXEA 4I38A 1T1BA 2WKPA 3UB7A 4HP9A 2P7JA 2A24B 1VB6A 3OLOA 4KQDA 4L9EA 4EEPA 2PDRA 3BY8A 3LI9A 1S1ZA 1OTBA 1OTAA 1UWPX 4HIAA 2A24A 3MQQA 1D06A 5DKLA 2QJ5A 1XFQA 1OT6A 3SW1A 3E4PA 3T50A 1OJGA 3LUQA 1Y28A 5HDDA 3UMEA 1XJ6A 5A8BA 1S67L 3CLOA 2W27A 2ZOHA 1LT0A 1TS6A 4F3LB 4HHDA 3P7NA 4JGOA 1ODVA 2PYRA 4RQ9A 3KX0X 2QHKA 4B9OA 4WF0A 4WUJA 4EEUA 3GECA 4LPZA 2V1BA 1T18A 4JGPA 4F3LA 2J80A 3B33A 2L0WA 3HJKA 3FG8A 2INWA 2WKRA 4NXGA 5F6AA 1D7EA 4L9FA 5HD3A 3RTYA 3PHYA 3UB6A 4NXFA 3MR0A 4YWZA 4I39A 4GW9A 3MFXA 1XJ3A 4KUOA 2PD8A 4E04A 1P97A 4LRYC 3FC7A 4MN6A 2B02A 1F9IA 2Z6CA 5G4YA 4HH3A 1LL8A 1UWNX 2V0UA 2VV6A 2JHEA 1S66L 1WA9A 3E4QA 2KDKA 2K7SA 4PKYG 3CWFA 1DP8A 1TS0A 3LYXA 2L1MA 3GDIA 5IS1A 3UE6A 2VV7A 1S1YA 5HWTA 3LIDA 4KUKA 4EETB 1N9NA 3K3DA 2V0WA 4H6JB 4EXOA 2ZBBA 4LLOB 1F98A 4EERA 2EA9A 5HDSA 3ZQ5A 4JGRA 4HP4A 3NJAA 3K3CA 4WN5A 4H6JA 2QJ7A 3NOTC 3LIBA 5J7EA 4L9GA 3PYPA 2QKPA 3IS2B 5F68A 3C8CA 1S4RA 4R70A 2PYPA 5AVFA 4HJ6A 5TBMB 4HJ3A 4HOIA 3F1NB 4BBUA 1EW0A 3IS2A 1X0OA 3LIAA 1XFNA 3LIFA 5DJUA 2PR6A 5TBMA 1KOUA 4I3JA 4HH2A 1GSWA 3RH8B 4M4XA 3BWLA 2WKQA 3UB8A 1T1AA 2Z6DA 3F1NA 1V9ZA 3MXQA 5DKKA 1MZUA 1T19A 3UB9A 1DRMA 2PR5A 2PHYA 2I9VA 3D72A 5KIZA 1V9YA 3H9WA 4EW7A 1XJ2A 3E4OA 4HNBA 3C2WA 3VE3A 1G28A 3LI8A 1LSWA 3ULFA 1UGUA 4K08A 1N9LA 2PD7A 3EWKA 1S4SA 5HSQA 4WL9A 4GHIB 3A0SA 1TS7A 5HD5A 1LSXA 3G6OA 1DP9A 3ICYA 2VV8A 4LRZE 4GS9B 1OTDA 3CAXA 1OTEA 4GHIA 3A0RA 3VE4A 5I5LA 2OWHA 1XJ4A 2VEAA 2HV1A 3LICA 4GS9A 1TS8A 1OJ5A 3EEHA 3NOUC 4R38A 3VOLA 5IU1A 3IBRA 4XT2B 5F5YA 5F69A 4LRXC 2R78A 4I5SA 4JGQA 3NHQA 4NXBA 4BBTA 2KX6A 4GCZA 1BYWA 5HZHA 2V9AA 3F1OB 2CMNA 5J3WA 2OOLA 2D01A 1OT9A 2GJ3A 4XT2A 5HWVA 2D02A 5HDCA 2BASA 5DJTA 3F1PB 2ZOIA 3LIEA 3MQOA 1GSXA 5J4EA 4HY8A 4MN5A 3F1OA 3H7WB 3UMDA 4R3AA 1JNUA 2QWSA 3BY9A 1N9OA 3F1PA 1OTIA 4PKYA 2H28A 4HI4A 1GSVA 5HWWA 1DP6A 4DJ2A 2V1AA 3H82B 4EESA 2VLGA 3H7WA 5AVEA 5EFWA 2JN7A 1NWZA 3NOPC 3HJIA
chains in the Genus database with same CATH superfamily
1M6KA 4B4ZA 3DW0A 5GL9A 4R4SA 5FQJA 3MJQA 1MXOA 4YOFA 1TEMA 3B3XA 5G4ZA 3BFFA 1LL5A 5EVLA 2P08A 4OVDA 5EE8A 3KYEA 1W8YA 3G2ZA 3IX4A 5EPHA 3FV7A 2XQZA 5DF8A 3V5MA 2EFXA 4NXEA 1K6RA 2ZQDA 1GHPA 1O07A 1T1BA 3IH8A 2Z2LB 3KYQA 4EUVA 4II7A 2FZ0A 2XGNA 4WMCA 4KZ6A 4B4XA 5L10A 4P87A 3OLOA 3CI6A 2QZ6A 3BEBA 4S2NC 3BLSA 1VQQA 1ZG4A 3UE0A 1S1ZA 5KSCA 4P85A 1PRQA 2J8YA 3O5YA 5EVEA 1OTAA 4BLMA 3LY3A 3T4SA 3JVVA 4QWOA 4R23A 1YQSA 5DF7A 3A3EA 2ZM2A 1WE4A 2V1ZA 4HESA 1MWUA 1Y28A 4X6TA 3UMEA 4R3JA 1S67L 3CLOA 3MS6A 2XFTA 2W27A 1LT0A 3T4LA 3BRMA 3MXSA 3Q82A 3SS5A 1MWRA 4FH2A 4Y7PA 1W8QA 2G2WA 4JGOA 3TW8A 3ZG8B 4Y0OA 2O99A 1MKMA 4B9OA 4KZ8A 2PT7A 1KGEA 4OH0A 4Z9QA 4X55A 2NUPC 2W1TA 4KG6A 1NLZA 2L0WA 1PWGA 3IF6A 4MBFA 3HJKA 1O7EA 1LL9A 4KQOA 4IEDA 3CPTA 1LI0A 3RTYA 4ZJ1A 3O87A 5IHVA 4QD4A 5EECA 3PAEA 4OOLA 3T4TA 2HP9A 2R9XA 3VP0A 3CZDA 5EM1A 3BQ8A 4E3NA 1H3QA 3UB5P 3PBTA 1A0KA 1K4EA 4KQRA 2B02A 3ZFZA 2QMIA 1MPLA 4ZJ2A 1K57A 1DY6A 2Y4AA 3N8SA 4S2KA 4NEED 5FATA 2JHEA 2JE5A 1WA9A 4QU3A 2KDKA 4ETZA 3ZVTA 1VHMA 3ZG7B 2AVXA 3B42A 4K0XA 3NI9A 1TS0A 3GDIA 4KZAA 2V20A 1JWPA 3IXBA 4WELA 1H8YA 2OLVA 2VV7A 1HD8A 4O7DA 1FSYA 3T1RA 1S1YA 4KUKA 4EETB 4OLGA 5U47A 5HARA 1IKGA 2KOIA 4EXOA 4LLOB 4IHQA 3WS0A 1F98A 4E3OA 4EERA 5TJJA 1N9BA 2HGVA 2JKTI 2EA9A 2G7UA 4OOMA 2J3TC 3ZQ5A 4JGRA 4UA7A 2KLIA 2P74A 3CMZA 1XXMA 3NJAA 4WEJA 2ZMAA 2WZZA 3UY6A 2XFSA 4IVIA 2XSSA 2VGLM 3OZHA 2QJ7A 4MDZA 5DTKA 2WGWA 5J7EA 1NRFA 2ZQ8A 4UQIM 5CEBA 4R70A 1W63M 4RYEA 1N4OA 5L8MA 3M2KA 5TBMB 2WKHA 4ARZB 2M7VA 5FA7A 2IWCA 3W2ZA 1PZOA 4FH4A 1XFNA 3LIFA 5DJUA 1WYCA 2PR6A 1K38A 4WYYA 2J3TD 1J9MA 4I3JA 3UO9A 4GD8A 4JPMA 4M4XA 5AQ7A 2ZQ9A 1T1AA 3T4JA 4DN0A 2EX6A 2DCFA 5EOEA 1SHVA 3MXQA 5DKKA 1IYPA 2PR5A 4HBUA 3DTKA 3BJNA 3H9WA 1CK3A 2JKFA 2P9VB 1SCWA 3C2WA 4Y2FA 3VE3A 3GRJA 3S7OA 4ZTKA 3TJZC 1FIKA 5AQ9A 2WYXA 3ULFA 5FSRA 1UGUA 2K2NA 4ZRRA 3HL9A 5TFQA 3T1SA 4OP5A 1S4SA 4OLDA 5EM0A 1P9WA 3KSFA 4G3WA 3PBQA 1BLHA 1K54A 5L07A 5D3OA 1S0WA 3NDGA 4DRTA 4GS9B 4FTXA 3KSGA 3UPOA 4IBXA 4GHIA 4N9LA 3SH9A 4RX2A 4N92A 1IEMA 1PWCA 4LFUA 1TVFA 2IWDA 4GDNA 3EQVA 4E6XA 5CHUA 3BFDA 3N7WA 2DNSA 3MMHA 4LRXC 2VJWA 2R78A 1XX2A 5CECA 3LR4A 1HZOA 4NXBA 4P6ZM 3IT9A 2XR0A 2V9AA 3F1OB 4L0LA 3Q1FA 5J3WA 2D01A 1OT9A 2GJ3A 4XT2A 2Y2IA 2VGKA 1YKDA 4IBRA 1F2KA 3T4OA 2D02A 3QP8A 3F1PB 4NK3A 3EOIA 4OQHA 3LIEA 3MQOA 1GSXA 4E3MA 1EWZA 3LR5A 5EV0A 1L0GA 1JNUA 3PXPA 4OP8A 1VETA 1SKOB 3VSLA 5FQ9A 4FUWA 4DE0A 5HWWA 3H82B 4GLQA 4S2LA 3LEZA 3HBRA 4GNUA 2HF6A 4HQAA 2ZJ9A 4X53A 4IVKA 3SOIA 1HTZA 4ZAMA 1MBLA 2L4RA 1ERMA 2YKHA 2Y2LA 4Y15A 3JYIA 4N1HA 1FOFA 4JXWA 3T4QA 1ONHA 4QHCA 1JWVA 1P0ZA 4X56A 3W4QA 4BBVA 4R6LA 5I94A 4GJ4A 2OWJA 2H0YA 4O01A 1BSGA 4I38A 2XA7M 4X1MA 3FPWA 4IUHA 5DFXA 1KE3A 2C5WB 2A24B 4KQQA 3NDEA 3S7QA 4EBNA 2PDRA 4A5RA 3WRZA 2ZQ7A 3BY8A 3LI9A 2JBFA 4R0QA 3KYZA 1YLYA 1WYBA 1UWPX 4B93A 3OCNA 3MQQA 2FFYA 5AQAA 2QJ5A 1BLCA 1OT6A 1BLPA 1K0KA 3E0YA 2DRWA 2B18A 3PTEA 3LUQA 1XJ6A 5A8BA 3OPLA 3I7JA 1GHIA 4QJGA 4LENA 4UQIS 2ZOHA 1L0DA 3C5AA 1VETB 3UPNA 4HHDA 4X25A 5DFYA 4DXBA 3P7NA 1KDSA 1K25A 1PWDA 3HLBA 2XD1A 3CUEA 4WF0A 1CQAA 3L9KA 1BZAA 4LPZA 5HX9A 4Y0UA 1T18A 2J80A 3QHYA 1ZKJA 3MZEA 3D9YA 2Y2PA 5F6AA 1TF1A 3G4PA 3R4KA 4L9FA 1FQGA 1FCMA 2G2UA 3IBJA 3OBFA 4NXFA 3MR0A 4YWZA 4PHTA 4DF6A 1ZG6A 3HUMA 3CHWP 1KE4A 5EOOA 1EI5A 5CTNA 4KUOA 4XUZA 1YSQA 1FR6A 1Z09A 4LRYC 3IF5A 5CHMA 4MN6A 3OC2A 1H8ZA 3FYZA 1LL8A 5EVIC 4U0TA 2V0UA 2VV6A 4C75A 3B47A 4OONA 1S66L 2HDUA 3E4QA 4PKYG 1IELA 1G68A 3HLFA 1I2SA 3LYXA 3A3FA 3N6IA 4BJPA 5L09A 1GCEA 1YLWA 3GVBA 2IA2A 3K3DA 3S4XA 3UDXA 2V0WA 2RL3A 3DTEA 4H6JB 2ZBBA 4S2NA 3R7WB 3JPUA 3BFEA 3S7NA 5GHYA 3PBSA 5GHZA 1G6AA 1NY0A 3BLMA 3IQAA 4Q8IA 3ZCZA 5CX7A 1I5QA 2BLSA 4MCWA 4JXGA 3S7PA 5C5KA 4P6ZS 3FPVA 4ZBEA 3Q81A 3HCYA 2QKPA 4G3VA 3EQUA 3A3JA 2PYPA 1ES2A 2JKGA 4NKPA 5FASA 3Q7VB 2EWWA 4HOIA 5GHXA 3EGDC 3VOYA 3F1NB 4BBUA 4GOGA 1X0OA 3LIAA 2OAP1 4LV3A 3LR0A 5CRFA 1VEUB 3DWKA 2XDMA 2GX5A 1XP4A 5TBMA 2Y2KA 3S1YA 2PU2A 1NRJA 4ARZA 3RXXA 5BOHA 4PM9A 3UB8A 2Z6DA 3NCKA 4JF5A 4BWIA 1DRMA 2I9VA 4KG5A 1I2WA 1EROA 4PMAA 4E3JA 1RCJA 3OPPA 5IT5A 4HNBA 5EVIB 4JKTA 1YT4A 3PBOA 4P0MA 1BULA 1Q2QA 2ZD8A 3LY4A 1N9LA 3A3DA 4GZBA 2P9VA 4WL9A 4MLLA 1SDEA 3SS3A 4R3BA 5GLAA 3A0SA 4KZ9A 5HD5A 1LSXA 2Q9MA 1DP9A 3ICYA 2XA7S 2VV8A 3LEQA 3E2KA 4KZ4A 4OQGA 1W79A 5KZHA 3A0RA 3LCEA 4H8RA 4S2PA 3VFFA 3G30A 2OWHA 3U4LP 2Y2GA 2HJ9C 4XXRA 4GS9A 1TS8A 3IHAA 3EEHA 4ZDXA 1CEGA 2J7VA 2EXAA 5IU1A 4O0PA 5F5YA 1DJBA 5F69A 2W3GA 5HPIA 1LI9A 1RGZA 3GTCA 4OOYA 4OPYA 2B5RA 3NHQA 5HAIA 1QMEA 2KX6A 4GCZA 2VKSA 1BYWA 2QPNA 4BL3A 3HREA 4Y13A 5HZHA 2CMNA 2OOLA 1E3UA 4UHUA 5HWVA 1G6OA 4KZ3A 2BASA 5DJTA 5CTMA 5FQKA 3UE3A 2ZC4B 5J4EA 1E25A 3QP1A 4HY8A 4ME4A 1K55C 3ZG5A 5JYOA 1FSWA 3RFBA 3F1OA 5F83A 2JC7A 2W3FA 1BT5A 4BENA 1N9OA 2O9AA 3F1PA 1QMFA 4DXCA 2WGVA 1H8MA 1E3UD 3NOPC 1TDLA 3HJIA 5M19A 5M1AA 4YINA 3V67A 3UN7A 4I3IA 2P04A 4BD0A 4DJ3A 2Y2OA 1S6RA 5CGXA 1SKOA 3VMAA 3PAGA 2EX2A 1LSVA 3A0VA 2XEPA 2W1RA 2YKFA 2HDSA 2PBYA 4XUXA 3IWQA 3H82A 2M1CA 1XA1A 1NZOA 1YMXA 2Z2MB 3MQ0A 4DKIA 4EQ1A 2EX8A 4QY6A 1M40A 3GR2A 3G35A 1PW1A 3NC8A 1E4DA 1T1CA 4I3AA 1PW8A 3SH8A 4C3QA 5FEFA 1NLYA 3UDIA 2VZWA 2H5SA 5FAOA 2ZQAA 4ID4A 4PM7A 2E8IA 2XD5A 3BM6A 2WKPA 3UB7A 1ALQA 2Q9NA 1PIOA 2UWXA 4HP9A 3FWLA 2ZC5B 4EU0A 2HJEA 4KQDA 4UAAA 1MY8A 2W3HA 1OTBA 2MJ6A 3HLCA 1BLSA 5FAPA 1ESIA 3ITAA 1OPXA 4HIAA 3KO6A 2A24A 3BYDA 2EXBA 5CXWA 4R1GA 2PAVP 1D06A 3V50A 5DKLA 3TOIA 2EX9A 1XFQA 3LGOA 5GLDA 1OJGA 1YPRA 2QYBA 2VK3A 5GLBA 1YM1A 2I72A 3A3IA 1TS6A 4LCMA 4F3LB 5MC7A 5FI7A 1K56D 1ODVA 2PYRA 4RQ9A 3KX0X 2QHKA 1BUEA 2Y2QA 4WUJA 1XKZA 2V1BA 2HDRA 3B33A 1PI4A 2Y2MA 3BFCA 3IX3A 4NXGA 1YLPA 1D7EA 4FD8A 5A93A 1U60A 3PHYA 3UB6A 1CI9A 2XH9A 2W3EA 4I39A 2O0YA 4GW9A 5DF9A 3D3OA 2WUQA 2FH5A 3C7VA 1IYQA 5CEDA 3WS2A 4CPKA 5FQIA 3MZFA 3S22A 3W8KA 2PD8A 5K5BA 1NZUA 4OPZA 4E04A 2J9OA 1P97A 2Y2JA 3P01A 2ZL1B 4CLCE 2XLNA 1F9IA 5KMWA 1CI8A 2Z6CA 3MKEA 2OSUA 4HH3A 5G4YA 5F1FA 3E98A 1CEFA 3G2YA 3W4PA 1YSPA 4CJNA 2K7SA 4FOFA 4DE1A 3WWXA 2XROA 1DP8A 4EBLA 2L1MA 4JF4A 5IS1A 3UE6A 4EWFA 2ZC3B 4WEKA 2M7UA 4RVAA 3LO7A 4DDYA 4NG2A 5HWTA 3LIDA 4FCFA 5LBRA 2Q0OA 4E6WA 2ZQCA 4CLCC 3OOVA 4EUZA 1PFLA 4WZ5A 5HDSA 3VSKA 3NULA 4UA6A 4C6YA 5M18A 2VGLS 4HP4A 2NUTC 3AGDA 4X68A 4F94A 4WN5A 3SS4A 5DTTA 4H6JA 3ZNTA 3DTIA 3O86A 1K6SA 3NOTC 3R7WA 3O88A 1Y4OA 4OKPA 1Z6FA 5HFOA 5E2GA 3PYPA 3IS2B 2WKEA 4E3LA 3N4IA 5FDSA 1S4RA 4G3KA 2OLUA 4HBTA 5AVFA 5E2FA 4HJ6A 4MMNA 1SZVA 1SKFA 4IJGA 3CUEC 2V2FF 3MFDA 2BG1A 1NXYA 4PAUA 2ZLYA 3ZYTA 1YMSA 4CLCD 5AJGA 5G18A 1KOUA 1ERQA 4HH2A 1JVJA 3HUOA 3Q7VA 3BWLA 3QNBA 2WKQA 3F1NA 4EV4A 1T19A 4YNRA 2E8JA 2X01A 3DTMA 2PHYA 3QP2A 1VEUA 2Y91A 3D72A 5KIZA 3GMWA 4BL2A 4EW7A 2JCHA 3E4OA 2K31A 3OPHA 2ZC6B 3LI8A 1JWZA 2OV5A 1LSWA 1YLTA 5TR7A 2H10A 4AFIA 2Y79A 4K08A 2Y55A 1MC0A 2PD7A 5HSQA 3MBZA 4PM5A 3MF0A 5HW3A 1PZPA 3KSHA 5EVIA 2A2LA 3G6OA 5FL3A 2BTFP 3BQAA 3ZHHA 2RCXA 4LRZE 3VP1A 2O9BA 3LFVA 4ETXA 1DJAA 4Y3IA 3CAXA 3UPPA 1OTEA 3VE4A 4CLCB 4JXVA 1XJ4A 1ZHHB 1RP5A 3G34A 2HV1A 3LICA 1YLJA 1P9RA 1OJ5A 1VM1A 3UE1A 4BMWA 5EVID 5FQMA 1IOUA 1FCNA 1ES5A 3TRCA 2VGJA 4R38A 3N8RA 1GA0A 1H0MA 3RXWA 3SZTA 5L2FA 5FEGA 4QB8A 4EQIA 1TD5A 4CQHA 4JGQA 1TDGA 3JVUA 4ESPA 1SDNA 5A90A 4UA9A 4BBTA 2XK1A 1L0FA 3MSHA 4WMCD 5FI2A 4WBGA 3IX8A 4QY5A 4GN2A 1PYYA 2PBDP 3ZGAB 2CC1A 2HDQA 4PPRA 2X02A 3IF6C 4OQ0A 5CHJA 4MN5A 2LB9A 4WM9A 2XRNA 4GD6A 3H7WB 5FAQA 4R3AA 2QWSA 4PKYA 1CF0A 4GB7A 1GSVA 1FR1A 3GSGA 5FDHA 3PR6A 4DJ2A 4EESA 2ACGA 2A3UA 2VLGA 5AVEA 2JN7A 2ZM8A 2W0NA 1IYSA 3IXHA 4HJ4A 4EBPA 3VOZA 5F1GA 1MWTA 1KVMA 3DBAA 1K57C 3HLEA 1LHYA 2Y59A 1PI5A 3QNCA 4WLAA 3G31A 5FQQA 4DE3A 5HAQA 4KZ7A 4R4RA 3T1QB 3FKVA 5AQBA 3ZDJA 1Q2PA 4LGWA 2A49A 3QP5A 1D1JA 3QP4A 5A92A 2P7JA 3NY4A 1MWSA 1VB6A 3DAVA 4L9EA 2WK0A 4EEPA 5KSHA 2OAQ1 2ZMFA 2HZ5A 2UV0E 2ZMVA 3Q7ZA 3EEAA 4JBFA 3LR3A 3Q07A 1KE0A 3G32A 1XPBA 2JKTM 4S2MA 3OCLA 2V8FA 4N1XA 4KZ5A 4LV1A 3SW1A 1W5DA 3E4PA 3T50A 3WS1A 4OPRA 4PM8A 5HDDA 1FCOA 4S2OA 1F5MA 2J9PA 4IUKA 1XA7A 1IKIA 1OMEA 4E3KA 3PBNA 2Y2HA 3T1XA 2W1TB 3IF6B 3CJMA 4B88A 5HPFA 3CPTB 2IWBA 2WADA 3HVFA 4EEUA 3GECA 4JGPA 4KZBA 4F3LA 1GA9A 3UNWA 1K55A 2PRFA 3FG8A 2INWA 4RA7A 4HEFA 2WKRA 3OPRA 2XF3A 4OPQA 3RJUA 5HD3A 3AGFA 3D4FA 1CJFA 3N8LA 1MKIA 4P6BA 2PU4A 5FI6A 1IFQA 3L7HA 1GHMA 3MFXA 4LV2A 1XJ3A 2V8CA 3NIAA 4KENB 2FFFB 3C30A 1JTGA 4DDSA 3KSIA 4NETA 3K2NA 3GV9A 4S2JA 4MBKA 1L0EA 3FC7A 3TE8A 1UWNX 1K54C 4MN7A 4UEYA 2GZAA 4E3IA 1NYMA 5HAPA 3CWFA 2ZL1A 2JKRM 5J8XA 2X71A 2JKRI 4DMZA 3C7UA 3HUNA 4BD1A 4RX3A 3BECA 1BTLA 4ZJ3A 5F82A 1W63Q 1N9NA 3VP3A 2HPBA 3HLGA 1JTDA 1ACFA 1K56A 5DTSA 3CITA 2GNXA 4GKUA 2EFUA 2WGWB 3GQZA 3ISGA 3HLDA 1RGYA 4U3TA 1YLZA 4X69A 3WS4A 1IYOA 1ES4A 5HL1A 4DE2A 4FSFA 2WAFA 3K3CA 3T12B 3ZNYA 3NBLA 4WZ4A 4U0XA 4K0WA 4KG2A 5GLCA 3IXGA 4LV0A 2Y2NA 3LIBA 4L9GA 1W7FA 3IWIA 4Q0JA 5F68A 5E2EA 3C8CA 3MZDA 1XGJA 3HLWA 4M3KA 4MBHA 3CG5A 2LB5A 3NECA 3MKFA 1C3BA 1PNEA 2H0TA 3M6HA 3W4OA 2W3DA 4HJ3A 1L2SA 3BW6A 4Q0IA 1HLUP 2ZC7A 1EW0A 3IWOA 3IS2A 5E43A 2VX8A 2EWVA 3M6BA 3QP6A 3VFHA 3VV4A 3V3SA 1GSWA 2Y8HA 1ONGA 3RH8B 4JLFA 1V9ZA 5CGSA 1MZUA 3MXRA 1ZC2A 4S2IA 5EUAA 3UB9A 1DJCA 3VP4A 5CERA 1V9YA 5E2HA 1NJ4A 1XJ2A 3VP2A 3P09A 3FKWA 1L3LA 3ITBA 1AXBA 1G28A 3EGXC 3IH9A 2J3WA 2WKIA 3M2JA 4N9KA 1AWIA 1NYYA 4JXSA 3UDFA 4O8GA 3EWKA 1ES3A 4MNRA 4Y5FA 4GHIB 3C4OA 5DVAA 3C38A 3SH7A 1TS7A 2B95A 1K4FA 2WAEA 5HL6A 4Q0HA 3O3VA 4LCLA 1G5UA 1OTDA 1KDWA 2C6WB 1LLBA 3E2LA 4Y0TA 2GDNA 3BFGA 5I5LA 1KVLA 3V39A 3P98A 3ZG9B 2WGIA 1J3WA 4QPRA 4YFMA 4X1LA 2VEAA 5CGWA 3TSGA 2HP5A 4GDBA 3T4KA 4PM6A 1ZTUA 3NOUC 2VA0A 3TG9A 4WZ5C 3V3RA 3VOLA 4BQMA 4CLCA 1ESUA 3IBRA 4XT2B 5TGFA 3ZG0A 4MEZA 4I5SA 4JF6A 3WS5A 2WZXA 1HVBA 3WRTA 4D60A 3PBRA 1H5XA 2DMWA 2R9WA 5HDCA 2ZOIA 5JYPA 1Y54A 5A91A 3FZCA 1XGIA 1KGGA 3DWZA 3UMDA 4K91A 2O9CA 1KGFA 3BY9A 4Y17A 1OTIA 2ZM0A 4D2OA 2H28A 4HI4A 3ZVWA 3IHBA 1DP6A 3AGEA 1STZA 2V1AA 1FILA 3U2AA 4Z1WA 3H7WA 4OQIA 5EFWA 1NWZA 3C4PA 3IXDA 2HP6A 1YAXA
chains in the Genus database with same CATH topology
2W0NA 4I3IA 2P04A 2HF6A 4DJ3A 4HQAA 4HJ4A 1LSVA 3A0VA 3MJQA 2W1RA 2YKFA 4YOFA 3H82A 2M1CA 2L4RA 5G4ZA 3DBAA 3MQ0A 2YKHA 2P08A 4EQ1A 3T4QA 1T1CA 4WLAA 4I3AA 4BBVA 1P0ZA 4R6LA 4GJ4A 1NLYA 2OWJA 4NXEA 2VZWA 4O01A 4I38A 2XA7M 1T1BA 3FPWA 4IUHA 2WKPA 3UB7A 3KYQA 4EUVA 4II7A 2FZ0A 4HP9A 5DFXA 2P7JA 2A24B 1VB6A 4EU0A 2HJEA 3OLOA 4KQDA 4L9EA 3CI6A 3S7QA 4EEPA 2PDRA 5KSHA 3BY8A 2OAQ1 2W3HA 2ZMFA 3LI9A 1S1ZA 3KYZA 1OTBA 2MJ6A 2ZMVA 3O5YA 3EEAA 1OTAA 3LR3A 1UWPX 1OPXA 4HIAA 3KO6A 2A24A 4B93A 2JKTM 3MQQA 3OCNA 3T4SA 1D06A 3JVVA 5DKLA 2QJ5A 3OCLA 1XFQA 1OT6A 3SW1A 3E0YA 2B18A 3E4PA 3T50A 1OJGA 3LUQA 1Y28A 5HDDA 3UMEA 1XJ6A 5A8BA 1S67L 2QYBA 3CLOA 1F5MA 4IUKA 2W27A 4UQIS 2ZOHA 1LT0A 3PBNA 3T4LA 1TS6A 4F3LB 2W1TB 4HHDA 5DFYA 5MC7A 3P7NA 4JGOA 1ODVA 3TW8A 2PYRA 4RQ9A 3CUEA 5HPFA 3KX0X 2O99A 1MKMA 2QHKA 4B9OA 4WF0A 2PT7A 4WUJA 4EEUA 3GECA 4LPZA 2V1BA 1T18A 4JGPA 2NUPC 4F3LA 2J80A 3B33A 2W1TA 1NLZA 2L0WA 3HJKA 3FG8A 2INWA 2WKRA 4KQOA 4NXGA 5F6AA 1D7EA 1TF1A 3R4KA 4L9FA 5HD3A 3IBJA 3OBFA 3RTYA 3PHYA 3UB6A 4NXFA 3MR0A 1IFQA 4YWZA 2W3EA 4I39A 2O0YA 4GW9A 4PHTA 3MFXA 5DF9A 3D3OA 2FH5A 1XJ3A 4OOLA 3T4TA 3C30A 4KUOA 2PD8A 5K5BA 1YSQA 3KSIA 3BQ8A 4E04A 1H3QA 3K2NA 1P97A 4LRYC 3P01A 3FC7A 3PBTA 4MN6A 3OC2A 3TE8A 4CLCE 2B02A 1F9IA 2Z6CA 5G4YA 1LL8A 1UWNX 4HH3A 3E98A 2V0UA 4NEED 4MN7A 4UEYA 2VV6A 2JHEA 3B47A 2GZAA 1YSPA 1S66L 1WA9A 3E4QA 2KDKA 4ETZA 2K7SA 4PKYG 3CWFA 4FOFA 2JKRM 1VHMA 3B42A 2XROA 1DP8A 2JKRI 4DMZA 1TS0A 3LYXA 2L1MA 3GDIA 4WELA 5IS1A 3UE6A 4BJPA 2VV7A 4WEKA 2M7UA 1S1YA 5HWTA 3LIDA 4KUKA 2IA2A 1W63Q 4EETB 1N9NA 3K3DA 5LBRA 2V0WA 2KOIA 4H6JB 4EXOA 2ZBBA 4LLOB 4IHQA 4CLCC 1F98A 3R7WB 3CITA 4EERA 3OOVA 5TJJA 2GNXA 2HGVA 2JKTI 3S7NA 2EA9A 2G7UA 4OOMA 5HDSA 3PBSA 2J3TC 3ZQ5A 4FSFA 2VGLS 4JGRA 4HP4A 2KLIA 3K3CA 3NJAA 2NUTC 4WEJA 5CX7A 4WN5A 2XSSA 4MCWA 4H6JA 2VGLM 2QJ7A 4MDZA 3NOTC 3R7WA 3S7PA 5C5KA 3LIBA 5J7EA 4P6ZS 3FPVA 4L9GA 4Q0JA 3HCYA 3PYPA 2QKPA 3IS2B 5F68A 4G3VA 4UQIM 3C8CA 1S4RA 3EQUA 4G3KA 4R70A 2PYPA 1W63M 4NKPA 5AVFA 5L8MA 2LB5A 4HJ6A 5TBMB 4MMNA 2W3DA 4HJ3A 2EWWA 4HOIA 4ARZB 2M7VA 3EGDC 4IJGA 3CUEC 3F1NB 4BBUA 3BW6A 3W2ZA 4Q0IA 1EW0A 3IS2A 1X0OA 4PAUA 3LIAA 1XFNA 3LIFA 2OAP1 3ZYTA 4CLCD 3LR0A 5AJGA 2VX8A 2EWVA 5DJUA 2PR6A 2GX5A 3VV4A 5TBMA 1KOUA 2J3TD 4I3JA 4HH2A 1GSWA 2Y8HA 4M4XA 1NRJA 3RH8B 4ARZA 3BWLA 2WKQA 3UB8A 1T1AA 3T4JA 4DN0A 2Z6DA 3F1NA 1V9ZA 3MXQA 5DKKA 1MZUA 1T19A 4YNRA 3UB9A 4BWIA 1DRMA 2PR5A 2PHYA 2I9VA 3BJNA 3D72A 5KIZA 1V9YA 3H9WA 4EW7A 1XJ2A 3E4OA 5IT5A 2K31A 4HNBA 3C2WA 4Y2FA 3VE3A 1G28A 3LI8A 3EGXC 2J3WA 1LSWA 3S7OA 3TJZC 4AFIA 2Y79A 3ULFA 1UGUA 3PBOA 2K2NA 4K08A 4ZRRA 1MC0A 4O8GA 1N9LA 2PD7A 3EWKA 1S4SA 5HSQA 4WL9A 3MF0A 4Y5FA 1P9WA 3KSFA 4GHIB 3A0SA 4G3WA 3PBQA 3C38A 3KSHA 1TS7A 5HD5A 1LSXA 2A2LA 3G6OA 5FL3A 1DP9A 5HL6A 3ICYA 3BQAA 2XA7S 4Q0HA 2VV8A 4LRZE 2O9BA 4GS9B 1OTDA 3LFVA 4ETXA 3KSGA 4Y3IA 3CAXA 1OTEA 4GHIA 3A0RA 3VE4A 5I5LA 4CLCB 2OWHA 2HJ9C 4QPRA 1XJ4A 1ZHHB 2VEAA 2HV1A 3LICA 1P9RA 4GS9A 3T4KA 1TS8A 1OJ5A 3EEHA 3EQVA 1ZTUA 3NOUC 2VA0A 4BMWA 1IOUA 3TRCA 4R38A 3VOLA 4CLCA 5IU1A 4O0PA 3IBRA 4XT2B 5F5YA 3MMHA 5F69A 4LRXC 2W3GA 5HPIA 2VJWA 2R78A 1TD5A 4CQHA 4I5SA 4JGQA 3JVUA 3LR4A 3NHQA 4NXBA 4BBTA 2KX6A 4P6ZM 4GCZA 2VKSA 1BYWA 5HZHA 2V9AA 3F1OB 4L0LA 2CMNA 5J3WA 2OOLA 2D01A 1OT9A 2GJ3A 3PBRA 4XT2A 1YKDA 5HWVA 2DMWA 3T4OA 2D02A 5HDCA 1G6OA 2BASA 5DJTA 3F1PB 2ZOIA 3EOIA 3LIEA 3MQOA 3UE3A 1GSXA 5J4EA 4HY8A 4ME4A 3RFBA 4MN5A 3F1OA 2LB9A 2XRNA 3LR5A 3H7WB 3UMDA 4R3AA 1JNUA 2QWSA 2W3FA 2O9CA 3BY9A 1N9OA 2O9AA 1OTIA 3F1PA 4PKYA 3PXPA 2H28A 4HI4A 1GSVA 5HWWA 1DP6A 3PR6A 4DJ2A 1STZA 2V1AA 1H8MA 3H82B 4GLQA 3U2AA 4EESA 2VLGA 4Z1WA 3H7WA 5AVEA 5EFWA 2JN7A 1NWZA 3NOPC 3HJIA 1YAXA 3V67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W0N A;  4I3I A;  4DJ3 A;  4HQA A;  4HJ4 A;  1LSV A;  3A0V A;  3MJQ A;  2YKF A;  3H82 A;  2M1C A;  2L4R A;  5G4Z A;  2YKH A;  4EQ1 A;  1T1C A;  4WLA A;  4I3A A;  4BBV A;  1P0Z A;  4R6L A;  2OWJ A;  4NXE A;  4I38 A;  1T1B A;  2WKP A;  3UB7 A;  4HP9 A;  2P7J A;  2A24 B;  1VB6 A;  3OLO A;  4KQD A;  4L9E A;  4EEP A;  2PDR A;  3BY8 A;  3LI9 A;  1S1Z A;  1OTB A;  1OTA A;  1UWP X;  4HIA A;  2A24 A;  3MQQ A;  1D06 A;  5DKL A;  2QJ5 A;  1XFQ A;  1OT6 A;  3SW1 A;  3E4P A;  3T50 A;  1OJG A;  3LUQ A;  1Y28 A;  5HDD A;  3UME A;  1XJ6 A;  5A8B A;  1S67 L;  3CLO A;  2W27 A;  2ZOH A;  1LT0 A;  1TS6 A;  4F3L B;  4HHD A;  3P7N A;  4JGO A;  1ODV A;  2PYR A;  4RQ9 A;  3KX0 X;  2QHK A;  4B9O A;  4WF0 A;  4WUJ A;  4EEU A;  3GEC A;  4LPZ A;  2V1B A;  1T18 A;  4JGP A;  4F3L A;  2J80 A;  3B33 A;  2L0W A;  3HJK A;  3FG8 A;  2INW A;  2WKR A;  4NXG A;  5F6A A;  1D7E A;  4L9F A;  5HD3 A;  3RTY A;  3PHY A;  3UB6 A;  4NXF A;  3MR0 A;  4YWZ A;  4I39 A;  4GW9 A;  3MFX A;  1XJ3 A;  4KUO A;  2PD8 A;  4E04 A;  1P97 A;  4LRY C;  3FC7 A;  4MN6 A;  2B02 A;  1F9I A;  2Z6C A;  5G4Y A;  4HH3 A;  1LL8 A;  1UWN X;  2V0U A;  2VV6 A;  2JHE A;  1S66 L;  1WA9 A;  3E4Q A;  2KDK A;  2K7S A;  4PKY G;  3CWF A;  1DP8 A;  1TS0 A;  3LYX A;  2L1M A;  3GDI A;  5IS1 A;  3UE6 A;  2VV7 A;  1S1Y A;  5HWT A;  3LID A;  4KUK A;  4EET B;  1N9N A;  3K3D A;  2V0W A;  4H6J B;  4EXO A;  2ZBB A;  4LLO B;  1F98 A;  4EER A;  2EA9 A;  5HDS A;  3ZQ5 A;  4JGR A;  4HP4 A;  3NJA A;  3K3C A;  4WN5 A;  4H6J A;  2QJ7 A;  3NOT C;  3LIB A;  5J7E A;  4L9G A;  3PYP A;  2QKP A;  3IS2 B;  5F68 A;  3C8C A;  1S4R A;  4R70 A;  2PYP A;  5AVF A;  4HJ6 A;  5TBM B;  4HJ3 A;  4HOI A;  3F1N B;  4BBU A;  1EW0 A;  3IS2 A;  1X0O A;  3LIA A;  1XFN A;  3LIF A;  5DJU A;  2PR6 A;  5TBM A;  1KOU A;  4I3J A;  4HH2 A;  1GSW A;  3RH8 B;  4M4X A;  3BWL A;  2WKQ A;  3UB8 A;  1T1A A;  2Z6D A;  3F1N A;  1V9Z A;  3MXQ A;  5DKK A;  1MZU A;  1T19 A;  3UB9 A;  1DRM A;  2PR5 A;  2PHY A;  2I9V A;  3D72 A;  5KIZ A;  1V9Y A;  3H9W A;  4EW7 A;  1XJ2 A;  3E4O A;  4HNB A;  3C2W A;  3VE3 A;  1G28 A;  3LI8 A;  1LSW A;  3ULF A;  1UGU A;  4K08 A;  1N9L A;  2PD7 A;  3EWK A;  1S4S A;  5HSQ A;  4WL9 A;  4GHI B;  3A0S A;  1TS7 A;  5HD5 A;  1LSX A;  3G6O A;  1DP9 A;  3ICY A;  2VV8 A;  4LRZ E;  4GS9 B;  1OTD A;  3CAX A;  1OTE A;  4GHI A;  3A0R A;  3VE4 A;  5I5L A;  2OWH A;  1XJ4 A;  2VEA A;  2HV1 A;  3LIC A;  4GS9 A;  1TS8 A;  1OJ5 A;  3EEH A;  3NOU C;  4R38 A;  3VOL A;  5IU1 A;  3IBR A;  4XT2 B;  5F5Y A;  5F69 A;  4LRX C;  2R78 A;  4I5S A;  4JGQ A;  3NHQ A;  4NXB A;  4BBT A;  2KX6 A;  4GCZ A;  1BYW A;  5HZH A;  2V9A A;  3F1O B;  2CMN A;  5J3W A;  2OOL A;  2D01 A;  1OT9 A;  2GJ3 A;  4XT2 A;  5HWV A;  2D02 A;  5HDC A;  2BAS A;  5DJT A;  3F1P B;  2ZOI A;  3LIE A;  3MQO A;  1GSX A;  5J4E A;  4HY8 A;  4MN5 A;  3F1O A;  3H7W B;  3UMD A;  4R3A A;  1JNU A;  2QWS A;  3BY9 A;  1N9O A;  3F1P A;  1OTI A;  4PKY A;  2H28 A;  4HI4 A;  1GSV A;  5HWW A;  1DP6 A;  4DJ2 A;  2V1A A;  3H82 B;  4EES A;  2VLG A;  3H7W A;  5AVE A;  5EFW A;  2JN7 A;  1NWZ A;  3NOP C;  3HJI A; 
#chains in the Genus database with same CATH topology
 1M6K A;  4B4Z A;  3DW0 A;  5GL9 A;  4R4S A;  5FQJ A;  3MJQ A;  1MXO A;  4YOF A;  1TEM A;  3B3X A;  5G4Z A;  3BFF A;  1LL5 A;  5EVL A;  2P08 A;  4OVD A;  5EE8 A;  3KYE A;  1W8Y A;  3G2Z A;  3IX4 A;  5EPH A;  3FV7 A;  2XQZ A;  5DF8 A;  3V5M A;  2EFX A;  4NXE A;  1K6R A;  2ZQD A;  1GHP A;  1O07 A;  1T1B A;  3IH8 A;  2Z2L B;  3KYQ A;  4EUV A;  4II7 A;  2FZ0 A;  2XGN A;  4WMC A;  4KZ6 A;  4B4X A;  5L10 A;  4P87 A;  3OLO A;  3CI6 A;  2QZ6 A;  3BEB A;  4S2N C;  3BLS A;  1VQQ A;  1ZG4 A;  3UE0 A;  1S1Z A;  5KSC A;  4P85 A;  1PRQ A;  2J8Y A;  3O5Y A;  5EVE A;  1OTA A;  4BLM A;  3LY3 A;  3T4S A;  3JVV A;  4QWO A;  4R23 A;  1YQS A;  5DF7 A;  3A3E A;  2ZM2 A;  1WE4 A;  2V1Z A;  4HES A;  1MWU A;  1Y28 A;  4X6T A;  3UME A;  4R3J A;  1S67 L;  3CLO A;  3MS6 A;  2XFT A;  2W27 A;  1LT0 A;  3T4L A;  3BRM A;  3MXS A;  3Q82 A;  3SS5 A;  1MWR A;  4FH2 A;  4Y7P A;  1W8Q A;  2G2W A;  4JGO A;  3TW8 A;  3ZG8 B;  4Y0O A;  2O99 A;  1MKM A;  4B9O A;  4KZ8 A;  2PT7 A;  1KGE A;  4OH0 A;  4Z9Q A;  4X55 A;  2NUP C;  2W1T A;  4KG6 A;  1NLZ A;  2L0W A;  1PWG A;  3IF6 A;  4MBF A;  3HJK A;  1O7E A;  1LL9 A;  4KQO A;  4IED A;  3CPT A;  1LI0 A;  3RTY A;  4ZJ1 A;  3O87 A;  5IHV A;  4QD4 A;  5EEC A;  3PAE A;  4OOL A;  3T4T A;  2HP9 A;  2R9X A;  3VP0 A;  3CZD A;  5EM1 A;  3BQ8 A;  4E3N A;  1H3Q A;  3UB5 P;  3PBT A;  1A0K A;  1K4E A;  4KQR A;  2B02 A;  3ZFZ A;  2QMI A;  1MPL A;  4ZJ2 A;  1K57 A;  1DY6 A;  2Y4A A;  3N8S A;  4S2K A;  4NEE D;  5FAT A;  2JHE A;  2JE5 A;  1WA9 A;  4QU3 A;  2KDK A;  4ETZ A;  3ZVT A;  1VHM A;  3ZG7 B;  2AVX A;  3B42 A;  4K0X A;  3NI9 A;  1TS0 A;  3GDI A;  4KZA A;  2V20 A;  1JWP A;  3IXB A;  4WEL A;  1H8Y A;  2OLV A;  2VV7 A;  1HD8 A;  4O7D A;  1FSY A;  3T1R A;  1S1Y A;  4KUK A;  4EET B;  4OLG A;  5U47 A;  5HAR A;  1IKG A;  2KOI A;  4EXO A;  4LLO B;  4IHQ A;  3WS0 A;  1F98 A;  4E3O A;  4EER A;  5TJJ A;  1N9B A;  2HGV A;  2JKT I;  2EA9 A;  2G7U A;  4OOM A;  2J3T C;  3ZQ5 A;  4JGR A;  4UA7 A;  2KLI A;  2P74 A;  3CMZ A;  1XXM A;  3NJA A;  4WEJ A;  2ZMA A;  2WZZ A;  3UY6 A;  2XFS A;  4IVI A;  2XSS A;  2VGL M;  3OZH A;  2QJ7 A;  4MDZ A;  5DTK A;  2WGW A;  5J7E A;  1NRF A;  2ZQ8 A;  4UQI M;  5CEB A;  4R70 A;  1W63 M;  4RYE A;  1N4O A;  5L8M A;  3M2K A;  5TBM B;  2WKH A;  4ARZ B;  2M7V A;  5FA7 A;  2IWC A;  3W2Z A;  1PZO A;  4FH4 A;  1XFN A;  3LIF A;  5DJU A;  1WYC A;  2PR6 A;  1K38 A;  4WYY A;  2J3T D;  1J9M A;  4I3J A;  3UO9 A;  4GD8 A;  4JPM A;  4M4X A;  5AQ7 A;  2ZQ9 A;  1T1A A;  3T4J A;  4DN0 A;  2EX6 A;  2DCF A;  5EOE A;  1SHV A;  3MXQ A;  5DKK A;  1IYP A;  2PR5 A;  4HBU A;  3DTK A;  3BJN A;  3H9W A;  1CK3 A;  2JKF A;  2P9V B;  1SCW A;  3C2W A;  4Y2F A;  3VE3 A;  3GRJ A;  3S7O A;  4ZTK A;  3TJZ C;  1FIK A;  5AQ9 A;  2WYX A;  3ULF A;  5FSR A;  1UGU A;  2K2N A;  4ZRR A;  3HL9 A;  5TFQ A;  3T1S A;  4OP5 A;  1S4S A;  4OLD A;  5EM0 A;  1P9W A;  3KSF A;  4G3W A;  3PBQ A;  1BLH A;  1K54 A;  5L07 A;  5D3O A;  1S0W A;  3NDG A;  4DRT A;  4GS9 B;  4FTX A;  3KSG A;  3UPO A;  4IBX A;  4GHI A;  4N9L A;  3SH9 A;  4RX2 A;  4N92 A;  1IEM A;  1PWC A;  4LFU A;  1TVF A;  2IWD A;  4GDN A;  3EQV A;  4E6X A;  5CHU A;  3BFD A;  3N7W A;  2DNS A;  3MMH A;  4LRX C;  2VJW A;  2R78 A;  1XX2 A;  5CEC A;  3LR4 A;  1HZO A;  4NXB A;  4P6Z M;  3IT9 A;  2XR0 A;  2V9A A;  3F1O B;  4L0L A;  3Q1F A;  5J3W A;  2D01 A;  1OT9 A;  2GJ3 A;  4XT2 A;  2Y2I A;  2VGK A;  1YKD A;  4IBR A;  1F2K A;  3T4O A;  2D02 A;  3QP8 A;  3F1P B;  4NK3 A;  3EOI A;  4OQH A;  3LIE A;  3MQO A;  1GSX A;  4E3M A;  1EWZ A;  3LR5 A;  5EV0 A;  1L0G A;  1JNU A;  3PXP A;  4OP8 A;  1VET A;  1SKO B;  3VSL A;  5FQ9 A;  4FUW A;  4DE0 A;  5HWW A;  3H82 B;  4GLQ A;  4S2L A;  3LEZ A;  3HBR A;  4GNU A;  2HF6 A;  4HQA A;  2ZJ9 A;  4X53 A;  4IVK A;  3SOI A;  1HTZ A;  4ZAM A;  1MBL A;  2L4R A;  1ERM A;  2YKH A;  2Y2L A;  4Y15 A;  3JYI A;  4N1H A;  1FOF A;  4JXW A;  3T4Q A;  1ONH A;  4QHC A;  1JWV A;  1P0Z A;  4X56 A;  3W4Q A;  4BBV A;  4R6L A;  5I94 A;  4GJ4 A;  2OWJ A;  2H0Y A;  4O01 A;  1BSG A;  4I38 A;  2XA7 M;  4X1M A;  3FPW A;  4IUH A;  5DFX A;  1KE3 A;  2C5W B;  2A24 B;  4KQQ A;  3NDE A;  3S7Q A;  4EBN A;  2PDR A;  4A5R A;  3WRZ A;  2ZQ7 A;  3BY8 A;  3LI9 A;  2JBF A;  4R0Q A;  3KYZ A;  1YLY A;  1WYB A;  1UWP X;  4B93 A;  3OCN A;  3MQQ A;  2FFY A;  5AQA A;  2QJ5 A;  1BLC A;  1OT6 A;  1BLP A;  1K0K A;  3E0Y A;  2DRW A;  2B18 A;  3PTE A;  3LUQ A;  1XJ6 A;  5A8B A;  3OPL A;  3I7J A;  1GHI A;  4QJG A;  4LEN A;  4UQI S;  2ZOH A;  1L0D A;  3C5A A;  1VET B;  3UPN A;  4HHD A;  4X25 A;  5DFY A;  4DXB A;  3P7N A;  1KDS A;  1K25 A;  1PWD A;  3HLB A;  2XD1 A;  3CUE A;  4WF0 A;  1CQA A;  3L9K A;  1BZA A;  4LPZ A;  5HX9 A;  4Y0U A;  1T18 A;  2J80 A;  3QHY A;  1ZKJ A;  3MZE A;  3D9Y A;  2Y2P A;  5F6A A;  1TF1 A;  3G4P A;  3R4K A;  4L9F A;  1FQG A;  1FCM A;  2G2U A;  3IBJ A;  3OBF A;  4NXF A;  3MR0 A;  4YWZ A;  4PHT A;  4DF6 A;  1ZG6 A;  3HUM A;  3CHW P;  1KE4 A;  5EOO A;  1EI5 A;  5CTN A;  4KUO A;  4XUZ A;  1YSQ A;  1FR6 A;  1Z09 A;  4LRY C;  3IF5 A;  5CHM A;  4MN6 A;  3OC2 A;  1H8Z A;  3FYZ A;  1LL8 A;  5EVI C;  4U0T A;  2V0U A;  2VV6 A;  4C75 A;  3B47 A;  4OON A;  1S66 L;  2HDU A;  3E4Q A;  4PKY G;  1IEL A;  1G68 A;  3HLF A;  1I2S A;  3LYX A;  3A3F A;  3N6I A;  4BJP A;  5L09 A;  1GCE A;  1YLW A;  3GVB A;  2IA2 A;  3K3D A;  3S4X A;  3UDX A;  2V0W A;  2RL3 A;  3DTE A;  4H6J B;  2ZBB A;  4S2N A;  3R7W B;  3JPU A;  3BFE A;  3S7N A;  5GHY A;  3PBS A;  5GHZ A;  1G6A A;  1NY0 A;  3BLM A;  3IQA A;  4Q8I A;  3ZCZ A;  5CX7 A;  1I5Q A;  2BLS A;  4MCW A;  4JXG A;  3S7P A;  5C5K A;  4P6Z S;  3FPV A;  4ZBE A;  3Q81 A;  3HCY A;  2QKP A;  4G3V A;  3EQU A;  3A3J A;  2PYP A;  1ES2 A;  2JKG A;  4NKP A;  5FAS A;  3Q7V B;  2EWW A;  4HOI A;  5GHX A;  3EGD C;  3VOY A;  3F1N B;  4BBU A;  4GOG A;  1X0O A;  3LIA A;  2OAP 1;  4LV3 A;  3LR0 A;  5CRF A;  1VEU B;  3DWK A;  2XDM A;  2GX5 A;  1XP4 A;  5TBM A;  2Y2K A;  3S1Y A;  2PU2 A;  1NRJ A;  4ARZ A;  3RXX A;  5BOH A;  4PM9 A;  3UB8 A;  2Z6D A;  3NCK A;  4JF5 A;  4BWI A;  1DRM A;  2I9V A;  4KG5 A;  1I2W A;  1ERO A;  4PMA A;  4E3J A;  1RCJ A;  3OPP A;  5IT5 A;  4HNB A;  5EVI B;  4JKT A;  1YT4 A;  3PBO A;  4P0M A;  1BUL A;  1Q2Q A;  2ZD8 A;  3LY4 A;  1N9L A;  3A3D A;  4GZB A;  2P9V A;  4WL9 A;  4MLL A;  1SDE A;  3SS3 A;  4R3B A;  5GLA A;  3A0S A;  4KZ9 A;  5HD5 A;  1LSX A;  2Q9M A;  1DP9 A;  3ICY A;  2XA7 S;  2VV8 A;  3LEQ A;  3E2K A;  4KZ4 A;  4OQG A;  1W79 A;  5KZH A;  3A0R A;  3LCE A;  4H8R A;  4S2P A;  3VFF A;  3G30 A;  2OWH A;  3U4L P;  2Y2G A;  2HJ9 C;  4XXR A;  4GS9 A;  1TS8 A;  3IHA A;  3EEH A;  4ZDX A;  1CEG A;  2J7V A;  2EXA A;  5IU1 A;  4O0P A;  5F5Y A;  1DJB A;  5F69 A;  2W3G A;  5HPI A;  1LI9 A;  1RGZ A;  3GTC A;  4OOY A;  4OPY A;  2B5R A;  3NHQ A;  5HAI A;  1QME A;  2KX6 A;  4GCZ A;  2VKS A;  1BYW A;  2QPN A;  4BL3 A;  3HRE A;  4Y13 A;  5HZH A;  2CMN A;  2OOL A;  1E3U A;  4UHU A;  5HWV A;  1G6O A;  4KZ3 A;  2BAS A;  5DJT A;  5CTM A;  5FQK A;  3UE3 A;  2ZC4 B;  5J4E A;  1E25 A;  3QP1 A;  4HY8 A;  4ME4 A;  1K55 C;  3ZG5 A;  5JYO A;  1FSW A;  3RFB A;  3F1O A;  5F83 A;  2JC7 A;  2W3F A;  1BT5 A;  4BEN A;  1N9O A;  2O9A A;  3F1P A;  1QMF A;  4DXC A;  2WGV A;  1H8M A;  1E3U D;  3NOP C;  1TDL A;  3HJI A;  5M19 A;  5M1A A;  4YIN A;  3V67 A;  3UN7 A;  4I3I A;  2P04 A;  4BD0 A;  4DJ3 A;  2Y2O A;  1S6R A;  5CGX A;  1SKO A;  3VMA A;  3PAG A;  2EX2 A;  1LSV A;  3A0V A;  2XEP A;  2W1R A;  2YKF A;  2HDS A;  2PBY A;  4XUX A;  3IWQ A;  3H82 A;  2M1C A;  1XA1 A;  1NZO A;  1YMX A;  2Z2M B;  3MQ0 A;  4DKI A;  4EQ1 A;  2EX8 A;  4QY6 A;  1M40 A;  3GR2 A;  3G35 A;  1PW1 A;  3NC8 A;  1E4D A;  1T1C A;  4I3A A;  1PW8 A;  3SH8 A;  4C3Q A;  5FEF A;  1NLY A;  3UDI A;  2VZW A;  2H5S A;  5FAO A;  2ZQA A;  4ID4 A;  4PM7 A;  2E8I A;  2XD5 A;  3BM6 A;  2WKP A;  3UB7 A;  1ALQ A;  2Q9N A;  1PIO A;  2UWX A;  4HP9 A;  3FWL A;  2ZC5 B;  4EU0 A;  2HJE A;  4KQD A;  4UAA A;  1MY8 A;  2W3H A;  1OTB A;  2MJ6 A;  3HLC A;  1BLS A;  5FAP A;  1ESI A;  3ITA A;  1OPX A;  4HIA A;  3KO6 A;  2A24 A;  3BYD A;  2EXB A;  5CXW A;  4R1G A;  2PAV P;  1D06 A;  3V50 A;  5DKL A;  3TOI A;  2EX9 A;  1XFQ A;  3LGO A;  5GLD A;  1OJG A;  1YPR A;  2QYB A;  2VK3 A;  5GLB A;  1YM1 A;  2I72 A;  3A3I A;  1TS6 A;  4LCM A;  4F3L B;  5MC7 A;  5FI7 A;  1K56 D;  1ODV A;  2PYR A;  4RQ9 A;  3KX0 X;  2QHK A;  1BUE A;  2Y2Q A;  4WUJ A;  1XKZ A;  2V1B A;  2HDR A;  3B33 A;  1PI4 A;  2Y2M A;  3BFC A;  3IX3 A;  4NXG A;  1YLP A;  1D7E A;  4FD8 A;  5A93 A;  1U60 A;  3PHY A;  3UB6 A;  1CI9 A;  2XH9 A;  2W3E A;  4I39 A;  2O0Y A;  4GW9 A;  5DF9 A;  3D3O A;  2WUQ A;  2FH5 A;  3C7V A;  1IYQ A;  5CED A;  3WS2 A;  4CPK A;  5FQI A;  3MZF A;  3S22 A;  3W8K A;  2PD8 A;  5K5B A;  1NZU A;  4OPZ A;  4E04 A;  2J9O A;  1P97 A;  2Y2J A;  3P01 A;  2ZL1 B;  4CLC E;  2XLN A;  1F9I A;  5KMW A;  1CI8 A;  2Z6C A;  3MKE A;  2OSU A;  4HH3 A;  5G4Y A;  5F1F A;  3E98 A;  1CEF A;  3G2Y A;  3W4P A;  1YSP A;  4CJN A;  2K7S A;  4FOF A;  4DE1 A;  3WWX A;  2XRO A;  1DP8 A;  4EBL A;  2L1M A;  4JF4 A;  5IS1 A;  3UE6 A;  4EWF A;  2ZC3 B;  4WEK A;  2M7U A;  4RVA A;  3LO7 A;  4DDY A;  4NG2 A;  5HWT A;  3LID A;  4FCF A;  5LBR A;  2Q0O A;  4E6W A;  2ZQC A;  4CLC C;  3OOV A;  4EUZ A;  1PFL A;  4WZ5 A;  5HDS A;  3VSK A;  3NUL A;  4UA6 A;  4C6Y A;  5M18 A;  2VGL S;  4HP4 A;  2NUT C;  3AGD A;  4X68 A;  4F94 A;  4WN5 A;  3SS4 A;  5DTT A;  4H6J A;  3ZNT A;  3DTI A;  3O86 A;  1K6S A;  3NOT C;  3R7W A;  3O88 A;  1Y4O A;  4OKP A;  1Z6F A;  5HFO A;  5E2G A;  3PYP A;  3IS2 B;  2WKE A;  4E3L A;  3N4I A;  5FDS A;  1S4R A;  4G3K A;  2OLU A;  4HBT A;  5AVF A;  5E2F A;  4HJ6 A;  4MMN A;  1SZV A;  1SKF A;  4IJG A;  3CUE C;  2V2F F;  3MFD A;  2BG1 A;  1NXY A;  4PAU A;  2ZLY A;  3ZYT A;  1YMS A;  4CLC D;  5AJG A;  5G18 A;  1KOU A;  1ERQ A;  4HH2 A;  1JVJ A;  3HUO A;  3Q7V A;  3BWL A;  3QNB A;  2WKQ A;  3F1N A;  4EV4 A;  1T19 A;  4YNR A;  2E8J A;  2X01 A;  3DTM A;  2PHY A;  3QP2 A;  1VEU A;  2Y91 A;  3D72 A;  5KIZ A;  3GMW A;  4BL2 A;  4EW7 A;  2JCH A;  3E4O A;  2K31 A;  3OPH A;  2ZC6 B;  3LI8 A;  1JWZ A;  2OV5 A;  1LSW A;  1YLT A;  5TR7 A;  2H10 A;  4AFI A;  2Y79 A;  4K08 A;  2Y55 A;  1MC0 A;  2PD7 A;  5HSQ A;  3MBZ A;  4PM5 A;  3MF0 A;  5HW3 A;  1PZP A;  3KSH A;  5EVI A;  2A2L A;  3G6O A;  5FL3 A;  2BTF P;  3BQA A;  3ZHH A;  2RCX A;  4LRZ E;  3VP1 A;  2O9B A;  3LFV A;  4ETX A;  1DJA A;  4Y3I A;  3CAX A;  3UPP A;  1OTE A;  3VE4 A;  4CLC B;  4JXV A;  1XJ4 A;  1ZHH B;  1RP5 A;  3G34 A;  2HV1 A;  3LIC A;  1YLJ A;  1P9R A;  1OJ5 A;  1VM1 A;  3UE1 A;  4BMW A;  5EVI D;  5FQM A;  1IOU A;  1FCN A;  1ES5 A;  3TRC A;  2VGJ A;  4R38 A;  3N8R A;  1GA0 A;  1H0M A;  3RXW A;  3SZT A;  5L2F A;  5FEG A;  4QB8 A;  4EQI A;  1TD5 A;  4CQH A;  4JGQ A;  1TDG A;  3JVU A;  4ESP A;  1SDN A;  5A90 A;  4UA9 A;  4BBT A;  2XK1 A;  1L0F A;  3MSH A;  4WMC D;  5FI2 A;  4WBG A;  3IX8 A;  4QY5 A;  4GN2 A;  1PYY A;  2PBD P;  3ZGA B;  2CC1 A;  2HDQ A;  4PPR A;  2X02 A;  3IF6 C;  4OQ0 A;  5CHJ A;  4MN5 A;  2LB9 A;  4WM9 A;  2XRN A;  4GD6 A;  3H7W B;  5FAQ A;  4R3A A;  2QWS A;  4PKY A;  1CF0 A;  4GB7 A;  1GSV A;  1FR1 A;  3GSG A;  5FDH A;  3PR6 A;  4DJ2 A;  4EES A;  2ACG A;  2A3U A;  2VLG A;  5AVE A;  2JN7 A;  2ZM8 A;  2W0N A;  1IYS A;  3IXH A;  4HJ4 A;  4EBP A;  3VOZ A;  5F1G A;  1MWT A;  1KVM A;  3DBA A;  1K57 C;  3HLE A;  1LHY A;  2Y59 A;  1PI5 A;  3QNC A;  4WLA A;  3G31 A;  5FQQ A;  4DE3 A;  5HAQ A;  4KZ7 A;  4R4R A;  3T1Q B;  3FKV A;  5AQB A;  3ZDJ A;  1Q2P A;  4LGW A;  2A49 A;  3QP5 A;  1D1J A;  3QP4 A;  5A92 A;  2P7J A;  3NY4 A;  1MWS A;  1VB6 A;  3DAV A;  4L9E A;  2WK0 A;  4EEP A;  5KSH A;  2OAQ 1;  2ZMF A;  2HZ5 A;  2UV0 E;  2ZMV A;  3Q7Z A;  3EEA A;  4JBF A;  3LR3 A;  3Q07 A;  1KE0 A;  3G32 A;  1XPB A;  2JKT M;  4S2M A;  3OCL A;  2V8F A;  4N1X A;  4KZ5 A;  4LV1 A;  3SW1 A;  1W5D A;  3E4P A;  3T50 A;  3WS1 A;  4OPR A;  4PM8 A;  5HDD A;  1FCO A;  4S2O A;  1F5M A;  2J9P A;  4IUK A;  1XA7 A;  1IKI A;  1OME A;  4E3K A;  3PBN A;  2Y2H A;  3T1X A;  2W1T B;  3IF6 B;  3CJM A;  4B88 A;  5HPF A;  3CPT B;  2IWB A;  2WAD A;  3HVF A;  4EEU A;  3GEC A;  4JGP A;  4KZB A;  4F3L A;  1GA9 A;  3UNW A;  1K55 A;  2PRF A;  3FG8 A;  2INW A;  4RA7 A;  4HEF A;  2WKR A;  3OPR A;  2XF3 A;  4OPQ A;  3RJU A;  5HD3 A;  3AGF A;  3D4F A;  1CJF A;  3N8L A;  1MKI A;  4P6B A;  2PU4 A;  5FI6 A;  1IFQ A;  3L7H A;  1GHM A;  3MFX A;  4LV2 A;  1XJ3 A;  2V8C A;  3NIA A;  4KEN B;  2FFF B;  3C30 A;  1JTG A;  4DDS A;  3KSI A;  4NET A;  3K2N A;  3GV9 A;  4S2J A;  4MBK A;  1L0E A;  3FC7 A;  3TE8 A;  1UWN X;  1K54 C;  4MN7 A;  4UEY A;  2GZA A;  4E3I A;  1NYM A;  5HAP A;  3CWF A;  2ZL1 A;  2JKR M;  5J8X A;  2X71 A;  2JKR I;  4DMZ A;  3C7U A;  3HUN A;  4BD1 A;  4RX3 A;  3BEC A;  1BTL A;  4ZJ3 A;  5F82 A;  1W63 Q;  1N9N A;  3VP3 A;  2HPB A;  3HLG A;  1JTD A;  1ACF A;  1K56 A;  5DTS A;  3CIT A;  2GNX A;  4GKU A;  2EFU A;  2WGW B;  3GQZ A;  3ISG A;  3HLD A;  1RGY A;  4U3T A;  1YLZ A;  4X69 A;  3WS4 A;  1IYO A;  1ES4 A;  5HL1 A;  4DE2 A;  4FSF A;  2WAF A;  3K3C A;  3T12 B;  3ZNY A;  3NBL A;  4WZ4 A;  4U0X A;  4K0W A;  4KG2 A;  5GLC A;  3IXG A;  4LV0 A;  2Y2N A;  3LIB A;  4L9G A;  1W7F A;  3IWI A;  4Q0J A;  5F68 A;  5E2E A;  3C8C A;  3MZD A;  1XGJ A;  3HLW A;  4M3K A;  4MBH A;  3CG5 A;  2LB5 A;  3NEC A;  3MKF A;  1C3B A;  1PNE A;  2H0T A;  3M6H A;  3W4O A;  2W3D A;  4HJ3 A;  1L2S A;  3BW6 A;  4Q0I A;  1HLU P;  2ZC7 A;  1EW0 A;  3IWO A;  3IS2 A;  5E43 A;  2VX8 A;  2EWV A;  3M6B A;  3QP6 A;  3VFH A;  3VV4 A;  3V3S A;  1GSW A;  2Y8H A;  1ONG A;  3RH8 B;  4JLF A;  1V9Z A;  5CGS A;  1MZU A;  3MXR A;  1ZC2 A;  4S2I A;  5EUA A;  3UB9 A;  1DJC A;  3VP4 A;  5CER A;  1V9Y A;  5E2H A;  1NJ4 A;  1XJ2 A;  3VP2 A;  3P09 A;  3FKW A;  1L3L A;  3ITB A;  1AXB A;  1G28 A;  3EGX C;  3IH9 A;  2J3W A;  2WKI A;  3M2J A;  4N9K A;  1AWI A;  1NYY A;  4JXS A;  3UDF A;  4O8G A;  3EWK A;  1ES3 A;  4MNR A;  4Y5F A;  4GHI B;  3C4O A;  5DVA A;  3C38 A;  3SH7 A;  1TS7 A;  2B95 A;  1K4F A;  2WAE A;  5HL6 A;  4Q0H A;  3O3V A;  4LCL A;  1G5U A;  1OTD A;  1KDW A;  2C6W B;  1LLB A;  3E2L A;  4Y0T A;  2GDN A;  3BFG A;  5I5L A;  1KVL A;  3V39 A;  3P98 A;  3ZG9 B;  2WGI A;  1J3W A;  4QPR A;  4YFM A;  4X1L A;  2VEA A;  5CGW A;  3TSG A;  2HP5 A;  4GDB A;  3T4K A;  4PM6 A;  1ZTU A;  3NOU C;  2VA0 A;  3TG9 A;  4WZ5 C;  3V3R A;  3VOL A;  4BQM A;  4CLC A;  1ESU A;  3IBR A;  4XT2 B;  5TGF A;  3ZG0 A;  4MEZ A;  4I5S A;  4JF6 A;  3WS5 A;  2WZX A;  1HVB A;  3WRT A;  4D60 A;  3PBR A;  1H5X A;  2DMW A;  2R9W A;  5HDC A;  2ZOI A;  5JYP A;  1Y54 A;  5A91 A;  3FZC A;  1XGI A;  1KGG A;  3DWZ A;  3UMD A;  4K91 A;  2O9C A;  1KGF A;  3BY9 A;  4Y17 A;  1OTI A;  2ZM0 A;  4D2O A;  2H28 A;  4HI4 A;  3ZVW A;  3IHB A;  1DP6 A;  3AGE A;  1STZ A;  2V1A A;  1FIL A;  3U2A A;  4Z1W A;  3H7W A;  4OQI A;  5EFW A;  1NWZ A;  3C4P A;  3IXD A;  2HP6 A;  1YAX A; 
#chains in the Genus database with same CATH homology
 2W0N A;  4I3I A;  2P04 A;  2HF6 A;  4DJ3 A;  4HQA A;  4HJ4 A;  1LSV A;  3A0V A;  3MJQ A;  2W1R A;  2YKF A;  4YOF A;  3H82 A;  2M1C A;  2L4R A;  5G4Z A;  3DBA A;  3MQ0 A;  2YKH A;  2P08 A;  4EQ1 A;  3T4Q A;  1T1C A;  4WLA A;  4I3A A;  4BBV A;  1P0Z A;  4R6L A;  4GJ4 A;  1NLY A;  2OWJ A;  4NXE A;  2VZW A;  4O01 A;  4I38 A;  2XA7 M;  1T1B A;  3FPW A;  4IUH A;  2WKP A;  3UB7 A;  3KYQ A;  4EUV A;  4II7 A;  2FZ0 A;  4HP9 A;  5DFX A;  2P7J A;  2A24 B;  1VB6 A;  4EU0 A;  2HJE A;  3OLO A;  4KQD A;  4L9E A;  3CI6 A;  3S7Q A;  4EEP A;  2PDR A;  5KSH A;  3BY8 A;  2OAQ 1;  2W3H A;  2ZMF A;  3LI9 A;  1S1Z A;  3KYZ A;  1OTB A;  2MJ6 A;  2ZMV A;  3O5Y A;  3EEA A;  1OTA A;  3LR3 A;  1UWP X;  1OPX A;  4HIA A;  3KO6 A;  2A24 A;  4B93 A;  2JKT M;  3MQQ A;  3OCN A;  3T4S A;  1D06 A;  3JVV A;  5DKL A;  2QJ5 A;  3OCL A;  1XFQ A;  1OT6 A;  3SW1 A;  3E0Y A;  2B18 A;  3E4P A;  3T50 A;  1OJG A;  3LUQ A;  1Y28 A;  5HDD A;  3UME A;  1XJ6 A;  5A8B A;  1S67 L;  2QYB A;  3CLO A;  1F5M A;  4IUK A;  2W27 A;  4UQI S;  2ZOH A;  1LT0 A;  3PBN A;  3T4L A;  1TS6 A;  4F3L B;  2W1T B;  4HHD A;  5DFY A;  5MC7 A;  3P7N A;  4JGO A;  1ODV A;  3TW8 A;  2PYR A;  4RQ9 A;  3CUE A;  5HPF A;  3KX0 X;  2O99 A;  1MKM A;  2QHK A;  4B9O A;  4WF0 A;  2PT7 A;  4WUJ A;  4EEU A;  3GEC A;  4LPZ A;  2V1B A;  1T18 A;  4JGP A;  2NUP C;  4F3L A;  2J80 A;  3B33 A;  2W1T A;  1NLZ A;  2L0W A;  3HJK A;  3FG8 A;  2INW A;  2WKR A;  4KQO A;  4NXG A;  5F6A A;  1D7E A;  1TF1 A;  3R4K A;  4L9F A;  5HD3 A;  3IBJ A;  3OBF A;  3RTY A;  3PHY A;  3UB6 A;  4NXF A;  3MR0 A;  1IFQ A;  4YWZ A;  2W3E A;  4I39 A;  2O0Y A;  4GW9 A;  4PHT A;  3MFX A;  5DF9 A;  3D3O A;  2FH5 A;  1XJ3 A;  4OOL A;  3T4T A;  3C30 A;  4KUO A;  2PD8 A;  5K5B A;  1YSQ A;  3KSI A;  3BQ8 A;  4E04 A;  1H3Q A;  3K2N A;  1P97 A;  4LRY C;  3P01 A;  3FC7 A;  3PBT A;  4MN6 A;  3OC2 A;  3TE8 A;  4CLC E;  2B02 A;  1F9I A;  2Z6C A;  5G4Y A;  1LL8 A;  1UWN X;  4HH3 A;  3E98 A;  2V0U A;  4NEE D;  4MN7 A;  4UEY A;  2VV6 A;  2JHE A;  3B47 A;  2GZA A;  1YSP A;  1S66 L;  1WA9 A;  3E4Q A;  2KDK A;  4ETZ A;  2K7S A;  4PKY G;  3CWF A;  4FOF A;  2JKR M;  1VHM A;  3B42 A;  2XRO A;  1DP8 A;  2JKR I;  4DMZ A;  1TS0 A;  3LYX A;  2L1M A;  3GDI A;  4WEL A;  5IS1 A;  3UE6 A;  4BJP A;  2VV7 A;  4WEK A;  2M7U A;  1S1Y A;  5HWT A;  3LID A;  4KUK A;  2IA2 A;  1W63 Q;  4EET B;  1N9N A;  3K3D A;  5LBR A;  2V0W A;  2KOI A;  4H6J B;  4EXO A;  2ZBB A;  4LLO B;  4IHQ A;  4CLC C;  1F98 A;  3R7W B;  3CIT A;  4EER A;  3OOV A;  5TJJ A;  2GNX A;  2HGV A;  2JKT I;  3S7N A;  2EA9 A;  2G7U A;  4OOM A;  5HDS A;  3PBS A;  2J3T C;  3ZQ5 A;  4FSF A;  2VGL S;  4JGR A;  4HP4 A;  2KLI A;  3K3C A;  3NJA A;  2NUT C;  4WEJ A;  5CX7 A;  4WN5 A;  2XSS A;  4MCW A;  4H6J A;  2VGL M;  2QJ7 A;  4MDZ A;  3NOT C;  3R7W A;  3S7P A;  5C5K A;  3LIB A;  5J7E A;  4P6Z S;  3FPV A;  4L9G A;  4Q0J A;  3HCY A;  3PYP A;  2QKP A;  3IS2 B;  5F68 A;  4G3V A;  4UQI M;  3C8C A;  1S4R A;  3EQU A;  4G3K A;  4R70 A;  2PYP A;  1W63 M;  4NKP A;  5AVF A;  5L8M A;  2LB5 A;  4HJ6 A;  5TBM B;  4MMN A;  2W3D A;  4HJ3 A;  2EWW A;  4HOI A;  4ARZ B;  2M7V A;  3EGD C;  4IJG A;  3CUE C;  3F1N B;  4BBU A;  3BW6 A;  3W2Z A;  4Q0I A;  1EW0 A;  3IS2 A;  1X0O A;  4PAU A;  3LIA A;  1XFN A;  3LIF A;  2OAP 1;  3ZYT A;  4CLC D;  3LR0 A;  5AJG A;  2VX8 A;  2EWV A;  5DJU A;  2PR6 A;  2GX5 A;  3VV4 A;  5TBM A;  1KOU A;  2J3T D;  4I3J A;  4HH2 A;  1GSW A;  2Y8H A;  4M4X A;  1NRJ A;  3RH8 B;  4ARZ A;  3BWL A;  2WKQ A;  3UB8 A;  1T1A A;  3T4J A;  4DN0 A;  2Z6D A;  3F1N A;  1V9Z A;  3MXQ A;  5DKK A;  1MZU A;  1T19 A;  4YNR A;  3UB9 A;  4BWI A;  1DRM A;  2PR5 A;  2PHY A;  2I9V A;  3BJN A;  3D72 A;  5KIZ A;  1V9Y A;  3H9W A;  4EW7 A;  1XJ2 A;  3E4O A;  5IT5 A;  2K31 A;  4HNB A;  3C2W A;  4Y2F A;  3VE3 A;  1G28 A;  3LI8 A;  3EGX C;  2J3W A;  1LSW A;  3S7O A;  3TJZ C;  4AFI A;  2Y79 A;  3ULF A;  1UGU A;  3PBO A;  2K2N A;  4K08 A;  4ZRR A;  1MC0 A;  4O8G A;  1N9L A;  2PD7 A;  3EWK A;  1S4S A;  5HSQ A;  4WL9 A;  3MF0 A;  4Y5F A;  1P9W A;  3KSF A;  4GHI B;  3A0S A;  4G3W A;  3PBQ A;  3C38 A;  3KSH A;  1TS7 A;  5HD5 A;  1LSX A;  2A2L A;  3G6O A;  5FL3 A;  1DP9 A;  5HL6 A;  3ICY A;  3BQA A;  2XA7 S;  4Q0H A;  2VV8 A;  4LRZ E;  2O9B A;  4GS9 B;  1OTD A;  3LFV A;  4ETX A;  3KSG A;  4Y3I A;  3CAX A;  1OTE A;  4GHI A;  3A0R A;  3VE4 A;  5I5L A;  4CLC B;  2OWH A;  2HJ9 C;  4QPR A;  1XJ4 A;  1ZHH B;  2VEA A;  2HV1 A;  3LIC A;  1P9R A;  4GS9 A;  3T4K A;  1TS8 A;  1OJ5 A;  3EEH A;  3EQV A;  1ZTU A;  3NOU C;  2VA0 A;  4BMW A;  1IOU A;  3TRC A;  4R38 A;  3VOL A;  4CLC A;  5IU1 A;  4O0P A;  3IBR A;  4XT2 B;  5F5Y A;  3MMH A;  5F69 A;  4LRX C;  2W3G A;  5HPI A;  2VJW A;  2R78 A;  1TD5 A;  4CQH A;  4I5S A;  4JGQ A;  3JVU A;  3LR4 A;  3NHQ A;  4NXB A;  4BBT A;  2KX6 A;  4P6Z M;  4GCZ A;  2VKS A;  1BYW A;  5HZH A;  2V9A A;  3F1O B;  4L0L A;  2CMN A;  5J3W A;  2OOL A;  2D01 A;  1OT9 A;  2GJ3 A;  3PBR A;  4XT2 A;  1YKD A;  5HWV A;  2DMW A;  3T4O A;  2D02 A;  5HDC A;  1G6O A;  2BAS A;  5DJT A;  3F1P B;  2ZOI A;  3EOI A;  3LIE A;  3MQO A;  3UE3 A;  1GSX A;  5J4E A;  4HY8 A;  4ME4 A;  3RFB A;  4MN5 A;  3F1O A;  2LB9 A;  2XRN A;  3LR5 A;  3H7W B;  3UMD A;  4R3A A;  1JNU A;  2QWS A;  2W3F A;  2O9C A;  3BY9 A;  1N9O A;  2O9A A;  1OTI A;  3F1P A;  4PKY A;  3PXP A;  2H28 A;  4HI4 A;  1GSV A;  5HWW A;  1DP6 A;  3PR6 A;  4DJ2 A;  1STZ A;  2V1A A;  1H8M A;  3H82 B;  4GLQ A;  3U2A A;  4EES A;  2VLG A;  4Z1W A;  3H7W A;  5AVE A;  5EFW A;  2JN7 A;  1NWZ A;  3NOP C;  3HJI A;  1YAX A;  3V67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...