4LLOB

Structure of the eag domain-cnbhd complex of the mouse eag1 channel
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
121
structure length
121
Chain Sequence
TFLENIVRRSNDTNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSACSFMYGELTDKDTVEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium voltage-gated channel subfamily H member 1
publication title The structural mechanism of KCNH-channel regulation by the eag domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 35
structure length 121
sequence length 121
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4lloB00
3MFXA 4R38A 5HWVA 4MN5A 1LSXA 2VV7A 4HH3A 2INWA 3NOTC 2L4RA 2M1CA 4EETB 4EEUA 4HP4A 3F1OB 4MN6A 3A0RA 4EXOA 3PYPA 5HD3A 1F9IA 4R6LA 2WKPA 4R3AA 3RTYA 4YWZA 5F5YA 3LIBA 1DP8A 5KIZA 1GSVA 5J7EA 2QKPA 3LIAA 1ODVA 3ZQ5A 2JN7A 1OTBA 5HD5A 3LI8A 5TBMB 4H6JB 2PD7A 3UMDA 1OT9A 4GCZA 3B33A 3ICYA 4F3LA 1T1BA 5J3WA 3F1NA 3HJKA 2W27A 2YKFA 4LRXC 5HWWA 3CWFA 4WN5A 2PYPA 5EFWA 3NHQA 1GSXA 3FC7A 5HDDA 5I5LA 5HDCA 3MXQA 2D01A 1NWZA 1N9OA 4GS9B 3BWLA 3E4OA 2V1BA 3UB7A 4DJ3A 4I38A 2W0NA 1D06A 1LT0A 5HWTA 4GHIA 3RH8B 1X0OA 4NXGA 2BASA 3UB9A 5G4YA 4XT2A 4WUJA 4JGQA 1LSWA 2KX6A 2PHYA 4HJ3A 1UWPX 3LIDA 3H7WA 4WL9A 4I3IA 2HV1A 1OTAA 5DJUA 2L1MA 2PYRA 2QJ7A 2ZBBA 1DP6A 2Z6CA 4I39A 1V9YA 4KUOA 1D7EA 1TS6A 1Y28A 1EW0A 3F1PB 2D02A 1WA9A 3EEHA 1BYWA 1XJ2A 4LRYC 4LPZA 4B9OA 2YKHA 2QHKA 1TS0A 4EW7A 3GECA 2VLGA 1XJ3A 1DRMA 2A24A 4E04A 2J80A 3LI9A 4PKYA 3LIEA 4PKYG 3G6OA 3VE3A 5F69A 2OWHA 4HHDA 2CMNA 1OTIA 1S1ZA 1UGUA 1TS8A 5HSQA 4EESA 3LYXA 3H82B 4LLOB 4HIAA 3IBRA 1OT6A 3MQQA 5DKLA 3C2WA 1T18A 3IS2B 3GDIA 1T19A 1TS7A 3OLOA 5J4EA 3VOLA 3CAXA 1LSVA 3F1OA 2I9VA 4L9FA 4BBTA 3P7NA 3NOPC 1XFQA 3EWKA 1VB6A 4HP9A 3VE4A 5F6AA 3ULFA 2V9AA 4GW9A 2B02A 4I3JA 1S4SA 1KOUA 2PD8A 1XFNA 3CLOA 4NXBA 4I5SA 5TBMA 4H6JA 1GSWA 5AVEA 1P97A 3LIFA 2QJ5A 3D72A 2ZOIA 4HNBA 4KQDA 4F3LB 4BBUA 3F1NB 1OTEA 5IS1A 2WKRA 4HQAA 1S66L 1OJGA 4GS9A 2JHEA 3LICA 5HDSA 2V1AA 3K3CA 3SW1A 4K08A 4BBVA 2Z6DA 3E4PA 4EERA 4JGRA 4EEPA 4HI4A 5HZHA 3T50A 4NXEA 1N9NA 1V9ZA 1LL8A 1DP9A 4KUKA 1G28A 3FG8A 2QWSA 4HH2A 4L9GA 4GHIB 3BY9A 1UWNX 2R78A 5A8BA 1N9LA 3MQOA 4JGOA 5G4ZA 1XJ6A 4HOIA 4XT2B 4L9EA 1OJ5A 2PR5A 3MR0A 3H7WB 3A0VA 4M4XA 3UMEA 3H9WA 3UB8A 3MJQA 2H28A 3E4QA 2EA9A 3K3DA 1T1CA 5DKKA 5AVFA 3F1PA 2ZOHA 4R70A 2VEAA 2VV8A 4WF0A 2OOLA 1JNUA 3UE6A 4NXFA 5F68A 2V0WA 2PDRA 2V0UA 4DJ2A 4WLAA 2WKQA 2P7JA 3UB6A 4HJ4A 1S1YA 5DJTA 3HJIA 3LUQA 4HY8A 2GJ3A 3KX0X 1MZUA 1S67L 2L0WA 1T1AA 4EQ1A 2PR6A 1P0ZA 2OWJA 2A24B 3PHYA 3H82A 4LRZE 2K7SA 2KDKA 4JGPA 4HJ6A 1OTDA 5IU1A 1F98A 1S4RA 3BY8A 4I3AA 3IS2A 3A0SA 1XJ4A 2VV6A 3C8CA 3NJAA 3NOUC 4RQ9A
chains in the Genus database with same CATH superfamily
3MFXA 2VV7A 1LI0A 2INWA 1NY0A 2L4RA 2EXBA 2M1CA 4EETB 3LR3A 5FQIA 4MN6A 3UPOA 3A0RA 1KGGA 4QJGA 1YQSA 1PFLA 4QU3A 3RTYA 3AGEA 2ZD8A 3FPWA 3E0YA 3MZDA 2QKPA 2VK3A 4ETXA 3LY3A 1ODVA 4UQIM 4FTXA 3VSKA 2JN7A 3OPHA 3LI8A 2XDMA 1I2SA 4PM5A 4R0QA 5TBMB 2PD7A 1OT9A 1LL9A 4GCZA 3T1XA 4ETZA 5EM1A 3A3DA 2W3HA 2W27A 5HWWA 1PW8A 5EFWA 4HBTA 3NHQA 5C5KA 3UDIA 3G30A 3FC7A 5CTMA 2Q9NA 1TEMA 3VMAA 3V50A 1PYYA 4KZ3A 3A3EA 2BTFP 4BWIA 3EGXC 1YLZA 2OSUA 3C4OA 1A0KA 3BWLA 3D9YA 3E4OA 4Y17A 4XXRA 1O07A 1FQGA 4PHTA 2W0NA 4NKPA 2A3UA 1D06A 5GLBA 5GLCA 3BRMA 3R7WA 1X0OA 2QPNA 4NG2A 3E2KA 2Y2HA 3WS5A 4JGQA 3OPRA 4WL9A 5DJUA 4S2MA 2L1MA 2ZBBA 1KGEA 1SKOA 4P85A 5DF8A 3ZHHA 4BD1A 4Y5FA 4E3JA 4I39A 3BQAA 4JXVA 3TRCA 4GDBA 3LCEA 2WKIA 4DE2A 1FSYA 3QNBA 4CJNA 5FDHA 4ESPA 2ZC5B 3G32A 1WA9A 4UA6A 5M18A 5E2FA 1NLYA 3PBSA 4B9OA 1MWRA 5KZHA 2QHKA 3A3JA 3G2YA 4U0TA 2GNXA 1XA7A 3GECA 3IX4A 3OBFA 3ZDJA 5FI2A 1S0WA 4JPMA 2QYBA 3TG9A 2A24A 1XA1A 4X6TA 1YMSA 4GNUA 4PKYG 4E3MA 5FAOA 4R4RA 5GL9A 2EFXA 5LBRA 5E2EA 4KG5A 5U47A 4FH4A 4GD8A 5A90A 3IHAA 3LYXA 4ARZA 4Q0JA 4OH0A 4E3IA 3MQQA 4NETA 3ISGA 4AFIA 3MFDA 3QP4A 2B95A 2W3DA 5EVIA 3NC8A 1GCEA 5HL6A 5J4EA 5EM0A 3BQ8A 1FCNA 1ZG4A 4LFUA 1XPBA 3IBJA 3UNWA 2WKHA 3P7NA 1BLSA 3GMWA 2J3TD 2IWCA 1XFQA 3NDEA 2ZM2A 3HVFA 4IVIA 1E3UD 1I2WA 3BFFA 2R9WA 5F6AA 3LEZA 3IWQA 2C6WB 4GW9A 2E8JA 1S4SA 1BLPA 1XFNA 3UE0A 4OP8A 3QP1A 4I5SA 3W4PA 4H6JA 3IF6A 2M7VA 3C7VA 4FSFA 4BMWA 5AQBA 3BFGA 4ZJ3A 1W79A 4B93A 4JXSA 4HNBA 4EQIA 4KZ4A 5FEFA 4LV1A 2JE5A 3F1NB 4QB8A 4ZRRA 1OTEA 4MMNA 4MCWA 1KVMA 4P6BA 1WE4A 5HDSA 1EWZA 1SKFA 4RX2A 4OVDA 2BG1A 4K08A 4DXBA 4BBVA 3E4PA 3SH8A 3QP8A 5FI7A 4NXEA 1N9NA 1DP9A 4KUKA 3UDFA 3HLBA 5A93A 2A49A 3MKFA 5EUAA 4BENA 3N8RA 1NZUA 2EWWA 2QZ6A 3GSGA 4JF5A 4R3BA 1PNEA 4K0XA 3ZNTA 3Q82A 1HD8A 4JGOA 3ZYTA 4Y13A 3FZCA 4IBXA 4E6WA 2ZQ9A 5FAPA 4QHCA 3NULA 4Q0HA 3UY6A 3P01A 4WELA 1ONGA 3UMEA 4KG6A 1W63M 2EA9A 5CRFA 2ZMVA 1Y4OA 3T4LA 2ZOHA 5DF9A 1PWGA 4CQHA 2OLVA 3QNCA 3TSGA 3EOIA 4IUHA 4WF0A 4Q8IA 2OOLA 4X68A 3ITAA 4N92A 2V0WA 4CLCC 3LR0A 2PDRA 3CPTA 2H0TA 2V0UA 4QWOA 2P7JA 4HJ4A 1S1YA 4DN0A 4DE3A 1DJAA 3WS1A 2DCFA 5HPFA 1G6AA 1CF0A 1Q2QA 2K2NA 3OPPA 3M2JA 1W7FA 2DMWA 1NJ4A 4BD0A 1DJBA 2HPBA 1K55C 2Y2GA 3W8KA 4LRZE 2K7SA 3S7OA 3KO6A 2KDKA 4DDYA 3PBRA 1TF1A 4I3AA 4WM9A 3NOUC 3NJAA 5FQ9A 2Y2PA 2Y2OA 1YLWA 2C5WB 5FL3A 3SS5A 1LSXA 2M7UA 4RYEA 5DF7A 3ITBA 1PRQA 1E3UA 4EEUA 3F1OB 1VHMA 1Y54A 2EX2A 3PYPA 2W1TA 5HD3A 4WZ5A 1F9IA 4JXWA 1ZTUA 2HDQA 2WAFA 2X71A 3N8SA 3NCKA 3IT9A 3LIBA 1DP8A 4OKPA 3T4QA 4KZ6A 2XGNA 5KIZA 3MS6A 2HP6A 3S4XA 4JXGA 5GLAA 3HLFA 5J7EA 3LIAA 1RGZA 4OPRA 4IEDA 2QMIA 3N7WA 4OONA 1TDLA 3BFEA 3IX3A 2J3TC 3GVBA 4S2NA 2PRFA 5J3WA 4KQOA 2H0YA 3NDGA 1D1JA 4UA7A 4RVAA 3ZG9B 2PYPA 4WZ5C 3AGDA 1GHMA 2B18A 3Q07A 4ZDXA 5I5LA 4YFMA 3KSIA 5HDCA 4Q0IA 1PW1A 4LGWA 3MXQA 3S22A 2HF6A 2D01A 1LLBA 3VFFA 1IKIA 3GV9A 4JF4A 1BZAA 3JPUA 2V1BA 1YMXA 4ZAMA 3UB7A 4G3WA 4P6ZM 4II7A 2WAEA 2A2LA 2Z2MB 4FH2A 1BUEA 1FCOA 1LT0A 2P74A 5HWTA 4GHIA 4IUKA 1VEUA 3RH8B 3GR2A 1WYCA 3UB9A 3G4PA 4GOGA 5KSCA 5G4YA 1K4FA 5EVEA 3BFDA 4BJPA 5EE8A 2PHYA 4HJ3A 3RXWA 1OTAA 1CEFA 2PYRA 3PR6A 2VX8A 1DP6A 2Z6CA 4UHUA 1V9YA 4EUVA 4GN2A 3T4KA 2J9PA 2V8CA 5L8MA 4FOFA 4DXCA 1D7EA 2XFSA 4KG2A 4LV0A 5IHVA 3EGDC 1W5DA 2PT7A 4M3KA 4N1XA 3BJNA 5FQKA 3WS2A 1W63Q 3EEHA 4X69A 3KYZA 1LL5A 4Y0UA 5CERA 1ES4A 4LPZA 4R3JA 1TS0A 4NEED 5FEGA 2FFYA 4EW7A 3HLWA 4GDNA 2Y91A 2RCXA 3LR5A 5HARA 1FR1A 2NUTC 1DRMA 2J80A 3LI9A 1YT4A 3RXXA 3EEAA 3GRJA 5EPHA 4HHDA 5CGXA 5FATA 1OTIA 4OQIA 1S1ZA 5D3OA 1C3BA 1TS8A 2J3WA 3ZVTA 2WGWB 5HSQA 1K56D 3BW6A 4LLOB 3ZG5A 4E3OA 3VV4A 1OT6A 3KSGA 3RJUA 2WKEA 5DKLA 3IF5A 4IJGA 3HL9A 1MBLA 3IS2B 2VJWA 1T19A 5AQAA 5EVLA 2Y2MA 3DTEA 2PAVP 4ID4A 2XR0A 4MNRA 3Q7ZA 1PZOA 1VETA 2WUQA 4C3QA 4KZAA 1HTZA 1K57A 4HP9A 3MZFA 2EFUA 4X56A 1BLHA 4GB7A 1NRJA 3HLGA 2XROA 2Q0OA 2XSSA 2HJEA 4YOFA 3N6IA 4GLQA 4CLCD 3V5MA 1MKIA 1ES3A 5F1FA 1L0EA 3IXGA 3LY4A 2QJ5A 3M6HA 2ZOIA 2AVXA 3LEQA 2FFFB 3QHYA 3V3RA 1QMFA 4XUZA 4BBUA 4YINA 5JYPA 1PI4A 3OC2A 3VP4A 1K57C 2OLUA 4HQAA 4JBFA 1SDNA 3VP0A 2ZQAA 2JC7A 2GX5A 1ACFA 4GS9A 3T12B 4E3LA 3K3CA 1G5UA 3TE8A 1M40A 1IOUA 4Y2FA 4PM7A 1JVJA 4JGRA 1CJFA 2PBYA 5HZHA 1ZKJA 2W3GA 5E2GA 4QY5A 2ZC7A 1V9ZA 2W3FA 1G28A 4ME4A 1ZG6A 3BLSA 5AJGA 3LFVA 1K4EA 4Y0OA 2QWSA 2ZQ7A 3FV7A 2Y59A 4D60A 4ZJ2A 3R7WB 2R78A 5A8BA 5L09A 3SS4A 4HOIA 2LB9A 2IWBA 1HZOA 3NBLA 3TJZC 4KQQA 4L9EA 1OJ5A 5DVAA 3A3IA 3HUMA 2R9XA 3MR0A 4MBKA 4OPQA 4M4XA 3UB8A 4BL3A 1SKOB 3E4QA 3L7HA 1ZHHB 3K3DA 1NXYA 1IEMA 5AVFA 1YLJA 3F1PA 3TW8A 2XFTA 3ZCZA 5AQ9A 1SZVA 1BT5A 2VEAA 1JNUA 3UE6A 5E2HA 5L07A 1RGYA 1EI5A 1FILA 3T4OA 2HP9A 1J3WA 1XKZA 4DDSA 4Y0TA 5TJJA 4B4XA 2ZM8A 1YM1A 4IVKA 3IH9A 4Z9QA 1MWTA 5HW3A 2G7UA 1IYOA 1DY6A 4QY6A 1P9RA 3HJIA 3LUQA 3KX0X 1MZUA 1P0ZA 5DFXA 4P0MA 1K56A 2A24B 4BLMA 3H82A 4UEYA 1QMEA 4JGPA 1K6RA 4P6ZS 5IU1A 3E2LA 1F98A 2Y8HA 4ARZB 4DF6A 3N8LA 3IH8A 1XJ4A 3C8CA 5CEDA 4XUXA 4RQ9A 5TFQA 3S7PA 4N1HA 2E8IA 4BQMA 2J8YA 3O87A 5EVIB 4A5RA 4WYYA 4LENA 1Z09A 1H5XA 3K2NA 3JVUA 1L2SA 4OPZA 3UPNA 2ZL1A 4EXOA 1L0FA 2WKPA 4UAAA 4ZTKA 2WZXA 5FQQA 4U3TA 5F5YA 1RCJA 3U2AA 2G2WA 1GSVA 4CLCA 5M1AA 1IYQA 2BLSA 1AXBA 2OAQ1 4F94A 3ZQ5A 1TD5A 5GHYA 4H6JB 3MMHA 3IF6B 2EX8A 3C30A 1VQQA 4EBPA 3B33A 4EBNA 4F3LA 4MEZA 1T1BA 3O3VA 2Y2LA 3S7NA 3HJKA 4LRXC 2Z2LB 4WN5A 4OQHA 3W2ZA 1K55A 2EX9A 1GSXA 3V3SA 4JLFA 5HDDA 5CHMA 3T1SA 2ZC3B 3LGOA 1HVBA 2Y2NA 1NLZA 4MN7A 1NWZA 5FQMA 5CXWA 2P9VA 3HLDA 1MKMA 3WS4A 3HUNA 1H0MA 1SHVA 4OOYA 4FCFA 2O0YA 3OPLA 4DJ3A 1MWSA 4I38A 3PBNA 3UPPA 2J9OA 4WBGA 4KZ5A 3DWKA 4DRTA 4HBUA 5K5BA 5A92A 4XT2A 4WUJA 3LO7A 4Y3IA 5F82A 3LIDA 3H7WA 4I3IA 2QJ7A 3HLEA 3KSHA 2RL3A 4KUOA 2IWDA 4MBHA 3W4OA 3S1YA 2JKTI 1NRFA 2EXAA 1IKGA 1CEGA 1E4DA 2P04A 4X1LA 1Y28A 3NECA 1EW0A 5DTKA 1FIKA 1PWDA 1TVFA 5HAPA 3Q7VA 1XJ2A 1K0KA 4R1GA 3HLCA 3KYEA 1ERMA 5HFOA 3CPTB 2OAP1 1YLYA 2VGJA 2MJ6A 1L0GA 3ZFZA 2ZMAA 4MBFA 3SH9A 2JCHA 3A3FA 3PAGA 5AQ7A 1JWZA 4N9LA 1XJ3A 3NI9A 5F83A 4E04A 4E3NA 5J8XA 3G6OA 5F69A 1N9BA 5E43A 4WEKA 3UE1A 3DAVA 4EESA 3IQAA 2EX6A 3NY4A 1BSGA 4OP5A 1ES2A 1MWUA 2EWVA 3Q81A 3QP6A 5CTNA 4KZBA 3AGFA 4G3VA 1K54C 2VKSA 1RP5A 1MPLA 3ZG8B 5EV0A 3VOLA 2KOIA 1H3QA 3CAXA 3EQUA 5HL1A 1LSVA 3UN7A 3VSLA 2J7VA 3VOZA 3CJMA 2XQZA 2Y2JA 1J9MA 5L10A 1F2KA 4DE0A 1H8ZA 2W1TB 3VE4A 4GZBA 3ULFA 2JKGA 4I3JA 2HGVA 1YKDA 1ZC2A 1KOUA 2PD8A 3R4KA 3PBTA 1Q2PA 3CLOA 3G35A 5TBMA 1FSWA 1PZPA 1GSWA 1WYBA 2JKRI 1TDGA 4MDZA 3ZGAB 1G6OA 1JTDA 3MXRA 4KENB 2CC1A 5IS1A 3OCNA 3C38A 5GLDA 4CPKA 1S66L 3KSFA 5DFYA 4FUWA 3C5AA 2V1AA 4GJ4A 3IXDA 3SW1A 2Y2IA 4R23A 5EVID 4EERA 2ZC4B 3RFBA 4HI4A 2WYXA 2XK1A 2GDNA 5CHJA 2HDSA 3PBQA 1LL8A 5CX7A 3SZTA 3O88A 2VGLM 2JKTM 2ZMFA 2HDUA 3T4SA 1O7EA 3GTCA 2XA7S 4HH2A 4L9GA 4WZ4A 4GHIB 3BY9A 1UWNX 3ZG7B 1VEUB 1YLTA 2OV5A 3MQOA 1GA0A 5G4ZA 4B88A 3ZNYA 3CUEA 1XJ6A 2DRWA 1DJCA 4JKTA 4KZ7A 3PTEA 4S2LA 1AWIA 2Y4AA 5CECA 2HP5A 3FKVA 2PU4A 2VGKA 3BYDA 3H9WA 4KZ9A 4PMAA 3UE3A 1IFQA 1T1CA 1JTGA 5DKKA 3O5YA 3B3XA 1IELA 3WS0A 1BTLA 2WGVA 4RX3A 1ESIA 2VV8A 3G2ZA 4U0XA 2K31A 1BLCA 1FOFA 1KE0A 1IYSA 4KQRA 4EUZA 4DJ2A 1KVLA 3UB6A 3BLMA 2H10A 3CUEC 4O0PA 1CI9A 3ZG0A 2Q9MA 4OOLA 2L0WA 5HX9A 1K6SA 4YNRA 1U60A 4EQ1A 1MY8A 1PIOA 3WWXA 2Y55A 4RA7A 2HJ9C 2ZQ8A 3OOVA 1NYMA 3OZHA 2OWJA 2WK0A 4EV4A 3PHYA 1YAXA 3HUOA 3C7UA 5EOEA 1VM1A 2VZWA 2ZJ9A 4OQ0A 2GZAA 1OTDA 1JWVA 2O9AA 1KGFA 1S4RA 3BY8A 4KZ8A 3A0SA 2VV6A 3BEBA 4R38A 2XRNA 5HWVA 3OCLA 4Y15A 4MN5A 3TOIA 3CHWP 4Y7PA 3O86A 4HH3A 4O01A 2I72A 4S2OA 2JKRM 1W8QA 3NOTC 5HAQA 4HP4A 1MXOA 3ZVWA 3B47A 5A91A 1SCWA 3MBZA 2W1RA 4X1MA 4R6LA 1VETB 2JKFA 3G31A 4CLCE 4R3AA 4YWZA 1NZOA 4B4ZA 3IXBA 4PM6A 1Z6FA 1ESUA 2V1ZA 2B5RA 1F5MA 2ZLYA 3CITA 3VP3A 1OPXA 1OTBA 5HD5A 3M2KA 1M6KA 1PWCA 3DBAA 3UMDA 3MZEA 1P9WA 1E25A 3ICYA 4O8GA 2Y2KA 3F1NA 4OPYA 4LV2A 2YKFA 3BECA 3D4FA 3CWFA 2XEPA 3M6BA 5I94A 1K25A 4QPRA 4P87A 4C6YA 1KDSA 1N4OA 3FPVA 1N9OA 4GS9B 4OQGA 2V2FF 1PI5A 2FZ0A 1ES5A 2XH9A 5F1GA 4S2JA 2O9BA 3T1QB 4PM8A 1IYPA 1XP4A 1ONHA 1FR6A 3BFCA 4PAUA 2HZ5A 4LCLA 2G2UA 3U4LP 3FWLA 1YSPA 2BASA 4NXGA 1JWPA 1NYYA 3SS3A 2V8FA 1LI9A 4BL2A 3CMZA 1LSWA 1LHYA 2KX6A 1YSQA 5EVIC 1UWPX 2HDRA 2HV1A 1SDEA 4X55A 2ACGA 2Y79A 2WADA 3VP1A 3VFHA 5FASA 1ALQA 2XA7M 2XD1A 4IHQA 1TS6A 2H5SA 3SOIA 3DTKA 2PU2A 1L0DA 3F1PB 3N4IA 3PXPA 2V20A 2D02A 4NK3A 1BYWA 4IBRA 3IWOA 3PBOA 3P09A 3HREA 3FKWA 3UB5P 4DKIA 5FSRA 5EOOA 3IF6C 4ZJ1A 4LRYC 2YKHA 2DNSA 3C4PA 3IWIA 5DTSA 2VLGA 3V39A 2VA0A 2X02A 3CZDA 3S7QA 1H8MA 3EQVA 3Q1FA 2WZZA 3P98A 1FCMA 4PKYA 2O9CA 3LIEA 2WGIA 1L3LA 4S2PA 4Z1WA 3VE3A 2OWHA 3L9KA 2CMNA 5CEBA 1UGUA 2KLIA 4OLDA 5BOHA 2P08A 4PM9A 1CQAA 1XGIA 4EBLA 3H82B 1I5QA 4HIAA 3IBRA 4X53A 4PPRA 4R4SA 3V67A 3MKEA 3MSHA 1HLUP 2UV0E 3QP5A 2VGLS 3C2WA 4WMCD 1GA9A 1T18A 4GKUA 3GDIA 1TS7A 3OLOA 5G18A 3NIAA 3JVVA 1MC0A 1S6RA 3DTMA 3F1OA 1YLPA 5FQJA 4UQIS 2I9VA 4EWFA 4L9FA 4BBTA 4C75A 3NOPC 3SH7A 3EWKA 2ZQCA 3MF0A 1VB6A 3DTIA 2ZL1B 4HESA 5TGFA 5EECA 2XD5A 3I7JA 2V9AA 4L0LA 3W4QA 2B02A 5FI6A 1CK3A 5CHUA 1XX2A 4CLCB 1XXMA 4NXBA 4G3KA 3FYZA 4OLGA 1GHIA 5AVEA 1BULA 1P97A 2Y2QA 2NUPC 3LIFA 3D72A 5L2FA 4X25A 3CG5A 3KYQA 5IT5A 5HAIA 4KQDA 4F3LB 5GHXA 2WKRA 2XLNA 2ZM0A 3BM6A 1OJGA 4WEJA 3MQ0A 2JHEA 3LICA 3VOYA 5DTTA 2O99A 5GHZA 4EU0A 1ERQA 4K91A 3JYIA 3UO9A 1OMEA 1CI8A 4LV3A 1GHPA 2Z6DA 2UWXA 4GD6A 4S2KA 4EEPA 1K54A 2FH5A 2XF3A 5JYOA 5FA7A 3T50A 5HPIA 1W8YA 2P9VB 3WRZA 4E6XA 4DMZA 4K0WA 3G34A 3IHBA 1KE4A 3FG8A 4QD4A 3UDXA 5KMWA 4MLLA 1N9LA 3HBRA 4OOMA 3DWZA 4XT2B 2ZC6B 3B42A 2PR5A 3MXSA 3H7WB 3A0VA 4UA9A 1XGJA 3QP2A 5CGWA 3MJQA 2H28A 1K38A 2PBDP 3T1RA 4R70A 2LB5A 3IXHA 2ZQDA 4NXFA 2IA2A 1KE3A 5F68A 5TR7A 1H8YA 3WRTA 4WLAA 4DE1A 2WKQA 3IX8A 3Q7VB 3PAEA 4ZBEA 4O7DA 5CGSA 3VP2A 5FDSA 4FD8A 3LR4A 5DJTA 3CI6A 5MC7A 5FAQA 4HY8A 2W3EA 2GJ3A 3HCYA 4D2OA 1S67L 4S2NC 4H8RA 1T1AA 4E3KA 2PR6A 3T4JA 3GQZA 2WGWA 1G68A 1YPRA 3D3OA 1KDWA 1STZA 3E98A 5M19A 4HEFA 4HJ6A 2JBFA 4JF6A 1EROA 4WMCA 4S2IA 4LCMA 3IS2A 3DW0A 2X01A 5KSHA 3T4TA 4N9KA
chains in the Genus database with same CATH topology
3S7PA 3MFXA 4R38A 2XRNA 5HWVA 3OCLA 5FL3A 4MN5A 1LSXA 2M7UA 2VV7A 4HH3A 4O01A 2INWA 2JKRM 3NOTC 2L4RA 2M1CA 4EETB 4EEUA 3LR3A 4HP4A 3F1OB 1VHMA 3K2NA 3JVUA 3B47A 4MN6A 3A0RA 4EXOA 3PYPA 2W1RA 2W1TA 5HD3A 1F9IA 4R6LA 2WKPA 1ZTUA 4CLCE 4R3AA 3RTYA 4YWZA 3FPWA 3LIBA 5F5YA 1DP8A 3E0YA 3T4QA 5KIZA 3U2AA 1GSVA 4CLCA 5J7EA 2QKPA 3LIAA 1F5MA 4ETXA 3CITA 1ODVA 4UQIM 1OPXA 2OAQ1 3ZQ5A 2JN7A 1OTBA 1TD5A 5HD5A 3LI8A 5TBMB 3DBAA 4H6JB 2PD7A 3MMHA 3UMDA 1OT9A 4GCZA 4ETZA 3C30A 1P9WA 2J3TC 3B33A 3ICYA 4F3LA 4O8GA 1T1BA 5J3WA 3F1NA 2W3HA 3S7NA 4KQOA 3HJKA 2W27A 2YKFA 4LRXC 5HWWA 3CWFA 4WN5A 2PYPA 5EFWA 5C5KA 3NHQA 3W2ZA 4QPRA 1GSXA 3FC7A 2B18A 5HDDA 3FPVA 5I5LA 3KSIA 5HDCA 4Q0IA 3MXQA 1NLZA 4MN7A 2HF6A 2D01A 1NWZA 1N9OA 3EGXC 4BWIA 4GS9B 2FZ0A 3BWLA 1MKMA 3E4OA 2V1BA 3UB7A 4G3WA 2O0YA 2O9BA 4DJ3A 4P6ZM 4II7A 4I38A 3PBNA 4PHTA 2A2LA 2W0NA 4NKPA 5K5BA 1D06A 1LT0A 4PAUA 5HWTA 4GHIA 4IUKA 3R7WA 3RH8B 1X0OA 1YSPA 2BASA 4NXGA 3UB9A 5G4YA 4XT2A 4WUJA 4JGQA 4BJPA 1LSWA 2KX6A 1YSQA 4Y3IA 2PHYA 4HJ3A 1UWPX 3LIDA 3H7WA 4WL9A 4I3IA 2HV1A 1OTAA 5DJUA 2L1MA 2PYRA 2QJ7A 2ZBBA 3PR6A 2Y79A 2VX8A 4Y5FA 3KSHA 1DP6A 2Z6CA 4I39A 3BQAA 1V9YA 3TRCA 4EUVA 4KUOA 3T4KA 5L8MA 4FOFA 2XA7M 2JKTI 1D7EA 4IHQA 1TS6A 2P04A 3EGDC 2PT7A 1Y28A 1EW0A 3F1PB 3BJNA 3PXPA 1W63Q 2D02A 1WA9A 3EEHA 1BYWA 1XJ2A 3PBOA 3KYZA 1NLYA 3PBSA 4LRYC 4LPZA 2OAP1 4B9OA 2YKHA 2QHKA 1TS0A 4NEED 2MJ6A 4EW7A 2GNXA 3GECA 3OBFA 2VLGA 2QYBA 3LR5A 2VA0A 1XJ3A 3S7QA 2NUTC 1H8MA 3EQVA 1DRMA 2A24A 4E04A 2J80A 3LI9A 4PKYA 2O9CA 3LIEA 3EEAA 4PKYG 4Z1WA 3G6OA 3VE3A 5F69A 2OWHA 4HHDA 2CMNA 5LBRA 1OTIA 4WEKA 1S1ZA 1UGUA 2KLIA 1TS8A 2J3WA 2P08A 5HSQA 4EESA 3BW6A 3LYXA 4ARZA 3H82B 4LLOB 4Q0JA 4HIAA 3IBRA 3VV4A 1OT6A 3V67A 2EWVA 3MQQA 3KSGA 5DKLA 2VGLS 3C2WA 4AFIA 4IJGA 4G3VA 2W3DA 1T18A 2VKSA 3IS2B 2VJWA 5HL6A 3GDIA 1T19A 1TS7A 3OLOA 5J4EA 3VOLA 3JVVA 2KOIA 1MC0A 3BQ8A 1H3QA 3CAXA 3EQUA 1LSVA 3F1OA 4UQIS 2I9VA 3IBJA 4L9FA 4BBTA 3P7NA 3NOPC 2J3TD 1XFQA 3EWKA 3MF0A 1VB6A 4HP9A 2W1TB 3VE4A 5F6AA 3ULFA 1NRJA 2V9AA 4GW9A 4L0LA 2B02A 4I3JA 2HGVA 2XROA 2XSSA 1YKDA 1S4SA 1KOUA 2PD8A 3R4KA 1XFNA 2HJEA 3CLOA 3PBTA 4YOFA 4GLQA 4CLCB 4NXBA 4CLCD 4I5SA 5TBMA 4H6JA 2M7VA 1GSWA 4G3KA 5AVEA 2JKRI 4MDZA 1P97A 4FSFA 4BMWA 2NUPC 3LIFA 2QJ5A 3D72A 1G6OA 2ZOIA 4B93A 4HNBA 3KYQA 5IT5A 4KQDA 4F3LB 4BBUA 3F1NB 4ZRRA 1OTEA 3OC2A 4MMNA 5IS1A 2WKRA 3C38A 3OCNA 4MCWA 4HQAA 1S66L 3KSFA 5DFYA 1OJGA 2GX5A 4WEJA 4GS9A 3MQ0A 2JHEA 3LICA 5HDSA 2O99A 4EU0A 2V1AA 3K3CA 4GJ4A 3TE8A 3SW1A 4K08A 1IOUA 4BBVA 2Z6DA 4Y2FA 3E4PA 4EERA 4JGRA 4EEPA 2FH5A 3RFBA 4HI4A 5HZHA 3T50A 5HPIA 2W3GA 4NXEA 1N9NA 1V9ZA 3PBQA 1LL8A 1DP9A 5CX7A 4DMZA 2W3FA 4KUKA 1G28A 4ME4A 2VGLM 2JKTM 2ZMFA 3T4SA 5AJGA 2EWWA 3LFVA 3FG8A 2QWSA 2XA7S 4HH2A 4L9GA 4GHIB 3BY9A 1UWNX 3R7WB 2R78A 5A8BA 1N9LA 3MQOA 4JGOA 3ZYTA 5G4ZA 4OOMA 3CUEA 1XJ6A 4HOIA 4XT2B 2LB9A 3B42A 3TJZC 4L9EA 1OJ5A 4Q0HA 2PR5A 3P01A 3MR0A 4WELA 3H7WB 3A0VA 4M4XA 3UMEA 3H9WA 3UB8A 1W63M 3MJQA 2H28A 3E4QA 2EA9A 1ZHHB 3K3DA 3UE3A 2ZMVA 1IFQA 1T1CA 5DKKA 5AVFA 3F1PA 3TW8A 3O5YA 3T4LA 2ZOHA 4R70A 2LB5A 5DF9A 4CQHA 2VEAA 3EOIA 4IUHA 2VV8A 4WF0A 2OOLA 1JNUA 3UE6A 2K31A 4NXFA 2IA2A 5F68A 3T4OA 2V0WA 4CLCC 3LR0A 2PDRA 2V0UA 4DJ2A 4WLAA 5TJJA 2WKQA 2P7JA 3UB6A 4HJ4A 1S1YA 3CUEC 2G7UA 4DN0A 4O0PA 3LR4A 5DJTA 4OOLA 1P9RA 3CI6A 5HPFA 3HJIA 3LUQA 5MC7A 4HY8A 2W3EA 2GJ3A 2K2NA 3HCYA 1MZUA 3KX0X 1S67L 2L0WA 4YNRA 1T1AA 2DMWA 4EQ1A 2PR6A 2HJ9C 1P0ZA 3OOVA 3T4JA 5DFXA 2OWJA 2A24B 3PHYA 3D3OA 1YAXA 3H82A 1STZA 4LRZE 4UEYA 2K7SA 3E98A 3KO6A 2VZWA 3S7OA 2KDKA 4JGPA 4HJ6A 2GZAA 1OTDA 3PBRA 2O9AA 4P6ZS 5IU1A 1F98A 1S4RA 2Y8HA 1TF1A 3BY8A 4ARZB 4I3AA 3IS2A 3A0SA 1XJ4A 2VV6A 3C8CA 3NJAA 3NOUC 5KSHA 4RQ9A 3T4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MFX A;  4R38 A;  5HWV A;  4MN5 A;  1LSX A;  2VV7 A;  4HH3 A;  2INW A;  3NOT C;  2L4R A;  2M1C A;  4EET B;  4EEU A;  4HP4 A;  3F1O B;  4MN6 A;  3A0R A;  4EXO A;  3PYP A;  5HD3 A;  1F9I A;  4R6L A;  2WKP A;  4R3A A;  3RTY A;  4YWZ A;  5F5Y A;  3LIB A;  1DP8 A;  5KIZ A;  1GSV A;  5J7E A;  2QKP A;  3LIA A;  1ODV A;  3ZQ5 A;  2JN7 A;  1OTB A;  5HD5 A;  3LI8 A;  5TBM B;  4H6J B;  2PD7 A;  3UMD A;  1OT9 A;  4GCZ A;  3B33 A;  3ICY A;  4F3L A;  1T1B A;  5J3W A;  3F1N A;  3HJK A;  2W27 A;  2YKF A;  4LRX C;  5HWW A;  3CWF A;  4WN5 A;  2PYP A;  5EFW A;  3NHQ A;  1GSX A;  3FC7 A;  5HDD A;  5I5L A;  5HDC A;  3MXQ A;  2D01 A;  1NWZ A;  1N9O A;  4GS9 B;  3BWL A;  3E4O A;  2V1B A;  3UB7 A;  4DJ3 A;  4I38 A;  2W0N A;  1D06 A;  1LT0 A;  5HWT A;  4GHI A;  3RH8 B;  1X0O A;  4NXG A;  2BAS A;  3UB9 A;  5G4Y A;  4XT2 A;  4WUJ A;  4JGQ A;  1LSW A;  2KX6 A;  2PHY A;  4HJ3 A;  1UWP X;  3LID A;  3H7W A;  4WL9 A;  4I3I A;  2HV1 A;  1OTA A;  5DJU A;  2L1M A;  2PYR A;  2QJ7 A;  2ZBB A;  1DP6 A;  2Z6C A;  4I39 A;  1V9Y A;  4KUO A;  1D7E A;  1TS6 A;  1Y28 A;  1EW0 A;  3F1P B;  2D02 A;  1WA9 A;  3EEH A;  1BYW A;  1XJ2 A;  4LRY C;  4LPZ A;  4B9O A;  2YKH A;  2QHK A;  1TS0 A;  4EW7 A;  3GEC A;  2VLG A;  1XJ3 A;  1DRM A;  2A24 A;  4E04 A;  2J80 A;  3LI9 A;  4PKY A;  3LIE A;  4PKY G;  3G6O A;  3VE3 A;  5F69 A;  2OWH A;  4HHD A;  2CMN A;  1OTI A;  1S1Z A;  1UGU A;  1TS8 A;  5HSQ A;  4EES A;  3LYX A;  3H82 B;  4LLO B;  4HIA A;  3IBR A;  1OT6 A;  3MQQ A;  5DKL A;  3C2W A;  1T18 A;  3IS2 B;  3GDI A;  1T19 A;  1TS7 A;  3OLO A;  5J4E A;  3VOL A;  3CAX A;  1LSV A;  3F1O A;  2I9V A;  4L9F A;  4BBT A;  3P7N A;  3NOP C;  1XFQ A;  3EWK A;  1VB6 A;  4HP9 A;  3VE4 A;  5F6A A;  3ULF A;  2V9A A;  4GW9 A;  2B02 A;  4I3J A;  1S4S A;  1KOU A;  2PD8 A;  1XFN A;  3CLO A;  4NXB A;  4I5S A;  5TBM A;  4H6J A;  1GSW A;  5AVE A;  1P97 A;  3LIF A;  2QJ5 A;  3D72 A;  2ZOI A;  4HNB A;  4KQD A;  4F3L B;  4BBU A;  3F1N B;  1OTE A;  5IS1 A;  2WKR A;  4HQA A;  1S66 L;  1OJG A;  4GS9 A;  2JHE A;  3LIC A;  5HDS A;  2V1A A;  3K3C A;  3SW1 A;  4K08 A;  4BBV A;  2Z6D A;  3E4P A;  4EER A;  4JGR A;  4EEP A;  4HI4 A;  5HZH A;  3T50 A;  4NXE A;  1N9N A;  1V9Z A;  1LL8 A;  1DP9 A;  4KUK A;  1G28 A;  3FG8 A;  2QWS A;  4HH2 A;  4L9G A;  4GHI B;  3BY9 A;  1UWN X;  2R78 A;  5A8B A;  1N9L A;  3MQO A;  4JGO A;  5G4Z A;  1XJ6 A;  4HOI A;  4XT2 B;  4L9E A;  1OJ5 A;  2PR5 A;  3MR0 A;  3H7W B;  3A0V A;  4M4X A;  3UME A;  3H9W A;  3UB8 A;  3MJQ A;  2H28 A;  3E4Q A;  2EA9 A;  3K3D A;  1T1C A;  5DKK A;  5AVF A;  3F1P A;  2ZOH A;  4R70 A;  2VEA A;  2VV8 A;  4WF0 A;  2OOL A;  1JNU A;  3UE6 A;  4NXF A;  5F68 A;  2V0W A;  2PDR A;  2V0U A;  4DJ2 A;  4WLA A;  2WKQ A;  2P7J A;  3UB6 A;  4HJ4 A;  1S1Y A;  5DJT A;  3HJI A;  3LUQ A;  4HY8 A;  2GJ3 A;  3KX0 X;  1MZU A;  1S67 L;  2L0W A;  1T1A A;  4EQ1 A;  2PR6 A;  1P0Z A;  2OWJ A;  2A24 B;  3PHY A;  3H82 A;  4LRZ E;  2K7S A;  2KDK A;  4JGP A;  4HJ6 A;  1OTD A;  5IU1 A;  1F98 A;  1S4R A;  3BY8 A;  4I3A A;  3IS2 A;  3A0S A;  1XJ4 A;  2VV6 A;  3C8C A;  3NJA A;  3NOU C;  4RQ9 A; 
#chains in the Genus database with same CATH topology
 3MFX A;  2VV7 A;  1LI0 A;  2INW A;  1NY0 A;  2L4R A;  2EXB A;  2M1C A;  4EET B;  3LR3 A;  5FQI A;  4MN6 A;  3UPO A;  3A0R A;  1KGG A;  4QJG A;  1YQS A;  1PFL A;  4QU3 A;  3RTY A;  3AGE A;  2ZD8 A;  3FPW A;  3E0Y A;  3MZD A;  2QKP A;  2VK3 A;  4ETX A;  3LY3 A;  1ODV A;  4UQI M;  4FTX A;  3VSK A;  2JN7 A;  3OPH A;  3LI8 A;  2XDM A;  1I2S A;  4PM5 A;  4R0Q A;  5TBM B;  2PD7 A;  1OT9 A;  1LL9 A;  4GCZ A;  3T1X A;  4ETZ A;  5EM1 A;  3A3D A;  2W3H A;  2W27 A;  5HWW A;  1PW8 A;  5EFW A;  4HBT A;  3NHQ A;  5C5K A;  3UDI A;  3G30 A;  3FC7 A;  5CTM A;  2Q9N A;  1TEM A;  3VMA A;  3V50 A;  1PYY A;  4KZ3 A;  3A3E A;  2BTF P;  4BWI A;  3EGX C;  1YLZ A;  2OSU A;  3C4O A;  1A0K A;  3BWL A;  3D9Y A;  3E4O A;  4Y17 A;  4XXR A;  1O07 A;  1FQG A;  4PHT A;  2W0N A;  4NKP A;  2A3U A;  1D06 A;  5GLB A;  5GLC A;  3BRM A;  3R7W A;  1X0O A;  2QPN A;  4NG2 A;  3E2K A;  2Y2H A;  3WS5 A;  4JGQ A;  3OPR A;  4WL9 A;  5DJU A;  4S2M A;  2L1M A;  2ZBB A;  1KGE A;  1SKO A;  4P85 A;  5DF8 A;  3ZHH A;  4BD1 A;  4Y5F A;  4E3J A;  4I39 A;  3BQA A;  4JXV A;  3TRC A;  4GDB A;  3LCE A;  2WKI A;  4DE2 A;  1FSY A;  3QNB A;  4CJN A;  5FDH A;  4ESP A;  2ZC5 B;  3G32 A;  1WA9 A;  4UA6 A;  5M18 A;  5E2F A;  1NLY A;  3PBS A;  4B9O A;  1MWR A;  5KZH A;  2QHK A;  3A3J A;  3G2Y A;  4U0T A;  2GNX A;  1XA7 A;  3GEC A;  3IX4 A;  3OBF A;  3ZDJ A;  5FI2 A;  1S0W A;  4JPM A;  2QYB A;  3TG9 A;  2A24 A;  1XA1 A;  4X6T A;  1YMS A;  4GNU A;  4PKY G;  4E3M A;  5FAO A;  4R4R A;  5GL9 A;  2EFX A;  5LBR A;  5E2E A;  4KG5 A;  5U47 A;  4FH4 A;  4GD8 A;  5A90 A;  3IHA A;  3LYX A;  4ARZ A;  4Q0J A;  4OH0 A;  4E3I A;  3MQQ A;  4NET A;  3ISG A;  4AFI A;  3MFD A;  3QP4 A;  2B95 A;  2W3D A;  5EVI A;  3NC8 A;  1GCE A;  5HL6 A;  5J4E A;  5EM0 A;  3BQ8 A;  1FCN A;  1ZG4 A;  4LFU A;  1XPB A;  3IBJ A;  3UNW A;  2WKH A;  3P7N A;  1BLS A;  3GMW A;  2J3T D;  2IWC A;  1XFQ A;  3NDE A;  2ZM2 A;  3HVF A;  4IVI A;  1E3U D;  1I2W A;  3BFF A;  2R9W A;  5F6A A;  3LEZ A;  3IWQ A;  2C6W B;  4GW9 A;  2E8J A;  1S4S A;  1BLP A;  1XFN A;  3UE0 A;  4OP8 A;  3QP1 A;  4I5S A;  3W4P A;  4H6J A;  3IF6 A;  2M7V A;  3C7V A;  4FSF A;  4BMW A;  5AQB A;  3BFG A;  4ZJ3 A;  1W79 A;  4B93 A;  4JXS A;  4HNB A;  4EQI A;  4KZ4 A;  5FEF A;  4LV1 A;  2JE5 A;  3F1N B;  4QB8 A;  4ZRR A;  1OTE A;  4MMN A;  4MCW A;  1KVM A;  4P6B A;  1WE4 A;  5HDS A;  1EWZ A;  1SKF A;  4RX2 A;  4OVD A;  2BG1 A;  4K08 A;  4DXB A;  4BBV A;  3E4P A;  3SH8 A;  3QP8 A;  5FI7 A;  4NXE A;  1N9N A;  1DP9 A;  4KUK A;  3UDF A;  3HLB A;  5A93 A;  2A49 A;  3MKF A;  5EUA A;  4BEN A;  3N8R A;  1NZU A;  2EWW A;  2QZ6 A;  3GSG A;  4JF5 A;  4R3B A;  1PNE A;  4K0X A;  3ZNT A;  3Q82 A;  1HD8 A;  4JGO A;  3ZYT A;  4Y13 A;  3FZC A;  4IBX A;  4E6W A;  2ZQ9 A;  5FAP A;  4QHC A;  3NUL A;  4Q0H A;  3UY6 A;  3P01 A;  4WEL A;  1ONG A;  3UME A;  4KG6 A;  1W63 M;  2EA9 A;  5CRF A;  2ZMV A;  1Y4O A;  3T4L A;  2ZOH A;  5DF9 A;  1PWG A;  4CQH A;  2OLV A;  3QNC A;  3TSG A;  3EOI A;  4IUH A;  4WF0 A;  4Q8I A;  2OOL A;  4X68 A;  3ITA A;  4N92 A;  2V0W A;  4CLC C;  3LR0 A;  2PDR A;  3CPT A;  2H0T A;  2V0U A;  4QWO A;  2P7J A;  4HJ4 A;  1S1Y A;  4DN0 A;  4DE3 A;  1DJA A;  3WS1 A;  2DCF A;  5HPF A;  1G6A A;  1CF0 A;  1Q2Q A;  2K2N A;  3OPP A;  3M2J A;  1W7F A;  2DMW A;  1NJ4 A;  4BD0 A;  1DJB A;  2HPB A;  1K55 C;  2Y2G A;  3W8K A;  4LRZ E;  2K7S A;  3S7O A;  3KO6 A;  2KDK A;  4DDY A;  3PBR A;  1TF1 A;  4I3A A;  4WM9 A;  3NOU C;  3NJA A;  5FQ9 A;  2Y2P A;  2Y2O A;  1YLW A;  2C5W B;  5FL3 A;  3SS5 A;  1LSX A;  2M7U A;  4RYE A;  5DF7 A;  3ITB A;  1PRQ A;  1E3U A;  4EEU A;  3F1O B;  1VHM A;  1Y54 A;  2EX2 A;  3PYP A;  2W1T A;  5HD3 A;  4WZ5 A;  1F9I A;  4JXW A;  1ZTU A;  2HDQ A;  2WAF A;  2X71 A;  3N8S A;  3NCK A;  3IT9 A;  3LIB A;  1DP8 A;  4OKP A;  3T4Q A;  4KZ6 A;  2XGN A;  5KIZ A;  3MS6 A;  2HP6 A;  3S4X A;  4JXG A;  5GLA A;  3HLF A;  5J7E A;  3LIA A;  1RGZ A;  4OPR A;  4IED A;  2QMI A;  3N7W A;  4OON A;  1TDL A;  3BFE A;  3IX3 A;  2J3T C;  3GVB A;  4S2N A;  2PRF A;  5J3W A;  4KQO A;  2H0Y A;  3NDG A;  1D1J A;  4UA7 A;  4RVA A;  3ZG9 B;  2PYP A;  4WZ5 C;  3AGD A;  1GHM A;  2B18 A;  3Q07 A;  4ZDX A;  5I5L A;  4YFM A;  3KSI A;  5HDC A;  4Q0I A;  1PW1 A;  4LGW A;  3MXQ A;  3S22 A;  2HF6 A;  2D01 A;  1LLB A;  3VFF A;  1IKI A;  3GV9 A;  4JF4 A;  1BZA A;  3JPU A;  2V1B A;  1YMX A;  4ZAM A;  3UB7 A;  4G3W A;  4P6Z M;  4II7 A;  2WAE A;  2A2L A;  2Z2M B;  4FH2 A;  1BUE A;  1FCO A;  1LT0 A;  2P74 A;  5HWT A;  4GHI A;  4IUK A;  1VEU A;  3RH8 B;  3GR2 A;  1WYC A;  3UB9 A;  3G4P A;  4GOG A;  5KSC A;  5G4Y A;  1K4F A;  5EVE A;  3BFD A;  4BJP A;  5EE8 A;  2PHY A;  4HJ3 A;  3RXW A;  1OTA A;  1CEF A;  2PYR A;  3PR6 A;  2VX8 A;  1DP6 A;  2Z6C A;  4UHU A;  1V9Y A;  4EUV A;  4GN2 A;  3T4K A;  2J9P A;  2V8C A;  5L8M A;  4FOF A;  4DXC A;  1D7E A;  2XFS A;  4KG2 A;  4LV0 A;  5IHV A;  3EGD C;  1W5D A;  2PT7 A;  4M3K A;  4N1X A;  3BJN A;  5FQK A;  3WS2 A;  1W63 Q;  3EEH A;  4X69 A;  3KYZ A;  1LL5 A;  4Y0U A;  5CER A;  1ES4 A;  4LPZ A;  4R3J A;  1TS0 A;  4NEE D;  5FEG A;  2FFY A;  4EW7 A;  3HLW A;  4GDN A;  2Y91 A;  2RCX A;  3LR5 A;  5HAR A;  1FR1 A;  2NUT C;  1DRM A;  2J80 A;  3LI9 A;  1YT4 A;  3RXX A;  3EEA A;  3GRJ A;  5EPH A;  4HHD A;  5CGX A;  5FAT A;  1OTI A;  4OQI A;  1S1Z A;  5D3O A;  1C3B A;  1TS8 A;  2J3W A;  3ZVT A;  2WGW B;  5HSQ A;  1K56 D;  3BW6 A;  4LLO B;  3ZG5 A;  4E3O A;  3VV4 A;  1OT6 A;  3KSG A;  3RJU A;  2WKE A;  5DKL A;  3IF5 A;  4IJG A;  3HL9 A;  1MBL A;  3IS2 B;  2VJW A;  1T19 A;  5AQA A;  5EVL A;  2Y2M A;  3DTE A;  2PAV P;  4ID4 A;  2XR0 A;  4MNR A;  3Q7Z A;  1PZO A;  1VET A;  2WUQ A;  4C3Q A;  4KZA A;  1HTZ A;  1K57 A;  4HP9 A;  3MZF A;  2EFU A;  4X56 A;  1BLH A;  4GB7 A;  1NRJ A;  3HLG A;  2XRO A;  2Q0O A;  2XSS A;  2HJE A;  4YOF A;  3N6I A;  4GLQ A;  4CLC D;  3V5M A;  1MKI A;  1ES3 A;  5F1F A;  1L0E A;  3IXG A;  3LY4 A;  2QJ5 A;  3M6H A;  2ZOI A;  2AVX A;  3LEQ A;  2FFF B;  3QHY A;  3V3R A;  1QMF A;  4XUZ A;  4BBU A;  4YIN A;  5JYP A;  1PI4 A;  3OC2 A;  3VP4 A;  1K57 C;  2OLU A;  4HQA A;  4JBF A;  1SDN A;  3VP0 A;  2ZQA A;  2JC7 A;  2GX5 A;  1ACF A;  4GS9 A;  3T12 B;  4E3L A;  3K3C A;  1G5U A;  3TE8 A;  1M40 A;  1IOU A;  4Y2F A;  4PM7 A;  1JVJ A;  4JGR A;  1CJF A;  2PBY A;  5HZH A;  1ZKJ A;  2W3G A;  5E2G A;  4QY5 A;  2ZC7 A;  1V9Z A;  2W3F A;  1G28 A;  4ME4 A;  1ZG6 A;  3BLS A;  5AJG A;  3LFV A;  1K4E A;  4Y0O A;  2QWS A;  2ZQ7 A;  3FV7 A;  2Y59 A;  4D60 A;  4ZJ2 A;  3R7W B;  2R78 A;  5A8B A;  5L09 A;  3SS4 A;  4HOI A;  2LB9 A;  2IWB A;  1HZO A;  3NBL A;  3TJZ C;  4KQQ A;  4L9E A;  1OJ5 A;  5DVA A;  3A3I A;  3HUM A;  2R9X A;  3MR0 A;  4MBK A;  4OPQ A;  4M4X A;  3UB8 A;  4BL3 A;  1SKO B;  3E4Q A;  3L7H A;  1ZHH B;  3K3D A;  1NXY A;  1IEM A;  5AVF A;  1YLJ A;  3F1P A;  3TW8 A;  2XFT A;  3ZCZ A;  5AQ9 A;  1SZV A;  1BT5 A;  2VEA A;  1JNU A;  3UE6 A;  5E2H A;  5L07 A;  1RGY A;  1EI5 A;  1FIL A;  3T4O A;  2HP9 A;  1J3W A;  1XKZ A;  4DDS A;  4Y0T A;  5TJJ A;  4B4X A;  2ZM8 A;  1YM1 A;  4IVK A;  3IH9 A;  4Z9Q A;  1MWT A;  5HW3 A;  2G7U A;  1IYO A;  1DY6 A;  4QY6 A;  1P9R A;  3HJI A;  3LUQ A;  3KX0 X;  1MZU A;  1P0Z A;  5DFX A;  4P0M A;  1K56 A;  2A24 B;  4BLM A;  3H82 A;  4UEY A;  1QME A;  4JGP A;  1K6R A;  4P6Z S;  5IU1 A;  3E2L A;  1F98 A;  2Y8H A;  4ARZ B;  4DF6 A;  3N8L A;  3IH8 A;  1XJ4 A;  3C8C A;  5CED A;  4XUX A;  4RQ9 A;  5TFQ A;  3S7P A;  4N1H A;  2E8I A;  4BQM A;  2J8Y A;  3O87 A;  5EVI B;  4A5R A;  4WYY A;  4LEN A;  1Z09 A;  1H5X A;  3K2N A;  3JVU A;  1L2S A;  4OPZ A;  3UPN A;  2ZL1 A;  4EXO A;  1L0F A;  2WKP A;  4UAA A;  4ZTK A;  2WZX A;  5FQQ A;  4U3T A;  5F5Y A;  1RCJ A;  3U2A A;  2G2W A;  1GSV A;  4CLC A;  5M1A A;  1IYQ A;  2BLS A;  1AXB A;  2OAQ 1;  4F94 A;  3ZQ5 A;  1TD5 A;  5GHY A;  4H6J B;  3MMH A;  3IF6 B;  2EX8 A;  3C30 A;  1VQQ A;  4EBP A;  3B33 A;  4EBN A;  4F3L A;  4MEZ A;  1T1B A;  3O3V A;  2Y2L A;  3S7N A;  3HJK A;  4LRX C;  2Z2L B;  4WN5 A;  4OQH A;  3W2Z A;  1K55 A;  2EX9 A;  1GSX A;  3V3S A;  4JLF A;  5HDD A;  5CHM A;  3T1S A;  2ZC3 B;  3LGO A;  1HVB A;  2Y2N A;  1NLZ A;  4MN7 A;  1NWZ A;  5FQM A;  5CXW A;  2P9V A;  3HLD A;  1MKM A;  3WS4 A;  3HUN A;  1H0M A;  1SHV A;  4OOY A;  4FCF A;  2O0Y A;  3OPL A;  4DJ3 A;  1MWS A;  4I38 A;  3PBN A;  3UPP A;  2J9O A;  4WBG A;  4KZ5 A;  3DWK A;  4DRT A;  4HBU A;  5K5B A;  5A92 A;  4XT2 A;  4WUJ A;  3LO7 A;  4Y3I A;  5F82 A;  3LID A;  3H7W A;  4I3I A;  2QJ7 A;  3HLE A;  3KSH A;  2RL3 A;  4KUO A;  2IWD A;  4MBH A;  3W4O A;  3S1Y A;  2JKT I;  1NRF A;  2EXA A;  1IKG A;  1CEG A;  1E4D A;  2P04 A;  4X1L A;  1Y28 A;  3NEC A;  1EW0 A;  5DTK A;  1FIK A;  1PWD A;  1TVF A;  5HAP A;  3Q7V A;  1XJ2 A;  1K0K A;  4R1G A;  3HLC A;  3KYE A;  1ERM A;  5HFO A;  3CPT B;  2OAP 1;  1YLY A;  2VGJ A;  2MJ6 A;  1L0G A;  3ZFZ A;  2ZMA A;  4MBF A;  3SH9 A;  2JCH A;  3A3F A;  3PAG A;  5AQ7 A;  1JWZ A;  4N9L A;  1XJ3 A;  3NI9 A;  5F83 A;  4E04 A;  4E3N A;  5J8X A;  3G6O A;  5F69 A;  1N9B A;  5E43 A;  4WEK A;  3UE1 A;  3DAV A;  4EES A;  3IQA A;  2EX6 A;  3NY4 A;  1BSG A;  4OP5 A;  1ES2 A;  1MWU A;  2EWV A;  3Q81 A;  3QP6 A;  5CTN A;  4KZB A;  3AGF A;  4G3V A;  1K54 C;  2VKS A;  1RP5 A;  1MPL A;  3ZG8 B;  5EV0 A;  3VOL A;  2KOI A;  1H3Q A;  3CAX A;  3EQU A;  5HL1 A;  1LSV A;  3UN7 A;  3VSL A;  2J7V A;  3VOZ A;  3CJM A;  2XQZ A;  2Y2J A;  1J9M A;  5L10 A;  1F2K A;  4DE0 A;  1H8Z A;  2W1T B;  3VE4 A;  4GZB A;  3ULF A;  2JKG A;  4I3J A;  2HGV A;  1YKD A;  1ZC2 A;  1KOU A;  2PD8 A;  3R4K A;  3PBT A;  1Q2P A;  3CLO A;  3G35 A;  5TBM A;  1FSW A;  1PZP A;  1GSW A;  1WYB A;  2JKR I;  1TDG A;  4MDZ A;  3ZGA B;  1G6O A;  1JTD A;  3MXR A;  4KEN B;  2CC1 A;  5IS1 A;  3OCN A;  3C38 A;  5GLD A;  4CPK A;  1S66 L;  3KSF A;  5DFY A;  4FUW A;  3C5A A;  2V1A A;  4GJ4 A;  3IXD A;  3SW1 A;  2Y2I A;  4R23 A;  5EVI D;  4EER A;  2ZC4 B;  3RFB A;  4HI4 A;  2WYX A;  2XK1 A;  2GDN A;  5CHJ A;  2HDS A;  3PBQ A;  1LL8 A;  5CX7 A;  3SZT A;  3O88 A;  2VGL M;  2JKT M;  2ZMF A;  2HDU A;  3T4S A;  1O7E A;  3GTC A;  2XA7 S;  4HH2 A;  4L9G A;  4WZ4 A;  4GHI B;  3BY9 A;  1UWN X;  3ZG7 B;  1VEU B;  1YLT A;  2OV5 A;  3MQO A;  1GA0 A;  5G4Z A;  4B88 A;  3ZNY A;  3CUE A;  1XJ6 A;  2DRW A;  1DJC A;  4JKT A;  4KZ7 A;  3PTE A;  4S2L A;  1AWI A;  2Y4A A;  5CEC A;  2HP5 A;  3FKV A;  2PU4 A;  2VGK A;  3BYD A;  3H9W A;  4KZ9 A;  4PMA A;  3UE3 A;  1IFQ A;  1T1C A;  1JTG A;  5DKK A;  3O5Y A;  3B3X A;  1IEL A;  3WS0 A;  1BTL A;  2WGV A;  4RX3 A;  1ESI A;  2VV8 A;  3G2Z A;  4U0X A;  2K31 A;  1BLC A;  1FOF A;  1KE0 A;  1IYS A;  4KQR A;  4EUZ A;  4DJ2 A;  1KVL A;  3UB6 A;  3BLM A;  2H10 A;  3CUE C;  4O0P A;  1CI9 A;  3ZG0 A;  2Q9M A;  4OOL A;  2L0W A;  5HX9 A;  1K6S A;  4YNR A;  1U60 A;  4EQ1 A;  1MY8 A;  1PIO A;  3WWX A;  2Y55 A;  4RA7 A;  2HJ9 C;  2ZQ8 A;  3OOV A;  1NYM A;  3OZH A;  2OWJ A;  2WK0 A;  4EV4 A;  3PHY A;  1YAX A;  3HUO A;  3C7U A;  5EOE A;  1VM1 A;  2VZW A;  2ZJ9 A;  4OQ0 A;  2GZA A;  1OTD A;  1JWV A;  2O9A A;  1KGF A;  1S4R A;  3BY8 A;  4KZ8 A;  3A0S A;  2VV6 A;  3BEB A;  4R38 A;  2XRN A;  5HWV A;  3OCL A;  4Y15 A;  4MN5 A;  3TOI A;  3CHW P;  4Y7P A;  3O86 A;  4HH3 A;  4O01 A;  2I72 A;  4S2O A;  2JKR M;  1W8Q A;  3NOT C;  5HAQ A;  4HP4 A;  1MXO A;  3ZVW A;  3B47 A;  5A91 A;  1SCW A;  3MBZ A;  2W1R A;  4X1M A;  4R6L A;  1VET B;  2JKF A;  3G31 A;  4CLC E;  4R3A A;  4YWZ A;  1NZO A;  4B4Z A;  3IXB A;  4PM6 A;  1Z6F A;  1ESU A;  2V1Z A;  2B5R A;  1F5M A;  2ZLY A;  3CIT A;  3VP3 A;  1OPX A;  1OTB A;  5HD5 A;  3M2K A;  1M6K A;  1PWC A;  3DBA A;  3UMD A;  3MZE A;  1P9W A;  1E25 A;  3ICY A;  4O8G A;  2Y2K A;  3F1N A;  4OPY A;  4LV2 A;  2YKF A;  3BEC A;  3D4F A;  3CWF A;  2XEP A;  3M6B A;  5I94 A;  1K25 A;  4QPR A;  4P87 A;  4C6Y A;  1KDS A;  1N4O A;  3FPV A;  1N9O A;  4GS9 B;  4OQG A;  2V2F F;  1PI5 A;  2FZ0 A;  1ES5 A;  2XH9 A;  5F1G A;  4S2J A;  2O9B A;  3T1Q B;  4PM8 A;  1IYP A;  1XP4 A;  1ONH A;  1FR6 A;  3BFC A;  4PAU A;  2HZ5 A;  4LCL A;  2G2U A;  3U4L P;  3FWL A;  1YSP A;  2BAS A;  4NXG A;  1JWP A;  1NYY A;  3SS3 A;  2V8F A;  1LI9 A;  4BL2 A;  3CMZ A;  1LSW A;  1LHY A;  2KX6 A;  1YSQ A;  5EVI C;  1UWP X;  2HDR A;  2HV1 A;  1SDE A;  4X55 A;  2ACG A;  2Y79 A;  2WAD A;  3VP1 A;  3VFH A;  5FAS A;  1ALQ A;  2XA7 M;  2XD1 A;  4IHQ A;  1TS6 A;  2H5S A;  3SOI A;  3DTK A;  2PU2 A;  1L0D A;  3F1P B;  3N4I A;  3PXP A;  2V20 A;  2D02 A;  4NK3 A;  1BYW A;  4IBR A;  3IWO A;  3PBO A;  3P09 A;  3HRE A;  3FKW A;  3UB5 P;  4DKI A;  5FSR A;  5EOO A;  3IF6 C;  4ZJ1 A;  4LRY C;  2YKH A;  2DNS A;  3C4P A;  3IWI A;  5DTS A;  2VLG A;  3V39 A;  2VA0 A;  2X02 A;  3CZD A;  3S7Q A;  1H8M A;  3EQV A;  3Q1F A;  2WZZ A;  3P98 A;  1FCM A;  4PKY A;  2O9C A;  3LIE A;  2WGI A;  1L3L A;  4S2P A;  4Z1W A;  3VE3 A;  2OWH A;  3L9K A;  2CMN A;  5CEB A;  1UGU A;  2KLI A;  4OLD A;  5BOH A;  2P08 A;  4PM9 A;  1CQA A;  1XGI A;  4EBL A;  3H82 B;  1I5Q A;  4HIA A;  3IBR A;  4X53 A;  4PPR A;  4R4S A;  3V67 A;  3MKE A;  3MSH A;  1HLU P;  2UV0 E;  3QP5 A;  2VGL S;  3C2W A;  4WMC D;  1GA9 A;  1T18 A;  4GKU A;  3GDI A;  1TS7 A;  3OLO A;  5G18 A;  3NIA A;  3JVV A;  1MC0 A;  1S6R A;  3DTM A;  3F1O A;  1YLP A;  5FQJ A;  4UQI S;  2I9V A;  4EWF A;  4L9F A;  4BBT A;  4C75 A;  3NOP C;  3SH7 A;  3EWK A;  2ZQC A;  3MF0 A;  1VB6 A;  3DTI A;  2ZL1 B;  4HES A;  5TGF A;  5EEC A;  2XD5 A;  3I7J A;  2V9A A;  4L0L A;  3W4Q A;  2B02 A;  5FI6 A;  1CK3 A;  5CHU A;  1XX2 A;  4CLC B;  1XXM A;  4NXB A;  4G3K A;  3FYZ A;  4OLG A;  1GHI A;  5AVE A;  1BUL A;  1P97 A;  2Y2Q A;  2NUP C;  3LIF A;  3D72 A;  5L2F A;  4X25 A;  3CG5 A;  3KYQ A;  5IT5 A;  5HAI A;  4KQD A;  4F3L B;  5GHX A;  2WKR A;  2XLN A;  2ZM0 A;  3BM6 A;  1OJG A;  4WEJ A;  3MQ0 A;  2JHE A;  3LIC A;  3VOY A;  5DTT A;  2O99 A;  5GHZ A;  4EU0 A;  1ERQ A;  4K91 A;  3JYI A;  3UO9 A;  1OME A;  1CI8 A;  4LV3 A;  1GHP A;  2Z6D A;  2UWX A;  4GD6 A;  4S2K A;  4EEP A;  1K54 A;  2FH5 A;  2XF3 A;  5JYO A;  5FA7 A;  3T50 A;  5HPI A;  1W8Y A;  2P9V B;  3WRZ A;  4E6X A;  4DMZ A;  4K0W A;  3G34 A;  3IHB A;  1KE4 A;  3FG8 A;  4QD4 A;  3UDX A;  5KMW A;  4MLL A;  1N9L A;  3HBR A;  4OOM A;  3DWZ A;  4XT2 B;  2ZC6 B;  3B42 A;  2PR5 A;  3MXS A;  3H7W B;  3A0V A;  4UA9 A;  1XGJ A;  3QP2 A;  5CGW A;  3MJQ A;  2H28 A;  1K38 A;  2PBD P;  3T1R A;  4R70 A;  2LB5 A;  3IXH A;  2ZQD A;  4NXF A;  2IA2 A;  1KE3 A;  5F68 A;  5TR7 A;  1H8Y A;  3WRT A;  4WLA A;  4DE1 A;  2WKQ A;  3IX8 A;  3Q7V B;  3PAE A;  4ZBE A;  4O7D A;  5CGS A;  3VP2 A;  5FDS A;  4FD8 A;  3LR4 A;  5DJT A;  3CI6 A;  5MC7 A;  5FAQ A;  4HY8 A;  2W3E A;  2GJ3 A;  3HCY A;  4D2O A;  1S67 L;  4S2N C;  4H8R A;  1T1A A;  4E3K A;  2PR6 A;  3T4J A;  3GQZ A;  2WGW A;  1G68 A;  1YPR A;  3D3O A;  1KDW A;  1STZ A;  3E98 A;  5M19 A;  4HEF A;  4HJ6 A;  2JBF A;  4JF6 A;  1ERO A;  4WMC A;  4S2I A;  4LCM A;  3IS2 A;  3DW0 A;  2X01 A;  5KSH A;  3T4T A;  4N9K A; 
#chains in the Genus database with same CATH homology
 3S7P A;  3MFX A;  4R38 A;  2XRN A;  5HWV A;  3OCL A;  5FL3 A;  4MN5 A;  1LSX A;  2M7U A;  2VV7 A;  4HH3 A;  4O01 A;  2INW A;  2JKR M;  3NOT C;  2L4R A;  2M1C A;  4EET B;  4EEU A;  3LR3 A;  4HP4 A;  3F1O B;  1VHM A;  3K2N A;  3JVU A;  3B47 A;  4MN6 A;  3A0R A;  4EXO A;  3PYP A;  2W1R A;  2W1T A;  5HD3 A;  1F9I A;  4R6L A;  2WKP A;  1ZTU A;  4CLC E;  4R3A A;  3RTY A;  4YWZ A;  3FPW A;  3LIB A;  5F5Y A;  1DP8 A;  3E0Y A;  3T4Q A;  5KIZ A;  3U2A A;  1GSV A;  4CLC A;  5J7E A;  2QKP A;  3LIA A;  1F5M A;  4ETX A;  3CIT A;  1ODV A;  4UQI M;  1OPX A;  2OAQ 1;  3ZQ5 A;  2JN7 A;  1OTB A;  1TD5 A;  5HD5 A;  3LI8 A;  5TBM B;  3DBA A;  4H6J B;  2PD7 A;  3MMH A;  3UMD A;  1OT9 A;  4GCZ A;  4ETZ A;  3C30 A;  1P9W A;  2J3T C;  3B33 A;  3ICY A;  4F3L A;  4O8G A;  1T1B A;  5J3W A;  3F1N A;  2W3H A;  3S7N A;  4KQO A;  3HJK A;  2W27 A;  2YKF A;  4LRX C;  5HWW A;  3CWF A;  4WN5 A;  2PYP A;  5EFW A;  5C5K A;  3NHQ A;  3W2Z A;  4QPR A;  1GSX A;  3FC7 A;  2B18 A;  5HDD A;  3FPV A;  5I5L A;  3KSI A;  5HDC A;  4Q0I A;  3MXQ A;  1NLZ A;  4MN7 A;  2HF6 A;  2D01 A;  1NWZ A;  1N9O A;  3EGX C;  4BWI A;  4GS9 B;  2FZ0 A;  3BWL A;  1MKM A;  3E4O A;  2V1B A;  3UB7 A;  4G3W A;  2O0Y A;  2O9B A;  4DJ3 A;  4P6Z M;  4II7 A;  4I38 A;  3PBN A;  4PHT A;  2A2L A;  2W0N A;  4NKP A;  5K5B A;  1D06 A;  1LT0 A;  4PAU A;  5HWT A;  4GHI A;  4IUK A;  3R7W A;  3RH8 B;  1X0O A;  1YSP A;  2BAS A;  4NXG A;  3UB9 A;  5G4Y A;  4XT2 A;  4WUJ A;  4JGQ A;  4BJP A;  1LSW A;  2KX6 A;  1YSQ A;  4Y3I A;  2PHY A;  4HJ3 A;  1UWP X;  3LID A;  3H7W A;  4WL9 A;  4I3I A;  2HV1 A;  1OTA A;  5DJU A;  2L1M A;  2PYR A;  2QJ7 A;  2ZBB A;  3PR6 A;  2Y79 A;  2VX8 A;  4Y5F A;  3KSH A;  1DP6 A;  2Z6C A;  4I39 A;  3BQA A;  1V9Y A;  3TRC A;  4EUV A;  4KUO A;  3T4K A;  5L8M A;  4FOF A;  2XA7 M;  2JKT I;  1D7E A;  4IHQ A;  1TS6 A;  2P04 A;  3EGD C;  2PT7 A;  1Y28 A;  1EW0 A;  3F1P B;  3BJN A;  3PXP A;  1W63 Q;  2D02 A;  1WA9 A;  3EEH A;  1BYW A;  1XJ2 A;  3PBO A;  3KYZ A;  1NLY A;  3PBS A;  4LRY C;  4LPZ A;  2OAP 1;  4B9O A;  2YKH A;  2QHK A;  1TS0 A;  4NEE D;  2MJ6 A;  4EW7 A;  2GNX A;  3GEC A;  3OBF A;  2VLG A;  2QYB A;  3LR5 A;  2VA0 A;  1XJ3 A;  3S7Q A;  2NUT C;  1H8M A;  3EQV A;  1DRM A;  2A24 A;  4E04 A;  2J80 A;  3LI9 A;  4PKY A;  2O9C A;  3LIE A;  3EEA A;  4PKY G;  4Z1W A;  3G6O A;  3VE3 A;  5F69 A;  2OWH A;  4HHD A;  2CMN A;  5LBR A;  1OTI A;  4WEK A;  1S1Z A;  1UGU A;  2KLI A;  1TS8 A;  2J3W A;  2P08 A;  5HSQ A;  4EES A;  3BW6 A;  3LYX A;  4ARZ A;  3H82 B;  4LLO B;  4Q0J A;  4HIA A;  3IBR A;  3VV4 A;  1OT6 A;  3V67 A;  2EWV A;  3MQQ A;  3KSG A;  5DKL A;  2VGL S;  3C2W A;  4AFI A;  4IJG A;  4G3V A;  2W3D A;  1T18 A;  2VKS A;  3IS2 B;  2VJW A;  5HL6 A;  3GDI A;  1T19 A;  1TS7 A;  3OLO A;  5J4E A;  3VOL A;  3JVV A;  2KOI A;  1MC0 A;  3BQ8 A;  1H3Q A;  3CAX A;  3EQU A;  1LSV A;  3F1O A;  4UQI S;  2I9V A;  3IBJ A;  4L9F A;  4BBT A;  3P7N A;  3NOP C;  2J3T D;  1XFQ A;  3EWK A;  3MF0 A;  1VB6 A;  4HP9 A;  2W1T B;  3VE4 A;  5F6A A;  3ULF A;  1NRJ A;  2V9A A;  4GW9 A;  4L0L A;  2B02 A;  4I3J A;  2HGV A;  2XRO A;  2XSS A;  1YKD A;  1S4S A;  1KOU A;  2PD8 A;  3R4K A;  1XFN A;  2HJE A;  3CLO A;  3PBT A;  4YOF A;  4GLQ A;  4CLC B;  4NXB A;  4CLC D;  4I5S A;  5TBM A;  4H6J A;  2M7V A;  1GSW A;  4G3K A;  5AVE A;  2JKR I;  4MDZ A;  1P97 A;  4FSF A;  4BMW A;  2NUP C;  3LIF A;  2QJ5 A;  3D72 A;  1G6O A;  2ZOI A;  4B93 A;  4HNB A;  3KYQ A;  5IT5 A;  4KQD A;  4F3L B;  4BBU A;  3F1N B;  4ZRR A;  1OTE A;  3OC2 A;  4MMN A;  5IS1 A;  2WKR A;  3C38 A;  3OCN A;  4MCW A;  4HQA A;  1S66 L;  3KSF A;  5DFY A;  1OJG A;  2GX5 A;  4WEJ A;  4GS9 A;  3MQ0 A;  2JHE A;  3LIC A;  5HDS A;  2O99 A;  4EU0 A;  2V1A A;  3K3C A;  4GJ4 A;  3TE8 A;  3SW1 A;  4K08 A;  1IOU A;  4BBV A;  2Z6D A;  4Y2F A;  3E4P A;  4EER A;  4JGR A;  4EEP A;  2FH5 A;  3RFB A;  4HI4 A;  5HZH A;  3T50 A;  5HPI A;  2W3G A;  4NXE A;  1N9N A;  1V9Z A;  3PBQ A;  1LL8 A;  1DP9 A;  5CX7 A;  4DMZ A;  2W3F A;  4KUK A;  1G28 A;  4ME4 A;  2VGL M;  2JKT M;  2ZMF A;  3T4S A;  5AJG A;  2EWW A;  3LFV A;  3FG8 A;  2QWS A;  2XA7 S;  4HH2 A;  4L9G A;  4GHI B;  3BY9 A;  1UWN X;  3R7W B;  2R78 A;  5A8B A;  1N9L A;  3MQO A;  4JGO A;  3ZYT A;  5G4Z A;  4OOM A;  3CUE A;  1XJ6 A;  4HOI A;  4XT2 B;  2LB9 A;  3B42 A;  3TJZ C;  4L9E A;  1OJ5 A;  4Q0H A;  2PR5 A;  3P01 A;  3MR0 A;  4WEL A;  3H7W B;  3A0V A;  4M4X A;  3UME A;  3H9W A;  3UB8 A;  1W63 M;  3MJQ A;  2H28 A;  3E4Q A;  2EA9 A;  1ZHH B;  3K3D A;  3UE3 A;  2ZMV A;  1IFQ A;  1T1C A;  5DKK A;  5AVF A;  3F1P A;  3TW8 A;  3O5Y A;  3T4L A;  2ZOH A;  4R70 A;  2LB5 A;  5DF9 A;  4CQH A;  2VEA A;  3EOI A;  4IUH A;  2VV8 A;  4WF0 A;  2OOL A;  1JNU A;  3UE6 A;  2K31 A;  4NXF A;  2IA2 A;  5F68 A;  3T4O A;  2V0W A;  4CLC C;  3LR0 A;  2PDR A;  2V0U A;  4DJ2 A;  4WLA A;  5TJJ A;  2WKQ A;  2P7J A;  3UB6 A;  4HJ4 A;  1S1Y A;  3CUE C;  2G7U A;  4DN0 A;  4O0P A;  3LR4 A;  5DJT A;  4OOL A;  1P9R A;  3CI6 A;  5HPF A;  3HJI A;  3LUQ A;  5MC7 A;  4HY8 A;  2W3E A;  2GJ3 A;  2K2N A;  3HCY A;  1MZU A;  3KX0 X;  1S67 L;  2L0W A;  4YNR A;  1T1A A;  2DMW A;  4EQ1 A;  2PR6 A;  2HJ9 C;  1P0Z A;  3OOV A;  3T4J A;  5DFX A;  2OWJ A;  2A24 B;  3PHY A;  3D3O A;  1YAX A;  3H82 A;  1STZ A;  4LRZ E;  4UEY A;  2K7S A;  3E98 A;  3KO6 A;  2VZW A;  3S7O A;  2KDK A;  4JGP A;  4HJ6 A;  2GZA A;  1OTD A;  3PBR A;  2O9A A;  4P6Z S;  5IU1 A;  1F98 A;  1S4R A;  2Y8H A;  1TF1 A;  3BY8 A;  4ARZ B;  4I3A A;  3IS2 A;  3A0S A;  1XJ4 A;  2VV6 A;  3C8C A;  3NJA A;  3NOU C;  5KSH A;  4RQ9 A;  3T4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...