4LLOB

Structure of the eag domain-cnbhd complex of the mouse eag1 channel
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
121
structure length
121
Chain Sequence
b'TFLENIVRRSNDTNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSACSFMYGELTDKDTVEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium voltage-gated channel subfamily H member 1
publication title The structural mechanism of KCNH-channel regulation by the eag domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 35
structure length 121
sequence length 121
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4lloB00
2V0UA 3PYPA 1N9OA 3LIEA 2VV7A 4NXEA 2KX6A 4HHDA 1V9YA 3UB8A 4MN5A 2J80A 3VE3A 4JGOA 4EERA 1XJ3A 1TS8A 3UMDA 3UE6A 3IS2A 4HH3A 3G6OA 1XFQA 3BY9A 4EXOA 4I39A 1DP9A 3C8CA 1LSXA 5DJUA 4L9GA 4WF0A 3UB7A 1LSVA 1OTEA 1XFNA 1T19A 1S67L 3H7WA 1UWPX 4JGRA 1T1BA 3K3DA 3PHYA 4XT2B 5F68A 1S66L 5TBMA 3HJIA 3NOPC 2R78A 2WKQA 3EEHA 5HDSA 4NXBA 3CWFA 5F5YA 4K08A 5HWVA 1BYWA 4I38A 2VEAA 5AVEA 3GECA 4GS9B 4GW9A 4WUJA 5DKKA 3ZQ5A 4LLOB 3CLOA 1S4SA 1V9ZA 5J4EA 2QJ5A 3LIAA 5HDCA 1OTDA 5F6AA 2W27A 4E04A 1GSWA 2PHYA 4KQDA 4HY8A 4HJ4A 5AVFA 1T18A 4R6LA 1S4RA 2HV1A 1DP8A 3MXQA 4KUKA 3LICA 3LI9A 2KDKA 2VV8A 3MQQA 2A24A 1OT6A 3E4QA 4I3IA 4LRXC 1F98A 1NWZA 3F1OA 2PR6A 1VB6A 3D72A 2PD8A 4HOIA 5DJTA 3IBRA 1X0OA 4BBTA 2QWSA 4GHIB 4WN5A 2P7JA 4EETB 3UB6A 5KIZA 3P7NA 4F3LB 3F1NA 3MR0A 2I9VA 3GDIA 4HP4A 4HNBA 2H28A 5HDDA 3VOLA 2D01A 3A0SA 4BBVA 4M4XA 2CMNA 3NJAA 4R70A 2D02A 1F9IA 1XJ2A 4HI4A 3BY8A 5IS1A 2VV6A 3H82A 3LIDA 4R3AA 4I5SA 4HH2A 1TS6A 3FC7A 2ZOIA 4RQ9A 4DJ3A 3A0VA 3ULFA 2QHKA 3HJKA 3F1PB 4H6JB 1TS0A 4DJ2A 1DP6A 1Y28A 4WL9A 5HD3A 5F69A 3KX0X 2WKRA 2L4RA 5G4ZA 1TS7A 4YWZA 1LL8A 2QJ7A 1WA9A 2WKPA 4PKYG 1LSWA 2JHEA 4NXFA 4I3JA 3NOUC 1JNUA 1T1AA 3NHQA 2K7SA 4L9FA 2GJ3A 2B02A 1OTIA 3CAXA 3IS2B 4R38A 2M1CA 2OOLA 4EQ1A 4KUOA 2ZBBA 5HWTA 5A8BA 2VLGA 4LRZE 2V1AA 4EESA 3LYXA 4GCZA 1P0ZA 2PYRA 3OLOA 5DKLA 3H7WB 4HIAA 4XT2A 2QKPA 2BASA 3MFXA 5HD5A 1XJ6A 5IU1A 3E4PA 1D7EA 1T1CA 2ZOHA 3VE4A 5TBMB 2EA9A 3A0RA 3MJQA 5I5LA 4EEPA 4NXGA 1LT0A 5J7EA 3LUQA 4GS9A 4HQAA 1S1YA 2W0NA 3C2WA 4HJ3A 2INWA 2JN7A 4L9EA 4BBUA 3BWLA 1G28A 3MQOA 5G4YA 2V1BA 2Z6DA 1KOUA 3LIBA 1UGUA 3UB9A 2V0WA 3K3CA 5HSQA 2YKFA 2L1MA 5HZHA 2A24B 3LI8A 2L0WA 1OJ5A 1OTBA 1S1ZA 1XJ4A 4LRYC 3F1OB 3T50A 1N9LA 3ICYA 4GHIA 4LPZA 4I3AA 4EW7A 3UMEA 4JGQA 2PYPA 3FG8A 2PR5A 4F3LA 4JGPA 3RTYA 4WLAA 3F1NB 1UWNX 3NOTC 1GSXA 3EWKA 5J3WA 1MZUA 4HJ6A 5HWWA 4PKYA 1N9NA 1OJGA 4HP9A 3RH8B 2PD7A 3E4OA 1OTAA 2OWJA 3H9WA 3LIFA 2PDRA 1ODVA 2OWHA 4MN6A 1P97A 3H82B 2V9AA 2YKHA 5EFWA 3SW1A 2Z6CA 4H6JA 3F1PA 1GSVA 3B33A 1EW0A 1DRMA 1OT9A 4EEUA 4B9OA 1D06A
chains in the Genus database with same CATH superfamily
4FOFA 3UO9A 1NZUA 3KSIA 4S2NC 2VV7A 3KYQA 3E0YA 3HLBA 3UB8A 4E3OA 3FV7A 3P01A 4NEED 2ZM2A 1GHPA 3VP0A 5CEDA 2ZL1B 4OLDA 3L7HA 1BLCA 2K2NA 3NY4A 1XP4A 1N4OA 4ZRRA 2M7VA 2WKIA 2VGLS 2WKEA 1XFQA 2EFXA 1EROA 5DTSA 5DF8A 5GLBA 3BFCA 3WS1A 5GLCA 2EWWA 3C8CA 4UAAA 3N6IA 5FQJA 4FH2A 1BUEA 5CGWA 3SS4A 5DJUA 1LHYA 2Q9MA 4WF0A 2ZQAA 3ZNYA 3ISGA 4JPMA 4E6XA 2C5WB 1UWPX 5A91A 3IT9A 3MXRA 1YLWA 4BD1A 3HL9A 1I5QA 3D3OA 5TBMA 4HEFA 4FD8A 5M18A 3HUNA 1W79A 3JYIA 3HJIA 3NOPC 2R78A 3EEHA 4R0QA 5HDSA 1W7FA 3CWFA 2J3TD 4RVAA 1QMEA 1Y4OA 4K08A 3L9KA 3W8KA 5CGSA 1I2SA 3QP6A 4R3BA 4WUJA 3TOIA 3NULA 3CLOA 2KLIA 2XD1A 5A90A 1S4SA 5J4EA 5HDCA 1OTDA 1MY8A 4C6YA 1ZG4A 4P0MA 3V50A 4HJ4A 4HY8A 5F1GA 2EX6A 4WMCD 1GHMA 4P6BA 4S2JA 1L0EA 4LV3A 1DP8A 2XDMA 5EVID 3LI9A 4WZ5A 2VV8A 4DMZA 2A24A 1VM1A 2Y2GA 1Q2QA 1TDGA 2JKFA 4I3IA 4LRXC 5E2EA 5DVAA 5E2GA 1NWZA 3F1OA 3KSHA 1FILA 3KYEA 1VB6A 1J9MA 3D72A 3ZG7B 4N9KA 5JYOA 1VQQA 4HOIA 4MLLA 3BRMA 5FQIA 3UNWA 1KE3A 1O07A 1PNEA 5GLDA 2P7JA 2B18A 3UB6A 2BTFP 5AQBA 2ZQ9A 3CG5A 4MEZA 3IF6B 4CLCA 5L09A 4Z9QA 4YFMA 2I9VA 4PM9A 4HP4A 1TD5A 1PWGA 1ES3A 3MF0A 3OPHA 3BECA 3VSLA 2O99A 3NJAA 3QNCA 1ESUA 1ZG6A 3NECA 5IS1A 2XH9A 2IWCA 2VJWA 3LIDA 1L0DA 3FC7A 3S7OA 3R7WB 4BWIA 3V67A 1P9WA 2QHKA 5EOEA 4BL3A 3RXXA 2AVXA 4PPRA 4WL9A 2PBYA 2ZJ9A 4S2NA 4NK3A 5GHZA 1K56D 1NYYA 2JBFA 2WKRA 3HREA 3N4IA 1PZPA 5G4ZA 3IBJA 1TS7A 3RXWA 1ES4A 2Y2IA 2Y2HA 4PKYG 1LSWA 1L3LA 4KG6A 2K7SA 4GZBA 5FDHA 5L2FA 4CQHA 1MPLA 1OTIA 4MCWA 2Y55A 4OQIA 2M1CA 3PAEA 2OOLA 4EQ1A 4ID4A 3DBAA 3Q7VA 5A93A 3G2YA 1W5DA 3OPRA 4UEYA 4LRZE 3BFGA 4CJNA 1GCEA 4EESA 4BMWA 5FQQA 1TEMA 2P04A 1D1JA 3OBFA 1MWRA 1ZHHB 3NBLA 4KZ6A 4JF4A 4OKPA 1PWDA 4GNUA 2NUPC 3FPVA 1NY0A 2ZM0A 1FR1A 2W3DA 3E4PA 5MC7A 1T1CA 2HDUA 5TBMB 3C4OA 3MS6A 2FH5A 2EXBA 3HUMA 1HZOA 2IWBA 4NXGA 1K38A 1W63Q 3LR5A 1LT0A 4RX2A 2VA0A 1Q2PA 4QD4A 1HLUP 2W0NA 3M2JA 3BLMA 3BYDA 3PTEA 2INWA 2V20A 2JN7A 4EBNA 4B4XA 4L9EA 4JKTA 4BBUA 4O0PA 2Y2NA 5G4YA 2VX8A 2Z6DA 3FKWA 3LIBA 1UGUA 4OQ0A 2V0WA 4GN2A 5FI6A 5F1FA 1VEUA 2YKFA 1NRJA 4PHTA 2XA7M 5FEGA 1ERQA 5E2HA 5GHYA 2A24B 5HZHA 2OSUA 4OOLA 1BZAA 2L0WA 4R4RA 2K31A 2W3EA 4ZTKA 3BFEA 1OTBA 3D9YA 4YOFA 3F1OB 1TDLA 3O5YA 3T50A 1MXOA 5BOHA 3T1RA 3HLEA 4GHIA 1ACFA 3U4LP 5FI7A 4I3AA 2ZC3B 4EW7A 4OVDA 4IEDA 4F3LA 4B88A 4Y17A 1I2WA 3AGFA 1JTDA 1YSQA 3NOTC 4CLCB 4UQIM 4PMAA 3LGOA 1SHVA 2XA7S 3A3JA 3E2KA 3LO7A 4RX3A 3T4QA 2Y2LA 3BFFA 1YLTA 1OTAA 4ZDXA 3H9WA 5DTTA 2J3WA 2XRNA 3LIFA 3EQVA 1GA9A 1YMSA 2PDRA 5FA7A 1ODVA 5E43A 2QYBA 4KZ5A 2G2WA 1P97A 3SOIA 4MBKA 2R9WA 2YKHA 2EFUA 2WAFA 3BQ8A 3F1PA 1LI0A 4R23A 3UY6A 1MWTA 1ONGA 1EW0A 4OPZA 4UQIS 2J3TC 3T4JA 2XEPA 3R4KA 1CJFA 2V0UA 4EUVA 3LIEA 4LCLA 1V9YA 2Y8HA 3GVBA 3HCYA 2J80A 3E98A 4X25A 4JGOA 3IQAA 3A3EA 3Q82A 1YLPA 4ZJ3A 5HAQA 4R4SA 5K5BA 2PU2A 1PI4A 3G6OA 3QP5A 3T4TA 1G68A 3LCEA 2QMIA 3UPNA 3EQUA 3Q7VB 3DTKA 2EX8A 3VOYA 3S7QA 1LL5A 1PFLA 1LSXA 5D3OA 3V3RA 4JLFA 4L9GA 2XFSA 4NG2A 1LSVA 1OTEA 4LGWA 3LR3A 1XFNA 2ZM8A 4OP8A 3U2AA 2HJ9C 4FH4A 4JGRA 3KO6A 3K3DA 3PHYA 4LV2A 5EUAA 2ZC4B 5F68A 4D60A 1S66L 1NLYA 1CEFA 2Y79A 2P08A 2H5SA 1O7EA 4WBGA 1HTZA 1CI8A 2Y2MA 4GOGA 4JF5A 3WS2A 5DFXA 4WEKA 4QU3A 3FPWA 2VGJA 3T4OA 4NETA 2VEAA 5AVEA 4GW9A 2JKTM 4GKUA 1YSPA 4IUKA 3EEAA 1SCWA 1Y54A 3LIAA 1GSWA 4KQDA 4R6LA 3S22A 2Y91A 2HV1A 5I94A 1W8YA 4BQMA 1NYMA 2KOIA 2OAP1 3LICA 3ITBA 3AGDA 3IX8A 3OPPA 2V2FF 1FCOA 3UE3A 2HDRA 1VEUB 2UV0E 2A2LA 2JKGA 2XK1A 2ZQ8A 5FASA 1FQGA 4H8RA 2J9OA 4ZJ1A 2PD8A 3CMZA 1BULA 2ZC6B 1X0OA 3TG9A 4BBTA 2HDSA 3OC2A 4GHIB 4WN5A 4EETB 3ZFZA 3T4KA 1F5MA 4F3LB 3A3IA 3F1NA 4LV0A 2H0YA 5AQ7A 5M1AA 1YMXA 3MQ0A 2XQZA 3HLWA 1ESIA 3A0SA 4E3IA 4IJGA 4HESA 2E8JA 3UPPA 4BBVA 5HX9A 2ZLYA 3FWLA 5CHUA 2OLUA 5KMWA 3H82A 1PZOA 1LLBA 2FZ0A 3W4QA 4Q0HA 3TE8A 2WKHA 3ULFA 4L0LA 3G31A 4QJGA 4OOYA 3HJKA 3F1PB 1TS0A 3KSGA 4OPQA 3KX0X 1HD8A 5EM1A 4ZAMA 3TW8A 1MWSA 3UDFA 2WKPA 4O7DA 4WMCA 3TJZC 4Q0JA 3VOZA 1SKFA 1PI5A 3JPUA 4KZAA 4U0XA 4DXBA 4Z1WA 1K25A 3JVUA 1T1AA 4L9FA 2GJ3A 2B02A 3CAXA 3GV9A 4Y5FA 4QB8A 5CXWA 4R38A 4DKIA 3WRTA 1OMEA 2Y59A 4KUOA 4Y7PA 2ZBBA 5CHJA 4Y2FA 2ZMVA 3QP4A 1W63M 3NDGA 4ETZA 1BLSA 5A8BA 2VLGA 5TFQA 3A3FA 1KVMA 3ZG0A 4DRTA 2Y4AA 3O3VA 1PW1A 3LYXA 4ZJ2A 1FOFA 3B47A 1P0ZA 4CLCE 1DY6A 3OLOA 4DE1A 1XKZA 3T12B 4S2MA 3MFXA 4P85A 1XJ6A 1Z09A 2IA2A 4RA7A 1RCJA 3MZDA 5A92A 1WYCA 4QY5A 3GTCA 3DWZA 4EU0A 3NC8A 3IWOA 4KQOA 2ZMFA 4EEPA 1SKOA 3G32A 3LUQA 5J7EA 2GX5A 3HLDA 1YQSA 3MBZA 1F2KA 3BW6A 3MKFA 4Q0IA 4X53A 1YLZA 5HL1A 3C2WA 1YKDA 1J3WA 4E3JA 4RYEA 3V39A 1BSGA 1KOUA 5M19A 4UA6A 1G6OA 3UB9A 2WGVA 2G7UA 3Q07A 4GD8A 4QY6A 4E3NA 2WGWA 4MBFA 3LI8A 4E3LA 1E3UD 3UE1A 4FSFA 4E3MA 2A49A 4O01A 1AWIA 3Q7ZA 4G3WA 2XD5A 1XJ4A 5KSHA 3VFFA 2B95A 2HZ5A 1E25A 3T1QB 3ZG8B 3K2NA 3VP1A 3UMEA 2NUTC 2PYPA 4GD6A 5FDSA 3FYZA 4WLAA 3F1NB 5DF7A 4MMNA 1PWCA 3CZDA 4GB7A 3HUOA 2XFTA 2HP5A 1G6AA 1MZUA 2M7UA 1H8ZA 4HJ6A 5IT5A 2RL3A 1FSWA 3IXBA 4MDZA 2B5RA 4OH0A 4HP9A 3RH8B 3IHBA 3E4OA 1Z6FA 1XA7A 2ZQDA 4GLQA 4R1GA 4QWOA 2Y2JA 3SS3A 2PAVP 1ONHA 3LY4A 4MN6A 3DW0A 3N8SA 1BLHA 4P6ZM 3H82B 1MKMA 4MBHA 4H6JA 1C3BA 3VFHA 1NZOA 3B33A 2HP6A 2V8CA 3OOVA 4EEUA 1FSYA 5EM0A 1K6SA 3VP3A 3PYPA 4Y0UA 1FR6A 4E6WA 3QP2A 4NXEA 1RGYA 4Y3IA 5TGFA 2I72A 1YLYA 2DMWA 3MMHA 4MN5A 1PYYA 3RFBA 3VE3A 4P6ZS 5EV0A 4EERA 1XJ3A 3UMDA 3IS2A 3HLCA 3E2LA 1YT4A 4II7A 3BY9A 5HARA 4UHUA 1VETA 1LL9A 3VP4A 2PBDP 4IBXA 3Q81A 4F94A 1PRQA 4HBUA 1T19A 5CECA 1S67L 5EVLA 4X68A 2WYXA 4IUHA 4JXWA 1JTGA 2WZXA 3VMAA 3WS0A 2VKSA 2WKQA 4NXBA 5F5YA 4DN0A 3I7JA 2QZ6A 5HWVA 1JWZA 1BYWA 1SKOB 3OZHA 1CI9A 3ZQ5A 3UDXA 4DE0A 1XXMA 3IWIA 1OPXA 5L10A 2QJ5A 4Y0TA 5F6AA 3N7WA 4MNRA 4E04A 3OCLA 4OPYA 3VV4A 4X1MA 4KZ3A 3C38A 2DRWA 4KUKA 4X56A 3MQQA 4KG5A 2X01A 1OT6A 3SH7A 3ZHHA 5U47A 2WGWB 2OLVA 4M3KA 2XGNA 2PR6A 3KSFA 2DCFA 3MSHA 3SH8A 4OQGA 3G4PA 3HLFA 3S4XA 4IHQA 3JVVA 3IXHA 2ZD8A 1BT5A 1K54C 1XX2A 3S1YA 5KIZA 2P74A 1MC0A 5CTNA 4OPRA 3GDIA 4HNBA 4UA7A 5EVIC 2H28A 5HDDA 2EX9A 3PAGA 4Y0OA 3Q1FA 2P9VA 5L07A 4FTXA 3GMWA 2Y2PA 4QPRA 2CMNA 2WUQA 4R70A 1F9IA 1IYPA 4KZ7A 1KGEA 3CJMA 5GLAA 2HDQA 4R3AA 4I5SA 4HH2A 1TS6A 2ZOIA 4DXCA 4KZ4A 4RQ9A 4DJ3A 4Q8IA 1W8QA 1H3QA 3LFVA 1ZKJA 3O87A 2JCHA 5CERA 2HGVA 2H10A 4H6JB 4GDNA 3M2KA 2BLSA 1DP6A 3ITAA 5HD3A 1SDNA 2JE5A 2L4RA 2W3FA 4EUZA 2XF3A 4AFIA 4BJPA 2ZQCA 3S7NA 2JHEA 2ZC5B 3W4PA 4I3JA 3NHQA 3QHYA 4DDYA 1IELA 2X71A 2EXAA 3DTEA 4OONA 3IS2B 3G35A 3PBQA 1M6KA 3V5MA 4BL2A 4S2OA 1VETB 5HPFA 4C3QA 3ZG9B 1H5XA 1NJ4A 1IKGA 4LCMA 3VSKA 1WE4A 3IWQA 2GNXA 2PYRA 5DKLA 4B93A 4XT2A 1GHIA 1PW8A 1XGIA 3NDEA 4EV4A 3CUEC 1EWZA 5IU1A 1D7EA 3IX4A 1N9BA 1JWPA 2ZOHA 3VE4A 2WAEA 5TJJA 3DAVA 1IYSA 1DJAA 3ZNTA 1CEGA 4BLMA 4S2PA 2X02A 3A0RA 4U3TA 1ES2A 2HP9A 2HJEA 3B3XA 1KE0A 2DNSA 4GS9A 2O9BA 4HQAA 4KZ8A 1NLZA 3C30A 1IEMA 1S1YA 3WS5A 4GDBA 4HJ3A 5AQAA 5L8MA 3MQOA 4EBLA 2V1BA 3LR4A 1K57C 3PBRA 4YNRA 1QMFA 4N92A 1SDEA 1A0KA 2J7VA 3ZGAB 4IVIA 1BTLA 1OJ5A 1YM1A 4PM6A 1DJBA 3DTIA 4KZ9A 3MZFA 1S1ZA 2W1RA 1CF0A 1K54A 5DTKA 2O0YA 4X6TA 3ICYA 2R9XA 2WK0A 4PM7A 5C5KA 4LPZA 4PM5A 4LV1A 2JKRI 3FG8A 2PR5A 2Z2LB 4JGPA 2Y2QA 5CEBA 4C75A 5EVIA 1UWNX 2ZC7A 3B42A 3BQAA 3O86A 2OV5A 3MKEA 4WYYA 4JBFA 3QP1A 1GSXA 3EWKA 5HWWA 1KE4A 5CHMA 3T1SA 4XUXA 3CI6A 2P9VB 2LB5A 1OJGA 4S2KA 4OOMA 2PD7A 1XA1A 2HPBA 2OWJA 2VK3A 4OQHA 1MWUA 1IOUA 3N8LA 3CPTA 5FQMA 3ZYTA 4WZ4A 3OPLA 2V9AA 5EFWA 2Z6CA 1RP5A 3T4SA 5F82A 2O9CA 3SH9A 2OAQ1 3SZTA 4B9OA 2V1ZA 1K4EA 3OCNA 3HBRA 1N9OA 3LEQA 1GA0A 2KX6A 4YINA 2IWDA 2ACGA 4HHDA 2Y2OA 3S7PA 2RCXA 2W3HA 3EOIA 3HLGA 4LFUA 3PBOA 1TS8A 1K0KA 4KQQA 3UE6A 1E3UA 4HH3A 3NI9A 3T1XA 4XUZA 5KZHA 3M6BA 1K56A 4LENA 3MZEA 4N1HA 4EXOA 4I39A 4CLCD 1DP9A 2BG1A 1TF1A 4WEJA 4E3KA 2PU4A 3PBNA 5CX7A 1M40A 2ZQ7A 5IHVA 3UE0A 5GHXA 3ZG5A 3UB7A 1RGZA 1YAXA 3CUEA 1WYBA 3H7WA 1ALQA 3MXSA 4DF6A 1T1BA 2Z2MB 4O8GA 4XT2B 2Q0OA 4PM8A 1CK3A 4JXVA 4EQIA 3AGEA 4Y15A 3WWXA 3PBSA 3WS4A 2H0TA 3CITA 1YLJA 1U60A 1JVJA 2J9PA 1FIKA 4P87A 2JKRM 1KGFA 3G30A 4I38A 5FATA 3GECA 4GS9B 5DKKA 1XPBA 5EVEA 4S2LA 4LLOB 1ERMA 3FZCA 1MKIA 1V9ZA 1K57A 1JWVA 1PIOA 5HW3A 2W27A 2MJ6A 2PHYA 5AVFA 2ZMAA 1T18A 1P9RA 5E2FA 3W2ZA 1XGJA 5FEFA 1S4RA 2O9AA 3MXQA 2FFYA 4DE2A 4WM9A 3VP2A 2KDKA 1BLPA 4N9LA 3E4QA 2V8FA 3O88A 4G3KA 1F98A 4JXGA 2W1TA 5DJTA 3BEBA 4Y13A 4R3JA 2GDNA 3IBRA 4ARZA 3G2ZA 5EE8A 2QWSA 5FAPA 2G2UA 1EI5A 4HBTA 5HL6A 3P7NA 2WZZA 3MR0A 5G18A 4EBPA 1NRFA 3ZCZA 1YPRA 5EVIB 3WRZA 1KDSA 2C6WB 1L0FA 4X1LA 5TR7A 4MN7A 3IF6C 5FI2A 1IFQA 3VOLA 2WGIA 2D01A 5FAOA 1ZC2A 3IX3A 1AXBA 3A3DA 4M4XA 4A5RA 5JYPA 3RJUA 3ZDJA 2CC1A 2D02A 1XJ2A 1E4DA 2WADA 4HI4A 3TRCA 3BY8A 3NIAA 2EX2A 2VV6A 3DTMA 1S6RA 4KQRA 3N8RA 3PBTA 1KDWA 4ETXA 1L2SA 3CPTB 1K6RA 3A0VA 2XLNA 3QP8A 5HAIA 4GJ4A 4DJ2A 3FKVA 3UB5P 5EPHA 1Y28A 4DDSA 3PXPA 2FFFB 5F69A 5J8XA 2EWVA 1K55C 5CTMA 4YWZA 3TSGA 1LL8A 2QJ7A 1WA9A 2HF6A 5CRFA 5DF9A 3IXGA 2UWXA 5AQ9A 3QNBA 1TVFA 3CHWP 3V3SA 4N1XA 4NXFA 2JKTI 3NOUC 1JNUA 2ZL1A 4S2IA 4CPKA 2XSSA 4WELA 5LBRA 1HVBA 3KYZA 5HFOA 1NXYA 4K0XA 2XROA 4U0TA 5HWTA 3LR0A 3EGDC 3BJNA 2JC7A 5CGXA 3UPOA 2V1AA 5HPIA 2PT7A 2W3GA 4GCZA 4EWFA 4JF6A 5F83A 4DE3A 3H7WB 4HIAA 1DJCA 2QKPA 2BASA 3IH8A 5HD5A 3UN7A 4IVKA 3MFDA 3EGXC 2EA9A 3ZVWA 1ES5A 2Q9NA 4B4ZA 3DWKA 3MJQA 5I5LA 5EOOA 1H8YA 1K4FA 4K0WA 1H8MA 5AJGA 1FCMA 3GR2A 4ESPA 3G34A 3C4PA 3IF5A 1STZA 5FSRA 1IYQA 3BWLA 1G28A 3W4OA 5FAQA 3HVFA 2VGKA 4UA9A 3LY3A 5FL3A 3C5AA 1H0MA 1FCNA 4K91A 3IH9A 3K3CA 5HSQA 5FQ9A 2VZWA 2PRFA 1MBLA 2Y2KA 1G5UA 4BENA 1VHMA 2L1MA 3D4FA 2QPNA 4WZ5C 4LRYC 5HAPA 1N9LA 2E8IA 3ZVTA 3SS5A 2A3UA 2W1TB 3GRJA 3IHAA 4ARZB 2LB9A 4D2OA 3C7UA 5KSCA 4KZBA 1IKIA 4JGQA 4ZBEA 4OLGA 5GL9A 3RTYA 3IF6A 3PR6A 3UDIA 2XR0A 3C7VA 4FCFA 5FQKA 1ZTUA 4X55A 2J8YA 5DFYA 3GSGA 1IYOA 4PAUA 5J3WA 4CLCC 2GZAA 1L0GA 4PKYA 3BM6A 1N9NA 1SZVA 3NCKA 4KG2A 1LI9A 1CQAA 3P09A 3BFDA 1S0WA 2OWHA 4KENB 3R7WA 3M6HA 3P98A 4FUWA 4JXSA 1KVLA 3SW1A 4X69A 4NKPA 4QHCA 4ME4A 1GSVA 5EECA 4XXRA 2VGLM 3BLSA 3IXDA 3GQZA 1DRMA 1K55A 1OT9A 3T4LA 4BD0A 3LEZA 4OP5A 1KGGA 4IBRA 4G3VA 1D06A
chains in the Genus database with same CATH topology
2V0UA 3OCNA 3PYPA 4FOFA 4EUVA 1N9OA 3KSIA 3LIEA 2VV7A 4NXEA 2KX6A 3KYQA 4Y3IA 3E0YA 4HHDA 2DMWA 1V9YA 3S7PA 3MMHA 3UB8A 4MN5A 2Y8HA 3HCYA 2J80A 3RFBA 2W3HA 3E98A 3EOIA 4P6ZS 4JGOA 3VE3A 3P01A 4NEED 4EERA 3PBOA 1XJ3A 1TS8A 3UMDA 3UE6A 3IS2A 2K2NA 5K5BA 4HH3A 4ZRRA 2M7VA 4II7A 3G6OA 2VGLS 1XFQA 3T4TA 3BY9A 4EXOA 4I39A 3EQUA 4CLCD 1DP9A 2EWWA 3C8CA 3S7QA 1TF1A 4WEJA 3PBNA 5CX7A 1LSXA 5DJUA 4L9GA 4WF0A 3UB7A 1LSVA 1OTEA 3LR3A 1XFNA 1YAXA 1T19A 3CUEA 1S67L 3U2AA 2HJ9C 3H7WA 1UWPX 4JGRA 3KO6A 4IUHA 1T1BA 3K3DA 3PHYA 4O8GA 4XT2B 5F68A 1S66L 1NLYA 2Y79A 3D3OA 5TBMA 2P08A 2VKSA 3PBSA 3HJIA 3NOPC 2R78A 3CITA 2WKQA 3EEHA 5HDSA 4NXBA 3CWFA 5F5YA 5DFXA 2J3TD 4WEKA 4K08A 4DN0A 2JKRM 5HWVA 3FPWA 1BYWA 3T4OA 4I38A 2VEAA 5AVEA 3GECA 4GS9B 2JKTM 4GW9A 4WUJA 5DKKA 3ZQ5A 1YSPA 4IUKA 4LLOB 3EEAA 3CLOA 2KLIA 1OPXA 1S4SA 1V9ZA 5J4EA 2QJ5A 3LIAA 5HDCA 1OTDA 5F6AA 2W27A 2MJ6A 4E04A 1GSWA 2PHYA 3OCLA 4KQDA 4HJ4A 4HY8A 5AVFA 1T18A 4R6LA 3VV4A 3C38A 1P9RA 3W2ZA 1S4RA 2HV1A 2O9AA 1DP8A 3MXQA 4KUKA 2KOIA 2OAP1 3LICA 3LI9A 2KDKA 2VV8A 3MQQA 3UE3A 4DMZA 2A24A 1OT6A 2A2LA 3E4QA 4I3IA 4LRXC 4G3KA 1F98A 1NWZA 3F1OA 3KSHA 2PR6A 3KSFA 1VB6A 3D72A 2PD8A 4HOIA 2W1TA 5DJTA 4IHQA 4ARZA 3IBRA 3JVVA 1X0OA 4BBTA 3OC2A 2QWSA 4GHIB 4WN5A 2P7JA 4EETB 2B18A 3T4KA 3UB6A 1F5MA 5HL6A 5KIZA 3P7NA 4F3LB 3F1NA 3MR0A 1MC0A 4CLCA 2I9VA 3GDIA 4HP4A 4HNBA 1TD5A 4MN7A 2H28A 5HDDA 1IFQA 3VOLA 3MQ0A 3MF0A 2D01A 3A0SA 4IJGA 4BBVA 4M4XA 4QPRA 2CMNA 2O99A 3NJAA 4R70A 2D02A 1F9IA 1XJ2A 3TRCA 4HI4A 3BY8A 5IS1A 2VV6A 3H82A 2VJWA 3LIDA 3PBTA 4R3AA 4I5SA 4ETXA 4HH2A 2FZ0A 1TS6A 3FC7A 2ZOIA 3S7OA 4RQ9A 4DJ3A 3R7WB 3A0VA 4Q0HA 3TE8A 1H3QA 3LFVA 3ULFA 4L0LA 4BWIA 3V67A 1P9WA 2QHKA 2HGVA 3HJKA 3F1PB 4H6JB 4GJ4A 1TS0A 4DJ2A 1DP6A 1Y28A 4WL9A 3PXPA 5HD3A 5F69A 3KSGA 3KX0X 2EWVA 2WKRA 2L4RA 5G4ZA 3TW8A 3IBJA 1TS7A 4YWZA 1LL8A 2QJ7A 1WA9A 2WKPA 2HF6A 3TJZC 2W3FA 4Q0JA 4PKYG 1LSWA 5DF9A 4AFIA 4BJPA 3S7NA 2JHEA 4Z1WA 4NXFA 2JKTI 3JVUA 4I3JA 3NOUC 1JNUA 1T1AA 3NHQA 2K7SA 4L9FA 2GJ3A 2B02A 2XSSA 4CQHA 1OTIA 3CAXA 4MCWA 4WELA 4Y5FA 5LBRA 3KYZA 3IS2B 4R38A 2M1CA 3PBQA 2OOLA 4EQ1A 4KUOA 2XROA 2ZBBA 3DBAA 5HWTA 4Y2FA 2ZMVA 1W63M 3LR0A 3EGDC 3BJNA 4ETZA 5A8BA 5HPFA 2VLGA 4UEYA 4LRZE 2V1AA 5HPIA 2PT7A 4EESA 3LYXA 4BMWA 2W3GA 4GCZA 3B47A 2GNXA 1P0ZA 2PYRA 4CLCE 2P04A 3OLOA 5DKLA 3OBFA 4B93A 3H7WB 4HIAA 1ZHHB 4XT2A 2QKPA 2BASA 2NUPC 3FPVA 3MFXA 3CUEC 5HD5A 1XJ6A 5IU1A 2W3DA 3E4PA 2IA2A 5MC7A 1D7EA 3EGXC 1T1CA 2ZOHA 3VE4A 5TBMB 2EA9A 5TJJA 2FH5A 4EU0A 3A0RA 4KQOA 2HJEA 2ZMFA 3MJQA 5I5LA 4EEPA 4NXGA 1W63Q 3LR5A 1LT0A 5J7EA 3LUQA 1H8MA 2VA0A 4GS9A 2GX5A 2O9BA 5AJGA 3BW6A 4HQAA 1NLZA 4Q0IA 3C30A 1S1YA 2W0NA 3C2WA 4HJ3A 1YKDA 1STZA 2INWA 2JN7A 4L9EA 5L8MA 4BBUA 3BWLA 4O0PA 1G28A 3MQOA 5G4YA 2V1BA 3LR4A 2VX8A 2Z6DA 1KOUA 3PBRA 4YNRA 3LIBA 5FL3A 1G6OA 1UGUA 3UB9A 2G7UA 2V0WA 3K3CA 5HSQA 2VZWA 2YKFA 1NRJA 4PHTA 2XA7M 1VHMA 2L1MA 5HZHA 2A24B 3LI8A 4OOLA 2L0WA 4FSFA 1OJ5A 4O01A 2K31A 2W3EA 4G3WA 1OTBA 1S1ZA 1XJ4A 2W1RA 4LRYC 4YOFA 5KSHA 3F1OB 3O5YA 3T50A 1N9LA 2O0YA 2W1TB 3ICYA 4ARZB 2LB9A 4GHIA 5C5KA 3K2NA 4LPZA 4I3AA 4EW7A 3UMEA 4JGQA 2NUTC 2PYPA 2JKRI 3FG8A 2PR5A 4F3LA 4JGPA 3RTYA 3PR6A 4WLAA 3F1NB 1UWNX 1YSQA 3B42A 3NOTC 4MMNA 3BQAA 1ZTUA 4CLCB 4UQIM 5DFYA 4PAUA 1GSXA 3EWKA 5J3WA 1MZUA 2M7UA 4HJ6A 5HWWA 5IT5A 4CLCC 2GZAA 2XA7S 4PKYA 4MDZA 1N9NA 3CI6A 2LB5A 1OJGA 3T4QA 4HP9A 4OOMA 3RH8B 2PD7A 3E4OA 4GLQA 1OTAA 2OWJA 3H9WA 2J3WA 2XRNA 3LIFA 3EQVA 2PDRA 1ODVA 1IOUA 2OWHA 2QYBA 4MN6A 4P6ZM 1P97A 3H82B 3R7WA 3ZYTA 2V9AA 2YKHA 5EFWA 1MKMA 3SW1A 3BQ8A 2Z6CA 4NKPA 4H6JA 3F1PA 4ME4A 1GSVA 3B33A 2VGLM 1EW0A 3T4SA 4UQIS 1DRMA 2O9CA 2J3TC 3OOVA 2OAQ1 1OT9A 3T4LA 4B9OA 4EEUA 3T4JA 3R4KA 4G3VA 1D06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V0U A;  3PYP A;  1N9O A;  3LIE A;  2VV7 A;  4NXE A;  2KX6 A;  4HHD A;  1V9Y A;  3UB8 A;  4MN5 A;  2J80 A;  3VE3 A;  4JGO A;  4EER A;  1XJ3 A;  1TS8 A;  3UMD A;  3UE6 A;  3IS2 A;  4HH3 A;  3G6O A;  1XFQ A;  3BY9 A;  4EXO A;  4I39 A;  1DP9 A;  3C8C A;  1LSX A;  5DJU A;  4L9G A;  4WF0 A;  3UB7 A;  1LSV A;  1OTE A;  1XFN A;  1T19 A;  1S67 L;  3H7W A;  1UWP X;  4JGR A;  1T1B A;  3K3D A;  3PHY A;  4XT2 B;  5F68 A;  1S66 L;  5TBM A;  3HJI A;  3NOP C;  2R78 A;  2WKQ A;  3EEH A;  5HDS A;  4NXB A;  3CWF A;  5F5Y A;  4K08 A;  5HWV A;  1BYW A;  4I38 A;  2VEA A;  5AVE A;  3GEC A;  4GS9 B;  4GW9 A;  4WUJ A;  5DKK A;  3ZQ5 A;  4LLO B;  3CLO A;  1S4S A;  1V9Z A;  5J4E A;  2QJ5 A;  3LIA A;  5HDC A;  1OTD A;  5F6A A;  2W27 A;  4E04 A;  1GSW A;  2PHY A;  4KQD A;  4HY8 A;  4HJ4 A;  5AVF A;  1T18 A;  4R6L A;  1S4R A;  2HV1 A;  1DP8 A;  3MXQ A;  4KUK A;  3LIC A;  3LI9 A;  2KDK A;  2VV8 A;  3MQQ A;  2A24 A;  1OT6 A;  3E4Q A;  4I3I A;  4LRX C;  1F98 A;  1NWZ A;  3F1O A;  2PR6 A;  1VB6 A;  3D72 A;  2PD8 A;  4HOI A;  5DJT A;  3IBR A;  1X0O A;  4BBT A;  2QWS A;  4GHI B;  4WN5 A;  2P7J A;  4EET B;  3UB6 A;  5KIZ A;  3P7N A;  4F3L B;  3F1N A;  3MR0 A;  2I9V A;  3GDI A;  4HP4 A;  4HNB A;  2H28 A;  5HDD A;  3VOL A;  2D01 A;  3A0S A;  4BBV A;  4M4X A;  2CMN A;  3NJA A;  4R70 A;  2D02 A;  1F9I A;  1XJ2 A;  4HI4 A;  3BY8 A;  5IS1 A;  2VV6 A;  3H82 A;  3LID A;  4R3A A;  4I5S A;  4HH2 A;  1TS6 A;  3FC7 A;  2ZOI A;  4RQ9 A;  4DJ3 A;  3A0V A;  3ULF A;  2QHK A;  3HJK A;  3F1P B;  4H6J B;  1TS0 A;  4DJ2 A;  1DP6 A;  1Y28 A;  4WL9 A;  5HD3 A;  5F69 A;  3KX0 X;  2WKR A;  2L4R A;  5G4Z A;  1TS7 A;  4YWZ A;  1LL8 A;  2QJ7 A;  1WA9 A;  2WKP A;  4PKY G;  1LSW A;  2JHE A;  4NXF A;  4I3J A;  3NOU C;  1JNU A;  1T1A A;  3NHQ A;  2K7S A;  4L9F A;  2GJ3 A;  2B02 A;  1OTI A;  3CAX A;  3IS2 B;  4R38 A;  2M1C A;  2OOL A;  4EQ1 A;  4KUO A;  2ZBB A;  5HWT A;  5A8B A;  2VLG A;  4LRZ E;  2V1A A;  4EES A;  3LYX A;  4GCZ A;  1P0Z A;  2PYR A;  3OLO A;  5DKL A;  3H7W B;  4HIA A;  4XT2 A;  2QKP A;  2BAS A;  3MFX A;  5HD5 A;  1XJ6 A;  5IU1 A;  3E4P A;  1D7E A;  1T1C A;  2ZOH A;  3VE4 A;  5TBM B;  2EA9 A;  3A0R A;  3MJQ A;  5I5L A;  4EEP A;  4NXG A;  1LT0 A;  5J7E A;  3LUQ A;  4GS9 A;  4HQA A;  1S1Y A;  2W0N A;  3C2W A;  4HJ3 A;  2INW A;  2JN7 A;  4L9E A;  4BBU A;  3BWL A;  1G28 A;  3MQO A;  5G4Y A;  2V1B A;  2Z6D A;  1KOU A;  3LIB A;  1UGU A;  3UB9 A;  2V0W A;  3K3C A;  5HSQ A;  2YKF A;  2L1M A;  5HZH A;  2A24 B;  3LI8 A;  2L0W A;  1OJ5 A;  1OTB A;  1S1Z A;  1XJ4 A;  4LRY C;  3F1O B;  3T50 A;  1N9L A;  3ICY A;  4GHI A;  4LPZ A;  4I3A A;  4EW7 A;  3UME A;  4JGQ A;  2PYP A;  3FG8 A;  2PR5 A;  4F3L A;  4JGP A;  3RTY A;  4WLA A;  3F1N B;  1UWN X;  3NOT C;  1GSX A;  3EWK A;  5J3W A;  1MZU A;  4HJ6 A;  5HWW A;  4PKY A;  1N9N A;  1OJG A;  4HP9 A;  3RH8 B;  2PD7 A;  3E4O A;  1OTA A;  2OWJ A;  3H9W A;  3LIF A;  2PDR A;  1ODV A;  2OWH A;  4MN6 A;  1P97 A;  3H82 B;  2V9A A;  2YKH A;  5EFW A;  3SW1 A;  2Z6C A;  4H6J A;  3F1P A;  1GSV A;  3B33 A;  1EW0 A;  1DRM A;  1OT9 A;  4EEU A;  4B9O A;  1D06 A; 
#chains in the Genus database with same CATH topology
 4FOF A;  3UO9 A;  1NZU A;  3KSI A;  4S2N C;  2VV7 A;  3KYQ A;  3E0Y A;  3HLB A;  3UB8 A;  4E3O A;  3FV7 A;  3P01 A;  4NEE D;  2ZM2 A;  1GHP A;  3VP0 A;  5CED A;  2ZL1 B;  4OLD A;  3L7H A;  1BLC A;  2K2N A;  3NY4 A;  1XP4 A;  1N4O A;  4ZRR A;  2M7V A;  2WKI A;  2VGL S;  2WKE A;  1XFQ A;  2EFX A;  1ERO A;  5DTS A;  5DF8 A;  5GLB A;  3BFC A;  3WS1 A;  5GLC A;  2EWW A;  3C8C A;  4UAA A;  3N6I A;  5FQJ A;  4FH2 A;  1BUE A;  5CGW A;  3SS4 A;  5DJU A;  1LHY A;  2Q9M A;  4WF0 A;  2ZQA A;  3ZNY A;  3ISG A;  4JPM A;  4E6X A;  2C5W B;  1UWP X;  5A91 A;  3IT9 A;  3MXR A;  1YLW A;  4BD1 A;  3HL9 A;  1I5Q A;  3D3O A;  5TBM A;  4HEF A;  4FD8 A;  5M18 A;  3HUN A;  1W79 A;  3JYI A;  3HJI A;  3NOP C;  2R78 A;  3EEH A;  4R0Q A;  5HDS A;  1W7F A;  3CWF A;  2J3T D;  4RVA A;  1QME A;  1Y4O A;  4K08 A;  3L9K A;  3W8K A;  5CGS A;  1I2S A;  3QP6 A;  4R3B A;  4WUJ A;  3TOI A;  3NUL A;  3CLO A;  2KLI A;  2XD1 A;  5A90 A;  1S4S A;  5J4E A;  5HDC A;  1OTD A;  1MY8 A;  4C6Y A;  1ZG4 A;  4P0M A;  3V50 A;  4HJ4 A;  4HY8 A;  5F1G A;  2EX6 A;  4WMC D;  1GHM A;  4P6B A;  4S2J A;  1L0E A;  4LV3 A;  1DP8 A;  2XDM A;  5EVI D;  3LI9 A;  4WZ5 A;  2VV8 A;  4DMZ A;  2A24 A;  1VM1 A;  2Y2G A;  1Q2Q A;  1TDG A;  2JKF A;  4I3I A;  4LRX C;  5E2E A;  5DVA A;  5E2G A;  1NWZ A;  3F1O A;  3KSH A;  1FIL A;  3KYE A;  1VB6 A;  1J9M A;  3D72 A;  3ZG7 B;  4N9K A;  5JYO A;  1VQQ A;  4HOI A;  4MLL A;  3BRM A;  5FQI A;  3UNW A;  1KE3 A;  1O07 A;  1PNE A;  5GLD A;  2P7J A;  2B18 A;  3UB6 A;  2BTF P;  5AQB A;  2ZQ9 A;  3CG5 A;  4MEZ A;  3IF6 B;  4CLC A;  5L09 A;  4Z9Q A;  4YFM A;  2I9V A;  4PM9 A;  4HP4 A;  1TD5 A;  1PWG A;  1ES3 A;  3MF0 A;  3OPH A;  3BEC A;  3VSL A;  2O99 A;  3NJA A;  3QNC A;  1ESU A;  1ZG6 A;  3NEC A;  5IS1 A;  2XH9 A;  2IWC A;  2VJW A;  3LID A;  1L0D A;  3FC7 A;  3S7O A;  3R7W B;  4BWI A;  3V67 A;  1P9W A;  2QHK A;  5EOE A;  4BL3 A;  3RXX A;  2AVX A;  4PPR A;  4WL9 A;  2PBY A;  2ZJ9 A;  4S2N A;  4NK3 A;  5GHZ A;  1K56 D;  1NYY A;  2JBF A;  2WKR A;  3HRE A;  3N4I A;  1PZP A;  5G4Z A;  3IBJ A;  1TS7 A;  3RXW A;  1ES4 A;  2Y2I A;  2Y2H A;  4PKY G;  1LSW A;  1L3L A;  4KG6 A;  2K7S A;  4GZB A;  5FDH A;  5L2F A;  4CQH A;  1MPL A;  1OTI A;  4MCW A;  2Y55 A;  4OQI A;  2M1C A;  3PAE A;  2OOL A;  4EQ1 A;  4ID4 A;  3DBA A;  3Q7V A;  5A93 A;  3G2Y A;  1W5D A;  3OPR A;  4UEY A;  4LRZ E;  3BFG A;  4CJN A;  1GCE A;  4EES A;  4BMW A;  5FQQ A;  1TEM A;  2P04 A;  1D1J A;  3OBF A;  1MWR A;  1ZHH B;  3NBL A;  4KZ6 A;  4JF4 A;  4OKP A;  1PWD A;  4GNU A;  2NUP C;  3FPV A;  1NY0 A;  2ZM0 A;  1FR1 A;  2W3D A;  3E4P A;  5MC7 A;  1T1C A;  2HDU A;  5TBM B;  3C4O A;  3MS6 A;  2FH5 A;  2EXB A;  3HUM A;  1HZO A;  2IWB A;  4NXG A;  1K38 A;  1W63 Q;  3LR5 A;  1LT0 A;  4RX2 A;  2VA0 A;  1Q2P A;  4QD4 A;  1HLU P;  2W0N A;  3M2J A;  3BLM A;  3BYD A;  3PTE A;  2INW A;  2V20 A;  2JN7 A;  4EBN A;  4B4X A;  4L9E A;  4JKT A;  4BBU A;  4O0P A;  2Y2N A;  5G4Y A;  2VX8 A;  2Z6D A;  3FKW A;  3LIB A;  1UGU A;  4OQ0 A;  2V0W A;  4GN2 A;  5FI6 A;  5F1F A;  1VEU A;  2YKF A;  1NRJ A;  4PHT A;  2XA7 M;  5FEG A;  1ERQ A;  5E2H A;  5GHY A;  2A24 B;  5HZH A;  2OSU A;  4OOL A;  1BZA A;  2L0W A;  4R4R A;  2K31 A;  2W3E A;  4ZTK A;  3BFE A;  1OTB A;  3D9Y A;  4YOF A;  3F1O B;  1TDL A;  3O5Y A;  3T50 A;  1MXO A;  5BOH A;  3T1R A;  3HLE A;  4GHI A;  1ACF A;  3U4L P;  5FI7 A;  4I3A A;  2ZC3 B;  4EW7 A;  4OVD A;  4IED A;  4F3L A;  4B88 A;  4Y17 A;  1I2W A;  3AGF A;  1JTD A;  1YSQ A;  3NOT C;  4CLC B;  4UQI M;  4PMA A;  3LGO A;  1SHV A;  2XA7 S;  3A3J A;  3E2K A;  3LO7 A;  4RX3 A;  3T4Q A;  2Y2L A;  3BFF A;  1YLT A;  1OTA A;  4ZDX A;  3H9W A;  5DTT A;  2J3W A;  2XRN A;  3LIF A;  3EQV A;  1GA9 A;  1YMS A;  2PDR A;  5FA7 A;  1ODV A;  5E43 A;  2QYB A;  4KZ5 A;  2G2W A;  1P97 A;  3SOI A;  4MBK A;  2R9W A;  2YKH A;  2EFU A;  2WAF A;  3BQ8 A;  3F1P A;  1LI0 A;  4R23 A;  3UY6 A;  1MWT A;  1ONG A;  1EW0 A;  4OPZ A;  4UQI S;  2J3T C;  3T4J A;  2XEP A;  3R4K A;  1CJF A;  2V0U A;  4EUV A;  3LIE A;  4LCL A;  1V9Y A;  2Y8H A;  3GVB A;  3HCY A;  2J80 A;  3E98 A;  4X25 A;  4JGO A;  3IQA A;  3A3E A;  3Q82 A;  1YLP A;  4ZJ3 A;  5HAQ A;  4R4S A;  5K5B A;  2PU2 A;  1PI4 A;  3G6O A;  3QP5 A;  3T4T A;  1G68 A;  3LCE A;  2QMI A;  3UPN A;  3EQU A;  3Q7V B;  3DTK A;  2EX8 A;  3VOY A;  3S7Q A;  1LL5 A;  1PFL A;  1LSX A;  5D3O A;  3V3R A;  4JLF A;  4L9G A;  2XFS A;  4NG2 A;  1LSV A;  1OTE A;  4LGW A;  3LR3 A;  1XFN A;  2ZM8 A;  4OP8 A;  3U2A A;  2HJ9 C;  4FH4 A;  4JGR A;  3KO6 A;  3K3D A;  3PHY A;  4LV2 A;  5EUA A;  2ZC4 B;  5F68 A;  4D60 A;  1S66 L;  1NLY A;  1CEF A;  2Y79 A;  2P08 A;  2H5S A;  1O7E A;  4WBG A;  1HTZ A;  1CI8 A;  2Y2M A;  4GOG A;  4JF5 A;  3WS2 A;  5DFX A;  4WEK A;  4QU3 A;  3FPW A;  2VGJ A;  3T4O A;  4NET A;  2VEA A;  5AVE A;  4GW9 A;  2JKT M;  4GKU A;  1YSP A;  4IUK A;  3EEA A;  1SCW A;  1Y54 A;  3LIA A;  1GSW A;  4KQD A;  4R6L A;  3S22 A;  2Y91 A;  2HV1 A;  5I94 A;  1W8Y A;  4BQM A;  1NYM A;  2KOI A;  2OAP 1;  3LIC A;  3ITB A;  3AGD A;  3IX8 A;  3OPP A;  2V2F F;  1FCO A;  3UE3 A;  2HDR A;  1VEU B;  2UV0 E;  2A2L A;  2JKG A;  2XK1 A;  2ZQ8 A;  5FAS A;  1FQG A;  4H8R A;  2J9O A;  4ZJ1 A;  2PD8 A;  3CMZ A;  1BUL A;  2ZC6 B;  1X0O A;  3TG9 A;  4BBT A;  2HDS A;  3OC2 A;  4GHI B;  4WN5 A;  4EET B;  3ZFZ A;  3T4K A;  1F5M A;  4F3L B;  3A3I A;  3F1N A;  4LV0 A;  2H0Y A;  5AQ7 A;  5M1A A;  1YMX A;  3MQ0 A;  2XQZ A;  3HLW A;  1ESI A;  3A0S A;  4E3I A;  4IJG A;  4HES A;  2E8J A;  3UPP A;  4BBV A;  5HX9 A;  2ZLY A;  3FWL A;  5CHU A;  2OLU A;  5KMW A;  3H82 A;  1PZO A;  1LLB A;  2FZ0 A;  3W4Q A;  4Q0H A;  3TE8 A;  2WKH A;  3ULF A;  4L0L A;  3G31 A;  4QJG A;  4OOY A;  3HJK A;  3F1P B;  1TS0 A;  3KSG A;  4OPQ A;  3KX0 X;  1HD8 A;  5EM1 A;  4ZAM A;  3TW8 A;  1MWS A;  3UDF A;  2WKP A;  4O7D A;  4WMC A;  3TJZ C;  4Q0J A;  3VOZ A;  1SKF A;  1PI5 A;  3JPU A;  4KZA A;  4U0X A;  4DXB A;  4Z1W A;  1K25 A;  3JVU A;  1T1A A;  4L9F A;  2GJ3 A;  2B02 A;  3CAX A;  3GV9 A;  4Y5F A;  4QB8 A;  5CXW A;  4R38 A;  4DKI A;  3WRT A;  1OME A;  2Y59 A;  4KUO A;  4Y7P A;  2ZBB A;  5CHJ A;  4Y2F A;  2ZMV A;  3QP4 A;  1W63 M;  3NDG A;  4ETZ A;  1BLS A;  5A8B A;  2VLG A;  5TFQ A;  3A3F A;  1KVM A;  3ZG0 A;  4DRT A;  2Y4A A;  3O3V A;  1PW1 A;  3LYX A;  4ZJ2 A;  1FOF A;  3B47 A;  1P0Z A;  4CLC E;  1DY6 A;  3OLO A;  4DE1 A;  1XKZ A;  3T12 B;  4S2M A;  3MFX A;  4P85 A;  1XJ6 A;  1Z09 A;  2IA2 A;  4RA7 A;  1RCJ A;  3MZD A;  5A92 A;  1WYC A;  4QY5 A;  3GTC A;  3DWZ A;  4EU0 A;  3NC8 A;  3IWO A;  4KQO A;  2ZMF A;  4EEP A;  1SKO A;  3G32 A;  3LUQ A;  5J7E A;  2GX5 A;  3HLD A;  1YQS A;  3MBZ A;  1F2K A;  3BW6 A;  3MKF A;  4Q0I A;  4X53 A;  1YLZ A;  5HL1 A;  3C2W A;  1YKD A;  1J3W A;  4E3J A;  4RYE A;  3V39 A;  1BSG A;  1KOU A;  5M19 A;  4UA6 A;  1G6O A;  3UB9 A;  2WGV A;  2G7U A;  3Q07 A;  4GD8 A;  4QY6 A;  4E3N A;  2WGW A;  4MBF A;  3LI8 A;  4E3L A;  1E3U D;  3UE1 A;  4FSF A;  4E3M A;  2A49 A;  4O01 A;  1AWI A;  3Q7Z A;  4G3W A;  2XD5 A;  1XJ4 A;  5KSH A;  3VFF A;  2B95 A;  2HZ5 A;  1E25 A;  3T1Q B;  3ZG8 B;  3K2N A;  3VP1 A;  3UME A;  2NUT C;  2PYP A;  4GD6 A;  5FDS A;  3FYZ A;  4WLA A;  3F1N B;  5DF7 A;  4MMN A;  1PWC A;  3CZD A;  4GB7 A;  3HUO A;  2XFT A;  2HP5 A;  1G6A A;  1MZU A;  2M7U A;  1H8Z A;  4HJ6 A;  5IT5 A;  2RL3 A;  1FSW A;  3IXB A;  4MDZ A;  2B5R A;  4OH0 A;  4HP9 A;  3RH8 B;  3IHB A;  3E4O A;  1Z6F A;  1XA7 A;  2ZQD A;  4GLQ A;  4R1G A;  4QWO A;  2Y2J A;  3SS3 A;  2PAV P;  1ONH A;  3LY4 A;  4MN6 A;  3DW0 A;  3N8S A;  1BLH A;  4P6Z M;  3H82 B;  1MKM A;  4MBH A;  4H6J A;  1C3B A;  3VFH A;  1NZO A;  3B33 A;  2HP6 A;  2V8C A;  3OOV A;  4EEU A;  1FSY A;  5EM0 A;  1K6S A;  3VP3 A;  3PYP A;  4Y0U A;  1FR6 A;  4E6W A;  3QP2 A;  4NXE A;  1RGY A;  4Y3I A;  5TGF A;  2I72 A;  1YLY A;  2DMW A;  3MMH A;  4MN5 A;  1PYY A;  3RFB A;  3VE3 A;  4P6Z S;  5EV0 A;  4EER A;  1XJ3 A;  3UMD A;  3IS2 A;  3HLC A;  3E2L A;  1YT4 A;  4II7 A;  3BY9 A;  5HAR A;  4UHU A;  1VET A;  1LL9 A;  3VP4 A;  2PBD P;  4IBX A;  3Q81 A;  4F94 A;  1PRQ A;  4HBU A;  1T19 A;  5CEC A;  1S67 L;  5EVL A;  4X68 A;  2WYX A;  4IUH A;  4JXW A;  1JTG A;  2WZX A;  3VMA A;  3WS0 A;  2VKS A;  2WKQ A;  4NXB A;  5F5Y A;  4DN0 A;  3I7J A;  2QZ6 A;  5HWV A;  1JWZ A;  1BYW A;  1SKO B;  3OZH A;  1CI9 A;  3ZQ5 A;  3UDX A;  4DE0 A;  1XXM A;  3IWI A;  1OPX A;  5L10 A;  2QJ5 A;  4Y0T A;  5F6A A;  3N7W A;  4MNR A;  4E04 A;  3OCL A;  4OPY A;  3VV4 A;  4X1M A;  4KZ3 A;  3C38 A;  2DRW A;  4KUK A;  4X56 A;  3MQQ A;  4KG5 A;  2X01 A;  1OT6 A;  3SH7 A;  3ZHH A;  5U47 A;  2WGW B;  2OLV A;  4M3K A;  2XGN A;  2PR6 A;  3KSF A;  2DCF A;  3MSH A;  3SH8 A;  4OQG A;  3G4P A;  3HLF A;  3S4X A;  4IHQ A;  3JVV A;  3IXH A;  2ZD8 A;  1BT5 A;  1K54 C;  1XX2 A;  3S1Y A;  5KIZ A;  2P74 A;  1MC0 A;  5CTN A;  4OPR A;  3GDI A;  4HNB A;  4UA7 A;  5EVI C;  2H28 A;  5HDD A;  2EX9 A;  3PAG A;  4Y0O A;  3Q1F A;  2P9V A;  5L07 A;  4FTX A;  3GMW A;  2Y2P A;  4QPR A;  2CMN A;  2WUQ A;  4R70 A;  1F9I A;  1IYP A;  4KZ7 A;  1KGE A;  3CJM A;  5GLA A;  2HDQ A;  4R3A A;  4I5S A;  4HH2 A;  1TS6 A;  2ZOI A;  4DXC A;  4KZ4 A;  4RQ9 A;  4DJ3 A;  4Q8I A;  1W8Q A;  1H3Q A;  3LFV A;  1ZKJ A;  3O87 A;  2JCH A;  5CER A;  2HGV A;  2H10 A;  4H6J B;  4GDN A;  3M2K A;  2BLS A;  1DP6 A;  3ITA A;  5HD3 A;  1SDN A;  2JE5 A;  2L4R A;  2W3F A;  4EUZ A;  2XF3 A;  4AFI A;  4BJP A;  2ZQC A;  3S7N A;  2JHE A;  2ZC5 B;  3W4P A;  4I3J A;  3NHQ A;  3QHY A;  4DDY A;  1IEL A;  2X71 A;  2EXA A;  3DTE A;  4OON A;  3IS2 B;  3G35 A;  3PBQ A;  1M6K A;  3V5M A;  4BL2 A;  4S2O A;  1VET B;  5HPF A;  4C3Q A;  3ZG9 B;  1H5X A;  1NJ4 A;  1IKG A;  4LCM A;  3VSK A;  1WE4 A;  3IWQ A;  2GNX A;  2PYR A;  5DKL A;  4B93 A;  4XT2 A;  1GHI A;  1PW8 A;  1XGI A;  3NDE A;  4EV4 A;  3CUE C;  1EWZ A;  5IU1 A;  1D7E A;  3IX4 A;  1N9B A;  1JWP A;  2ZOH A;  3VE4 A;  2WAE A;  5TJJ A;  3DAV A;  1IYS A;  1DJA A;  3ZNT A;  1CEG A;  4BLM A;  4S2P A;  2X02 A;  3A0R A;  4U3T A;  1ES2 A;  2HP9 A;  2HJE A;  3B3X A;  1KE0 A;  2DNS A;  4GS9 A;  2O9B A;  4HQA A;  4KZ8 A;  1NLZ A;  3C30 A;  1IEM A;  1S1Y A;  3WS5 A;  4GDB A;  4HJ3 A;  5AQA A;  5L8M A;  3MQO A;  4EBL A;  2V1B A;  3LR4 A;  1K57 C;  3PBR A;  4YNR A;  1QMF A;  4N92 A;  1SDE A;  1A0K A;  2J7V A;  3ZGA B;  4IVI A;  1BTL A;  1OJ5 A;  1YM1 A;  4PM6 A;  1DJB A;  3DTI A;  4KZ9 A;  3MZF A;  1S1Z A;  2W1R A;  1CF0 A;  1K54 A;  5DTK A;  2O0Y A;  4X6T A;  3ICY A;  2R9X A;  2WK0 A;  4PM7 A;  5C5K A;  4LPZ A;  4PM5 A;  4LV1 A;  2JKR I;  3FG8 A;  2PR5 A;  2Z2L B;  4JGP A;  2Y2Q A;  5CEB A;  4C75 A;  5EVI A;  1UWN X;  2ZC7 A;  3B42 A;  3BQA A;  3O86 A;  2OV5 A;  3MKE A;  4WYY A;  4JBF A;  3QP1 A;  1GSX A;  3EWK A;  5HWW A;  1KE4 A;  5CHM A;  3T1S A;  4XUX A;  3CI6 A;  2P9V B;  2LB5 A;  1OJG A;  4S2K A;  4OOM A;  2PD7 A;  1XA1 A;  2HPB A;  2OWJ A;  2VK3 A;  4OQH A;  1MWU A;  1IOU A;  3N8L A;  3CPT A;  5FQM A;  3ZYT A;  4WZ4 A;  3OPL A;  2V9A A;  5EFW A;  2Z6C A;  1RP5 A;  3T4S A;  5F82 A;  2O9C A;  3SH9 A;  2OAQ 1;  3SZT A;  4B9O A;  2V1Z A;  1K4E A;  3OCN A;  3HBR A;  1N9O A;  3LEQ A;  1GA0 A;  2KX6 A;  4YIN A;  2IWD A;  2ACG A;  4HHD A;  2Y2O A;  3S7P A;  2RCX A;  2W3H A;  3EOI A;  3HLG A;  4LFU A;  3PBO A;  1TS8 A;  1K0K A;  4KQQ A;  3UE6 A;  1E3U A;  4HH3 A;  3NI9 A;  3T1X A;  4XUZ A;  5KZH A;  3M6B A;  1K56 A;  4LEN A;  3MZE A;  4N1H A;  4EXO A;  4I39 A;  4CLC D;  1DP9 A;  2BG1 A;  1TF1 A;  4WEJ A;  4E3K A;  2PU4 A;  3PBN A;  5CX7 A;  1M40 A;  2ZQ7 A;  5IHV A;  3UE0 A;  5GHX A;  3ZG5 A;  3UB7 A;  1RGZ A;  1YAX A;  3CUE A;  1WYB A;  3H7W A;  1ALQ A;  3MXS A;  4DF6 A;  1T1B A;  2Z2M B;  4O8G A;  4XT2 B;  2Q0O A;  4PM8 A;  1CK3 A;  4JXV A;  4EQI A;  3AGE A;  4Y15 A;  3WWX A;  3PBS A;  3WS4 A;  2H0T A;  3CIT A;  1YLJ A;  1U60 A;  1JVJ A;  2J9P A;  1FIK A;  4P87 A;  2JKR M;  1KGF A;  3G30 A;  4I38 A;  5FAT A;  3GEC A;  4GS9 B;  5DKK A;  1XPB A;  5EVE A;  4S2L A;  4LLO B;  1ERM A;  3FZC A;  1MKI A;  1V9Z A;  1K57 A;  1JWV A;  1PIO A;  5HW3 A;  2W27 A;  2MJ6 A;  2PHY A;  5AVF A;  2ZMA A;  1T18 A;  1P9R A;  5E2F A;  3W2Z A;  1XGJ A;  5FEF A;  1S4R A;  2O9A A;  3MXQ A;  2FFY A;  4DE2 A;  4WM9 A;  3VP2 A;  2KDK A;  1BLP A;  4N9L A;  3E4Q A;  2V8F A;  3O88 A;  4G3K A;  1F98 A;  4JXG A;  2W1T A;  5DJT A;  3BEB A;  4Y13 A;  4R3J A;  2GDN A;  3IBR A;  4ARZ A;  3G2Z A;  5EE8 A;  2QWS A;  5FAP A;  2G2U A;  1EI5 A;  4HBT A;  5HL6 A;  3P7N A;  2WZZ A;  3MR0 A;  5G18 A;  4EBP A;  1NRF A;  3ZCZ A;  1YPR A;  5EVI B;  3WRZ A;  1KDS A;  2C6W B;  1L0F A;  4X1L A;  5TR7 A;  4MN7 A;  3IF6 C;  5FI2 A;  1IFQ A;  3VOL A;  2WGI A;  2D01 A;  5FAO A;  1ZC2 A;  3IX3 A;  1AXB A;  3A3D A;  4M4X A;  4A5R A;  5JYP A;  3RJU A;  3ZDJ A;  2CC1 A;  2D02 A;  1XJ2 A;  1E4D A;  2WAD A;  4HI4 A;  3TRC A;  3BY8 A;  3NIA A;  2EX2 A;  2VV6 A;  3DTM A;  1S6R A;  4KQR A;  3N8R A;  3PBT A;  1KDW A;  4ETX A;  1L2S A;  3CPT B;  1K6R A;  3A0V A;  2XLN A;  3QP8 A;  5HAI A;  4GJ4 A;  4DJ2 A;  3FKV A;  3UB5 P;  5EPH A;  1Y28 A;  4DDS A;  3PXP A;  2FFF B;  5F69 A;  5J8X A;  2EWV A;  1K55 C;  5CTM A;  4YWZ A;  3TSG A;  1LL8 A;  2QJ7 A;  1WA9 A;  2HF6 A;  5CRF A;  5DF9 A;  3IXG A;  2UWX A;  5AQ9 A;  3QNB A;  1TVF A;  3CHW P;  3V3S A;  4N1X A;  4NXF A;  2JKT I;  3NOU C;  1JNU A;  2ZL1 A;  4S2I A;  4CPK A;  2XSS A;  4WEL A;  5LBR A;  1HVB A;  3KYZ A;  5HFO A;  1NXY A;  4K0X A;  2XRO A;  4U0T A;  5HWT A;  3LR0 A;  3EGD C;  3BJN A;  2JC7 A;  5CGX A;  3UPO A;  2V1A A;  5HPI A;  2PT7 A;  2W3G A;  4GCZ A;  4EWF A;  4JF6 A;  5F83 A;  4DE3 A;  3H7W B;  4HIA A;  1DJC A;  2QKP A;  2BAS A;  3IH8 A;  5HD5 A;  3UN7 A;  4IVK A;  3MFD A;  3EGX C;  2EA9 A;  3ZVW A;  1ES5 A;  2Q9N A;  4B4Z A;  3DWK A;  3MJQ A;  5I5L A;  5EOO A;  1H8Y A;  1K4F A;  4K0W A;  1H8M A;  5AJG A;  1FCM A;  3GR2 A;  4ESP A;  3G34 A;  3C4P A;  3IF5 A;  1STZ A;  5FSR A;  1IYQ A;  3BWL A;  1G28 A;  3W4O A;  5FAQ A;  3HVF A;  2VGK A;  4UA9 A;  3LY3 A;  5FL3 A;  3C5A A;  1H0M A;  1FCN A;  4K91 A;  3IH9 A;  3K3C A;  5HSQ A;  5FQ9 A;  2VZW A;  2PRF A;  1MBL A;  2Y2K A;  1G5U A;  4BEN A;  1VHM A;  2L1M A;  3D4F A;  2QPN A;  4WZ5 C;  4LRY C;  5HAP A;  1N9L A;  2E8I A;  3ZVT A;  3SS5 A;  2A3U A;  2W1T B;  3GRJ A;  3IHA A;  4ARZ B;  2LB9 A;  4D2O A;  3C7U A;  5KSC A;  4KZB A;  1IKI A;  4JGQ A;  4ZBE A;  4OLG A;  5GL9 A;  3RTY A;  3IF6 A;  3PR6 A;  3UDI A;  2XR0 A;  3C7V A;  4FCF A;  5FQK A;  1ZTU A;  4X55 A;  2J8Y A;  5DFY A;  3GSG A;  1IYO A;  4PAU A;  5J3W A;  4CLC C;  2GZA A;  1L0G A;  4PKY A;  3BM6 A;  1N9N A;  1SZV A;  3NCK A;  4KG2 A;  1LI9 A;  1CQA A;  3P09 A;  3BFD A;  1S0W A;  2OWH A;  4KEN B;  3R7W A;  3M6H A;  3P98 A;  4FUW A;  4JXS A;  1KVL A;  3SW1 A;  4X69 A;  4NKP A;  4QHC A;  4ME4 A;  1GSV A;  5EEC A;  4XXR A;  2VGL M;  3BLS A;  3IXD A;  3GQZ A;  1DRM A;  1K55 A;  1OT9 A;  3T4L A;  4BD0 A;  3LEZ A;  4OP5 A;  1KGG A;  4IBR A;  4G3V A;  1D06 A; 
#chains in the Genus database with same CATH homology
 2V0U A;  3OCN A;  3PYP A;  4FOF A;  4EUV A;  1N9O A;  3KSI A;  3LIE A;  2VV7 A;  4NXE A;  2KX6 A;  3KYQ A;  4Y3I A;  3E0Y A;  4HHD A;  2DMW A;  1V9Y A;  3S7P A;  3MMH A;  3UB8 A;  4MN5 A;  2Y8H A;  3HCY A;  2J80 A;  3RFB A;  2W3H A;  3E98 A;  3EOI A;  4P6Z S;  4JGO A;  3VE3 A;  3P01 A;  4NEE D;  4EER A;  3PBO A;  1XJ3 A;  1TS8 A;  3UMD A;  3UE6 A;  3IS2 A;  2K2N A;  5K5B A;  4HH3 A;  4ZRR A;  2M7V A;  4II7 A;  3G6O A;  2VGL S;  1XFQ A;  3T4T A;  3BY9 A;  4EXO A;  4I39 A;  3EQU A;  4CLC D;  1DP9 A;  2EWW A;  3C8C A;  3S7Q A;  1TF1 A;  4WEJ A;  3PBN A;  5CX7 A;  1LSX A;  5DJU A;  4L9G A;  4WF0 A;  3UB7 A;  1LSV A;  1OTE A;  3LR3 A;  1XFN A;  1YAX A;  1T19 A;  3CUE A;  1S67 L;  3U2A A;  2HJ9 C;  3H7W A;  1UWP X;  4JGR A;  3KO6 A;  4IUH A;  1T1B A;  3K3D A;  3PHY A;  4O8G A;  4XT2 B;  5F68 A;  1S66 L;  1NLY A;  2Y79 A;  3D3O A;  5TBM A;  2P08 A;  2VKS A;  3PBS A;  3HJI A;  3NOP C;  2R78 A;  3CIT A;  2WKQ A;  3EEH A;  5HDS A;  4NXB A;  3CWF A;  5F5Y A;  5DFX A;  2J3T D;  4WEK A;  4K08 A;  4DN0 A;  2JKR M;  5HWV A;  3FPW A;  1BYW A;  3T4O A;  4I38 A;  2VEA A;  5AVE A;  3GEC A;  4GS9 B;  2JKT M;  4GW9 A;  4WUJ A;  5DKK A;  3ZQ5 A;  1YSP A;  4IUK A;  4LLO B;  3EEA A;  3CLO A;  2KLI A;  1OPX A;  1S4S A;  1V9Z A;  5J4E A;  2QJ5 A;  3LIA A;  5HDC A;  1OTD A;  5F6A A;  2W27 A;  2MJ6 A;  4E04 A;  1GSW A;  2PHY A;  3OCL A;  4KQD A;  4HJ4 A;  4HY8 A;  5AVF A;  1T18 A;  4R6L A;  3VV4 A;  3C38 A;  1P9R A;  3W2Z A;  1S4R A;  2HV1 A;  2O9A A;  1DP8 A;  3MXQ A;  4KUK A;  2KOI A;  2OAP 1;  3LIC A;  3LI9 A;  2KDK A;  2VV8 A;  3MQQ A;  3UE3 A;  4DMZ A;  2A24 A;  1OT6 A;  2A2L A;  3E4Q A;  4I3I A;  4LRX C;  4G3K A;  1F98 A;  1NWZ A;  3F1O A;  3KSH A;  2PR6 A;  3KSF A;  1VB6 A;  3D72 A;  2PD8 A;  4HOI A;  2W1T A;  5DJT A;  4IHQ A;  4ARZ A;  3IBR A;  3JVV A;  1X0O A;  4BBT A;  3OC2 A;  2QWS A;  4GHI B;  4WN5 A;  2P7J A;  4EET B;  2B18 A;  3T4K A;  3UB6 A;  1F5M A;  5HL6 A;  5KIZ A;  3P7N A;  4F3L B;  3F1N A;  3MR0 A;  1MC0 A;  4CLC A;  2I9V A;  3GDI A;  4HP4 A;  4HNB A;  1TD5 A;  4MN7 A;  2H28 A;  5HDD A;  1IFQ A;  3VOL A;  3MQ0 A;  3MF0 A;  2D01 A;  3A0S A;  4IJG A;  4BBV A;  4M4X A;  4QPR A;  2CMN A;  2O99 A;  3NJA A;  4R70 A;  2D02 A;  1F9I A;  1XJ2 A;  3TRC A;  4HI4 A;  3BY8 A;  5IS1 A;  2VV6 A;  3H82 A;  2VJW A;  3LID A;  3PBT A;  4R3A A;  4I5S A;  4ETX A;  4HH2 A;  2FZ0 A;  1TS6 A;  3FC7 A;  2ZOI A;  3S7O A;  4RQ9 A;  4DJ3 A;  3R7W B;  3A0V A;  4Q0H A;  3TE8 A;  1H3Q A;  3LFV A;  3ULF A;  4L0L A;  4BWI A;  3V67 A;  1P9W A;  2QHK A;  2HGV A;  3HJK A;  3F1P B;  4H6J B;  4GJ4 A;  1TS0 A;  4DJ2 A;  1DP6 A;  1Y28 A;  4WL9 A;  3PXP A;  5HD3 A;  5F69 A;  3KSG A;  3KX0 X;  2EWV A;  2WKR A;  2L4R A;  5G4Z A;  3TW8 A;  3IBJ A;  1TS7 A;  4YWZ A;  1LL8 A;  2QJ7 A;  1WA9 A;  2WKP A;  2HF6 A;  3TJZ C;  2W3F A;  4Q0J A;  4PKY G;  1LSW A;  5DF9 A;  4AFI A;  4BJP A;  3S7N A;  2JHE A;  4Z1W A;  4NXF A;  2JKT I;  3JVU A;  4I3J A;  3NOU C;  1JNU A;  1T1A A;  3NHQ A;  2K7S A;  4L9F A;  2GJ3 A;  2B02 A;  2XSS A;  4CQH A;  1OTI A;  3CAX A;  4MCW A;  4WEL A;  4Y5F A;  5LBR A;  3KYZ A;  3IS2 B;  4R38 A;  2M1C A;  3PBQ A;  2OOL A;  4EQ1 A;  4KUO A;  2XRO A;  2ZBB A;  3DBA A;  5HWT A;  4Y2F A;  2ZMV A;  1W63 M;  3LR0 A;  3EGD C;  3BJN A;  4ETZ A;  5A8B A;  5HPF A;  2VLG A;  4UEY A;  4LRZ E;  2V1A A;  5HPI A;  2PT7 A;  4EES A;  3LYX A;  4BMW A;  2W3G A;  4GCZ A;  3B47 A;  2GNX A;  1P0Z A;  2PYR A;  4CLC E;  2P04 A;  3OLO A;  5DKL A;  3OBF A;  4B93 A;  3H7W B;  4HIA A;  1ZHH B;  4XT2 A;  2QKP A;  2BAS A;  2NUP C;  3FPV A;  3MFX A;  3CUE C;  5HD5 A;  1XJ6 A;  5IU1 A;  2W3D A;  3E4P A;  2IA2 A;  5MC7 A;  1D7E A;  3EGX C;  1T1C A;  2ZOH A;  3VE4 A;  5TBM B;  2EA9 A;  5TJJ A;  2FH5 A;  4EU0 A;  3A0R A;  4KQO A;  2HJE A;  2ZMF A;  3MJQ A;  5I5L A;  4EEP A;  4NXG A;  1W63 Q;  3LR5 A;  1LT0 A;  5J7E A;  3LUQ A;  1H8M A;  2VA0 A;  4GS9 A;  2GX5 A;  2O9B A;  5AJG A;  3BW6 A;  4HQA A;  1NLZ A;  4Q0I A;  3C30 A;  1S1Y A;  2W0N A;  3C2W A;  4HJ3 A;  1YKD A;  1STZ A;  2INW A;  2JN7 A;  4L9E A;  5L8M A;  4BBU A;  3BWL A;  4O0P A;  1G28 A;  3MQO A;  5G4Y A;  2V1B A;  3LR4 A;  2VX8 A;  2Z6D A;  1KOU A;  3PBR A;  4YNR A;  3LIB A;  5FL3 A;  1G6O A;  1UGU A;  3UB9 A;  2G7U A;  2V0W A;  3K3C A;  5HSQ A;  2VZW A;  2YKF A;  1NRJ A;  4PHT A;  2XA7 M;  1VHM A;  2L1M A;  5HZH A;  2A24 B;  3LI8 A;  4OOL A;  2L0W A;  4FSF A;  1OJ5 A;  4O01 A;  2K31 A;  2W3E A;  4G3W A;  1OTB A;  1S1Z A;  1XJ4 A;  2W1R A;  4LRY C;  4YOF A;  5KSH A;  3F1O B;  3O5Y A;  3T50 A;  1N9L A;  2O0Y A;  2W1T B;  3ICY A;  4ARZ B;  2LB9 A;  4GHI A;  5C5K A;  3K2N A;  4LPZ A;  4I3A A;  4EW7 A;  3UME A;  4JGQ A;  2NUT C;  2PYP A;  2JKR I;  3FG8 A;  2PR5 A;  4F3L A;  4JGP A;  3RTY A;  3PR6 A;  4WLA A;  3F1N B;  1UWN X;  1YSQ A;  3B42 A;  3NOT C;  4MMN A;  3BQA A;  1ZTU A;  4CLC B;  4UQI M;  5DFY A;  4PAU A;  1GSX A;  3EWK A;  5J3W A;  1MZU A;  2M7U A;  4HJ6 A;  5HWW A;  5IT5 A;  4CLC C;  2GZA A;  2XA7 S;  4PKY A;  4MDZ A;  1N9N A;  3CI6 A;  2LB5 A;  1OJG A;  3T4Q A;  4HP9 A;  4OOM A;  3RH8 B;  2PD7 A;  3E4O A;  4GLQ A;  1OTA A;  2OWJ A;  3H9W A;  2J3W A;  2XRN A;  3LIF A;  3EQV A;  2PDR A;  1ODV A;  1IOU A;  2OWH A;  2QYB A;  4MN6 A;  4P6Z M;  1P97 A;  3H82 B;  3R7W A;  3ZYT A;  2V9A A;  2YKH A;  5EFW A;  1MKM A;  3SW1 A;  3BQ8 A;  2Z6C A;  4NKP A;  4H6J A;  3F1P A;  4ME4 A;  1GSV A;  3B33 A;  2VGL M;  1EW0 A;  3T4S A;  4UQI S;  1DRM A;  2O9C A;  2J3T C;  3OOV A;  2OAQ 1;  1OT9 A;  3T4L A;  4B9O A;  4EEU A;  3T4J A;  3R4K A;  4G3V A;  1D06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...