3HCYA

The crystal structure of the domain of putative two-component sensor histidine kinase protein from sinorhizobium meliloti 1021
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
148
structure length
145
Chain Sequence
b'SNAIEEVYEATLDAIQGALNCDRASILLFDEAGTMRFVAARGLSEHYQRAVDGHSPWINEPEPIFVENVDDAEFSRELKESIVGEGIAALGFFPLVTEGRLIGKFMTYYDRPHRFADSEIGMALTIARQLGFSIQRMRAEYARRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative two-component sensor histidine kinase protein
molecule tags Structural genomics, unknown function
source organism Sinorhizobium meliloti
publication title The crystal structure of the domain of putative two-component sensor histidine kinase protein from Sinorhizobium meliloti 1021
rcsb
total genus 39
structure length 145
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3hcyA00
2K2NA 5HPFA 3OBFA 1VHMA 5DFXA 2O9CA 2W3FA 2M7UA 1MKMA 2ZMFA 3TRCA 2M7VA 3S7PA 4FOFA 4Q0IA 4GW9A 4Y5FA 2W1TA 4Q0JA 3C2WA 1ZTUA 4MCWA 3KO6A 2KOIA 4YNRA 3MQ0A 3DBAA 2QYBA 3G6OA 4MDZA 3KSGA 3K2NA 2W1RA 5HPIA 1YKDA 2O9AA 4Y2FA 2VEAA 3S7OA 2O0YA 4G3VA 4Y3IA 5LBRA 4PAUA 4LRZE 4EUVA 3S7NA 4IJGA 3NHQA 2XRNA 2XSSA 5K5BA 4LRYC 2W1TB 1YSPA 3BJNA 2IA2A 2XROA 4O8GA 5HL6A 4DMZA 4DN0A 3IBJA 2OOLA 3W2ZA 3KSFA 1MC0A 3O5YA 5C5KA 4O0PA 3NOPC 4GLQA 2LB9A 4O01A 3KSHA 4G3WA 3OOVA 4QPRA 3MMHA 1TD5A 3LFVA 3EEAA 2GX5A 5I5LA 4R70A 2VZWA 2LB5A 2O9BA 2G7UA 1YSQA 2VKSA 1STZA 4ETZA 3KSIA 1TF1A 4EU0A 4MMNA 3VV4A 5L8MA 2B18A 4Q0HA 3MF0A 1F5MA 2W3EA 3NOUC 4IUHA 2W3DA 4ETXA 5AJGA 4MN7A 4R6LA 5DFYA 4IUKA 4YOFA 3RFBA 3R4KA 5HSQA 3CI6A 5TJJA 3IBRA 4E04A 3E98A 4ME4A 3E0YA 4Z1WA 4LRXC 4RQ9A 3HCYA 4ZRRA 2K31A 4BWIA 3S7QA 2HGVA 2VJWA 2KLIA 3NOTC 2W3HA 2Y8HA 3ZQ5A 2W3GA 4G3KA 3CITA 4CQHA 3D3OA 2Y79A 2O99A
chains in the Genus database with same CATH superfamily
4PM5A 2PHYA 1G5UA 3GTCA 2Y4AA 2HV1A 3L9KA 4BD0A 2PBYA 3LIBA 2XD5A 3ITAA 2FFFB 3WRZA 5AVFA 1MXOA 4WF0A 1Y4OA 5GHXA 1PRQA 1HLUP 5AVEA 1FOFA 2DRWA 4KZ7A 3LI9A 2O0YA 3SS5A 4LRYC 4JXVA 3T4KA 3BJNA 4O8GA 5DTTA 3LCEA 3PR6A 1YMXA 3MBZA 5CTMA 3T4JA 2EX2A 4EERA 4OLGA 2Y2LA 1Q2PA 3T1SA 3F1OA 4KZ6A 1T18A 4GS9B 2Q9MA 4Y0UA 2GX5A 3ZG8B 1DP8A 5HFOA 4KZ9A 2Y2IA 5HARA 1K4EA 4IVKA 3RJUA 1Y54A 2QPNA 1RCJA 2ZC3B 3V3SA 2B18A 1EWZA 1LT0A 4E3MA 3HLEA 2PDRA 2A49A 2G2WA 5DFYA 4EQ1A 3UDIA 5U47A 4EV4A 2P74A 1BLCA 2A2LA 3FKWA 2ZC4B 1XA7A 3C7UA 2GNXA 1K54C 1XJ6A 3E4OA 5HAPA 1WE4A 1BLSA 5F1GA 3FZCA 3PBQA 1W79A 3N7WA 2XFTA 1PI5A 2HDUA 3OBFA 1LI9A 2VV8A 1I2WA 4GW9A 3KYEA 1F98A 1ZTUA 3NECA 2KOIA 4KZ8A 4PM7A 1CJFA 1N9OA 1IELA 3KX0X 1IFQA 2O9AA 4K0WA 3IHAA 4X1LA 2J9PA 3VOZA 4WZ5C 3HJIA 2JKFA 4JF6A 3JVVA 4K91A 4PM9A 2QJ7A 2C5WB 2ZM8A 3IQAA 4BBTA 4EETB 3N8RA 3NIAA 3IF6A 1NXYA 1OJ5A 4WZ4A 4LPZA 5FEGA 2ZLYA 1NWZA 2DMWA 1YLZA 3KSIA 3NY4A 3O3VA 3AGDA 2JKRI 4MMNA 2JC7A 3HLDA 1K6RA 2H0TA 4DF6A 3MF0A 5HWTA 4ETXA 4LCLA 4X25A 1BTLA 2X71A 1LL9A 3V5MA 1EROA 2HP6A 2H5SA 3UDFA 2UV0E 4E3OA 3E0YA 4ZJ1A 4OPRA 3NULA 1WA9A 3S7QA 3PTEA 4DDYA 2V20A 3H7WA 1IYSA 5KZHA 1PFLA 3MXRA 4FOFA 4S2NC 2WZZA 2HP5A 2W1TA 5FI7A 4X68A 4E3NA 3V3RA 1XA1A 3T4SA 2VGLM 3A0VA 4D2OA 4OH0A 3R7WB 2HDQA 4Y3IA 3G30A 2XSSA 3UY6A 2I9VA 1N4OA 3LEQA 2V8CA 3UE1A 2XLNA 3B47A 5EVID 3IHBA 4OKPA 3B3XA 3EWKA 4I38A 5GLBA 1IEMA 2WAEA 1L0GA 3OCNA 3GV9A 1K57A 1T1CA 3PAEA 3HLBA 3UB9A 1HTZA 1E25A 5FQMA 4I3IA 3T4OA 1K38A 4GOGA 2KX6A 4RX3A 5E2HA 1MKIA 2OWHA 1NLZA 3A0RA 4YOFA 1J3WA 2JHEA 4P85A 3E98A 2HF6A 3HLCA 5HDCA 5HWVA 5GLCA 3LIFA 2XQZA 2Z2LB 3NBLA 5HAQA 4HH3A 1KVMA 1ERMA 1IYOA 1W63M 5DFXA 1T19A 3C38A 4X55A 1VQQA 2WGWA 4Q0JA 3A3JA 2VLGA 4Y7PA 4ZJ2A 4NXEA 1N9LA 3N6IA 1YM1A 3LR4A 1OMEA 4LLOB 5G18A 3KO6A 2MJ6A 2VK3A 2GDNA 4HJ4A 4JF4A 1D06A 4KZ3A 5HAIA 4JKTA 4MLLA 3B33A 4XUXA 5K5BA 3BFEA 4ARZB 4OQIA 5AQ9A 3IXHA 4DN0A 3BECA 1LSXA 3VE3A 3ZG5A 4U0XA 1IYQA 3RXWA 2IWDA 4E3KA 3GMWA 4G3WA 1SKFA 1SDEA 2ZL1B 3LYXA 4B4XA 1H8ZA 4MBKA 3H82A 4X69A 1YLYA 2YKHA 3BEBA 1FQGA 2VX8A 2RCXA 3JPUA 3HL9A 2XA7S 4IVIA 1K56D 4PHTA 3QP1A 2FZ0A 4HBTA 1UWPX 4UA7A 5L8MA 3SW1A 3ZG7B 2ZQAA 4EQIA 2QZ6A 2V2FF 3C5AA 3TW8A 3U4LP 3F1OB 2W27A 3RFBA 4DXCA 1NLYA 5M1AA 3ZNTA 3DW0A 1JVJA 3C4PA 3HCYA 2Y2PA 3TG9A 4R3AA 4WLAA 1AXBA 1K56A 5KIZA 5HDDA 3W4QA 4KQDA 5AQBA 3TOIA 4HJ6A 4KQQA 1O7EA 2H28A 3W4OA 4N1HA 5F6AA 3CG5A 5A92A 3ICYA 3VOLA 4C3QA 4P6BA 3BFDA 4R3BA 4F3LA 3UPNA 4JPMA 4KZ4A 2XR0A 3SS4A 2EX9A 5CEDA 2XROA 5DF7A 2V1BA 2PYPA 1J9MA 2OLVA 4KZ5A 1PWDA 4O0PA 1OT9A 1DJCA 2L4RA 3ZHHA 3M2KA 3GVBA 4R23A 3T50A 4S2IA 3U2AA 1FCOA 4FCFA 5CGWA 1YSQA 4ETZA 1M6KA 4EU0A 2ZBBA 4N1XA 3NDEA 2Y2MA 3SS3A 3T12B 4FTXA 4OQHA 2VGLS 3QHYA 3BQAA 3FG8A 2WKRA 1GHIA 5AJGA 3BY9A 3FKVA 1W7FA 3UB5P 2V9AA 5J8XA 1RP5A 2BTFP 4DDSA 5TR7A 1PW8A 2J8YA 2HGVA 4I3AA 4BMWA 1XJ2A 1A0KA 4WMCD 3IS2A 5HWWA 1I2SA 5FA7A 1P9RA 3ZNYA 1H5XA 1W8YA 1FR1A 3OLOA 1HZOA 1L0EA 1MWUA 4GNUA 3HREA 3IXBA 3KSGA 2XK1A 4L0LA 4E3LA 4Y2FA 3VP3A 1LSVA 2DCFA 3GRJA 3K3CA 4G3VA 4AFIA 4N9LA 4PM8A 3G2ZA 3GDIA 3MS6A 4P0MA 4R0QA 1QMEA 3NOPC 3O86A 5EE8A 5CERA 3CMZA 4X1MA 3CJMA 1N9NA 4Z9QA 2Z2MB 4X6TA 3FYZA 1PI4A 1LLBA 3ZG0A 5AQAA 1ONHA 1XP4A 5TFQA 1S67L 4S2JA 1TEMA 2OV5A 4IBRA 3P09A 1K57C 3MZDA 5HD5A 3T1RA 3VOYA 4Q0HA 2GZAA 1LL5A 5EM1A 5KMWA 1XPBA 4OVDA 2QWSA 4KENB 2B02A 5CRFA 5MC7A 1CK3A 2Y91A 3MSHA 3R4KA 1D1JA 1ACFA 2NUTC 4GD6A 2P04A 1ZG4A 2VGJA 5TBMB 3Q7VA 1SCWA 3LI8A 1S0WA 3JVUA 3BLMA 5AQ7A 2WKEA 2W3GA 4CQHA 5CGXA 3D3OA 4WEKA 1MZUA 1P9WA 2O99A 3C8CA 1LHYA 4ARZA 1T1AA 5CGSA 2M7UA 1M40A 2WKPA 3VSKA 2QHKA 5EV0A 2ACGA 2OAP1 2WAFA 1E3UD 4CLCE 4DE2A 5L2FA 1JTGA 3MFDA 1FSWA 1ZKJA 3CHWP 1YT4A 2VEAA 1OJGA 1SDNA 4PMAA 5LBRA 4EW7A 4EUVA 3S7NA 5DF9A 4GS9A 3WWXA 5A90A 5HL6A 4DMZA 1YLPA 1WYBA 3WS2A 2DNSA 5EPHA 1GA0A 1KDSA 2Y2NA 2ZC7A 3CAXA 3P7NA 3SH8A 3IXDA 3OCLA 3WS0A 4U3TA 3N8SA 2ZD8A 3FWLA 4DKIA 2AVXA 4NG2A 1AWIA 1PZOA 1WYCA 3PBRA 3UO9A 2WGIA 3VE4A 5GL9A 3M6HA 3IF6B 5G4YA 1DP9A 1TVFA 1IYPA 1H0MA 2WKHA 1DJBA 3T1XA 3W4PA 2PBDP 2J80A 2E8JA 2ZQ7A 3CPTB 4E04A 5DJTA 1E3UA 3H82B 2WZXA 1MWSA 4QY5A 1XFNA 2WKQA 4XT2B 3FPWA 4X56A 3ZYTA 4JLFA 2JKRM 5TGFA 3BFCA 2EXAA 2PRFA 3C30A 2E8IA 3VMAA 5FI2A 3WRTA 4ZTKA 2K7SA 5FQIA 4NXFA 4F94A 2EA9A 3DAVA 1HD8A 2XH9A 3LR0A 2KDKA 1XX2A 5HDSA 1S6RA 3H9WA 3UE3A 3ZCZA 2EXBA 2VGKA 3Q82A 1E4DA 4P6ZS 1VB6A 3CZDA 4OONA 4PAUA 4H8RA 4LV3A 2HDSA 1JWVA 5EFWA 3KSFA 4S2OA 1W8QA 1NRJA 3OOVA 4QPRA 4R38A 5JYOA 4HP9A 1ESIA 2WGVA 4XUZA 5EOEA 4YFMA 1VEUB 2ZOIA 5FQJA 1NZOA 3IF6C 4WUJA 2G7UA 4I39A 3ISGA 1W5DA 1S4RA 3G32A 5DTSA 1TF1A 4GDNA 4HP4A 1ES4A 3MZEA 5E2EA 2V0WA 5G4ZA 1SKOB 4HY8A 4RYEA 2WGWB 3UN7A 3DWKA 2W3EA 1NJ4A 3HUMA 2QKPA 1TDGA 2Y59A 2PD8A 1TS0A 4BQMA 5KSHA 3V50A 5TJJA 4LENA 1FILA 3N4IA 4LRXC 4OLDA 5L10A 2WYXA 1L0FA 2JKTM 1CQAA 5DF8A 3T4LA 4Y15A 3CLOA 3M6BA 5DVAA 5M19A 1MPLA 1FCNA 5HPFA 1VHMA 1PWGA 3IF5A 3PBNA 1FR6A 4FH4A 4WELA 3HUOA 1OT6A 5FDHA 4JXWA 3IS2B 3RXXA 4H6JB 1KDWA 3CUEA 4YNRA 4WN5A 1LL8A 5I94A 3LIAA 2OLUA 3V39A 4MDZA 2W1RA 3VSLA 3IT9A 2H10A 4EBNA 4L9FA 3T4TA 4L9GA 3LIEA 1XJ3A 2W1TB 2J3TC 4HQAA 4HH2A 1F2KA 2P9VB 4OPQA 1C3BA 4K0XA 2QJ5A 2ZMAA 5GLDA 4QU3A 1DJAA 4OOMA 3KYZA 1X0OA 1F9IA 3CWFA 2ZOHA 1K0KA 3QNBA 4EESA 2OSUA 4GCZA 2LB5A 2XFSA 4LFUA 4CLCD 3MQQA 5CX7A 5DKKA 4UA6A 4MN5A 1YQSA 2P9VA 4K08A 4UA9A 4II7A 4DE1A 4WL9A 3LO7A 4FUWA 4R3JA 1ERQA 4D60A 3OPPA 4WMCA 3HJKA 4OPYA 2XF3A 3QP6A 1BT5A 4UQIS 1T1BA 2J3WA 3Q07A 1K25A 2Q9NA 3HUNA 3MZFA 3QP2A 3EOIA 4EEPA 3OC2A 3UE0A 3D4FA 2Y2KA 3O87A 2YKFA 1BULA 1S1YA 4B9OA 3G35A 2R9XA 4S2LA 1S4SA 1ES5A 3PXPA 3B42A 3MQ0A 4CPKA 3F1PA 4NXBA 3VFHA 4NKPA 4RVAA 4Y0TA 3I7JA 3IH8A 3VP0A 4C75A 4LV0A 2XRNA 5E2GA 3NJAA 4DE3A 2IA2A 3C4OA 5FL3A 2HJ9C 3IBJA 1MC0A 5EOOA 3DTMA 4EUZA 1TS6A 3OPRA 3RH8B 1CI9A 5DTKA 3GSGA 1SKOA 3D72A 3LY4A 2J7VA 5L09A 2BASA 4QD4A 5EM0A 1JNUA 1V9ZA 4R4SA 2PR6A 2XA7M 3G34A 4Y0OA 4ID4A 1EI5A 2VKSA 2A3UA 4QB8A 3UPPA 3VV4A 2OWJA 1PW1A 1YLWA 1Q2QA 3NOUC 4GHIB 1OTIA 1YMSA 2ZQDA 3SOIA 3ZFZA 1LI0A 1D7EA 4E3JA 2ZMVA 5FAQA 3IBRA 5CTNA 1VM1A 2BG1A 3IWQA 2G2UA 2Q0OA 2ZQ8A 2Y8HA 5FQKA 1MBLA 2INWA 1ZHHB 4QY6A 5CEBA 3E2KA 5F69A 4PM6A 2Y79A 4JXGA 4P6ZM 2PU2A 2V0UA 4KUKA 3WS5A 4MBHA 1SHVA 2EX6A 2W3FA 4JXSA 1FIKA 3S7PA 4I5SA 1CEGA 5FI6A 4E6WA 4ZBEA 2XEPA 4CJNA 3F1PB 2PT7A 1L0DA 3MR0A 3MXSA 1GA9A 3WS4A 1YKDA 3S7OA 4OOYA 1IOUA 1G6OA 5CHJA 3Q7ZA 2R78A 1YSPA 1NYMA 2OAQ1 2JCHA 2L1MA 2X01A 5EVLA 5C5KA 2LB9A 4WEJA 4JGRA 4EBLA 5M18A 1O07A 4JF5A 5GLAA 4B88A 3Q81A 5IHVA 4DJ2A 1ES3A 4OQGA 3A3DA 4HBUA 5HW3A 4RX2A 3UNWA 4GZBA 5CECA 4ESPA 3F1NB 4JGPA 5CHUA 2IWCA 2D01A 5KSCA 3MQOA 4BENA 3SH7A 1W63Q 3RTYA 4S2PA 4LCMA 2Y55A 5FQQA 4O7DA 2PU4A 5IT5A 5E2FA 2Y2HA 3NI9A 4IUKA 1XJ4A 2Y2GA 1NYYA 4FSFA 3OPHA 4B4ZA 3SH9A 1DY6A 5EVIC 1QMFA 4RQ9A 4ZRRA 4N92A 1SZVA 4U0TA 2HPBA 3ZQ5A 5HD3A 2VV6A 2JKTI 3CITA 4CLCA 4HNBA 3LICA 3IX8A 4HI4A 1ES2A 2FH5A 3OZHA 3TRCA 1MKMA 1YLJA 5FEFA 3BQ8A 5DJUA 5TBMA 3SZTA 4M4XA 4HESA 2J3TD 1K55A 2ZL1A 4UEYA 2JE5A 3L7HA 3UMDA 3KYQA 3G2YA 4WM9A 3LUQA 4NK3A 4GD8A 1PWCA 3Q1FA 3P98A 3E4QA 3S1YA 3VP1A 2OOLA 4UQIM 1Z09A 3O5YA 1GSXA 3KSHA 4NETA 1Y28A 2I72A 3MXQA 3UDXA 2VV7A 4NXGA 3EEAA 5IU1A 2PD7A 3FPVA 1UGUA 3UB6A 1XFQA 3VP2A 2P08A 1S1ZA 5CXWA 1ODVA 2XDMA 4OQ0A 2GJ3A 3IX4A 1FSYA 4KQOA 3EGXC 2WUQA 5J4EA 2BLSA 5F82A 1CI8A 1VEUA 1PNEA 3BWLA 2NUPC 2W0NA 3NOTC 3OPLA 4Q8IA 1L3LA 5BOHA 4A5RA 3MFXA 4OP8A 1XGIA 5EVIB 2Y2JA 4B93A 4QWOA 2Y2OA 3FV7A 4ZJ3A 1OTBA 1MWRA 4GKUA 1KE0A 3AGFA 1BUEA 1XXMA 3D9YA 2X02A 3Q7VB 3C2WA 5F68A 4JBFA 1GSWA 4EBPA 1V9YA 4PKYA 5DKLA 4FD8A 2Z6CA 3IWIA 2IWBA 2V1ZA 3K2NA 1LSWA 3EEHA 3EQVA 4KZAA 4ZAMA 4OPZA 3LGOA 1OTAA 2RL3A 1KOUA 2ZJ9A 3R7WA 1BZAA 4OP5A 2HJEA 5EVIA 4DE0A 4O01A 3UB8A 1N9BA 5F5YA 1K4FA 4BL2A 3T4QA 3BM6A 4BD1A 1VETB 2WK0A 4IBXA 1YPRA 2WADA 5J3WA 3ZG9B 1OTDA 1NZUA 2JN7A 1STZA 4S2MA 3K3DA 3PYPA 3S4XA 3N8LA 3W8KA 3IXGA 4LGWA 3BRMA 3A3FA 4PKYG 1F5MA 2W3DA 4WZ5A 4R6LA 1ESUA 3G31A 4P87A 4UAAA 1DP6A 1P0ZA 3UMEA 3CI6A 4OOLA 3P01A 4KQRA 4MEZA 4RA7A 4IHQA 4DXBA 1K54A 4EEUA 1PZPA 1IKGA 5A93A 4LV1A 3LR5A 4PPRA 3GQZA 2M7VA 3HLWA 4Q0IA 4Y5FA 3FC7A 1XKZA 3BW6A 5JYPA 2V8FA 3PBOA 3ZGAB 4FH2A 3DBAA 2VA0A 3G6OA 1YLTA 2PYRA 1OTEA 3M2JA 3QNCA 4LRZE 2EWWA 3QP4A 3O88A 4WBGA 4LV2A 3CPTA 3MKFA 3ULFA 3A0SA 5D3OA 5EECA 4GLQA 4GHIA 4GJ4A 3E2LA 4HJ3A 1L2SA 3T1QB 3LEZA 5FQ9A 1TD5A 5I5LA 2D02A 1TDLA 2Y2QA 3EQUA 4X53A 3A3EA 3HBRA 2EX8A 3LIDA 4KG5A 3MJQA 4GDBA 2EFXA 1KGGA 3IH9A 4YINA 1U60A 2ZQ9A 1G68A 1RGYA 3NC8A 1HVBA 4YWZA 3A3IA 1XGJA 3ZDJA 2CC1A 3DWZA 1K6SA 5HSQA 2ZM2A 3WS1A 2V1AA 2ZQCA 4E3IA 2K31A 4HHDA 5FASA 2KLIA 3BFFA 2W3HA 3GR2A 3ZVWA 1GHPA 4DRTA 3TSGA 1I5QA 3QP8A 2K2NA 4BBUA 1GCEA 1VETA 3MKEA 3HLFA 4BL3A 3DTIA 1IKIA 1EW0A 3LR3A 2ZM0A 2HDRA 3PHYA 4EXOA 3AGEA 5FAOA 5FDSA 2QYBA 2A24B 5L07A 5HPIA 2C6WB 1NRFA 4GN2A 1GSVA 5EUAA 1KGEA 5HL1A 4S2KA 4DJ3A 1JWZA 4IJGA 3NHQA 4KUOA 4ZDXA 2ZC6B 1CEFA 4N9KA 1G28A 4CLCB 5EVEA 2B5RA 3BFGA 1KE4A 3MMHA 3PBTA 4WYYA 5GHZA 4R70A 1KVLA 1ZC2A 1BYWA 3JYIA 3IX3A 1H8MA 2XGNA 1PYYA 2UWXA 2B95A 2Z6DA 3H7WB 5F1FA 3UB7A 1KE3A 4I3JA 1UWNX 4HEFA 5A91A 2H0YA 1GHMA 4MBFA 3HVFA 4KZBA 4E6XA 5HZHA 1JTDA 4MN7A 1OPXA 4NEED 3DTEA 3F1NA 4XXRA 3V67A 2P7JA 4Y17A 4BLMA 4Z1WA 4IEDA 4BWIA 4HOIA 4KG2A 4HIAA 2J9OA 3NDGA 4UHUA 3C7VA 3GECA 1P97A 1BLHA 1FCMA 2QMIA 2FFYA 2L0WA 5F83A 2O9CA 4S2NA 2ZMFA 4M3KA 3S22A 3TE8A 3TJZC 1CF0A 2EFUA 4MN6A 1K55C 4MCWA 1H8YA 1G6AA 4BJPA 5HX9A 4QHCA 1TS7A 1YAXA 2M1CA 2PR5A 3BYDA 5FSRA 2JBFA 4JGOA 4GB7A 4L9EA 4C6YA 4R4RA 1BSGA 3W2ZA 5A8BA 1KGFA 2JKGA 1MWTA 3QP5A 1PIOA 3ITBA 2EWVA 1NY0A 3BY8A 2HP9A 4Y13A 3LFVA 4CLCC 1H3QA 2VZWA 5FATA 2R9WA 2O9BA 1JWPA 3IWOA 3NCKA 5FAPA 3UPOA 3PAGA 1ALQA 4R1GA 4EWFA 5CHMA 1Z6FA 2WKIA 3CUEC 3HLGA 4QJGA 1RGZA 1TS8A 2HZ5A 4BBVA 3UE6A 2XD1A 4IUHA 3EGDC 2CMNA 1ONGA 3ZVTA 4XT2A 2A24A 2ZC5B 4MNRA 5E43A 3VP4A 5J7EA 1BLPA 4ME4A 3BLSA 3LY3A 3PBSA 5IS1A 4H6JA 4KG6A 4JGQA 5GHYA 2VJWA 3E4PA 3DTKA 1ZG6A 3VFFA 1DRMA 4G3KA 1MY8A 2PAVP 1S66L 3G4PA 4F3LB
chains in the Genus database with same CATH topology
3MFXA 5HPFA 4B93A 1VHMA 2PHYA 3PBNA 2HV1A 4KQDA 1OTBA 4HJ6A 4WELA 1OT6A 3LIBA 2H28A 3C2WA 5F68A 5AVFA 3IS2B 4H6JB 1GSWA 4WF0A 5F6AA 3CUEA 1V9YA 4PKYA 5DKLA 5AVEA 4YNRA 4WN5A 1LL8A 3ICYA 3VOLA 3LIAA 2Z6CA 4MDZA 3LI9A 3K2NA 2W1RA 4F3LA 1LSWA 2O0YA 4L9FA 3T4TA 3EEHA 3EQVA 4L9GA 3LIEA 1XJ3A 4LRYC 2W1TB 2J3TC 4HQAA 3T4KA 4HH2A 3BJNA 1OTAA 2XROA 4O8GA 2V1BA 1KOUA 2PYPA 3R7WA 3PR6A 2QJ5A 2HJEA 3T4JA 4EERA 4O0PA 3F1OA 4O01A 3UB8A 1OT9A 5F5YA 1T18A 4OOMA 3KYZA 4GS9B 2L4RA 1X0OA 1F9IA 3CWFA 2ZOHA 3T4QA 3T50A 2GX5A 3U2AA 4EESA 1DP8A 4GCZA 2LB5A 5J3WA 1OTDA 4CLCD 3MQQA 5CX7A 5DKKA 1YSQA 2JN7A 1STZA 4MN5A 4ETZA 3K3DA 3PYPA 4K08A 4EU0A 4II7A 2ZBBA 4WL9A 2B18A 4PKYG 2VGLS 1F5MA 1LT0A 3BQAA 3FG8A 2PDRA 2W3DA 2WKRA 5AJGA 3BY9A 4R6LA 5DFYA 3HJKA 4EQ1A 1DP6A 2V9AA 1P0ZA 4UQIS 1T1BA 2J3WA 3CI6A 2A2LA 3UMEA 4OOLA 3P01A 2GNXA 1XJ6A 3E4OA 2HGVA 4IHQA 4I3AA 4BMWA 3PBQA 1XJ2A 4EEUA 3EOIA 4EEPA 3OC2A 3LR5A 3IS2A 3OBFA 5HWWA 2VV8A 2M7VA 4Q0IA 4GW9A 3FC7A 2YKFA 4Y5FA 1S1YA 3BW6A 1P9RA 4B9OA 1S4SA 1F98A 1ZTUA 3PBOA 2KOIA 3PXPA 3OLOA 3B42A 3MQ0A 3DBAA 3F1PA 4NXBA 2VA0A 3G6OA 1N9OA 3KSGA 3KX0X 4NKPA 2PYRA 1IFQA 1OTEA 2O9AA 4L0LA 4Y2FA 1LSVA 3K3CA 4G3VA 4LRZE 4AFIA 2EWWA 3HJIA 2XRNA 3GDIA 3NJAA 3JVVA 2IA2A 5FL3A 2HJ9C 3IBJA 3ULFA 3A0SA 1MC0A 3NOPC 1TS6A 4GLQA 4GHIA 3RH8B 4GJ4A 2QJ7A 4HJ3A 1N9NA 3D72A 1TD5A 2BASA 4BBTA 1JNUA 5I5LA 4EETB 1V9ZA 2D02A 3EQUA 1OJ5A 2PR6A 2XA7M 4LPZA 1NWZA 1S67L 2VKSA 2DMWA 3LIDA 3KSIA 3MJQA 2JKRI 5HD5A 4MMNA 3VV4A 2OWJA 4Q0HA 2GZAA 3MF0A 3NOUC 4GHIB 1OTIA 5HWTA 4ETXA 2QWSA 2B02A 1D7EA 4YWZA 5MC7A 2ZMVA 3R4KA 5HSQA 2NUTC 2P04A 3IBRA 2V1AA 3E0YA 2K31A 4HHDA 5TBMB 1WA9A 3S7QA 3LI8A 2KLIA 2W3HA 3JVUA 2Y8HA 2INWA 2W3GA 1ZHHB 4CQHA 5F69A 3D3OA 4WEKA 2Y79A 1MZUA 3H7WA 2O99A 1P9WA 4P6ZM 2V0UA 2K2NA 4KUKA 3C8CA 4BBUA 4ARZA 2W3FA 1T1AA 2M7UA 2WKPA 4FOFA 4I5SA 3S7PA 1EW0A 2QHKA 3LR3A 2W1TA 2OAP1 3PHYA 4EXOA 3F1PB 4CLCE 2PT7A 3MR0A 3T4SA 2VGLM 2QYBA 3A0VA 2A24B 3R7WB 5HPIA 1YKDA 2VEAA 1OJGA 3S7OA 1GSVA 4Y3IA 5LBRA 4EW7A 1IOUA 1G6OA 3S7NA 4DJ3A 4EUVA 4IJGA 3NHQA 2XSSA 2R78A 5DF9A 4GS9A 4KUOA 1YSPA 5HL6A 4DMZA 2OAQ1 1G28A 2I9VA 4CLCB 2L1MA 5C5KA 3CAXA 3P7NA 2LB9A 4WEJA 4JGRA 3OCLA 3B47A 3MMHA 3PBTA 4DJ2A 3EWKA 4I38A 4R70A 1BYWA 1H8MA 3F1NB 4JGPA 3PBRA 3OCNA 2Z6DA 3H7WB 2D01A 1T1CA 3MQOA 3VE4A 3UB7A 1W63Q 4I3JA 3RTYA 3UB9A 1UWNX 4I3IA 3T4OA 5G4YA 2KX6A 1DP9A 5HZHA 5IT5A 2OWHA 4MN7A 1NLZA 1OPXA 3A0RA 4NEED 3F1NA 4IUKA 4YOFA 1XJ4A 2J80A 2JHEA 4FSFA 3V67A 2P7JA 4E04A 3E98A 5DJTA 4Z1WA 2HF6A 4RQ9A 4ZRRA 3H82B 4BWIA 4HOIA 5HDCA 1XFNA 5HWVA 4HIAA 2WKQA 3LIFA 3ZQ5A 5HD3A 3GECA 2VV6A 4XT2B 2JKTI 3CITA 3FPWA 3ZYTA 4CLCA 4HNBA 1P97A 2JKRM 4HH3A 3LICA 4HI4A 3C30A 1W63M 2L0WA 5DFXA 2O9CA 1T19A 2FH5A 3C38A 3TRCA 1MKMA 2ZMFA 3BQ8A 5DJUA 5TBMA 2K7SA 3TE8A 3TJZC 4Q0JA 4M4XA 2VLGA 4MN6A 4NXEA 1N9LA 4NXFA 4MCWA 2EA9A 3LR4A 2J3TD 4LLOB 3KO6A 3LR0A 2MJ6A 4BJPA 4UEYA 2KDKA 4HJ4A 1D06A 3UMDA 5HDSA 1TS7A 3H9WA 3UE3A 1YAXA 3KYQA 2M1CA 4P6ZS 2PR5A 3LUQA 1VB6A 4PAUA 3B33A 4JGOA 4L9EA 5K5BA 4ARZB 3E4QA 4DN0A 1LSXA 3VE3A 2OOLA 4UQIM 3W2ZA 5EFWA 3KSFA 5A8BA 3O5YA 1NRJA 1GSXA 3KSHA 4G3WA 3OOVA 4QPRA 1Y28A 3MXQA 4R38A 2EWVA 3BY8A 3LYXA 2VV7A 4HP9A 4NXGA 3LFVA 3EEAA 4CLCC 3H82A 1H3QA 2VZWA 2ZOIA 2YKHA 2VX8A 2O9BA 4WUJA 5IU1A 2PD7A 2G7UA 3FPVA 1UGUA 4I39A 3UB6A 2XA7S 1XFQA 4PHTA 1S4RA 1TF1A 4HP4A 2FZ0A 1UWPX 2P08A 2V0WA 5L8MA 3CUEC 4HY8A 5G4ZA 3SW1A 1S1ZA 1ODVA 1TS8A 2GJ3A 4BBVA 3UE6A 2W3EA 4IUHA 3EGDC 2QKPA 2CMNA 4KQOA 2PD8A 3EGXC 3TW8A 1TS0A 5J4EA 3F1OB 2W27A 2A24A 4XT2A 3RFBA 5KSHA 5TJJA 1NLYA 5J7EA 4ME4A 3PBSA 3BWLA 5IS1A 2NUPC 4H6JA 4LRXC 3HCYA 4JGQA 2W0NA 2VJWA 3E4PA 3NOTC 4R3AA 2JKTM 4WLAA 1DRMA 4G3KA 3T4LA 5KIZA 3CLOA 1S66L 5HDDA 4F3LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K2N A;  5HPF A;  3OBF A;  1VHM A;  5DFX A;  2O9C A;  2W3F A;  2M7U A;  1MKM A;  2ZMF A;  3TRC A;  2M7V A;  3S7P A;  4FOF A;  4Q0I A;  4GW9 A;  4Y5F A;  2W1T A;  4Q0J A;  3C2W A;  1ZTU A;  4MCW A;  3KO6 A;  2KOI A;  4YNR A;  3MQ0 A;  3DBA A;  2QYB A;  3G6O A;  4MDZ A;  3KSG A;  3K2N A;  2W1R A;  5HPI A;  1YKD A;  2O9A A;  4Y2F A;  2VEA A;  3S7O A;  2O0Y A;  4G3V A;  4Y3I A;  5LBR A;  4PAU A;  4LRZ E;  4EUV A;  3S7N A;  4IJG A;  3NHQ A;  2XRN A;  2XSS A;  5K5B A;  4LRY C;  2W1T B;  1YSP A;  3BJN A;  2IA2 A;  2XRO A;  4O8G A;  5HL6 A;  4DMZ A;  4DN0 A;  3IBJ A;  2OOL A;  3W2Z A;  3KSF A;  1MC0 A;  3O5Y A;  5C5K A;  4O0P A;  3NOP C;  4GLQ A;  2LB9 A;  4O01 A;  3KSH A;  4G3W A;  3OOV A;  4QPR A;  3MMH A;  1TD5 A;  3LFV A;  3EEA A;  2GX5 A;  5I5L A;  4R70 A;  2VZW A;  2LB5 A;  2O9B A;  2G7U A;  1YSQ A;  2VKS A;  1STZ A;  4ETZ A;  3KSI A;  1TF1 A;  4EU0 A;  4MMN A;  3VV4 A;  5L8M A;  2B18 A;  4Q0H A;  3MF0 A;  1F5M A;  2W3E A;  3NOU C;  4IUH A;  2W3D A;  4ETX A;  5AJG A;  4MN7 A;  4R6L A;  5DFY A;  4IUK A;  4YOF A;  3RFB A;  3R4K A;  5HSQ A;  3CI6 A;  5TJJ A;  3IBR A;  4E04 A;  3E98 A;  4ME4 A;  3E0Y A;  4Z1W A;  4LRX C;  4RQ9 A;  3HCY A;  4ZRR A;  2K31 A;  4BWI A;  3S7Q A;  2HGV A;  2VJW A;  2KLI A;  3NOT C;  2W3H A;  2Y8H A;  3ZQ5 A;  2W3G A;  4G3K A;  3CIT A;  4CQH A;  3D3O A;  2Y79 A;  2O99 A; 
#chains in the Genus database with same CATH topology
 4PM5 A;  2PHY A;  1G5U A;  3GTC A;  2Y4A A;  2HV1 A;  3L9K A;  4BD0 A;  2PBY A;  3LIB A;  2XD5 A;  3ITA A;  2FFF B;  3WRZ A;  5AVF A;  1MXO A;  4WF0 A;  1Y4O A;  5GHX A;  1PRQ A;  1HLU P;  5AVE A;  1FOF A;  2DRW A;  4KZ7 A;  3LI9 A;  2O0Y A;  3SS5 A;  4LRY C;  4JXV A;  3T4K A;  3BJN A;  4O8G A;  5DTT A;  3LCE A;  3PR6 A;  1YMX A;  3MBZ A;  5CTM A;  3T4J A;  2EX2 A;  4EER A;  4OLG A;  2Y2L A;  1Q2P A;  3T1S A;  3F1O A;  4KZ6 A;  1T18 A;  4GS9 B;  2Q9M A;  4Y0U A;  2GX5 A;  3ZG8 B;  1DP8 A;  5HFO A;  4KZ9 A;  2Y2I A;  5HAR A;  1K4E A;  4IVK A;  3RJU A;  1Y54 A;  2QPN A;  1RCJ A;  2ZC3 B;  3V3S A;  2B18 A;  1EWZ A;  1LT0 A;  4E3M A;  3HLE A;  2PDR A;  2A49 A;  2G2W A;  5DFY A;  4EQ1 A;  3UDI A;  5U47 A;  4EV4 A;  2P74 A;  1BLC A;  2A2L A;  3FKW A;  2ZC4 B;  1XA7 A;  3C7U A;  2GNX A;  1K54 C;  1XJ6 A;  3E4O A;  5HAP A;  1WE4 A;  1BLS A;  5F1G A;  3FZC A;  3PBQ A;  1W79 A;  3N7W A;  2XFT A;  1PI5 A;  2HDU A;  3OBF A;  1LI9 A;  2VV8 A;  1I2W A;  4GW9 A;  3KYE A;  1F98 A;  1ZTU A;  3NEC A;  2KOI A;  4KZ8 A;  4PM7 A;  1CJF A;  1N9O A;  1IEL A;  3KX0 X;  1IFQ A;  2O9A A;  4K0W A;  3IHA A;  4X1L A;  2J9P A;  3VOZ A;  4WZ5 C;  3HJI A;  2JKF A;  4JF6 A;  3JVV A;  4K91 A;  4PM9 A;  2QJ7 A;  2C5W B;  2ZM8 A;  3IQA A;  4BBT A;  4EET B;  3N8R A;  3NIA A;  3IF6 A;  1NXY A;  1OJ5 A;  4WZ4 A;  4LPZ A;  5FEG A;  2ZLY A;  1NWZ A;  2DMW A;  1YLZ A;  3KSI A;  3NY4 A;  3O3V A;  3AGD A;  2JKR I;  4MMN A;  2JC7 A;  3HLD A;  1K6R A;  2H0T A;  4DF6 A;  3MF0 A;  5HWT A;  4ETX A;  4LCL A;  4X25 A;  1BTL A;  2X71 A;  1LL9 A;  3V5M A;  1ERO A;  2HP6 A;  2H5S A;  3UDF A;  2UV0 E;  4E3O A;  3E0Y A;  4ZJ1 A;  4OPR A;  3NUL A;  1WA9 A;  3S7Q A;  3PTE A;  4DDY A;  2V20 A;  3H7W A;  1IYS A;  5KZH A;  1PFL A;  3MXR A;  4FOF A;  4S2N C;  2WZZ A;  2HP5 A;  2W1T A;  5FI7 A;  4X68 A;  4E3N A;  3V3R A;  1XA1 A;  3T4S A;  2VGL M;  3A0V A;  4D2O A;  4OH0 A;  3R7W B;  2HDQ A;  4Y3I A;  3G30 A;  2XSS A;  3UY6 A;  2I9V A;  1N4O A;  3LEQ A;  2V8C A;  3UE1 A;  2XLN A;  3B47 A;  5EVI D;  3IHB A;  4OKP A;  3B3X A;  3EWK A;  4I38 A;  5GLB A;  1IEM A;  2WAE A;  1L0G A;  3OCN A;  3GV9 A;  1K57 A;  1T1C A;  3PAE A;  3HLB A;  3UB9 A;  1HTZ A;  1E25 A;  5FQM A;  4I3I A;  3T4O A;  1K38 A;  4GOG A;  2KX6 A;  4RX3 A;  5E2H A;  1MKI A;  2OWH A;  1NLZ A;  3A0R A;  4YOF A;  1J3W A;  2JHE A;  4P85 A;  3E98 A;  2HF6 A;  3HLC A;  5HDC A;  5HWV A;  5GLC A;  3LIF A;  2XQZ A;  2Z2L B;  3NBL A;  5HAQ A;  4HH3 A;  1KVM A;  1ERM A;  1IYO A;  1W63 M;  5DFX A;  1T19 A;  3C38 A;  4X55 A;  1VQQ A;  2WGW A;  4Q0J A;  3A3J A;  2VLG A;  4Y7P A;  4ZJ2 A;  4NXE A;  1N9L A;  3N6I A;  1YM1 A;  3LR4 A;  1OME A;  4LLO B;  5G18 A;  3KO6 A;  2MJ6 A;  2VK3 A;  2GDN A;  4HJ4 A;  4JF4 A;  1D06 A;  4KZ3 A;  5HAI A;  4JKT A;  4MLL A;  3B33 A;  4XUX A;  5K5B A;  3BFE A;  4ARZ B;  4OQI A;  5AQ9 A;  3IXH A;  4DN0 A;  3BEC A;  1LSX A;  3VE3 A;  3ZG5 A;  4U0X A;  1IYQ A;  3RXW A;  2IWD A;  4E3K A;  3GMW A;  4G3W A;  1SKF A;  1SDE A;  2ZL1 B;  3LYX A;  4B4X A;  1H8Z A;  4MBK A;  3H82 A;  4X69 A;  1YLY A;  2YKH A;  3BEB A;  1FQG A;  2VX8 A;  2RCX A;  3JPU A;  3HL9 A;  2XA7 S;  4IVI A;  1K56 D;  4PHT A;  3QP1 A;  2FZ0 A;  4HBT A;  1UWP X;  4UA7 A;  5L8M A;  3SW1 A;  3ZG7 B;  2ZQA A;  4EQI A;  2QZ6 A;  2V2F F;  3C5A A;  3TW8 A;  3U4L P;  3F1O B;  2W27 A;  3RFB A;  4DXC A;  1NLY A;  5M1A A;  3ZNT A;  3DW0 A;  1JVJ A;  3C4P A;  3HCY A;  2Y2P A;  3TG9 A;  4R3A A;  4WLA A;  1AXB A;  1K56 A;  5KIZ A;  5HDD A;  3W4Q A;  4KQD A;  5AQB A;  3TOI A;  4HJ6 A;  4KQQ A;  1O7E A;  2H28 A;  3W4O A;  4N1H A;  5F6A A;  3CG5 A;  5A92 A;  3ICY A;  3VOL A;  4C3Q A;  4P6B A;  3BFD A;  4R3B A;  4F3L A;  3UPN A;  4JPM A;  4KZ4 A;  2XR0 A;  3SS4 A;  2EX9 A;  5CED A;  2XRO A;  5DF7 A;  2V1B A;  2PYP A;  1J9M A;  2OLV A;  4KZ5 A;  1PWD A;  4O0P A;  1OT9 A;  1DJC A;  2L4R A;  3ZHH A;  3M2K A;  3GVB A;  4R23 A;  3T50 A;  4S2I A;  3U2A A;  1FCO A;  4FCF A;  5CGW A;  1YSQ A;  4ETZ A;  1M6K A;  4EU0 A;  2ZBB A;  4N1X A;  3NDE A;  2Y2M A;  3SS3 A;  3T12 B;  4FTX A;  4OQH A;  2VGL S;  3QHY A;  3BQA A;  3FG8 A;  2WKR A;  1GHI A;  5AJG A;  3BY9 A;  3FKV A;  1W7F A;  3UB5 P;  2V9A A;  5J8X A;  1RP5 A;  2BTF P;  4DDS A;  5TR7 A;  1PW8 A;  2J8Y A;  2HGV A;  4I3A A;  4BMW A;  1XJ2 A;  1A0K A;  4WMC D;  3IS2 A;  5HWW A;  1I2S A;  5FA7 A;  1P9R A;  3ZNY A;  1H5X A;  1W8Y A;  1FR1 A;  3OLO A;  1HZO A;  1L0E A;  1MWU A;  4GNU A;  3HRE A;  3IXB A;  3KSG A;  2XK1 A;  4L0L A;  4E3L A;  4Y2F A;  3VP3 A;  1LSV A;  2DCF A;  3GRJ A;  3K3C A;  4G3V A;  4AFI A;  4N9L A;  4PM8 A;  3G2Z A;  3GDI A;  3MS6 A;  4P0M A;  4R0Q A;  1QME A;  3NOP C;  3O86 A;  5EE8 A;  5CER A;  3CMZ A;  4X1M A;  3CJM A;  1N9N A;  4Z9Q A;  2Z2M B;  4X6T A;  3FYZ A;  1PI4 A;  1LLB A;  3ZG0 A;  5AQA A;  1ONH A;  1XP4 A;  5TFQ A;  1S67 L;  4S2J A;  1TEM A;  2OV5 A;  4IBR A;  3P09 A;  1K57 C;  3MZD A;  5HD5 A;  3T1R A;  3VOY A;  4Q0H A;  2GZA A;  1LL5 A;  5EM1 A;  5KMW A;  1XPB A;  4OVD A;  2QWS A;  4KEN B;  2B02 A;  5CRF A;  5MC7 A;  1CK3 A;  2Y91 A;  3MSH A;  3R4K A;  1D1J A;  1ACF A;  2NUT C;  4GD6 A;  2P04 A;  1ZG4 A;  2VGJ A;  5TBM B;  3Q7V A;  1SCW A;  3LI8 A;  1S0W A;  3JVU A;  3BLM A;  5AQ7 A;  2WKE A;  2W3G A;  4CQH A;  5CGX A;  3D3O A;  4WEK A;  1MZU A;  1P9W A;  2O99 A;  3C8C A;  1LHY A;  4ARZ A;  1T1A A;  5CGS A;  2M7U A;  1M40 A;  2WKP A;  3VSK A;  2QHK A;  5EV0 A;  2ACG A;  2OAP 1;  2WAF A;  1E3U D;  4CLC E;  4DE2 A;  5L2F A;  1JTG A;  3MFD A;  1FSW A;  1ZKJ A;  3CHW P;  1YT4 A;  2VEA A;  1OJG A;  1SDN A;  4PMA A;  5LBR A;  4EW7 A;  4EUV A;  3S7N A;  5DF9 A;  4GS9 A;  3WWX A;  5A90 A;  5HL6 A;  4DMZ A;  1YLP A;  1WYB A;  3WS2 A;  2DNS A;  5EPH A;  1GA0 A;  1KDS A;  2Y2N A;  2ZC7 A;  3CAX A;  3P7N A;  3SH8 A;  3IXD A;  3OCL A;  3WS0 A;  4U3T A;  3N8S A;  2ZD8 A;  3FWL A;  4DKI A;  2AVX A;  4NG2 A;  1AWI A;  1PZO A;  1WYC A;  3PBR A;  3UO9 A;  2WGI A;  3VE4 A;  5GL9 A;  3M6H A;  3IF6 B;  5G4Y A;  1DP9 A;  1TVF A;  1IYP A;  1H0M A;  2WKH A;  1DJB A;  3T1X A;  3W4P A;  2PBD P;  2J80 A;  2E8J A;  2ZQ7 A;  3CPT B;  4E04 A;  5DJT A;  1E3U A;  3H82 B;  2WZX A;  1MWS A;  4QY5 A;  1XFN A;  2WKQ A;  4XT2 B;  3FPW A;  4X56 A;  3ZYT A;  4JLF A;  2JKR M;  5TGF A;  3BFC A;  2EXA A;  2PRF A;  3C30 A;  2E8I A;  3VMA A;  5FI2 A;  3WRT A;  4ZTK A;  2K7S A;  5FQI A;  4NXF A;  4F94 A;  2EA9 A;  3DAV A;  1HD8 A;  2XH9 A;  3LR0 A;  2KDK A;  1XX2 A;  5HDS A;  1S6R A;  3H9W A;  3UE3 A;  3ZCZ A;  2EXB A;  2VGK A;  3Q82 A;  1E4D A;  4P6Z S;  1VB6 A;  3CZD A;  4OON A;  4PAU A;  4H8R A;  4LV3 A;  2HDS A;  1JWV A;  5EFW A;  3KSF A;  4S2O A;  1W8Q A;  1NRJ A;  3OOV A;  4QPR A;  4R38 A;  5JYO A;  4HP9 A;  1ESI A;  2WGV A;  4XUZ A;  5EOE A;  4YFM A;  1VEU B;  2ZOI A;  5FQJ A;  1NZO A;  3IF6 C;  4WUJ A;  2G7U A;  4I39 A;  3ISG A;  1W5D A;  1S4R A;  3G32 A;  5DTS A;  1TF1 A;  4GDN A;  4HP4 A;  1ES4 A;  3MZE A;  5E2E A;  2V0W A;  5G4Z A;  1SKO B;  4HY8 A;  4RYE A;  2WGW B;  3UN7 A;  3DWK A;  2W3E A;  1NJ4 A;  3HUM A;  2QKP A;  1TDG A;  2Y59 A;  2PD8 A;  1TS0 A;  4BQM A;  5KSH A;  3V50 A;  5TJJ A;  4LEN A;  1FIL A;  3N4I A;  4LRX C;  4OLD A;  5L10 A;  2WYX A;  1L0F A;  2JKT M;  1CQA A;  5DF8 A;  3T4L A;  4Y15 A;  3CLO A;  3M6B A;  5DVA A;  5M19 A;  1MPL A;  1FCN A;  5HPF A;  1VHM A;  1PWG A;  3IF5 A;  3PBN A;  1FR6 A;  4FH4 A;  4WEL A;  3HUO A;  1OT6 A;  5FDH A;  4JXW A;  3IS2 B;  3RXX A;  4H6J B;  1KDW A;  3CUE A;  4YNR A;  4WN5 A;  1LL8 A;  5I94 A;  3LIA A;  2OLU A;  3V39 A;  4MDZ A;  2W1R A;  3VSL A;  3IT9 A;  2H10 A;  4EBN A;  4L9F A;  3T4T A;  4L9G A;  3LIE A;  1XJ3 A;  2W1T B;  2J3T C;  4HQA A;  4HH2 A;  1F2K A;  2P9V B;  4OPQ A;  1C3B A;  4K0X A;  2QJ5 A;  2ZMA A;  5GLD A;  4QU3 A;  1DJA A;  4OOM A;  3KYZ A;  1X0O A;  1F9I A;  3CWF A;  2ZOH A;  1K0K A;  3QNB A;  4EES A;  2OSU A;  4GCZ A;  2LB5 A;  2XFS A;  4LFU A;  4CLC D;  3MQQ A;  5CX7 A;  5DKK A;  4UA6 A;  4MN5 A;  1YQS A;  2P9V A;  4K08 A;  4UA9 A;  4II7 A;  4DE1 A;  4WL9 A;  3LO7 A;  4FUW A;  4R3J A;  1ERQ A;  4D60 A;  3OPP A;  4WMC A;  3HJK A;  4OPY A;  2XF3 A;  3QP6 A;  1BT5 A;  4UQI S;  1T1B A;  2J3W A;  3Q07 A;  1K25 A;  2Q9N A;  3HUN A;  3MZF A;  3QP2 A;  3EOI A;  4EEP A;  3OC2 A;  3UE0 A;  3D4F A;  2Y2K A;  3O87 A;  2YKF A;  1BUL A;  1S1Y A;  4B9O A;  3G35 A;  2R9X A;  4S2L A;  1S4S A;  1ES5 A;  3PXP A;  3B42 A;  3MQ0 A;  4CPK A;  3F1P A;  4NXB A;  3VFH A;  4NKP A;  4RVA A;  4Y0T A;  3I7J A;  3IH8 A;  3VP0 A;  4C75 A;  4LV0 A;  2XRN A;  5E2G A;  3NJA A;  4DE3 A;  2IA2 A;  3C4O A;  5FL3 A;  2HJ9 C;  3IBJ A;  1MC0 A;  5EOO A;  3DTM A;  4EUZ A;  1TS6 A;  3OPR A;  3RH8 B;  1CI9 A;  5DTK A;  3GSG A;  1SKO A;  3D72 A;  3LY4 A;  2J7V A;  5L09 A;  2BAS A;  4QD4 A;  5EM0 A;  1JNU A;  1V9Z A;  4R4S A;  2PR6 A;  2XA7 M;  3G34 A;  4Y0O A;  4ID4 A;  1EI5 A;  2VKS A;  2A3U A;  4QB8 A;  3UPP A;  3VV4 A;  2OWJ A;  1PW1 A;  1YLW A;  1Q2Q A;  3NOU C;  4GHI B;  1OTI A;  1YMS A;  2ZQD A;  3SOI A;  3ZFZ A;  1LI0 A;  1D7E A;  4E3J A;  2ZMV A;  5FAQ A;  3IBR A;  5CTN A;  1VM1 A;  2BG1 A;  3IWQ A;  2G2U A;  2Q0O A;  2ZQ8 A;  2Y8H A;  5FQK A;  1MBL A;  2INW A;  1ZHH B;  4QY6 A;  5CEB A;  3E2K A;  5F69 A;  4PM6 A;  2Y79 A;  4JXG A;  4P6Z M;  2PU2 A;  2V0U A;  4KUK A;  3WS5 A;  4MBH A;  1SHV A;  2EX6 A;  2W3F A;  4JXS A;  1FIK A;  3S7P A;  4I5S A;  1CEG A;  5FI6 A;  4E6W A;  4ZBE A;  2XEP A;  4CJN A;  3F1P B;  2PT7 A;  1L0D A;  3MR0 A;  3MXS A;  1GA9 A;  3WS4 A;  1YKD A;  3S7O A;  4OOY A;  1IOU A;  1G6O A;  5CHJ A;  3Q7Z A;  2R78 A;  1YSP A;  1NYM A;  2OAQ 1;  2JCH A;  2L1M A;  2X01 A;  5EVL A;  5C5K A;  2LB9 A;  4WEJ A;  4JGR A;  4EBL A;  5M18 A;  1O07 A;  4JF5 A;  5GLA A;  4B88 A;  3Q81 A;  5IHV A;  4DJ2 A;  1ES3 A;  4OQG A;  3A3D A;  4HBU A;  5HW3 A;  4RX2 A;  3UNW A;  4GZB A;  5CEC A;  4ESP A;  3F1N B;  4JGP A;  5CHU A;  2IWC A;  2D01 A;  5KSC A;  3MQO A;  4BEN A;  3SH7 A;  1W63 Q;  3RTY A;  4S2P A;  4LCM A;  2Y55 A;  5FQQ A;  4O7D A;  2PU4 A;  5IT5 A;  5E2F A;  2Y2H A;  3NI9 A;  4IUK A;  1XJ4 A;  2Y2G A;  1NYY A;  4FSF A;  3OPH A;  4B4Z A;  3SH9 A;  1DY6 A;  5EVI C;  1QMF A;  4RQ9 A;  4ZRR A;  4N92 A;  1SZV A;  4U0T A;  2HPB A;  3ZQ5 A;  5HD3 A;  2VV6 A;  2JKT I;  3CIT A;  4CLC A;  4HNB A;  3LIC A;  3IX8 A;  4HI4 A;  1ES2 A;  2FH5 A;  3OZH A;  3TRC A;  1MKM A;  1YLJ A;  5FEF A;  3BQ8 A;  5DJU A;  5TBM A;  3SZT A;  4M4X A;  4HES A;  2J3T D;  1K55 A;  2ZL1 A;  4UEY A;  2JE5 A;  3L7H A;  3UMD A;  3KYQ A;  3G2Y A;  4WM9 A;  3LUQ A;  4NK3 A;  4GD8 A;  1PWC A;  3Q1F A;  3P98 A;  3E4Q A;  3S1Y A;  3VP1 A;  2OOL A;  4UQI M;  1Z09 A;  3O5Y A;  1GSX A;  3KSH A;  4NET A;  1Y28 A;  2I72 A;  3MXQ A;  3UDX A;  2VV7 A;  4NXG A;  3EEA A;  5IU1 A;  2PD7 A;  3FPV A;  1UGU A;  3UB6 A;  1XFQ A;  3VP2 A;  2P08 A;  1S1Z A;  5CXW A;  1ODV A;  2XDM A;  4OQ0 A;  2GJ3 A;  3IX4 A;  1FSY A;  4KQO A;  3EGX C;  2WUQ A;  5J4E A;  2BLS A;  5F82 A;  1CI8 A;  1VEU A;  1PNE A;  3BWL A;  2NUP C;  2W0N A;  3NOT C;  3OPL A;  4Q8I A;  1L3L A;  5BOH A;  4A5R A;  3MFX A;  4OP8 A;  1XGI A;  5EVI B;  2Y2J A;  4B93 A;  4QWO A;  2Y2O A;  3FV7 A;  4ZJ3 A;  1OTB A;  1MWR A;  4GKU A;  1KE0 A;  3AGF A;  1BUE A;  1XXM A;  3D9Y A;  2X02 A;  3Q7V B;  3C2W A;  5F68 A;  4JBF A;  1GSW A;  4EBP A;  1V9Y A;  4PKY A;  5DKL A;  4FD8 A;  2Z6C A;  3IWI A;  2IWB A;  2V1Z A;  3K2N A;  1LSW A;  3EEH A;  3EQV A;  4KZA A;  4ZAM A;  4OPZ A;  3LGO A;  1OTA A;  2RL3 A;  1KOU A;  2ZJ9 A;  3R7W A;  1BZA A;  4OP5 A;  2HJE A;  5EVI A;  4DE0 A;  4O01 A;  3UB8 A;  1N9B A;  5F5Y A;  1K4F A;  4BL2 A;  3T4Q A;  3BM6 A;  4BD1 A;  1VET B;  2WK0 A;  4IBX A;  1YPR A;  2WAD A;  5J3W A;  3ZG9 B;  1OTD A;  1NZU A;  2JN7 A;  1STZ A;  4S2M A;  3K3D A;  3PYP A;  3S4X A;  3N8L A;  3W8K A;  3IXG A;  4LGW A;  3BRM A;  3A3F A;  4PKY G;  1F5M A;  2W3D A;  4WZ5 A;  4R6L A;  1ESU A;  3G31 A;  4P87 A;  4UAA A;  1DP6 A;  1P0Z A;  3UME A;  3CI6 A;  4OOL A;  3P01 A;  4KQR A;  4MEZ A;  4RA7 A;  4IHQ A;  4DXB A;  1K54 A;  4EEU A;  1PZP A;  1IKG A;  5A93 A;  4LV1 A;  3LR5 A;  4PPR A;  3GQZ A;  2M7V A;  3HLW A;  4Q0I A;  4Y5F A;  3FC7 A;  1XKZ A;  3BW6 A;  5JYP A;  2V8F A;  3PBO A;  3ZGA B;  4FH2 A;  3DBA A;  2VA0 A;  3G6O A;  1YLT A;  2PYR A;  1OTE A;  3M2J A;  3QNC A;  4LRZ E;  2EWW A;  3QP4 A;  3O88 A;  4WBG A;  4LV2 A;  3CPT A;  3MKF A;  3ULF A;  3A0S A;  5D3O A;  5EEC A;  4GLQ A;  4GHI A;  4GJ4 A;  3E2L A;  4HJ3 A;  1L2S A;  3T1Q B;  3LEZ A;  5FQ9 A;  1TD5 A;  5I5L A;  2D02 A;  1TDL A;  2Y2Q A;  3EQU A;  4X53 A;  3A3E A;  3HBR A;  2EX8 A;  3LID A;  4KG5 A;  3MJQ A;  4GDB A;  2EFX A;  1KGG A;  3IH9 A;  4YIN A;  1U60 A;  2ZQ9 A;  1G68 A;  1RGY A;  3NC8 A;  1HVB A;  4YWZ A;  3A3I A;  1XGJ A;  3ZDJ A;  2CC1 A;  3DWZ A;  1K6S A;  5HSQ A;  2ZM2 A;  3WS1 A;  2V1A A;  2ZQC A;  4E3I A;  2K31 A;  4HHD A;  5FAS A;  2KLI A;  3BFF A;  2W3H A;  3GR2 A;  3ZVW A;  1GHP A;  4DRT A;  3TSG A;  1I5Q A;  3QP8 A;  2K2N A;  4BBU A;  1GCE A;  1VET A;  3MKE A;  3HLF A;  4BL3 A;  3DTI A;  1IKI A;  1EW0 A;  3LR3 A;  2ZM0 A;  2HDR A;  3PHY A;  4EXO A;  3AGE A;  5FAO A;  5FDS A;  2QYB A;  2A24 B;  5L07 A;  5HPI A;  2C6W B;  1NRF A;  4GN2 A;  1GSV A;  5EUA A;  1KGE A;  5HL1 A;  4S2K A;  4DJ3 A;  1JWZ A;  4IJG A;  3NHQ A;  4KUO A;  4ZDX A;  2ZC6 B;  1CEF A;  4N9K A;  1G28 A;  4CLC B;  5EVE A;  2B5R A;  3BFG A;  1KE4 A;  3MMH A;  3PBT A;  4WYY A;  5GHZ A;  4R70 A;  1KVL A;  1ZC2 A;  1BYW A;  3JYI A;  3IX3 A;  1H8M A;  2XGN A;  1PYY A;  2UWX A;  2B95 A;  2Z6D A;  3H7W B;  5F1F A;  3UB7 A;  1KE3 A;  4I3J A;  1UWN X;  4HEF A;  5A91 A;  2H0Y A;  1GHM A;  4MBF A;  3HVF A;  4KZB A;  4E6X A;  5HZH A;  1JTD A;  4MN7 A;  1OPX A;  4NEE D;  3DTE A;  3F1N A;  4XXR A;  3V67 A;  2P7J A;  4Y17 A;  4BLM A;  4Z1W A;  4IED A;  4BWI A;  4HOI A;  4KG2 A;  4HIA A;  2J9O A;  3NDG A;  4UHU A;  3C7V A;  3GEC A;  1P97 A;  1BLH A;  1FCM A;  2QMI A;  2FFY A;  2L0W A;  5F83 A;  2O9C A;  4S2N A;  2ZMF A;  4M3K A;  3S22 A;  3TE8 A;  3TJZ C;  1CF0 A;  2EFU A;  4MN6 A;  1K55 C;  4MCW A;  1H8Y A;  1G6A A;  4BJP A;  5HX9 A;  4QHC A;  1TS7 A;  1YAX A;  2M1C A;  2PR5 A;  3BYD A;  5FSR A;  2JBF A;  4JGO A;  4GB7 A;  4L9E A;  4C6Y A;  4R4R A;  1BSG A;  3W2Z A;  5A8B A;  1KGF A;  2JKG A;  1MWT A;  3QP5 A;  1PIO A;  3ITB A;  2EWV A;  1NY0 A;  3BY8 A;  2HP9 A;  4Y13 A;  3LFV A;  4CLC C;  1H3Q A;  2VZW A;  5FAT A;  2R9W A;  2O9B A;  1JWP A;  3IWO A;  3NCK A;  5FAP A;  3UPO A;  3PAG A;  1ALQ A;  4R1G A;  4EWF A;  5CHM A;  1Z6F A;  2WKI A;  3CUE C;  3HLG A;  4QJG A;  1RGZ A;  1TS8 A;  2HZ5 A;  4BBV A;  3UE6 A;  2XD1 A;  4IUH A;  3EGD C;  2CMN A;  1ONG A;  3ZVT A;  4XT2 A;  2A24 A;  2ZC5 B;  4MNR A;  5E43 A;  3VP4 A;  5J7E A;  1BLP A;  4ME4 A;  3BLS A;  3LY3 A;  3PBS A;  5IS1 A;  4H6J A;  4KG6 A;  4JGQ A;  5GHY A;  2VJW A;  3E4P A;  3DTK A;  1ZG6 A;  3VFF A;  1DRM A;  4G3K A;  1MY8 A;  2PAV P;  1S66 L;  3G4P A;  4F3L B; 
#chains in the Genus database with same CATH homology
 3MFX A;  5HPF A;  4B93 A;  1VHM A;  2PHY A;  3PBN A;  2HV1 A;  4KQD A;  1OTB A;  4HJ6 A;  4WEL A;  1OT6 A;  3LIB A;  2H28 A;  3C2W A;  5F68 A;  5AVF A;  3IS2 B;  4H6J B;  1GSW A;  4WF0 A;  5F6A A;  3CUE A;  1V9Y A;  4PKY A;  5DKL A;  5AVE A;  4YNR A;  4WN5 A;  1LL8 A;  3ICY A;  3VOL A;  3LIA A;  2Z6C A;  4MDZ A;  3LI9 A;  3K2N A;  2W1R A;  4F3L A;  1LSW A;  2O0Y A;  4L9F A;  3T4T A;  3EEH A;  3EQV A;  4L9G A;  3LIE A;  1XJ3 A;  4LRY C;  2W1T B;  2J3T C;  4HQA A;  3T4K A;  4HH2 A;  3BJN A;  1OTA A;  2XRO A;  4O8G A;  2V1B A;  1KOU A;  2PYP A;  3R7W A;  3PR6 A;  2QJ5 A;  2HJE A;  3T4J A;  4EER A;  4O0P A;  3F1O A;  4O01 A;  3UB8 A;  1OT9 A;  5F5Y A;  1T18 A;  4OOM A;  3KYZ A;  4GS9 B;  2L4R A;  1X0O A;  1F9I A;  3CWF A;  2ZOH A;  3T4Q A;  3T50 A;  2GX5 A;  3U2A A;  4EES A;  1DP8 A;  4GCZ A;  2LB5 A;  5J3W A;  1OTD A;  4CLC D;  3MQQ A;  5CX7 A;  5DKK A;  1YSQ A;  2JN7 A;  1STZ A;  4MN5 A;  4ETZ A;  3K3D A;  3PYP A;  4K08 A;  4EU0 A;  4II7 A;  2ZBB A;  4WL9 A;  2B18 A;  4PKY G;  2VGL S;  1F5M A;  1LT0 A;  3BQA A;  3FG8 A;  2PDR A;  2W3D A;  2WKR A;  5AJG A;  3BY9 A;  4R6L A;  5DFY A;  3HJK A;  4EQ1 A;  1DP6 A;  2V9A A;  1P0Z A;  4UQI S;  1T1B A;  2J3W A;  3CI6 A;  2A2L A;  3UME A;  4OOL A;  3P01 A;  2GNX A;  1XJ6 A;  3E4O A;  2HGV A;  4IHQ A;  4I3A A;  4BMW A;  3PBQ A;  1XJ2 A;  4EEU A;  3EOI A;  4EEP A;  3OC2 A;  3LR5 A;  3IS2 A;  3OBF A;  5HWW A;  2VV8 A;  2M7V A;  4Q0I A;  4GW9 A;  3FC7 A;  2YKF A;  4Y5F A;  1S1Y A;  3BW6 A;  1P9R A;  4B9O A;  1S4S A;  1F98 A;  1ZTU A;  3PBO A;  2KOI A;  3PXP A;  3OLO A;  3B42 A;  3MQ0 A;  3DBA A;  3F1P A;  4NXB A;  2VA0 A;  3G6O A;  1N9O A;  3KSG A;  3KX0 X;  4NKP A;  2PYR A;  1IFQ A;  1OTE A;  2O9A A;  4L0L A;  4Y2F A;  1LSV A;  3K3C A;  4G3V A;  4LRZ E;  4AFI A;  2EWW A;  3HJI A;  2XRN A;  3GDI A;  3NJA A;  3JVV A;  2IA2 A;  5FL3 A;  2HJ9 C;  3IBJ A;  3ULF A;  3A0S A;  1MC0 A;  3NOP C;  1TS6 A;  4GLQ A;  4GHI A;  3RH8 B;  4GJ4 A;  2QJ7 A;  4HJ3 A;  1N9N A;  3D72 A;  1TD5 A;  2BAS A;  4BBT A;  1JNU A;  5I5L A;  4EET B;  1V9Z A;  2D02 A;  3EQU A;  1OJ5 A;  2PR6 A;  2XA7 M;  4LPZ A;  1NWZ A;  1S67 L;  2VKS A;  2DMW A;  3LID A;  3KSI A;  3MJQ A;  2JKR I;  5HD5 A;  4MMN A;  3VV4 A;  2OWJ A;  4Q0H A;  2GZA A;  3MF0 A;  3NOU C;  4GHI B;  1OTI A;  5HWT A;  4ETX A;  2QWS A;  2B02 A;  1D7E A;  4YWZ A;  5MC7 A;  2ZMV A;  3R4K A;  5HSQ A;  2NUT C;  2P04 A;  3IBR A;  2V1A A;  3E0Y A;  2K31 A;  4HHD A;  5TBM B;  1WA9 A;  3S7Q A;  3LI8 A;  2KLI A;  2W3H A;  3JVU A;  2Y8H A;  2INW A;  2W3G A;  1ZHH B;  4CQH A;  5F69 A;  3D3O A;  4WEK A;  2Y79 A;  1MZU A;  3H7W A;  2O99 A;  1P9W A;  4P6Z M;  2V0U A;  2K2N A;  4KUK A;  3C8C A;  4BBU A;  4ARZ A;  2W3F A;  1T1A A;  2M7U A;  2WKP A;  4FOF A;  4I5S A;  3S7P A;  1EW0 A;  2QHK A;  3LR3 A;  2W1T A;  2OAP 1;  3PHY A;  4EXO A;  3F1P B;  4CLC E;  2PT7 A;  3MR0 A;  3T4S A;  2VGL M;  2QYB A;  3A0V A;  2A24 B;  3R7W B;  5HPI A;  1YKD A;  2VEA A;  1OJG A;  3S7O A;  1GSV A;  4Y3I A;  5LBR A;  4EW7 A;  1IOU A;  1G6O A;  3S7N A;  4DJ3 A;  4EUV A;  4IJG A;  3NHQ A;  2XSS A;  2R78 A;  5DF9 A;  4GS9 A;  4KUO A;  1YSP A;  5HL6 A;  4DMZ A;  2OAQ 1;  1G28 A;  2I9V A;  4CLC B;  2L1M A;  5C5K A;  3CAX A;  3P7N A;  2LB9 A;  4WEJ A;  4JGR A;  3OCL A;  3B47 A;  3MMH A;  3PBT A;  4DJ2 A;  3EWK A;  4I38 A;  4R70 A;  1BYW A;  1H8M A;  3F1N B;  4JGP A;  3PBR A;  3OCN A;  2Z6D A;  3H7W B;  2D01 A;  1T1C A;  3MQO A;  3VE4 A;  3UB7 A;  1W63 Q;  4I3J A;  3RTY A;  3UB9 A;  1UWN X;  4I3I A;  3T4O A;  5G4Y A;  2KX6 A;  1DP9 A;  5HZH A;  5IT5 A;  2OWH A;  4MN7 A;  1NLZ A;  1OPX A;  3A0R A;  4NEE D;  3F1N A;  4IUK A;  4YOF A;  1XJ4 A;  2J80 A;  2JHE A;  4FSF A;  3V67 A;  2P7J A;  4E04 A;  3E98 A;  5DJT A;  4Z1W A;  2HF6 A;  4RQ9 A;  4ZRR A;  3H82 B;  4BWI A;  4HOI A;  5HDC A;  1XFN A;  5HWV A;  4HIA A;  2WKQ A;  3LIF A;  3ZQ5 A;  5HD3 A;  3GEC A;  2VV6 A;  4XT2 B;  2JKT I;  3CIT A;  3FPW A;  3ZYT A;  4CLC A;  4HNB A;  1P97 A;  2JKR M;  4HH3 A;  3LIC A;  4HI4 A;  3C30 A;  1W63 M;  2L0W A;  5DFX A;  2O9C A;  1T19 A;  2FH5 A;  3C38 A;  3TRC A;  1MKM A;  2ZMF A;  3BQ8 A;  5DJU A;  5TBM A;  2K7S A;  3TE8 A;  3TJZ C;  4Q0J A;  4M4X A;  2VLG A;  4MN6 A;  4NXE A;  1N9L A;  4NXF A;  4MCW A;  2EA9 A;  3LR4 A;  2J3T D;  4LLO B;  3KO6 A;  3LR0 A;  2MJ6 A;  4BJP A;  4UEY A;  2KDK A;  4HJ4 A;  1D06 A;  3UMD A;  5HDS A;  1TS7 A;  3H9W A;  3UE3 A;  1YAX A;  3KYQ A;  2M1C A;  4P6Z S;  2PR5 A;  3LUQ A;  1VB6 A;  4PAU A;  3B33 A;  4JGO A;  4L9E A;  5K5B A;  4ARZ B;  3E4Q A;  4DN0 A;  1LSX A;  3VE3 A;  2OOL A;  4UQI M;  3W2Z A;  5EFW A;  3KSF A;  5A8B A;  3O5Y A;  1NRJ A;  1GSX A;  3KSH A;  4G3W A;  3OOV A;  4QPR A;  1Y28 A;  3MXQ A;  4R38 A;  2EWV A;  3BY8 A;  3LYX A;  2VV7 A;  4HP9 A;  4NXG A;  3LFV A;  3EEA A;  4CLC C;  3H82 A;  1H3Q A;  2VZW A;  2ZOI A;  2YKH A;  2VX8 A;  2O9B A;  4WUJ A;  5IU1 A;  2PD7 A;  2G7U A;  3FPV A;  1UGU A;  4I39 A;  3UB6 A;  2XA7 S;  1XFQ A;  4PHT A;  1S4R A;  1TF1 A;  4HP4 A;  2FZ0 A;  1UWP X;  2P08 A;  2V0W A;  5L8M A;  3CUE C;  4HY8 A;  5G4Z A;  3SW1 A;  1S1Z A;  1ODV A;  1TS8 A;  2GJ3 A;  4BBV A;  3UE6 A;  2W3E A;  4IUH A;  3EGD C;  2QKP A;  2CMN A;  4KQO A;  2PD8 A;  3EGX C;  3TW8 A;  1TS0 A;  5J4E A;  3F1O B;  2W27 A;  2A24 A;  4XT2 A;  3RFB A;  5KSH A;  5TJJ A;  1NLY A;  5J7E A;  4ME4 A;  3PBS A;  3BWL A;  5IS1 A;  2NUP C;  4H6J A;  4LRX C;  3HCY A;  4JGQ A;  2W0N A;  2VJW A;  3E4P A;  3NOT C;  4R3A A;  2JKT M;  4WLA A;  1DRM A;  4G3K A;  3T4L A;  5KIZ A;  3CLO A;  1S66 L;  5HDD A;  4F3L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...