3HCYA

The crystal structure of the domain of putative two-component sensor histidine kinase protein from sinorhizobium meliloti 1021
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
148
structure length
145
Chain Sequence
SNAIEEVYEATLDAIQGALNCDRASILLFDEAGTMRFVAARGLSEHYQRAVDGHSPWINEPEPIFVENVDDAEFSRELKESIVGEGIAALGFFPLVTEGRLIGKFMTYYDRPHRFADSEIGMALTIARQLGFSIQRMRAEYARRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative two-component sensor histidine kinase protein
publication title The crystal structure of the domain of putative two-component sensor histidine kinase protein from Sinorhizobium meliloti 1021
rcsb
source organism Sinorhizobium meliloti
total genus 39
structure length 145
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3hcyA00
4Z1WA 5DFYA 5L8MA 1STZA 2W3DA 5TJJA 4MMNA 1TF1A 3IBRA 2Y79A 4Q0HA 3TRCA 5K5BA 4O01A 3BJNA 1F5MA 5DFXA 4DN0A 3S7QA 3NHQA 4ZRRA 3W2ZA 5HSQA 2LB5A 2G7UA 3S7OA 2O9CA 2GX5A 2XRNA 4PAUA 2M7UA 1TD5A 4QPRA 4BWIA 4R6LA 3CI6A 3KSIA 3KO6A 4EUVA 4RQ9A 4Y2FA 2KOIA 3KSFA 2ZMFA 4Q0IA 5I5LA 4GW9A 2M7VA 2W3GA 3MF0A 4MN7A 3E98A 4LRYC 2O9BA 2W3EA 3G6OA 4DMZA 2QYBA 2O9AA 3NOTC 1YSPA 2Y8HA 2W1TB 3ZQ5A 4IUHA 5AJGA 1YSQA 3C2WA 4CQHA 3LFVA 3S7PA 3CITA 4G3KA 3S7NA 4ETZA 2O99A 4Y5FA 5C5KA 3KSHA 4IUKA 3KSGA 3OBFA 2LB9A 4R70A 1VHMA 4LRXC 4EU0A 4YNRA 2K31A 4LRZE 2W3HA 4ME4A 4MCWA 4O8GA 2K2NA 4O0PA 2OOLA 2VEAA 5HPIA 3NOPC 3VV4A 2IA2A 3MMHA 2KLIA 3K2NA 3DBAA 4FOFA 3O5YA 3HCYA 4YOFA 1YKDA 4E04A 1MKMA 4Y3IA 5HPFA 2W3FA 3R4KA 3E0YA 4G3WA 2O0YA 3IBJA 3D3OA 1MC0A 2VZWA 2W1TA 3EEAA 4GLQA 4MDZA 5HL6A 3OOVA 3NOUC 4IJGA 4Q0JA 2W1RA 2B18A 3MQ0A 3RFBA 2XROA 5LBRA 2XSSA 1ZTUA 4G3VA 2HGVA 2VJWA 2VKSA 4ETXA
chains in the Genus database with same CATH superfamily
2WKHA 4JGQA 2W3DA 3IHBA 2B02A 1TEMA 2I9VA 4O01A 4GHIB 3MZDA 5TBMB 2ZM0A 3AGFA 5FQIA 2WGIA 3ZNTA 4R1GA 4DDSA 1Q2QA 2Z2LB 3ZG5A 5A93A 1E3UA 2JKGA 4PM7A 3VP2A 3CI6A 3FYZA 1Y4OA 2E8IA 3WS0A 2MJ6A 3GDIA 4WELA 4YFMA 5CEDA 3HREA 3HLDA 2PYRA 1IKIA 1K38A 4ZTKA 1S67L 1OT9A 4N9LA 3IT9A 5DTTA 4XT2A 3C38A 5TGFA 4JXSA 1FR1A 3OLOA 3TOIA 1YMSA 4R4SA 1XJ6A 3KSHA 3PYPA 4JGRA 3T4QA 5EOEA 3T4KA 2BG1A 2OAQ1 4U3TA 4ESPA 4S2OA 2W3HA 3GR2A 4S2KA 4MBFA 1G68A 5F82A 3LR3A 4R4RA 1EI5A 4CLCE 3QP1A 4XXRA 4UQIM 3D4FA 1SKOA 2IWBA 4JF5A 3BFCA 2O0YA 1LT0A 1OTDA 1XJ4A 1IKGA 3VE3A 2HDQA 3WS4A 2V1BA 5KSCA 2IWDA 2I72A 5CXWA 3LIDA 5A90A 3QP2A 1VETA 3MZFA 4D60A 3Q7VB 1FOFA 3CJMA 4QHCA 5DKLA 5K5BA 1W5DA 1YLWA 3ITAA 3NHQA 2UWXA 1J3WA 5FEFA 2G7UA 2XRNA 1ESUA 5HDDA 2ZC5B 2V20A 1TD5A 4HY8A 4HP9A 5HAPA 2EA9A 4GW9A 3MKFA 4LRYC 3MQQA 4ARZA 2JKTI 2PHYA 4PM8A 1NY0A 3HVFA 3SH7A 4CPKA 2J80A 1KGFA 3HBRA 1V9ZA 3RH8B 5HL1A 1W63M 2H0YA 1QMEA 3S7NA 4DXCA 1NLZA 2DMWA 2B5RA 2LB9A 5HWVA 3R7WA 4PPRA 3UMDA 1BT5A 5EECA 4OPYA 4X55A 2WADA 4XUZA 3PXPA 5EPHA 3IWIA 4GS9A 5CHUA 1OTEA 1GSWA 2XQZA 4HEFA 3QP4A 4HHDA 5FSRA 3ZVTA 2EWWA 5F83A 2NUPC 2GDNA 1NRJA 5HARA 1BYWA 4DXBA 3HLEA 1NYMA 4R0QA 2WKQA 3NY4A 3OCLA 4IHQA 1N9OA 1MC0A 2K7SA 5J4EA 2Y2NA 2PD8A 1DY6A 1FCMA 3U2AA 1UWPX 2XROA 4G3VA 2ZC4B 3V50A 4HBUA 1TS6A 4K08A 2W0NA 3VE4A 1OJ5A 2A3UA 1E3UD 2HPBA 1CEFA 3Q82A 1ZC2A 1D7EA 2LB5A 4K0XA 3IF5A 5IS1A 4KQRA 3KSIA 1LSWA 1RCJA 3KO6A 4BLMA 1DP9A 3BWLA 3NCKA 4S2JA 4BQMA 5J3WA 2YKHA 4HJ6A 5E2EA 3LR0A 2O9BA 5GLBA 5FL3A 1HZOA 2J9PA 4PKYG 2ZQCA 3EWKA 1HTZA 4EBNA 2ZM8A 1ONHA 1L0GA 2XR0A 5L09A 3HUOA 3IXHA 3NIAA 3OPHA 4KQDA 3IQAA 4IUKA 3JVVA 2QMIA 3UE0A 3SOIA 4GZBA 3UB8A 4R38A 4WL9A 3CUEC 5EOOA 4P6ZM 1PI4A 1H8MA 2IA2A 4YINA 2ZC6B 4F3LB 1BLSA 4LV3A 5J7EA 5EM1A 3WS2A 3C8CA 3IH8A 1PIOA 3VP0A 4GD6A 2XD5A 1GHIA 4Y13A 3OOVA 2Y2PA 3W4OA 2C5WB 4WZ5A 5F69A 5E2GA 2WZZA 1LI9A 5LBRA 3GQZA 1VEUA 4KUKA 1MPLA 1NWZA 4OKPA 4M4XA 4OQIA 2ZQ7A 4QD4A 2WGWA 2EX6A 3ZFZA 3LGOA 1NJ4A 3BQAA 1IYPA 4I3JA 1Q2PA 1IYSA 3VMAA 4B4XA 3LIAA 1TS8A 5G4ZA 1M6KA 2ZQ8A 4QPRA 3DWKA 3SW1A 1JWPA 1Y28A 4R6LA 4ZBEA 4CLCB 4P87A 5F1FA 4MN7A 4ZJ3A 5F5YA 4OLDA 3O86A 3G30A 2ZQAA 1FSYA 3CMZA 3ZQ5A 4IUHA 3B3XA 3W8KA 2L0WA 3BYDA 3N8LA 4OH0A 1N9LA 1UGUA 4H8RA 2PU2A 3B47A 3E4PA 4OPQA 1C3BA 2Y2KA 4Y7PA 4GHIA 3EGDC 3MZEA 5TBMA 3WS5A 2HP5A 4O8GA 5CTMA 2J3TD 1PNEA 4MNRA 3CLOA 3T1XA 1XFQA 4MN6A 3UO9A 4Y0TA 3HL9A 1E25A 1GA0A 1CI8A 4OP8A 1IOUA 3O3VA 2JKRI 2XA7M 1GHPA 4E3KA 4B4ZA 3H7WB 5FQQA 1OJGA 3IS2B 1BZAA 2B18A 3OPLA 2ZL1B 3UE3A 4DF6A 1ZTUA 2HGVA 1HD8A 5FI2A 5M1AA 3UN7A 1ES5A 4GB7A 5FAOA 3UE1A 1H0MA 4KG6A 4Y0OA 3ITBA 2Y2IA 3F1OB 1XKZA 3KX0X 1GCEA 4I3AA 2ZOHA 2O9CA 3JYIA 4KZ5A 4JPMA 3GTCA 4WF0A 3E2LA 3JVUA 3MF0A 4GKUA 3MJQA 1BULA 4EERA 2PYPA 1M40A 2HJEA 2HZ5A 4L9FA 2W1TB 2J3TC 5KSHA 3BLSA 3M6HA 4HBTA 1FILA 3Q7VA 4S2PA 3LIBA 2JN7A 1OTBA 2IWCA 4PMAA 2H0TA 4H6JB 1Y54A 1XA7A 3QHYA 4WN5A 3OC2A 3CHWP 3HUMA 4X69A 1XGIA 1JNUA 1EW0A 4OPZA 4X68A 4BENA 2P7JA 3UDIA 4OONA 4DE3A 5EVLA 4D2OA 4E3OA 1ZHHB 2BASA 4RA7A 2Y2MA 2V1ZA 1E4DA 4RYEA 5FEGA 1K4FA 3D3OA 3V39A 5CTNA 5DF7A 3SS4A 2KDKA 4R3JA 4FUWA 1DP8A 3ZG0A 2X01A 2EFXA 1BTLA 1YAXA 2A49A 4O7DA 3IH9A 2BTFP 3D72A 5DFYA 1TS0A 3UB9A 4WZ4A 3FKVA 4EWFA 2ZQDA 4WMCD 5CEBA 3G35A 1TDLA 3UB7A 1K54C 4DN0A 1DJCA 2ACGA 5CERA 2FFYA 1S4RA 1OPXA 3LIEA 3A3DA 3W4PA 4GCZA 2XDMA 2V1AA 3ISGA 5IHVA 1H3QA 1K4EA 4NK3A 1HLUP 4DJ3A 4OP5A 3SH8A 4BD0A 5KIZA 1P9RA 2O9AA 1VM1A 1KE4A 3C2WA 4JKTA 2XFSA 1KDSA 3LFVA 4NXEA 3C4PA 4WZ5C 3P7NA 4Y5FA 1SZVA 3BEBA 1TVFA 3QNCA 2Y2JA 3IF6A 4X53A 3E4OA 1DJAA 2Q9MA 3C7UA 1YMXA 3SS5A 4LGWA 1ODVA 4DRTA 1NYYA 2OOLA 3K2NA 4I3IA 3HCYA 3OCNA 3DWZA 3DW0A 5JYOA 1KGGA 2JE5A 3A0VA 1NZUA 5E2FA 3FWLA 1OMEA 3ZDJA 4X56A 3VOLA 2VGLM 3DTKA 4JGPA 1JWZA 3P98A 1MWRA 2W1RA 4Q0JA 2FH5A 2Z2MB 3KYZA 5GHYA 2P9VA 4EBPA 4BBUA 3VSLA 3I7JA 5TJJA 4OOYA 3F1PA 3N6IA 1CEGA 4LV0A 1K25A 2Q0OA 4E3JA 4KZ6A 2UV0E 4DE2A 3W2ZA 3MXQA 4II7A 5A8BA 3JPUA 2B95A 5AQBA 2WZXA 2VV8A 3T1RA 4EUVA 5I5LA 3E4QA 5EVIA 2C6WB 3NECA 3NOTC 3E2KA 3N8SA 3ZGAB 4E3IA 3QP6A 3G31A 2JKTM 4S2NA 4EV4A 2O99A 2H28A 4IBRA 4GOGA 4F94A 5FQ9A 1AXBA 4YWZA 5CGSA 3G4PA 4ZJ1A 2EXBA 3RJUA 2A24A 3MBZA 4O0PA 3BECA 3NOPC 3VV4A 3MMHA 1P9WA 5U47A 2OLVA 1D06A 4RX3A 1WYBA 3FKWA 4HOIA 4CLCA 1K0KA 1O07A 2V0WA 1WYCA 2XLNA 1FQGA 3UB6A 5HPFA 5FQMA 2Y2GA 4PM5A 4GLQA 4L0LA 5HL6A 3EGXC 4K91A 3ZYTA 4UHUA 1VB6A 4FCFA 2OWHA 1MXOA 2YKFA 1FCOA 1U60A 4NEED 4B93A 2D01A 2ZC3B 2VV6A 4ETXA 1ZG6A 3PBOA 1P97A 3UDFA 4KZ7A 1G5UA 4IVKA 2QJ5A 4QY5A 5AVEA 1IEMA 3TRCA 2M1CA 1K55A 3WRZA 1L0EA 3V3SA 1W7FA 3HJKA 1FIKA 5EV0A 5HAIA 1S4SA 3WRTA 5FAQA 3KSFA 2HP9A 3ZG7B 3P09A 4UA7A 2W3EA 4E6WA 2FFFB 1HVBA 3Q07A 2HDRA 1PYYA 4Z9QA 2ZL1A 3UNWA 3UPNA 3BY9A 3L7HA 3VFHA 4R3BA 4JF4A 4N92A 4GN2A 3H82A 2QHKA 3ICYA 3G2ZA 4X6TA 5DF9A 2V2FF 3UE6A 3F1OA 1F9IA 4FD8A 2PD7A 5FAPA 2KLIA 3O5YA 4XT2B 2FZ0A 5L2FA 3MSHA 3VP1A 4X1MA 4N1XA 3E0YA 2QPNA 2XF3A 4OOMA 4BBTA 3F1NA 2VZWA 2W1TA 3EEAA 2J9OA 2Q9NA 4NETA 3T4JA 1J9MA 4EETB 2EXAA 5FI6A 4P6BA 3DTEA 3M2KA 2WYXA 3GMWA 2VKSA 4ZAMA 3TG9A 3T4SA 5A92A 4E3MA 4H6JA 4OOLA 1OTIA 4QB8A 5IT5A 4MMNA 1SKOB 3GRJA 1CJFA 2XFTA 4WYYA 3IF6C 3LEZA 2V0UA 5EVID 4AFIA 5AQ9A 5AQAA 3FPWA 4S2LA 5HWWA 2OV5A 1NLYA 4Y2FA 3QP5A 3MR0A 5CGWA 1PW8A 5EE8A 4C6YA 2VK3A 1ZKJA 2OLUA 2G2WA 1FCNA 3DAVA 3GVBA 4XUXA 1XP4A 3RXXA 1ALQA 4EESA 2H5SA 1YLPA 3OPPA 1CF0A 2V8FA 2VGKA 2HJ9C 4EW7A 1MZUA 1L0FA 2BLSA 1WE4A 3SS3A 3NDEA 4R70A 5HW3A 1JVJA 3UY6A 2K31A 1MBLA 1YLTA 1OTAA 4ARZB 4HNBA 3BFDA 4UQIS 2P08A 4HQAA 1G6OA 1N4OA 3U4LP 2XK1A 2Y59A 1CK3A 4UA9A 2WKPA 4DE1A 5FDHA 5HDSA 3EEHA 3T4OA 3H9WA 3R7WB 3HJIA 1W63Q 4S2MA 4JF6A 1YM1A 5EVIC 4IJGA 2ZD8A 4QJGA 3ZG8B 2ZMVA 1MWTA 2JKRM 2L1MA 4KZ8A 3LY4A 3M2JA 2EFUA 2VJWA 1STZA 1FSWA 4FSFA 3A0SA 4LV2A 2G2UA 3RTYA 2X02A 1F5MA 5DFXA 2HV1A 5HSQA 1CI9A 1ZG4A 3S4XA 2P74A 4DJ2A 1IFQA 2W3GA 3G6OA 2ZC7A 4KZ3A 4PKYA 3K3CA 3FPVA 5G18A 1BUEA 4B88A 1NXYA 3BLMA 1T1CA 4Y17A 1L0DA 4LFUA 1P0ZA 2EX8A 5G4YA 4ZJ2A 5HWTA 1K6RA 2A2LA 1YPRA 2XD1A 4MLLA 5L07A 4ME4A 4MCWA 4JXWA 4BL3A 5CRFA 3P01A 4IBXA 2RCXA 3L9KA 1A0KA 4MBHA 4GD8A 4MEZA 1MKMA 4Y3IA 3TJZC 2PBYA 1V9YA 3BFGA 1KOUA 3BW6A 1K56A 2JCHA 3O88A 5EVEA 1SKFA 5FATA 5E43A 4Q8IA 2JHEA 5CGXA 4KZ9A 4BD1A 4GNUA 4P0MA 2X71A 3RFBA 2WAEA 1LSVA 1GHMA 3UMEA 1UWNX 3LYXA 4Z1WA 1PWDA 3AGEA 3ULFA 4KG5A 2J8YA 3EOIA 1EROA 3CAXA 1S1ZA 3IHAA 2Y91A 3IBRA 2Y79A 4KG2A 4DDYA 2XH9A 4S2IA 1SDNA 1RGYA 3FC7A 5FQJA 1TDGA 2WKEA 3LR5A 5JYPA 4ZDXA 2GX5A 5M18A 3IX3A 4BWIA 3MFXA 2HDSA 5EUAA 2Z6CA 2WKRA 3E98A 2WGWB 2QWSA 5A91A 2KX6A 4OQHA 3UPPA 1KE0A 3CPTB 5GLCA 4NKPA 4WM9A 3FV7A 3G2YA 3FG8A 5KZHA 1Z6FA 4X25A 4P6ZS 1PZPA 1RGZA 3LUQA 4QWOA 4LRXC 1YLYA 3UB5P 2DNSA 4R3AA 4EXOA 1XJ3A 1XX2A 2PBDP 5MC7A 1X0OA 3OZHA 5FI7A 3C30A 1AWIA 3VOYA 3CUEA 5E2HA 3GSGA 3IXDA 4L9GA 1G28A 2R9WA 2ZQ9A 5GHXA 5AVFA 5F6AA 3LY3A 1EWZA 4LENA 2PR6A 3B33A 5CHJA 2PDRA 3PBSA 3WS1A 2DCFA 5EM0A 5DKKA 1PRQA 1PWGA 2VGJA 4E3NA 3UPOA 2PR5A 2PAVP 3LI9A 4FH2A 4LLOB 4N9KA 1N9NA 2L4RA 5L10A 1DRMA 3S7QA 4E6XA 4WUJA 3T12B 4I38A 3A3JA 1JTGA 2OAP1 5TR7A 4BMWA 2CMNA 1YQSA 3PBTA 3B42A 3VSKA 5HFOA 4OQGA 1YSPA 5CX7A 4F3LA 4KZAA 4N1HA 4MBKA 2Y2QA 1GSXA 4JXGA 3DTIA 4OPRA 3KYQA 2NUTC 5FA7A 1BSGA 2JBFA 1WA9A 1LL5A 4EU0A 4LRZE 3MQOA 1K56D 2QJ7A 2Y4AA 3BRMA 4Y15A 3C7VA 2XA7S 4CJNA 3R4KA 3IX4A 3KYEA 4G3WA 1G6AA 4R23A 3IBJA 5IU1A 3O87A 4IEDA 4MDZA 1PFLA 3HLGA 5J8XA 2Y2HA 1KE3A 5GLAA 1T1AA 2INWA 3MQ0A 4U0XA 2XSSA 5DJTA 3ZHHA 1PI5A 2ZMAA 2H10A 2EX2A 4BL2A 5HD5A 3EQVA 4WLAA 5GLDA 3EQUA 4FTXA 2E8JA 3HLCA 4BJPA 1XGJA 3TW8A 4HESA 1GSVA 5CHMA 4ZRRA 1D1JA 2XGNA 1YLZA 2M7UA 3LICA 1IELA 4IVIA 3QP8A 4NG2A 1LL8A 3IXGA 2QKPA 2GNXA 4FH4A 1T1BA 2JC7A 2ZMFA 4Q0IA 2M7VA 4QY6A 4OLGA 3Q81A 3MXRA 4Y0UA 3DTMA 3PBRA 4CQHA 3RXWA 3LI8A 1W8QA 2OWJA 5DTKA 3CITA 4EQIA 2ZBBA 4G3KA 3PTEA 5C5KA 3V67A 3A3EA 4PM6A 4EQ1A 3H7WA 3HUNA 1W79A 4GJ4A 3MKEA 1ERQA 4A5RA 3IS2A 2HDUA 1VQQA 1LL9A 3OPRA 4LPZA 1SCWA 4YOFA 4E04A 4DKIA 4X1LA 2Y55A 3C4OA 5FDSA 4EEUA 3CG5A 5AQ7A 3IF6B 5DJUA 1IYOA 4BBVA 1S66L 4LCMA 2XEPA 4HP4A 4UA6A 1I2SA 2J3WA 1PWCA 1IYQA 3Q7ZA 1LI0A 2WUQA 4KZ4A 1T19A 4RX2A 4NXBA 5L8MA 3G34A 3A3IA 3Q1FA 1MWSA 4Q0HA 3BJNA 2WGVA 4HJ3A 3ZCZA 1XPBA 2VLGA 1BLHA 3W4QA 4OVDA 1RP5A 3S7OA 4PAUA 3SZTA 1NRFA 3PBNA 1S1YA 5I94A 2P9VB 2Y2OA 1JWVA 1K54A 3HLWA 3PAEA 2Z6DA 4PM9A 4P85A 4HI4A 1QMFA 1MY8A 3F1PB 1K57A 2Y8HA 3S1YA 2R78A 2HP6A 2ZOIA 3PBQA 1DJBA 4HH2A 1MKIA 3TE8A 3HLBA 3KSGA 3OBFA 1H8YA 3T1QB 1VETB 3LCEA 1VHMA 4K0WA 5BOHA 3NULA 5EVIB 2WKIA 5DTSA 1XXMA 4HH3A 3V3RA 2WK0A 3DBAA 5DF8A 4I5SA 1L3LA 2WAFA 4LV1A 5HAQA 2VA0A 3BFFA 2W3FA 2P04A 3PHYA 4NXFA 5HX9A 2VGLS 3N7WA 3VFFA 2GJ3A 4CLCD 4KQQA 3N4IA 5FASA 2OSUA 3NOUC 1PW1A 3IWOA 3N8RA 3CPTA 2A24B 3K3DA 3IX8A 4WMCA 3MS6A 1ESIA 1MWUA 3PR6A 3A0RA 1L2SA 1Z09A 1DP6A 2Y2LA 5TFQA 2ZM2A 3D9YA 1OT6A 2D02A 3T50A 5GL9A 3VOZA 4NXGA 4GS9B 5D3OA 2J7VA 1CQAA 4U0TA 1BLPA 1K6SA 4DMZA 3QNBA 2QYBA 3ZVWA 1BLCA 3T1SA 3GECA 4S2NC 5FQKA 4MN5A 1GA9A 3ZG9B 1XJ2A 5AJGA 4HJ4A 3T4LA 1XFNA 2ZLYA 3BFEA 1ONGA 1LSXA 1T18A 1FR6A 2PRFA 3S7PA 1N9BA 3SH9A 1S6RA 4WEJA 3T4TA 4ETZA 4C3QA 4RVAA 3V5MA 1JTDA 3LO7A 5F68A 4CLCC 1XA1A 2V8CA 1ES4A 1PZOA 2W27A 3CZDA 5CECA 4FOFA 3C5AA 3NI9A 1YT4A 1YKDA 1KGEA 3H82B 3UDXA 5EFWA 4UEYA 4EUZA 4JBFA 1LHYA 2HF6A 3IXBA 1KVMA 3LIFA 3A3FA 1SDEA 3AGDA 2V9AA 2PU4A 4GDNA 4UAAA 1K55C 1TS7A 2QZ6A 3M6BA 2VX8A 3NC8A 1I2WA 2CC1A 1TF1A 4KENB 3S22A 3F1NB 3G32A 4KUOA 3BQ8A 5DVAA 1ERMA 4E3LA 1W8YA 3VP3A 3LEQA 1LLBA 1YLJA 3ZNYA 4RQ9A 3GV9A 2KOIA 2PT7A 2VV7A 4JXVA 1SHVA 4B9OA 3WWXA 3LR4A 4L9EA 4EBLA 1KVLA 4DE0A 4OQ0A 3TSGA 3PAGA 3FZCA 1H5XA 4EEPA 1YSQA 1ES3A 3NBLA 3MFDA 1ES2A 1ACFA 2EX9A 5F1GA 4PHTA 4C75A 1VEUB 3NDGA 1I5QA 3IWQA 4GDBA 1O7EA 4YNRA 4QU3A 2K2NA 1S0WA 3MXSA 2RL3A 2VEAA 5HPIA 2R9XA 4M3KA 4HIAA 3BM6A 5M19A 4KQOA 4JGOA 1F98A 2AVXA 4KZBA 5GHZA 2EWVA 1F2KA 1NZOA 2ZJ9A 3NJAA 3BY8A 4I39A 2DRWA 5HZHA 2GZAA 5HD3A 5KMWA 3HLFA 1KDWA 2JKFA 4WEKA 3VP4A 1H8ZA 4ID4A 5HDCA 4WBGA 1K57C 4JLFA 3CWFA 4LCLA
chains in the Genus database with same CATH topology
3T4SA 5HD5A 3EQVA 4JGQA 4H6JA 4WLAA 4OOLA 1OTIA 2W3DA 5IT5A 4MMNA 2B02A 3EQUA 2I9VA 4O01A 4GHIB 3F1OB 5TBMB 4BJPA 2V0UA 3KX0X 4I3AA 4AFIA 2ZOHA 3TW8A 4ZRRA 1GSVA 3FPWA 2O9CA 2M7UA 3LICA 5HWWA 1NLYA 3CI6A 1LL8A 4Y2FA 2QKPA 2GNXA 2MJ6A 1T1BA 2ZMFA 3MR0A 4Q0IA 3GDIA 4WF0A 4WELA 3JVUA 3MF0A 2M7VA 3MJQA 2PYRA 2PYPA 4EERA 2HJEA 1S67L 1OT9A 4L9FA 2W1TB 3PBRA 2J3TC 4EESA 4CQHA 4XT2A 5KSHA 3LI8A 3C38A 2OWJA 3CITA 2ZBBA 4G3KA 3OLOA 3LIBA 2HJ9C 5C5KA 4EW7A 1XJ6A 2JN7A 1OTBA 3KSHA 3PYPA 1MZUA 4JGRA 3T4QA 3V67A 3T4KA 4R70A 2OAQ1 4H6JB 4EQ1A 4WN5A 3H7WA 2K31A 3OC2A 2W3HA 4GJ4A 1OTAA 4ARZB 4HNBA 3IS2A 4UQIS 1JNUA 1EW0A 2P08A 3LR3A 4HQAA 1G6OA 4CLCE 4LPZA 2P7JA 4UQIM 4YOFA 4E04A 1ZHHB 2BASA 2WKPA 4EEUA 5HDSA 3EEHA 2O0YA 3D3OA 5DJUA 1LT0A 3T4OA 1OTDA 1XJ4A 3H9WA 3R7WB 2KDKA 3VE3A 4BBVA 1DP8A 3HJIA 2V1BA 1W63Q 1S66L 4IJGA 4HP4A 1YAXA 2ZMVA 2JKRM 2L1MA 2J3WA 3LIDA 3D72A 2VJWA 1T19A 5DFYA 4NXBA 5L8MA 1STZA 1TS0A 3UB9A 4FSFA 3A0SA 5DKLA 4Q0HA 3RTYA 3UB7A 5K5BA 3BJNA 4HJ3A 2VLGA 1F5MA 5DFXA 4DN0A 3NHQA 2HV1A 5HSQA 1S4RA 2G7UA 3S7OA 1OPXA 2XRNA 3LIEA 4PAUA 4GCZA 5HDDA 1TD5A 4HY8A 2V1AA 3PBNA 1S1YA 1H3QA 4HP9A 4DJ2A 1IFQA 2EA9A 2Z6DA 4GW9A 2W3GA 4DJ3A 4LRYC 3MQQA 4HI4A 3G6OA 5KIZA 1P9RA 2O9AA 4ARZA 2JKTI 3F1PB 4PKYA 3K3CA 2PHYA 3FPVA 2Y8HA 2R78A 2ZOIA 3C2WA 3LFVA 2J80A 3PBQA 4HH2A 4NXEA 3RH8B 1V9ZA 1T1CA 1W63M 3S7NA 3P7NA 1P0ZA 1NLZA 4Y5FA 5G4YA 3TE8A 2DMWA 3KSGA 3OBFA 3E4OA 5HWTA 2LB9A 1VHMA 5HWVA 3R7WA 3UMDA 2A2LA 4ME4A 1ODVA 4MCWA 3PXPA 2OOLA 4HH3A 3P01A 3K2NA 3DBAA 4GS9A 4I3IA 1OTEA 4I5SA 1GSWA 4HHDA 3HCYA 2EWWA 3OCNA 1MKMA 2NUPC 4Y3IA 3TJZC 2VA0A 3A0VA 1NRJA 1BYWA 2P04A 2W3FA 3PHYA 2WKQA 4NXFA 4IHQA 3OCLA 2VGLS 1N9OA 1V9YA 2GJ3A 1KOUA 4CLCD 3BW6A 1MC0A 2K7SA 5J4EA 3NOUC 3VOLA 2JHEA 2VGLM 4JGPA 2PD8A 2A24B 4Q0JA 2W1RA 3K3DA 2FH5A 3RFBA 3U2AA 1UWPX 2XROA 1LSVA 3UMEA 3KYZA 4G3VA 1UWNX 3LYXA 4Z1WA 4BBUA 1TS6A 3PR6A 4K08A 2W0NA 3VE4A 3A0RA 1OJ5A 3ULFA 5TJJA 3EOIA 3CAXA 3F1PA 1DP6A 1S1ZA 3IBRA 2Y79A 1OT6A 2D02A 3T50A 3FC7A 1D7EA 3W2ZA 3LR5A 2LB5A 3MXQA 2GX5A 4II7A 4NXGA 5A8BA 5IS1A 4GS9B 4BWIA 3MFXA 2VV8A 3KSIA 1LSWA 3KO6A 4EUVA 2Z6CA 1DP9A 3BWLA 2WKRA 5I5LA 5J3WA 2YKHA 4HJ6A 3E4QA 3E98A 3LR0A 2O9BA 4DMZA 5FL3A 2QYBA 3GECA 3NOTC 4PKYG 2QWSA 4MN5A 2KX6A 3EWKA 1XJ2A 5AJGA 4HJ4A 3T4LA 1XFNA 1LSXA 1T18A 3S7PA 2JKTM 4WEJA 3T4TA 4ETZA 4NKPA 4KQDA 2O99A 3FG8A 4IUKA 2H28A 3JVVA 4P6ZS 4YWZA 3LUQA 3UB8A 4LRXC 4R38A 5F68A 4WL9A 3CUEC 4CLCC 4P6ZM 2W27A 4R3AA 4EXOA 1XJ3A 2A24A 1H8MA 4O0PA 3NOPC 3VV4A 5MC7A 2IA2A 3MMHA 4FOFA 1X0OA 1P9WA 3C30A 4F3LB 1D06A 3CUEA 4HOIA 4CLCA 1YKDA 5J7EA 4L9GA 2V0WA 3C8CA 3H82B 3UB6A 5HPFA 1G28A 5AVFA 5EFWA 5F6AA 4UEYA 4GLQA 4L0LA 5HL6A 3OOVA 2HF6A 3EGXC 2PR6A 3B33A 3ZYTA 3LIFA 1VB6A 2PDRA 3PBSA 2OWHA 2V9AA 5F69A 2YKFA 4NEED 5LBRA 4B93A 2D01A 5DKKA 1TS7A 4KUKA 2VV6A 4ETXA 1NWZA 2PR5A 3PBOA 4M4XA 1P97A 3LI9A 2QJ5A 2VX8A 5AVEA 4LLOB 1TF1A 1N9NA 3BQAA 3TRCA 2M1CA 4I3JA 2L4RA 3F1NB 4KUOA 3LIAA 1DRMA 3BQ8A 3S7QA 1TS8A 4WUJA 5G4ZA 3HJKA 4I38A 4QPRA 2VKSA 3SW1A 1Y28A 1S4SA 4R6LA 2OAP1 4BMWA 2CMNA 4RQ9A 2KOIA 3KSFA 4CLCB 3PBTA 2PT7A 2VV7A 4B9OA 3LR4A 4L9EA 4MN7A 2W3EA 3B42A 5F5YA 1YSPA 3ZQ5A 4IUHA 4EEPA 5CX7A 4F3LA 1YSQA 3BY9A 2L0WA 1GSXA 3KYQA 1N9LA 1UGUA 2NUTC 4PHTA 3H82A 2QHKA 3ICYA 3B47A 3E4PA 1WA9A 4GHIA 3EGDC 4YNRA 5DF9A 3UE6A 4EU0A 3F1OA 5TBMA 4LRZE 4O8GA 1F9IA 2K2NA 2VEAA 3MQOA 2J3TD 5HPIA 2PD7A 2KLIA 4HIAA 3CLOA 2QJ7A 3O5YA 1XFQA 4MN6A 4XT2B 4KQOA 4JGOA 1F98A 2FZ0A 2EWVA 2XA7S 3NJAA 3R4KA 3E0YA 1IOUA 4G3WA 3BY8A 3IBJA 5IU1A 2JKRI 4OOMA 4I39A 2XA7M 4BBTA 3F1NA 2VZWA 2W1TA 2GZAA 3EEAA 5HZHA 4MDZA 3H7WB 3T4JA 5HD3A 4EETB 1OJGA 3IS2B 1T1AA 2INWA 4WEKA 2B18A 3MQ0A 3UE3A 5HDCA 2XSSA 5DJTA 1ZTUA 2HGVA 3CWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z1W A;  5DFY A;  5L8M A;  1STZ A;  2W3D A;  5TJJ A;  4MMN A;  1TF1 A;  3IBR A;  2Y79 A;  4Q0H A;  3TRC A;  5K5B A;  4O01 A;  3BJN A;  1F5M A;  5DFX A;  4DN0 A;  3S7Q A;  3NHQ A;  4ZRR A;  3W2Z A;  5HSQ A;  2LB5 A;  2G7U A;  3S7O A;  2O9C A;  2GX5 A;  2XRN A;  4PAU A;  2M7U A;  1TD5 A;  4QPR A;  4BWI A;  4R6L A;  3CI6 A;  3KSI A;  3KO6 A;  4EUV A;  4RQ9 A;  4Y2F A;  2KOI A;  3KSF A;  2ZMF A;  4Q0I A;  5I5L A;  4GW9 A;  2M7V A;  2W3G A;  3MF0 A;  4MN7 A;  3E98 A;  4LRY C;  2O9B A;  2W3E A;  3G6O A;  4DMZ A;  2QYB A;  2O9A A;  3NOT C;  1YSP A;  2Y8H A;  2W1T B;  3ZQ5 A;  4IUH A;  5AJG A;  1YSQ A;  3C2W A;  4CQH A;  3LFV A;  3S7P A;  3CIT A;  4G3K A;  3S7N A;  4ETZ A;  2O99 A;  4Y5F A;  5C5K A;  3KSH A;  4IUK A;  3KSG A;  3OBF A;  2LB9 A;  4R70 A;  1VHM A;  4LRX C;  4EU0 A;  4YNR A;  2K31 A;  4LRZ E;  2W3H A;  4ME4 A;  4MCW A;  4O8G A;  2K2N A;  4O0P A;  2OOL A;  2VEA A;  5HPI A;  3NOP C;  3VV4 A;  2IA2 A;  3MMH A;  2KLI A;  3K2N A;  3DBA A;  4FOF A;  3O5Y A;  3HCY A;  4YOF A;  1YKD A;  4E04 A;  1MKM A;  4Y3I A;  5HPF A;  2W3F A;  3R4K A;  3E0Y A;  4G3W A;  2O0Y A;  3IBJ A;  3D3O A;  1MC0 A;  2VZW A;  2W1T A;  3EEA A;  4GLQ A;  4MDZ A;  5HL6 A;  3OOV A;  3NOU C;  4IJG A;  4Q0J A;  2W1R A;  2B18 A;  3MQ0 A;  3RFB A;  2XRO A;  5LBR A;  2XSS A;  1ZTU A;  4G3V A;  2HGV A;  2VJW A;  2VKS A;  4ETX A; 
#chains in the Genus database with same CATH topology
 2WKH A;  4JGQ A;  2W3D A;  3IHB A;  2B02 A;  1TEM A;  2I9V A;  4O01 A;  4GHI B;  3MZD A;  5TBM B;  2ZM0 A;  3AGF A;  5FQI A;  2WGI A;  3ZNT A;  4R1G A;  4DDS A;  1Q2Q A;  2Z2L B;  3ZG5 A;  5A93 A;  1E3U A;  2JKG A;  4PM7 A;  3VP2 A;  3CI6 A;  3FYZ A;  1Y4O A;  2E8I A;  3WS0 A;  2MJ6 A;  3GDI A;  4WEL A;  4YFM A;  5CED A;  3HRE A;  3HLD A;  2PYR A;  1IKI A;  1K38 A;  4ZTK A;  1S67 L;  1OT9 A;  4N9L A;  3IT9 A;  5DTT A;  4XT2 A;  3C38 A;  5TGF A;  4JXS A;  1FR1 A;  3OLO A;  3TOI A;  1YMS A;  4R4S A;  1XJ6 A;  3KSH A;  3PYP A;  4JGR A;  3T4Q A;  5EOE A;  3T4K A;  2BG1 A;  2OAQ 1;  4U3T A;  4ESP A;  4S2O A;  2W3H A;  3GR2 A;  4S2K A;  4MBF A;  1G68 A;  5F82 A;  3LR3 A;  4R4R A;  1EI5 A;  4CLC E;  3QP1 A;  4XXR A;  4UQI M;  3D4F A;  1SKO A;  2IWB A;  4JF5 A;  3BFC A;  2O0Y A;  1LT0 A;  1OTD A;  1XJ4 A;  1IKG A;  3VE3 A;  2HDQ A;  3WS4 A;  2V1B A;  5KSC A;  2IWD A;  2I72 A;  5CXW A;  3LID A;  5A90 A;  3QP2 A;  1VET A;  3MZF A;  4D60 A;  3Q7V B;  1FOF A;  3CJM A;  4QHC A;  5DKL A;  5K5B A;  1W5D A;  1YLW A;  3ITA A;  3NHQ A;  2UWX A;  1J3W A;  5FEF A;  2G7U A;  2XRN A;  1ESU A;  5HDD A;  2ZC5 B;  2V20 A;  1TD5 A;  4HY8 A;  4HP9 A;  5HAP A;  2EA9 A;  4GW9 A;  3MKF A;  4LRY C;  3MQQ A;  4ARZ A;  2JKT I;  2PHY A;  4PM8 A;  1NY0 A;  3HVF A;  3SH7 A;  4CPK A;  2J80 A;  1KGF A;  3HBR A;  1V9Z A;  3RH8 B;  5HL1 A;  1W63 M;  2H0Y A;  1QME A;  3S7N A;  4DXC A;  1NLZ A;  2DMW A;  2B5R A;  2LB9 A;  5HWV A;  3R7W A;  4PPR A;  3UMD A;  1BT5 A;  5EEC A;  4OPY A;  4X55 A;  2WAD A;  4XUZ A;  3PXP A;  5EPH A;  3IWI A;  4GS9 A;  5CHU A;  1OTE A;  1GSW A;  2XQZ A;  4HEF A;  3QP4 A;  4HHD A;  5FSR A;  3ZVT A;  2EWW A;  5F83 A;  2NUP C;  2GDN A;  1NRJ A;  5HAR A;  1BYW A;  4DXB A;  3HLE A;  1NYM A;  4R0Q A;  2WKQ A;  3NY4 A;  3OCL A;  4IHQ A;  1N9O A;  1MC0 A;  2K7S A;  5J4E A;  2Y2N A;  2PD8 A;  1DY6 A;  1FCM A;  3U2A A;  1UWP X;  2XRO A;  4G3V A;  2ZC4 B;  3V50 A;  4HBU A;  1TS6 A;  4K08 A;  2W0N A;  3VE4 A;  1OJ5 A;  2A3U A;  1E3U D;  2HPB A;  1CEF A;  3Q82 A;  1ZC2 A;  1D7E A;  2LB5 A;  4K0X A;  3IF5 A;  5IS1 A;  4KQR A;  3KSI A;  1LSW A;  1RCJ A;  3KO6 A;  4BLM A;  1DP9 A;  3BWL A;  3NCK A;  4S2J A;  4BQM A;  5J3W A;  2YKH A;  4HJ6 A;  5E2E A;  3LR0 A;  2O9B A;  5GLB A;  5FL3 A;  1HZO A;  2J9P A;  4PKY G;  2ZQC A;  3EWK A;  1HTZ A;  4EBN A;  2ZM8 A;  1ONH A;  1L0G A;  2XR0 A;  5L09 A;  3HUO A;  3IXH A;  3NIA A;  3OPH A;  4KQD A;  3IQA A;  4IUK A;  3JVV A;  2QMI A;  3UE0 A;  3SOI A;  4GZB A;  3UB8 A;  4R38 A;  4WL9 A;  3CUE C;  5EOO A;  4P6Z M;  1PI4 A;  1H8M A;  2IA2 A;  4YIN A;  2ZC6 B;  4F3L B;  1BLS A;  4LV3 A;  5J7E A;  5EM1 A;  3WS2 A;  3C8C A;  3IH8 A;  1PIO A;  3VP0 A;  4GD6 A;  2XD5 A;  1GHI A;  4Y13 A;  3OOV A;  2Y2P A;  3W4O A;  2C5W B;  4WZ5 A;  5F69 A;  5E2G A;  2WZZ A;  1LI9 A;  5LBR A;  3GQZ A;  1VEU A;  4KUK A;  1MPL A;  1NWZ A;  4OKP A;  4M4X A;  4OQI A;  2ZQ7 A;  4QD4 A;  2WGW A;  2EX6 A;  3ZFZ A;  3LGO A;  1NJ4 A;  3BQA A;  1IYP A;  4I3J A;  1Q2P A;  1IYS A;  3VMA A;  4B4X A;  3LIA A;  1TS8 A;  5G4Z A;  1M6K A;  2ZQ8 A;  4QPR A;  3DWK A;  3SW1 A;  1JWP A;  1Y28 A;  4R6L A;  4ZBE A;  4CLC B;  4P87 A;  5F1F A;  4MN7 A;  4ZJ3 A;  5F5Y A;  4OLD A;  3O86 A;  3G30 A;  2ZQA A;  1FSY A;  3CMZ A;  3ZQ5 A;  4IUH A;  3B3X A;  3W8K A;  2L0W A;  3BYD A;  3N8L A;  4OH0 A;  1N9L A;  1UGU A;  4H8R A;  2PU2 A;  3B47 A;  3E4P A;  4OPQ A;  1C3B A;  2Y2K A;  4Y7P A;  4GHI A;  3EGD C;  3MZE A;  5TBM A;  3WS5 A;  2HP5 A;  4O8G A;  5CTM A;  2J3T D;  1PNE A;  4MNR A;  3CLO A;  3T1X A;  1XFQ A;  4MN6 A;  3UO9 A;  4Y0T A;  3HL9 A;  1E25 A;  1GA0 A;  1CI8 A;  4OP8 A;  1IOU A;  3O3V A;  2JKR I;  2XA7 M;  1GHP A;  4E3K A;  4B4Z A;  3H7W B;  5FQQ A;  1OJG A;  3IS2 B;  1BZA A;  2B18 A;  3OPL A;  2ZL1 B;  3UE3 A;  4DF6 A;  1ZTU A;  2HGV A;  1HD8 A;  5FI2 A;  5M1A A;  3UN7 A;  1ES5 A;  4GB7 A;  5FAO A;  3UE1 A;  1H0M A;  4KG6 A;  4Y0O A;  3ITB A;  2Y2I A;  3F1O B;  1XKZ A;  3KX0 X;  1GCE A;  4I3A A;  2ZOH A;  2O9C A;  3JYI A;  4KZ5 A;  4JPM A;  3GTC A;  4WF0 A;  3E2L A;  3JVU A;  3MF0 A;  4GKU A;  3MJQ A;  1BUL A;  4EER A;  2PYP A;  1M40 A;  2HJE A;  2HZ5 A;  4L9F A;  2W1T B;  2J3T C;  5KSH A;  3BLS A;  3M6H A;  4HBT A;  1FIL A;  3Q7V A;  4S2P A;  3LIB A;  2JN7 A;  1OTB A;  2IWC A;  4PMA A;  2H0T A;  4H6J B;  1Y54 A;  1XA7 A;  3QHY A;  4WN5 A;  3OC2 A;  3CHW P;  3HUM A;  4X69 A;  1XGI A;  1JNU A;  1EW0 A;  4OPZ A;  4X68 A;  4BEN A;  2P7J A;  3UDI A;  4OON A;  4DE3 A;  5EVL A;  4D2O A;  4E3O A;  1ZHH B;  2BAS A;  4RA7 A;  2Y2M A;  2V1Z A;  1E4D A;  4RYE A;  5FEG A;  1K4F A;  3D3O A;  3V39 A;  5CTN A;  5DF7 A;  3SS4 A;  2KDK A;  4R3J A;  4FUW A;  1DP8 A;  3ZG0 A;  2X01 A;  2EFX A;  1BTL A;  1YAX A;  2A49 A;  4O7D A;  3IH9 A;  2BTF P;  3D72 A;  5DFY A;  1TS0 A;  3UB9 A;  4WZ4 A;  3FKV A;  4EWF A;  2ZQD A;  4WMC D;  5CEB A;  3G35 A;  1TDL A;  3UB7 A;  1K54 C;  4DN0 A;  1DJC A;  2ACG A;  5CER A;  2FFY A;  1S4R A;  1OPX A;  3LIE A;  3A3D A;  3W4P A;  4GCZ A;  2XDM A;  2V1A A;  3ISG A;  5IHV A;  1H3Q A;  1K4E A;  4NK3 A;  1HLU P;  4DJ3 A;  4OP5 A;  3SH8 A;  4BD0 A;  5KIZ A;  1P9R A;  2O9A A;  1VM1 A;  1KE4 A;  3C2W A;  4JKT A;  2XFS A;  1KDS A;  3LFV A;  4NXE A;  3C4P A;  4WZ5 C;  3P7N A;  4Y5F A;  1SZV A;  3BEB A;  1TVF A;  3QNC A;  2Y2J A;  3IF6 A;  4X53 A;  3E4O A;  1DJA A;  2Q9M A;  3C7U A;  1YMX A;  3SS5 A;  4LGW A;  1ODV A;  4DRT A;  1NYY A;  2OOL A;  3K2N A;  4I3I A;  3HCY A;  3OCN A;  3DWZ A;  3DW0 A;  5JYO A;  1KGG A;  2JE5 A;  3A0V A;  1NZU A;  5E2F A;  3FWL A;  1OME A;  3ZDJ A;  4X56 A;  3VOL A;  2VGL M;  3DTK A;  4JGP A;  1JWZ A;  3P98 A;  1MWR A;  2W1R A;  4Q0J A;  2FH5 A;  2Z2M B;  3KYZ A;  5GHY A;  2P9V A;  4EBP A;  4BBU A;  3VSL A;  3I7J A;  5TJJ A;  4OOY A;  3F1P A;  3N6I A;  1CEG A;  4LV0 A;  1K25 A;  2Q0O A;  4E3J A;  4KZ6 A;  2UV0 E;  4DE2 A;  3W2Z A;  3MXQ A;  4II7 A;  5A8B A;  3JPU A;  2B95 A;  5AQB A;  2WZX A;  2VV8 A;  3T1R A;  4EUV A;  5I5L A;  3E4Q A;  5EVI A;  2C6W B;  3NEC A;  3NOT C;  3E2K A;  3N8S A;  3ZGA B;  4E3I A;  3QP6 A;  3G31 A;  2JKT M;  4S2N A;  4EV4 A;  2O99 A;  2H28 A;  4IBR A;  4GOG A;  4F94 A;  5FQ9 A;  1AXB A;  4YWZ A;  5CGS A;  3G4P A;  4ZJ1 A;  2EXB A;  3RJU A;  2A24 A;  3MBZ A;  4O0P A;  3BEC A;  3NOP C;  3VV4 A;  3MMH A;  1P9W A;  5U47 A;  2OLV A;  1D06 A;  4RX3 A;  1WYB A;  3FKW A;  4HOI A;  4CLC A;  1K0K A;  1O07 A;  2V0W A;  1WYC A;  2XLN A;  1FQG A;  3UB6 A;  5HPF A;  5FQM A;  2Y2G A;  4PM5 A;  4GLQ A;  4L0L A;  5HL6 A;  3EGX C;  4K91 A;  3ZYT A;  4UHU A;  1VB6 A;  4FCF A;  2OWH A;  1MXO A;  2YKF A;  1FCO A;  1U60 A;  4NEE D;  4B93 A;  2D01 A;  2ZC3 B;  2VV6 A;  4ETX A;  1ZG6 A;  3PBO A;  1P97 A;  3UDF A;  4KZ7 A;  1G5U A;  4IVK A;  2QJ5 A;  4QY5 A;  5AVE A;  1IEM A;  3TRC A;  2M1C A;  1K55 A;  3WRZ A;  1L0E A;  3V3S A;  1W7F A;  3HJK A;  1FIK A;  5EV0 A;  5HAI A;  1S4S A;  3WRT A;  5FAQ A;  3KSF A;  2HP9 A;  3ZG7 B;  3P09 A;  4UA7 A;  2W3E A;  4E6W A;  2FFF B;  1HVB A;  3Q07 A;  2HDR A;  1PYY A;  4Z9Q A;  2ZL1 A;  3UNW A;  3UPN A;  3BY9 A;  3L7H A;  3VFH A;  4R3B A;  4JF4 A;  4N92 A;  4GN2 A;  3H82 A;  2QHK A;  3ICY A;  3G2Z A;  4X6T A;  5DF9 A;  2V2F F;  3UE6 A;  3F1O A;  1F9I A;  4FD8 A;  2PD7 A;  5FAP A;  2KLI A;  3O5Y A;  4XT2 B;  2FZ0 A;  5L2F A;  3MSH A;  3VP1 A;  4X1M A;  4N1X A;  3E0Y A;  2QPN A;  2XF3 A;  4OOM A;  4BBT A;  3F1N A;  2VZW A;  2W1T A;  3EEA A;  2J9O A;  2Q9N A;  4NET A;  3T4J A;  1J9M A;  4EET B;  2EXA A;  5FI6 A;  4P6B A;  3DTE A;  3M2K A;  2WYX A;  3GMW A;  2VKS A;  4ZAM A;  3TG9 A;  3T4S A;  5A92 A;  4E3M A;  4H6J A;  4OOL A;  1OTI A;  4QB8 A;  5IT5 A;  4MMN A;  1SKO B;  3GRJ A;  1CJF A;  2XFT A;  4WYY A;  3IF6 C;  3LEZ A;  2V0U A;  5EVI D;  4AFI A;  5AQ9 A;  5AQA A;  3FPW A;  4S2L A;  5HWW A;  2OV5 A;  1NLY A;  4Y2F A;  3QP5 A;  3MR0 A;  5CGW A;  1PW8 A;  5EE8 A;  4C6Y A;  2VK3 A;  1ZKJ A;  2OLU A;  2G2W A;  1FCN A;  3DAV A;  3GVB A;  4XUX A;  1XP4 A;  3RXX A;  1ALQ A;  4EES A;  2H5S A;  1YLP A;  3OPP A;  1CF0 A;  2V8F A;  2VGK A;  2HJ9 C;  4EW7 A;  1MZU A;  1L0F A;  2BLS A;  1WE4 A;  3SS3 A;  3NDE A;  4R70 A;  5HW3 A;  1JVJ A;  3UY6 A;  2K31 A;  1MBL A;  1YLT A;  1OTA A;  4ARZ B;  4HNB A;  3BFD A;  4UQI S;  2P08 A;  4HQA A;  1G6O A;  1N4O A;  3U4L P;  2XK1 A;  2Y59 A;  1CK3 A;  4UA9 A;  2WKP A;  4DE1 A;  5FDH A;  5HDS A;  3EEH A;  3T4O A;  3H9W A;  3R7W B;  3HJI A;  1W63 Q;  4S2M A;  4JF6 A;  1YM1 A;  5EVI C;  4IJG A;  2ZD8 A;  4QJG A;  3ZG8 B;  2ZMV A;  1MWT A;  2JKR M;  2L1M A;  4KZ8 A;  3LY4 A;  3M2J A;  2EFU A;  2VJW A;  1STZ A;  1FSW A;  4FSF A;  3A0S A;  4LV2 A;  2G2U A;  3RTY A;  2X02 A;  1F5M A;  5DFX A;  2HV1 A;  5HSQ A;  1CI9 A;  1ZG4 A;  3S4X A;  2P74 A;  4DJ2 A;  1IFQ A;  2W3G A;  3G6O A;  2ZC7 A;  4KZ3 A;  4PKY A;  3K3C A;  3FPV A;  5G18 A;  1BUE A;  4B88 A;  1NXY A;  3BLM A;  1T1C A;  4Y17 A;  1L0D A;  4LFU A;  1P0Z A;  2EX8 A;  5G4Y A;  4ZJ2 A;  5HWT A;  1K6R A;  2A2L A;  1YPR A;  2XD1 A;  4MLL A;  5L07 A;  4ME4 A;  4MCW A;  4JXW A;  4BL3 A;  5CRF A;  3P01 A;  4IBX A;  2RCX A;  3L9K A;  1A0K A;  4MBH A;  4GD8 A;  4MEZ A;  1MKM A;  4Y3I A;  3TJZ C;  2PBY A;  1V9Y A;  3BFG A;  1KOU A;  3BW6 A;  1K56 A;  2JCH A;  3O88 A;  5EVE A;  1SKF A;  5FAT A;  5E43 A;  4Q8I A;  2JHE A;  5CGX A;  4KZ9 A;  4BD1 A;  4GNU A;  4P0M A;  2X71 A;  3RFB A;  2WAE A;  1LSV A;  1GHM A;  3UME A;  1UWN X;  3LYX A;  4Z1W A;  1PWD A;  3AGE A;  3ULF A;  4KG5 A;  2J8Y A;  3EOI A;  1ERO A;  3CAX A;  1S1Z A;  3IHA A;  2Y91 A;  3IBR A;  2Y79 A;  4KG2 A;  4DDY A;  2XH9 A;  4S2I A;  1SDN A;  1RGY A;  3FC7 A;  5FQJ A;  1TDG A;  2WKE A;  3LR5 A;  5JYP A;  4ZDX A;  2GX5 A;  5M18 A;  3IX3 A;  4BWI A;  3MFX A;  2HDS A;  5EUA A;  2Z6C A;  2WKR A;  3E98 A;  2WGW B;  2QWS A;  5A91 A;  2KX6 A;  4OQH A;  3UPP A;  1KE0 A;  3CPT B;  5GLC A;  4NKP A;  4WM9 A;  3FV7 A;  3G2Y A;  3FG8 A;  5KZH A;  1Z6F A;  4X25 A;  4P6Z S;  1PZP A;  1RGZ A;  3LUQ A;  4QWO A;  4LRX C;  1YLY A;  3UB5 P;  2DNS A;  4R3A A;  4EXO A;  1XJ3 A;  1XX2 A;  2PBD P;  5MC7 A;  1X0O A;  3OZH A;  5FI7 A;  3C30 A;  1AWI A;  3VOY A;  3CUE A;  5E2H A;  3GSG A;  3IXD A;  4L9G A;  1G28 A;  2R9W A;  2ZQ9 A;  5GHX A;  5AVF A;  5F6A A;  3LY3 A;  1EWZ A;  4LEN A;  2PR6 A;  3B33 A;  5CHJ A;  2PDR A;  3PBS A;  3WS1 A;  2DCF A;  5EM0 A;  5DKK A;  1PRQ A;  1PWG A;  2VGJ A;  4E3N A;  3UPO A;  2PR5 A;  2PAV P;  3LI9 A;  4FH2 A;  4LLO B;  4N9K A;  1N9N A;  2L4R A;  5L10 A;  1DRM A;  3S7Q A;  4E6X A;  4WUJ A;  3T12 B;  4I38 A;  3A3J A;  1JTG A;  2OAP 1;  5TR7 A;  4BMW A;  2CMN A;  1YQS A;  3PBT A;  3B42 A;  3VSK A;  5HFO A;  4OQG A;  1YSP A;  5CX7 A;  4F3L A;  4KZA A;  4N1H A;  4MBK A;  2Y2Q A;  1GSX A;  4JXG A;  3DTI A;  4OPR A;  3KYQ A;  2NUT C;  5FA7 A;  1BSG A;  2JBF A;  1WA9 A;  1LL5 A;  4EU0 A;  4LRZ E;  3MQO A;  1K56 D;  2QJ7 A;  2Y4A A;  3BRM A;  4Y15 A;  3C7V A;  2XA7 S;  4CJN A;  3R4K A;  3IX4 A;  3KYE A;  4G3W A;  1G6A A;  4R23 A;  3IBJ A;  5IU1 A;  3O87 A;  4IED A;  4MDZ A;  1PFL A;  3HLG A;  5J8X A;  2Y2H A;  1KE3 A;  5GLA A;  1T1A A;  2INW A;  3MQ0 A;  4U0X A;  2XSS A;  5DJT A;  3ZHH A;  1PI5 A;  2ZMA A;  2H10 A;  2EX2 A;  4BL2 A;  5HD5 A;  3EQV A;  4WLA A;  5GLD A;  3EQU A;  4FTX A;  2E8J A;  3HLC A;  4BJP A;  1XGJ A;  3TW8 A;  4HES A;  1GSV A;  5CHM A;  4ZRR A;  1D1J A;  2XGN A;  1YLZ A;  2M7U A;  3LIC A;  1IEL A;  4IVI A;  3QP8 A;  4NG2 A;  1LL8 A;  3IXG A;  2QKP A;  2GNX A;  4FH4 A;  1T1B A;  2JC7 A;  2ZMF A;  4Q0I A;  2M7V A;  4QY6 A;  4OLG A;  3Q81 A;  3MXR A;  4Y0U A;  3DTM A;  3PBR A;  4CQH A;  3RXW A;  3LI8 A;  1W8Q A;  2OWJ A;  5DTK A;  3CIT A;  4EQI A;  2ZBB A;  4G3K A;  3PTE A;  5C5K A;  3V67 A;  3A3E A;  4PM6 A;  4EQ1 A;  3H7W A;  3HUN A;  1W79 A;  4GJ4 A;  3MKE A;  1ERQ A;  4A5R A;  3IS2 A;  2HDU A;  1VQQ A;  1LL9 A;  3OPR A;  4LPZ A;  1SCW A;  4YOF A;  4E04 A;  4DKI A;  4X1L A;  2Y55 A;  3C4O A;  5FDS A;  4EEU A;  3CG5 A;  5AQ7 A;  3IF6 B;  5DJU A;  1IYO A;  4BBV A;  1S66 L;  4LCM A;  2XEP A;  4HP4 A;  4UA6 A;  1I2S A;  2J3W A;  1PWC A;  1IYQ A;  3Q7Z A;  1LI0 A;  2WUQ A;  4KZ4 A;  1T19 A;  4RX2 A;  4NXB A;  5L8M A;  3G34 A;  3A3I A;  3Q1F A;  1MWS A;  4Q0H A;  3BJN A;  2WGV A;  4HJ3 A;  3ZCZ A;  1XPB A;  2VLG A;  1BLH A;  3W4Q A;  4OVD A;  1RP5 A;  3S7O A;  4PAU A;  3SZT A;  1NRF A;  3PBN A;  1S1Y A;  5I94 A;  2P9V B;  2Y2O A;  1JWV A;  1K54 A;  3HLW A;  3PAE A;  2Z6D A;  4PM9 A;  4P85 A;  4HI4 A;  1QMF A;  1MY8 A;  3F1P B;  1K57 A;  2Y8H A;  3S1Y A;  2R78 A;  2HP6 A;  2ZOI A;  3PBQ A;  1DJB A;  4HH2 A;  1MKI A;  3TE8 A;  3HLB A;  3KSG A;  3OBF A;  1H8Y A;  3T1Q B;  1VET B;  3LCE A;  1VHM A;  4K0W A;  5BOH A;  3NUL A;  5EVI B;  2WKI A;  5DTS A;  1XXM A;  4HH3 A;  3V3R A;  2WK0 A;  3DBA A;  5DF8 A;  4I5S A;  1L3L A;  2WAF A;  4LV1 A;  5HAQ A;  2VA0 A;  3BFF A;  2W3F A;  2P04 A;  3PHY A;  4NXF A;  5HX9 A;  2VGL S;  3N7W A;  3VFF A;  2GJ3 A;  4CLC D;  4KQQ A;  3N4I A;  5FAS A;  2OSU A;  3NOU C;  1PW1 A;  3IWO A;  3N8R A;  3CPT A;  2A24 B;  3K3D A;  3IX8 A;  4WMC A;  3MS6 A;  1ESI A;  1MWU A;  3PR6 A;  3A0R A;  1L2S A;  1Z09 A;  1DP6 A;  2Y2L A;  5TFQ A;  2ZM2 A;  3D9Y A;  1OT6 A;  2D02 A;  3T50 A;  5GL9 A;  3VOZ A;  4NXG A;  4GS9 B;  5D3O A;  2J7V A;  1CQA A;  4U0T A;  1BLP A;  1K6S A;  4DMZ A;  3QNB A;  2QYB A;  3ZVW A;  1BLC A;  3T1S A;  3GEC A;  4S2N C;  5FQK A;  4MN5 A;  1GA9 A;  3ZG9 B;  1XJ2 A;  5AJG A;  4HJ4 A;  3T4L A;  1XFN A;  2ZLY A;  3BFE A;  1ONG A;  1LSX A;  1T18 A;  1FR6 A;  2PRF A;  3S7P A;  1N9B A;  3SH9 A;  1S6R A;  4WEJ A;  3T4T A;  4ETZ A;  4C3Q A;  4RVA A;  3V5M A;  1JTD A;  3LO7 A;  5F68 A;  4CLC C;  1XA1 A;  2V8C A;  1ES4 A;  1PZO A;  2W27 A;  3CZD A;  5CEC A;  4FOF A;  3C5A A;  3NI9 A;  1YT4 A;  1YKD A;  1KGE A;  3H82 B;  3UDX A;  5EFW A;  4UEY A;  4EUZ A;  4JBF A;  1LHY A;  2HF6 A;  3IXB A;  1KVM A;  3LIF A;  3A3F A;  1SDE A;  3AGD A;  2V9A A;  2PU4 A;  4GDN A;  4UAA A;  1K55 C;  1TS7 A;  2QZ6 A;  3M6B A;  2VX8 A;  3NC8 A;  1I2W A;  2CC1 A;  1TF1 A;  4KEN B;  3S22 A;  3F1N B;  3G32 A;  4KUO A;  3BQ8 A;  5DVA A;  1ERM A;  4E3L A;  1W8Y A;  3VP3 A;  3LEQ A;  1LLB A;  1YLJ A;  3ZNY A;  4RQ9 A;  3GV9 A;  2KOI A;  2PT7 A;  2VV7 A;  4JXV A;  1SHV A;  4B9O A;  3WWX A;  3LR4 A;  4L9E A;  4EBL A;  1KVL A;  4DE0 A;  4OQ0 A;  3TSG A;  3PAG A;  3FZC A;  1H5X A;  4EEP A;  1YSQ A;  1ES3 A;  3NBL A;  3MFD A;  1ES2 A;  1ACF A;  2EX9 A;  5F1G A;  4PHT A;  4C75 A;  1VEU B;  3NDG A;  1I5Q A;  3IWQ A;  4GDB A;  1O7E A;  4YNR A;  4QU3 A;  2K2N A;  1S0W A;  3MXS A;  2RL3 A;  2VEA A;  5HPI A;  2R9X A;  4M3K A;  4HIA A;  3BM6 A;  5M19 A;  4KQO A;  4JGO A;  1F98 A;  2AVX A;  4KZB A;  5GHZ A;  2EWV A;  1F2K A;  1NZO A;  2ZJ9 A;  3NJA A;  3BY8 A;  4I39 A;  2DRW A;  5HZH A;  2GZA A;  5HD3 A;  5KMW A;  3HLF A;  1KDW A;  2JKF A;  4WEK A;  3VP4 A;  1H8Z A;  4ID4 A;  5HDC A;  4WBG A;  1K57 C;  4JLF A;  3CWF A;  4LCL A; 
#chains in the Genus database with same CATH homology
 3T4S A;  5HD5 A;  3EQV A;  4JGQ A;  4H6J A;  4WLA A;  4OOL A;  1OTI A;  2W3D A;  5IT5 A;  4MMN A;  2B02 A;  3EQU A;  2I9V A;  4O01 A;  4GHI B;  3F1O B;  5TBM B;  4BJP A;  2V0U A;  3KX0 X;  4I3A A;  4AFI A;  2ZOH A;  3TW8 A;  4ZRR A;  1GSV A;  3FPW A;  2O9C A;  2M7U A;  3LIC A;  5HWW A;  1NLY A;  3CI6 A;  1LL8 A;  4Y2F A;  2QKP A;  2GNX A;  2MJ6 A;  1T1B A;  2ZMF A;  3MR0 A;  4Q0I A;  3GDI A;  4WF0 A;  4WEL A;  3JVU A;  3MF0 A;  2M7V A;  3MJQ A;  2PYR A;  2PYP A;  4EER A;  2HJE A;  1S67 L;  1OT9 A;  4L9F A;  2W1T B;  3PBR A;  2J3T C;  4EES A;  4CQH A;  4XT2 A;  5KSH A;  3LI8 A;  3C38 A;  2OWJ A;  3CIT A;  2ZBB A;  4G3K A;  3OLO A;  3LIB A;  2HJ9 C;  5C5K A;  4EW7 A;  1XJ6 A;  2JN7 A;  1OTB A;  3KSH A;  3PYP A;  1MZU A;  4JGR A;  3T4Q A;  3V67 A;  3T4K A;  4R70 A;  2OAQ 1;  4H6J B;  4EQ1 A;  4WN5 A;  3H7W A;  2K31 A;  3OC2 A;  2W3H A;  4GJ4 A;  1OTA A;  4ARZ B;  4HNB A;  3IS2 A;  4UQI S;  1JNU A;  1EW0 A;  2P08 A;  3LR3 A;  4HQA A;  1G6O A;  4CLC E;  4LPZ A;  2P7J A;  4UQI M;  4YOF A;  4E04 A;  1ZHH B;  2BAS A;  2WKP A;  4EEU A;  5HDS A;  3EEH A;  2O0Y A;  3D3O A;  5DJU A;  1LT0 A;  3T4O A;  1OTD A;  1XJ4 A;  3H9W A;  3R7W B;  2KDK A;  3VE3 A;  4BBV A;  1DP8 A;  3HJI A;  2V1B A;  1W63 Q;  1S66 L;  4IJG A;  4HP4 A;  1YAX A;  2ZMV A;  2JKR M;  2L1M A;  2J3W A;  3LID A;  3D72 A;  2VJW A;  1T19 A;  5DFY A;  4NXB A;  5L8M A;  1STZ A;  1TS0 A;  3UB9 A;  4FSF A;  3A0S A;  5DKL A;  4Q0H A;  3RTY A;  3UB7 A;  5K5B A;  3BJN A;  4HJ3 A;  2VLG A;  1F5M A;  5DFX A;  4DN0 A;  3NHQ A;  2HV1 A;  5HSQ A;  1S4R A;  2G7U A;  3S7O A;  1OPX A;  2XRN A;  3LIE A;  4PAU A;  4GCZ A;  5HDD A;  1TD5 A;  4HY8 A;  2V1A A;  3PBN A;  1S1Y A;  1H3Q A;  4HP9 A;  4DJ2 A;  1IFQ A;  2EA9 A;  2Z6D A;  4GW9 A;  2W3G A;  4DJ3 A;  4LRY C;  3MQQ A;  4HI4 A;  3G6O A;  5KIZ A;  1P9R A;  2O9A A;  4ARZ A;  2JKT I;  3F1P B;  4PKY A;  3K3C A;  2PHY A;  3FPV A;  2Y8H A;  2R78 A;  2ZOI A;  3C2W A;  3LFV A;  2J80 A;  3PBQ A;  4HH2 A;  4NXE A;  3RH8 B;  1V9Z A;  1T1C A;  1W63 M;  3S7N A;  3P7N A;  1P0Z A;  1NLZ A;  4Y5F A;  5G4Y A;  3TE8 A;  2DMW A;  3KSG A;  3OBF A;  3E4O A;  5HWT A;  2LB9 A;  1VHM A;  5HWV A;  3R7W A;  3UMD A;  2A2L A;  4ME4 A;  1ODV A;  4MCW A;  3PXP A;  2OOL A;  4HH3 A;  3P01 A;  3K2N A;  3DBA A;  4GS9 A;  4I3I A;  1OTE A;  4I5S A;  1GSW A;  4HHD A;  3HCY A;  2EWW A;  3OCN A;  1MKM A;  2NUP C;  4Y3I A;  3TJZ C;  2VA0 A;  3A0V A;  1NRJ A;  1BYW A;  2P04 A;  2W3F A;  3PHY A;  2WKQ A;  4NXF A;  4IHQ A;  3OCL A;  2VGL S;  1N9O A;  1V9Y A;  2GJ3 A;  1KOU A;  4CLC D;  3BW6 A;  1MC0 A;  2K7S A;  5J4E A;  3NOU C;  3VOL A;  2JHE A;  2VGL M;  4JGP A;  2PD8 A;  2A24 B;  4Q0J A;  2W1R A;  3K3D A;  2FH5 A;  3RFB A;  3U2A A;  1UWP X;  2XRO A;  1LSV A;  3UME A;  3KYZ A;  4G3V A;  1UWN X;  3LYX A;  4Z1W A;  4BBU A;  1TS6 A;  3PR6 A;  4K08 A;  2W0N A;  3VE4 A;  3A0R A;  1OJ5 A;  3ULF A;  5TJJ A;  3EOI A;  3CAX A;  3F1P A;  1DP6 A;  1S1Z A;  3IBR A;  2Y79 A;  1OT6 A;  2D02 A;  3T50 A;  3FC7 A;  1D7E A;  3W2Z A;  3LR5 A;  2LB5 A;  3MXQ A;  2GX5 A;  4II7 A;  4NXG A;  5A8B A;  5IS1 A;  4GS9 B;  4BWI A;  3MFX A;  2VV8 A;  3KSI A;  1LSW A;  3KO6 A;  4EUV A;  2Z6C A;  1DP9 A;  3BWL A;  2WKR A;  5I5L A;  5J3W A;  2YKH A;  4HJ6 A;  3E4Q A;  3E98 A;  3LR0 A;  2O9B A;  4DMZ A;  5FL3 A;  2QYB A;  3GEC A;  3NOT C;  4PKY G;  2QWS A;  4MN5 A;  2KX6 A;  3EWK A;  1XJ2 A;  5AJG A;  4HJ4 A;  3T4L A;  1XFN A;  1LSX A;  1T18 A;  3S7P A;  2JKT M;  4WEJ A;  3T4T A;  4ETZ A;  4NKP A;  4KQD A;  2O99 A;  3FG8 A;  4IUK A;  2H28 A;  3JVV A;  4P6Z S;  4YWZ A;  3LUQ A;  3UB8 A;  4LRX C;  4R38 A;  5F68 A;  4WL9 A;  3CUE C;  4CLC C;  4P6Z M;  2W27 A;  4R3A A;  4EXO A;  1XJ3 A;  2A24 A;  1H8M A;  4O0P A;  3NOP C;  3VV4 A;  5MC7 A;  2IA2 A;  3MMH A;  4FOF A;  1X0O A;  1P9W A;  3C30 A;  4F3L B;  1D06 A;  3CUE A;  4HOI A;  4CLC A;  1YKD A;  5J7E A;  4L9G A;  2V0W A;  3C8C A;  3H82 B;  3UB6 A;  5HPF A;  1G28 A;  5AVF A;  5EFW A;  5F6A A;  4UEY A;  4GLQ A;  4L0L A;  5HL6 A;  3OOV A;  2HF6 A;  3EGX C;  2PR6 A;  3B33 A;  3ZYT A;  3LIF A;  1VB6 A;  2PDR A;  3PBS A;  2OWH A;  2V9A A;  5F69 A;  2YKF A;  4NEE D;  5LBR A;  4B93 A;  2D01 A;  5DKK A;  1TS7 A;  4KUK A;  2VV6 A;  4ETX A;  1NWZ A;  2PR5 A;  3PBO A;  4M4X A;  1P97 A;  3LI9 A;  2QJ5 A;  2VX8 A;  5AVE A;  4LLO B;  1TF1 A;  1N9N A;  3BQA A;  3TRC A;  2M1C A;  4I3J A;  2L4R A;  3F1N B;  4KUO A;  3LIA A;  1DRM A;  3BQ8 A;  3S7Q A;  1TS8 A;  4WUJ A;  5G4Z A;  3HJK A;  4I38 A;  4QPR A;  2VKS A;  3SW1 A;  1Y28 A;  1S4S A;  4R6L A;  2OAP 1;  4BMW A;  2CMN A;  4RQ9 A;  2KOI A;  3KSF A;  4CLC B;  3PBT A;  2PT7 A;  2VV7 A;  4B9O A;  3LR4 A;  4L9E A;  4MN7 A;  2W3E A;  3B42 A;  5F5Y A;  1YSP A;  3ZQ5 A;  4IUH A;  4EEP A;  5CX7 A;  4F3L A;  1YSQ A;  3BY9 A;  2L0W A;  1GSX A;  3KYQ A;  1N9L A;  1UGU A;  2NUT C;  4PHT A;  3H82 A;  2QHK A;  3ICY A;  3B47 A;  3E4P A;  1WA9 A;  4GHI A;  3EGD C;  4YNR A;  5DF9 A;  3UE6 A;  4EU0 A;  3F1O A;  5TBM A;  4LRZ E;  4O8G A;  1F9I A;  2K2N A;  2VEA A;  3MQO A;  2J3T D;  5HPI A;  2PD7 A;  2KLI A;  4HIA A;  3CLO A;  2QJ7 A;  3O5Y A;  1XFQ A;  4MN6 A;  4XT2 B;  4KQO A;  4JGO A;  1F98 A;  2FZ0 A;  2EWV A;  2XA7 S;  3NJA A;  3R4K A;  3E0Y A;  1IOU A;  4G3W A;  3BY8 A;  3IBJ A;  5IU1 A;  2JKR I;  4OOM A;  4I39 A;  2XA7 M;  4BBT A;  3F1N A;  2VZW A;  2W1T A;  2GZA A;  3EEA A;  5HZH A;  4MDZ A;  3H7W B;  3T4J A;  5HD3 A;  4EET B;  1OJG A;  3IS2 B;  1T1A A;  2INW A;  4WEK A;  2B18 A;  3MQ0 A;  3UE3 A;  5HDC A;  2XSS A;  5DJT A;  1ZTU A;  2HGV A;  3CWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...