1FCNA

Crystal structure of the e. coli ampc beta-lactamase mutant q120l/y150e covalently acylated with the substrate beta-lactam loracarbef
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
358
structure length
352
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLLVPDEVKSSSDLLRFYQNWQPAWAPGTQRLEANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE
publication title Crystal Structures of Substrate and Inhibitor Complexes with AmpC -Lactamase: Possible Implications for Substrate-Assisted Catalysis
pubmed doi rcsb
source organism Escherichia coli
total genus 102
structure length 352
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1fcnA00
4WYYA 4KZAA 3OCLA 5GLDA 1IYOA 4KQQA 4NK3A 3GTCA 4EBLA 1GHPA 2VGJA 2WYXA 3VFFA 1KVMA 5BOHA 2A49A 1K56A 2HP5A 2P9VA 4OPRA 3N8SA 4OKPA 3SS3A 1KGGA 3BFFA 4OOLA 3BFGA 5DF8A 1IYPA 4DDSA 4L0LA 4KZ9A 4S2JA 3LCEA 5HAPA 3UO9A 5J8XA 4JBFA 2EX9A 4WZ5A 4MEZA 4B88A 1G6AA 1YT4A 4GD6A 1BSGA 1L0DA 4GOGA 1EWZA 4Y7PA 4OLDA 5GHXA 4WMCA 4KZ5A 5DF7A 4OP8A 4N9LA 2V2FF 4FD8A 3ZGAB 3G31A 4DE2A 3PBQA 5HW3A 2ZLYA 1CEFA 3BFDA 1FSYA 5F1FA 3OPLA 4WZ4A 4RX2A 3OC2A 1SDNA 3M2JA 4MBKA 2XK1A 4QHCA 5CERA 1NZUA 2R9WA 2WGVA 4JXWA 4QY5A 1LI0A 1RCJA 4OOYA 2E8IA 5TFQA 1MPLA 3G30A 4E3MA 4JXVA 4QD4A 3FYZA 4S2KA 4KZ4A 5EVID 3G2YA 3PBTA 3ZVTA 1KVLA 4U0TA 3IF6C 3AGDA 3HLDA 3HLBA 1CI9A 4RX3A 1XA1A 4OQHA 4PM9A 5TGFA 2WAEA 5CTNA 5FQ9A 4OLGA 5DF9A 1CK3A 4E3LA 3VP3A 4C75A 3MZDA 1CEGA 5EOOA 3TSGA 4RYEA 3VP2A 1YQSA 2Q9NA 1HVBA 1K55A 2HDRA 5FASA 1FOFA 1IYSA 1M40A 2UWXA 5GHYA 1RP5A 3NDEA 2ZQ7A 4OOMA 3HL9A 1FCNA 1PYYA 3IF6B 3ZG8B 1XKZA 5E43A 3Q81A 1ES3A 1G68A 4BQMA 1JWZA 4B4ZA 2IWDA 4JXGA 5EOEA 1VM1A 3WS1A 2RCXA 1MXOA 4XUZA 4IVIA 3V3RA 3UDXA 4E3NA 5DVAA 1IYQA 1MWUA 1QMEA 3MXRA 3N4IA 3G34A 3WS0A 4DE0A 1ESUA 4E3KA 3SS5A 3A3FA 1Q2PA 2XF3A 4UA9A 1YLZA 3I7JA 2OLUA 3ZCZA 4QY6A 2EXAA 1YMSA 5AQBA 3IF6A 1YM1A 4EBPA 4E3OA 2JE5A 2WZXA 3AGFA 4R3BA 3AGEA 1Q2QA 4KG5A 3WS4A 1BT5A 3ITBA 4BL2A 3PAEA 3IXHA 4LV1A 4BENA 2WADA 4DE3A 3PBSA 1H5XA 1I2SA 3IT9A 1HZOA 3W4OA 2DRWA 4LENA 3ZG5A 3IF5A 5FAPA 3BEBA 4DXBA 4JF6A 2QPNA 5EVLA 4EQIA 4OH0A 2PBYA 2Y2KA 1E3UA 1NYMA 4Y0TA 4BD0A 4RA7A 4BJPA 3ZDJA 4K0WA 5F83A 1JWVA 3QNCA 4WEKA 3WS2A 4BLMA 3VP4A 3MFDA 3SH9A 3FV7A 3TOIA 2WGWA 2Y2MA 3S22A 3RXWA 3NI9A 3N6IA 5CHUA 3IXGA 2Y2OA 3GMWA 2XR0A 3HBRA 3CZDA 3E2LA 5G18A 2B5RA 2Y2NA 5CHJA 2GDNA 3ZHHA 3Q7VB 1BLPA 4X53A 3BFEA 1ZKJA 4EBNA 1LL9A 3OZHA 5IHVA 3SH7A 4EV4A 2HDUA 1ZG4A 5GLCA 1RGYA 1IKGA 4FH2A 4FSFA 2XDMA 3DTMA 5HAIA 3B3XA 1O7EA 3IHBA 1YLJA 4UA7A 1S6RA 2ZMAA 3N8LA 3VP1A 4KZBA 1FR1A 2ZQ9A 3CG5A 4DF6A 4X6TA 4QB8A 5A93A 1XX2A 4E6XA 4UAAA 4KZ8A 4UA6A 4OQIA 4CPKA 3VFHA 1PWGA 1PZPA 3HVFA 2G2WA 4IBXA 3N7WA 3QHYA 4S2LA 2J8YA 3WWXA 3Q7VA 4WEJA 4ID4A 4UHUA 2Y55A 2HDQA 1ONHA 2HP9A 5FSRA 4GN2A 2Y4AA 5CEDA 4P87A 3HLFA 2G2UA 5M19A 3UE1A 3ZVWA 3DWZA 4KQOA 3OPHA 5E2GA 1W5DA 1KGEA 3IH8A 3NBLA 1MWSA 3BFCA 5FAOA 2ZC3B 4B4XA 2X71A 5CTMA 1KE4A 1PI5A 2R9XA 1N9BA 3EQUA 3IQAA 3M6HA 4XXRA 2WKHA 3MXSA 4GZBA 1VQQA 4P85A 5E2HA 5HARA 1K6RA 1BLHA 1NXYA 1EI5A 2DNSA 4R23A 2ZC6B 3V39A 3PBNA 3G2ZA 3ZG0A 2OV5A 1ERQA 1HTZA 4WM9A 1SKFA 3NC8A 3Q07A 3Q7ZA 3HUMA 4NETA 1JTDA 3UY6A 2H0YA 3FKWA 2J9OA 1W7FA 2ZD8A 4FCFA 4QU3A 3LO7A 2QMIA 4PM6A 3SOIA 3UDIA 3PBRA 2XQZA 1JWPA 1W8YA 2ZQ8A 4OVDA 1TVFA 4MLLA 3A3DA 2V20A 1ONGA 3OPPA 3G4PA 4HBUA 4OPYA 3VMAA 1I5QA 4KQRA 1J9MA 1MWTA 1IELA 4K91A 4WBGA 2WK0A 1JVJA 3O87A 3P09A 4Z9QA 3C5AA 4JLFA 4HEFA 3MKEA 2HDSA 4S2NC 5A91A 1L0GA 2HPBA 1ZG6A 3RXXA 1FSWA 4E6WA 4GDNA 1KDWA 3RJUA 5KSCA 4F94A 4K0XA 3MKFA 1H8ZA 2ZQDA 2I72A 3WRZA 1DJCA 1PW1A 5CXWA 1FCMA 5EECA 1PIOA 4PM7A 1ES2A 1ES4A 2PU4A 4ZBEA 3G32A 4KZ6A 1K38A 3W4PA 2WGIA 1ERMA 3ZNYA 2EX8A 3IXDA 4GB7A 4PMAA 1SCWA 4S2MA 4YINA 5FQQA 5EVIC 1FR6A 4X55A 1K56D 2Y2PA 1W8QA 4N9KA 5FI6A 3O3VA 5FDHA 4DRTA 2QZ6A 2A3UA 2J7VA 3S4XA 3NDGA 3M6BA 3A3JA 1U60A 3DW0A 4KZ3A 4R4RA 4KZ7A 5M1AA 3ITAA 3IWIA 3UPPA 3C7VA 4HBTA 3HLWA 1E4DA 5F1GA 4EWFA 3GSGA 1WE4A 2ZC4B 3LEZA 4S2NA 1KE3A 4MNRA 5EVIB 3VOYA 3ZNTA 2XFTA 1NRFA 5U47A 4WMCD 1QMFA 3P98A 3UNWA 2WKEA 2X01A 1TDGA 5DTKA 1GHMA 4X68A 5AQ7A 4ZJ1A 3W4QA 1XA7A 4DDYA 3UDFA 5CGWA 4DE1A 1BUEA 1S0WA 3OCNA 3PBOA 3LY4A 2EFUA 4U0XA 5TR7A 3BECA 2PU2A 2IWCA 2ZQCA 2EFXA 1H8YA 2H0TA 3FKVA 1MWRA 5DTTA 1IEMA 3CMZA 3GRJA 3V50A 4S2OA 2EX2A 4R3JA 2XLNA 5EVIA 5HAQA 2FFFB 3E2KA 1IKIA 2OSUA 5KMWA 3IXBA 1CI8A 1PZOA 1BLCA 1KE0A 3EQVA 2Y2LA 4Y0OA 1L0FA 3NY4A 4OPQA 2BLSA 4WZ5C 4R0QA 3ZG7B 2FFYA 4BL3A 4E3IA 3V3SA 5GHZA 2P9VB 2H5SA 4OQGA 5EE8A 4GD8A 1ALQA 1LI9A 3GVBA 3IH9A 4PM5A 1Z6FA 5A92A 4JF4A 2DCFA 5FQKA 1YMXA 1Y54A 1KDSA 2XD1A 2Y2HA 4MBFA 2XD5A 1M6KA 3V5MA 2WKIA 3UE3A 3PAGA 1E25A 1MY8A 4HESA 3OPRA 2ZJ9A 3SH8A 1GA9A 3WRTA 4KG2A 4N1HA 1K6SA 4P0MA 3HLGA 5GL9A 5FQJA 2P74A 3JYIA 5A90A 4EUZA 5CHMA 1AXBA 2JBFA 4JXSA 5CGXA 4P6BA 1BULA 2VGKA 1N4OA 4ZJ3A 1NYYA 4ZJ2A 1KGFA 1BTLA 5CGSA 1GHIA 1LLBA 1W79A 3IWQA 4ZDXA 1K55C 1YLPA 3NCKA 1K57C 3MZEA 3NIAA 3QNBA 1XPBA 1FCOA 4PPRA 3ZG9B 1PWCA 4GDBA 3N8RA 2RL3A 1E3UD 1I2WA 5AQAA 1L2SA 4PM8A 4O7DA 1DY6A 4U3TA 4YFMA 3GQZA 1K25A 1PWDA 2Y2GA 1YLWA 4Y0UA 1SDEA 3C4PA 3A3IA 3S1YA 2OLVA 1XGIA 2JC7A 2ZQAA 1SHVA 3C4OA 4S2PA 3IHAA 4BD1A 2XEPA 3UPOA 3PTEA 4LV3A 2Z2MB 4QJGA 3DWKA 3M2KA 4M3KA 1GCEA 2ZC7A 1O07A 2Y2JA 3ISGA 5F82A 2ZM2A 3VSLA 2X02A 1EROA 3HUOA 1FQGA 2C6WB 1LL5A 1XGJA 2WAFA 4A5RA 3D4FA 1XXMA 3SS4A 2ZC5B 5I94A 3BLMA 1ES5A 5JYOA 1LHYA 3MBZA 5CRFA 2CC1A 4ZTKA 5FA7A 1ZC2A 5E2EA 1K57A 3FWLA 2XH9A 1NZOA 1K54C 2Y59A 4OONA 3VP0A 4LV0A 5L2FA 1MBLA 2WUQA 4C6YA 2WZZA 3HLCA 3Q82A 5GLAA 5FQIA 3HUNA 2ZM0A 4IVKA 4KENB 5CECA 5E2FA 2XGNA 3O86A 5AQ9A 4JPMA 4FH4A 4IEDA 1OMEA 3UN7A 1GA0A 3FZCA 4N92A 4OPZA 1PW8A 4LCMA 4WELA 3VSKA 2J9PA 1BZAA 4XUXA 5KZHA 5FI7A 3G35A 3HREA 4H8RA 5HFOA 4LV2A 3VOZA 3C7UA 2Y91A 4GKUA 1ESIA 1YLTA 2H10A 5EUAA 4R4SA 2WGWB 4GNUA 3W8KA 4RVAA 2C5WB 2ZM8A 1K4EA 3BLSA 5HX9A 5M18A 5FATA 2Y2QA 2JCHA 1HD8A 1YLYA 4IBRA 4E3JA 4MBHA 1DJAA 5FAQA 1PI4A 4JKTA 1WYBA 4DKIA 4X56A 1JTGA 5DTSA 3WS5A 2Q9MA 4N1XA 4KG6A 4X69A 5FI2A 5EPHA 3BYDA 4C3QA 4CJNA 1C3BA 1K54A 1L0EA 2XFSA 3IWOA 4D2OA 1NY0A 3Q1FA 1BLSA 2EXBA 4S2IA 3TG9A 5KSHA 3UE0A 3UPNA 1RGZA 3ZFZA 3GR2A 1NJ4A 3BRMA 4JF5A 3BM6A 4LCLA 3MZFA 1DJBA 2IWBA 5D3OA 3CJMA 4R1GA 3HLEA 2Z2LB 5FQMA 1TDLA 1MKIA 2EX6A 3LY3A 5GLBA 4DXCA 4Q8IA 5CEBA 1XP4A 4ZAMA 5HL1A 2BG1A 1K4FA 3A3EA 3O88A 4OP5A 2V1ZA 4OQ0A 2Y2IA 5JYPA 2HP6A 3GV9A 1WYCA 1TEMA
chains in the Genus database with same CATH superfamily
1IYOA 4KQQA 4NK3A 1UWNX 2A49A 2HP5A 2P9VA 4OPRA 3BFFA 2JKTM 1IYPA 4FTXA 4DDSA 4S2JA 5HAPA 3UO9A 5J8XA 1W63Q 1D06A 4MEZA 1G6AA 1YT4A 4Y7PA 5AVFA 5GHXA 4KZ5A 4DE2A 3G31A 3PBQA 2ZLYA 3HCYA 1CEFA 3D3OA 5TBMA 3OPLA 5AJGA 4MBKA 4QHCA 5EM0A 2WGVA 3NECA 1RCJA 4EEPA 3G30A 4QD4A 5EVID 1ODVA 3DTIA 3ZVTA 2GZAA 3IF6C 3HLDA 1CQAA 1CI9A 4PM9A 3BWLA 1G6OA 1CK3A 4E3LA 2O9AA 3IX8A 1GSWA 4R38A 1RP5A 4EERA 2ZQ7A 3HL9A 3IF6B 1XKZA 1G68A 5J3WA 3C30A 5EOEA 2RCXA 5DVAA 1MWUA 1QMEA 1T19A 2ZL1B 3G34A 4L9EA 1ESUA 3NULA 2XF3A 4UA9A 5AQBA 4EBPA 2WZXA 3AGFA 3WS4A 4R3BA 2W3GA 4M4XA 3V67A 5K5BA 3PAEA 4LV1A 1H5XA 3IT9A 2DRWA 4DXBA 2QPNA 4OH0A 1E3UA 1NYMA 4RA7A 3ZDJA 3QNCA 3WS2A 3VP4A 3MFDA 2Y2MA 3LICA 4LGWA 3S22A 5CHUA 2M1CA 3IXGA 2Y2OA 2XR0A 3T50A 5G18A 1LSWA 2JKGA 1LL9A 1DRMA 2HDUA 3VP1A 4EETB 4YOFA 2J80A 4IUHA 5HDSA 2B02A 1PWGA 2EWWA 5J7EA 2G2WA 3Q7VA 3CPTB 2HP9A 1OTIA 3HLFA 3DWZA 4GHIB 4EXOA 3C38A 3NBLA 1MWSA 5HSQA 4B4XA 2VEAA 2X71A 5CTMA 5IU1A 5HARA 3MXSA 1K6RA 1NXYA 4UQIM 5DJUA 3V39A 3G2ZA 1LSXA 2G7UA 1SKFA 3HUMA 4P6ZM 3T4SA 1H8MA 4QU3A 3FPVA 2QMIA 2XQZA 1JWPA 1TVFA 1X0OA 3G4PA 3EGDC 4WBGA 2EWVA 3O87A 3BY8A 2HDSA 3MKEA 5HDCA 1A0KA 4F94A 4K0XA 5HZHA 1H8ZA 3LIDA 2L0WA 3UB6A 1S4SA 2W3DA 3KX0X 5CXWA 1FCMA 4PM7A 4KZ6A 3W4PA 2EX8A 4GB7A 4S2MA 1K56D 5FI6A 3O3VA 4DRTA 2A3UA 3DW0A 4R4RA 3JPUA 1TS0A 4I39A 3C7VA 4HBTA 3LEQA 1E4DA 3CWFA 5F1GA 4WN5A 1WE4A 2ZC4B 4S2NA 3VOYA 2L4RA 3K2NA 2PDRA 3P98A 3UNWA 2JHEA 1TDGA 5DTKA 2MJ6A 3UDFA 3T4QA 5CGWA 1BUEA 2O0YA 3LY4A 1T1CA 2EFUA 4X1LA 4BWIA 3BECA 4R3JA 2XLNA 2OSUA 3T1XA 2PR6A 1BLCA 3EQVA 4NXBA 2Y2LA 4O8GA 3NY4A 5EVEA 1DP8A 4WZ5C 5J4EA 3ZG7B 2FFYA 4BL3A 5GHZA 4OQGA 5HPFA 4GD8A 4PM5A 3IH9A 3LI8A 1VETB 5A92A 1CJFA 3S7NA 2XD1A 3V5MA 2WKIA 5L07A 3WRTA 1S66L 2P74A 2JBFA 4JXSA 4CLCA 3NOPC 2VGKA 1F2KA 1KGFA 3QP2A 5CGSA 4HHDA 1K55C 1NRJA 2XA7M 2Y2GA 1YLWA 1VEUB 2WKRA 2OLVA 1SHVA 3E4PA 3S7OA 2XEPA 4LV3A 3DWKA 3M2KA 4KUKA 2Y2JA 4MDZA 3T4KA 2HJEA 2P08A 2OAQ1 3HUOA 2C6WB 2WAFA 1G5UA 3SS4A 5JYOA 1ES5A 1K0KA 4JGQA 3KSHA 3MSHA 4ZTKA 1ZC2A 5HL6A 1K57A 2XH9A 1NZOA 2W1RA 4LV0A 2WUQA 4G3WA 3PR6A 1UWPX 3HUNA 4IVKA 5CECA 1OJGA 2HGVA 3E0YA 3O86A 5DFYA 4KUOA 4IEDA 1OMEA 1GA0A 4Y5FA 4LRXC 4LCMA 2J9PA 2HV1A 5HFOA 3VOZA 3C7UA 2H10A 2VV6A 2C5WB 2FH5A 1HD8A 4E3JA 2Y8HA 4DJ2A 1DJAA 2W3EA 1WYBA 1JTGA 1J3WA 4KG6A 2JKRM 4X69A 4CJNA 3HJIA 3K3DA 1K54A 4G3VA 3Q1FA 3IS2A 1BLSA 3UE0A 4R70A 3BRMA 4JF5A 4MCWA 4LCLA 3MZFA 3KSIA 2VK3A 4R1GA 4FUWA 5FQMA 3A3EA 3O88A 4ARZA 3PBNA 4WYYA 3GTCA 4UQIS 3VFFA 5TBMB 3N8SA 4OKPA 1KGGA 3JVUA 1NLYA 4P6ZS 3BFGA 2ZOHA 1V9ZA 4L0LA 4KZ9A 2OOLA 3MQQA 4WZ5A 4B88A 2ACGA 1L0DA 3MJQA 1EWZA 4N9LA 2V2FF 4FD8A 1FSYA 5F1FA 4I3AA 3LR4A 1NZUA 4QY5A 1KOUA 4JXWA 3UB5P 5TFQA 3FPWA 4E3MA 4S2KA 2A2LA 1KVLA 1XA1A 2QJ5A 5TGFA 4JGPA 5FQ9A 2HZ5A 4LPZA 3VP3A 4C75A 1CEGA 5EOOA 3S7PA 3TSGA 5IS1A 1YQSA 3L9KA 1K55A 2HDRA 2PAVP 1FOFA 1M40A 4PKYA 2UWXA 5GHYA 4PAUA 2XRNA 5KIZA 3ZG8B 5E43A 2CMNA 3QP6A 4BQMA 2IWDA 4JXGA 1VM1A 4EUVA 1MXOA 4IVIA 1LSVA 3V3RA 3UDXA 4E3NA 1IYQA 4DE0A 2W3HA 1YLZA 3I7JA 4QY6A 3BQ8A 3AGEA 4WL9A 2M7VA 4BL2A 4DE3A 2W0NA 1HZOA 4LENA 3KO6A 4JF6A 4NXFA 5EVLA 2Y2KA 2YKHA 5EV0A 4NG2A 4BJPA 1JWVA 3TOIA 5L8MA 3GMWA 3HBRA 3VE3A 5FL3A 5CHJA 2GDNA 4R6LA 3UB7A 3Q7VB 4X53A 3BFEA 3OZHA 1ZG4A 4FH2A 3D9YA 1YLJA 1S6RA 4KZBA 1FR1A 1XX2A 1CF0A 4E6XA 1XFQA 4WF0A 3VFHA 2O9BA 3QHYA 4S2LA 2Y55A 2HDQA 5FSRA 2PR5A 2G2UA 5M19A 3OPHA 1W5DA 1H0MA 2ZC3B 1KE4A 1PI5A 3QP4A 4XXRA 3IQAA 2WKHA 4GZBA 1Z09A 3P01A 4HJ3A 4H6JA 2OV5A 1ERQA 3JVVA 3NC8A 3Q07A 3UY6A 4NETA 3FKWA 4ETZA 4FCFA 3LO7A 3PBRA 2OWHA 3T4OA 3A3DA 3MFXA 5HD3A 2VGLS 3CHWP 1J9MA 1YKDA 2WK0A 3P09A 4Z9QA 2WKPA 4S2NC 4HEFA 5A91A 3RXXA 1FSWA 4E6WA 3F1NA 3MKFA 1DP9A 3A0VA 3E4OA 3U2AA 1DJCA 4YNRA 5HDDA 1PIOA 3G32A 1K38A 4BBTA 1MZUA 1ERMA 2JKTI 3IXDA 4HI4A 3LIFA 4PHTA 1FIKA 2J7VA 3S4XA 2AVXA 3A3JA 1U60A 3CUEA 3IWIA 1ZHHB 4HQAA 1KE3A 4MNRA 2WKEA 2X01A 4D60A 5AVEA 4BBUA 5AQ7A 3GECA 5EFWA 2K7SA 1EW0A 4X25A 3W2ZA 1W63M 2EFXA 4Q0HA 4F3LA 4CLCC 4S2OA 2PT7A 5HAQA 2FFFB 3E2KA 5KMWA 3IXBA 2NUPC 2ZBBA 2Y79A 3O5YA 2BLSA 2OAP1 3H9WA 4E3IA 4CLCB 3PXPA 4WLAA 1MKMA 1LI9A 1Y54A 1KDSA 3PAGA 1E25A 5MC7A 4L9FA 4HESA 2ZMFA 3OPRA 5FQJA 3JYIA 3R4KA 4UEYA 5F6AA 2WKQA 1BULA 4ZJ3A 3CITA 3G6OA 4ZJ2A 1GHIA 1LLBA 4ZDXA 1YLPA 3NCKA 1K57C 2HF6A 2VZWA 1XPBA 3N8RA 1E3UD 2Z6CA 4PM8A 4O7DA 1DY6A 3B47A 3KYEA 3EWKA 1SDEA 3C4PA 2PD8A 2JC7A 3A0RA 4BD1A 3UPOA 4JGRA 1GCEA 2ZC7A 1O07A 4M3KA 4Q0JA 2X02A 1EROA 4WUJA 1XGJA 3KSFA 3D4FA 5I94A 3LI9A 3MBZA 4I38A 5CRFA 5FA7A 3FWLA 1K54C 5L2FA 4HOIA 2WZZA 3C8CA 4YWZA 3UB8A 2VLGA 5FQIA 3S7QA 2UV0E 3FZCA 4N92A 1PW8A 3VSKA 2W1TA 4XUXA 5CX7A 4H8RA 5FI7A 1OTBA 4LV2A 2Y91A 3IS2B 4GKUA 2A24A 4R4SA 2WGWB 2J3TC 3W8KA 2BTFP 3BLSA 5HX9A 5FEFA 4AFIA 5FAQA 2J3WA 4JKTA 4DKIA 5DTSA 2LB9A 3KSGA 4N1XA 2K31A 5FI2A 4C3QA 3BYDA 4ARZB 1L0EA 1SKOA 3IWOA 3UE6A 1NY0A 3TG9A 4GS9A 1SZVA 3BM6A 2Z6DA 4G3KA 2E8JA 4CQHA 4DXCA 2EX6A 1VHMA 1K4FA 1STZA 4OP5A 2V1ZA 2Y2IA 5DKLA 1TEMA 1OT9A 3R7WB 4KZAA 3MS6A 5GLDA 3F1PB 1H3QA 4EBLA 1GHPA 2VGJA 2WYXA 5BOHA 5FDSA 2H28A 2XSSA 3BW6A 4OOLA 2VA0A 1T1AA 4LLOB 4JBFA 4GOGA 3LIEA 3LGOA 4WMCA 3TRCA 5DF7A 4OP8A 2V8CA 3ZGAB 3BY9A 4WZ4A 5IT5A 3M2JA 1LT0A 4E04A 5CERA 5HWVA 2R9WA 5F68A 1LI0A 1MPLA 5DKKA 3FYZA 4KZ4A 3ZYTA 3PBTA 4EEUA 4U0TA 4Y2FA 5CTNA 3MZDA 3VP2A 1XFNA 3LYXA 4ESPA 1XJ6A 2Q9NA 4Q0IA 1HVBA 5FASA 1PYYA 1ES3A 4DJ3A 4B4ZA 3WS1A 4CLCE 3MXRA 3WS0A 4ETXA 4CLCD 2D02A 4E3KA 3SS5A 3A3FA 2OLUA 1YMSA 1YM1A 2JE5A 1BT5A 3ITBA 3IXHA 4HNBA 3PBSA 1I2SA 3L7HA 2V9AA 3W4OA 3QP1A 3IF5A 3BEBA 2PBYA 4Y0TA 5F83A 4BLMA 2WGWA 1P9WA 3CZDA 2ZOIA 2Y2NA 3ZHHA 4EBNA 4EV4A 3SH7A 5GLCA 1IKGA 2XDMA 3DTMA 4HH3A 1O7EA 4UA7A 2ZMAA 2ZQ9A 3H82A 3F1OB 4DF6A 4UAAA 3B42A 4UA6A 4OQIA 4H6JB 1N9OA 4IBXA 2J8YA 4WEJA 4UHUA 1ONHA 2Q0OA 2Y4AA 1Y4OA 1N9LA 2M7UA 3UE1A 4KQOA 1TS7A 3T1QB 3R7WA 2R9XA 3F1PA 3EQUA 2W3FA 3M6HA 5E2HA 1BLHA 2DNSA 2B18A 3RFBA 3OOVA 3ZG0A 1HTZA 4WM9A 3F1NB 4MN5A 2H0YA 3TW8A 1W7FA 3UDIA 4PM6A 3SOIA 1YSQA 2ZQ8A 4MLLA 4XT2B 4EU0A 1TF1A 4HBUA 3VMAA 3CUEC 1MWTA 3DTEA 4HY8A 2HPBA 4GDNA 3RJUA 4QPRA 2ZQDA 3LUQA 2I72A 3LR0A 1TD5A 2V0WA 3H7WB 2J3TD 4GJ4A 5EECA 1ES2A 2D01A 4IUKA 2WGIA 2W27A 5FQQA 4PMAA 1YSPA 1YAXA 2Y2PA 4ME4A 4N9KA 3T12B 5FDHA 5G4ZA 4Y13A 3UMEA 4KZ3A 5M1AA 1ACFA 4F3LB 5A8BA 4EWFA 1P97A 3GSGA 3LEZA 1NRFA 5U47A 1QMFA 2NUTC 1GHMA 3W4QA 1XA7A 4DDYA 3OCNA 3PBOA 3QP5A 4EQ1A 5TR7A 2PU2A 3T4LA 2IWCA 2ZQCA 1H8YA 2H0TA 2PYPA 1MWRA 2VJWA 5LBRA 1IEMA 3CMZA 4EW7A 3V50A 5EVIA 1IKIA 1CI8A 4Y0OA 1L0FA 1YPRA 2QKPA 4OPQA 1AWIA 2LB5A 3RH8B 1DP6A 2H5SA 4Y3IA 2QWSA 3FG8A 1ALQA 2O99A 3GVBA 1NLZA 1Z6FA 4JF4A 3ULFA 1YMXA 4RQ9A 3UE3A 2GJ3A 2ZJ9A 3SH8A 4KG2A 4N1HA 4P0MA 2XA7S 3F1OA 5A90A 2QYBA 4EUZA 1AXBA 3MQOA 1S67L 2HJ9C 1N4OA 1W79A 3IWQA 3MZEA 1PWCA 1L3LA 2RL3A 3VV4A 1K25A 1PWDA 2PBDP 4HJ4A 3PHYA 3QP8A 1F98A 2GNXA 2QHKA 3IHAA 4S2PA 4BMWA 3PTEA 4QJGA 3ISGA 3DAVA 4XT2A 3DTKA 3IX4A 1BYWA 1FQGA 4A5RA 3ICYA 1XXMA 1Y28A 2ZC5B 3BLMA 2W1TB 4Y17A 1IOUA 1D1JA 2A24B 5E2EA 3VP0A 4OONA 4LRZE 3HLCA 3Q82A 3D72A 2ZM0A 3H7WA 4KENB 5E2FA 2FZ0A 2XGNA 1PRQA 4JPMA 3UN7A 1D7EA 3LIBA 4KQDA 4O0PA 4WELA 5KZHA 3G35A 3HREA 1SKOB 2V1AA 1ESIA 1YLTA 2KOIA 2L1MA 4RVAA 2ZM8A 1GSVA 4GS9B 1K4EA 5FATA 2JCHA 1YLYA 4IBRA 2JN7A 4MBHA 3DBAA 1UGUA 4X56A 4B93A 3NOUC 2Q9MA 1C3BA 2XFSA 4D2OA 4S2IA 5KSHA 3VOLA 3ZFZA 1NJ4A 1DJBA 2IWBA 3A0SA 1IFQA 4MN7A 2Z2LB 1S1YA 3LY3A 4Q8IA 5GLBA 3U4LP 1XP4A 4EESA 2B95A 5JYPA 3GV9A 1XJ4A 3EOIA 3OCLA 4I3JA 1F5MA 3B33A 1KVMA 1K56A 3SS3A 4O01A 5DF8A 4GCZA 5HWWA 3LCEA 1V9YA 2EX9A 4GD6A 1BSGA 3P7NA 4OLDA 5HW3A 3BFDA 3UB9A 2PD7A 5F69A 4RX2A 3OC2A 1SDNA 2XK1A 4Z1WA 4OOYA 2E8IA 4JXVA 3G2YA 3LR3A 4I5SA 3AGDA 3HLBA 4RX3A 4OQHA 2WAEA 2K2NA 4OLGA 5DF9A 2XROA 4RYEA 4BBVA 3K3CA 3NOTC 1IYSA 1OTDA 3MQ0A 3NDEA 4OOMA 1FCNA 5C5KA 3Q81A 4HJ6A 3ZQ5A 1JWZA 4DMZA 4Y15A 4XUZA 3T4JA 4HP9A 1XJ2A 3IBRA 3UMDA 3N4IA 3E4QA 1Q2PA 2KLIA 3ZCZA 2EXAA 1OTAA 3IF6A 4E3OA 3MXQA 1Q2QA 4KG5A 2KDKA 4BENA 2WADA 3EGXC 3GDIA 3ZG5A 5L09A 5FAPA 4IJGA 4EQIA 4BD0A 2ZL1A 4K0WA 4R3AA 4WEKA 3C2WA 3SH9A 3FV7A 3EEAA 3H82B 3RXWA 4NXGA 3NI9A 2PRFA 3N6IA 3E2LA 2B5RA 3SW1A 1BLPA 1ZKJA 2EA9A 5IHVA 3SZTA 1RGYA 4FSFA 5HAIA 3B3XA 3IHBA 2BASA 2V0UA 3N8LA 3MMHA 3CG5A 4X6TA 4QB8A 5A93A 3PYPA 4KZ8A 4CPKA 1PZPA 3HVFA 3N7WA 3WWXA 4ID4A 4GN2A 1XJ3A 2VV7A 5CEDA 4P87A 4LRYC 3BQAA 4HH2A 3ZVWA 2PYRA 5E2GA 3IH8A 1KGEA 3BFCA 5FAOA 2ZMVA 3NHQA 4HP4A 3E98A 1N9BA 4P85A 1VQQA 2I9VA 4HIAA 1EI5A 4R23A 2ZC6B 3KYZA 2IA2A 5DJTA 3T4TA 3Q7ZA 1JTDA 2J9OA 2ZD8A 3CPTA 4GHIA 1W8YA 4MN6A 4OVDA 2V20A 1ONGA 3OPPA 4OPYA 1I5QA 1TS8A 4KQRA 1HLUP 1G28A 4K91A 1IELA 3IBJA 1JVJA 3C5AA 4JLFA 2O9CA 1L0GA 4X1MA 1ZG6A 1KDWA 4JGOA 5KSCA 3IX3A 1PNEA 5DFXA 3WRZA 4GW9A 2YKFA 4K08A 1PW1A 1ES4A 2PU4A 4ZBEA 4GLQA 3TE8A 2VGLM 3ZNYA 4YINA 1SCWA 4II7A 5EVIC 1FR6A 4X55A 1W8QA 2QZ6A 2JKFA 3NDGA 2INWA 3M6BA 4KZ7A 3ITAA 3UPPA 3HLWA 2OWJA 5EVIB 3ZNTA 2XFTA 4WMCD 1OTEA 4X68A 4ZJ1A 1S4RA 1VB6A 4MMNA 4DE1A 3OBFA 1S0WA 4U0XA 1T18A 3BJNA 3FKVA 3RTYA 3CI6A 2VKSA 5DTTA 3GRJA 3OLOA 2EX2A 1GSXA 4NEED 5HPIA 1N9NA 1PZOA 4B9OA 1KE0A 1OPXA 4R0QA 1T1BA 5HWTA 3V3SA 2P9VB 5EE8A 1MC0A 5FEGA 4NKPA 3CLOA 1FILA 3VE4A 2DCFA 5FQKA 2Y2HA 4MBFA 2XD5A 1M6KA 1MY8A 1TS6A 1GA9A 1WA9A 1K6SA 5GL9A 3HLGA 1ZTUA 3T1SA 3CAXA 1P9RA 5CHMA 5CGXA 4P6BA 1S1ZA 1OT6A 2GX5A 2JKRI 1VETA 5L10A 1NYYA 5F5YA 3NJAA 1BTLA 3QNBA 3NIAA 4PPRA 1FCOA 3ZG9B 4GDBA 1I2WA 3KYQA 5AQAA 1L2SA 4U3TA 4YFMA 3GQZA 2V1BA 1PFLA 4Y0UA 5HD5A 3A3IA 3S1YA 1XGIA 2ZQAA 3C4OA 3TJZC 4L9GA 4QWOA 2VX8A 2P04A 2Z2MB 5TJJA 5F82A 1F9IA 2ZM2A 3VSLA 4I3IA 2P7JA 1LL5A 1LHYA 3MF0A 1VEUA 2CC1A 5I5LA 5EM1A 2Y59A 1OJ5A 3LIAA 1MBLA 2VV8A 4C6YA 5GLAA 2QJ7A 4IHQA 1JNUA 4LFUA 3FC7A 5AQ9A 4FH4A 3T1RA 2R78A 4OPZA 3LFVA 1NWZA 1BZAA 3MR0A 2PHYA 5EUAA 4GNUA 4DN0A 5M18A 2Y2QA 1PI4A 3HJKA 3WS5A 3EEHA 4FOFA 4NXEA 3LR5A 5EPHA 2V8FA 2DMWA 2EXBA 1LL8A 2KX6A 3UPNA 1RGZA 3GR2A 5G4YA 5D3OA 1P0ZA 3CJMA 4PKYG 3HLEA 1TDLA 1MKIA 5CEBA 4ZAMA 5HL1A 2BG1A 4ZRRA 4OQ0A 2HP6A 1WYCA
chains in the Genus database with same CATH topology
4WYYA 4KZAA 3OCLA 5GLDA 1IYOA 4KQQA 4NK3A 3GTCA 4EBLA 1GHPA 2VGJA 2WYXA 3VFFA 1KVMA 5BOHA 2A49A 1K56A 2HP5A 2P9VA 4OPRA 3N8SA 4OKPA 3SS3A 1KGGA 3BFFA 4OOLA 3BFGA 5DF8A 1IYPA 4DDSA 4L0LA 4KZ9A 4S2JA 3LCEA 5HAPA 3UO9A 5J8XA 4JBFA 2EX9A 4WZ5A 4MEZA 4B88A 1G6AA 1YT4A 4GD6A 1BSGA 1L0DA 4GOGA 1EWZA 4Y7PA 4OLDA 5GHXA 4WMCA 4KZ5A 5DF7A 4OP8A 4N9LA 2V2FF 4FD8A 3ZGAB 3G31A 4DE2A 3PBQA 5HW3A 2ZLYA 1CEFA 3BFDA 1FSYA 5F1FA 3OPLA 4WZ4A 4RX2A 3OC2A 1SDNA 3M2JA 4MBKA 2XK1A 4QHCA 5CERA 1NZUA 2R9WA 2WGVA 4JXWA 4QY5A 1LI0A 1RCJA 4OOYA 2E8IA 5TFQA 1MPLA 3G30A 4E3MA 4JXVA 4QD4A 3FYZA 4S2KA 4KZ4A 5EVID 3G2YA 3PBTA 3ZVTA 1KVLA 4U0TA 3IF6C 3AGDA 3HLDA 3HLBA 1CI9A 4RX3A 1XA1A 4OQHA 4PM9A 5TGFA 2WAEA 5CTNA 5FQ9A 4OLGA 5DF9A 1CK3A 4E3LA 3VP3A 4C75A 3MZDA 1CEGA 5EOOA 3TSGA 4RYEA 3VP2A 1YQSA 2Q9NA 1HVBA 1K55A 2HDRA 5FASA 1FOFA 1IYSA 1M40A 2UWXA 5GHYA 1RP5A 3NDEA 2ZQ7A 4OOMA 3HL9A 1FCNA 1PYYA 3IF6B 3ZG8B 1XKZA 5E43A 3Q81A 1ES3A 1G68A 4BQMA 1JWZA 4B4ZA 2IWDA 4JXGA 5EOEA 1VM1A 3WS1A 2RCXA 1MXOA 4XUZA 4IVIA 3V3RA 3UDXA 4E3NA 5DVAA 1IYQA 1MWUA 1QMEA 3MXRA 3N4IA 3G34A 3WS0A 4DE0A 1ESUA 4E3KA 3SS5A 3A3FA 1Q2PA 2XF3A 4UA9A 1YLZA 3I7JA 2OLUA 3ZCZA 4QY6A 2EXAA 1YMSA 5AQBA 3IF6A 1YM1A 4EBPA 4E3OA 2JE5A 2WZXA 3AGFA 4R3BA 3AGEA 1Q2QA 4KG5A 3WS4A 1BT5A 3ITBA 4BL2A 3PAEA 3IXHA 4LV1A 4BENA 2WADA 4DE3A 3PBSA 1H5XA 1I2SA 3IT9A 1HZOA 3W4OA 2DRWA 4LENA 3ZG5A 3IF5A 5FAPA 3BEBA 4DXBA 4JF6A 2QPNA 5EVLA 4EQIA 4OH0A 2PBYA 2Y2KA 1E3UA 1NYMA 4Y0TA 4BD0A 4RA7A 4BJPA 3ZDJA 4K0WA 5F83A 1JWVA 3QNCA 4WEKA 3WS2A 4BLMA 3VP4A 3MFDA 3SH9A 3FV7A 3TOIA 2WGWA 2Y2MA 3S22A 3RXWA 3NI9A 3N6IA 5CHUA 3IXGA 2Y2OA 3GMWA 2XR0A 3HBRA 3CZDA 3E2LA 5G18A 2B5RA 2Y2NA 5CHJA 2GDNA 3ZHHA 3Q7VB 1BLPA 4X53A 3BFEA 1ZKJA 4EBNA 1LL9A 3OZHA 5IHVA 3SH7A 4EV4A 2HDUA 1ZG4A 5GLCA 1RGYA 1IKGA 4FH2A 4FSFA 2XDMA 3DTMA 5HAIA 3B3XA 1O7EA 3IHBA 1YLJA 4UA7A 1S6RA 2ZMAA 3N8LA 3VP1A 4KZBA 1FR1A 2ZQ9A 3CG5A 4DF6A 4X6TA 4QB8A 5A93A 1XX2A 4E6XA 4UAAA 4KZ8A 4UA6A 4OQIA 4CPKA 3VFHA 1PWGA 1PZPA 3HVFA 2G2WA 4IBXA 3N7WA 3QHYA 4S2LA 2J8YA 3WWXA 3Q7VA 4WEJA 4ID4A 4UHUA 2Y55A 2HDQA 1ONHA 2HP9A 5FSRA 4GN2A 2Y4AA 5CEDA 4P87A 3HLFA 2G2UA 5M19A 3UE1A 3ZVWA 3DWZA 4KQOA 3OPHA 5E2GA 1W5DA 1KGEA 3IH8A 3NBLA 1MWSA 3BFCA 5FAOA 2ZC3B 4B4XA 2X71A 5CTMA 1KE4A 1PI5A 2R9XA 1N9BA 3EQUA 3IQAA 3M6HA 4XXRA 2WKHA 3MXSA 4GZBA 1VQQA 4P85A 5E2HA 5HARA 1K6RA 1BLHA 1NXYA 1EI5A 2DNSA 4R23A 2ZC6B 3V39A 3PBNA 3G2ZA 3ZG0A 2OV5A 1ERQA 1HTZA 4WM9A 1SKFA 3NC8A 3Q07A 3Q7ZA 3HUMA 4NETA 1JTDA 3UY6A 2H0YA 3FKWA 2J9OA 1W7FA 2ZD8A 4FCFA 4QU3A 3LO7A 2QMIA 4PM6A 3SOIA 3UDIA 3PBRA 2XQZA 1JWPA 1W8YA 2ZQ8A 4OVDA 1TVFA 4MLLA 3A3DA 2V20A 1ONGA 3OPPA 3G4PA 4HBUA 4OPYA 3VMAA 1I5QA 4KQRA 1J9MA 1MWTA 1IELA 4K91A 4WBGA 2WK0A 1JVJA 3O87A 3P09A 4Z9QA 3C5AA 4JLFA 4HEFA 3MKEA 2HDSA 4S2NC 5A91A 1L0GA 2HPBA 1ZG6A 3RXXA 1FSWA 4E6WA 4GDNA 1KDWA 3RJUA 5KSCA 4F94A 4K0XA 3MKFA 1H8ZA 2ZQDA 2I72A 3WRZA 1DJCA 1PW1A 5CXWA 1FCMA 5EECA 1PIOA 4PM7A 1ES2A 1ES4A 2PU4A 4ZBEA 3G32A 4KZ6A 1K38A 3W4PA 2WGIA 1ERMA 3ZNYA 2EX8A 3IXDA 4GB7A 4PMAA 1SCWA 4S2MA 4YINA 5FQQA 5EVIC 1FR6A 4X55A 1K56D 2Y2PA 1W8QA 4N9KA 5FI6A 3O3VA 5FDHA 4DRTA 2QZ6A 2A3UA 2J7VA 3S4XA 3NDGA 3M6BA 3A3JA 1U60A 3DW0A 4KZ3A 4R4RA 4KZ7A 5M1AA 3ITAA 3IWIA 3UPPA 3C7VA 4HBTA 3HLWA 1E4DA 5F1GA 4EWFA 3GSGA 1WE4A 2ZC4B 3LEZA 4S2NA 1KE3A 4MNRA 5EVIB 3VOYA 3ZNTA 2XFTA 1NRFA 5U47A 4WMCD 1QMFA 3P98A 3UNWA 2WKEA 2X01A 1TDGA 5DTKA 1GHMA 4X68A 5AQ7A 4ZJ1A 3W4QA 1XA7A 4DDYA 3UDFA 5CGWA 4DE1A 1BUEA 1S0WA 3OCNA 3PBOA 3LY4A 2EFUA 4U0XA 5TR7A 3BECA 2PU2A 2IWCA 2ZQCA 2EFXA 1H8YA 2H0TA 3FKVA 1MWRA 5DTTA 1IEMA 3CMZA 3GRJA 3V50A 4S2OA 2EX2A 4R3JA 2XLNA 5EVIA 5HAQA 2FFFB 3E2KA 1IKIA 2OSUA 5KMWA 3IXBA 1CI8A 1PZOA 1BLCA 1KE0A 3EQVA 2Y2LA 4Y0OA 1L0FA 3NY4A 4OPQA 2BLSA 4WZ5C 4R0QA 3ZG7B 2FFYA 4BL3A 4E3IA 3V3SA 5GHZA 2P9VB 2H5SA 4OQGA 5EE8A 4GD8A 1ALQA 1LI9A 3GVBA 3IH9A 4PM5A 1Z6FA 5A92A 4JF4A 2DCFA 5FQKA 1YMXA 1Y54A 1KDSA 2XD1A 2Y2HA 4MBFA 2XD5A 1M6KA 3V5MA 2WKIA 3UE3A 3PAGA 1E25A 1MY8A 4HESA 3OPRA 2ZJ9A 3SH8A 1GA9A 3WRTA 4KG2A 4N1HA 1K6SA 4P0MA 3HLGA 5GL9A 5FQJA 2P74A 3JYIA 5A90A 4EUZA 5CHMA 1AXBA 2JBFA 4JXSA 5CGXA 4P6BA 1BULA 2VGKA 1N4OA 4ZJ3A 1NYYA 4ZJ2A 1KGFA 1BTLA 5CGSA 1GHIA 1LLBA 1W79A 3IWQA 4ZDXA 1K55C 1YLPA 3NCKA 1K57C 3MZEA 3NIAA 3QNBA 1XPBA 1FCOA 4PPRA 3ZG9B 1PWCA 4GDBA 3N8RA 2RL3A 1E3UD 1I2WA 5AQAA 1L2SA 4PM8A 4O7DA 1DY6A 4U3TA 4YFMA 3GQZA 1K25A 1PWDA 2Y2GA 1YLWA 4Y0UA 1SDEA 3C4PA 3A3IA 3S1YA 2OLVA 1XGIA 2JC7A 2ZQAA 1SHVA 3C4OA 4S2PA 3IHAA 4BD1A 2XEPA 3UPOA 3PTEA 4LV3A 2Z2MB 4QJGA 3DWKA 3M2KA 4M3KA 1GCEA 2ZC7A 1O07A 2Y2JA 3ISGA 5F82A 2ZM2A 3VSLA 2X02A 1EROA 3HUOA 1FQGA 2C6WB 1LL5A 1XGJA 2WAFA 4A5RA 3D4FA 1XXMA 3SS4A 2ZC5B 5I94A 3BLMA 1ES5A 5JYOA 1LHYA 3MBZA 5CRFA 2CC1A 4ZTKA 5FA7A 1ZC2A 5E2EA 1K57A 3FWLA 2XH9A 1NZOA 1K54C 2Y59A 4OONA 3VP0A 4LV0A 5L2FA 1MBLA 2WUQA 4C6YA 2WZZA 3HLCA 3Q82A 5GLAA 5FQIA 3HUNA 2ZM0A 4IVKA 4KENB 5CECA 5E2FA 2XGNA 3O86A 5AQ9A 4JPMA 4FH4A 4IEDA 1OMEA 3UN7A 1GA0A 3FZCA 4N92A 4OPZA 1PW8A 4LCMA 4WELA 3VSKA 2J9PA 1BZAA 4XUXA 5KZHA 5FI7A 3G35A 3HREA 4H8RA 5HFOA 4LV2A 3VOZA 3C7UA 2Y91A 4GKUA 1ESIA 1YLTA 2H10A 5EUAA 4R4SA 2WGWB 4GNUA 3W8KA 4RVAA 2C5WB 2ZM8A 1K4EA 3BLSA 5HX9A 5M18A 5FATA 2Y2QA 2JCHA 1HD8A 1YLYA 4IBRA 4E3JA 4MBHA 1DJAA 5FAQA 1PI4A 4JKTA 1WYBA 4DKIA 4X56A 1JTGA 5DTSA 3WS5A 2Q9MA 4N1XA 4KG6A 4X69A 5FI2A 5EPHA 3BYDA 4C3QA 4CJNA 1C3BA 1K54A 1L0EA 2XFSA 3IWOA 4D2OA 1NY0A 3Q1FA 1BLSA 2EXBA 4S2IA 3TG9A 5KSHA 3UE0A 3UPNA 1RGZA 3ZFZA 3GR2A 1NJ4A 3BRMA 4JF5A 3BM6A 4LCLA 3MZFA 1DJBA 2IWBA 5D3OA 3CJMA 4R1GA 3HLEA 2Z2LB 5FQMA 1TDLA 1MKIA 2EX6A 3LY3A 5GLBA 4DXCA 4Q8IA 5CEBA 1XP4A 4ZAMA 5HL1A 2BG1A 1K4FA 3A3EA 3O88A 4OP5A 2V1ZA 4OQ0A 2Y2IA 5JYPA 2HP6A 3GV9A 1WYCA 1TEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WYY A;  4KZA A;  3OCL A;  5GLD A;  1IYO A;  4KQQ A;  4NK3 A;  3GTC A;  4EBL A;  1GHP A;  2VGJ A;  2WYX A;  3VFF A;  1KVM A;  5BOH A;  2A49 A;  1K56 A;  2HP5 A;  2P9V A;  4OPR A;  3N8S A;  4OKP A;  3SS3 A;  1KGG A;  3BFF A;  4OOL A;  3BFG A;  5DF8 A;  1IYP A;  4DDS A;  4L0L A;  4KZ9 A;  4S2J A;  3LCE A;  5HAP A;  3UO9 A;  5J8X A;  4JBF A;  2EX9 A;  4WZ5 A;  4MEZ A;  4B88 A;  1G6A A;  1YT4 A;  4GD6 A;  1BSG A;  1L0D A;  4GOG A;  1EWZ A;  4Y7P A;  4OLD A;  5GHX A;  4WMC A;  4KZ5 A;  5DF7 A;  4OP8 A;  4N9L A;  2V2F F;  4FD8 A;  3ZGA B;  3G31 A;  4DE2 A;  3PBQ A;  5HW3 A;  2ZLY A;  1CEF A;  3BFD A;  1FSY A;  5F1F A;  3OPL A;  4WZ4 A;  4RX2 A;  3OC2 A;  1SDN A;  3M2J A;  4MBK A;  2XK1 A;  4QHC A;  5CER A;  1NZU A;  2R9W A;  2WGV A;  4JXW A;  4QY5 A;  1LI0 A;  1RCJ A;  4OOY A;  2E8I A;  5TFQ A;  1MPL A;  3G30 A;  4E3M A;  4JXV A;  4QD4 A;  3FYZ A;  4S2K A;  4KZ4 A;  5EVI D;  3G2Y A;  3PBT A;  3ZVT A;  1KVL A;  4U0T A;  3IF6 C;  3AGD A;  3HLD A;  3HLB A;  1CI9 A;  4RX3 A;  1XA1 A;  4OQH A;  4PM9 A;  5TGF A;  2WAE A;  5CTN A;  5FQ9 A;  4OLG A;  5DF9 A;  1CK3 A;  4E3L A;  3VP3 A;  4C75 A;  3MZD A;  1CEG A;  5EOO A;  3TSG A;  4RYE A;  3VP2 A;  1YQS A;  2Q9N A;  1HVB A;  1K55 A;  2HDR A;  5FAS A;  1FOF A;  1IYS A;  1M40 A;  2UWX A;  5GHY A;  1RP5 A;  3NDE A;  2ZQ7 A;  4OOM A;  3HL9 A;  1FCN A;  1PYY A;  3IF6 B;  3ZG8 B;  1XKZ A;  5E43 A;  3Q81 A;  1ES3 A;  1G68 A;  4BQM A;  1JWZ A;  4B4Z A;  2IWD A;  4JXG A;  5EOE A;  1VM1 A;  3WS1 A;  2RCX A;  1MXO A;  4XUZ A;  4IVI A;  3V3R A;  3UDX A;  4E3N A;  5DVA A;  1IYQ A;  1MWU A;  1QME A;  3MXR A;  3N4I A;  3G34 A;  3WS0 A;  4DE0 A;  1ESU A;  4E3K A;  3SS5 A;  3A3F A;  1Q2P A;  2XF3 A;  4UA9 A;  1YLZ A;  3I7J A;  2OLU A;  3ZCZ A;  4QY6 A;  2EXA A;  1YMS A;  5AQB A;  3IF6 A;  1YM1 A;  4EBP A;  4E3O A;  2JE5 A;  2WZX A;  3AGF A;  4R3B A;  3AGE A;  1Q2Q A;  4KG5 A;  3WS4 A;  1BT5 A;  3ITB A;  4BL2 A;  3PAE A;  3IXH A;  4LV1 A;  4BEN A;  2WAD A;  4DE3 A;  3PBS A;  1H5X A;  1I2S A;  3IT9 A;  1HZO A;  3W4O A;  2DRW A;  4LEN A;  3ZG5 A;  3IF5 A;  5FAP A;  3BEB A;  4DXB A;  4JF6 A;  2QPN A;  5EVL A;  4EQI A;  4OH0 A;  2PBY A;  2Y2K A;  1E3U A;  1NYM A;  4Y0T A;  4BD0 A;  4RA7 A;  4BJP A;  3ZDJ A;  4K0W A;  5F83 A;  1JWV A;  3QNC A;  4WEK A;  3WS2 A;  4BLM A;  3VP4 A;  3MFD A;  3SH9 A;  3FV7 A;  3TOI A;  2WGW A;  2Y2M A;  3S22 A;  3RXW A;  3NI9 A;  3N6I A;  5CHU A;  3IXG A;  2Y2O A;  3GMW A;  2XR0 A;  3HBR A;  3CZD A;  3E2L A;  5G18 A;  2B5R A;  2Y2N A;  5CHJ A;  2GDN A;  3ZHH A;  3Q7V B;  1BLP A;  4X53 A;  3BFE A;  1ZKJ A;  4EBN A;  1LL9 A;  3OZH A;  5IHV A;  3SH7 A;  4EV4 A;  2HDU A;  1ZG4 A;  5GLC A;  1RGY A;  1IKG A;  4FH2 A;  4FSF A;  2XDM A;  3DTM A;  5HAI A;  3B3X A;  1O7E A;  3IHB A;  1YLJ A;  4UA7 A;  1S6R A;  2ZMA A;  3N8L A;  3VP1 A;  4KZB A;  1FR1 A;  2ZQ9 A;  3CG5 A;  4DF6 A;  4X6T A;  4QB8 A;  5A93 A;  1XX2 A;  4E6X A;  4UAA A;  4KZ8 A;  4UA6 A;  4OQI A;  4CPK A;  3VFH A;  1PWG A;  1PZP A;  3HVF A;  2G2W A;  4IBX A;  3N7W A;  3QHY A;  4S2L A;  2J8Y A;  3WWX A;  3Q7V A;  4WEJ A;  4ID4 A;  4UHU A;  2Y55 A;  2HDQ A;  1ONH A;  2HP9 A;  5FSR A;  4GN2 A;  2Y4A A;  5CED A;  4P87 A;  3HLF A;  2G2U A;  5M19 A;  3UE1 A;  3ZVW A;  3DWZ A;  4KQO A;  3OPH A;  5E2G A;  1W5D A;  1KGE A;  3IH8 A;  3NBL A;  1MWS A;  3BFC A;  5FAO A;  2ZC3 B;  4B4X A;  2X71 A;  5CTM A;  1KE4 A;  1PI5 A;  2R9X A;  1N9B A;  3EQU A;  3IQA A;  3M6H A;  4XXR A;  2WKH A;  3MXS A;  4GZB A;  1VQQ A;  4P85 A;  5E2H A;  5HAR A;  1K6R A;  1BLH A;  1NXY A;  1EI5 A;  2DNS A;  4R23 A;  2ZC6 B;  3V39 A;  3PBN A;  3G2Z A;  3ZG0 A;  2OV5 A;  1ERQ A;  1HTZ A;  4WM9 A;  1SKF A;  3NC8 A;  3Q07 A;  3Q7Z A;  3HUM A;  4NET A;  1JTD A;  3UY6 A;  2H0Y A;  3FKW A;  2J9O A;  1W7F A;  2ZD8 A;  4FCF A;  4QU3 A;  3LO7 A;  2QMI A;  4PM6 A;  3SOI A;  3UDI A;  3PBR A;  2XQZ A;  1JWP A;  1W8Y A;  2ZQ8 A;  4OVD A;  1TVF A;  4MLL A;  3A3D A;  2V20 A;  1ONG A;  3OPP A;  3G4P A;  4HBU A;  4OPY A;  3VMA A;  1I5Q A;  4KQR A;  1J9M A;  1MWT A;  1IEL A;  4K91 A;  4WBG A;  2WK0 A;  1JVJ A;  3O87 A;  3P09 A;  4Z9Q A;  3C5A A;  4JLF A;  4HEF A;  3MKE A;  2HDS A;  4S2N C;  5A91 A;  1L0G A;  2HPB A;  1ZG6 A;  3RXX A;  1FSW A;  4E6W A;  4GDN A;  1KDW A;  3RJU A;  5KSC A;  4F94 A;  4K0X A;  3MKF A;  1H8Z A;  2ZQD A;  2I72 A;  3WRZ A;  1DJC A;  1PW1 A;  5CXW A;  1FCM A;  5EEC A;  1PIO A;  4PM7 A;  1ES2 A;  1ES4 A;  2PU4 A;  4ZBE A;  3G32 A;  4KZ6 A;  1K38 A;  3W4P A;  2WGI A;  1ERM A;  3ZNY A;  2EX8 A;  3IXD A;  4GB7 A;  4PMA A;  1SCW A;  4S2M A;  4YIN A;  5FQQ A;  5EVI C;  1FR6 A;  4X55 A;  1K56 D;  2Y2P A;  1W8Q A;  4N9K A;  5FI6 A;  3O3V A;  5FDH A;  4DRT A;  2QZ6 A;  2A3U A;  2J7V A;  3S4X A;  3NDG A;  3M6B A;  3A3J A;  1U60 A;  3DW0 A;  4KZ3 A;  4R4R A;  4KZ7 A;  5M1A A;  3ITA A;  3IWI A;  3UPP A;  3C7V A;  4HBT A;  3HLW A;  1E4D A;  5F1G A;  4EWF A;  3GSG A;  1WE4 A;  2ZC4 B;  3LEZ A;  4S2N A;  1KE3 A;  4MNR A;  5EVI B;  3VOY A;  3ZNT A;  2XFT A;  1NRF A;  5U47 A;  4WMC D;  1QMF A;  3P98 A;  3UNW A;  2WKE A;  2X01 A;  1TDG A;  5DTK A;  1GHM A;  4X68 A;  5AQ7 A;  4ZJ1 A;  3W4Q A;  1XA7 A;  4DDY A;  3UDF A;  5CGW A;  4DE1 A;  1BUE A;  1S0W A;  3OCN A;  3PBO A;  3LY4 A;  2EFU A;  4U0X A;  5TR7 A;  3BEC A;  2PU2 A;  2IWC A;  2ZQC A;  2EFX A;  1H8Y A;  2H0T A;  3FKV A;  1MWR A;  5DTT A;  1IEM A;  3CMZ A;  3GRJ A;  3V50 A;  4S2O A;  2EX2 A;  4R3J A;  2XLN A;  5EVI A;  5HAQ A;  2FFF B;  3E2K A;  1IKI A;  2OSU A;  5KMW A;  3IXB A;  1CI8 A;  1PZO A;  1BLC A;  1KE0 A;  3EQV A;  2Y2L A;  4Y0O A;  1L0F A;  3NY4 A;  4OPQ A;  2BLS A;  4WZ5 C;  4R0Q A;  3ZG7 B;  2FFY A;  4BL3 A;  4E3I A;  3V3S A;  5GHZ A;  2P9V B;  2H5S A;  4OQG A;  5EE8 A;  4GD8 A;  1ALQ A;  1LI9 A;  3GVB A;  3IH9 A;  4PM5 A;  1Z6F A;  5A92 A;  4JF4 A;  2DCF A;  5FQK A;  1YMX A;  1Y54 A;  1KDS A;  2XD1 A;  2Y2H A;  4MBF A;  2XD5 A;  1M6K A;  3V5M A;  2WKI A;  3UE3 A;  3PAG A;  1E25 A;  1MY8 A;  4HES A;  3OPR A;  2ZJ9 A;  3SH8 A;  1GA9 A;  3WRT A;  4KG2 A;  4N1H A;  1K6S A;  4P0M A;  3HLG A;  5GL9 A;  5FQJ A;  2P74 A;  3JYI A;  5A90 A;  4EUZ A;  5CHM A;  1AXB A;  2JBF A;  4JXS A;  5CGX A;  4P6B A;  1BUL A;  2VGK A;  1N4O A;  4ZJ3 A;  1NYY A;  4ZJ2 A;  1KGF A;  1BTL A;  5CGS A;  1GHI A;  1LLB A;  1W79 A;  3IWQ A;  4ZDX A;  1K55 C;  1YLP A;  3NCK A;  1K57 C;  3MZE A;  3NIA A;  3QNB A;  1XPB A;  1FCO A;  4PPR A;  3ZG9 B;  1PWC A;  4GDB A;  3N8R A;  2RL3 A;  1E3U D;  1I2W A;  5AQA A;  1L2S A;  4PM8 A;  4O7D A;  1DY6 A;  4U3T A;  4YFM A;  3GQZ A;  1K25 A;  1PWD A;  2Y2G A;  1YLW A;  4Y0U A;  1SDE A;  3C4P A;  3A3I A;  3S1Y A;  2OLV A;  1XGI A;  2JC7 A;  2ZQA A;  1SHV A;  3C4O A;  4S2P A;  3IHA A;  4BD1 A;  2XEP A;  3UPO A;  3PTE A;  4LV3 A;  2Z2M B;  4QJG A;  3DWK A;  3M2K A;  4M3K A;  1GCE A;  2ZC7 A;  1O07 A;  2Y2J A;  3ISG A;  5F82 A;  2ZM2 A;  3VSL A;  2X02 A;  1ERO A;  3HUO A;  1FQG A;  2C6W B;  1LL5 A;  1XGJ A;  2WAF A;  4A5R A;  3D4F A;  1XXM A;  3SS4 A;  2ZC5 B;  5I94 A;  3BLM A;  1ES5 A;  5JYO A;  1LHY A;  3MBZ A;  5CRF A;  2CC1 A;  4ZTK A;  5FA7 A;  1ZC2 A;  5E2E A;  1K57 A;  3FWL A;  2XH9 A;  1NZO A;  1K54 C;  2Y59 A;  4OON A;  3VP0 A;  4LV0 A;  5L2F A;  1MBL A;  2WUQ A;  4C6Y A;  2WZZ A;  3HLC A;  3Q82 A;  5GLA A;  5FQI A;  3HUN A;  2ZM0 A;  4IVK A;  4KEN B;  5CEC A;  5E2F A;  2XGN A;  3O86 A;  5AQ9 A;  4JPM A;  4FH4 A;  4IED A;  1OME A;  3UN7 A;  1GA0 A;  3FZC A;  4N92 A;  4OPZ A;  1PW8 A;  4LCM A;  4WEL A;  3VSK A;  2J9P A;  1BZA A;  4XUX A;  5KZH A;  5FI7 A;  3G35 A;  3HRE A;  4H8R A;  5HFO A;  4LV2 A;  3VOZ A;  3C7U A;  2Y91 A;  4GKU A;  1ESI A;  1YLT A;  2H10 A;  5EUA A;  4R4S A;  2WGW B;  4GNU A;  3W8K A;  4RVA A;  2C5W B;  2ZM8 A;  1K4E A;  3BLS A;  5HX9 A;  5M18 A;  5FAT A;  2Y2Q A;  2JCH A;  1HD8 A;  1YLY A;  4IBR A;  4E3J A;  4MBH A;  1DJA A;  5FAQ A;  1PI4 A;  4JKT A;  1WYB A;  4DKI A;  4X56 A;  1JTG A;  5DTS A;  3WS5 A;  2Q9M A;  4N1X A;  4KG6 A;  4X69 A;  5FI2 A;  5EPH A;  3BYD A;  4C3Q A;  4CJN A;  1C3B A;  1K54 A;  1L0E A;  2XFS A;  3IWO A;  4D2O A;  1NY0 A;  3Q1F A;  1BLS A;  2EXB A;  4S2I A;  3TG9 A;  5KSH A;  3UE0 A;  3UPN A;  1RGZ A;  3ZFZ A;  3GR2 A;  1NJ4 A;  3BRM A;  4JF5 A;  3BM6 A;  4LCL A;  3MZF A;  1DJB A;  2IWB A;  5D3O A;  3CJM A;  4R1G A;  3HLE A;  2Z2L B;  5FQM A;  1TDL A;  1MKI A;  2EX6 A;  3LY3 A;  5GLB A;  4DXC A;  4Q8I A;  5CEB A;  1XP4 A;  4ZAM A;  5HL1 A;  2BG1 A;  1K4F A;  3A3E A;  3O88 A;  4OP5 A;  2V1Z A;  4OQ0 A;  2Y2I A;  5JYP A;  2HP6 A;  3GV9 A;  1WYC A;  1TEM A; 
#chains in the Genus database with same CATH topology
 1IYO A;  4KQQ A;  4NK3 A;  1UWN X;  2A49 A;  2HP5 A;  2P9V A;  4OPR A;  3BFF A;  2JKT M;  1IYP A;  4FTX A;  4DDS A;  4S2J A;  5HAP A;  3UO9 A;  5J8X A;  1W63 Q;  1D06 A;  4MEZ A;  1G6A A;  1YT4 A;  4Y7P A;  5AVF A;  5GHX A;  4KZ5 A;  4DE2 A;  3G31 A;  3PBQ A;  2ZLY A;  3HCY A;  1CEF A;  3D3O A;  5TBM A;  3OPL A;  5AJG A;  4MBK A;  4QHC A;  5EM0 A;  2WGV A;  3NEC A;  1RCJ A;  4EEP A;  3G30 A;  4QD4 A;  5EVI D;  1ODV A;  3DTI A;  3ZVT A;  2GZA A;  3IF6 C;  3HLD A;  1CQA A;  1CI9 A;  4PM9 A;  3BWL A;  1G6O A;  1CK3 A;  4E3L A;  2O9A A;  3IX8 A;  1GSW A;  4R38 A;  1RP5 A;  4EER A;  2ZQ7 A;  3HL9 A;  3IF6 B;  1XKZ A;  1G68 A;  5J3W A;  3C30 A;  5EOE A;  2RCX A;  5DVA A;  1MWU A;  1QME A;  1T19 A;  2ZL1 B;  3G34 A;  4L9E A;  1ESU A;  3NUL A;  2XF3 A;  4UA9 A;  5AQB A;  4EBP A;  2WZX A;  3AGF A;  3WS4 A;  4R3B A;  2W3G A;  4M4X A;  3V67 A;  5K5B A;  3PAE A;  4LV1 A;  1H5X A;  3IT9 A;  2DRW A;  4DXB A;  2QPN A;  4OH0 A;  1E3U A;  1NYM A;  4RA7 A;  3ZDJ A;  3QNC A;  3WS2 A;  3VP4 A;  3MFD A;  2Y2M A;  3LIC A;  4LGW A;  3S22 A;  5CHU A;  2M1C A;  3IXG A;  2Y2O A;  2XR0 A;  3T50 A;  5G18 A;  1LSW A;  2JKG A;  1LL9 A;  1DRM A;  2HDU A;  3VP1 A;  4EET B;  4YOF A;  2J80 A;  4IUH A;  5HDS A;  2B02 A;  1PWG A;  2EWW A;  5J7E A;  2G2W A;  3Q7V A;  3CPT B;  2HP9 A;  1OTI A;  3HLF A;  3DWZ A;  4GHI B;  4EXO A;  3C38 A;  3NBL A;  1MWS A;  5HSQ A;  4B4X A;  2VEA A;  2X71 A;  5CTM A;  5IU1 A;  5HAR A;  3MXS A;  1K6R A;  1NXY A;  4UQI M;  5DJU A;  3V39 A;  3G2Z A;  1LSX A;  2G7U A;  1SKF A;  3HUM A;  4P6Z M;  3T4S A;  1H8M A;  4QU3 A;  3FPV A;  2QMI A;  2XQZ A;  1JWP A;  1TVF A;  1X0O A;  3G4P A;  3EGD C;  4WBG A;  2EWV A;  3O87 A;  3BY8 A;  2HDS A;  3MKE A;  5HDC A;  1A0K A;  4F94 A;  4K0X A;  5HZH A;  1H8Z A;  3LID A;  2L0W A;  3UB6 A;  1S4S A;  2W3D A;  3KX0 X;  5CXW A;  1FCM A;  4PM7 A;  4KZ6 A;  3W4P A;  2EX8 A;  4GB7 A;  4S2M A;  1K56 D;  5FI6 A;  3O3V A;  4DRT A;  2A3U A;  3DW0 A;  4R4R A;  3JPU A;  1TS0 A;  4I39 A;  3C7V A;  4HBT A;  3LEQ A;  1E4D A;  3CWF A;  5F1G A;  4WN5 A;  1WE4 A;  2ZC4 B;  4S2N A;  3VOY A;  2L4R A;  3K2N A;  2PDR A;  3P98 A;  3UNW A;  2JHE A;  1TDG A;  5DTK A;  2MJ6 A;  3UDF A;  3T4Q A;  5CGW A;  1BUE A;  2O0Y A;  3LY4 A;  1T1C A;  2EFU A;  4X1L A;  4BWI A;  3BEC A;  4R3J A;  2XLN A;  2OSU A;  3T1X A;  2PR6 A;  1BLC A;  3EQV A;  4NXB A;  2Y2L A;  4O8G A;  3NY4 A;  5EVE A;  1DP8 A;  4WZ5 C;  5J4E A;  3ZG7 B;  2FFY A;  4BL3 A;  5GHZ A;  4OQG A;  5HPF A;  4GD8 A;  4PM5 A;  3IH9 A;  3LI8 A;  1VET B;  5A92 A;  1CJF A;  3S7N A;  2XD1 A;  3V5M A;  2WKI A;  5L07 A;  3WRT A;  1S66 L;  2P74 A;  2JBF A;  4JXS A;  4CLC A;  3NOP C;  2VGK A;  1F2K A;  1KGF A;  3QP2 A;  5CGS A;  4HHD A;  1K55 C;  1NRJ A;  2XA7 M;  2Y2G A;  1YLW A;  1VEU B;  2WKR A;  2OLV A;  1SHV A;  3E4P A;  3S7O A;  2XEP A;  4LV3 A;  3DWK A;  3M2K A;  4KUK A;  2Y2J A;  4MDZ A;  3T4K A;  2HJE A;  2P08 A;  2OAQ 1;  3HUO A;  2C6W B;  2WAF A;  1G5U A;  3SS4 A;  5JYO A;  1ES5 A;  1K0K A;  4JGQ A;  3KSH A;  3MSH A;  4ZTK A;  1ZC2 A;  5HL6 A;  1K57 A;  2XH9 A;  1NZO A;  2W1R A;  4LV0 A;  2WUQ A;  4G3W A;  3PR6 A;  1UWP X;  3HUN A;  4IVK A;  5CEC A;  1OJG A;  2HGV A;  3E0Y A;  3O86 A;  5DFY A;  4KUO A;  4IED A;  1OME A;  1GA0 A;  4Y5F A;  4LRX C;  4LCM A;  2J9P A;  2HV1 A;  5HFO A;  3VOZ A;  3C7U A;  2H10 A;  2VV6 A;  2C5W B;  2FH5 A;  1HD8 A;  4E3J A;  2Y8H A;  4DJ2 A;  1DJA A;  2W3E A;  1WYB A;  1JTG A;  1J3W A;  4KG6 A;  2JKR M;  4X69 A;  4CJN A;  3HJI A;  3K3D A;  1K54 A;  4G3V A;  3Q1F A;  3IS2 A;  1BLS A;  3UE0 A;  4R70 A;  3BRM A;  4JF5 A;  4MCW A;  4LCL A;  3MZF A;  3KSI A;  2VK3 A;  4R1G A;  4FUW A;  5FQM A;  3A3E A;  3O88 A;  4ARZ A;  3PBN A;  4WYY A;  3GTC A;  4UQI S;  3VFF A;  5TBM B;  3N8S A;  4OKP A;  1KGG A;  3JVU A;  1NLY A;  4P6Z S;  3BFG A;  2ZOH A;  1V9Z A;  4L0L A;  4KZ9 A;  2OOL A;  3MQQ A;  4WZ5 A;  4B88 A;  2ACG A;  1L0D A;  3MJQ A;  1EWZ A;  4N9L A;  2V2F F;  4FD8 A;  1FSY A;  5F1F A;  4I3A A;  3LR4 A;  1NZU A;  4QY5 A;  1KOU A;  4JXW A;  3UB5 P;  5TFQ A;  3FPW A;  4E3M A;  4S2K A;  2A2L A;  1KVL A;  1XA1 A;  2QJ5 A;  5TGF A;  4JGP A;  5FQ9 A;  2HZ5 A;  4LPZ A;  3VP3 A;  4C75 A;  1CEG A;  5EOO A;  3S7P A;  3TSG A;  5IS1 A;  1YQS A;  3L9K A;  1K55 A;  2HDR A;  2PAV P;  1FOF A;  1M40 A;  4PKY A;  2UWX A;  5GHY A;  4PAU A;  2XRN A;  5KIZ A;  3ZG8 B;  5E43 A;  2CMN A;  3QP6 A;  4BQM A;  2IWD A;  4JXG A;  1VM1 A;  4EUV A;  1MXO A;  4IVI A;  1LSV A;  3V3R A;  3UDX A;  4E3N A;  1IYQ A;  4DE0 A;  2W3H A;  1YLZ A;  3I7J A;  4QY6 A;  3BQ8 A;  3AGE A;  4WL9 A;  2M7V A;  4BL2 A;  4DE3 A;  2W0N A;  1HZO A;  4LEN A;  3KO6 A;  4JF6 A;  4NXF A;  5EVL A;  2Y2K A;  2YKH A;  5EV0 A;  4NG2 A;  4BJP A;  1JWV A;  3TOI A;  5L8M A;  3GMW A;  3HBR A;  3VE3 A;  5FL3 A;  5CHJ A;  2GDN A;  4R6L A;  3UB7 A;  3Q7V B;  4X53 A;  3BFE A;  3OZH A;  1ZG4 A;  4FH2 A;  3D9Y A;  1YLJ A;  1S6R A;  4KZB A;  1FR1 A;  1XX2 A;  1CF0 A;  4E6X A;  1XFQ A;  4WF0 A;  3VFH A;  2O9B A;  3QHY A;  4S2L A;  2Y55 A;  2HDQ A;  5FSR A;  2PR5 A;  2G2U A;  5M19 A;  3OPH A;  1W5D A;  1H0M A;  2ZC3 B;  1KE4 A;  1PI5 A;  3QP4 A;  4XXR A;  3IQA A;  2WKH A;  4GZB A;  1Z09 A;  3P01 A;  4HJ3 A;  4H6J A;  2OV5 A;  1ERQ A;  3JVV A;  3NC8 A;  3Q07 A;  3UY6 A;  4NET A;  3FKW A;  4ETZ A;  4FCF A;  3LO7 A;  3PBR A;  2OWH A;  3T4O A;  3A3D A;  3MFX A;  5HD3 A;  2VGL S;  3CHW P;  1J9M A;  1YKD A;  2WK0 A;  3P09 A;  4Z9Q A;  2WKP A;  4S2N C;  4HEF A;  5A91 A;  3RXX A;  1FSW A;  4E6W A;  3F1N A;  3MKF A;  1DP9 A;  3A0V A;  3E4O A;  3U2A A;  1DJC A;  4YNR A;  5HDD A;  1PIO A;  3G32 A;  1K38 A;  4BBT A;  1MZU A;  1ERM A;  2JKT I;  3IXD A;  4HI4 A;  3LIF A;  4PHT A;  1FIK A;  2J7V A;  3S4X A;  2AVX A;  3A3J A;  1U60 A;  3CUE A;  3IWI A;  1ZHH B;  4HQA A;  1KE3 A;  4MNR A;  2WKE A;  2X01 A;  4D60 A;  5AVE A;  4BBU A;  5AQ7 A;  3GEC A;  5EFW A;  2K7S A;  1EW0 A;  4X25 A;  3W2Z A;  1W63 M;  2EFX A;  4Q0H A;  4F3L A;  4CLC C;  4S2O A;  2PT7 A;  5HAQ A;  2FFF B;  3E2K A;  5KMW A;  3IXB A;  2NUP C;  2ZBB A;  2Y79 A;  3O5Y A;  2BLS A;  2OAP 1;  3H9W A;  4E3I A;  4CLC B;  3PXP A;  4WLA A;  1MKM A;  1LI9 A;  1Y54 A;  1KDS A;  3PAG A;  1E25 A;  5MC7 A;  4L9F A;  4HES A;  2ZMF A;  3OPR A;  5FQJ A;  3JYI A;  3R4K A;  4UEY A;  5F6A A;  2WKQ A;  1BUL A;  4ZJ3 A;  3CIT A;  3G6O A;  4ZJ2 A;  1GHI A;  1LLB A;  4ZDX A;  1YLP A;  3NCK A;  1K57 C;  2HF6 A;  2VZW A;  1XPB A;  3N8R A;  1E3U D;  2Z6C A;  4PM8 A;  4O7D A;  1DY6 A;  3B47 A;  3KYE A;  3EWK A;  1SDE A;  3C4P A;  2PD8 A;  2JC7 A;  3A0R A;  4BD1 A;  3UPO A;  4JGR A;  1GCE A;  2ZC7 A;  1O07 A;  4M3K A;  4Q0J A;  2X02 A;  1ERO A;  4WUJ A;  1XGJ A;  3KSF A;  3D4F A;  5I94 A;  3LI9 A;  3MBZ A;  4I38 A;  5CRF A;  5FA7 A;  3FWL A;  1K54 C;  5L2F A;  4HOI A;  2WZZ A;  3C8C A;  4YWZ A;  3UB8 A;  2VLG A;  5FQI A;  3S7Q A;  2UV0 E;  3FZC A;  4N92 A;  1PW8 A;  3VSK A;  2W1T A;  4XUX A;  5CX7 A;  4H8R A;  5FI7 A;  1OTB A;  4LV2 A;  2Y91 A;  3IS2 B;  4GKU A;  2A24 A;  4R4S A;  2WGW B;  2J3T C;  3W8K A;  2BTF P;  3BLS A;  5HX9 A;  5FEF A;  4AFI A;  5FAQ A;  2J3W A;  4JKT A;  4DKI A;  5DTS A;  2LB9 A;  3KSG A;  4N1X A;  2K31 A;  5FI2 A;  4C3Q A;  3BYD A;  4ARZ B;  1L0E A;  1SKO A;  3IWO A;  3UE6 A;  1NY0 A;  3TG9 A;  4GS9 A;  1SZV A;  3BM6 A;  2Z6D A;  4G3K A;  2E8J A;  4CQH A;  4DXC A;  2EX6 A;  1VHM A;  1K4F A;  1STZ A;  4OP5 A;  2V1Z A;  2Y2I A;  5DKL A;  1TEM A;  1OT9 A;  3R7W B;  4KZA A;  3MS6 A;  5GLD A;  3F1P B;  1H3Q A;  4EBL A;  1GHP A;  2VGJ A;  2WYX A;  5BOH A;  5FDS A;  2H28 A;  2XSS A;  3BW6 A;  4OOL A;  2VA0 A;  1T1A A;  4LLO B;  4JBF A;  4GOG A;  3LIE A;  3LGO A;  4WMC A;  3TRC A;  5DF7 A;  4OP8 A;  2V8C A;  3ZGA B;  3BY9 A;  4WZ4 A;  5IT5 A;  3M2J A;  1LT0 A;  4E04 A;  5CER A;  5HWV A;  2R9W A;  5F68 A;  1LI0 A;  1MPL A;  5DKK A;  3FYZ A;  4KZ4 A;  3ZYT A;  3PBT A;  4EEU A;  4U0T A;  4Y2F A;  5CTN A;  3MZD A;  3VP2 A;  1XFN A;  3LYX A;  4ESP A;  1XJ6 A;  2Q9N A;  4Q0I A;  1HVB A;  5FAS A;  1PYY A;  1ES3 A;  4DJ3 A;  4B4Z A;  3WS1 A;  4CLC E;  3MXR A;  3WS0 A;  4ETX A;  4CLC D;  2D02 A;  4E3K A;  3SS5 A;  3A3F A;  2OLU A;  1YMS A;  1YM1 A;  2JE5 A;  1BT5 A;  3ITB A;  3IXH A;  4HNB A;  3PBS A;  1I2S A;  3L7H A;  2V9A A;  3W4O A;  3QP1 A;  3IF5 A;  3BEB A;  2PBY A;  4Y0T A;  5F83 A;  4BLM A;  2WGW A;  1P9W A;  3CZD A;  2ZOI A;  2Y2N A;  3ZHH A;  4EBN A;  4EV4 A;  3SH7 A;  5GLC A;  1IKG A;  2XDM A;  3DTM A;  4HH3 A;  1O7E A;  4UA7 A;  2ZMA A;  2ZQ9 A;  3H82 A;  3F1O B;  4DF6 A;  4UAA A;  3B42 A;  4UA6 A;  4OQI A;  4H6J B;  1N9O A;  4IBX A;  2J8Y A;  4WEJ A;  4UHU A;  1ONH A;  2Q0O A;  2Y4A A;  1Y4O A;  1N9L A;  2M7U A;  3UE1 A;  4KQO A;  1TS7 A;  3T1Q B;  3R7W A;  2R9X A;  3F1P A;  3EQU A;  2W3F A;  3M6H A;  5E2H A;  1BLH A;  2DNS A;  2B18 A;  3RFB A;  3OOV A;  3ZG0 A;  1HTZ A;  4WM9 A;  3F1N B;  4MN5 A;  2H0Y A;  3TW8 A;  1W7F A;  3UDI A;  4PM6 A;  3SOI A;  1YSQ A;  2ZQ8 A;  4MLL A;  4XT2 B;  4EU0 A;  1TF1 A;  4HBU A;  3VMA A;  3CUE C;  1MWT A;  3DTE A;  4HY8 A;  2HPB A;  4GDN A;  3RJU A;  4QPR A;  2ZQD A;  3LUQ A;  2I72 A;  3LR0 A;  1TD5 A;  2V0W A;  3H7W B;  2J3T D;  4GJ4 A;  5EEC A;  1ES2 A;  2D01 A;  4IUK A;  2WGI A;  2W27 A;  5FQQ A;  4PMA A;  1YSP A;  1YAX A;  2Y2P A;  4ME4 A;  4N9K A;  3T12 B;  5FDH A;  5G4Z A;  4Y13 A;  3UME A;  4KZ3 A;  5M1A A;  1ACF A;  4F3L B;  5A8B A;  4EWF A;  1P97 A;  3GSG A;  3LEZ A;  1NRF A;  5U47 A;  1QMF A;  2NUT C;  1GHM A;  3W4Q A;  1XA7 A;  4DDY A;  3OCN A;  3PBO A;  3QP5 A;  4EQ1 A;  5TR7 A;  2PU2 A;  3T4L A;  2IWC A;  2ZQC A;  1H8Y A;  2H0T A;  2PYP A;  1MWR A;  2VJW A;  5LBR A;  1IEM A;  3CMZ A;  4EW7 A;  3V50 A;  5EVI A;  1IKI A;  1CI8 A;  4Y0O A;  1L0F A;  1YPR A;  2QKP A;  4OPQ A;  1AWI A;  2LB5 A;  3RH8 B;  1DP6 A;  2H5S A;  4Y3I A;  2QWS A;  3FG8 A;  1ALQ A;  2O99 A;  3GVB A;  1NLZ A;  1Z6F A;  4JF4 A;  3ULF A;  1YMX A;  4RQ9 A;  3UE3 A;  2GJ3 A;  2ZJ9 A;  3SH8 A;  4KG2 A;  4N1H A;  4P0M A;  2XA7 S;  3F1O A;  5A90 A;  2QYB A;  4EUZ A;  1AXB A;  3MQO A;  1S67 L;  2HJ9 C;  1N4O A;  1W79 A;  3IWQ A;  3MZE A;  1PWC A;  1L3L A;  2RL3 A;  3VV4 A;  1K25 A;  1PWD A;  2PBD P;  4HJ4 A;  3PHY A;  3QP8 A;  1F98 A;  2GNX A;  2QHK A;  3IHA A;  4S2P A;  4BMW A;  3PTE A;  4QJG A;  3ISG A;  3DAV A;  4XT2 A;  3DTK A;  3IX4 A;  1BYW A;  1FQG A;  4A5R A;  3ICY A;  1XXM A;  1Y28 A;  2ZC5 B;  3BLM A;  2W1T B;  4Y17 A;  1IOU A;  1D1J A;  2A24 B;  5E2E A;  3VP0 A;  4OON A;  4LRZ E;  3HLC A;  3Q82 A;  3D72 A;  2ZM0 A;  3H7W A;  4KEN B;  5E2F A;  2FZ0 A;  2XGN A;  1PRQ A;  4JPM A;  3UN7 A;  1D7E A;  3LIB A;  4KQD A;  4O0P A;  4WEL A;  5KZH A;  3G35 A;  3HRE A;  1SKO B;  2V1A A;  1ESI A;  1YLT A;  2KOI A;  2L1M A;  4RVA A;  2ZM8 A;  1GSV A;  4GS9 B;  1K4E A;  5FAT A;  2JCH A;  1YLY A;  4IBR A;  2JN7 A;  4MBH A;  3DBA A;  1UGU A;  4X56 A;  4B93 A;  3NOU C;  2Q9M A;  1C3B A;  2XFS A;  4D2O A;  4S2I A;  5KSH A;  3VOL A;  3ZFZ A;  1NJ4 A;  1DJB A;  2IWB A;  3A0S A;  1IFQ A;  4MN7 A;  2Z2L B;  1S1Y A;  3LY3 A;  4Q8I A;  5GLB A;  3U4L P;  1XP4 A;  4EES A;  2B95 A;  5JYP A;  3GV9 A;  1XJ4 A;  3EOI A;  3OCL A;  4I3J A;  1F5M A;  3B33 A;  1KVM A;  1K56 A;  3SS3 A;  4O01 A;  5DF8 A;  4GCZ A;  5HWW A;  3LCE A;  1V9Y A;  2EX9 A;  4GD6 A;  1BSG A;  3P7N A;  4OLD A;  5HW3 A;  3BFD A;  3UB9 A;  2PD7 A;  5F69 A;  4RX2 A;  3OC2 A;  1SDN A;  2XK1 A;  4Z1W A;  4OOY A;  2E8I A;  4JXV A;  3G2Y A;  3LR3 A;  4I5S A;  3AGD A;  3HLB A;  4RX3 A;  4OQH A;  2WAE A;  2K2N A;  4OLG A;  5DF9 A;  2XRO A;  4RYE A;  4BBV A;  3K3C A;  3NOT C;  1IYS A;  1OTD A;  3MQ0 A;  3NDE A;  4OOM A;  1FCN A;  5C5K A;  3Q81 A;  4HJ6 A;  3ZQ5 A;  1JWZ A;  4DMZ A;  4Y15 A;  4XUZ A;  3T4J A;  4HP9 A;  1XJ2 A;  3IBR A;  3UMD A;  3N4I A;  3E4Q A;  1Q2P A;  2KLI A;  3ZCZ A;  2EXA A;  1OTA A;  3IF6 A;  4E3O A;  3MXQ A;  1Q2Q A;  4KG5 A;  2KDK A;  4BEN A;  2WAD A;  3EGX C;  3GDI A;  3ZG5 A;  5L09 A;  5FAP A;  4IJG A;  4EQI A;  4BD0 A;  2ZL1 A;  4K0W A;  4R3A A;  4WEK A;  3C2W A;  3SH9 A;  3FV7 A;  3EEA A;  3H82 B;  3RXW A;  4NXG A;  3NI9 A;  2PRF A;  3N6I A;  3E2L A;  2B5R A;  3SW1 A;  1BLP A;  1ZKJ A;  2EA9 A;  5IHV A;  3SZT A;  1RGY A;  4FSF A;  5HAI A;  3B3X A;  3IHB A;  2BAS A;  2V0U A;  3N8L A;  3MMH A;  3CG5 A;  4X6T A;  4QB8 A;  5A93 A;  3PYP A;  4KZ8 A;  4CPK A;  1PZP A;  3HVF A;  3N7W A;  3WWX A;  4ID4 A;  4GN2 A;  1XJ3 A;  2VV7 A;  5CED A;  4P87 A;  4LRY C;  3BQA A;  4HH2 A;  3ZVW A;  2PYR A;  5E2G A;  3IH8 A;  1KGE A;  3BFC A;  5FAO A;  2ZMV A;  3NHQ A;  4HP4 A;  3E98 A;  1N9B A;  4P85 A;  1VQQ A;  2I9V A;  4HIA A;  1EI5 A;  4R23 A;  2ZC6 B;  3KYZ A;  2IA2 A;  5DJT A;  3T4T A;  3Q7Z A;  1JTD A;  2J9O A;  2ZD8 A;  3CPT A;  4GHI A;  1W8Y A;  4MN6 A;  4OVD A;  2V20 A;  1ONG A;  3OPP A;  4OPY A;  1I5Q A;  1TS8 A;  4KQR A;  1HLU P;  1G28 A;  4K91 A;  1IEL A;  3IBJ A;  1JVJ A;  3C5A A;  4JLF A;  2O9C A;  1L0G A;  4X1M A;  1ZG6 A;  1KDW A;  4JGO A;  5KSC A;  3IX3 A;  1PNE A;  5DFX A;  3WRZ A;  4GW9 A;  2YKF A;  4K08 A;  1PW1 A;  1ES4 A;  2PU4 A;  4ZBE A;  4GLQ A;  3TE8 A;  2VGL M;  3ZNY A;  4YIN A;  1SCW A;  4II7 A;  5EVI C;  1FR6 A;  4X55 A;  1W8Q A;  2QZ6 A;  2JKF A;  3NDG A;  2INW A;  3M6B A;  4KZ7 A;  3ITA A;  3UPP A;  3HLW A;  2OWJ A;  5EVI B;  3ZNT A;  2XFT A;  4WMC D;  1OTE A;  4X68 A;  4ZJ1 A;  1S4R A;  1VB6 A;  4MMN A;  4DE1 A;  3OBF A;  1S0W A;  4U0X A;  1T18 A;  3BJN A;  3FKV A;  3RTY A;  3CI6 A;  2VKS A;  5DTT A;  3GRJ A;  3OLO A;  2EX2 A;  1GSX A;  4NEE D;  5HPI A;  1N9N A;  1PZO A;  4B9O A;  1KE0 A;  1OPX A;  4R0Q A;  1T1B A;  5HWT A;  3V3S A;  2P9V B;  5EE8 A;  1MC0 A;  5FEG A;  4NKP A;  3CLO A;  1FIL A;  3VE4 A;  2DCF A;  5FQK A;  2Y2H A;  4MBF A;  2XD5 A;  1M6K A;  1MY8 A;  1TS6 A;  1GA9 A;  1WA9 A;  1K6S A;  5GL9 A;  3HLG A;  1ZTU A;  3T1S A;  3CAX A;  1P9R A;  5CHM A;  5CGX A;  4P6B A;  1S1Z A;  1OT6 A;  2GX5 A;  2JKR I;  1VET A;  5L10 A;  1NYY A;  5F5Y A;  3NJA A;  1BTL A;  3QNB A;  3NIA A;  4PPR A;  1FCO A;  3ZG9 B;  4GDB A;  1I2W A;  3KYQ A;  5AQA A;  1L2S A;  4U3T A;  4YFM A;  3GQZ A;  2V1B A;  1PFL A;  4Y0U A;  5HD5 A;  3A3I A;  3S1Y A;  1XGI A;  2ZQA A;  3C4O A;  3TJZ C;  4L9G A;  4QWO A;  2VX8 A;  2P04 A;  2Z2M B;  5TJJ A;  5F82 A;  1F9I A;  2ZM2 A;  3VSL A;  4I3I A;  2P7J A;  1LL5 A;  1LHY A;  3MF0 A;  1VEU A;  2CC1 A;  5I5L A;  5EM1 A;  2Y59 A;  1OJ5 A;  3LIA A;  1MBL A;  2VV8 A;  4C6Y A;  5GLA A;  2QJ7 A;  4IHQ A;  1JNU A;  4LFU A;  3FC7 A;  5AQ9 A;  4FH4 A;  3T1R A;  2R78 A;  4OPZ A;  3LFV A;  1NWZ A;  1BZA A;  3MR0 A;  2PHY A;  5EUA A;  4GNU A;  4DN0 A;  5M18 A;  2Y2Q A;  1PI4 A;  3HJK A;  3WS5 A;  3EEH A;  4FOF A;  4NXE A;  3LR5 A;  5EPH A;  2V8F A;  2DMW A;  2EXB A;  1LL8 A;  2KX6 A;  3UPN A;  1RGZ A;  3GR2 A;  5G4Y A;  5D3O A;  1P0Z A;  3CJM A;  4PKY G;  3HLE A;  1TDL A;  1MKI A;  5CEB A;  4ZAM A;  5HL1 A;  2BG1 A;  4ZRR A;  4OQ0 A;  2HP6 A;  1WYC A; 
#chains in the Genus database with same CATH homology
 4WYY A;  4KZA A;  3OCL A;  5GLD A;  1IYO A;  4KQQ A;  4NK3 A;  3GTC A;  4EBL A;  1GHP A;  2VGJ A;  2WYX A;  3VFF A;  1KVM A;  5BOH A;  2A49 A;  1K56 A;  2HP5 A;  2P9V A;  4OPR A;  3N8S A;  4OKP A;  3SS3 A;  1KGG A;  3BFF A;  4OOL A;  3BFG A;  5DF8 A;  1IYP A;  4DDS A;  4L0L A;  4KZ9 A;  4S2J A;  3LCE A;  5HAP A;  3UO9 A;  5J8X A;  4JBF A;  2EX9 A;  4WZ5 A;  4MEZ A;  4B88 A;  1G6A A;  1YT4 A;  4GD6 A;  1BSG A;  1L0D A;  4GOG A;  1EWZ A;  4Y7P A;  4OLD A;  5GHX A;  4WMC A;  4KZ5 A;  5DF7 A;  4OP8 A;  4N9L A;  2V2F F;  4FD8 A;  3ZGA B;  3G31 A;  4DE2 A;  3PBQ A;  5HW3 A;  2ZLY A;  1CEF A;  3BFD A;  1FSY A;  5F1F A;  3OPL A;  4WZ4 A;  4RX2 A;  3OC2 A;  1SDN A;  3M2J A;  4MBK A;  2XK1 A;  4QHC A;  5CER A;  1NZU A;  2R9W A;  2WGV A;  4JXW A;  4QY5 A;  1LI0 A;  1RCJ A;  4OOY A;  2E8I A;  5TFQ A;  1MPL A;  3G30 A;  4E3M A;  4JXV A;  4QD4 A;  3FYZ A;  4S2K A;  4KZ4 A;  5EVI D;  3G2Y A;  3PBT A;  3ZVT A;  1KVL A;  4U0T A;  3IF6 C;  3AGD A;  3HLD A;  3HLB A;  1CI9 A;  4RX3 A;  1XA1 A;  4OQH A;  4PM9 A;  5TGF A;  2WAE A;  5CTN A;  5FQ9 A;  4OLG A;  5DF9 A;  1CK3 A;  4E3L A;  3VP3 A;  4C75 A;  3MZD A;  1CEG A;  5EOO A;  3TSG A;  4RYE A;  3VP2 A;  1YQS A;  2Q9N A;  1HVB A;  1K55 A;  2HDR A;  5FAS A;  1FOF A;  1IYS A;  1M40 A;  2UWX A;  5GHY A;  1RP5 A;  3NDE A;  2ZQ7 A;  4OOM A;  3HL9 A;  1FCN A;  1PYY A;  3IF6 B;  3ZG8 B;  1XKZ A;  5E43 A;  3Q81 A;  1ES3 A;  1G68 A;  4BQM A;  1JWZ A;  4B4Z A;  2IWD A;  4JXG A;  5EOE A;  1VM1 A;  3WS1 A;  2RCX A;  1MXO A;  4XUZ A;  4IVI A;  3V3R A;  3UDX A;  4E3N A;  5DVA A;  1IYQ A;  1MWU A;  1QME A;  3MXR A;  3N4I A;  3G34 A;  3WS0 A;  4DE0 A;  1ESU A;  4E3K A;  3SS5 A;  3A3F A;  1Q2P A;  2XF3 A;  4UA9 A;  1YLZ A;  3I7J A;  2OLU A;  3ZCZ A;  4QY6 A;  2EXA A;  1YMS A;  5AQB A;  3IF6 A;  1YM1 A;  4EBP A;  4E3O A;  2JE5 A;  2WZX A;  3AGF A;  4R3B A;  3AGE A;  1Q2Q A;  4KG5 A;  3WS4 A;  1BT5 A;  3ITB A;  4BL2 A;  3PAE A;  3IXH A;  4LV1 A;  4BEN A;  2WAD A;  4DE3 A;  3PBS A;  1H5X A;  1I2S A;  3IT9 A;  1HZO A;  3W4O A;  2DRW A;  4LEN A;  3ZG5 A;  3IF5 A;  5FAP A;  3BEB A;  4DXB A;  4JF6 A;  2QPN A;  5EVL A;  4EQI A;  4OH0 A;  2PBY A;  2Y2K A;  1E3U A;  1NYM A;  4Y0T A;  4BD0 A;  4RA7 A;  4BJP A;  3ZDJ A;  4K0W A;  5F83 A;  1JWV A;  3QNC A;  4WEK A;  3WS2 A;  4BLM A;  3VP4 A;  3MFD A;  3SH9 A;  3FV7 A;  3TOI A;  2WGW A;  2Y2M A;  3S22 A;  3RXW A;  3NI9 A;  3N6I A;  5CHU A;  3IXG A;  2Y2O A;  3GMW A;  2XR0 A;  3HBR A;  3CZD A;  3E2L A;  5G18 A;  2B5R A;  2Y2N A;  5CHJ A;  2GDN A;  3ZHH A;  3Q7V B;  1BLP A;  4X53 A;  3BFE A;  1ZKJ A;  4EBN A;  1LL9 A;  3OZH A;  5IHV A;  3SH7 A;  4EV4 A;  2HDU A;  1ZG4 A;  5GLC A;  1RGY A;  1IKG A;  4FH2 A;  4FSF A;  2XDM A;  3DTM A;  5HAI A;  3B3X A;  1O7E A;  3IHB A;  1YLJ A;  4UA7 A;  1S6R A;  2ZMA A;  3N8L A;  3VP1 A;  4KZB A;  1FR1 A;  2ZQ9 A;  3CG5 A;  4DF6 A;  4X6T A;  4QB8 A;  5A93 A;  1XX2 A;  4E6X A;  4UAA A;  4KZ8 A;  4UA6 A;  4OQI A;  4CPK A;  3VFH A;  1PWG A;  1PZP A;  3HVF A;  2G2W A;  4IBX A;  3N7W A;  3QHY A;  4S2L A;  2J8Y A;  3WWX A;  3Q7V A;  4WEJ A;  4ID4 A;  4UHU A;  2Y55 A;  2HDQ A;  1ONH A;  2HP9 A;  5FSR A;  4GN2 A;  2Y4A A;  5CED A;  4P87 A;  3HLF A;  2G2U A;  5M19 A;  3UE1 A;  3ZVW A;  3DWZ A;  4KQO A;  3OPH A;  5E2G A;  1W5D A;  1KGE A;  3IH8 A;  3NBL A;  1MWS A;  3BFC A;  5FAO A;  2ZC3 B;  4B4X A;  2X71 A;  5CTM A;  1KE4 A;  1PI5 A;  2R9X A;  1N9B A;  3EQU A;  3IQA A;  3M6H A;  4XXR A;  2WKH A;  3MXS A;  4GZB A;  1VQQ A;  4P85 A;  5E2H A;  5HAR A;  1K6R A;  1BLH A;  1NXY A;  1EI5 A;  2DNS A;  4R23 A;  2ZC6 B;  3V39 A;  3PBN A;  3G2Z A;  3ZG0 A;  2OV5 A;  1ERQ A;  1HTZ A;  4WM9 A;  1SKF A;  3NC8 A;  3Q07 A;  3Q7Z A;  3HUM A;  4NET A;  1JTD A;  3UY6 A;  2H0Y A;  3FKW A;  2J9O A;  1W7F A;  2ZD8 A;  4FCF A;  4QU3 A;  3LO7 A;  2QMI A;  4PM6 A;  3SOI A;  3UDI A;  3PBR A;  2XQZ A;  1JWP A;  1W8Y A;  2ZQ8 A;  4OVD A;  1TVF A;  4MLL A;  3A3D A;  2V20 A;  1ONG A;  3OPP A;  3G4P A;  4HBU A;  4OPY A;  3VMA A;  1I5Q A;  4KQR A;  1J9M A;  1MWT A;  1IEL A;  4K91 A;  4WBG A;  2WK0 A;  1JVJ A;  3O87 A;  3P09 A;  4Z9Q A;  3C5A A;  4JLF A;  4HEF A;  3MKE A;  2HDS A;  4S2N C;  5A91 A;  1L0G A;  2HPB A;  1ZG6 A;  3RXX A;  1FSW A;  4E6W A;  4GDN A;  1KDW A;  3RJU A;  5KSC A;  4F94 A;  4K0X A;  3MKF A;  1H8Z A;  2ZQD A;  2I72 A;  3WRZ A;  1DJC A;  1PW1 A;  5CXW A;  1FCM A;  5EEC A;  1PIO A;  4PM7 A;  1ES2 A;  1ES4 A;  2PU4 A;  4ZBE A;  3G32 A;  4KZ6 A;  1K38 A;  3W4P A;  2WGI A;  1ERM A;  3ZNY A;  2EX8 A;  3IXD A;  4GB7 A;  4PMA A;  1SCW A;  4S2M A;  4YIN A;  5FQQ A;  5EVI C;  1FR6 A;  4X55 A;  1K56 D;  2Y2P A;  1W8Q A;  4N9K A;  5FI6 A;  3O3V A;  5FDH A;  4DRT A;  2QZ6 A;  2A3U A;  2J7V A;  3S4X A;  3NDG A;  3M6B A;  3A3J A;  1U60 A;  3DW0 A;  4KZ3 A;  4R4R A;  4KZ7 A;  5M1A A;  3ITA A;  3IWI A;  3UPP A;  3C7V A;  4HBT A;  3HLW A;  1E4D A;  5F1G A;  4EWF A;  3GSG A;  1WE4 A;  2ZC4 B;  3LEZ A;  4S2N A;  1KE3 A;  4MNR A;  5EVI B;  3VOY A;  3ZNT A;  2XFT A;  1NRF A;  5U47 A;  4WMC D;  1QMF A;  3P98 A;  3UNW A;  2WKE A;  2X01 A;  1TDG A;  5DTK A;  1GHM A;  4X68 A;  5AQ7 A;  4ZJ1 A;  3W4Q A;  1XA7 A;  4DDY A;  3UDF A;  5CGW A;  4DE1 A;  1BUE A;  1S0W A;  3OCN A;  3PBO A;  3LY4 A;  2EFU A;  4U0X A;  5TR7 A;  3BEC A;  2PU2 A;  2IWC A;  2ZQC A;  2EFX A;  1H8Y A;  2H0T A;  3FKV A;  1MWR A;  5DTT A;  1IEM A;  3CMZ A;  3GRJ A;  3V50 A;  4S2O A;  2EX2 A;  4R3J A;  2XLN A;  5EVI A;  5HAQ A;  2FFF B;  3E2K A;  1IKI A;  2OSU A;  5KMW A;  3IXB A;  1CI8 A;  1PZO A;  1BLC A;  1KE0 A;  3EQV A;  2Y2L A;  4Y0O A;  1L0F A;  3NY4 A;  4OPQ A;  2BLS A;  4WZ5 C;  4R0Q A;  3ZG7 B;  2FFY A;  4BL3 A;  4E3I A;  3V3S A;  5GHZ A;  2P9V B;  2H5S A;  4OQG A;  5EE8 A;  4GD8 A;  1ALQ A;  1LI9 A;  3GVB A;  3IH9 A;  4PM5 A;  1Z6F A;  5A92 A;  4JF4 A;  2DCF A;  5FQK A;  1YMX A;  1Y54 A;  1KDS A;  2XD1 A;  2Y2H A;  4MBF A;  2XD5 A;  1M6K A;  3V5M A;  2WKI A;  3UE3 A;  3PAG A;  1E25 A;  1MY8 A;  4HES A;  3OPR A;  2ZJ9 A;  3SH8 A;  1GA9 A;  3WRT A;  4KG2 A;  4N1H A;  1K6S A;  4P0M A;  3HLG A;  5GL9 A;  5FQJ A;  2P74 A;  3JYI A;  5A90 A;  4EUZ A;  5CHM A;  1AXB A;  2JBF A;  4JXS A;  5CGX A;  4P6B A;  1BUL A;  2VGK A;  1N4O A;  4ZJ3 A;  1NYY A;  4ZJ2 A;  1KGF A;  1BTL A;  5CGS A;  1GHI A;  1LLB A;  1W79 A;  3IWQ A;  4ZDX A;  1K55 C;  1YLP A;  3NCK A;  1K57 C;  3MZE A;  3NIA A;  3QNB A;  1XPB A;  1FCO A;  4PPR A;  3ZG9 B;  1PWC A;  4GDB A;  3N8R A;  2RL3 A;  1E3U D;  1I2W A;  5AQA A;  1L2S A;  4PM8 A;  4O7D A;  1DY6 A;  4U3T A;  4YFM A;  3GQZ A;  1K25 A;  1PWD A;  2Y2G A;  1YLW A;  4Y0U A;  1SDE A;  3C4P A;  3A3I A;  3S1Y A;  2OLV A;  1XGI A;  2JC7 A;  2ZQA A;  1SHV A;  3C4O A;  4S2P A;  3IHA A;  4BD1 A;  2XEP A;  3UPO A;  3PTE A;  4LV3 A;  2Z2M B;  4QJG A;  3DWK A;  3M2K A;  4M3K A;  1GCE A;  2ZC7 A;  1O07 A;  2Y2J A;  3ISG A;  5F82 A;  2ZM2 A;  3VSL A;  2X02 A;  1ERO A;  3HUO A;  1FQG A;  2C6W B;  1LL5 A;  1XGJ A;  2WAF A;  4A5R A;  3D4F A;  1XXM A;  3SS4 A;  2ZC5 B;  5I94 A;  3BLM A;  1ES5 A;  5JYO A;  1LHY A;  3MBZ A;  5CRF A;  2CC1 A;  4ZTK A;  5FA7 A;  1ZC2 A;  5E2E A;  1K57 A;  3FWL A;  2XH9 A;  1NZO A;  1K54 C;  2Y59 A;  4OON A;  3VP0 A;  4LV0 A;  5L2F A;  1MBL A;  2WUQ A;  4C6Y A;  2WZZ A;  3HLC A;  3Q82 A;  5GLA A;  5FQI A;  3HUN A;  2ZM0 A;  4IVK A;  4KEN B;  5CEC A;  5E2F A;  2XGN A;  3O86 A;  5AQ9 A;  4JPM A;  4FH4 A;  4IED A;  1OME A;  3UN7 A;  1GA0 A;  3FZC A;  4N92 A;  4OPZ A;  1PW8 A;  4LCM A;  4WEL A;  3VSK A;  2J9P A;  1BZA A;  4XUX A;  5KZH A;  5FI7 A;  3G35 A;  3HRE A;  4H8R A;  5HFO A;  4LV2 A;  3VOZ A;  3C7U A;  2Y91 A;  4GKU A;  1ESI A;  1YLT A;  2H10 A;  5EUA A;  4R4S A;  2WGW B;  4GNU A;  3W8K A;  4RVA A;  2C5W B;  2ZM8 A;  1K4E A;  3BLS A;  5HX9 A;  5M18 A;  5FAT A;  2Y2Q A;  2JCH A;  1HD8 A;  1YLY A;  4IBR A;  4E3J A;  4MBH A;  1DJA A;  5FAQ A;  1PI4 A;  4JKT A;  1WYB A;  4DKI A;  4X56 A;  1JTG A;  5DTS A;  3WS5 A;  2Q9M A;  4N1X A;  4KG6 A;  4X69 A;  5FI2 A;  5EPH A;  3BYD A;  4C3Q A;  4CJN A;  1C3B A;  1K54 A;  1L0E A;  2XFS A;  3IWO A;  4D2O A;  1NY0 A;  3Q1F A;  1BLS A;  2EXB A;  4S2I A;  3TG9 A;  5KSH A;  3UE0 A;  3UPN A;  1RGZ A;  3ZFZ A;  3GR2 A;  1NJ4 A;  3BRM A;  4JF5 A;  3BM6 A;  4LCL A;  3MZF A;  1DJB A;  2IWB A;  5D3O A;  3CJM A;  4R1G A;  3HLE A;  2Z2L B;  5FQM A;  1TDL A;  1MKI A;  2EX6 A;  3LY3 A;  5GLB A;  4DXC A;  4Q8I A;  5CEB A;  1XP4 A;  4ZAM A;  5HL1 A;  2BG1 A;  1K4F A;  3A3E A;  3O88 A;  4OP5 A;  2V1Z A;  4OQ0 A;  2Y2I A;  5JYP A;  2HP6 A;  3GV9 A;  1WYC A;  1TEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...