1FCNA

Crystal structure of the e. coli ampc beta-lactamase mutant q120l/y150e covalently acylated with the substrate beta-lactam loracarbef
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
358
structure length
352
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLLVPDEVKSSSDLLRFYQNWQPAWAPGTQRLEANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Crystal Structures of Substrate and Inhibitor Complexes with AmpC -Lactamase: Possible Implications for Substrate-Assisted Catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 102
structure length 352
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1fcnA00
2ZJ9A 1DJCA 4GZBA 4LENA 1IKGA 3Q7VB 4D2OA 3ZHHA 1XX2A 1RGYA 1K54C 4RX2A 1K6SA 4KZ5A 1E3UD 3N4IA 3WS4A 4HEFA 4WMCD 3ZDJA 1BLHA 1EI5A 3GSGA 3FWLA 4OQ0A 5EVID 3AGEA 3HLEA 3VP0A 1C3BA 1MPLA 3A3JA 3AGFA 2HDRA 4FH4A 1K4FA 2QZ6A 1CEFA 3ISGA 3BFFA 4MLLA 5FQJA 2H5SA 1VM1A 3IWOA 5AQBA 2Y2GA 1CK3A 3MXSA 1ESIA 2HDUA 2QPNA 2ZC7A 3BYDA 2Y2PA 3NCKA 2XF3A 1SKFA 3GV9A 1LHYA 2Y2MA 2Y2OA 3IHBA 4R3JA 1KE3A 5DTTA 1JWZA 1MXOA 3LO7A 4WELA 4P85A 3Q82A 1Y54A 3BRMA 4OQGA 1XXMA 4EQIA 2Q9MA 3LY4A 3SH7A 4IBXA 5FA7A 3HVFA 4X6TA 2RCXA 4JF4A 3UE3A 3PTEA 1BT5A 1HTZA 1FR1A 2J9PA 4YINA 4MBFA 3D4FA 3PBQA 1ERMA 4S2IA 5F1GA 2WZXA 4OPRA 4GDBA 4KZ9A 4C75A 2ZC3B 2ZQ8A 2ZLYA 3HLBA 4KG2A 3SS4A 2XD5A 1BSGA 2WKEA 4QHCA 1GA9A 3ZCZA 1FCNA 1W5DA 3VSKA 2XGNA 3S1YA 3BLSA 4HBUA 3MZDA 3ZFZA 4LV3A 3A3FA 3FYZA 1IKIA 3BFEA 4OQHA 2DNSA 4OPYA 4GKUA 2HPBA 3W4QA 2Y2LA 3VP4A 4S2OA 4BLMA 4DE0A 1J9MA 1W8YA 4FH2A 1FR6A 4KZ3A 4P87A 4OP8A 1MWUA 3OZHA 4S2NC 4KQOA 2Y2HA 3Q1FA 2ZC5B 4X69A 3VOYA 2A3UA 3ITBA 3PBRA 1E3UA 4X55A 5CXWA 2EFXA 4WMCA 2Z2MB 1U60A 5JYOA 2XH9A 4XXRA 3QNBA 4QY6A 1SDNA 4JXWA 2ZM2A 3MBZA 3ZG7B 4NK3A 4S2KA 4JF6A 1KVLA 1TDLA 2J8YA 1ESUA 2WKHA 4MNRA 3BFGA 3FKWA 4XUXA 5DF9A 3Q81A 3NDGA 2Q9NA 2FFYA 3PAGA 5E2GA 3N8LA 1L0GA 3WS2A 4OVDA 3ZVWA 5FQ9A 1MWTA 1NYMA 4X53A 4ZBEA 1YLYA 5CGXA 3VFHA 1K6RA 2H0YA 1ONGA 4Z9QA 4R0QA 5FAPA 1HD8A 1LL9A 4E3OA 1GA0A 3O88A 2G2WA 1FSWA 5EOOA 1TDGA 5E2HA 4DRTA 3UE1A 2WGWA 1ES3A 3UPOA 3IXHA 3PBNA 3IXBA 1WYBA 4KENB 3MZFA 5GL9A 4C6YA 5AQ9A 4KZ7A 2XR0A 1H8YA 4U3TA 4XUZA 1Q2QA 2ZC4B 2XD1A 5AQ7A 4PM7A 4OKPA 3W8KA 5GLAA 5FASA 1PZOA 4OPZA 2IWCA 2Y59A 2EFUA 3N8SA 3BLMA 3NBLA 3OPPA 4KG6A 3WRZA 3WS0A 4S2LA 1N4OA 4DXCA 3DWZA 3IH9A 3RJUA 3TOIA 5KSCA 4WZ5C 1K56A 5CRFA 5DF7A 4X68A 1RGZA 4E3NA 3BFDA 1G6AA 1PZPA 5HL1A 2ZD8A 5BOHA 3V5MA 1MWSA 5HX9A 3OPHA 5TR7A 4OOMA 4KQRA 3SH8A 1JWVA 1L2SA 5CTMA 3ZNTA 3WS1A 2ZC6B 2EX6A 4KZ4A 1K4EA 4JF5A 4P0MA 2EXBA 5CGWA 2BLSA 5EVLA 5FI6A 4RX3A 5GHXA 4QJGA 3MKEA 1EWZA 2E8IA 3HUMA 3VP2A 5A90A 4F94A 1MY8A 3SOIA 3GTCA 4PM9A 1NZOA 1PYYA 3NY4A 4E3IA 4R4SA 3BECA 2OLVA 3UDFA 4NETA 4Y0TA 2R9XA 4PM6A 2XK1A 1ONHA 1KDSA 2P9VA 4GDNA 3IHAA 4P6BA 1I5QA 4ZJ2A 1W8QA 4S2JA 2ZMAA 1FCMA 1O7EA 1XGIA 3HUNA 3ZG5A 3NDEA 4ZJ3A 3W4OA 4DKIA 3TG9A 3EQVA 3MFDA 3UPNA 1QMEA 4LV1A 2JCHA 4N9KA 1YMXA 3CJMA 1MKIA 1BTLA 4UA6A 3WS5A 4BJPA 3IF6A 2WZZA 3UNWA 4KZBA 3O87A 3GR2A 3VFFA 1VQQA 4O7DA 1DY6A 2WGVA 5EUAA 2WADA 4X56A 1XPBA 1PWGA 5E2FA 2JBFA 4KQQA 3PBSA 4JXGA 4EBNA 4MBKA 4JBFA 1KGGA 3G4PA 3O86A 4IEDA 5DF8A 1IEMA 4KZ8A 1M6KA 2P74A 4LV0A 4JLFA 4CPKA 2VGJA 4K91A 4E3JA 4HESA 3ZG8B 4ZDXA 2BG1A 4LCLA 4CJNA 4QB8A 3A3EA 1S0WA 5CHMA 3CZDA 5DTKA 3QNCA 3PAEA 4FSFA 1XGJA 2Z2LB 4ZTKA 1S6RA 1LLBA 2JC7A 1YLTA 3GRJA 1JWPA 5EVIA 3HLFA 1K38A 4R1GA 3C7UA 5DVAA 3VSLA 5CHUA 4EBPA 5CERA 5HAPA 3HLCA 5FQMA 4YFMA 2B5RA 5D3OA 1ZKJA 3QHYA 5AQAA 3UPPA 3W4PA 4A5RA 2HP9A 4EV4A 5KSHA 4BQMA 1SDEA 4OH0A 1L0FA 2Y2NA 3B3XA 4S2PA 5G18A 3NIAA 5FATA 2I72A 3ITAA 1W79A 2ZQ9A 3G30A 4RYEA 2ZM0A 1XA1A 1NYYA 3HREA 3N8RA 4WBGA 5EPHA 4GD8A 3SS5A 1ALQA 2ZQAA 2QMIA 3DW0A 3N6IA 4Y7PA 1I2SA 4WM9A 4EUZA 1RCJA 3G34A 4PPRA 1BUEA 4RA7A 2WAEA 1E4DA 3OCLA 5HAIA 3IF6B 1M40A 5FQKA 4M3KA 1IYPA 1K55A 3OC2A 4OP5A 4WZ4A 5FAQA 3ZG9B 4BD1A 3LCEA 3WWXA 2DRWA 2R9WA 3IT9A 5HW3A 4B88A 5CEBA 3IF6C 3NI9A 5EECA 4S2MA 2FFFB 4GB7A 1CI8A 2V2FF 4KG5A 5IHVA 4BL2A 3VOZA 1QMFA 5GLDA 2Y55A 1K57A 1JTDA 5L2FA 1FCOA 1YMSA 4R3BA 1JTGA 1LL5A 4L0LA 2Y2QA 5JYPA 4RVAA 4E6WA 3G2ZA 4ZAMA 1YLWA 2EX8A 2JE5A 3N7WA 1FOFA 5CTNA 1IYOA 1PI5A 2X02A 3EQUA 3PBTA 3FZCA 1YLPA 1L0DA 4QD4A 1YLZA 4QU3A 3SH9A 3UDIA 2HP5A 1Q2PA 4N9LA 5FSRA 3V50A 1GHIA 1JVJA 3I7JA 3WRTA 4DE3A 4UAAA 4BENA 3G2YA 3DTMA 5EVIB 1ES4A 4H8RA 3ZGAB 3C4PA 4Y0UA 4N1HA 5A92A 1XKZA 1GHMA 5GHYA 4UA7A 2H0TA 4KZ6A 3UE0A 3UDXA 4E3KA 3G31A 3SS3A 4UHUA 3LEZA 4S2NA 5EVIC 4N92A 3IQAA 3O3VA 4OPQA 4B4XA 1NJ4A 3HUOA 2G2UA 3BM6A 5GLBA 5I94A 1KGFA 1FSYA 3BEBA 1BLPA 5DTSA 2C5WB 3CG5A 3NC8A 5E43A 1H5XA 1H8ZA 4PM5A 1PW8A 2Y2IA 1ERQA 5HFOA 5J8XA 3IWIA 4K0WA 4GN2A 2XEPA 4ID4A 1HVBA 2OLUA 3UO9A 4DDYA 2PU4A 5A91A 5M1AA 4R4RA 3A3IA 1FQGA 3RXWA 1XA7A 4OONA 3C4OA 2Y2JA 3HL9A 1LI0A 1LI9A 1MBLA 3C7VA 4OOLA 4IVKA 5M18A 2WGWB 1PIOA 2H10A 3MKFA 3E2KA 3OCNA 2WAFA 4HBTA 5F83A 4IBRA 1BZAA 2EX9A 2OSUA 1Z6FA 1WYCA 3IWQA 3M6BA 3IH8A 4GNUA 5FQQA 3FV7A 3G35A 2ZQ7A 1CI9A 3A3DA 1K55C 3HLGA 5EOEA 2Y2KA 2J7VA 2HDSA 5FI2A 3ZVTA 3G32A 2ZQDA 4JPMA 5FAOA 1NXYA 1GCEA 5FQIA 2WGIA 3S4XA 2C6WB 2DCFA 3M2KA 3UY6A 5CECA 1K57C 4OLDA 1AXBA 3Q07A 3HLDA 4R23A 1IYQA 1KE4A 4ZJ1A 5TFQA 4MBHA 2XFSA 4Y0OA 2WKIA 3FKVA 5CGSA 5E2EA 4KZAA 2UWXA 3GMWA 4JXVA 1ES5A 1WE4A 2PBYA 3IF5A 5FI7A 3VP1A 1DJBA 3JYIA 1HZOA 1L0EA 3DWKA 5KMWA 4K0XA 3VMAA 1ZC2A 1PW1A 2WUQA 2Y4AA 1K56D 3P98A 4FD8A 5M19A 4OLGA 1K54A 2Y91A 4WZ5A 2PU2A 3IXDA 4PMAA 2VGKA 1TEMA 3UN7A 5HAQA 1PI4A 2GDNA 2ZQCA 2IWBA 5CEDA 2HDQA 3Q7VA 1PWDA 2HP6A 2A49A 1ZG4A 1BULA 4U0XA 4LCMA 5EE8A 4E3LA 1KE0A 5F82A 1CEGA 4FCFA 4DDSA 3V3SA 3P09A 2P9VB 5F1FA 4WEJA 1RP5A 1KVMA 1IELA 2XLNA 5CHJA 1W7FA 3M6HA 1NY0A 3LY3A 2J9OA 2RL3A 3BFCA 2XDMA 4Q8IA 3AGDA 4B4ZA 1SCWA 4IVIA 3V39A 2IWDA 4U0TA 3HLWA 3ZG0A 4BD0A 1DJAA 3RXXA 4DE2A 1ZG6A 3GQZA 1KGEA 1TVFA 5HARA 2EXAA 4OQIA 3V3RA 4OOYA 4JXSA 4E3MA 1YT4A 4JKTA 4EBLA 2WYXA 3HBRA 1YM1A 3E2LA 1BLSA 1IYSA 3MXRA 4QY5A 4BL3A 3OPRA 5U47A 4GD6A 2V20A 1KDWA 1N9BA 1ES2A 1YLJA 3C5AA 1MWRA 1GHPA 2WK0A 3VP3A 2X01A 2CC1A 3OPLA 1K25A 2XFTA 3Q7ZA 4MEZA 4N1XA 4DE1A 1XP4A 2V1ZA 4DF6A 4GOGA 1NRFA 3M2JA 5GLCA 3S22A 1I2WA 2X71A 1G68A 3GVBA 3IXGA 1O07A 4WYYA 1PWCA 4UA9A 5FDHA 2ZM8A 1NZUA 4WEKA 1EROA 5TGFA 3MZEA 2OV5A 3ZNYA 4DXBA 2EX2A 4LV2A 1YQSA 1OMEA 1BLCA 4PM8A 3CMZA 1E25A 4C3QA 5KZHA 3PBOA 4EWFA 2XQZA 5GHZA 1SHVA 4E6XA 3TSGA 5A93A
chains in the Genus database with same CATH superfamily
2ZJ9A 3D9YA 1DJCA 3CAXA 4LENA 1XJ3A 4Y13A 1XX2A 1K54C 5CX7A 1S1YA 3H82A 3DTIA 4HEFA 1BLHA 4JGQA 2W1TA 3A3JA 4WUJA 1MZUA 3BFFA 2O9BA 1X0OA 4ME4A 1S4RA 2VZWA 5AQBA 3UMEA 1A0KA 1VEUA 4DJ2A 1SKOA 2W3DA 2ZC7A 3BYDA 4FOFA 1XJ2A 2XF3A 3E4OA 1EW0A 1LHYA 2Y2OA 3OBFA 1S67L 2V8CA 4R3JA 1P97A 1KE3A 3QP5A 4P85A 3Q82A 2VKSA 2L4RA 2HJEA 3DTKA 3SH7A 4X6TA 2RCXA 4JF4A 1BT5A 2J9PA 1FR1A 4X1LA 5F1GA 2WZXA 4OPRA 4KZ9A 2ZC3B 2ZQ8A 2XD5A 4QHCA 1GA9A 3S1YA 1MC0A 4HNBA 3BFEA 2W3FA 5HDSA 3W4QA 3VP4A 4BLMA 1J9MA 1W8YA 1FR6A 1ODVA 3OZHA 4S2NC 4KQOA 4X69A 2Z2MB 2XH9A 3QNBA 3L7HA 2ZM2A 3MBZA 5L10A 5IT5A 2M7UA 5DJUA 3ZG7B 1ESUA 3FKWA 4XUXA 3Q81A 2FFYA 5E2GA 1L0GA 1MWTA 2QHKA 1YLYA 4HIAA 5CGXA 3FC7A 1K6RA 1ZHHB 5FAPA 1HD8A 4CQHA 2Z6CA 1FSWA 5EOOA 2V9AA 5E2HA 4DRTA 3UE1A 2WGWA 4C6YA 2OWHA 2QJ5A 2XR0A 4PM7A 3W8KA 3LIEA 3WS0A 3IH9A 3TOIA 4WZ5C 5C5KA 2ZD8A 5BOHA 4OOMA 3MSHA 1JWVA 4EERA 2HJ9C 3ZNTA 3QP8A 4KZ4A 2B18A 4G3VA 4I3JA 2EXBA 1N9OA 5EVLA 3KYEA 3S7OA 2JKGA 5A90A 1MY8A 2W1RA 3UDFA 4NETA 1ONHA 2HZ5A 3IHAA 1I5QA 3NDEA 3LGOA 4ZJ3A 3EQVA 5LBRA 3MFDA 4LV1A 2QYBA 4NEED 1MKIA 2O9AA 3WS5A 3IF6A 4KZBA 2OWJA 3VFFA 2WADA 1XPBA 4MBKA 4JBFA 3S7PA 1KGGA 3ZQ5A 5DF8A 1IEMA 4LRZE 3ZG8B 4ZDXA 1S1ZA 4QPRA 1S0WA 4HH3A 3C2WA 3CZDA 4EW7A 4FSFA 4ZTKA 1YLTA 1JWPA 1OTBA 2OAQ1 3HLFA 3T1QB 2GZAA 4WLAA 2KDKA 3C7UA 5DVAA 5CHUA 5CERA 3HLCA 4YFMA 3QHYA 3W4PA 5L07A 4BQMA 4MMNA 4OH0A 3B3XA 4S2PA 5EM1A 1W79A 3LI8A 4RYEA 3QP2A 2QMIA 4Y7PA 1I2SA 4O01A 1E4DA 1M40A 5FQKA 2QKPA 4XT2B 2M1CA 3OC2A 4OP5A 5FAQA 4BD1A 3KSIA 4B88A 5CEBA 3IF6C 2FFFB 1QMFA 1K57A 1JTDA 1JNUA 4I5SA 1JTGA 4L0LA 1G6OA 4RVAA 2OOLA 4NKPA 1YLWA 1IYOA 1UWNX 3FZCA 1YLPA 2PRFA 4QU3A 3UDIA 4Q0JA 3E98A 2GJ3A 3BQAA 3G2YA 1PRQA 5EVIB 1ES4A 3JVUA 4H8RA 4BMWA 4UA7A 4E3KA 5FEFA 4UHUA 4OPQA 2G2UA 4I3AA 1KGFA 2XRNA 2C5WB 3NC8A 1H5XA 1ERQA 4M4XA 5J8XA 3IWIA 4GS9A 2PYRA 4DDYA 5A91A 2LB5A 3NJAA 3C7VA 1UGUA 2ZMFA 4IVKA 5M18A 1PIOA 3MKFA 2WAFA 5F83A 4P6ZS 1Z6FA 1WYCA 5AVEA 1TS7A 2ZQ7A 5EOEA 2V0UA 3S7QA 2ZQDA 2WGIA 2ACGA 1K57C 4OLDA 5TFQA 1KE4A 3BJNA 2ZMVA 2VEAA 3P7NA 4F3LA 4Y0OA 2WKIA 3FKVA 5E2EA 1DJBA 5KMWA 4HOIA 1G5UA 1TEMA 4DJ3A 2GDNA 2ZQCA 1TS0A 1ZG4A 4U0XA 1KE0A 5F82A 5J7EA 1CEGA 1LL8A 4DDSA 3V3SA 5L8MA 3K3DA 4PAUA 2D01A 1W7FA 1NY0A 2XDMA 3FG8A 4MDZA 1OJ5A 4U0TA 2YKHA 4BD0A 1ZG6A 3GQZA 3QP1A 5HARA 3LR4A 2ZL1A 1BLSA 3C38A 1N9BA 3C5AA 2M7VA 2AVXA 1OT9A 3Q7ZA 2XFTA 1T1AA 2WKRA 4GOGA 1PWCA 1EROA 2A2LA 4DXBA 2EX2A 4YNRA 1OMEA 3GDIA 5KZHA 5GHZA 2DMWA 1IKGA 4RX2A 1K6SA 1E3UD 3N4IA 2L1MA 3WS4A 4WMCD 3ZDJA 5TBMB 4P6ZM 5EVID 5IS1A 2Z6DA 3AGEA 2E8JA 5DJTA 2HDRA 2A24A 3R7WB 3LR3A 3IWOA 2CMNA 3MXSA 3NECA 4IJGA 3GV9A 2Y2MA 3IHBA 1PNEA 3LO7A 4WELA 1Y54A 4LPZA 3ICYA 3FPVA 3NOPC 3PTEA 4MBFA 3PBQA 5IU1A 2J3WA 4GDBA 4HI4A 2ZLYA 4KG2A 4IUKA 1FCNA 1W5DA 2XGNA 1V9YA 3VE4A 4HBUA 3ZFZA 4LV3A 2ZOIA 1IKIA 2HPBA 3NOTC 4DE0A 1MKMA 4S2OA 2VJWA 3KYQA 3H82B 4OP8A 5F6AA 3VOYA 3PBRA 2EFXA 5JYOA 4QY6A 2J3TD 1SKOB 4MCWA 4NK3A 4S2KA 4NG2A 4NXGA 1KVLA 1FIKA 1UWPX 3BFGA 4LRXC 4OVDA 4D60A 1NYMA 4X53A 3PYPA 2ZBBA 1ONGA 3VE3A 3LI9A 1LL9A 2WKPA 2LB9A 4GLQA 1TDGA 3RH8B 4IHQA 1L3LA 3MZFA 3DBAA 2QWSA 4BBTA 4UEYA 2HF6A 1IOUA 1Q2QA 5AQ7A 2XSSA 5GLAA 5FASA 2XROA 4OPZA 2VX8A 4G3WA 1OPXA 5KSCA 5CRFA 5DF7A 3HJIA 2PYPA 3V5MA 1HLUP 3OPHA 4KQRA 2B02A 1ZTUA 1P0ZA 5K5BA 4RX3A 4ZRRA 3C8CA 5FL3A 4QJGA 2E8IA 4GHIA 4R4SA 3BECA 2OLVA 4PM6A 2P9VA 4P6BA 3ULFA 1W8QA 3EGDC 1V9ZA 1XGIA 3HUNA 3ZG5A 4DKIA 5L09A 1F98A 1SZVA 3H7WB 1QMEA 4N9KA 3E0YA 4UA6A 2WZZA 3GR2A 2R78A 3JPUA 1VQQA 1DY6A 4CLCA 1PWGA 5E2FA 4HJ3A 3A0RA 1TS8A 1YAXA 3G4PA 1GSVA 4KZ8A 1M6KA 5EFWA 4CPKA 4E3JA 4RQ9A 2BG1A 4LCLA 4CJNA 3A3EA 3V67A 2KOIA 1G28A 4JGPA 2Z2LB 3UB6A 4Y2FA 3GRJA 3T4KA 3PHYA 1OJGA 2B5RA 1ZKJA 1VB6A 4NXBA 4A5RA 4EV4A 1P9RA 3NOUC 3T4SA 3T4TA 2ZQ9A 3B47A 2ZM0A 4ARZA 3LICA 4WBGA 1CQAA 2K31A 4EU0A 3DW0A 4EUZA 3G34A 3IF6B 1XJ6A 1IYPA 1K55A 4H6JA 4WZ4A 2R9WA 5EECA 2JKTI 1CI8A 3MXQA 4KG5A 3TE8A 5GLDA 1FCOA 4B9OA 4R3BA 4CLCC 5JYPA 2Y2QA 3UB8A 5I5LA 2X02A 3EQUA 5F68A 5A8BA 2PR6A 3JVVA 1Q2PA 3V50A 3MMHA 3UB7A 2V8FA 4DE3A 4BBVA 3C30A 1GHMA 3MQOA 3IQAA 2JHEA 4L9GA 5HDDA 4BWIA 3HJKA 5I94A 1FSYA 2D02A 1BLPA 5E43A 1H8ZA 2Y2IA 5HFOA 2P08A 4GN2A 4WN5A 1HVBA 2OLUA 3UO9A 4WF0A 2W0NA 3RXWA 4OONA 3HL9A 4MN5A 1N9NA 1KOUA 1MBLA 1CJFA 2W3GA 1K0KA 4O8GA 3E2KA 3OCNA 1LSXA 4HBTA 5AVFA 2OSUA 4EETB 4WL9A 4YOFA 4Y3IA 3KSFA 5EV0A 1K55C 2GX5A 3PXPA 4JPMA 3RFBA 2I9VA 1NXYA 5FAOA 1GCEA 3S4XA 2C6WB 1AXBA 3HLDA 1IYQA 4MBHA 2XFSA 2P7JA 5CGSA 3NHQA 3GMWA 2VGLS 4JXVA 1WE4A 2PBYA 5FI7A 3VP1A 1L0EA 2JKRM 1ZC2A 2Y4AA 4FD8A 2Y91A 4GJ4A 2VGKA 1PI4A 1Y28A 3Q7VA 1NWZA 2HP6A 5EE8A 5F1FA 3M6HA 3LY3A 2HV1A 2FH5A 3BFCA 3T1SA 3ZYTA 4Q8IA 1SCWA 3V39A 1DJAA 3RXXA 1DP9A 3T4JA 4OQIA 4E3MA 2WYXA 3HBRA 3E2LA 5HD3A 4BL3A 4DN0A 5G4ZA 4GD6A 1YLJA 1MWRA 2WK0A 3VP3A 2X01A 3QP4A 4MEZA 3OLOA 2UV0E 4DE1A 4F3LB 3S22A 1I2WA 3F1OA 2ZM8A 4EESA 5TGFA 5HWVA 5HWWA 2OV5A 3ZNYA 4EUVA 1YQSA 3VOLA 2FZ0A 1W63M 2XQZA 4E6XA 3TSGA 3ZHHA 4KZ5A 1H0MA 1GSXA 1EI5A 3FWLA 4OQ0A 3VP0A 2W3HA 1C3BA 3AGFA 3KX0X 2QZ6A 3ISGA 4MLLA 3MR0A 4KUKA 1T1BA 2HDUA 2PT7A 4PKYG 2QPNA 1LSVA 3NCKA 2Y79A 2Q0OA 2VGLM 5FDSA 4R6LA 3H9WA 3BRMA 1XXMA 2Q9MA 3LY4A 1F2KA 4IBXA 3BWLA 4R3AA 2QJ7A 3CUEA 1HTZA 4YINA 2GNXA 2O0YA 4S2IA 3LIFA 4R70A 3K2NA 5KIZA 2BASA 4XT2A 4C75A 3SS4A 1D06A 1BSGA 2WKEA 2W3EA 3BLSA 2PHYA 3CPTA 1VETB 1W63Q 3FYZA 3KSGA 2DNSA 1AWIA 5HWTA 4P87A 3IS2A 2Y2HA 2A24B 1E3UA 2WKQA 5CXWA 3UMDA 4WMCA 4JXWA 2J8YA 4Y17A 4MNRA 2WKHA 5HD5A 2B95A 5G4YA 3MF0A 3PAGA 2EA9A 3WS2A 3R4KA 4ZBEA 1OT6A 3VFHA 4Z9QA 1OTIA 4R0QA 4E3OA 1GA0A 4I38A 1H8MA 4EEPA 3F1PA 5DFYA 3D3OA 1WYBA 4KENB 5GL9A 3BY8A 4KZ7A 3CUEC 4U3TA 4XUZA 2XD1A 5MC7A 2IWCA 2EFUA 3WRZA 3BLMA 4ESPA 3OPPA 4KG6A 4DXCA 3PR6A 1N4OA 3K3CA 3DWZA 1YKDA 2J80A 3T1XA 1K56A 4X68A 1RGZA 4E3NA 3LIBA 5HL1A 1MWSA 3LFVA 3SH8A 3TRCA 5CTMA 3EOIA 1GSWA 4EQ1A 4JF5A 4P0MA 2BLSA 5FI6A 1LT0A 3MKEA 1EWZA 3HUMA 3VP2A 4F94A 3CLOA 3SOIA 3LIAA 2XA7S 4PM9A 4E3IA 3NY4A 2ZOHA 4Y0TA 2R9XA 5FEGA 4GDNA 4ZJ2A 4Q0IA 1FCMA 3KYZA 2JCHA 4NXFA 2VK3A 3BW6A 3T12B 1YPRA 3UNWA 3O5YA 4HP4A 4JGOA 4O7DA 2WGVA 4PKYA 2K7SA 4KUOA 2JBFA 4KQQA 3U2AA 4UQIS 4IEDA 3HCYA 2L0WA 1D7EA 1XFNA 2P74A 4LV0A 4JLFA 3KO6A 3MJQA 3CITA 3B42A 3IX4A 5AJGA 3QNCA 2W1TB 1N9LA 1S6RA 1LLBA 4R1GA 3IX8A 3EWKA 1VEUB 3T4LA 2BTFP 3IBJA 4EBPA 4GHIB 5FQMA 4GCZA 5HAPA 5D3OA 3U4LP 1L0FA 2Y2NA 5G18A 3D72A 2OAP1 5FATA 3ITAA 3G30A 3NULA 1NYYA 3R7WA 3HREA 3N8RA 3UB5P 2VV6A 4Z1WA 4RA7A 3OCLA 2Y8HA 3IX3A 2NUTC 4M3KA 3ZG9B 3LCEA 3WWXA 2PDRA 3IT9A 4CLCB 2V2FF 3LIDA 5IHVA 2Y55A 3F1NA 1DP8A 3EEAA 2JE5A 3N7WA 1FOFA 5CTNA 1PI5A 2XA7M 1CF0A 3PBTA 1YLZA 3TW8A 2HP5A 5FSRA 1GHIA 1JVJA 3I7JA 4BENA 3DTMA 3ZGAB 4N1HA 1XKZA 4IUHA 2VLGA 5GHYA 2H0TA 3UE0A 3G31A 4S2NA 5F69A 4N92A 1NJ4A 2W27A 3CG5A 4PM5A 1PW8A 4K0WA 4ARZB 3B33A 5M1AA 3LUQA 1FQGA 4UQIM 1XA7A 3C4OA 1LI0A 2PAVP 1LI9A 4GW9A 4OOLA 2WGWB 1F5MA 4H6JB 4IBRA 3IWQA 3A0SA 3IH8A 4GNUA 3FV7A 2JN7A 4HP9A 1CI9A 3A3DA 2J7VA 2G7UA 3ZVTA 1S4SA 1T19A 5FQIA 3CI6A 2DCFA 3A0VA 3UE6A 1IFQA 3UB9A 4ZJ1A 3E4PA 3S7NA 1VHMA 2UWXA 1ES5A 3IBRA 3IF5A 4ETXA 1HZOA 4X1MA 4K0XA 3VMAA 3P98A 4LFUA 5M19A 4WZ5A 5HAQA 3IXDA 4PMAA 2IWBA 2A49A 4LCMA 4KQDA 3P09A 2JKRI 1IELA 1S66L 2J9OA 3AGDA 4B4ZA 4IVIA 3HLWA 2K2NA 3ZG0A 4DE2A 1KGEA 1TVFA 2EXAA 3V3RA 4JXSA 2PD7A 2JKFA 4EBLA 3DAVA 1IYSA 4QY5A 4BBUA 4FUWA 3OPRA 1KDWA 1XFQA 2CC1A 1K25A 4N1XA 3H7WA 1NRFA 5GLCA 2X71A 4CLCD 1O07A 4UA9A 4ETZA 4WEKA 3MZEA 2PD8A 4LV2A 5HL6A 1E25A 4EWFA 2MJ6A 5A93A 4GZBA 3T4OA 4HY8A 3Q7VB 4D2OA 1RGYA 3GSGA 3SW1A 5HDCA 3HLEA 4R38A 4FH4A 1MPLA 1K4FA 1CEFA 3TJZC 5FQJA 2H5SA 1VM1A 4MN7A 3E4QA 5DFXA 2Y2GA 1CK3A 4G3KA 1ESIA 3T50A 2Y2PA 1SKFA 4L9FA 5DTTA 1JWZA 1MXOA 4LRYC 3RTYA 4OQGA 4EQIA 4QWOA 3OOVA 5FA7A 3HVFA 1NLZA 3L9KA 1F9IA 3UE3A 3F1OB 4E04A 3D4FA 5J3WA 3P01A 4K08A 1ERMA 2PR5A 4L9EA 2KLIA 3HLBA 2V1AA 4Q0HA 3ZCZA 4LGWA 3VSKA 3G6OA 1PFLA 2O99A 3MZDA 3A3FA 4OQHA 4OPYA 4GKUA 2Y2LA 4FH2A 4Y15A 1Z09A 4KZ3A 1MWUA 3LEQA 4MN6A 3Q1FA 2ZC5B 4GS9B 4EEUA 2A3UA 3ITBA 4X55A 1DP6A 3QP6A 1U60A 4XXRA 1SDNA 2KX6A 4JF6A 1TDLA 4CLCE 5DF9A 3NDGA 4Y5FA 2Q9NA 3N8LA 3ZVWA 5FQ9A 3T4QA 4I39A 2H0YA 2O9CA 5HPFA 2JKTM 5HZHA 3O88A 2G2WA 1ES3A 3UPOA 3IXHA 3PBNA 3IXBA 1OTDA 5AQ9A 1H8YA 2ZC4B 4OKPA 1NRJA 1PZOA 3CPTB 1ACFA 4HH2A 2Y59A 3N8SA 1OTAA 2P04A 3NBLA 4S2LA 4DMZA 3RJUA 4LLOB 3IS2B 3BFDA 1G6AA 1PZPA 5HX9A 1YSQA 5TR7A 1L2SA 3LR5A 3WS1A 2ZC6B 2EX6A 1K4EA 5CGWA 1XJ4A 5GHXA 3GTCA 1NZOA 1PYYA 3MQ0A 2ZL1B 2XK1A 1KDSA 1TD5A 4S2JA 2ZMAA 1O7EA 4EXOA 3W4OA 3TG9A 3UPNA 3F1PB 1YMXA 3CJMA 1BTLA 4BJPA 3O87A 3FPWA 5EUAA 1LSWA 4X56A 3PBSA 4JXGA 4EBNA 3O86A 5EVEA 2YKFA 2VGJA 4K91A 4HESA 4QB8A 1T1CA 5CHMA 5DTKA 3PAEA 2VV7A 1XGJA 2JC7A 4O0PA 5EVIA 2INWA 4HHDA 1K38A 3W2ZA 3CHWP 3VSLA 4PHTA 2VA0A 5AQAA 3UPPA 2HP9A 5KSHA 1SDEA 3VV4A 3NIAA 2I72A 1D1JA 1FILA 1XA1A 5HSQA 5EPHA 4GD8A 3SS5A 1ALQA 3LR0A 2ZQAA 3N6IA 4WM9A 2PBDP 1RCJA 1TF1A 4PPRA 1BUEA 2WAEA 2VV8A 5HAIA 2DRWA 5HW3A 2NUPC 3NI9A 4S2MA 4GB7A 4BL2A 3VOZA 5L2FA 1YMSA 3MFXA 1LL5A 4E6WA 1BYWA 3G2ZA 4ZAMA 2EX8A 3MS6A 4HJ6A 1L0DA 4QD4A 1DRMA 3SH9A 5EM0A 4N9LA 3EEHA 3MQQA 3WRTA 4UAAA 3C4PA 4Y0UA 5A92A 1VETA 4KZ6A 3UDXA 3SS3A 5EVIC 3LEZA 3O3VA 4B4XA 5GLBA 3HUOA 3BM6A 3KSHA 5DTSA 3BEBA 5DKLA 2EWVA 2XEPA 4ID4A 2PU4A 3BQ8A 4R4RA 3A3IA 2Y2JA 4HQAA 2H10A 1BZAA 2EX9A 1NLYA 3M6BA 4AFIA 3GECA 5FQQA 3G35A 1TS6A 3HLGA 2V0WA 2Y2KA 3F1NB 2HDSA 4FTXA 5FI2A 3G32A 4II7A 4JGRA 3M2KA 4X25A 5F5YA 3UY6A 5CECA 3Q07A 4R23A 4NXEA 2H28A 4KZAA 2V1BA 3JYIA 3SZTA 1YSPA 3DWKA 2WUQA 1PW1A 5HPIA 1K56D 4OLGA 1K54A 3UN7A 2PU2A 2IA2A 1J3WA 1OTEA 5CEDA 2HDQA 1PWDA 1P9WA 1WA9A 1BULA 4E3LA 3CWFA 5TJJA 1H3QA 4FCFA 5TBMA 2P9VB 2J3TC 1Y4OA 5DKKA 4WEJA 1RP5A 1KVMA 2XLNA 5CHJA 3LYXA 2RL3A 3DTEA 3T1RA 2HGVA 5J4EA 2IWDA 4OOYA 1YT4A 4JKTA 1YM1A 2EWWA 3MXRA 5U47A 2V20A 1ES2A 1T18A 1GHPA 3BY9A 3OPLA 4YWZA 4B93A 1XP4A 2V1ZA 4DF6A 4HJ4A 3M2JA 1G68A 3GVBA 3IXGA 4WYYA 5FDHA 3EGXC 1NZUA 1STZA 1BLCA 4PM8A 3CMZA 4C3QA 3PBOA 4I3IA 1SHVA
chains in the Genus database with same CATH topology
2ZJ9A 1DJCA 4GZBA 4LENA 1IKGA 3Q7VB 4D2OA 3ZHHA 1XX2A 1RGYA 1K54C 4RX2A 1K6SA 4KZ5A 1E3UD 3N4IA 3WS4A 4HEFA 4WMCD 3ZDJA 1BLHA 1EI5A 3GSGA 3FWLA 4OQ0A 5EVID 3AGEA 3HLEA 3VP0A 1C3BA 1MPLA 3A3JA 3AGFA 2HDRA 4FH4A 1K4FA 2QZ6A 1CEFA 3ISGA 3BFFA 4MLLA 5FQJA 2H5SA 1VM1A 3IWOA 5AQBA 2Y2GA 1CK3A 3MXSA 1ESIA 2HDUA 2QPNA 2ZC7A 3BYDA 2Y2PA 3NCKA 2XF3A 1SKFA 3GV9A 1LHYA 2Y2MA 2Y2OA 3IHBA 4R3JA 1KE3A 5DTTA 1JWZA 1MXOA 3LO7A 4WELA 4P85A 3Q82A 1Y54A 3BRMA 4OQGA 1XXMA 4EQIA 2Q9MA 3LY4A 3SH7A 4IBXA 5FA7A 3HVFA 4X6TA 2RCXA 4JF4A 3UE3A 3PTEA 1BT5A 1HTZA 1FR1A 2J9PA 4YINA 4MBFA 3D4FA 3PBQA 1ERMA 4S2IA 5F1GA 2WZXA 4OPRA 4GDBA 4KZ9A 4C75A 2ZC3B 2ZQ8A 2ZLYA 3HLBA 4KG2A 3SS4A 2XD5A 1BSGA 2WKEA 4QHCA 1GA9A 3ZCZA 1FCNA 1W5DA 3VSKA 2XGNA 3S1YA 3BLSA 4HBUA 3MZDA 3ZFZA 4LV3A 3A3FA 3FYZA 1IKIA 3BFEA 4OQHA 2DNSA 4OPYA 4GKUA 2HPBA 3W4QA 2Y2LA 3VP4A 4S2OA 4BLMA 4DE0A 1J9MA 1W8YA 4FH2A 1FR6A 4KZ3A 4P87A 4OP8A 1MWUA 3OZHA 4S2NC 4KQOA 2Y2HA 3Q1FA 2ZC5B 4X69A 3VOYA 2A3UA 3ITBA 3PBRA 1E3UA 4X55A 5CXWA 2EFXA 4WMCA 2Z2MB 1U60A 5JYOA 2XH9A 4XXRA 3QNBA 4QY6A 1SDNA 4JXWA 2ZM2A 3MBZA 3ZG7B 4NK3A 4S2KA 4JF6A 1KVLA 1TDLA 2J8YA 1ESUA 2WKHA 4MNRA 3BFGA 3FKWA 4XUXA 5DF9A 3Q81A 3NDGA 2Q9NA 2FFYA 3PAGA 5E2GA 3N8LA 1L0GA 3WS2A 4OVDA 3ZVWA 5FQ9A 1MWTA 1NYMA 4X53A 4ZBEA 1YLYA 5CGXA 3VFHA 1K6RA 2H0YA 1ONGA 4Z9QA 4R0QA 5FAPA 1HD8A 1LL9A 4E3OA 1GA0A 3O88A 2G2WA 1FSWA 5EOOA 1TDGA 5E2HA 4DRTA 3UE1A 2WGWA 1ES3A 3UPOA 3IXHA 3PBNA 3IXBA 1WYBA 4KENB 3MZFA 5GL9A 4C6YA 5AQ9A 4KZ7A 2XR0A 1H8YA 4U3TA 4XUZA 1Q2QA 2ZC4B 2XD1A 5AQ7A 4PM7A 4OKPA 3W8KA 5GLAA 5FASA 1PZOA 4OPZA 2IWCA 2Y59A 2EFUA 3N8SA 3BLMA 3NBLA 3OPPA 4KG6A 3WRZA 3WS0A 4S2LA 1N4OA 4DXCA 3DWZA 3IH9A 3RJUA 3TOIA 5KSCA 4WZ5C 1K56A 5CRFA 5DF7A 4X68A 1RGZA 4E3NA 3BFDA 1G6AA 1PZPA 5HL1A 2ZD8A 5BOHA 3V5MA 1MWSA 5HX9A 3OPHA 5TR7A 4OOMA 4KQRA 3SH8A 1JWVA 1L2SA 5CTMA 3ZNTA 3WS1A 2ZC6B 2EX6A 4KZ4A 1K4EA 4JF5A 4P0MA 2EXBA 5CGWA 2BLSA 5EVLA 5FI6A 4RX3A 5GHXA 4QJGA 3MKEA 1EWZA 2E8IA 3HUMA 3VP2A 5A90A 4F94A 1MY8A 3SOIA 3GTCA 4PM9A 1NZOA 1PYYA 3NY4A 4E3IA 4R4SA 3BECA 2OLVA 3UDFA 4NETA 4Y0TA 2R9XA 4PM6A 2XK1A 1ONHA 1KDSA 2P9VA 4GDNA 3IHAA 4P6BA 1I5QA 4ZJ2A 1W8QA 4S2JA 2ZMAA 1FCMA 1O7EA 1XGIA 3HUNA 3ZG5A 3NDEA 4ZJ3A 3W4OA 4DKIA 3TG9A 3EQVA 3MFDA 3UPNA 1QMEA 4LV1A 2JCHA 4N9KA 1YMXA 3CJMA 1MKIA 1BTLA 4UA6A 3WS5A 4BJPA 3IF6A 2WZZA 3UNWA 4KZBA 3O87A 3GR2A 3VFFA 1VQQA 4O7DA 1DY6A 2WGVA 5EUAA 2WADA 4X56A 1XPBA 1PWGA 5E2FA 2JBFA 4KQQA 3PBSA 4JXGA 4EBNA 4MBKA 4JBFA 1KGGA 3G4PA 3O86A 4IEDA 5DF8A 1IEMA 4KZ8A 1M6KA 2P74A 4LV0A 4JLFA 4CPKA 2VGJA 4K91A 4E3JA 4HESA 3ZG8B 4ZDXA 2BG1A 4LCLA 4CJNA 4QB8A 3A3EA 1S0WA 5CHMA 3CZDA 5DTKA 3QNCA 3PAEA 4FSFA 1XGJA 2Z2LB 4ZTKA 1S6RA 1LLBA 2JC7A 1YLTA 3GRJA 1JWPA 5EVIA 3HLFA 1K38A 4R1GA 3C7UA 5DVAA 3VSLA 5CHUA 4EBPA 5CERA 5HAPA 3HLCA 5FQMA 4YFMA 2B5RA 5D3OA 1ZKJA 3QHYA 5AQAA 3UPPA 3W4PA 4A5RA 2HP9A 4EV4A 5KSHA 4BQMA 1SDEA 4OH0A 1L0FA 2Y2NA 3B3XA 4S2PA 5G18A 3NIAA 5FATA 2I72A 3ITAA 1W79A 2ZQ9A 3G30A 4RYEA 2ZM0A 1XA1A 1NYYA 3HREA 3N8RA 4WBGA 5EPHA 4GD8A 3SS5A 1ALQA 2ZQAA 2QMIA 3DW0A 3N6IA 4Y7PA 1I2SA 4WM9A 4EUZA 1RCJA 3G34A 4PPRA 1BUEA 4RA7A 2WAEA 1E4DA 3OCLA 5HAIA 3IF6B 1M40A 5FQKA 4M3KA 1IYPA 1K55A 3OC2A 4OP5A 4WZ4A 5FAQA 3ZG9B 4BD1A 3LCEA 3WWXA 2DRWA 2R9WA 3IT9A 5HW3A 4B88A 5CEBA 3IF6C 3NI9A 5EECA 4S2MA 2FFFB 4GB7A 1CI8A 2V2FF 4KG5A 5IHVA 4BL2A 3VOZA 1QMFA 5GLDA 2Y55A 1K57A 1JTDA 5L2FA 1FCOA 1YMSA 4R3BA 1JTGA 1LL5A 4L0LA 2Y2QA 5JYPA 4RVAA 4E6WA 3G2ZA 4ZAMA 1YLWA 2EX8A 2JE5A 3N7WA 1FOFA 5CTNA 1IYOA 1PI5A 2X02A 3EQUA 3PBTA 3FZCA 1YLPA 1L0DA 4QD4A 1YLZA 4QU3A 3SH9A 3UDIA 2HP5A 1Q2PA 4N9LA 5FSRA 3V50A 1GHIA 1JVJA 3I7JA 3WRTA 4DE3A 4UAAA 4BENA 3G2YA 3DTMA 5EVIB 1ES4A 4H8RA 3ZGAB 3C4PA 4Y0UA 4N1HA 5A92A 1XKZA 1GHMA 5GHYA 4UA7A 2H0TA 4KZ6A 3UE0A 3UDXA 4E3KA 3G31A 3SS3A 4UHUA 3LEZA 4S2NA 5EVIC 4N92A 3IQAA 3O3VA 4OPQA 4B4XA 1NJ4A 3HUOA 2G2UA 3BM6A 5GLBA 5I94A 1KGFA 1FSYA 3BEBA 1BLPA 5DTSA 2C5WB 3CG5A 3NC8A 5E43A 1H5XA 1H8ZA 4PM5A 1PW8A 2Y2IA 1ERQA 5HFOA 5J8XA 3IWIA 4K0WA 4GN2A 2XEPA 4ID4A 1HVBA 2OLUA 3UO9A 4DDYA 2PU4A 5A91A 5M1AA 4R4RA 3A3IA 1FQGA 3RXWA 1XA7A 4OONA 3C4OA 2Y2JA 3HL9A 1LI0A 1LI9A 1MBLA 3C7VA 4OOLA 4IVKA 5M18A 2WGWB 1PIOA 2H10A 3MKFA 3E2KA 3OCNA 2WAFA 4HBTA 5F83A 4IBRA 1BZAA 2EX9A 2OSUA 1Z6FA 1WYCA 3IWQA 3M6BA 3IH8A 4GNUA 5FQQA 3FV7A 3G35A 2ZQ7A 1CI9A 3A3DA 1K55C 3HLGA 5EOEA 2Y2KA 2J7VA 2HDSA 5FI2A 3ZVTA 3G32A 2ZQDA 4JPMA 5FAOA 1NXYA 1GCEA 5FQIA 2WGIA 3S4XA 2C6WB 2DCFA 3M2KA 3UY6A 5CECA 1K57C 4OLDA 1AXBA 3Q07A 3HLDA 4R23A 1IYQA 1KE4A 4ZJ1A 5TFQA 4MBHA 2XFSA 4Y0OA 2WKIA 3FKVA 5CGSA 5E2EA 4KZAA 2UWXA 3GMWA 4JXVA 1ES5A 1WE4A 2PBYA 3IF5A 5FI7A 3VP1A 1DJBA 3JYIA 1HZOA 1L0EA 3DWKA 5KMWA 4K0XA 3VMAA 1ZC2A 1PW1A 2WUQA 2Y4AA 1K56D 3P98A 4FD8A 5M19A 4OLGA 1K54A 2Y91A 4WZ5A 2PU2A 3IXDA 4PMAA 2VGKA 1TEMA 3UN7A 5HAQA 1PI4A 2GDNA 2ZQCA 2IWBA 5CEDA 2HDQA 3Q7VA 1PWDA 2HP6A 2A49A 1ZG4A 1BULA 4U0XA 4LCMA 5EE8A 4E3LA 1KE0A 5F82A 1CEGA 4FCFA 4DDSA 3V3SA 3P09A 2P9VB 5F1FA 4WEJA 1RP5A 1KVMA 1IELA 2XLNA 5CHJA 1W7FA 3M6HA 1NY0A 3LY3A 2J9OA 2RL3A 3BFCA 2XDMA 4Q8IA 3AGDA 4B4ZA 1SCWA 4IVIA 3V39A 2IWDA 4U0TA 3HLWA 3ZG0A 4BD0A 1DJAA 3RXXA 4DE2A 1ZG6A 3GQZA 1KGEA 1TVFA 5HARA 2EXAA 4OQIA 3V3RA 4OOYA 4JXSA 4E3MA 1YT4A 4JKTA 4EBLA 2WYXA 3HBRA 1YM1A 3E2LA 1BLSA 1IYSA 3MXRA 4QY5A 4BL3A 3OPRA 5U47A 4GD6A 2V20A 1KDWA 1N9BA 1ES2A 1YLJA 3C5AA 1MWRA 1GHPA 2WK0A 3VP3A 2X01A 2CC1A 3OPLA 1K25A 2XFTA 3Q7ZA 4MEZA 4N1XA 4DE1A 1XP4A 2V1ZA 4DF6A 4GOGA 1NRFA 3M2JA 5GLCA 3S22A 1I2WA 2X71A 1G68A 3GVBA 3IXGA 1O07A 4WYYA 1PWCA 4UA9A 5FDHA 2ZM8A 1NZUA 4WEKA 1EROA 5TGFA 3MZEA 2OV5A 3ZNYA 4DXBA 2EX2A 4LV2A 1YQSA 1OMEA 1BLCA 4PM8A 3CMZA 1E25A 4C3QA 5KZHA 3PBOA 4EWFA 2XQZA 5GHZA 1SHVA 4E6XA 3TSGA 5A93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJ9 A;  1DJC A;  4GZB A;  4LEN A;  1IKG A;  3Q7V B;  4D2O A;  3ZHH A;  1XX2 A;  1RGY A;  1K54 C;  4RX2 A;  1K6S A;  4KZ5 A;  1E3U D;  3N4I A;  3WS4 A;  4HEF A;  4WMC D;  3ZDJ A;  1BLH A;  1EI5 A;  3GSG A;  3FWL A;  4OQ0 A;  5EVI D;  3AGE A;  3HLE A;  3VP0 A;  1C3B A;  1MPL A;  3A3J A;  3AGF A;  2HDR A;  4FH4 A;  1K4F A;  2QZ6 A;  1CEF A;  3ISG A;  3BFF A;  4MLL A;  5FQJ A;  2H5S A;  1VM1 A;  3IWO A;  5AQB A;  2Y2G A;  1CK3 A;  3MXS A;  1ESI A;  2HDU A;  2QPN A;  2ZC7 A;  3BYD A;  2Y2P A;  3NCK A;  2XF3 A;  1SKF A;  3GV9 A;  1LHY A;  2Y2M A;  2Y2O A;  3IHB A;  4R3J A;  1KE3 A;  5DTT A;  1JWZ A;  1MXO A;  3LO7 A;  4WEL A;  4P85 A;  3Q82 A;  1Y54 A;  3BRM A;  4OQG A;  1XXM A;  4EQI A;  2Q9M A;  3LY4 A;  3SH7 A;  4IBX A;  5FA7 A;  3HVF A;  4X6T A;  2RCX A;  4JF4 A;  3UE3 A;  3PTE A;  1BT5 A;  1HTZ A;  1FR1 A;  2J9P A;  4YIN A;  4MBF A;  3D4F A;  3PBQ A;  1ERM A;  4S2I A;  5F1G A;  2WZX A;  4OPR A;  4GDB A;  4KZ9 A;  4C75 A;  2ZC3 B;  2ZQ8 A;  2ZLY A;  3HLB A;  4KG2 A;  3SS4 A;  2XD5 A;  1BSG A;  2WKE A;  4QHC A;  1GA9 A;  3ZCZ A;  1FCN A;  1W5D A;  3VSK A;  2XGN A;  3S1Y A;  3BLS A;  4HBU A;  3MZD A;  3ZFZ A;  4LV3 A;  3A3F A;  3FYZ A;  1IKI A;  3BFE A;  4OQH A;  2DNS A;  4OPY A;  4GKU A;  2HPB A;  3W4Q A;  2Y2L A;  3VP4 A;  4S2O A;  4BLM A;  4DE0 A;  1J9M A;  1W8Y A;  4FH2 A;  1FR6 A;  4KZ3 A;  4P87 A;  4OP8 A;  1MWU A;  3OZH A;  4S2N C;  4KQO A;  2Y2H A;  3Q1F A;  2ZC5 B;  4X69 A;  3VOY A;  2A3U A;  3ITB A;  3PBR A;  1E3U A;  4X55 A;  5CXW A;  2EFX A;  4WMC A;  2Z2M B;  1U60 A;  5JYO A;  2XH9 A;  4XXR A;  3QNB A;  4QY6 A;  1SDN A;  4JXW A;  2ZM2 A;  3MBZ A;  3ZG7 B;  4NK3 A;  4S2K A;  4JF6 A;  1KVL A;  1TDL A;  2J8Y A;  1ESU A;  2WKH A;  4MNR A;  3BFG A;  3FKW A;  4XUX A;  5DF9 A;  3Q81 A;  3NDG A;  2Q9N A;  2FFY A;  3PAG A;  5E2G A;  3N8L A;  1L0G A;  3WS2 A;  4OVD A;  3ZVW A;  5FQ9 A;  1MWT A;  1NYM A;  4X53 A;  4ZBE A;  1YLY A;  5CGX A;  3VFH A;  1K6R A;  2H0Y A;  1ONG A;  4Z9Q A;  4R0Q A;  5FAP A;  1HD8 A;  1LL9 A;  4E3O A;  1GA0 A;  3O88 A;  2G2W A;  1FSW A;  5EOO A;  1TDG A;  5E2H A;  4DRT A;  3UE1 A;  2WGW A;  1ES3 A;  3UPO A;  3IXH A;  3PBN A;  3IXB A;  1WYB A;  4KEN B;  3MZF A;  5GL9 A;  4C6Y A;  5AQ9 A;  4KZ7 A;  2XR0 A;  1H8Y A;  4U3T A;  4XUZ A;  1Q2Q A;  2ZC4 B;  2XD1 A;  5AQ7 A;  4PM7 A;  4OKP A;  3W8K A;  5GLA A;  5FAS A;  1PZO A;  4OPZ A;  2IWC A;  2Y59 A;  2EFU A;  3N8S A;  3BLM A;  3NBL A;  3OPP A;  4KG6 A;  3WRZ A;  3WS0 A;  4S2L A;  1N4O A;  4DXC A;  3DWZ A;  3IH9 A;  3RJU A;  3TOI A;  5KSC A;  4WZ5 C;  1K56 A;  5CRF A;  5DF7 A;  4X68 A;  1RGZ A;  4E3N A;  3BFD A;  1G6A A;  1PZP A;  5HL1 A;  2ZD8 A;  5BOH A;  3V5M A;  1MWS A;  5HX9 A;  3OPH A;  5TR7 A;  4OOM A;  4KQR A;  3SH8 A;  1JWV A;  1L2S A;  5CTM A;  3ZNT A;  3WS1 A;  2ZC6 B;  2EX6 A;  4KZ4 A;  1K4E A;  4JF5 A;  4P0M A;  2EXB A;  5CGW A;  2BLS A;  5EVL A;  5FI6 A;  4RX3 A;  5GHX A;  4QJG A;  3MKE A;  1EWZ A;  2E8I A;  3HUM A;  3VP2 A;  5A90 A;  4F94 A;  1MY8 A;  3SOI A;  3GTC A;  4PM9 A;  1NZO A;  1PYY A;  3NY4 A;  4E3I A;  4R4S A;  3BEC A;  2OLV A;  3UDF A;  4NET A;  4Y0T A;  2R9X A;  4PM6 A;  2XK1 A;  1ONH A;  1KDS A;  2P9V A;  4GDN A;  3IHA A;  4P6B A;  1I5Q A;  4ZJ2 A;  1W8Q A;  4S2J A;  2ZMA A;  1FCM A;  1O7E A;  1XGI A;  3HUN A;  3ZG5 A;  3NDE A;  4ZJ3 A;  3W4O A;  4DKI A;  3TG9 A;  3EQV A;  3MFD A;  3UPN A;  1QME A;  4LV1 A;  2JCH A;  4N9K A;  1YMX A;  3CJM A;  1MKI A;  1BTL A;  4UA6 A;  3WS5 A;  4BJP A;  3IF6 A;  2WZZ A;  3UNW A;  4KZB A;  3O87 A;  3GR2 A;  3VFF A;  1VQQ A;  4O7D A;  1DY6 A;  2WGV A;  5EUA A;  2WAD A;  4X56 A;  1XPB A;  1PWG A;  5E2F A;  2JBF A;  4KQQ A;  3PBS A;  4JXG A;  4EBN A;  4MBK A;  4JBF A;  1KGG A;  3G4P A;  3O86 A;  4IED A;  5DF8 A;  1IEM A;  4KZ8 A;  1M6K A;  2P74 A;  4LV0 A;  4JLF A;  4CPK A;  2VGJ A;  4K91 A;  4E3J A;  4HES A;  3ZG8 B;  4ZDX A;  2BG1 A;  4LCL A;  4CJN A;  4QB8 A;  3A3E A;  1S0W A;  5CHM A;  3CZD A;  5DTK A;  3QNC A;  3PAE A;  4FSF A;  1XGJ A;  2Z2L B;  4ZTK A;  1S6R A;  1LLB A;  2JC7 A;  1YLT A;  3GRJ A;  1JWP A;  5EVI A;  3HLF A;  1K38 A;  4R1G A;  3C7U A;  5DVA A;  3VSL A;  5CHU A;  4EBP A;  5CER A;  5HAP A;  3HLC A;  5FQM A;  4YFM A;  2B5R A;  5D3O A;  1ZKJ A;  3QHY A;  5AQA A;  3UPP A;  3W4P A;  4A5R A;  2HP9 A;  4EV4 A;  5KSH A;  4BQM A;  1SDE A;  4OH0 A;  1L0F A;  2Y2N A;  3B3X A;  4S2P A;  5G18 A;  3NIA A;  5FAT A;  2I72 A;  3ITA A;  1W79 A;  2ZQ9 A;  3G30 A;  4RYE A;  2ZM0 A;  1XA1 A;  1NYY A;  3HRE A;  3N8R A;  4WBG A;  5EPH A;  4GD8 A;  3SS5 A;  1ALQ A;  2ZQA A;  2QMI A;  3DW0 A;  3N6I A;  4Y7P A;  1I2S A;  4WM9 A;  4EUZ A;  1RCJ A;  3G34 A;  4PPR A;  1BUE A;  4RA7 A;  2WAE A;  1E4D A;  3OCL A;  5HAI A;  3IF6 B;  1M40 A;  5FQK A;  4M3K A;  1IYP A;  1K55 A;  3OC2 A;  4OP5 A;  4WZ4 A;  5FAQ A;  3ZG9 B;  4BD1 A;  3LCE A;  3WWX A;  2DRW A;  2R9W A;  3IT9 A;  5HW3 A;  4B88 A;  5CEB A;  3IF6 C;  3NI9 A;  5EEC A;  4S2M A;  2FFF B;  4GB7 A;  1CI8 A;  2V2F F;  4KG5 A;  5IHV A;  4BL2 A;  3VOZ A;  1QMF A;  5GLD A;  2Y55 A;  1K57 A;  1JTD A;  5L2F A;  1FCO A;  1YMS A;  4R3B A;  1JTG A;  1LL5 A;  4L0L A;  2Y2Q A;  5JYP A;  4RVA A;  4E6W A;  3G2Z A;  4ZAM A;  1YLW A;  2EX8 A;  2JE5 A;  3N7W A;  1FOF A;  5CTN A;  1IYO A;  1PI5 A;  2X02 A;  3EQU A;  3PBT A;  3FZC A;  1YLP A;  1L0D A;  4QD4 A;  1YLZ A;  4QU3 A;  3SH9 A;  3UDI A;  2HP5 A;  1Q2P A;  4N9L A;  5FSR A;  3V50 A;  1GHI A;  1JVJ A;  3I7J A;  3WRT A;  4DE3 A;  4UAA A;  4BEN A;  3G2Y A;  3DTM A;  5EVI B;  1ES4 A;  4H8R A;  3ZGA B;  3C4P A;  4Y0U A;  4N1H A;  5A92 A;  1XKZ A;  1GHM A;  5GHY A;  4UA7 A;  2H0T A;  4KZ6 A;  3UE0 A;  3UDX A;  4E3K A;  3G31 A;  3SS3 A;  4UHU A;  3LEZ A;  4S2N A;  5EVI C;  4N92 A;  3IQA A;  3O3V A;  4OPQ A;  4B4X A;  1NJ4 A;  3HUO A;  2G2U A;  3BM6 A;  5GLB A;  5I94 A;  1KGF A;  1FSY A;  3BEB A;  1BLP A;  5DTS A;  2C5W B;  3CG5 A;  3NC8 A;  5E43 A;  1H5X A;  1H8Z A;  4PM5 A;  1PW8 A;  2Y2I A;  1ERQ A;  5HFO A;  5J8X A;  3IWI A;  4K0W A;  4GN2 A;  2XEP A;  4ID4 A;  1HVB A;  2OLU A;  3UO9 A;  4DDY A;  2PU4 A;  5A91 A;  5M1A A;  4R4R A;  3A3I A;  1FQG A;  3RXW A;  1XA7 A;  4OON A;  3C4O A;  2Y2J A;  3HL9 A;  1LI0 A;  1LI9 A;  1MBL A;  3C7V A;  4OOL A;  4IVK A;  5M18 A;  2WGW B;  1PIO A;  2H10 A;  3MKF A;  3E2K A;  3OCN A;  2WAF A;  4HBT A;  5F83 A;  4IBR A;  1BZA A;  2EX9 A;  2OSU A;  1Z6F A;  1WYC A;  3IWQ A;  3M6B A;  3IH8 A;  4GNU A;  5FQQ A;  3FV7 A;  3G35 A;  2ZQ7 A;  1CI9 A;  3A3D A;  1K55 C;  3HLG A;  5EOE A;  2Y2K A;  2J7V A;  2HDS A;  5FI2 A;  3ZVT A;  3G32 A;  2ZQD A;  4JPM A;  5FAO A;  1NXY A;  1GCE A;  5FQI A;  2WGI A;  3S4X A;  2C6W B;  2DCF A;  3M2K A;  3UY6 A;  5CEC A;  1K57 C;  4OLD A;  1AXB A;  3Q07 A;  3HLD A;  4R23 A;  1IYQ A;  1KE4 A;  4ZJ1 A;  5TFQ A;  4MBH A;  2XFS A;  4Y0O A;  2WKI A;  3FKV A;  5CGS A;  5E2E A;  4KZA A;  2UWX A;  3GMW A;  4JXV A;  1ES5 A;  1WE4 A;  2PBY A;  3IF5 A;  5FI7 A;  3VP1 A;  1DJB A;  3JYI A;  1HZO A;  1L0E A;  3DWK A;  5KMW A;  4K0X A;  3VMA A;  1ZC2 A;  1PW1 A;  2WUQ A;  2Y4A A;  1K56 D;  3P98 A;  4FD8 A;  5M19 A;  4OLG A;  1K54 A;  2Y91 A;  4WZ5 A;  2PU2 A;  3IXD A;  4PMA A;  2VGK A;  1TEM A;  3UN7 A;  5HAQ A;  1PI4 A;  2GDN A;  2ZQC A;  2IWB A;  5CED A;  2HDQ A;  3Q7V A;  1PWD A;  2HP6 A;  2A49 A;  1ZG4 A;  1BUL A;  4U0X A;  4LCM A;  5EE8 A;  4E3L A;  1KE0 A;  5F82 A;  1CEG A;  4FCF A;  4DDS A;  3V3S A;  3P09 A;  2P9V B;  5F1F A;  4WEJ A;  1RP5 A;  1KVM A;  1IEL A;  2XLN A;  5CHJ A;  1W7F A;  3M6H A;  1NY0 A;  3LY3 A;  2J9O A;  2RL3 A;  3BFC A;  2XDM A;  4Q8I A;  3AGD A;  4B4Z A;  1SCW A;  4IVI A;  3V39 A;  2IWD A;  4U0T A;  3HLW A;  3ZG0 A;  4BD0 A;  1DJA A;  3RXX A;  4DE2 A;  1ZG6 A;  3GQZ A;  1KGE A;  1TVF A;  5HAR A;  2EXA A;  4OQI A;  3V3R A;  4OOY A;  4JXS A;  4E3M A;  1YT4 A;  4JKT A;  4EBL A;  2WYX A;  3HBR A;  1YM1 A;  3E2L A;  1BLS A;  1IYS A;  3MXR A;  4QY5 A;  4BL3 A;  3OPR A;  5U47 A;  4GD6 A;  2V20 A;  1KDW A;  1N9B A;  1ES2 A;  1YLJ A;  3C5A A;  1MWR A;  1GHP A;  2WK0 A;  3VP3 A;  2X01 A;  2CC1 A;  3OPL A;  1K25 A;  2XFT A;  3Q7Z A;  4MEZ A;  4N1X A;  4DE1 A;  1XP4 A;  2V1Z A;  4DF6 A;  4GOG A;  1NRF A;  3M2J A;  5GLC A;  3S22 A;  1I2W A;  2X71 A;  1G68 A;  3GVB A;  3IXG A;  1O07 A;  4WYY A;  1PWC A;  4UA9 A;  5FDH A;  2ZM8 A;  1NZU A;  4WEK A;  1ERO A;  5TGF A;  3MZE A;  2OV5 A;  3ZNY A;  4DXB A;  2EX2 A;  4LV2 A;  1YQS A;  1OME A;  1BLC A;  4PM8 A;  3CMZ A;  1E25 A;  4C3Q A;  5KZH A;  3PBO A;  4EWF A;  2XQZ A;  5GHZ A;  1SHV A;  4E6X A;  3TSG A;  5A93 A; 
#chains in the Genus database with same CATH topology
 2ZJ9 A;  3D9Y A;  1DJC A;  3CAX A;  4LEN A;  1XJ3 A;  4Y13 A;  1XX2 A;  1K54 C;  5CX7 A;  1S1Y A;  3H82 A;  3DTI A;  4HEF A;  1BLH A;  4JGQ A;  2W1T A;  3A3J A;  4WUJ A;  1MZU A;  3BFF A;  2O9B A;  1X0O A;  4ME4 A;  1S4R A;  2VZW A;  5AQB A;  3UME A;  1A0K A;  1VEU A;  4DJ2 A;  1SKO A;  2W3D A;  2ZC7 A;  3BYD A;  4FOF A;  1XJ2 A;  2XF3 A;  3E4O A;  1EW0 A;  1LHY A;  2Y2O A;  3OBF A;  1S67 L;  2V8C A;  4R3J A;  1P97 A;  1KE3 A;  3QP5 A;  4P85 A;  3Q82 A;  2VKS A;  2L4R A;  2HJE A;  3DTK A;  3SH7 A;  4X6T A;  2RCX A;  4JF4 A;  1BT5 A;  2J9P A;  1FR1 A;  4X1L A;  5F1G A;  2WZX A;  4OPR A;  4KZ9 A;  2ZC3 B;  2ZQ8 A;  2XD5 A;  4QHC A;  1GA9 A;  3S1Y A;  1MC0 A;  4HNB A;  3BFE A;  2W3F A;  5HDS A;  3W4Q A;  3VP4 A;  4BLM A;  1J9M A;  1W8Y A;  1FR6 A;  1ODV A;  3OZH A;  4S2N C;  4KQO A;  4X69 A;  2Z2M B;  2XH9 A;  3QNB A;  3L7H A;  2ZM2 A;  3MBZ A;  5L10 A;  5IT5 A;  2M7U A;  5DJU A;  3ZG7 B;  1ESU A;  3FKW A;  4XUX A;  3Q81 A;  2FFY A;  5E2G A;  1L0G A;  1MWT A;  2QHK A;  1YLY A;  4HIA A;  5CGX A;  3FC7 A;  1K6R A;  1ZHH B;  5FAP A;  1HD8 A;  4CQH A;  2Z6C A;  1FSW A;  5EOO A;  2V9A A;  5E2H A;  4DRT A;  3UE1 A;  2WGW A;  4C6Y A;  2OWH A;  2QJ5 A;  2XR0 A;  4PM7 A;  3W8K A;  3LIE A;  3WS0 A;  3IH9 A;  3TOI A;  4WZ5 C;  5C5K A;  2ZD8 A;  5BOH A;  4OOM A;  3MSH A;  1JWV A;  4EER A;  2HJ9 C;  3ZNT A;  3QP8 A;  4KZ4 A;  2B18 A;  4G3V A;  4I3J A;  2EXB A;  1N9O A;  5EVL A;  3KYE A;  3S7O A;  2JKG A;  5A90 A;  1MY8 A;  2W1R A;  3UDF A;  4NET A;  1ONH A;  2HZ5 A;  3IHA A;  1I5Q A;  3NDE A;  3LGO A;  4ZJ3 A;  3EQV A;  5LBR A;  3MFD A;  4LV1 A;  2QYB A;  4NEE D;  1MKI A;  2O9A A;  3WS5 A;  3IF6 A;  4KZB A;  2OWJ A;  3VFF A;  2WAD A;  1XPB A;  4MBK A;  4JBF A;  3S7P A;  1KGG A;  3ZQ5 A;  5DF8 A;  1IEM A;  4LRZ E;  3ZG8 B;  4ZDX A;  1S1Z A;  4QPR A;  1S0W A;  4HH3 A;  3C2W A;  3CZD A;  4EW7 A;  4FSF A;  4ZTK A;  1YLT A;  1JWP A;  1OTB A;  2OAQ 1;  3HLF A;  3T1Q B;  2GZA A;  4WLA A;  2KDK A;  3C7U A;  5DVA A;  5CHU A;  5CER A;  3HLC A;  4YFM A;  3QHY A;  3W4P A;  5L07 A;  4BQM A;  4MMN A;  4OH0 A;  3B3X A;  4S2P A;  5EM1 A;  1W79 A;  3LI8 A;  4RYE A;  3QP2 A;  2QMI A;  4Y7P A;  1I2S A;  4O01 A;  1E4D A;  1M40 A;  5FQK A;  2QKP A;  4XT2 B;  2M1C A;  3OC2 A;  4OP5 A;  5FAQ A;  4BD1 A;  3KSI A;  4B88 A;  5CEB A;  3IF6 C;  2FFF B;  1QMF A;  1K57 A;  1JTD A;  1JNU A;  4I5S A;  1JTG A;  4L0L A;  1G6O A;  4RVA A;  2OOL A;  4NKP A;  1YLW A;  1IYO A;  1UWN X;  3FZC A;  1YLP A;  2PRF A;  4QU3 A;  3UDI A;  4Q0J A;  3E98 A;  2GJ3 A;  3BQA A;  3G2Y A;  1PRQ A;  5EVI B;  1ES4 A;  3JVU A;  4H8R A;  4BMW A;  4UA7 A;  4E3K A;  5FEF A;  4UHU A;  4OPQ A;  2G2U A;  4I3A A;  1KGF A;  2XRN A;  2C5W B;  3NC8 A;  1H5X A;  1ERQ A;  4M4X A;  5J8X A;  3IWI A;  4GS9 A;  2PYR A;  4DDY A;  5A91 A;  2LB5 A;  3NJA A;  3C7V A;  1UGU A;  2ZMF A;  4IVK A;  5M18 A;  1PIO A;  3MKF A;  2WAF A;  5F83 A;  4P6Z S;  1Z6F A;  1WYC A;  5AVE A;  1TS7 A;  2ZQ7 A;  5EOE A;  2V0U A;  3S7Q A;  2ZQD A;  2WGI A;  2ACG A;  1K57 C;  4OLD A;  5TFQ A;  1KE4 A;  3BJN A;  2ZMV A;  2VEA A;  3P7N A;  4F3L A;  4Y0O A;  2WKI A;  3FKV A;  5E2E A;  1DJB A;  5KMW A;  4HOI A;  1G5U A;  1TEM A;  4DJ3 A;  2GDN A;  2ZQC A;  1TS0 A;  1ZG4 A;  4U0X A;  1KE0 A;  5F82 A;  5J7E A;  1CEG A;  1LL8 A;  4DDS A;  3V3S A;  5L8M A;  3K3D A;  4PAU A;  2D01 A;  1W7F A;  1NY0 A;  2XDM A;  3FG8 A;  4MDZ A;  1OJ5 A;  4U0T A;  2YKH A;  4BD0 A;  1ZG6 A;  3GQZ A;  3QP1 A;  5HAR A;  3LR4 A;  2ZL1 A;  1BLS A;  3C38 A;  1N9B A;  3C5A A;  2M7V A;  2AVX A;  1OT9 A;  3Q7Z A;  2XFT A;  1T1A A;  2WKR A;  4GOG A;  1PWC A;  1ERO A;  2A2L A;  4DXB A;  2EX2 A;  4YNR A;  1OME A;  3GDI A;  5KZH A;  5GHZ A;  2DMW A;  1IKG A;  4RX2 A;  1K6S A;  1E3U D;  3N4I A;  2L1M A;  3WS4 A;  4WMC D;  3ZDJ A;  5TBM B;  4P6Z M;  5EVI D;  5IS1 A;  2Z6D A;  3AGE A;  2E8J A;  5DJT A;  2HDR A;  2A24 A;  3R7W B;  3LR3 A;  3IWO A;  2CMN A;  3MXS A;  3NEC A;  4IJG A;  3GV9 A;  2Y2M A;  3IHB A;  1PNE A;  3LO7 A;  4WEL A;  1Y54 A;  4LPZ A;  3ICY A;  3FPV A;  3NOP C;  3PTE A;  4MBF A;  3PBQ A;  5IU1 A;  2J3W A;  4GDB A;  4HI4 A;  2ZLY A;  4KG2 A;  4IUK A;  1FCN A;  1W5D A;  2XGN A;  1V9Y A;  3VE4 A;  4HBU A;  3ZFZ A;  4LV3 A;  2ZOI A;  1IKI A;  2HPB A;  3NOT C;  4DE0 A;  1MKM A;  4S2O A;  2VJW A;  3KYQ A;  3H82 B;  4OP8 A;  5F6A A;  3VOY A;  3PBR A;  2EFX A;  5JYO A;  4QY6 A;  2J3T D;  1SKO B;  4MCW A;  4NK3 A;  4S2K A;  4NG2 A;  4NXG A;  1KVL A;  1FIK A;  1UWP X;  3BFG A;  4LRX C;  4OVD A;  4D60 A;  1NYM A;  4X53 A;  3PYP A;  2ZBB A;  1ONG A;  3VE3 A;  3LI9 A;  1LL9 A;  2WKP A;  2LB9 A;  4GLQ A;  1TDG A;  3RH8 B;  4IHQ A;  1L3L A;  3MZF A;  3DBA A;  2QWS A;  4BBT A;  4UEY A;  2HF6 A;  1IOU A;  1Q2Q A;  5AQ7 A;  2XSS A;  5GLA A;  5FAS A;  2XRO A;  4OPZ A;  2VX8 A;  4G3W A;  1OPX A;  5KSC A;  5CRF A;  5DF7 A;  3HJI A;  2PYP A;  3V5M A;  1HLU P;  3OPH A;  4KQR A;  2B02 A;  1ZTU A;  1P0Z A;  5K5B A;  4RX3 A;  4ZRR A;  3C8C A;  5FL3 A;  4QJG A;  2E8I A;  4GHI A;  4R4S A;  3BEC A;  2OLV A;  4PM6 A;  2P9V A;  4P6B A;  3ULF A;  1W8Q A;  3EGD C;  1V9Z A;  1XGI A;  3HUN A;  3ZG5 A;  4DKI A;  5L09 A;  1F98 A;  1SZV A;  3H7W B;  1QME A;  4N9K A;  3E0Y A;  4UA6 A;  2WZZ A;  3GR2 A;  2R78 A;  3JPU A;  1VQQ A;  1DY6 A;  4CLC A;  1PWG A;  5E2F A;  4HJ3 A;  3A0R A;  1TS8 A;  1YAX A;  3G4P A;  1GSV A;  4KZ8 A;  1M6K A;  5EFW A;  4CPK A;  4E3J A;  4RQ9 A;  2BG1 A;  4LCL A;  4CJN A;  3A3E A;  3V67 A;  2KOI A;  1G28 A;  4JGP A;  2Z2L B;  3UB6 A;  4Y2F A;  3GRJ A;  3T4K A;  3PHY A;  1OJG A;  2B5R A;  1ZKJ A;  1VB6 A;  4NXB A;  4A5R A;  4EV4 A;  1P9R A;  3NOU C;  3T4S A;  3T4T A;  2ZQ9 A;  3B47 A;  2ZM0 A;  4ARZ A;  3LIC A;  4WBG A;  1CQA A;  2K31 A;  4EU0 A;  3DW0 A;  4EUZ A;  3G34 A;  3IF6 B;  1XJ6 A;  1IYP A;  1K55 A;  4H6J A;  4WZ4 A;  2R9W A;  5EEC A;  2JKT I;  1CI8 A;  3MXQ A;  4KG5 A;  3TE8 A;  5GLD A;  1FCO A;  4B9O A;  4R3B A;  4CLC C;  5JYP A;  2Y2Q A;  3UB8 A;  5I5L A;  2X02 A;  3EQU A;  5F68 A;  5A8B A;  2PR6 A;  3JVV A;  1Q2P A;  3V50 A;  3MMH A;  3UB7 A;  2V8F A;  4DE3 A;  4BBV A;  3C30 A;  1GHM A;  3MQO A;  3IQA A;  2JHE A;  4L9G A;  5HDD A;  4BWI A;  3HJK A;  5I94 A;  1FSY A;  2D02 A;  1BLP A;  5E43 A;  1H8Z A;  2Y2I A;  5HFO A;  2P08 A;  4GN2 A;  4WN5 A;  1HVB A;  2OLU A;  3UO9 A;  4WF0 A;  2W0N A;  3RXW A;  4OON A;  3HL9 A;  4MN5 A;  1N9N A;  1KOU A;  1MBL A;  1CJF A;  2W3G A;  1K0K A;  4O8G A;  3E2K A;  3OCN A;  1LSX A;  4HBT A;  5AVF A;  2OSU A;  4EET B;  4WL9 A;  4YOF A;  4Y3I A;  3KSF A;  5EV0 A;  1K55 C;  2GX5 A;  3PXP A;  4JPM A;  3RFB A;  2I9V A;  1NXY A;  5FAO A;  1GCE A;  3S4X A;  2C6W B;  1AXB A;  3HLD A;  1IYQ A;  4MBH A;  2XFS A;  2P7J A;  5CGS A;  3NHQ A;  3GMW A;  2VGL S;  4JXV A;  1WE4 A;  2PBY A;  5FI7 A;  3VP1 A;  1L0E A;  2JKR M;  1ZC2 A;  2Y4A A;  4FD8 A;  2Y91 A;  4GJ4 A;  2VGK A;  1PI4 A;  1Y28 A;  3Q7V A;  1NWZ A;  2HP6 A;  5EE8 A;  5F1F A;  3M6H A;  3LY3 A;  2HV1 A;  2FH5 A;  3BFC A;  3T1S A;  3ZYT A;  4Q8I A;  1SCW A;  3V39 A;  1DJA A;  3RXX A;  1DP9 A;  3T4J A;  4OQI A;  4E3M A;  2WYX A;  3HBR A;  3E2L A;  5HD3 A;  4BL3 A;  4DN0 A;  5G4Z A;  4GD6 A;  1YLJ A;  1MWR A;  2WK0 A;  3VP3 A;  2X01 A;  3QP4 A;  4MEZ A;  3OLO A;  2UV0 E;  4DE1 A;  4F3L B;  3S22 A;  1I2W A;  3F1O A;  2ZM8 A;  4EES A;  5TGF A;  5HWV A;  5HWW A;  2OV5 A;  3ZNY A;  4EUV A;  1YQS A;  3VOL A;  2FZ0 A;  1W63 M;  2XQZ A;  4E6X A;  3TSG A;  3ZHH A;  4KZ5 A;  1H0M A;  1GSX A;  1EI5 A;  3FWL A;  4OQ0 A;  3VP0 A;  2W3H A;  1C3B A;  3AGF A;  3KX0 X;  2QZ6 A;  3ISG A;  4MLL A;  3MR0 A;  4KUK A;  1T1B A;  2HDU A;  2PT7 A;  4PKY G;  2QPN A;  1LSV A;  3NCK A;  2Y79 A;  2Q0O A;  2VGL M;  5FDS A;  4R6L A;  3H9W A;  3BRM A;  1XXM A;  2Q9M A;  3LY4 A;  1F2K A;  4IBX A;  3BWL A;  4R3A A;  2QJ7 A;  3CUE A;  1HTZ A;  4YIN A;  2GNX A;  2O0Y A;  4S2I A;  3LIF A;  4R70 A;  3K2N A;  5KIZ A;  2BAS A;  4XT2 A;  4C75 A;  3SS4 A;  1D06 A;  1BSG A;  2WKE A;  2W3E A;  3BLS A;  2PHY A;  3CPT A;  1VET B;  1W63 Q;  3FYZ A;  3KSG A;  2DNS A;  1AWI A;  5HWT A;  4P87 A;  3IS2 A;  2Y2H A;  2A24 B;  1E3U A;  2WKQ A;  5CXW A;  3UMD A;  4WMC A;  4JXW A;  2J8Y A;  4Y17 A;  4MNR A;  2WKH A;  5HD5 A;  2B95 A;  5G4Y A;  3MF0 A;  3PAG A;  2EA9 A;  3WS2 A;  3R4K A;  4ZBE A;  1OT6 A;  3VFH A;  4Z9Q A;  1OTI A;  4R0Q A;  4E3O A;  1GA0 A;  4I38 A;  1H8M A;  4EEP A;  3F1P A;  5DFY A;  3D3O A;  1WYB A;  4KEN B;  5GL9 A;  3BY8 A;  4KZ7 A;  3CUE C;  4U3T A;  4XUZ A;  2XD1 A;  5MC7 A;  2IWC A;  2EFU A;  3WRZ A;  3BLM A;  4ESP A;  3OPP A;  4KG6 A;  4DXC A;  3PR6 A;  1N4O A;  3K3C A;  3DWZ A;  1YKD A;  2J80 A;  3T1X A;  1K56 A;  4X68 A;  1RGZ A;  4E3N A;  3LIB A;  5HL1 A;  1MWS A;  3LFV A;  3SH8 A;  3TRC A;  5CTM A;  3EOI A;  1GSW A;  4EQ1 A;  4JF5 A;  4P0M A;  2BLS A;  5FI6 A;  1LT0 A;  3MKE A;  1EWZ A;  3HUM A;  3VP2 A;  4F94 A;  3CLO A;  3SOI A;  3LIA A;  2XA7 S;  4PM9 A;  4E3I A;  3NY4 A;  2ZOH A;  4Y0T A;  2R9X A;  5FEG A;  4GDN A;  4ZJ2 A;  4Q0I A;  1FCM A;  3KYZ A;  2JCH A;  4NXF A;  2VK3 A;  3BW6 A;  3T12 B;  1YPR A;  3UNW A;  3O5Y A;  4HP4 A;  4JGO A;  4O7D A;  2WGV A;  4PKY A;  2K7S A;  4KUO A;  2JBF A;  4KQQ A;  3U2A A;  4UQI S;  4IED A;  3HCY A;  2L0W A;  1D7E A;  1XFN A;  2P74 A;  4LV0 A;  4JLF A;  3KO6 A;  3MJQ A;  3CIT A;  3B42 A;  3IX4 A;  5AJG A;  3QNC A;  2W1T B;  1N9L A;  1S6R A;  1LLB A;  4R1G A;  3IX8 A;  3EWK A;  1VEU B;  3T4L A;  2BTF P;  3IBJ A;  4EBP A;  4GHI B;  5FQM A;  4GCZ A;  5HAP A;  5D3O A;  3U4L P;  1L0F A;  2Y2N A;  5G18 A;  3D72 A;  2OAP 1;  5FAT A;  3ITA A;  3G30 A;  3NUL A;  1NYY A;  3R7W A;  3HRE A;  3N8R A;  3UB5 P;  2VV6 A;  4Z1W A;  4RA7 A;  3OCL A;  2Y8H A;  3IX3 A;  2NUT C;  4M3K A;  3ZG9 B;  3LCE A;  3WWX A;  2PDR A;  3IT9 A;  4CLC B;  2V2F F;  3LID A;  5IHV A;  2Y55 A;  3F1N A;  1DP8 A;  3EEA A;  2JE5 A;  3N7W A;  1FOF A;  5CTN A;  1PI5 A;  2XA7 M;  1CF0 A;  3PBT A;  1YLZ A;  3TW8 A;  2HP5 A;  5FSR A;  1GHI A;  1JVJ A;  3I7J A;  4BEN A;  3DTM A;  3ZGA B;  4N1H A;  1XKZ A;  4IUH A;  2VLG A;  5GHY A;  2H0T A;  3UE0 A;  3G31 A;  4S2N A;  5F69 A;  4N92 A;  1NJ4 A;  2W27 A;  3CG5 A;  4PM5 A;  1PW8 A;  4K0W A;  4ARZ B;  3B33 A;  5M1A A;  3LUQ A;  1FQG A;  4UQI M;  1XA7 A;  3C4O A;  1LI0 A;  2PAV P;  1LI9 A;  4GW9 A;  4OOL A;  2WGW B;  1F5M A;  4H6J B;  4IBR A;  3IWQ A;  3A0S A;  3IH8 A;  4GNU A;  3FV7 A;  2JN7 A;  4HP9 A;  1CI9 A;  3A3D A;  2J7V A;  2G7U A;  3ZVT A;  1S4S A;  1T19 A;  5FQI A;  3CI6 A;  2DCF A;  3A0V A;  3UE6 A;  1IFQ A;  3UB9 A;  4ZJ1 A;  3E4P A;  3S7N A;  1VHM A;  2UWX A;  1ES5 A;  3IBR A;  3IF5 A;  4ETX A;  1HZO A;  4X1M A;  4K0X A;  3VMA A;  3P98 A;  4LFU A;  5M19 A;  4WZ5 A;  5HAQ A;  3IXD A;  4PMA A;  2IWB A;  2A49 A;  4LCM A;  4KQD A;  3P09 A;  2JKR I;  1IEL A;  1S66 L;  2J9O A;  3AGD A;  4B4Z A;  4IVI A;  3HLW A;  2K2N A;  3ZG0 A;  4DE2 A;  1KGE A;  1TVF A;  2EXA A;  3V3R A;  4JXS A;  2PD7 A;  2JKF A;  4EBL A;  3DAV A;  1IYS A;  4QY5 A;  4BBU A;  4FUW A;  3OPR A;  1KDW A;  1XFQ A;  2CC1 A;  1K25 A;  4N1X A;  3H7W A;  1NRF A;  5GLC A;  2X71 A;  4CLC D;  1O07 A;  4UA9 A;  4ETZ A;  4WEK A;  3MZE A;  2PD8 A;  4LV2 A;  5HL6 A;  1E25 A;  4EWF A;  2MJ6 A;  5A93 A;  4GZB A;  3T4O A;  4HY8 A;  3Q7V B;  4D2O A;  1RGY A;  3GSG A;  3SW1 A;  5HDC A;  3HLE A;  4R38 A;  4FH4 A;  1MPL A;  1K4F A;  1CEF A;  3TJZ C;  5FQJ A;  2H5S A;  1VM1 A;  4MN7 A;  3E4Q A;  5DFX A;  2Y2G A;  1CK3 A;  4G3K A;  1ESI A;  3T50 A;  2Y2P A;  1SKF A;  4L9F A;  5DTT A;  1JWZ A;  1MXO A;  4LRY C;  3RTY A;  4OQG A;  4EQI A;  4QWO A;  3OOV A;  5FA7 A;  3HVF A;  1NLZ A;  3L9K A;  1F9I A;  3UE3 A;  3F1O B;  4E04 A;  3D4F A;  5J3W A;  3P01 A;  4K08 A;  1ERM A;  2PR5 A;  4L9E A;  2KLI A;  3HLB A;  2V1A A;  4Q0H A;  3ZCZ A;  4LGW A;  3VSK A;  3G6O A;  1PFL A;  2O99 A;  3MZD A;  3A3F A;  4OQH A;  4OPY A;  4GKU A;  2Y2L A;  4FH2 A;  4Y15 A;  1Z09 A;  4KZ3 A;  1MWU A;  3LEQ A;  4MN6 A;  3Q1F A;  2ZC5 B;  4GS9 B;  4EEU A;  2A3U A;  3ITB A;  4X55 A;  1DP6 A;  3QP6 A;  1U60 A;  4XXR A;  1SDN A;  2KX6 A;  4JF6 A;  1TDL A;  4CLC E;  5DF9 A;  3NDG A;  4Y5F A;  2Q9N A;  3N8L A;  3ZVW A;  5FQ9 A;  3T4Q A;  4I39 A;  2H0Y A;  2O9C A;  5HPF A;  2JKT M;  5HZH A;  3O88 A;  2G2W A;  1ES3 A;  3UPO A;  3IXH A;  3PBN A;  3IXB A;  1OTD A;  5AQ9 A;  1H8Y A;  2ZC4 B;  4OKP A;  1NRJ A;  1PZO A;  3CPT B;  1ACF A;  4HH2 A;  2Y59 A;  3N8S A;  1OTA A;  2P04 A;  3NBL A;  4S2L A;  4DMZ A;  3RJU A;  4LLO B;  3IS2 B;  3BFD A;  1G6A A;  1PZP A;  5HX9 A;  1YSQ A;  5TR7 A;  1L2S A;  3LR5 A;  3WS1 A;  2ZC6 B;  2EX6 A;  1K4E A;  5CGW A;  1XJ4 A;  5GHX A;  3GTC A;  1NZO A;  1PYY A;  3MQ0 A;  2ZL1 B;  2XK1 A;  1KDS A;  1TD5 A;  4S2J A;  2ZMA A;  1O7E A;  4EXO A;  3W4O A;  3TG9 A;  3UPN A;  3F1P B;  1YMX A;  3CJM A;  1BTL A;  4BJP A;  3O87 A;  3FPW A;  5EUA A;  1LSW A;  4X56 A;  3PBS A;  4JXG A;  4EBN A;  3O86 A;  5EVE A;  2YKF A;  2VGJ A;  4K91 A;  4HES A;  4QB8 A;  1T1C A;  5CHM A;  5DTK A;  3PAE A;  2VV7 A;  1XGJ A;  2JC7 A;  4O0P A;  5EVI A;  2INW A;  4HHD A;  1K38 A;  3W2Z A;  3CHW P;  3VSL A;  4PHT A;  2VA0 A;  5AQA A;  3UPP A;  2HP9 A;  5KSH A;  1SDE A;  3VV4 A;  3NIA A;  2I72 A;  1D1J A;  1FIL A;  1XA1 A;  5HSQ A;  5EPH A;  4GD8 A;  3SS5 A;  1ALQ A;  3LR0 A;  2ZQA A;  3N6I A;  4WM9 A;  2PBD P;  1RCJ A;  1TF1 A;  4PPR A;  1BUE A;  2WAE A;  2VV8 A;  5HAI A;  2DRW A;  5HW3 A;  2NUP C;  3NI9 A;  4S2M A;  4GB7 A;  4BL2 A;  3VOZ A;  5L2F A;  1YMS A;  3MFX A;  1LL5 A;  4E6W A;  1BYW A;  3G2Z A;  4ZAM A;  2EX8 A;  3MS6 A;  4HJ6 A;  1L0D A;  4QD4 A;  1DRM A;  3SH9 A;  5EM0 A;  4N9L A;  3EEH A;  3MQQ A;  3WRT A;  4UAA A;  3C4P A;  4Y0U A;  5A92 A;  1VET A;  4KZ6 A;  3UDX A;  3SS3 A;  5EVI C;  3LEZ A;  3O3V A;  4B4X A;  5GLB A;  3HUO A;  3BM6 A;  3KSH A;  5DTS A;  3BEB A;  5DKL A;  2EWV A;  2XEP A;  4ID4 A;  2PU4 A;  3BQ8 A;  4R4R A;  3A3I A;  2Y2J A;  4HQA A;  2H10 A;  1BZA A;  2EX9 A;  1NLY A;  3M6B A;  4AFI A;  3GEC A;  5FQQ A;  3G35 A;  1TS6 A;  3HLG A;  2V0W A;  2Y2K A;  3F1N B;  2HDS A;  4FTX A;  5FI2 A;  3G32 A;  4II7 A;  4JGR A;  3M2K A;  4X25 A;  5F5Y A;  3UY6 A;  5CEC A;  3Q07 A;  4R23 A;  4NXE A;  2H28 A;  4KZA A;  2V1B A;  3JYI A;  3SZT A;  1YSP A;  3DWK A;  2WUQ A;  1PW1 A;  5HPI A;  1K56 D;  4OLG A;  1K54 A;  3UN7 A;  2PU2 A;  2IA2 A;  1J3W A;  1OTE A;  5CED A;  2HDQ A;  1PWD A;  1P9W A;  1WA9 A;  1BUL A;  4E3L A;  3CWF A;  5TJJ A;  1H3Q A;  4FCF A;  5TBM A;  2P9V B;  2J3T C;  1Y4O A;  5DKK A;  4WEJ A;  1RP5 A;  1KVM A;  2XLN A;  5CHJ A;  3LYX A;  2RL3 A;  3DTE A;  3T1R A;  2HGV A;  5J4E A;  2IWD A;  4OOY A;  1YT4 A;  4JKT A;  1YM1 A;  2EWW A;  3MXR A;  5U47 A;  2V20 A;  1ES2 A;  1T18 A;  1GHP A;  3BY9 A;  3OPL A;  4YWZ A;  4B93 A;  1XP4 A;  2V1Z A;  4DF6 A;  4HJ4 A;  3M2J A;  1G68 A;  3GVB A;  3IXG A;  4WYY A;  5FDH A;  3EGX C;  1NZU A;  1STZ A;  1BLC A;  4PM8 A;  3CMZ A;  4C3Q A;  3PBO A;  4I3I A;  1SHV A; 
#chains in the Genus database with same CATH homology
 2ZJ9 A;  1DJC A;  4GZB A;  4LEN A;  1IKG A;  3Q7V B;  4D2O A;  3ZHH A;  1XX2 A;  1RGY A;  1K54 C;  4RX2 A;  1K6S A;  4KZ5 A;  1E3U D;  3N4I A;  3WS4 A;  4HEF A;  4WMC D;  3ZDJ A;  1BLH A;  1EI5 A;  3GSG A;  3FWL A;  4OQ0 A;  5EVI D;  3AGE A;  3HLE A;  3VP0 A;  1C3B A;  1MPL A;  3A3J A;  3AGF A;  2HDR A;  4FH4 A;  1K4F A;  2QZ6 A;  1CEF A;  3ISG A;  3BFF A;  4MLL A;  5FQJ A;  2H5S A;  1VM1 A;  3IWO A;  5AQB A;  2Y2G A;  1CK3 A;  3MXS A;  1ESI A;  2HDU A;  2QPN A;  2ZC7 A;  3BYD A;  2Y2P A;  3NCK A;  2XF3 A;  1SKF A;  3GV9 A;  1LHY A;  2Y2M A;  2Y2O A;  3IHB A;  4R3J A;  1KE3 A;  5DTT A;  1JWZ A;  1MXO A;  3LO7 A;  4WEL A;  4P85 A;  3Q82 A;  1Y54 A;  3BRM A;  4OQG A;  1XXM A;  4EQI A;  2Q9M A;  3LY4 A;  3SH7 A;  4IBX A;  5FA7 A;  3HVF A;  4X6T A;  2RCX A;  4JF4 A;  3UE3 A;  3PTE A;  1BT5 A;  1HTZ A;  1FR1 A;  2J9P A;  4YIN A;  4MBF A;  3D4F A;  3PBQ A;  1ERM A;  4S2I A;  5F1G A;  2WZX A;  4OPR A;  4GDB A;  4KZ9 A;  4C75 A;  2ZC3 B;  2ZQ8 A;  2ZLY A;  3HLB A;  4KG2 A;  3SS4 A;  2XD5 A;  1BSG A;  2WKE A;  4QHC A;  1GA9 A;  3ZCZ A;  1FCN A;  1W5D A;  3VSK A;  2XGN A;  3S1Y A;  3BLS A;  4HBU A;  3MZD A;  3ZFZ A;  4LV3 A;  3A3F A;  3FYZ A;  1IKI A;  3BFE A;  4OQH A;  2DNS A;  4OPY A;  4GKU A;  2HPB A;  3W4Q A;  2Y2L A;  3VP4 A;  4S2O A;  4BLM A;  4DE0 A;  1J9M A;  1W8Y A;  4FH2 A;  1FR6 A;  4KZ3 A;  4P87 A;  4OP8 A;  1MWU A;  3OZH A;  4S2N C;  4KQO A;  2Y2H A;  3Q1F A;  2ZC5 B;  4X69 A;  3VOY A;  2A3U A;  3ITB A;  3PBR A;  1E3U A;  4X55 A;  5CXW A;  2EFX A;  4WMC A;  2Z2M B;  1U60 A;  5JYO A;  2XH9 A;  4XXR A;  3QNB A;  4QY6 A;  1SDN A;  4JXW A;  2ZM2 A;  3MBZ A;  3ZG7 B;  4NK3 A;  4S2K A;  4JF6 A;  1KVL A;  1TDL A;  2J8Y A;  1ESU A;  2WKH A;  4MNR A;  3BFG A;  3FKW A;  4XUX A;  5DF9 A;  3Q81 A;  3NDG A;  2Q9N A;  2FFY A;  3PAG A;  5E2G A;  3N8L A;  1L0G A;  3WS2 A;  4OVD A;  3ZVW A;  5FQ9 A;  1MWT A;  1NYM A;  4X53 A;  4ZBE A;  1YLY A;  5CGX A;  3VFH A;  1K6R A;  2H0Y A;  1ONG A;  4Z9Q A;  4R0Q A;  5FAP A;  1HD8 A;  1LL9 A;  4E3O A;  1GA0 A;  3O88 A;  2G2W A;  1FSW A;  5EOO A;  1TDG A;  5E2H A;  4DRT A;  3UE1 A;  2WGW A;  1ES3 A;  3UPO A;  3IXH A;  3PBN A;  3IXB A;  1WYB A;  4KEN B;  3MZF A;  5GL9 A;  4C6Y A;  5AQ9 A;  4KZ7 A;  2XR0 A;  1H8Y A;  4U3T A;  4XUZ A;  1Q2Q A;  2ZC4 B;  2XD1 A;  5AQ7 A;  4PM7 A;  4OKP A;  3W8K A;  5GLA A;  5FAS A;  1PZO A;  4OPZ A;  2IWC A;  2Y59 A;  2EFU A;  3N8S A;  3BLM A;  3NBL A;  3OPP A;  4KG6 A;  3WRZ A;  3WS0 A;  4S2L A;  1N4O A;  4DXC A;  3DWZ A;  3IH9 A;  3RJU A;  3TOI A;  5KSC A;  4WZ5 C;  1K56 A;  5CRF A;  5DF7 A;  4X68 A;  1RGZ A;  4E3N A;  3BFD A;  1G6A A;  1PZP A;  5HL1 A;  2ZD8 A;  5BOH A;  3V5M A;  1MWS A;  5HX9 A;  3OPH A;  5TR7 A;  4OOM A;  4KQR A;  3SH8 A;  1JWV A;  1L2S A;  5CTM A;  3ZNT A;  3WS1 A;  2ZC6 B;  2EX6 A;  4KZ4 A;  1K4E A;  4JF5 A;  4P0M A;  2EXB A;  5CGW A;  2BLS A;  5EVL A;  5FI6 A;  4RX3 A;  5GHX A;  4QJG A;  3MKE A;  1EWZ A;  2E8I A;  3HUM A;  3VP2 A;  5A90 A;  4F94 A;  1MY8 A;  3SOI A;  3GTC A;  4PM9 A;  1NZO A;  1PYY A;  3NY4 A;  4E3I A;  4R4S A;  3BEC A;  2OLV A;  3UDF A;  4NET A;  4Y0T A;  2R9X A;  4PM6 A;  2XK1 A;  1ONH A;  1KDS A;  2P9V A;  4GDN A;  3IHA A;  4P6B A;  1I5Q A;  4ZJ2 A;  1W8Q A;  4S2J A;  2ZMA A;  1FCM A;  1O7E A;  1XGI A;  3HUN A;  3ZG5 A;  3NDE A;  4ZJ3 A;  3W4O A;  4DKI A;  3TG9 A;  3EQV A;  3MFD A;  3UPN A;  1QME A;  4LV1 A;  2JCH A;  4N9K A;  1YMX A;  3CJM A;  1MKI A;  1BTL A;  4UA6 A;  3WS5 A;  4BJP A;  3IF6 A;  2WZZ A;  3UNW A;  4KZB A;  3O87 A;  3GR2 A;  3VFF A;  1VQQ A;  4O7D A;  1DY6 A;  2WGV A;  5EUA A;  2WAD A;  4X56 A;  1XPB A;  1PWG A;  5E2F A;  2JBF A;  4KQQ A;  3PBS A;  4JXG A;  4EBN A;  4MBK A;  4JBF A;  1KGG A;  3G4P A;  3O86 A;  4IED A;  5DF8 A;  1IEM A;  4KZ8 A;  1M6K A;  2P74 A;  4LV0 A;  4JLF A;  4CPK A;  2VGJ A;  4K91 A;  4E3J A;  4HES A;  3ZG8 B;  4ZDX A;  2BG1 A;  4LCL A;  4CJN A;  4QB8 A;  3A3E A;  1S0W A;  5CHM A;  3CZD A;  5DTK A;  3QNC A;  3PAE A;  4FSF A;  1XGJ A;  2Z2L B;  4ZTK A;  1S6R A;  1LLB A;  2JC7 A;  1YLT A;  3GRJ A;  1JWP A;  5EVI A;  3HLF A;  1K38 A;  4R1G A;  3C7U A;  5DVA A;  3VSL A;  5CHU A;  4EBP A;  5CER A;  5HAP A;  3HLC A;  5FQM A;  4YFM A;  2B5R A;  5D3O A;  1ZKJ A;  3QHY A;  5AQA A;  3UPP A;  3W4P A;  4A5R A;  2HP9 A;  4EV4 A;  5KSH A;  4BQM A;  1SDE A;  4OH0 A;  1L0F A;  2Y2N A;  3B3X A;  4S2P A;  5G18 A;  3NIA A;  5FAT A;  2I72 A;  3ITA A;  1W79 A;  2ZQ9 A;  3G30 A;  4RYE A;  2ZM0 A;  1XA1 A;  1NYY A;  3HRE A;  3N8R A;  4WBG A;  5EPH A;  4GD8 A;  3SS5 A;  1ALQ A;  2ZQA A;  2QMI A;  3DW0 A;  3N6I A;  4Y7P A;  1I2S A;  4WM9 A;  4EUZ A;  1RCJ A;  3G34 A;  4PPR A;  1BUE A;  4RA7 A;  2WAE A;  1E4D A;  3OCL A;  5HAI A;  3IF6 B;  1M40 A;  5FQK A;  4M3K A;  1IYP A;  1K55 A;  3OC2 A;  4OP5 A;  4WZ4 A;  5FAQ A;  3ZG9 B;  4BD1 A;  3LCE A;  3WWX A;  2DRW A;  2R9W A;  3IT9 A;  5HW3 A;  4B88 A;  5CEB A;  3IF6 C;  3NI9 A;  5EEC A;  4S2M A;  2FFF B;  4GB7 A;  1CI8 A;  2V2F F;  4KG5 A;  5IHV A;  4BL2 A;  3VOZ A;  1QMF A;  5GLD A;  2Y55 A;  1K57 A;  1JTD A;  5L2F A;  1FCO A;  1YMS A;  4R3B A;  1JTG A;  1LL5 A;  4L0L A;  2Y2Q A;  5JYP A;  4RVA A;  4E6W A;  3G2Z A;  4ZAM A;  1YLW A;  2EX8 A;  2JE5 A;  3N7W A;  1FOF A;  5CTN A;  1IYO A;  1PI5 A;  2X02 A;  3EQU A;  3PBT A;  3FZC A;  1YLP A;  1L0D A;  4QD4 A;  1YLZ A;  4QU3 A;  3SH9 A;  3UDI A;  2HP5 A;  1Q2P A;  4N9L A;  5FSR A;  3V50 A;  1GHI A;  1JVJ A;  3I7J A;  3WRT A;  4DE3 A;  4UAA A;  4BEN A;  3G2Y A;  3DTM A;  5EVI B;  1ES4 A;  4H8R A;  3ZGA B;  3C4P A;  4Y0U A;  4N1H A;  5A92 A;  1XKZ A;  1GHM A;  5GHY A;  4UA7 A;  2H0T A;  4KZ6 A;  3UE0 A;  3UDX A;  4E3K A;  3G31 A;  3SS3 A;  4UHU A;  3LEZ A;  4S2N A;  5EVI C;  4N92 A;  3IQA A;  3O3V A;  4OPQ A;  4B4X A;  1NJ4 A;  3HUO A;  2G2U A;  3BM6 A;  5GLB A;  5I94 A;  1KGF A;  1FSY A;  3BEB A;  1BLP A;  5DTS A;  2C5W B;  3CG5 A;  3NC8 A;  5E43 A;  1H5X A;  1H8Z A;  4PM5 A;  1PW8 A;  2Y2I A;  1ERQ A;  5HFO A;  5J8X A;  3IWI A;  4K0W A;  4GN2 A;  2XEP A;  4ID4 A;  1HVB A;  2OLU A;  3UO9 A;  4DDY A;  2PU4 A;  5A91 A;  5M1A A;  4R4R A;  3A3I A;  1FQG A;  3RXW A;  1XA7 A;  4OON A;  3C4O A;  2Y2J A;  3HL9 A;  1LI0 A;  1LI9 A;  1MBL A;  3C7V A;  4OOL A;  4IVK A;  5M18 A;  2WGW B;  1PIO A;  2H10 A;  3MKF A;  3E2K A;  3OCN A;  2WAF A;  4HBT A;  5F83 A;  4IBR A;  1BZA A;  2EX9 A;  2OSU A;  1Z6F A;  1WYC A;  3IWQ A;  3M6B A;  3IH8 A;  4GNU A;  5FQQ A;  3FV7 A;  3G35 A;  2ZQ7 A;  1CI9 A;  3A3D A;  1K55 C;  3HLG A;  5EOE A;  2Y2K A;  2J7V A;  2HDS A;  5FI2 A;  3ZVT A;  3G32 A;  2ZQD A;  4JPM A;  5FAO A;  1NXY A;  1GCE A;  5FQI A;  2WGI A;  3S4X A;  2C6W B;  2DCF A;  3M2K A;  3UY6 A;  5CEC A;  1K57 C;  4OLD A;  1AXB A;  3Q07 A;  3HLD A;  4R23 A;  1IYQ A;  1KE4 A;  4ZJ1 A;  5TFQ A;  4MBH A;  2XFS A;  4Y0O A;  2WKI A;  3FKV A;  5CGS A;  5E2E A;  4KZA A;  2UWX A;  3GMW A;  4JXV A;  1ES5 A;  1WE4 A;  2PBY A;  3IF5 A;  5FI7 A;  3VP1 A;  1DJB A;  3JYI A;  1HZO A;  1L0E A;  3DWK A;  5KMW A;  4K0X A;  3VMA A;  1ZC2 A;  1PW1 A;  2WUQ A;  2Y4A A;  1K56 D;  3P98 A;  4FD8 A;  5M19 A;  4OLG A;  1K54 A;  2Y91 A;  4WZ5 A;  2PU2 A;  3IXD A;  4PMA A;  2VGK A;  1TEM A;  3UN7 A;  5HAQ A;  1PI4 A;  2GDN A;  2ZQC A;  2IWB A;  5CED A;  2HDQ A;  3Q7V A;  1PWD A;  2HP6 A;  2A49 A;  1ZG4 A;  1BUL A;  4U0X A;  4LCM A;  5EE8 A;  4E3L A;  1KE0 A;  5F82 A;  1CEG A;  4FCF A;  4DDS A;  3V3S A;  3P09 A;  2P9V B;  5F1F A;  4WEJ A;  1RP5 A;  1KVM A;  1IEL A;  2XLN A;  5CHJ A;  1W7F A;  3M6H A;  1NY0 A;  3LY3 A;  2J9O A;  2RL3 A;  3BFC A;  2XDM A;  4Q8I A;  3AGD A;  4B4Z A;  1SCW A;  4IVI A;  3V39 A;  2IWD A;  4U0T A;  3HLW A;  3ZG0 A;  4BD0 A;  1DJA A;  3RXX A;  4DE2 A;  1ZG6 A;  3GQZ A;  1KGE A;  1TVF A;  5HAR A;  2EXA A;  4OQI A;  3V3R A;  4OOY A;  4JXS A;  4E3M A;  1YT4 A;  4JKT A;  4EBL A;  2WYX A;  3HBR A;  1YM1 A;  3E2L A;  1BLS A;  1IYS A;  3MXR A;  4QY5 A;  4BL3 A;  3OPR A;  5U47 A;  4GD6 A;  2V20 A;  1KDW A;  1N9B A;  1ES2 A;  1YLJ A;  3C5A A;  1MWR A;  1GHP A;  2WK0 A;  3VP3 A;  2X01 A;  2CC1 A;  3OPL A;  1K25 A;  2XFT A;  3Q7Z A;  4MEZ A;  4N1X A;  4DE1 A;  1XP4 A;  2V1Z A;  4DF6 A;  4GOG A;  1NRF A;  3M2J A;  5GLC A;  3S22 A;  1I2W A;  2X71 A;  1G68 A;  3GVB A;  3IXG A;  1O07 A;  4WYY A;  1PWC A;  4UA9 A;  5FDH A;  2ZM8 A;  1NZU A;  4WEK A;  1ERO A;  5TGF A;  3MZE A;  2OV5 A;  3ZNY A;  4DXB A;  2EX2 A;  4LV2 A;  1YQS A;  1OME A;  1BLC A;  4PM8 A;  3CMZ A;  1E25 A;  4C3Q A;  5KZH A;  3PBO A;  4EWF A;  2XQZ A;  5GHZ A;  1SHV A;  4E6X A;  3TSG A;  5A93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...