3G35A

Ctx-m-9 class a beta-lactamase complexed with compound 12 (f13)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
260
structure length
259
Chain Sequence
AVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase CTX-M-9a
publication title Molecular docking and ligand specificity in fragment-based inhibitor discovery
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 94
structure length 259
sequence length 260
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3g35A00
1MWSA 4S2IA 2XDMA 2WGVA 4DE2A 3QNBA 4C6YA 2XQZA 1ALQA 4QB8A 1W8YA 1WYBA 3BYDA 3NDGA 1BLHA 2H10A 1PW1A 2C6WB 3VOYA 2Y2PA 5CXWA 4Y0OA 1FR6A 2WZZA 3EQVA 4PPRA 2PBYA 5BOHA 1HTZA 5CHUA 2Y2LA 3IWOA 4OKPA 5FQIA 2V1ZA 1G6AA 1IYPA 1VM1A 3A3FA 4FCFA 3SH8A 3GSGA 3CMZA 4JXSA 3UDXA 1DY6A 1XPBA 3FZCA 3PAGA 3VP3A 4HEFA 3SOIA 1GHMA 3GVBA 1L0GA 2VGKA 3FV7A 3NIAA 3V39A 1YT4A 3HLEA 3NCKA 4K0WA 2QZ6A 1KDSA 1TDGA 3MZFA 3BFEA 4K0XA 5TR7A 4C3QA 4K91A 3HUMA 5EVLA 3MFDA 4N1XA 1ZC2A 1EI5A 3GR2A 2JBFA 5CTMA 2WZXA 5FQKA 3LEZA 4BL3A 1YLWA 1K38A 1W5DA 3IXHA 4FH2A 5AQ7A 4MEZA 3ZG9B 4ZAMA 4OPYA 1WYCA 1YMSA 3S22A 1Q2QA 3NI9A 1HD8A 1VQQA 4R0QA 2Y2NA 4N9LA 4DE1A 3G4PA 4U3TA 2HP5A 2XGNA 1XP4A 3UDIA 3DTMA 1CEFA 3A3EA 4X6TA 4DDYA 2ZQ9A 3ZNYA 2BLSA 5KSCA 2PU4A 1I2SA 2HDUA 3O87A 3W4OA 2Y4AA 3OCLA 4WMCD 4R3JA 2ZM8A 3IWIA 5IHVA 3HUNA 1ERMA 1K56D 1MBLA 4EBLA 3VP0A 5GLAA 3AGDA 4P87A 1ONHA 5FDHA 2XD5A 4R4RA 1H8YA 1QMFA 2ZQCA 3HLBA 3BFDA 5F83A 4BL2A 1IEMA 3ZGAB 5I94A 3MKEA 5DVAA 2Y2QA 3BFGA 3C4OA 2Z2MB 4RX2A 1JWVA 2ZLYA 3IXGA 2Y2IA 3V5MA 5G18A 1Q2PA 3N8LA 4XUZA 1W7FA 5E2HA 3G2YA 4OH0A 4GKUA 4JF4A 3CZDA 1ES2A 1K57C 3VP1A 2J9PA 4L0LA 3N6IA 1DJAA 3WS4A 3HLGA 2EX8A 1M6KA 5KZHA 1CK3A 1PYYA 4GD6A 3VSKA 5TGFA 1IELA 4E3OA 3IH9A 4JXGA 4KQQA 4N9KA 4S2MA 4PM9A 4YFMA 2XEPA 4JXVA 3GV9A 4FSFA 4DRTA 4OQ0A 1LL5A 4KZ3A 2E8IA 5F1FA 3IT9A 3RJUA 1NZUA 3S1YA 3IF6C 4WYYA 3QHYA 3S4XA 1GCEA 1PZOA 2EFXA 3M6HA 1LI9A 4S2LA 3VP2A 5HL1A 4NK3A 1PWDA 4X56A 4BLMA 1LL9A 3PAEA 4S2KA 4JBFA 1KVMA 1MWRA 1K57A 3V3RA 3UNWA 5DF7A 3BECA 3ZG0A 3FKVA 1E4DA 3SS5A 3BLSA 2EX9A 3TSGA 3SS3A 1HVBA 1MXOA 3G31A 2WGIA 4NETA 3PBRA 2V20A 5KMWA 1BTLA 3O86A 3Q81A 4WEJA 4OQHA 3IF6A 1YM1A 3P09A 4GDNA 1BZAA 4EWFA 4GN2A 1K4EA 5FQMA 4CJNA 1O07A 2UWXA 2B5RA 3E2KA 4QY6A 1S0WA 4S2OA 4RX3A 3HBRA 4IBXA 4KG6A 5TFQA 2ZM2A 3MZDA 1O7EA 4OOLA 4WZ5C 3Q07A 4F94A 4X69A 4R4SA 3HREA 5FATA 3OPLA 1NJ4A 5DF9A 1IKIA 1TEMA 2X71A 2ZJ9A 1CI9A 3B3XA 4IVIA 2QMIA 4RYEA 3O3VA 5U47A 4EQIA 4OOYA 2X02A 4E3LA 1CI8A 4D2OA 2JCHA 1ES3A 1N9BA 1XX2A 5HAIA 4UA7A 5GLCA 5EOEA 2IWCA 1K4FA 5DTSA 3HVFA 4Y0TA 1H5XA 5HW3A 4OPQA 2QPNA 4KZ9A 1GA9A 2H5SA 3IXDA 1DJCA 2WGWA 5EVIC 4MBHA 2IWDA 4WZ5A 5DF8A 1FSYA 2I72A 4UA9A 3C4PA 1IYQA 4U0TA 2WKEA 3NDEA 5D3OA 4B4ZA 1EROA 5A92A 3MZEA 3GTCA 5FI6A 4MBFA 3UPOA 3SH9A 3TOIA 1XA7A 1H8ZA 4EV4A 3G34A 5FAPA 3ZG7B 1JWPA 2P74A 1L0EA 1BLPA 2ZMAA 4YINA 3VOZA 4Q8IA 4R1GA 1K54C 2OLUA 3QNCA 4PM7A 3ZDJA 3LO7A 3G32A 3HLDA 3OPRA 3Q7ZA 5EOOA 5FQ9A 3WS1A 1FQGA 4FD8A 4KG5A 5FASA 5HAPA 4E3JA 3W8KA 3M2JA 5EVIA 3GQZA 1FR1A 4IVKA 5HARA 3P98A 2HDQA 2ZD8A 3FWLA 4EUZA 3V50A 5CGWA 4WM9A 4OPRA 3G30A 4OVDA 4Z9QA 2Y2MA 1MPLA 5A91A 1S6RA 2Y59A 1I2WA 4BD0A 3IF6B 4WBGA 2BG1A 4WZ4A 2R9WA 3BEBA 4LV0A 4RA7A 4LV1A 4X68A 4ZJ1A 4DKIA 3IHAA 5FA7A 3OPHA 3IXBA 1RCJA 1E3UA 4U0XA 1K54A 3M2KA 4Y7PA 5CHJA 4S2NC 5JYPA 3DWKA 4E6WA 3ZG8B 3C5AA 4E3KA 1XA1A 1TVFA 3BRMA 2WUQA 3W4PA 1W79A 3IWQA 4JKTA 4KZ7A 2Q9MA 3LCEA 4ID4A 5FQQA 3IF5A 2EXAA 1PI5A 1SCWA 2XLNA 3HLCA 1BLSA 3GRJA 1L0DA 4CPKA 3I7JA 3A3JA 3N7WA 5FAQA 1Y54A 1ERQA 2Y2HA 4S2JA 1N4OA 4GZBA 1E25A 2WGWB 4ZTKA 2XF3A 4KENB 1K55C 2XFSA 5AQ9A 2J9OA 1RGZA 2RCXA 1BSGA 2P9VA 4S2NA 5CHMA 5M1AA 5DTTA 3V3SA 3BFFA 3NBLA 1DJBA 2Q9NA 4BENA 3UPPA 5CEDA 5HX9A 4IBRA 3DWZA 4P0MA 3BFCA 3N8RA 2WK0A 4DE0A 5E2GA 4KZ4A 3IQAA 4QU3A 4C75A 4GNUA 1NZOA 1KE3A 3SS4A 1NXYA 2A49A 4JLFA 5AQBA 5GL9A 1XGIA 3ZG5A 1PI4A 2ZQ7A 4UA6A 5CGXA 2CC1A 4MNRA 3VMAA 4OLDA 1YLTA 3UY6A 4DF6A 4DXCA 4E3IA 2J7VA 2XD1A 5CECA 1EWZA 2EFUA 2HDSA 1SHVA 3ISGA 3LY4A 4KG2A 5EVIB 2Y2KA 4KQOA 4E6XA 5AQAA 2JE5A 4JF5A 1K55A 3ITBA 4DXBA 1IYOA 1PWGA 2ZC6B 2FFYA 4GOGA 1ZG4A 3Q1FA 2ZQ8A 1RP5A 4P6BA 2OV5A 3IH8A 5EUAA 2PU2A 3WS0A 1GHPA 4PMAA 4OQGA 1IKGA 3CG5A 3C7UA 4MLLA 2EX6A 3PBSA 1NYYA 1OMEA 2ZM0A 3BM6A 1YLJA 2G2WA 3RXXA 1KE0A 2G2UA 5E2FA 4UHUA 3WWXA 3PBTA 3ZNTA 1QMEA 5CGSA 5CRFA 1G68A 1ZG6A 4OP5A 3M6BA 3W4QA 2ZQAA 2HDRA 4BQMA 1JTGA 3MXSA 2ZC7A 3IHBA 4X53A 2HP9A 4HESA 3OZHA 3ZFZA 1HZOA 3UN7A 2WKHA 5F1GA 2A3UA 4QHCA 3HL9A 3Q82A 3ZHHA 2V2FF 1J9MA 1M40A 3PTEA 3FKWA 2WAEA 1ES4A 1ESUA 1Z6FA 1ES5A 1PZPA 2OLVA 3VFFA 5HAQA 1JWZA 1FSWA 1L0FA 1SKFA 2P9VB 3D4FA 4WEKA 3PBQA 3EQUA 3UPNA 1ONGA 4QJGA 4WMCA 3O88A 2RL3A 1K56A 3VP4A 2OSUA 4H8RA 1BUEA 2EX2A 4A5RA 4OONA 5CERA 3ZVTA 3UE3A 1KGEA 5F82A 2C5WB 1FCOA 3ITAA 2X01A 2ZC5B 1FOFA 1NRFA 2DRWA 1CEGA 4OLGA 5CEBA 5FSRA 4LV2A 3C7VA 5M19A 2WYXA 3UE0A 2GDNA 3WS5A 3A3DA 3HLFA 3PBOA 2Y91A 1MY8A 1YMXA 1YQSA 4KZ5A 4XXRA 1K6SA 1W8QA 3AGFA 2Y2GA 1K6RA 1KVLA 5GHZA 4GDBA 4RVAA 4JXWA 2ZQDA 5EE8A 3OCNA 4ZBEA 5M18A 4Y0UA 4ZJ2A 5J8XA 1TDLA 1FCNA 2XFTA 4JPMA 4B4XA 4WELA 1KDWA 3MKFA 4FH4A 5GLDA 3N4IA 4O7DA 3AGEA 4OOMA 1WE4A 1KE4A 3VSLA 2HPBA 2WKIA 3G2ZA 3GMWA 3JYIA 1PWCA 2DNSA 4X55A 4PM5A 5EPHA 3Q7VA 3TG9A 4KZAA 3HUOA 1YLPA 5E43A 1KGFA 4KQRA 1U60A 1KGGA 5L2FA 2XR0A 3BLMA 4ZJ3A 5CTNA 2Y2OA 2ZC4B 1MKIA 1XKZA 1C3BA 3G35A 2DCFA 2J8YA 2XH9A 1IYSA 1MWTA 2EXBA 4OPZA 4MBKA 5HFOA 2WADA 4GB7A 1YLZA 4EBNA 3LY3A 4DE3A 1YLYA 1L2SA 3MXRA 1JVJA 3UDFA 4OP8A 3E2LA 3HLWA 1MWUA 4LV3A 3OPPA 2HP6A 4HBTA 1LHYA 1XGJA 4LCLA 5E2EA 5EVID 3UO9A 3WS2A 3ZCZA 3FYZA 4P85A 4IEDA 4UAAA 4QD4A 5KSHA 4KZ6A 2Y55A 5A90A 1XXMA 4LCMA 5FI2A 3RXWA 4DDSA 4E3MA 2Y2JA 5GHYA 1LLBA 2FFFB 4PM8A 5FI7A 5A93A 3VFHA 2JC7A 1SDEA 1JTDA 2WAFA 4R3BA 5FQJA 1GHIA 3NC8A 5DTKA 1LI0A 2XK1A 1BT5A 4EBPA 3WRZA 2Z2LB 1E3UD 3ZVWA 3OC2A 4BJPA 4B88A 4HBUA 4R23A 3NY4A 2H0YA 1NY0A 1K25A 4LENA 4N92A 4GD8A 4OQIA 4M3KA 4JF6A 1BLCA 3DW0A 4QY5A 2ZC3B 1I5QA 4KZBA 1NYMA 1PW8A 1SDNA 1GA0A 1BULA 4ZDXA 4E3NA 4PM6A 3SH7A 1ESIA 4S2PA 1AXBA 5JYOA 1ZKJA 3MBZA 3N8SA 2IWBA 3A3IA 2R9XA 5FAOA 3CJMA 2H0TA 1PIOA 5GHXA 1RGYA 4KZ8A 2VGJA 5EECA 4BD1A 4N1HA 4XUXA 3UE1A 3Q7VB 3PBNA 3WRTA 1FCMA 5GLBA
chains in the Genus database with same CATH superfamily
4QB8A 2LB9A 5C5KA 4DJ3A 2H10A 2C6WB 2Y2PA 4GHIB 2YKHA 2XSSA 4WUJA 3IWOA 1MKMA 5FQIA 2V1ZA 2PAVP 1G6AA 1VM1A 4QPRA 3CMZA 4JXSA 3PAGA 4HEFA 3MQOA 3NIAA 5DKKA 4K0WA 4K0XA 4C3QA 4K91A 3MFDA 4N1XA 1STZA 1Y4OA 3H9WA 4BL3A 4M4XA 3KYZA 3MMHA 5AQ7A 4MEZA 4OPYA 2A24A 3T4QA 3S22A 1VQQA 4KUKA 2KLIA 2O0YA 2XGNA 2HJ9C 5F6AA 2PU4A 2ZM8A 1K56D 1MBLA 5GLAA 5FDHA 1OTBA 3OLOA 4P6ZS 2ZQCA 3HLBA 5F83A 1IEMA 5I94A 2Q0OA 1P0ZA 3BFGA 2PD7A 1PFLA 1JWVA 2ZLYA 1XJ3A 3N8LA 1W7FA 3FC7A 5E2HA 3BQ8A 3LIEA 4OH0A 3CZDA 1ES2A 1K57C 1M6KA 3VSKA 1XJ4A 5DFYA 4B9OA 4KQQA 4JXVA 2V8FA 3IT9A 4WYYA 3T4SA 3S4XA 1V9ZA 5HPIA 4B93A 5HL1A 4NK3A 4BLMA 3PAEA 1KVMA 3UNWA 1NLYA 3FKVA 1D1JA 2EX9A 3TSGA 4X1LA 4O01A 3RTYA 1HVBA 3PBRA 4NXEA 2O9AA 3Q81A 4LFUA 1YM1A 3P09A 1BZAA 5FQMA 1O07A 3E2KA 2ZM2A 4OOLA 4WZ5C 4HJ6A 4IUHA 4R4SA 3DBAA 1IKIA 1CI9A 3B3XA 4RYEA 3O3VA 5U47A 4EQIA 1CI8A 2EA9A 5L10A 4GJ4A 2IWCA 4RQ9A 4KZ9A 2H5SA 1MZUA 3IXDA 2WGWA 5EVIC 4MBHA 2VV8A 5DF8A 1FSYA 5EM0A 4G3WA 3C4PA 1G28A 5L07A 3DTEA 5A92A 3C38A 1OTAA 4I3JA 3SH9A 4MDZA 3TOIA 4BMWA 4EV4A 5FAPA 1JWPA 2P74A 1CQAA 1BLPA 2ZMAA 4Q0JA 1K54C 2OLUA 3LO7A 3HLDA 3WS1A 1SKOB 3K3DA 4HY8A 4WM9A 4Q0IA 4OVDA 2Y59A 1I2WA 3IF6B 4WZ4A 4RA7A 4DKIA 3IHAA 3LIDA 2OAP1 4MN5A 5HPFA 5CHJA 2W3EA 3ZG8B 1W63Q 1XA1A 2WKPA 1TVFA 1F2KA 3GECA 2WUQA 1W79A 2Q9MA 3IF5A 4CLCC 2EXAA 4F3LA 2XLNA 3GRJA 1H8MA 1L0DA 3NOUC 3I7JA 4CPKA 2O9BA 1G6OA 4S2JA 1P9WA 2XF3A 1K55C 3TE8A 4EW7A 4S2NA 5CHMA 5DTTA 3NBLA 4BENA 3UPPA 5HX9A 3BFCA 3N8RA 2WK0A 3BY9A 2JKRI 4GNUA 3C30A 2GNXA 2GX5A 3FPWA 1DRMA 2J7VA 2XD1A 1EWZA 2HDSA 1W63M 3LY4A 4KQOA 5AQAA 4JF5A 3L7HA 3ITBA 4DXBA 1PWGA 1YKDA 4MCWA 2ZQ8A 3DTIA 4PMAA 3C7UA 2VKSA 2FZ0A 1CF0A 3VV4A 2ZM0A 3BM6A 3R4KA 5AVFA 3PBTA 1QMEA 3M6BA 3W4QA 4BQMA 4R3AA 2ZC7A 3IHBA 1F98A 4HESA 3OZHA 3UN7A 2W1TA 2WKHA 3MR0A 4WLAA 5FEFA 1Z6FA 1PZPA 4II7A 5HAQA 3PXPA 1FSWA 1L0FA 1SKFA 1SZVA 4WEKA 2LB5A 2VGLM 3T1XA 5F5YA 3UPNA 1ONGA 3O88A 5EFWA 3UE3A 2B95A 5F82A 2C5WB 3ITAA 2Y8HA 4OLGA 2A2LA 2VX8A 3C7VA 5M19A 3SW1A 1VEUB 2INWA 1L3LA 3A3DA 2D01A 4YWZA 1MY8A 3LIFA 2Y2GA 3T4KA 5AJGA 2XROA 1K6RA 2PDRA 4JXWA 2L0WA 4ZJ2A 4JPMA 1FCNA 2BASA 2W3GA 1FILA 1ZHHB 3N4IA 3AGEA 1KE4A 3G2ZA 1PWCA 4X55A 3TG9A 3LFVA 4K08A 3CAXA 3HUOA 4KQRA 2P7JA 3VE4A 2ZC4B 1VHMA 4MBKA 4GB7A 3V67A 4EBNA 1YLYA 4GS9B 4NG2A 1S1YA 3B42A 3HLWA 2B02A 4GHIA 4HBTA 4JGPA 5EVID 3UO9A 1GSVA 4UAAA 4QD4A 2Y55A 4E3MA 5GHYA 5TJJA 1SDEA 1JTDA 2ZL1B 1BT5A 2B18A 3ZVWA 2L1MA 3T4LA 4HBUA 4R23A 3NY4A 1K25A 4LENA 3BQAA 3LYXA 4M3KA 4KZBA 3JPUA 1UWNX 4S2PA 2W1RA 1LSVA 3MBZA 2R9XA 1MC0A 3CJMA 2H0TA 3BY8A 5EECA 3UE1A 1T18A 3OOVA 2V9AA 4PAUA 4ETZA 4S2IA 3EEAA 1J3WA 3BYDA 1GSWA 1BLHA 4CLCD 1OT6A 2E8JA 5KIZA 5FEGA 5FDSA 4HJ4A 5BOHA 4OKPA 3F1NB 4NXGA 1DY6A 1TS6A 2QKPA 3OBFA 3MZFA 3C2WA 3BFEA 5TR7A 4FOFA 4FUWA 3HUMA 5EVLA 3E0YA 1XJ2A 4JGQA 2JBFA 4GW9A 5FQKA 4HH3A 1YLWA 1W5DA 3ZG9B 3KSIA 1HD8A 4N9LA 4DE1A 3DTMA 1CEFA 3A3EA 4X6TA 3UB8A 2ZQ9A 5HDDA 3O87A 1I2SA 4IHQA 3T4JA 3W4OA 3OCLA 4WMCD 5IHVA 1ERMA 3VP0A 3R7WB 3AGDA 4P87A 3BFDA 3E4PA 3MKEA 1OTDA 2VA0A 2Z2MB 1D06A 4Z1WA 2JKTM 4I5SA 3T4OA 3G2YA 4JF4A 2J9PA 4GD6A 3P7NA 2D02A 4JXGA 4EQ1A 4PM9A 3GV9A 4FSFA 3MJQA 3S1YA 2O9CA 2EFXA 4O8GA 3VP2A 5HDCA 4BBTA 3PR6A 1SKOA 1P9RA 3BLSA 1N9OA 2AVXA 3H7WB 5KMWA 1BTLA 4WEJA 3IF6A 4EWFA 4GDNA 4BBVA 4R38A 2UWXA 2B5RA 5HD5A 4BWIA 3MZDA 2VJWA 4F94A 4X69A 2ZJ9A 1DP8A 2V0WA 2X02A 5HAIA 3KSHA 4UA7A 3HVFA 5K5BA 3MS6A 4EETB 5D3OA 3MZEA 3TW8A 4HNBA 4HHDA 1XA7A 5EVEA 5F68A 3QP5A 3Q7ZA 3OPRA 1FQGA 2KDKA 3M2JA 5HARA 2HDQA 2ZD8A 1T1CA 4EUZA 4LGWA 3V50A 4EESA 4WN5A 3G6OA 3G30A 4CQHA 2Y2MA 1Z09A 1MPLA 1S6RA 2Z6CA 2BG1A 4UQIM 2R9WA 4ZJ1A 4X68A 3MQQA 2IA2A 4U0XA 5HSQA 4EERA 3M2KA 3LR3A 4S2NC 3H82A 3K3CA 3DWKA 4E6WA 1PRQA 3C5AA 1X0OA 3IWQA 5CX7A 5FQQA 4ID4A 1PI5A 3FPVA 4ZTKA 2XFSA 5AQ9A 1RGZA 1BSGA 3DWZA 4P0MA 4DE0A 5E2GA 3C8CA 4KZ4A 5L8MA 4C75A 3SS4A 1XFNA 5GL9A 3ZG5A 1PI4A 5DJTA 2ZQ7A 4NKPA 4UA6A 5CGXA 2CC1A 4MNRA 1YLTA 4P6ZM 4E6XA 1SHVA 4KG2A 4ESPA 1VEUA 3HJKA 1ZTUA 2FFYA 5DJUA 4GOGA 1ZG4A 3WS0A 4OQGA 1YSQA 1NYYA 2ACGA 4GLQA 1KE0A 2G2UA 3EOIA 4Y15A 5E2FA 5FL3A 3ZNTA 4I3AA 1G68A 2W0NA 4I39A 3MXSA 4X53A 5IU1A 4XT2B 2OWJA 2A3UA 4QHCA 3Q82A 3PTEA 3IS2B 2WAEA 3VFFA 1JWZA 2P9VB 4GS9A 3EQUA 2WKQA 4WL9A 5MC7A 2RL3A 3VP4A 4H8RA 5CERA 2R78A 2J3WA 5FSRA 4LV2A 2WYXA 2GDNA 2ZL1A 3LIBA 3WS5A 3CLOA 5TBMA 1YQSA 4XXRA 5HWTA 3S7NA 2ZQDA 5M18A 4Y0UA 4H6JA 3NOTC 3MKFA 5HL6A 4FH4A 4O7DA 3VSLA 2HPBA 2VK3A 3GMWA 1IFQA 1S66L 2DNSA 1VB6A 5EPHA 3ZYTA 2PHYA 1KGFA 3BLMA 2OAQ1 2QYBA 1XJ6A 2WADA 1L2SA 1JVJA 4LV3A 2W3DA 2JKGA 3WS2A 3JVUA 5KSHA 3EWKA 5A90A 3F1NA 3CWFA 2FFFB 3KYEA 5FI7A 1OJ5A 4R3BA 4EBPA 3UB6A 3OC2A 3CPTA 4BJPA 2MJ6A 2H0YA 3T50A 3IBRA 4JF6A 4QY5A 1K0KA 3DW0A 2ZC3B 4DN0A 4PM6A 3SH7A 4E3NA 1ESIA 5JYOA 1AXBA 3A3IA 4BBUA 3F1OB 2VGLS 2VGJA 4N1HA 3WRTA 3T1QB 1FCMA 2XDMA 4C6YA 1ACFA 1ALQA 1WYBA 3ULFA 5J3WA 2YKFA 3NDGA 3R7WA 1PW1A 3VOYA 1LL8A 3NECA 2Y79A 5CXWA 4Y0OA 1FR6A 2WZZA 4PPRA 2PBYA 1HTZA 5CHUA 1EW0A 2G7UA 2HF6A 3SH8A 3VE3A 3GSGA 3MFXA 3LI8A 3UDXA 1XPBA 4WF0A 3VP3A 3HCYA 3SOIA 3GVBA 1L0GA 2VGKA 3UB5P 3FV7A 3V39A 2QZ6A 1KDSA 1TDGA 4LPZA 1ZC2A 5CTMA 4ARZB 3IXHA 4FH2A 3S7QA 3EGDC 3KSFA 4R0QA 1V9YA 3G4PA 4U3TA 2ZMVA 1XP4A 2PT7A 4DDYA 3H7WA 3ZNYA 2BLSA 2HDUA 5EV0A 3IWIA 3HUNA 4EBLA 3IX3A 1ONHA 2XD5A 5LBRA 2ZBBA 2ZOHA 4R4RA 3KO6A 4BL2A 3ZGAB 5HZHA 3W2ZA 5DVAA 1XFQA 3IXGA 4CLCE 4UEYA 2XA7M 1Q2PA 3PHYA 4XUZA 4R6LA 4GKUA 3VOLA 4I3IA 4L0LA 1DJAA 3HLGA 4E04A 1PYYA 1IELA 4L9FA 4E3OA 3IH9A 4N9KA 4S2MA 4DRTA 4OQ0A 1LL5A 2E8IA 2EWVA 1NZUA 3IF6C 1GCEA 3U2AA 1LT0A 1LL9A 4JBFA 4FTXA 3BECA 3ZG0A 1E4DA 3SS5A 3SS3A 2WGIA 2V20A 3A0SA 4OQHA 1N9LA 1K4EA 4GN2A 4CJNA 4QY6A 1S0WA 2PBDP 4IBXA 2GZAA 4KG6A 4YNRA 5A8BA 1HLUP 4Y5FA 3DTKA 4NXFA 5FATA 3HREA 1NJ4A 5DF9A 1TEMA 2QMIA 1YSPA 2JN7A 4MN7A 4E3LA 3CHWP 2JCHA 3LI9A 4D2OA 1N9BA 1K4FA 1H5XA 5HW3A 4R70A 3U4LP 3NOPC 4UA9A 1IYQA 4U0TA 2WKEA 3NDEA 4B4ZA 1EROA 2KOIA 5FI6A 3KSGA 4MBFA 2XRNA 3UPOA 3NJAA 1T1AA 3ZG7B 2NUPC 5EM1A 3VOZA 4Q8IA 3E4QA 3G32A 5EOOA 4FD8A 4KG5A 5FASA 4E3JA 3W8KA 4MN6A 3GQZA 4IVKA 5CGWA 2QHKA 2PYPA 5DKLA 5A91A 5HWVA 4BD0A 1Y28A 4WBGA 4LV0A 4EU0A 1OT9A 3IXBA 1E3UA 2KX6A 4Y7PA 2ZMFA 3BRMA 3LGOA 3W4PA 4JKTA 3LCEA 2W1TB 1SCWA 2PYRA 1Y54A 1ERQA 1IOUA 3IS2A 2Y2HA 3ICYA 3QP1A 1E25A 4KENB 2RCXA 4DJ2A 2P9VA 3V3SA 5M1AA 3BFFA 1DJBA 2Q9NA 3NULA 4IBRA 3IQAA 1NZOA 1KE3A 1NXYA 2A49A 1XGIA 3VMAA 4OLDA 3UY6A 4DXCA 3ISGA 2EFUA 3B47A 5EVIB 1IYOA 3EEHA 2CMNA 3Q1FA 4P6BA 1RP5A 2OV5A 5EUAA 4MLLA 2EX6A 2G2WA 2QJ5A 2K7SA 2WKRA 5CGSA 5CRFA 4OP5A 4Y3IA 3DAVA 3ZFZA 3ZHHA 2V2FF 1J9MA 1M40A 3LIAA 3CI6A 3P01A 3TJZC 4X1MA 2HGVA 4QJGA 1K56A 4CLCB 4OONA 3EGXC 5J7EA 1FCOA 4UQIS 2X01A 3T1SA 1NRFA 2DRWA 1CEGA 5CEBA 2VV6A 4G3KA 3HLFA 2K31A 1PNEA 2NUTC 4PKYA 1YMXA 3AGFA 1KVLA 3BWLA 4RVAA 5EE8A 3RH8B 5J8XA 4B4XA 4WELA 1KDWA 5GLDA 3MSHA 2DMWA 1S1ZA 3F1OA 3JYIA 3MXQA 3QP4A 2W27A 2J3TC 1YLPA 5E43A 4DMZA 1U60A 1KGGA 5L2FA 4JGRA 2Y2OA 1MKIA 1NRJA 4LRYC 3G35A 2DCFA 2J8YA 2XH9A 4OPZA 1IYSA 1MWTA 2EXBA 2L4RA 3CITA 5HFOA 1YLZA 3LY3A 3MXRA 2K2NA 3UDFA 4OP8A 3QP8A 2PD8A 3OPPA 5J4EA 1XGJA 4LCLA 4Y2FA 4P85A 1UWPX 1A0KA 3LICA 1OTEA 3GDIA 3CUEA 4LCMA 5FI2A 4DDSA 2Y2JA 1LLBA 4PKYG 3E4OA 4PM8A 3SZTA 2JC7A 3S7PA 3NC8A 2HV1A 3WRZA 1OTIA 4N92A 4OQIA 2VV7A 1PW8A 1SDNA 3IX4A 4HIAA 3A0RA 5HD3A 1TS0A 3RFBA 4LRZE 4ARZA 2IWBA 4Y13A 5FAOA 4O0PA 1PIOA 2W3FA 5GHXA 1RGYA 4BD1A 3Q7VB 3PBNA 1MWSA 3LR5A 2WGVA 4DE2A 3F1PB 3QNBA 4GCZA 2XQZA 5IT5A 1W8YA 3UMEA 3ZQ5A 3EQVA 3UB7A 2Y2LA 3UMDA 1D7EA 2V0UA 2OOLA 1IYPA 3A3FA 4FCFA 2EWWA 3LR0A 2M1CA 3FZCA 1GHMA 1OJGA 4AFIA 1YT4A 3HLEA 3NCKA 1CJFA 5I5LA 3LEQA 3T4TA 1VETB 1EI5A 3GR2A 2PRFA 2WZXA 3LEZA 1K38A 4ZAMA 1WYCA 1YMSA 5F69A 1LSWA 1Q2QA 3NI9A 2Y2NA 2HP5A 2VEAA 1YAXA 2VLGA 3UDIA 5KSCA 4LRXC 2Y4AA 4R3JA 2P04A 4IJGA 1DP6A 1H8YA 1QMFA 2QWSA 4G3VA 2Y2QA 3C4OA 4RX2A 3V5MA 2Y2IA 5G18A 2JKRM 3VP1A 3N6IA 3WS4A 2EX8A 5KZHA 1DP9A 1CK3A 5TGFA 3UE6A 4ZRRA 4YFMA 2XEPA 1P97A 2I9VA 4KZ3A 5F1FA 3RJUA 3QHYA 1PZOA 3M6HA 4S2LA 1LI9A 1F5MA 1PWDA 2P08A 4X56A 3FG8A 4S2KA 4EEUA 1MWRA 1K57A 3V3RA 2PR6A 1S4RA 5DF7A 2A24B 4EXOA 1BYWA 1MXOA 3G31A 4NETA 3D9YA 3MQ0A 2V1AA 3O86A 4YOFA 1H3QA 4L9EA 4X25A 2HJEA 4S2OA 4RX3A 3HBRA 4PHTA 2J3TD 5TFQA 1O7EA 3H82B 3Q07A 1KOUA 2ZOIA 3OPLA 4IVIA 1WA9A 2X71A 3S7OA 4OOYA 1ES3A 1XX2A 5GLCA 3MF0A 4IUKA 4NXBA 5EOEA 5DTSA 4Y0TA 4OPQA 2QPNA 1GA9A 1DJCA 1YPRA 2IWDA 4WZ5A 3T1RA 4NEED 2I72A 3UB9A 2QJ7A 2M7UA 5L09A 3A0VA 3GTCA 1H8ZA 3G34A 2V8CA 4MMNA 4JGOA 1L0EA 4YINA 4R1GA 1UGUA 3QNCA 4PM7A 3ZDJA 5FQ9A 2BTFP 3T12B 4EEPA 5HAPA 5EVIA 1FR1A 3P98A 3FWLA 1ODVA 3KYQA 4EUVA 4OPRA 4Z9QA 2PR5A 3PYPA 4Y17A 4QWOA 5G4YA 3L9KA 3BEBA 2XA7S 4LV1A 2JHEA 3QP2A 5FA7A 3OPHA 1RCJA 1K54A 4HP9A 5JYPA 2M7VA 4E3KA 1GSXA 4KZ7A 3HLCA 1BLSA 1NWZA 3JVVA 1N9NA 3A3JA 5G4ZA 2V1BA 3N7WA 5FAQA 1S67L 1LSXA 1N4OA 4GZBA 2WGWB 3D3OA 2J9OA 1TS7A 5CEDA 3LUQA 3O5YA 4QU3A 5AVEA 4CLCA 4JLFA 5AQBA 2VZWA 1OPXA 4DF6A 5CECA 4E3IA 2Y2KA 2JE5A 5TBMB 1K55A 3QP6A 2ZC6B 1H0MA 3BW6A 3IH8A 2PU2A 1GHPA 1IKGA 3CG5A 3PBSA 4H6JB 1OMEA 1YLJA 3RXXA 4UHUA 5HDSA 3WWXA 1ZG6A 2JKFA 2ZQAA 2HDRA 1JTGA 2HP9A 1HZOA 4F3LB 2J80A 5F1GA 2OWHA 2O99A 3HL9A 3FKWA 1ES4A 1ESUA 1ES5A 2OLVA 1T1BA 4KQDA 3D4FA 3HJIA 3PBQA 4D60A 4WMCA 2OSUA 1BUEA 2EX2A 2UV0E 4A5RA 3ZVTA 4ETXA 1KGEA 2ZC5B 1FOFA 1TD5A 3BJNA 1NLZA 1F9IA 1JNUA 3UE0A 4HQAA 3TRCA 4L9GA 3PBOA 2Y91A 3CPTB 2H28A 4KZ5A 1K6SA 1W8QA 5GHZA 4GDBA 4KUOA 4I38A 4ZBEA 3OCNA 5DFXA 1TDLA 2XFTA 1T19A 4OOMA 1WE4A 1G5UA 1S4SA 2WKIA 4HI4A 1FIKA 4PM5A 3Q7VA 4HJ3A 4KZAA 3D72A 4XT2A 3CUEC 3F1PA 2XR0A 4ZJ3A 5CTNA 5IS1A 1XKZA 1C3BA 1TS8A 4HH2A 4DE3A 2JKTI 4ME4A 3E2LA 2HZ5A 3K2NA 1MWUA 2HP6A 1LHYA 5E2EA 3ZCZA 3FYZA 4IEDA 3KX0X 4KZ6A 1XXMA 3NHQA 5HWWA 3RXWA 5A93A 1TF1A 3VFHA 2WAFA 5FQJA 1GHIA 2GJ3A 2W3HA 4HOIA 5DTKA 3E98A 1LI0A 2XK1A 3LR4A 2Z6DA 2Z2LB 1E3UD 4B88A 1NY0A 4HP4A 4GD8A 1VETA 1BLCA 2FH5A 1I5QA 1NYMA 3IX8A 3B33A 1GA0A 1BULA 4ZDXA 1ZKJA 3N8SA 4KZ8A 4Q0HA 4LLOB 4XUXA 1AWIA 5GLBA 3IBJA
chains in the Genus database with same CATH topology
1MWSA 4S2IA 2XDMA 2WGVA 4DE2A 3QNBA 4C6YA 2XQZA 1ALQA 4QB8A 1W8YA 1WYBA 3BYDA 3NDGA 1BLHA 2H10A 1PW1A 2C6WB 3VOYA 2Y2PA 5CXWA 4Y0OA 1FR6A 2WZZA 3EQVA 4PPRA 2PBYA 5BOHA 1HTZA 5CHUA 2Y2LA 3IWOA 4OKPA 5FQIA 2V1ZA 1G6AA 1IYPA 1VM1A 3A3FA 4FCFA 3SH8A 3GSGA 3CMZA 4JXSA 3UDXA 1DY6A 1XPBA 3FZCA 3PAGA 3VP3A 4HEFA 3SOIA 1GHMA 3GVBA 1L0GA 2VGKA 3FV7A 3NIAA 3V39A 1YT4A 3HLEA 3NCKA 4K0WA 2QZ6A 1KDSA 1TDGA 3MZFA 3BFEA 4K0XA 5TR7A 4C3QA 4K91A 3HUMA 5EVLA 3MFDA 4N1XA 1ZC2A 1EI5A 3GR2A 2JBFA 5CTMA 2WZXA 5FQKA 3LEZA 4BL3A 1YLWA 1K38A 1W5DA 3IXHA 4FH2A 5AQ7A 4MEZA 3ZG9B 4ZAMA 4OPYA 1WYCA 1YMSA 3S22A 1Q2QA 3NI9A 1HD8A 1VQQA 4R0QA 2Y2NA 4N9LA 4DE1A 3G4PA 4U3TA 2HP5A 2XGNA 1XP4A 3UDIA 3DTMA 1CEFA 3A3EA 4X6TA 4DDYA 2ZQ9A 3ZNYA 2BLSA 5KSCA 2PU4A 1I2SA 2HDUA 3O87A 3W4OA 2Y4AA 3OCLA 4WMCD 4R3JA 2ZM8A 3IWIA 5IHVA 3HUNA 1ERMA 1K56D 1MBLA 4EBLA 3VP0A 5GLAA 3AGDA 4P87A 1ONHA 5FDHA 2XD5A 4R4RA 1H8YA 1QMFA 2ZQCA 3HLBA 3BFDA 5F83A 4BL2A 1IEMA 3ZGAB 5I94A 3MKEA 5DVAA 2Y2QA 3BFGA 3C4OA 2Z2MB 4RX2A 1JWVA 2ZLYA 3IXGA 2Y2IA 3V5MA 5G18A 1Q2PA 3N8LA 4XUZA 1W7FA 5E2HA 3G2YA 4OH0A 4GKUA 4JF4A 3CZDA 1ES2A 1K57C 3VP1A 2J9PA 4L0LA 3N6IA 1DJAA 3WS4A 3HLGA 2EX8A 1M6KA 5KZHA 1CK3A 1PYYA 4GD6A 3VSKA 5TGFA 1IELA 4E3OA 3IH9A 4JXGA 4KQQA 4N9KA 4S2MA 4PM9A 4YFMA 2XEPA 4JXVA 3GV9A 4FSFA 4DRTA 4OQ0A 1LL5A 4KZ3A 2E8IA 5F1FA 3IT9A 3RJUA 1NZUA 3S1YA 3IF6C 4WYYA 3QHYA 3S4XA 1GCEA 1PZOA 2EFXA 3M6HA 1LI9A 4S2LA 3VP2A 5HL1A 4NK3A 1PWDA 4X56A 4BLMA 1LL9A 3PAEA 4S2KA 4JBFA 1KVMA 1MWRA 1K57A 3V3RA 3UNWA 5DF7A 3BECA 3ZG0A 3FKVA 1E4DA 3SS5A 3BLSA 2EX9A 3TSGA 3SS3A 1HVBA 1MXOA 3G31A 2WGIA 4NETA 3PBRA 2V20A 5KMWA 1BTLA 3O86A 3Q81A 4WEJA 4OQHA 3IF6A 1YM1A 3P09A 4GDNA 1BZAA 4EWFA 4GN2A 1K4EA 5FQMA 4CJNA 1O07A 2UWXA 2B5RA 3E2KA 4QY6A 1S0WA 4S2OA 4RX3A 3HBRA 4IBXA 4KG6A 5TFQA 2ZM2A 3MZDA 1O7EA 4OOLA 4WZ5C 3Q07A 4F94A 4X69A 4R4SA 3HREA 5FATA 3OPLA 1NJ4A 5DF9A 1IKIA 1TEMA 2X71A 2ZJ9A 1CI9A 3B3XA 4IVIA 2QMIA 4RYEA 3O3VA 5U47A 4EQIA 4OOYA 2X02A 4E3LA 1CI8A 4D2OA 2JCHA 1ES3A 1N9BA 1XX2A 5HAIA 4UA7A 5GLCA 5EOEA 2IWCA 1K4FA 5DTSA 3HVFA 4Y0TA 1H5XA 5HW3A 4OPQA 2QPNA 4KZ9A 1GA9A 2H5SA 3IXDA 1DJCA 2WGWA 5EVIC 4MBHA 2IWDA 4WZ5A 5DF8A 1FSYA 2I72A 4UA9A 3C4PA 1IYQA 4U0TA 2WKEA 3NDEA 5D3OA 4B4ZA 1EROA 5A92A 3MZEA 3GTCA 5FI6A 4MBFA 3UPOA 3SH9A 3TOIA 1XA7A 1H8ZA 4EV4A 3G34A 5FAPA 3ZG7B 1JWPA 2P74A 1L0EA 1BLPA 2ZMAA 4YINA 3VOZA 4Q8IA 4R1GA 1K54C 2OLUA 3QNCA 4PM7A 3ZDJA 3LO7A 3G32A 3HLDA 3OPRA 3Q7ZA 5EOOA 5FQ9A 3WS1A 1FQGA 4FD8A 4KG5A 5FASA 5HAPA 4E3JA 3W8KA 3M2JA 5EVIA 3GQZA 1FR1A 4IVKA 5HARA 3P98A 2HDQA 2ZD8A 3FWLA 4EUZA 3V50A 5CGWA 4WM9A 4OPRA 3G30A 4OVDA 4Z9QA 2Y2MA 1MPLA 5A91A 1S6RA 2Y59A 1I2WA 4BD0A 3IF6B 4WBGA 2BG1A 4WZ4A 2R9WA 3BEBA 4LV0A 4RA7A 4LV1A 4X68A 4ZJ1A 4DKIA 3IHAA 5FA7A 3OPHA 3IXBA 1RCJA 1E3UA 4U0XA 1K54A 3M2KA 4Y7PA 5CHJA 4S2NC 5JYPA 3DWKA 4E6WA 3ZG8B 3C5AA 4E3KA 1XA1A 1TVFA 3BRMA 2WUQA 3W4PA 1W79A 3IWQA 4JKTA 4KZ7A 2Q9MA 3LCEA 4ID4A 5FQQA 3IF5A 2EXAA 1PI5A 1SCWA 2XLNA 3HLCA 1BLSA 3GRJA 1L0DA 4CPKA 3I7JA 3A3JA 3N7WA 5FAQA 1Y54A 1ERQA 2Y2HA 4S2JA 1N4OA 4GZBA 1E25A 2WGWB 4ZTKA 2XF3A 4KENB 1K55C 2XFSA 5AQ9A 2J9OA 1RGZA 2RCXA 1BSGA 2P9VA 4S2NA 5CHMA 5M1AA 5DTTA 3V3SA 3BFFA 3NBLA 1DJBA 2Q9NA 4BENA 3UPPA 5CEDA 5HX9A 4IBRA 3DWZA 4P0MA 3BFCA 3N8RA 2WK0A 4DE0A 5E2GA 4KZ4A 3IQAA 4QU3A 4C75A 4GNUA 1NZOA 1KE3A 3SS4A 1NXYA 2A49A 4JLFA 5AQBA 5GL9A 1XGIA 3ZG5A 1PI4A 2ZQ7A 4UA6A 5CGXA 2CC1A 4MNRA 3VMAA 4OLDA 1YLTA 3UY6A 4DF6A 4DXCA 4E3IA 2J7VA 2XD1A 5CECA 1EWZA 2EFUA 2HDSA 1SHVA 3ISGA 3LY4A 4KG2A 5EVIB 2Y2KA 4KQOA 4E6XA 5AQAA 2JE5A 4JF5A 1K55A 3ITBA 4DXBA 1IYOA 1PWGA 2ZC6B 2FFYA 4GOGA 1ZG4A 3Q1FA 2ZQ8A 1RP5A 4P6BA 2OV5A 3IH8A 5EUAA 2PU2A 3WS0A 1GHPA 4PMAA 4OQGA 1IKGA 3CG5A 3C7UA 4MLLA 2EX6A 3PBSA 1NYYA 1OMEA 2ZM0A 3BM6A 1YLJA 2G2WA 3RXXA 1KE0A 2G2UA 5E2FA 4UHUA 3WWXA 3PBTA 3ZNTA 1QMEA 5CGSA 5CRFA 1G68A 1ZG6A 4OP5A 3M6BA 3W4QA 2ZQAA 2HDRA 4BQMA 1JTGA 3MXSA 2ZC7A 3IHBA 4X53A 2HP9A 4HESA 3OZHA 3ZFZA 1HZOA 3UN7A 2WKHA 5F1GA 2A3UA 4QHCA 3HL9A 3Q82A 3ZHHA 2V2FF 1J9MA 1M40A 3PTEA 3FKWA 2WAEA 1ES4A 1ESUA 1Z6FA 1ES5A 1PZPA 2OLVA 3VFFA 5HAQA 1JWZA 1FSWA 1L0FA 1SKFA 2P9VB 3D4FA 4WEKA 3PBQA 3EQUA 3UPNA 1ONGA 4QJGA 4WMCA 3O88A 2RL3A 1K56A 3VP4A 2OSUA 4H8RA 1BUEA 2EX2A 4A5RA 4OONA 5CERA 3ZVTA 3UE3A 1KGEA 5F82A 2C5WB 1FCOA 3ITAA 2X01A 2ZC5B 1FOFA 1NRFA 2DRWA 1CEGA 4OLGA 5CEBA 5FSRA 4LV2A 3C7VA 5M19A 2WYXA 3UE0A 2GDNA 3WS5A 3A3DA 3HLFA 3PBOA 2Y91A 1MY8A 1YMXA 1YQSA 4KZ5A 4XXRA 1K6SA 1W8QA 3AGFA 2Y2GA 1K6RA 1KVLA 5GHZA 4GDBA 4RVAA 4JXWA 2ZQDA 5EE8A 3OCNA 4ZBEA 5M18A 4Y0UA 4ZJ2A 5J8XA 1TDLA 1FCNA 2XFTA 4JPMA 4B4XA 4WELA 1KDWA 3MKFA 4FH4A 5GLDA 3N4IA 4O7DA 3AGEA 4OOMA 1WE4A 1KE4A 3VSLA 2HPBA 2WKIA 3G2ZA 3GMWA 3JYIA 1PWCA 2DNSA 4X55A 4PM5A 5EPHA 3Q7VA 3TG9A 4KZAA 3HUOA 1YLPA 5E43A 1KGFA 4KQRA 1U60A 1KGGA 5L2FA 2XR0A 3BLMA 4ZJ3A 5CTNA 2Y2OA 2ZC4B 1MKIA 1XKZA 1C3BA 3G35A 2DCFA 2J8YA 2XH9A 1IYSA 1MWTA 2EXBA 4OPZA 4MBKA 5HFOA 2WADA 4GB7A 1YLZA 4EBNA 3LY3A 4DE3A 1YLYA 1L2SA 3MXRA 1JVJA 3UDFA 4OP8A 3E2LA 3HLWA 1MWUA 4LV3A 3OPPA 2HP6A 4HBTA 1LHYA 1XGJA 4LCLA 5E2EA 5EVID 3UO9A 3WS2A 3ZCZA 3FYZA 4P85A 4IEDA 4UAAA 4QD4A 5KSHA 4KZ6A 2Y55A 5A90A 1XXMA 4LCMA 5FI2A 3RXWA 4DDSA 4E3MA 2Y2JA 5GHYA 1LLBA 2FFFB 4PM8A 5FI7A 5A93A 3VFHA 2JC7A 1SDEA 1JTDA 2WAFA 4R3BA 5FQJA 1GHIA 3NC8A 5DTKA 1LI0A 2XK1A 1BT5A 4EBPA 3WRZA 2Z2LB 1E3UD 3ZVWA 3OC2A 4BJPA 4B88A 4HBUA 4R23A 3NY4A 2H0YA 1NY0A 1K25A 4LENA 4N92A 4GD8A 4OQIA 4M3KA 4JF6A 1BLCA 3DW0A 4QY5A 2ZC3B 1I5QA 4KZBA 1NYMA 1PW8A 1SDNA 1GA0A 1BULA 4ZDXA 4E3NA 4PM6A 3SH7A 1ESIA 4S2PA 1AXBA 5JYOA 1ZKJA 3MBZA 3N8SA 2IWBA 3A3IA 2R9XA 5FAOA 3CJMA 2H0TA 1PIOA 5GHXA 1RGYA 4KZ8A 2VGJA 5EECA 4BD1A 4N1HA 4XUXA 3UE1A 3Q7VB 3PBNA 3WRTA 1FCMA 5GLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MWS A;  4S2I A;  2XDM A;  2WGV A;  4DE2 A;  3QNB A;  4C6Y A;  2XQZ A;  1ALQ A;  4QB8 A;  1W8Y A;  1WYB A;  3BYD A;  3NDG A;  1BLH A;  2H10 A;  1PW1 A;  2C6W B;  3VOY A;  2Y2P A;  5CXW A;  4Y0O A;  1FR6 A;  2WZZ A;  3EQV A;  4PPR A;  2PBY A;  5BOH A;  1HTZ A;  5CHU A;  2Y2L A;  3IWO A;  4OKP A;  5FQI A;  2V1Z A;  1G6A A;  1IYP A;  1VM1 A;  3A3F A;  4FCF A;  3SH8 A;  3GSG A;  3CMZ A;  4JXS A;  3UDX A;  1DY6 A;  1XPB A;  3FZC A;  3PAG A;  3VP3 A;  4HEF A;  3SOI A;  1GHM A;  3GVB A;  1L0G A;  2VGK A;  3FV7 A;  3NIA A;  3V39 A;  1YT4 A;  3HLE A;  3NCK A;  4K0W A;  2QZ6 A;  1KDS A;  1TDG A;  3MZF A;  3BFE A;  4K0X A;  5TR7 A;  4C3Q A;  4K91 A;  3HUM A;  5EVL A;  3MFD A;  4N1X A;  1ZC2 A;  1EI5 A;  3GR2 A;  2JBF A;  5CTM A;  2WZX A;  5FQK A;  3LEZ A;  4BL3 A;  1YLW A;  1K38 A;  1W5D A;  3IXH A;  4FH2 A;  5AQ7 A;  4MEZ A;  3ZG9 B;  4ZAM A;  4OPY A;  1WYC A;  1YMS A;  3S22 A;  1Q2Q A;  3NI9 A;  1HD8 A;  1VQQ A;  4R0Q A;  2Y2N A;  4N9L A;  4DE1 A;  3G4P A;  4U3T A;  2HP5 A;  2XGN A;  1XP4 A;  3UDI A;  3DTM A;  1CEF A;  3A3E A;  4X6T A;  4DDY A;  2ZQ9 A;  3ZNY A;  2BLS A;  5KSC A;  2PU4 A;  1I2S A;  2HDU A;  3O87 A;  3W4O A;  2Y4A A;  3OCL A;  4WMC D;  4R3J A;  2ZM8 A;  3IWI A;  5IHV A;  3HUN A;  1ERM A;  1K56 D;  1MBL A;  4EBL A;  3VP0 A;  5GLA A;  3AGD A;  4P87 A;  1ONH A;  5FDH A;  2XD5 A;  4R4R A;  1H8Y A;  1QMF A;  2ZQC A;  3HLB A;  3BFD A;  5F83 A;  4BL2 A;  1IEM A;  3ZGA B;  5I94 A;  3MKE A;  5DVA A;  2Y2Q A;  3BFG A;  3C4O A;  2Z2M B;  4RX2 A;  1JWV A;  2ZLY A;  3IXG A;  2Y2I A;  3V5M A;  5G18 A;  1Q2P A;  3N8L A;  4XUZ A;  1W7F A;  5E2H A;  3G2Y A;  4OH0 A;  4GKU A;  4JF4 A;  3CZD A;  1ES2 A;  1K57 C;  3VP1 A;  2J9P A;  4L0L A;  3N6I A;  1DJA A;  3WS4 A;  3HLG A;  2EX8 A;  1M6K A;  5KZH A;  1CK3 A;  1PYY A;  4GD6 A;  3VSK A;  5TGF A;  1IEL A;  4E3O A;  3IH9 A;  4JXG A;  4KQQ A;  4N9K A;  4S2M A;  4PM9 A;  4YFM A;  2XEP A;  4JXV A;  3GV9 A;  4FSF A;  4DRT A;  4OQ0 A;  1LL5 A;  4KZ3 A;  2E8I A;  5F1F A;  3IT9 A;  3RJU A;  1NZU A;  3S1Y A;  3IF6 C;  4WYY A;  3QHY A;  3S4X A;  1GCE A;  1PZO A;  2EFX A;  3M6H A;  1LI9 A;  4S2L A;  3VP2 A;  5HL1 A;  4NK3 A;  1PWD A;  4X56 A;  4BLM A;  1LL9 A;  3PAE A;  4S2K A;  4JBF A;  1KVM A;  1MWR A;  1K57 A;  3V3R A;  3UNW A;  5DF7 A;  3BEC A;  3ZG0 A;  3FKV A;  1E4D A;  3SS5 A;  3BLS A;  2EX9 A;  3TSG A;  3SS3 A;  1HVB A;  1MXO A;  3G31 A;  2WGI A;  4NET A;  3PBR A;  2V20 A;  5KMW A;  1BTL A;  3O86 A;  3Q81 A;  4WEJ A;  4OQH A;  3IF6 A;  1YM1 A;  3P09 A;  4GDN A;  1BZA A;  4EWF A;  4GN2 A;  1K4E A;  5FQM A;  4CJN A;  1O07 A;  2UWX A;  2B5R A;  3E2K A;  4QY6 A;  1S0W A;  4S2O A;  4RX3 A;  3HBR A;  4IBX A;  4KG6 A;  5TFQ A;  2ZM2 A;  3MZD A;  1O7E A;  4OOL A;  4WZ5 C;  3Q07 A;  4F94 A;  4X69 A;  4R4S A;  3HRE A;  5FAT A;  3OPL A;  1NJ4 A;  5DF9 A;  1IKI A;  1TEM A;  2X71 A;  2ZJ9 A;  1CI9 A;  3B3X A;  4IVI A;  2QMI A;  4RYE A;  3O3V A;  5U47 A;  4EQI A;  4OOY A;  2X02 A;  4E3L A;  1CI8 A;  4D2O A;  2JCH A;  1ES3 A;  1N9B A;  1XX2 A;  5HAI A;  4UA7 A;  5GLC A;  5EOE A;  2IWC A;  1K4F A;  5DTS A;  3HVF A;  4Y0T A;  1H5X A;  5HW3 A;  4OPQ A;  2QPN A;  4KZ9 A;  1GA9 A;  2H5S A;  3IXD A;  1DJC A;  2WGW A;  5EVI C;  4MBH A;  2IWD A;  4WZ5 A;  5DF8 A;  1FSY A;  2I72 A;  4UA9 A;  3C4P A;  1IYQ A;  4U0T A;  2WKE A;  3NDE A;  5D3O A;  4B4Z A;  1ERO A;  5A92 A;  3MZE A;  3GTC A;  5FI6 A;  4MBF A;  3UPO A;  3SH9 A;  3TOI A;  1XA7 A;  1H8Z A;  4EV4 A;  3G34 A;  5FAP A;  3ZG7 B;  1JWP A;  2P74 A;  1L0E A;  1BLP A;  2ZMA A;  4YIN A;  3VOZ A;  4Q8I A;  4R1G A;  1K54 C;  2OLU A;  3QNC A;  4PM7 A;  3ZDJ A;  3LO7 A;  3G32 A;  3HLD A;  3OPR A;  3Q7Z A;  5EOO A;  5FQ9 A;  3WS1 A;  1FQG A;  4FD8 A;  4KG5 A;  5FAS A;  5HAP A;  4E3J A;  3W8K A;  3M2J A;  5EVI A;  3GQZ A;  1FR1 A;  4IVK A;  5HAR A;  3P98 A;  2HDQ A;  2ZD8 A;  3FWL A;  4EUZ A;  3V50 A;  5CGW A;  4WM9 A;  4OPR A;  3G30 A;  4OVD A;  4Z9Q A;  2Y2M A;  1MPL A;  5A91 A;  1S6R A;  2Y59 A;  1I2W A;  4BD0 A;  3IF6 B;  4WBG A;  2BG1 A;  4WZ4 A;  2R9W A;  3BEB A;  4LV0 A;  4RA7 A;  4LV1 A;  4X68 A;  4ZJ1 A;  4DKI A;  3IHA A;  5FA7 A;  3OPH A;  3IXB A;  1RCJ A;  1E3U A;  4U0X A;  1K54 A;  3M2K A;  4Y7P A;  5CHJ A;  4S2N C;  5JYP A;  3DWK A;  4E6W A;  3ZG8 B;  3C5A A;  4E3K A;  1XA1 A;  1TVF A;  3BRM A;  2WUQ A;  3W4P A;  1W79 A;  3IWQ A;  4JKT A;  4KZ7 A;  2Q9M A;  3LCE A;  4ID4 A;  5FQQ A;  3IF5 A;  2EXA A;  1PI5 A;  1SCW A;  2XLN A;  3HLC A;  1BLS A;  3GRJ A;  1L0D A;  4CPK A;  3I7J A;  3A3J A;  3N7W A;  5FAQ A;  1Y54 A;  1ERQ A;  2Y2H A;  4S2J A;  1N4O A;  4GZB A;  1E25 A;  2WGW B;  4ZTK A;  2XF3 A;  4KEN B;  1K55 C;  2XFS A;  5AQ9 A;  2J9O A;  1RGZ A;  2RCX A;  1BSG A;  2P9V A;  4S2N A;  5CHM A;  5M1A A;  5DTT A;  3V3S A;  3BFF A;  3NBL A;  1DJB A;  2Q9N A;  4BEN A;  3UPP A;  5CED A;  5HX9 A;  4IBR A;  3DWZ A;  4P0M A;  3BFC A;  3N8R A;  2WK0 A;  4DE0 A;  5E2G A;  4KZ4 A;  3IQA A;  4QU3 A;  4C75 A;  4GNU A;  1NZO A;  1KE3 A;  3SS4 A;  1NXY A;  2A49 A;  4JLF A;  5AQB A;  5GL9 A;  1XGI A;  3ZG5 A;  1PI4 A;  2ZQ7 A;  4UA6 A;  5CGX A;  2CC1 A;  4MNR A;  3VMA A;  4OLD A;  1YLT A;  3UY6 A;  4DF6 A;  4DXC A;  4E3I A;  2J7V A;  2XD1 A;  5CEC A;  1EWZ A;  2EFU A;  2HDS A;  1SHV A;  3ISG A;  3LY4 A;  4KG2 A;  5EVI B;  2Y2K A;  4KQO A;  4E6X A;  5AQA A;  2JE5 A;  4JF5 A;  1K55 A;  3ITB A;  4DXB A;  1IYO A;  1PWG A;  2ZC6 B;  2FFY A;  4GOG A;  1ZG4 A;  3Q1F A;  2ZQ8 A;  1RP5 A;  4P6B A;  2OV5 A;  3IH8 A;  5EUA A;  2PU2 A;  3WS0 A;  1GHP A;  4PMA A;  4OQG A;  1IKG A;  3CG5 A;  3C7U A;  4MLL A;  2EX6 A;  3PBS A;  1NYY A;  1OME A;  2ZM0 A;  3BM6 A;  1YLJ A;  2G2W A;  3RXX A;  1KE0 A;  2G2U A;  5E2F A;  4UHU A;  3WWX A;  3PBT A;  3ZNT A;  1QME A;  5CGS A;  5CRF A;  1G68 A;  1ZG6 A;  4OP5 A;  3M6B A;  3W4Q A;  2ZQA A;  2HDR A;  4BQM A;  1JTG A;  3MXS A;  2ZC7 A;  3IHB A;  4X53 A;  2HP9 A;  4HES A;  3OZH A;  3ZFZ A;  1HZO A;  3UN7 A;  2WKH A;  5F1G A;  2A3U A;  4QHC A;  3HL9 A;  3Q82 A;  3ZHH A;  2V2F F;  1J9M A;  1M40 A;  3PTE A;  3FKW A;  2WAE A;  1ES4 A;  1ESU A;  1Z6F A;  1ES5 A;  1PZP A;  2OLV A;  3VFF A;  5HAQ A;  1JWZ A;  1FSW A;  1L0F A;  1SKF A;  2P9V B;  3D4F A;  4WEK A;  3PBQ A;  3EQU A;  3UPN A;  1ONG A;  4QJG A;  4WMC A;  3O88 A;  2RL3 A;  1K56 A;  3VP4 A;  2OSU A;  4H8R A;  1BUE A;  2EX2 A;  4A5R A;  4OON A;  5CER A;  3ZVT A;  3UE3 A;  1KGE A;  5F82 A;  2C5W B;  1FCO A;  3ITA A;  2X01 A;  2ZC5 B;  1FOF A;  1NRF A;  2DRW A;  1CEG A;  4OLG A;  5CEB A;  5FSR A;  4LV2 A;  3C7V A;  5M19 A;  2WYX A;  3UE0 A;  2GDN A;  3WS5 A;  3A3D A;  3HLF A;  3PBO A;  2Y91 A;  1MY8 A;  1YMX A;  1YQS A;  4KZ5 A;  4XXR A;  1K6S A;  1W8Q A;  3AGF A;  2Y2G A;  1K6R A;  1KVL A;  5GHZ A;  4GDB A;  4RVA A;  4JXW A;  2ZQD A;  5EE8 A;  3OCN A;  4ZBE A;  5M18 A;  4Y0U A;  4ZJ2 A;  5J8X A;  1TDL A;  1FCN A;  2XFT A;  4JPM A;  4B4X A;  4WEL A;  1KDW A;  3MKF A;  4FH4 A;  5GLD A;  3N4I A;  4O7D A;  3AGE A;  4OOM A;  1WE4 A;  1KE4 A;  3VSL A;  2HPB A;  2WKI A;  3G2Z A;  3GMW A;  3JYI A;  1PWC A;  2DNS A;  4X55 A;  4PM5 A;  5EPH A;  3Q7V A;  3TG9 A;  4KZA A;  3HUO A;  1YLP A;  5E43 A;  1KGF A;  4KQR A;  1U60 A;  1KGG A;  5L2F A;  2XR0 A;  3BLM A;  4ZJ3 A;  5CTN A;  2Y2O A;  2ZC4 B;  1MKI A;  1XKZ A;  1C3B A;  3G35 A;  2DCF A;  2J8Y A;  2XH9 A;  1IYS A;  1MWT A;  2EXB A;  4OPZ A;  4MBK A;  5HFO A;  2WAD A;  4GB7 A;  1YLZ A;  4EBN A;  3LY3 A;  4DE3 A;  1YLY A;  1L2S A;  3MXR A;  1JVJ A;  3UDF A;  4OP8 A;  3E2L A;  3HLW A;  1MWU A;  4LV3 A;  3OPP A;  2HP6 A;  4HBT A;  1LHY A;  1XGJ A;  4LCL A;  5E2E A;  5EVI D;  3UO9 A;  3WS2 A;  3ZCZ A;  3FYZ A;  4P85 A;  4IED A;  4UAA A;  4QD4 A;  5KSH A;  4KZ6 A;  2Y55 A;  5A90 A;  1XXM A;  4LCM A;  5FI2 A;  3RXW A;  4DDS A;  4E3M A;  2Y2J A;  5GHY A;  1LLB A;  2FFF B;  4PM8 A;  5FI7 A;  5A93 A;  3VFH A;  2JC7 A;  1SDE A;  1JTD A;  2WAF A;  4R3B A;  5FQJ A;  1GHI A;  3NC8 A;  5DTK A;  1LI0 A;  2XK1 A;  1BT5 A;  4EBP A;  3WRZ A;  2Z2L B;  1E3U D;  3ZVW A;  3OC2 A;  4BJP A;  4B88 A;  4HBU A;  4R23 A;  3NY4 A;  2H0Y A;  1NY0 A;  1K25 A;  4LEN A;  4N92 A;  4GD8 A;  4OQI A;  4M3K A;  4JF6 A;  1BLC A;  3DW0 A;  4QY5 A;  2ZC3 B;  1I5Q A;  4KZB A;  1NYM A;  1PW8 A;  1SDN A;  1GA0 A;  1BUL A;  4ZDX A;  4E3N A;  4PM6 A;  3SH7 A;  1ESI A;  4S2P A;  1AXB A;  5JYO A;  1ZKJ A;  3MBZ A;  3N8S A;  2IWB A;  3A3I A;  2R9X A;  5FAO A;  3CJM A;  2H0T A;  1PIO A;  5GHX A;  1RGY A;  4KZ8 A;  2VGJ A;  5EEC A;  4BD1 A;  4N1H A;  4XUX A;  3UE1 A;  3Q7V B;  3PBN A;  3WRT A;  1FCM A;  5GLB A; 
#chains in the Genus database with same CATH topology
 4QB8 A;  2LB9 A;  5C5K A;  4DJ3 A;  2H10 A;  2C6W B;  2Y2P A;  4GHI B;  2YKH A;  2XSS A;  4WUJ A;  3IWO A;  1MKM A;  5FQI A;  2V1Z A;  2PAV P;  1G6A A;  1VM1 A;  4QPR A;  3CMZ A;  4JXS A;  3PAG A;  4HEF A;  3MQO A;  3NIA A;  5DKK A;  4K0W A;  4K0X A;  4C3Q A;  4K91 A;  3MFD A;  4N1X A;  1STZ A;  1Y4O A;  3H9W A;  4BL3 A;  4M4X A;  3KYZ A;  3MMH A;  5AQ7 A;  4MEZ A;  4OPY A;  2A24 A;  3T4Q A;  3S22 A;  1VQQ A;  4KUK A;  2KLI A;  2O0Y A;  2XGN A;  2HJ9 C;  5F6A A;  2PU4 A;  2ZM8 A;  1K56 D;  1MBL A;  5GLA A;  5FDH A;  1OTB A;  3OLO A;  4P6Z S;  2ZQC A;  3HLB A;  5F83 A;  1IEM A;  5I94 A;  2Q0O A;  1P0Z A;  3BFG A;  2PD7 A;  1PFL A;  1JWV A;  2ZLY A;  1XJ3 A;  3N8L A;  1W7F A;  3FC7 A;  5E2H A;  3BQ8 A;  3LIE A;  4OH0 A;  3CZD A;  1ES2 A;  1K57 C;  1M6K A;  3VSK A;  1XJ4 A;  5DFY A;  4B9O A;  4KQQ A;  4JXV A;  2V8F A;  3IT9 A;  4WYY A;  3T4S A;  3S4X A;  1V9Z A;  5HPI A;  4B93 A;  5HL1 A;  4NK3 A;  4BLM A;  3PAE A;  1KVM A;  3UNW A;  1NLY A;  3FKV A;  1D1J A;  2EX9 A;  3TSG A;  4X1L A;  4O01 A;  3RTY A;  1HVB A;  3PBR A;  4NXE A;  2O9A A;  3Q81 A;  4LFU A;  1YM1 A;  3P09 A;  1BZA A;  5FQM A;  1O07 A;  3E2K A;  2ZM2 A;  4OOL A;  4WZ5 C;  4HJ6 A;  4IUH A;  4R4S A;  3DBA A;  1IKI A;  1CI9 A;  3B3X A;  4RYE A;  3O3V A;  5U47 A;  4EQI A;  1CI8 A;  2EA9 A;  5L10 A;  4GJ4 A;  2IWC A;  4RQ9 A;  4KZ9 A;  2H5S A;  1MZU A;  3IXD A;  2WGW A;  5EVI C;  4MBH A;  2VV8 A;  5DF8 A;  1FSY A;  5EM0 A;  4G3W A;  3C4P A;  1G28 A;  5L07 A;  3DTE A;  5A92 A;  3C38 A;  1OTA A;  4I3J A;  3SH9 A;  4MDZ A;  3TOI A;  4BMW A;  4EV4 A;  5FAP A;  1JWP A;  2P74 A;  1CQA A;  1BLP A;  2ZMA A;  4Q0J A;  1K54 C;  2OLU A;  3LO7 A;  3HLD A;  3WS1 A;  1SKO B;  3K3D A;  4HY8 A;  4WM9 A;  4Q0I A;  4OVD A;  2Y59 A;  1I2W A;  3IF6 B;  4WZ4 A;  4RA7 A;  4DKI A;  3IHA A;  3LID A;  2OAP 1;  4MN5 A;  5HPF A;  5CHJ A;  2W3E A;  3ZG8 B;  1W63 Q;  1XA1 A;  2WKP A;  1TVF A;  1F2K A;  3GEC A;  2WUQ A;  1W79 A;  2Q9M A;  3IF5 A;  4CLC C;  2EXA A;  4F3L A;  2XLN A;  3GRJ A;  1H8M A;  1L0D A;  3NOU C;  3I7J A;  4CPK A;  2O9B A;  1G6O A;  4S2J A;  1P9W A;  2XF3 A;  1K55 C;  3TE8 A;  4EW7 A;  4S2N A;  5CHM A;  5DTT A;  3NBL A;  4BEN A;  3UPP A;  5HX9 A;  3BFC A;  3N8R A;  2WK0 A;  3BY9 A;  2JKR I;  4GNU A;  3C30 A;  2GNX A;  2GX5 A;  3FPW A;  1DRM A;  2J7V A;  2XD1 A;  1EWZ A;  2HDS A;  1W63 M;  3LY4 A;  4KQO A;  5AQA A;  4JF5 A;  3L7H A;  3ITB A;  4DXB A;  1PWG A;  1YKD A;  4MCW A;  2ZQ8 A;  3DTI A;  4PMA A;  3C7U A;  2VKS A;  2FZ0 A;  1CF0 A;  3VV4 A;  2ZM0 A;  3BM6 A;  3R4K A;  5AVF A;  3PBT A;  1QME A;  3M6B A;  3W4Q A;  4BQM A;  4R3A A;  2ZC7 A;  3IHB A;  1F98 A;  4HES A;  3OZH A;  3UN7 A;  2W1T A;  2WKH A;  3MR0 A;  4WLA A;  5FEF A;  1Z6F A;  1PZP A;  4II7 A;  5HAQ A;  3PXP A;  1FSW A;  1L0F A;  1SKF A;  1SZV A;  4WEK A;  2LB5 A;  2VGL M;  3T1X A;  5F5Y A;  3UPN A;  1ONG A;  3O88 A;  5EFW A;  3UE3 A;  2B95 A;  5F82 A;  2C5W B;  3ITA A;  2Y8H A;  4OLG A;  2A2L A;  2VX8 A;  3C7V A;  5M19 A;  3SW1 A;  1VEU B;  2INW A;  1L3L A;  3A3D A;  2D01 A;  4YWZ A;  1MY8 A;  3LIF A;  2Y2G A;  3T4K A;  5AJG A;  2XRO A;  1K6R A;  2PDR A;  4JXW A;  2L0W A;  4ZJ2 A;  4JPM A;  1FCN A;  2BAS A;  2W3G A;  1FIL A;  1ZHH B;  3N4I A;  3AGE A;  1KE4 A;  3G2Z A;  1PWC A;  4X55 A;  3TG9 A;  3LFV A;  4K08 A;  3CAX A;  3HUO A;  4KQR A;  2P7J A;  3VE4 A;  2ZC4 B;  1VHM A;  4MBK A;  4GB7 A;  3V67 A;  4EBN A;  1YLY A;  4GS9 B;  4NG2 A;  1S1Y A;  3B42 A;  3HLW A;  2B02 A;  4GHI A;  4HBT A;  4JGP A;  5EVI D;  3UO9 A;  1GSV A;  4UAA A;  4QD4 A;  2Y55 A;  4E3M A;  5GHY A;  5TJJ A;  1SDE A;  1JTD A;  2ZL1 B;  1BT5 A;  2B18 A;  3ZVW A;  2L1M A;  3T4L A;  4HBU A;  4R23 A;  3NY4 A;  1K25 A;  4LEN A;  3BQA A;  3LYX A;  4M3K A;  4KZB A;  3JPU A;  1UWN X;  4S2P A;  2W1R A;  1LSV A;  3MBZ A;  2R9X A;  1MC0 A;  3CJM A;  2H0T A;  3BY8 A;  5EEC A;  3UE1 A;  1T18 A;  3OOV A;  2V9A A;  4PAU A;  4ETZ A;  4S2I A;  3EEA A;  1J3W A;  3BYD A;  1GSW A;  1BLH A;  4CLC D;  1OT6 A;  2E8J A;  5KIZ A;  5FEG A;  5FDS A;  4HJ4 A;  5BOH A;  4OKP A;  3F1N B;  4NXG A;  1DY6 A;  1TS6 A;  2QKP A;  3OBF A;  3MZF A;  3C2W A;  3BFE A;  5TR7 A;  4FOF A;  4FUW A;  3HUM A;  5EVL A;  3E0Y A;  1XJ2 A;  4JGQ A;  2JBF A;  4GW9 A;  5FQK A;  4HH3 A;  1YLW A;  1W5D A;  3ZG9 B;  3KSI A;  1HD8 A;  4N9L A;  4DE1 A;  3DTM A;  1CEF A;  3A3E A;  4X6T A;  3UB8 A;  2ZQ9 A;  5HDD A;  3O87 A;  1I2S A;  4IHQ A;  3T4J A;  3W4O A;  3OCL A;  4WMC D;  5IHV A;  1ERM A;  3VP0 A;  3R7W B;  3AGD A;  4P87 A;  3BFD A;  3E4P A;  3MKE A;  1OTD A;  2VA0 A;  2Z2M B;  1D06 A;  4Z1W A;  2JKT M;  4I5S A;  3T4O A;  3G2Y A;  4JF4 A;  2J9P A;  4GD6 A;  3P7N A;  2D02 A;  4JXG A;  4EQ1 A;  4PM9 A;  3GV9 A;  4FSF A;  3MJQ A;  3S1Y A;  2O9C A;  2EFX A;  4O8G A;  3VP2 A;  5HDC A;  4BBT A;  3PR6 A;  1SKO A;  1P9R A;  3BLS A;  1N9O A;  2AVX A;  3H7W B;  5KMW A;  1BTL A;  4WEJ A;  3IF6 A;  4EWF A;  4GDN A;  4BBV A;  4R38 A;  2UWX A;  2B5R A;  5HD5 A;  4BWI A;  3MZD A;  2VJW A;  4F94 A;  4X69 A;  2ZJ9 A;  1DP8 A;  2V0W A;  2X02 A;  5HAI A;  3KSH A;  4UA7 A;  3HVF A;  5K5B A;  3MS6 A;  4EET B;  5D3O A;  3MZE A;  3TW8 A;  4HNB A;  4HHD A;  1XA7 A;  5EVE A;  5F68 A;  3QP5 A;  3Q7Z A;  3OPR A;  1FQG A;  2KDK A;  3M2J A;  5HAR A;  2HDQ A;  2ZD8 A;  1T1C A;  4EUZ A;  4LGW A;  3V50 A;  4EES A;  4WN5 A;  3G6O A;  3G30 A;  4CQH A;  2Y2M A;  1Z09 A;  1MPL A;  1S6R A;  2Z6C A;  2BG1 A;  4UQI M;  2R9W A;  4ZJ1 A;  4X68 A;  3MQQ A;  2IA2 A;  4U0X A;  5HSQ A;  4EER A;  3M2K A;  3LR3 A;  4S2N C;  3H82 A;  3K3C A;  3DWK A;  4E6W A;  1PRQ A;  3C5A A;  1X0O A;  3IWQ A;  5CX7 A;  5FQQ A;  4ID4 A;  1PI5 A;  3FPV A;  4ZTK A;  2XFS A;  5AQ9 A;  1RGZ A;  1BSG A;  3DWZ A;  4P0M A;  4DE0 A;  5E2G A;  3C8C A;  4KZ4 A;  5L8M A;  4C75 A;  3SS4 A;  1XFN A;  5GL9 A;  3ZG5 A;  1PI4 A;  5DJT A;  2ZQ7 A;  4NKP A;  4UA6 A;  5CGX A;  2CC1 A;  4MNR A;  1YLT A;  4P6Z M;  4E6X A;  1SHV A;  4KG2 A;  4ESP A;  1VEU A;  3HJK A;  1ZTU A;  2FFY A;  5DJU A;  4GOG A;  1ZG4 A;  3WS0 A;  4OQG A;  1YSQ A;  1NYY A;  2ACG A;  4GLQ A;  1KE0 A;  2G2U A;  3EOI A;  4Y15 A;  5E2F A;  5FL3 A;  3ZNT A;  4I3A A;  1G68 A;  2W0N A;  4I39 A;  3MXS A;  4X53 A;  5IU1 A;  4XT2 B;  2OWJ A;  2A3U A;  4QHC A;  3Q82 A;  3PTE A;  3IS2 B;  2WAE A;  3VFF A;  1JWZ A;  2P9V B;  4GS9 A;  3EQU A;  2WKQ A;  4WL9 A;  5MC7 A;  2RL3 A;  3VP4 A;  4H8R A;  5CER A;  2R78 A;  2J3W A;  5FSR A;  4LV2 A;  2WYX A;  2GDN A;  2ZL1 A;  3LIB A;  3WS5 A;  3CLO A;  5TBM A;  1YQS A;  4XXR A;  5HWT A;  3S7N A;  2ZQD A;  5M18 A;  4Y0U A;  4H6J A;  3NOT C;  3MKF A;  5HL6 A;  4FH4 A;  4O7D A;  3VSL A;  2HPB A;  2VK3 A;  3GMW A;  1IFQ A;  1S66 L;  2DNS A;  1VB6 A;  5EPH A;  3ZYT A;  2PHY A;  1KGF A;  3BLM A;  2OAQ 1;  2QYB A;  1XJ6 A;  2WAD A;  1L2S A;  1JVJ A;  4LV3 A;  2W3D A;  2JKG A;  3WS2 A;  3JVU A;  5KSH A;  3EWK A;  5A90 A;  3F1N A;  3CWF A;  2FFF B;  3KYE A;  5FI7 A;  1OJ5 A;  4R3B A;  4EBP A;  3UB6 A;  3OC2 A;  3CPT A;  4BJP A;  2MJ6 A;  2H0Y A;  3T50 A;  3IBR A;  4JF6 A;  4QY5 A;  1K0K A;  3DW0 A;  2ZC3 B;  4DN0 A;  4PM6 A;  3SH7 A;  4E3N A;  1ESI A;  5JYO A;  1AXB A;  3A3I A;  4BBU A;  3F1O B;  2VGL S;  2VGJ A;  4N1H A;  3WRT A;  3T1Q B;  1FCM A;  2XDM A;  4C6Y A;  1ACF A;  1ALQ A;  1WYB A;  3ULF A;  5J3W A;  2YKF A;  3NDG A;  3R7W A;  1PW1 A;  3VOY A;  1LL8 A;  3NEC A;  2Y79 A;  5CXW A;  4Y0O A;  1FR6 A;  2WZZ A;  4PPR A;  2PBY A;  1HTZ A;  5CHU A;  1EW0 A;  2G7U A;  2HF6 A;  3SH8 A;  3VE3 A;  3GSG A;  3MFX A;  3LI8 A;  3UDX A;  1XPB A;  4WF0 A;  3VP3 A;  3HCY A;  3SOI A;  3GVB A;  1L0G A;  2VGK A;  3UB5 P;  3FV7 A;  3V39 A;  2QZ6 A;  1KDS A;  1TDG A;  4LPZ A;  1ZC2 A;  5CTM A;  4ARZ B;  3IXH A;  4FH2 A;  3S7Q A;  3EGD C;  3KSF A;  4R0Q A;  1V9Y A;  3G4P A;  4U3T A;  2ZMV A;  1XP4 A;  2PT7 A;  4DDY A;  3H7W A;  3ZNY A;  2BLS A;  2HDU A;  5EV0 A;  3IWI A;  3HUN A;  4EBL A;  3IX3 A;  1ONH A;  2XD5 A;  5LBR A;  2ZBB A;  2ZOH A;  4R4R A;  3KO6 A;  4BL2 A;  3ZGA B;  5HZH A;  3W2Z A;  5DVA A;  1XFQ A;  3IXG A;  4CLC E;  4UEY A;  2XA7 M;  1Q2P A;  3PHY A;  4XUZ A;  4R6L A;  4GKU A;  3VOL A;  4I3I A;  4L0L A;  1DJA A;  3HLG A;  4E04 A;  1PYY A;  1IEL A;  4L9F A;  4E3O A;  3IH9 A;  4N9K A;  4S2M A;  4DRT A;  4OQ0 A;  1LL5 A;  2E8I A;  2EWV A;  1NZU A;  3IF6 C;  1GCE A;  3U2A A;  1LT0 A;  1LL9 A;  4JBF A;  4FTX A;  3BEC A;  3ZG0 A;  1E4D A;  3SS5 A;  3SS3 A;  2WGI A;  2V20 A;  3A0S A;  4OQH A;  1N9L A;  1K4E A;  4GN2 A;  4CJN A;  4QY6 A;  1S0W A;  2PBD P;  4IBX A;  2GZA A;  4KG6 A;  4YNR A;  5A8B A;  1HLU P;  4Y5F A;  3DTK A;  4NXF A;  5FAT A;  3HRE A;  1NJ4 A;  5DF9 A;  1TEM A;  2QMI A;  1YSP A;  2JN7 A;  4MN7 A;  4E3L A;  3CHW P;  2JCH A;  3LI9 A;  4D2O A;  1N9B A;  1K4F A;  1H5X A;  5HW3 A;  4R70 A;  3U4L P;  3NOP C;  4UA9 A;  1IYQ A;  4U0T A;  2WKE A;  3NDE A;  4B4Z A;  1ERO A;  2KOI A;  5FI6 A;  3KSG A;  4MBF A;  2XRN A;  3UPO A;  3NJA A;  1T1A A;  3ZG7 B;  2NUP C;  5EM1 A;  3VOZ A;  4Q8I A;  3E4Q A;  3G32 A;  5EOO A;  4FD8 A;  4KG5 A;  5FAS A;  4E3J A;  3W8K A;  4MN6 A;  3GQZ A;  4IVK A;  5CGW A;  2QHK A;  2PYP A;  5DKL A;  5A91 A;  5HWV A;  4BD0 A;  1Y28 A;  4WBG A;  4LV0 A;  4EU0 A;  1OT9 A;  3IXB A;  1E3U A;  2KX6 A;  4Y7P A;  2ZMF A;  3BRM A;  3LGO A;  3W4P A;  4JKT A;  3LCE A;  2W1T B;  1SCW A;  2PYR A;  1Y54 A;  1ERQ A;  1IOU A;  3IS2 A;  2Y2H A;  3ICY A;  3QP1 A;  1E25 A;  4KEN B;  2RCX A;  4DJ2 A;  2P9V A;  3V3S A;  5M1A A;  3BFF A;  1DJB A;  2Q9N A;  3NUL A;  4IBR A;  3IQA A;  1NZO A;  1KE3 A;  1NXY A;  2A49 A;  1XGI A;  3VMA A;  4OLD A;  3UY6 A;  4DXC A;  3ISG A;  2EFU A;  3B47 A;  5EVI B;  1IYO A;  3EEH A;  2CMN A;  3Q1F A;  4P6B A;  1RP5 A;  2OV5 A;  5EUA A;  4MLL A;  2EX6 A;  2G2W A;  2QJ5 A;  2K7S A;  2WKR A;  5CGS A;  5CRF A;  4OP5 A;  4Y3I A;  3DAV A;  3ZFZ A;  3ZHH A;  2V2F F;  1J9M A;  1M40 A;  3LIA A;  3CI6 A;  3P01 A;  3TJZ C;  4X1M A;  2HGV A;  4QJG A;  1K56 A;  4CLC B;  4OON A;  3EGX C;  5J7E A;  1FCO A;  4UQI S;  2X01 A;  3T1S A;  1NRF A;  2DRW A;  1CEG A;  5CEB A;  2VV6 A;  4G3K A;  3HLF A;  2K31 A;  1PNE A;  2NUT C;  4PKY A;  1YMX A;  3AGF A;  1KVL A;  3BWL A;  4RVA A;  5EE8 A;  3RH8 B;  5J8X A;  4B4X A;  4WEL A;  1KDW A;  5GLD A;  3MSH A;  2DMW A;  1S1Z A;  3F1O A;  3JYI A;  3MXQ A;  3QP4 A;  2W27 A;  2J3T C;  1YLP A;  5E43 A;  4DMZ A;  1U60 A;  1KGG A;  5L2F A;  4JGR A;  2Y2O A;  1MKI A;  1NRJ A;  4LRY C;  3G35 A;  2DCF A;  2J8Y A;  2XH9 A;  4OPZ A;  1IYS A;  1MWT A;  2EXB A;  2L4R A;  3CIT A;  5HFO A;  1YLZ A;  3LY3 A;  3MXR A;  2K2N A;  3UDF A;  4OP8 A;  3QP8 A;  2PD8 A;  3OPP A;  5J4E A;  1XGJ A;  4LCL A;  4Y2F A;  4P85 A;  1UWP X;  1A0K A;  3LIC A;  1OTE A;  3GDI A;  3CUE A;  4LCM A;  5FI2 A;  4DDS A;  2Y2J A;  1LLB A;  4PKY G;  3E4O A;  4PM8 A;  3SZT A;  2JC7 A;  3S7P A;  3NC8 A;  2HV1 A;  3WRZ A;  1OTI A;  4N92 A;  4OQI A;  2VV7 A;  1PW8 A;  1SDN A;  3IX4 A;  4HIA A;  3A0R A;  5HD3 A;  1TS0 A;  3RFB A;  4LRZ E;  4ARZ A;  2IWB A;  4Y13 A;  5FAO A;  4O0P A;  1PIO A;  2W3F A;  5GHX A;  1RGY A;  4BD1 A;  3Q7V B;  3PBN A;  1MWS A;  3LR5 A;  2WGV A;  4DE2 A;  3F1P B;  3QNB A;  4GCZ A;  2XQZ A;  5IT5 A;  1W8Y A;  3UME A;  3ZQ5 A;  3EQV A;  3UB7 A;  2Y2L A;  3UMD A;  1D7E A;  2V0U A;  2OOL A;  1IYP A;  3A3F A;  4FCF A;  2EWW A;  3LR0 A;  2M1C A;  3FZC A;  1GHM A;  1OJG A;  4AFI A;  1YT4 A;  3HLE A;  3NCK A;  1CJF A;  5I5L A;  3LEQ A;  3T4T A;  1VET B;  1EI5 A;  3GR2 A;  2PRF A;  2WZX A;  3LEZ A;  1K38 A;  4ZAM A;  1WYC A;  1YMS A;  5F69 A;  1LSW A;  1Q2Q A;  3NI9 A;  2Y2N A;  2HP5 A;  2VEA A;  1YAX A;  2VLG A;  3UDI A;  5KSC A;  4LRX C;  2Y4A A;  4R3J A;  2P04 A;  4IJG A;  1DP6 A;  1H8Y A;  1QMF A;  2QWS A;  4G3V A;  2Y2Q A;  3C4O A;  4RX2 A;  3V5M A;  2Y2I A;  5G18 A;  2JKR M;  3VP1 A;  3N6I A;  3WS4 A;  2EX8 A;  5KZH A;  1DP9 A;  1CK3 A;  5TGF A;  3UE6 A;  4ZRR A;  4YFM A;  2XEP A;  1P97 A;  2I9V A;  4KZ3 A;  5F1F A;  3RJU A;  3QHY A;  1PZO A;  3M6H A;  4S2L A;  1LI9 A;  1F5M A;  1PWD A;  2P08 A;  4X56 A;  3FG8 A;  4S2K A;  4EEU A;  1MWR A;  1K57 A;  3V3R A;  2PR6 A;  1S4R A;  5DF7 A;  2A24 B;  4EXO A;  1BYW A;  1MXO A;  3G31 A;  4NET A;  3D9Y A;  3MQ0 A;  2V1A A;  3O86 A;  4YOF A;  1H3Q A;  4L9E A;  4X25 A;  2HJE A;  4S2O A;  4RX3 A;  3HBR A;  4PHT A;  2J3T D;  5TFQ A;  1O7E A;  3H82 B;  3Q07 A;  1KOU A;  2ZOI A;  3OPL A;  4IVI A;  1WA9 A;  2X71 A;  3S7O A;  4OOY A;  1ES3 A;  1XX2 A;  5GLC A;  3MF0 A;  4IUK A;  4NXB A;  5EOE A;  5DTS A;  4Y0T A;  4OPQ A;  2QPN A;  1GA9 A;  1DJC A;  1YPR A;  2IWD A;  4WZ5 A;  3T1R A;  4NEE D;  2I72 A;  3UB9 A;  2QJ7 A;  2M7U A;  5L09 A;  3A0V A;  3GTC A;  1H8Z A;  3G34 A;  2V8C A;  4MMN A;  4JGO A;  1L0E A;  4YIN A;  4R1G A;  1UGU A;  3QNC A;  4PM7 A;  3ZDJ A;  5FQ9 A;  2BTF P;  3T12 B;  4EEP A;  5HAP A;  5EVI A;  1FR1 A;  3P98 A;  3FWL A;  1ODV A;  3KYQ A;  4EUV A;  4OPR A;  4Z9Q A;  2PR5 A;  3PYP A;  4Y17 A;  4QWO A;  5G4Y A;  3L9K A;  3BEB A;  2XA7 S;  4LV1 A;  2JHE A;  3QP2 A;  5FA7 A;  3OPH A;  1RCJ A;  1K54 A;  4HP9 A;  5JYP A;  2M7V A;  4E3K A;  1GSX A;  4KZ7 A;  3HLC A;  1BLS A;  1NWZ A;  3JVV A;  1N9N A;  3A3J A;  5G4Z A;  2V1B A;  3N7W A;  5FAQ A;  1S67 L;  1LSX A;  1N4O A;  4GZB A;  2WGW B;  3D3O A;  2J9O A;  1TS7 A;  5CED A;  3LUQ A;  3O5Y A;  4QU3 A;  5AVE A;  4CLC A;  4JLF A;  5AQB A;  2VZW A;  1OPX A;  4DF6 A;  5CEC A;  4E3I A;  2Y2K A;  2JE5 A;  5TBM B;  1K55 A;  3QP6 A;  2ZC6 B;  1H0M A;  3BW6 A;  3IH8 A;  2PU2 A;  1GHP A;  1IKG A;  3CG5 A;  3PBS A;  4H6J B;  1OME A;  1YLJ A;  3RXX A;  4UHU A;  5HDS A;  3WWX A;  1ZG6 A;  2JKF A;  2ZQA A;  2HDR A;  1JTG A;  2HP9 A;  1HZO A;  4F3L B;  2J80 A;  5F1G A;  2OWH A;  2O99 A;  3HL9 A;  3FKW A;  1ES4 A;  1ESU A;  1ES5 A;  2OLV A;  1T1B A;  4KQD A;  3D4F A;  3HJI A;  3PBQ A;  4D60 A;  4WMC A;  2OSU A;  1BUE A;  2EX2 A;  2UV0 E;  4A5R A;  3ZVT A;  4ETX A;  1KGE A;  2ZC5 B;  1FOF A;  1TD5 A;  3BJN A;  1NLZ A;  1F9I A;  1JNU A;  3UE0 A;  4HQA A;  3TRC A;  4L9G A;  3PBO A;  2Y91 A;  3CPT B;  2H28 A;  4KZ5 A;  1K6S A;  1W8Q A;  5GHZ A;  4GDB A;  4KUO A;  4I38 A;  4ZBE A;  3OCN A;  5DFX A;  1TDL A;  2XFT A;  1T19 A;  4OOM A;  1WE4 A;  1G5U A;  1S4S A;  2WKI A;  4HI4 A;  1FIK A;  4PM5 A;  3Q7V A;  4HJ3 A;  4KZA A;  3D72 A;  4XT2 A;  3CUE C;  3F1P A;  2XR0 A;  4ZJ3 A;  5CTN A;  5IS1 A;  1XKZ A;  1C3B A;  1TS8 A;  4HH2 A;  4DE3 A;  2JKT I;  4ME4 A;  3E2L A;  2HZ5 A;  3K2N A;  1MWU A;  2HP6 A;  1LHY A;  5E2E A;  3ZCZ A;  3FYZ A;  4IED A;  3KX0 X;  4KZ6 A;  1XXM A;  3NHQ A;  5HWW A;  3RXW A;  5A93 A;  1TF1 A;  3VFH A;  2WAF A;  5FQJ A;  1GHI A;  2GJ3 A;  2W3H A;  4HOI A;  5DTK A;  3E98 A;  1LI0 A;  2XK1 A;  3LR4 A;  2Z6D A;  2Z2L B;  1E3U D;  4B88 A;  1NY0 A;  4HP4 A;  4GD8 A;  1VET A;  1BLC A;  2FH5 A;  1I5Q A;  1NYM A;  3IX8 A;  3B33 A;  1GA0 A;  1BUL A;  4ZDX A;  1ZKJ A;  3N8S A;  4KZ8 A;  4Q0H A;  4LLO B;  4XUX A;  1AWI A;  5GLB A;  3IBJ A; 
#chains in the Genus database with same CATH homology
 1MWS A;  4S2I A;  2XDM A;  2WGV A;  4DE2 A;  3QNB A;  4C6Y A;  2XQZ A;  1ALQ A;  4QB8 A;  1W8Y A;  1WYB A;  3BYD A;  3NDG A;  1BLH A;  2H10 A;  1PW1 A;  2C6W B;  3VOY A;  2Y2P A;  5CXW A;  4Y0O A;  1FR6 A;  2WZZ A;  3EQV A;  4PPR A;  2PBY A;  5BOH A;  1HTZ A;  5CHU A;  2Y2L A;  3IWO A;  4OKP A;  5FQI A;  2V1Z A;  1G6A A;  1IYP A;  1VM1 A;  3A3F A;  4FCF A;  3SH8 A;  3GSG A;  3CMZ A;  4JXS A;  3UDX A;  1DY6 A;  1XPB A;  3FZC A;  3PAG A;  3VP3 A;  4HEF A;  3SOI A;  1GHM A;  3GVB A;  1L0G A;  2VGK A;  3FV7 A;  3NIA A;  3V39 A;  1YT4 A;  3HLE A;  3NCK A;  4K0W A;  2QZ6 A;  1KDS A;  1TDG A;  3MZF A;  3BFE A;  4K0X A;  5TR7 A;  4C3Q A;  4K91 A;  3HUM A;  5EVL A;  3MFD A;  4N1X A;  1ZC2 A;  1EI5 A;  3GR2 A;  2JBF A;  5CTM A;  2WZX A;  5FQK A;  3LEZ A;  4BL3 A;  1YLW A;  1K38 A;  1W5D A;  3IXH A;  4FH2 A;  5AQ7 A;  4MEZ A;  3ZG9 B;  4ZAM A;  4OPY A;  1WYC A;  1YMS A;  3S22 A;  1Q2Q A;  3NI9 A;  1HD8 A;  1VQQ A;  4R0Q A;  2Y2N A;  4N9L A;  4DE1 A;  3G4P A;  4U3T A;  2HP5 A;  2XGN A;  1XP4 A;  3UDI A;  3DTM A;  1CEF A;  3A3E A;  4X6T A;  4DDY A;  2ZQ9 A;  3ZNY A;  2BLS A;  5KSC A;  2PU4 A;  1I2S A;  2HDU A;  3O87 A;  3W4O A;  2Y4A A;  3OCL A;  4WMC D;  4R3J A;  2ZM8 A;  3IWI A;  5IHV A;  3HUN A;  1ERM A;  1K56 D;  1MBL A;  4EBL A;  3VP0 A;  5GLA A;  3AGD A;  4P87 A;  1ONH A;  5FDH A;  2XD5 A;  4R4R A;  1H8Y A;  1QMF A;  2ZQC A;  3HLB A;  3BFD A;  5F83 A;  4BL2 A;  1IEM A;  3ZGA B;  5I94 A;  3MKE A;  5DVA A;  2Y2Q A;  3BFG A;  3C4O A;  2Z2M B;  4RX2 A;  1JWV A;  2ZLY A;  3IXG A;  2Y2I A;  3V5M A;  5G18 A;  1Q2P A;  3N8L A;  4XUZ A;  1W7F A;  5E2H A;  3G2Y A;  4OH0 A;  4GKU A;  4JF4 A;  3CZD A;  1ES2 A;  1K57 C;  3VP1 A;  2J9P A;  4L0L A;  3N6I A;  1DJA A;  3WS4 A;  3HLG A;  2EX8 A;  1M6K A;  5KZH A;  1CK3 A;  1PYY A;  4GD6 A;  3VSK A;  5TGF A;  1IEL A;  4E3O A;  3IH9 A;  4JXG A;  4KQQ A;  4N9K A;  4S2M A;  4PM9 A;  4YFM A;  2XEP A;  4JXV A;  3GV9 A;  4FSF A;  4DRT A;  4OQ0 A;  1LL5 A;  4KZ3 A;  2E8I A;  5F1F A;  3IT9 A;  3RJU A;  1NZU A;  3S1Y A;  3IF6 C;  4WYY A;  3QHY A;  3S4X A;  1GCE A;  1PZO A;  2EFX A;  3M6H A;  1LI9 A;  4S2L A;  3VP2 A;  5HL1 A;  4NK3 A;  1PWD A;  4X56 A;  4BLM A;  1LL9 A;  3PAE A;  4S2K A;  4JBF A;  1KVM A;  1MWR A;  1K57 A;  3V3R A;  3UNW A;  5DF7 A;  3BEC A;  3ZG0 A;  3FKV A;  1E4D A;  3SS5 A;  3BLS A;  2EX9 A;  3TSG A;  3SS3 A;  1HVB A;  1MXO A;  3G31 A;  2WGI A;  4NET A;  3PBR A;  2V20 A;  5KMW A;  1BTL A;  3O86 A;  3Q81 A;  4WEJ A;  4OQH A;  3IF6 A;  1YM1 A;  3P09 A;  4GDN A;  1BZA A;  4EWF A;  4GN2 A;  1K4E A;  5FQM A;  4CJN A;  1O07 A;  2UWX A;  2B5R A;  3E2K A;  4QY6 A;  1S0W A;  4S2O A;  4RX3 A;  3HBR A;  4IBX A;  4KG6 A;  5TFQ A;  2ZM2 A;  3MZD A;  1O7E A;  4OOL A;  4WZ5 C;  3Q07 A;  4F94 A;  4X69 A;  4R4S A;  3HRE A;  5FAT A;  3OPL A;  1NJ4 A;  5DF9 A;  1IKI A;  1TEM A;  2X71 A;  2ZJ9 A;  1CI9 A;  3B3X A;  4IVI A;  2QMI A;  4RYE A;  3O3V A;  5U47 A;  4EQI A;  4OOY A;  2X02 A;  4E3L A;  1CI8 A;  4D2O A;  2JCH A;  1ES3 A;  1N9B A;  1XX2 A;  5HAI A;  4UA7 A;  5GLC A;  5EOE A;  2IWC A;  1K4F A;  5DTS A;  3HVF A;  4Y0T A;  1H5X A;  5HW3 A;  4OPQ A;  2QPN A;  4KZ9 A;  1GA9 A;  2H5S A;  3IXD A;  1DJC A;  2WGW A;  5EVI C;  4MBH A;  2IWD A;  4WZ5 A;  5DF8 A;  1FSY A;  2I72 A;  4UA9 A;  3C4P A;  1IYQ A;  4U0T A;  2WKE A;  3NDE A;  5D3O A;  4B4Z A;  1ERO A;  5A92 A;  3MZE A;  3GTC A;  5FI6 A;  4MBF A;  3UPO A;  3SH9 A;  3TOI A;  1XA7 A;  1H8Z A;  4EV4 A;  3G34 A;  5FAP A;  3ZG7 B;  1JWP A;  2P74 A;  1L0E A;  1BLP A;  2ZMA A;  4YIN A;  3VOZ A;  4Q8I A;  4R1G A;  1K54 C;  2OLU A;  3QNC A;  4PM7 A;  3ZDJ A;  3LO7 A;  3G32 A;  3HLD A;  3OPR A;  3Q7Z A;  5EOO A;  5FQ9 A;  3WS1 A;  1FQG A;  4FD8 A;  4KG5 A;  5FAS A;  5HAP A;  4E3J A;  3W8K A;  3M2J A;  5EVI A;  3GQZ A;  1FR1 A;  4IVK A;  5HAR A;  3P98 A;  2HDQ A;  2ZD8 A;  3FWL A;  4EUZ A;  3V50 A;  5CGW A;  4WM9 A;  4OPR A;  3G30 A;  4OVD A;  4Z9Q A;  2Y2M A;  1MPL A;  5A91 A;  1S6R A;  2Y59 A;  1I2W A;  4BD0 A;  3IF6 B;  4WBG A;  2BG1 A;  4WZ4 A;  2R9W A;  3BEB A;  4LV0 A;  4RA7 A;  4LV1 A;  4X68 A;  4ZJ1 A;  4DKI A;  3IHA A;  5FA7 A;  3OPH A;  3IXB A;  1RCJ A;  1E3U A;  4U0X A;  1K54 A;  3M2K A;  4Y7P A;  5CHJ A;  4S2N C;  5JYP A;  3DWK A;  4E6W A;  3ZG8 B;  3C5A A;  4E3K A;  1XA1 A;  1TVF A;  3BRM A;  2WUQ A;  3W4P A;  1W79 A;  3IWQ A;  4JKT A;  4KZ7 A;  2Q9M A;  3LCE A;  4ID4 A;  5FQQ A;  3IF5 A;  2EXA A;  1PI5 A;  1SCW A;  2XLN A;  3HLC A;  1BLS A;  3GRJ A;  1L0D A;  4CPK A;  3I7J A;  3A3J A;  3N7W A;  5FAQ A;  1Y54 A;  1ERQ A;  2Y2H A;  4S2J A;  1N4O A;  4GZB A;  1E25 A;  2WGW B;  4ZTK A;  2XF3 A;  4KEN B;  1K55 C;  2XFS A;  5AQ9 A;  2J9O A;  1RGZ A;  2RCX A;  1BSG A;  2P9V A;  4S2N A;  5CHM A;  5M1A A;  5DTT A;  3V3S A;  3BFF A;  3NBL A;  1DJB A;  2Q9N A;  4BEN A;  3UPP A;  5CED A;  5HX9 A;  4IBR A;  3DWZ A;  4P0M A;  3BFC A;  3N8R A;  2WK0 A;  4DE0 A;  5E2G A;  4KZ4 A;  3IQA A;  4QU3 A;  4C75 A;  4GNU A;  1NZO A;  1KE3 A;  3SS4 A;  1NXY A;  2A49 A;  4JLF A;  5AQB A;  5GL9 A;  1XGI A;  3ZG5 A;  1PI4 A;  2ZQ7 A;  4UA6 A;  5CGX A;  2CC1 A;  4MNR A;  3VMA A;  4OLD A;  1YLT A;  3UY6 A;  4DF6 A;  4DXC A;  4E3I A;  2J7V A;  2XD1 A;  5CEC A;  1EWZ A;  2EFU A;  2HDS A;  1SHV A;  3ISG A;  3LY4 A;  4KG2 A;  5EVI B;  2Y2K A;  4KQO A;  4E6X A;  5AQA A;  2JE5 A;  4JF5 A;  1K55 A;  3ITB A;  4DXB A;  1IYO A;  1PWG A;  2ZC6 B;  2FFY A;  4GOG A;  1ZG4 A;  3Q1F A;  2ZQ8 A;  1RP5 A;  4P6B A;  2OV5 A;  3IH8 A;  5EUA A;  2PU2 A;  3WS0 A;  1GHP A;  4PMA A;  4OQG A;  1IKG A;  3CG5 A;  3C7U A;  4MLL A;  2EX6 A;  3PBS A;  1NYY A;  1OME A;  2ZM0 A;  3BM6 A;  1YLJ A;  2G2W A;  3RXX A;  1KE0 A;  2G2U A;  5E2F A;  4UHU A;  3WWX A;  3PBT A;  3ZNT A;  1QME A;  5CGS A;  5CRF A;  1G68 A;  1ZG6 A;  4OP5 A;  3M6B A;  3W4Q A;  2ZQA A;  2HDR A;  4BQM A;  1JTG A;  3MXS A;  2ZC7 A;  3IHB A;  4X53 A;  2HP9 A;  4HES A;  3OZH A;  3ZFZ A;  1HZO A;  3UN7 A;  2WKH A;  5F1G A;  2A3U A;  4QHC A;  3HL9 A;  3Q82 A;  3ZHH A;  2V2F F;  1J9M A;  1M40 A;  3PTE A;  3FKW A;  2WAE A;  1ES4 A;  1ESU A;  1Z6F A;  1ES5 A;  1PZP A;  2OLV A;  3VFF A;  5HAQ A;  1JWZ A;  1FSW A;  1L0F A;  1SKF A;  2P9V B;  3D4F A;  4WEK A;  3PBQ A;  3EQU A;  3UPN A;  1ONG A;  4QJG A;  4WMC A;  3O88 A;  2RL3 A;  1K56 A;  3VP4 A;  2OSU A;  4H8R A;  1BUE A;  2EX2 A;  4A5R A;  4OON A;  5CER A;  3ZVT A;  3UE3 A;  1KGE A;  5F82 A;  2C5W B;  1FCO A;  3ITA A;  2X01 A;  2ZC5 B;  1FOF A;  1NRF A;  2DRW A;  1CEG A;  4OLG A;  5CEB A;  5FSR A;  4LV2 A;  3C7V A;  5M19 A;  2WYX A;  3UE0 A;  2GDN A;  3WS5 A;  3A3D A;  3HLF A;  3PBO A;  2Y91 A;  1MY8 A;  1YMX A;  1YQS A;  4KZ5 A;  4XXR A;  1K6S A;  1W8Q A;  3AGF A;  2Y2G A;  1K6R A;  1KVL A;  5GHZ A;  4GDB A;  4RVA A;  4JXW A;  2ZQD A;  5EE8 A;  3OCN A;  4ZBE A;  5M18 A;  4Y0U A;  4ZJ2 A;  5J8X A;  1TDL A;  1FCN A;  2XFT A;  4JPM A;  4B4X A;  4WEL A;  1KDW A;  3MKF A;  4FH4 A;  5GLD A;  3N4I A;  4O7D A;  3AGE A;  4OOM A;  1WE4 A;  1KE4 A;  3VSL A;  2HPB A;  2WKI A;  3G2Z A;  3GMW A;  3JYI A;  1PWC A;  2DNS A;  4X55 A;  4PM5 A;  5EPH A;  3Q7V A;  3TG9 A;  4KZA A;  3HUO A;  1YLP A;  5E43 A;  1KGF A;  4KQR A;  1U60 A;  1KGG A;  5L2F A;  2XR0 A;  3BLM A;  4ZJ3 A;  5CTN A;  2Y2O A;  2ZC4 B;  1MKI A;  1XKZ A;  1C3B A;  3G35 A;  2DCF A;  2J8Y A;  2XH9 A;  1IYS A;  1MWT A;  2EXB A;  4OPZ A;  4MBK A;  5HFO A;  2WAD A;  4GB7 A;  1YLZ A;  4EBN A;  3LY3 A;  4DE3 A;  1YLY A;  1L2S A;  3MXR A;  1JVJ A;  3UDF A;  4OP8 A;  3E2L A;  3HLW A;  1MWU A;  4LV3 A;  3OPP A;  2HP6 A;  4HBT A;  1LHY A;  1XGJ A;  4LCL A;  5E2E A;  5EVI D;  3UO9 A;  3WS2 A;  3ZCZ A;  3FYZ A;  4P85 A;  4IED A;  4UAA A;  4QD4 A;  5KSH A;  4KZ6 A;  2Y55 A;  5A90 A;  1XXM A;  4LCM A;  5FI2 A;  3RXW A;  4DDS A;  4E3M A;  2Y2J A;  5GHY A;  1LLB A;  2FFF B;  4PM8 A;  5FI7 A;  5A93 A;  3VFH A;  2JC7 A;  1SDE A;  1JTD A;  2WAF A;  4R3B A;  5FQJ A;  1GHI A;  3NC8 A;  5DTK A;  1LI0 A;  2XK1 A;  1BT5 A;  4EBP A;  3WRZ A;  2Z2L B;  1E3U D;  3ZVW A;  3OC2 A;  4BJP A;  4B88 A;  4HBU A;  4R23 A;  3NY4 A;  2H0Y A;  1NY0 A;  1K25 A;  4LEN A;  4N92 A;  4GD8 A;  4OQI A;  4M3K A;  4JF6 A;  1BLC A;  3DW0 A;  4QY5 A;  2ZC3 B;  1I5Q A;  4KZB A;  1NYM A;  1PW8 A;  1SDN A;  1GA0 A;  1BUL A;  4ZDX A;  4E3N A;  4PM6 A;  3SH7 A;  1ESI A;  4S2P A;  1AXB A;  5JYO A;  1ZKJ A;  3MBZ A;  3N8S A;  2IWB A;  3A3I A;  2R9X A;  5FAO A;  3CJM A;  2H0T A;  1PIO A;  5GHX A;  1RGY A;  4KZ8 A;  2VGJ A;  5EEC A;  4BD1 A;  4N1H A;  4XUX A;  3UE1 A;  3Q7V B;  3PBN A;  3WRT A;  1FCM A;  5GLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...