3G35A

Ctx-m-9 class a beta-lactamase complexed with compound 12 (f13)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
260
structure length
259
Chain Sequence
AVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase CTX-M-9a
publication title Molecular docking and ligand specificity in fragment-based inhibitor discovery
pubmed doi rcsb
source organism Escherichia coli
total genus 94
structure length 259
sequence length 260
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3g35A00
3ISGA 5CHUA 2HP5A 3PBRA 5CTNA 5EPHA 1LHYA 1GA9A 5AQ9A 3C5AA 4LV0A 5HW3A 4EV4A 3UPNA 3Q81A 5CTMA 3VFHA 2J8YA 1ONGA 3HLEA 4WELA 5EVID 1SHVA 5HAIA 4C75A 1KGGA 2OSUA 3Q7VB 5GLAA 4DXCA 3ITBA 3PBOA 1L0GA 3IF6A 2ZM8A 3OZHA 3Q7VA 4QHCA 3VMAA 3OPHA 4WMCD 1EWZA 4ID4A 1PWGA 2RL3A 4MBFA 2XLNA 4KENB 4RX3A 5FATA 2XQZA 3TSGA 2EFUA 5F83A 4WBGA 3GSGA 4IVIA 2XK1A 3PTEA 4Y7PA 3GVBA 1BT5A 1NXYA 3NDEA 4PM7A 5FQMA 4X53A 3IQAA 5DF9A 4PM5A 5CEBA 1MWSA 4PM9A 1RP5A 2CC1A 3C4PA 4PPRA 3VP4A 4NK3A 3IH9A 4ZJ3A 1PI4A 3CMZA 1HTZA 3M6BA 4OPYA 1IKIA 2HP9A 2V1ZA 2HDUA 2WGWB 4K0XA 4OPZA 4WEJA 2WAFA 5FQ9A 3ZNYA 4OLDA 5DTTA 4E3NA 3SH7A 2ZLYA 4DE1A 2WGWA 3N4IA 3S4XA 3P98A 1PI5A 4Y0OA 5CECA 1YLJA 3UDIA 4GOGA 4LCMA 1EROA 4KG2A 1IYPA 4MLLA 3BRMA 1HZOA 3Q1FA 2WK0A 5FAPA 3CG5A 4EBLA 3A3JA 5G18A 1GHIA 3V3RA 1CK3A 4GDBA 3A3EA 1NJ4A 5U47A 1W8QA 5A92A 3IXBA 5A90A 1K57C 1ES4A 2A49A 2JE5A 3HUNA 5FQIA 4S2PA 5BOHA 4JF4A 1JTDA 3SS3A 4KZ5A 2Q9NA 2XFSA 4Y0UA 5CHMA 3SS4A 1YQSA 5TFQA 3V5MA 4BD0A 4KQQA 4BJPA 1PWDA 4E3JA 2Y2HA 2DCFA 3N6IA 4GKUA 3ZNTA 1FQGA 4RVAA 1FSWA 1QMEA 4GB7A 3N8LA 4RYEA 1BLHA 4HBTA 4ZBEA 3WS1A 5KSCA 4S2NA 1YT4A 4HESA 5TGFA 5DTSA 1BZAA 3M2KA 3MKFA 4LCLA 2ZM0A 3MXRA 3G32A 4IBXA 4JBFA 4DRTA 1BLPA 5M1AA 2WGVA 5I94A 2HP6A 4UA7A 3PBQA 4P6BA 1K54C 3HBRA 5EECA 1Y54A 3G2ZA 5EVIB 3OPRA 4EQIA 2A3UA 3QHYA 4NETA 2H10A 1K4FA 3VSLA 2VGKA 5L2FA 2EX9A 5HARA 5CGWA 1K6RA 3BFCA 4OQGA 1K4EA 3DW0A 4GZBA 1FCNA 1O7EA 4U3TA 5HL1A 5JYOA 1K6SA 4QJGA 1W7FA 3UE0A 1EI5A 2JBFA 2XEPA 3OPPA 3NIAA 4PM6A 1FOFA 3BLMA 4JXSA 5A91A 3V50A 4KG6A 5CEDA 4KQRA 1OMEA 1E3UA 1S0WA 3FYZA 1JWVA 2XDMA 4UAAA 1MBLA 3CZDA 1XA1A 4WZ5C 1XA7A 3IXGA 2G2WA 5CGXA 3BM6A 1FR1A 1NRFA 1ES5A 2WZXA 3A3FA 1PWCA 1LLBA 1Z6FA 1WE4A 5E43A 3W4OA 1W8YA 2G2UA 2R9WA 4KZBA 3PBNA 3UO9A 2ZQ7A 4RX2A 2JC7A 2X71A 3OCLA 4KG5A 1YM1A 3FV7A 4UA6A 1KDWA 2PBYA 4PM8A 2PU4A 5F82A 1AXBA 4X69A 1YLZA 1GA0A 2WADA 3BYDA 4R0QA 3FKWA 3SH8A 4N1HA 2WYXA 4MBHA 4KZAA 4P87A 3G4PA 4P85A 4XXRA 3PBTA 3IHAA 3G30A 5FDHA 4JPMA 2P9VB 4IBRA 4KZ3A 3IF6B 3DTMA 2P9VA 1I2WA 2ZC5B 3S1YA 2J9OA 4Y0TA 1VQQA 3LO7A 3FWLA 5EE8A 3O86A 2Z2LB 2H5SA 1K55C 4FCFA 4FD8A 2Y91A 4Q8IA 2FFFB 4N1XA 2C6WB 1PZOA 5F1FA 1E3UD 2JCHA 4XUXA 4EUZA 3IXDA 5FQQA 3UPPA 3IWIA 3O87A 1XGIA 1TEMA 3C7UA 4JLFA 3UE3A 3WS5A 1XGJA 5EOEA 4F94A 4OP5A 1NY0A 5GHYA 1YMSA 1KGEA 4MEZA 3IF5A 4DDSA 4EBPA 1ZG6A 5CGSA 4S2LA 3ZG8B 2HDSA 4GN2A 1N9BA 5HFOA 5FQKA 2Y2GA 4DXBA 3BEBA 4HEFA 4CPKA 1K57A 4ZJ1A 2IWCA 3G35A 4KZ9A 5HAQA 5GHXA 1YLTA 2DNSA 4OKPA 4WM9A 3NCKA 2OLVA 3D4FA 2BG1A 3VOYA 3HREA 4WYYA 4X55A 4OONA 4ZJ2A 1PYYA 1U60A 3VFFA 1SDNA 2Y2IA 4XUZA 4DDYA 1YLWA 2XR0A 3RXXA 3HLDA 3TOIA 1MWRA 1WYCA 3HUOA 3IT9A 5CHJA 5A93A 3Q07A 2I72A 3UDFA 4R4SA 5GLBA 1IYQA 1HD8A 3PAGA 4R23A 5E2GA 4B4XA 2H0YA 3N7WA 2HDQA 1Q2QA 4P0MA 4E3LA 1PIOA 4S2OA 5IHVA 3SH9A 2EXBA 1DJBA 1JWPA 4H8RA 4OPQA 5CXWA 1XPBA 2B5RA 4LV1A 2WAEA 1CI8A 2XGNA 3LEZA 5DF7A 3IWQA 2WKEA 2OV5A 3FZCA 3SS5A 1JTGA 3ZG5A 4DF6A 3MXSA 3OC2A 5AQBA 4BENA 5FA7A 1CEGA 3ZCZA 1L0EA 3A3IA 3PBSA 2XFTA 1LL9A 1L2SA 5FASA 1KE3A 4OQIA 1XP4A 2Z2MB 3AGFA 3GMWA 3WRZA 4JXVA 3NI9A 4R3JA 3IWOA 4FH2A 1PW1A 1E4DA 4OQ0A 2Q9MA 1ES2A 1M6KA 4WEKA 3LY3A 4DE3A 2WUQA 5FI7A 1QMFA 2XH9A 4B88A 1BLCA 4QU3A 4WZ5A 5EOOA 2ZC3B 4R3BA 1XX2A 4E3MA 3E2KA 3O3VA 4LENA 4QB8A 5CRFA 3IH8A 4KZ4A 1ERMA 1IELA 2EX6A 4OOLA 3AGEA 1KGFA 4GDNA 5HX9A 4EBNA 1C3BA 2EX2A 4R1GA 4S2NC 2XD5A 4KZ7A 1ZC2A 2Y2KA 5GLCA 3S22A 5E2EA 1IYOA 2QZ6A 3I7JA 4E6XA 4K91A 3G34A 4MNRA 5AQ7A 1FCMA 3MZFA 5KMWA 4B4ZA 1I2SA 1TDLA 1H5XA 3BFDA 1M40A 4HBUA 4MBKA 3ZGAB 5DTKA 3UPOA 1K38A 3WRTA 1MWTA 3VOZA 5EVIC 3MKEA 5GLDA 1YLPA 1ZG4A 2IWDA 5FSRA 2ZQCA 4S2JA 4X6TA 4CJNA 3N8RA 4GNUA 5GL9A 4LV3A 3UDXA 4M3KA 1DY6A 1MWUA 1SCWA 3EQUA 4S2KA 4U0TA 4D2OA 2EX8A 5FQJA 1KVLA 5JYPA 2VGJA 4BL2A 1K55A 3M6HA 4OQHA 3DWKA 3RXWA 3SOIA 2ZQDA 2V2FF 1NZUA 3BECA 1IEMA 4E6WA 2Y2PA 2WKIA 2Y2QA 4DE0A 3EQVA 1NZOA 1G6AA 1MY8A 2P74A 4OH0A 4KZ6A 3WWXA 3HVFA 1KVMA 4GD6A 1SDEA 4QY5A 4ZDXA 1GHMA 1XXMA 3GV9A 3Q7ZA 1S6RA 2ZC4B 2X01A 3HLGA 4UHUA 1W5DA 5FAQA 3DWZA 4GD8A 3HL9A 4ZTKA 3MZDA 3FKVA 4KQOA 3VP0A 4C6YA 1WYBA 3HLCA 1G68A 2ZC6B 2J9PA 4JKTA 5M19A 2Y2LA 1ZKJA 3UN7A 1K56D 3OPLA 4OOYA 1FSYA 3WS0A 1K25A 2WKHA 4FSFA 3VP3A 4IEDA 5AQAA 1L0DA 1VM1A 3W4QA 1N4OA 3GQZA 3LCEA 1ONHA 3GR2A 1BLSA 3ZFZA 1L0FA 5EVLA 3IXHA 1GHPA 3O88A 4Z9QA 5KSHA 3IF6C 1ESUA 2XD1A 3V3SA 1MPLA 5M18A 3TG9A 4BD1A 1RGZA 2Y4AA 2QMIA 5E2FA 2FFYA 2Y2MA 5FAOA 4BLMA 1SKFA 3UY6A 2HDRA 3WS2A 2E8IA 4BL3A 1DJAA 1I5QA 3NDGA 1ERQA 5E2HA 3NC8A 4N9LA 3ZDJA 3MBZA 1FR6A 1JWZA 2R9XA 3ZG7B 3MFDA 3ZVTA 2WZZA 2ZM2A 3ZG9B 2WGIA 2ZQAA 4DE2A 4JF6A 2Y59A 4BQMA 3ZG0A 2X02A 3NY4A 1BSGA 1NYMA 3AGDA 4X68A 3P09A 2Y2JA 3E2LA 4C3QA 4S2MA 4A5RA 1K54A 2C5WB 3QNBA 3BFFA 1LI9A 2ZQ8A 1O07A 1CI9A 1W79A 4IVKA 2XF3A 1E25A 2EXAA 2ZC7A 2Y2NA 3RJUA 3OCNA 1ES3A 3M2JA 4QY6A 1HVBA 1KE0A 1MKIA 2DRWA 5DF8A 3PAEA 3W4PA 2ZQ9A 5J8XA 3LY4A 2IWBA 3HLFA 3UE1A 4R4RA 1YMXA 3CJMA 4K0WA 3WS4A 1BTLA 1LL5A 5CERA 3W8KA 1MXOA 3HUMA 5F1GA 2PU2A 5EUAA 4QD4A 1BULA 2GDNA 3C7VA 1KE4A 2UWXA 3C4OA 4N92A 2EFXA 1FCOA 2ZD8A 1GCEA 3BFEA 3HLBA 4PMAA 4UA9A 2H0TA 1Q2PA 1IYSA 5FI6A 5TR7A 4L0LA 3NBLA 3HLWA 1ESIA 3ZHHA 1CEFA 4S2IA 4ZAMA 2J7VA 1PW8A 3UNWA 4KZ8A 3GTCA 1PZPA 5EVIA 3JYIA 4EWFA 2RCXA 5FI2A 2HPBA 3A3DA 4LV2A 4YFMA 4O7DA 4OPRA 3GRJA 1TVFA 3Q82A 5DVAA 4FH4A 1TDGA 3QNCA 1K56A 3VSKA 1IKGA 5HAPA 1LI0A 1RGYA 3ITAA 4WMCA 1ALQA 4OLGA 4E3KA 1BUEA 4U0XA 2ZJ9A 1JVJA 2BLSA 2Y2OA 3ZVWA 4OP8A 4JF5A 2ZMAA 4N9KA 4YINA 3MZEA 3V39A 4JXWA 3G2YA 5GHZA 1H8ZA 1H8YA 4E3IA 3B3XA 1NYYA 3BFGA 1RCJA 3N8SA 1KDSA 4OVDA 3G31A 4WZ4A 3VP1A 3IHBA 3BLSA 2Y55A 1DJCA 5KZHA 2V20A 1XKZA 4RA7A 5D3OA 1J9MA 4E3OA 4JXGA 1YLYA 2OLUA 4DKIA 4OOMA 2QPNA 3VP2A 4X56A
chains in the Genus database with same CATH superfamily
3ISGA 2HP5A 5EPHA 1GA9A 1D06A 5CTMA 3HLEA 2JHEA 3ITBA 3PBOA 2ZM8A 1EWZA 2RL3A 2XLNA 3TSGA 4IVIA 4HP9A 1OPXA 4Y7PA 1BT5A 2PBDP 4PM5A 2VK3A 4PM9A 1RP5A 5HWVA 2J3TD 3PR6A 4NXFA 3CMZA 1HTZA 2HP9A 4K0XA 2WGWB 2WAFA 3N4IA 3JVUA 1PI5A 1ZTUA 3CI6A 2LB5A 4LCMA 1EROA 1IYPA 1HZOA 3Q1FA 5FAPA 3A3JA 3V3RA 1GHIA 1CK3A 1NJ4A 5U47A 1W8QA 1JTDA 2Q9NA 5CHMA 3LR3A 1DP6A 4E3JA 2Y2HA 2DCFA 3LI8A 1FSWA 1QMEA 5KSCA 4S2NA 1YT4A 4IBXA 4X25A 3HJIA 2WGVA 2PRFA 2W3FA 3LEQA 1K54C 1OTIA 4ARZB 3G2ZA 4MMNA 3OPRA 4EQIA 1K4FA 5FL3A 2VGKA 1FILA 4OQGA 1FCNA 5HL1A 2QKPA 3UE0A 3V50A 4KG6A 3GECA 1G5UA 4JGRA 4WUJA 1S0WA 5EVEA 3T4JA 3NOTC 4ME4A 2WKPA 3IXGA 2HV1A 1ES5A 1P9WA 2WZXA 4RQ9A 2H28A 1WE4A 2R9WA 2PR5A 3E0YA 3OCLA 1YM1A 2PU4A 1AXBA 1YLZA 2WADA 4I38A 2EWVA 4MBHA 4KZAA 4P87A 3PBTA 2V1BA 1ACFA 3G30A 2P9VB 4KZ3A 1N9NA 3F1PA 3S1YA 3IBJA 1S4SA 1XFQA 4LPZA 2P04A 2Y91A 4B93A 1JNUA 2L1MA 1D1JA 4EUZA 5FQQA 3IWIA 3O87A 3C7UA 1P0ZA 5K5BA 1XFNA 4EBPA 1NLZA 2BTFP 4GCZA 3BEBA 4HEFA 4QWOA 1YLTA 5HDCA 5I5LA 4YWZA 2OLVA 1UWNX 4OONA 4ZJ2A 1PYYA 1YSQA 5EV0A 3HUOA 3IT9A 5A93A 5CHJA 1T18A 4H6JA 3UDFA 5GLBA 1IYQA 5E2GA 2HDQA 5IHVA 1N9LA 2EXBA 1JWPA 4H8RA 4OPQA 5DF7A 2OV5A 2XGNA 1MC0A 2EA9A 3MXSA 3OC2A 5FA7A 1CEGA 2KOIA 2A24A 3PBSA 3VE4A 3TJZC 1XP4A 3AGFA 4JXVA 2XSSA 4FH2A 2Q9MA 4WEKA 2XRNA 2XH9A 4B88A 4WZ5A 1EW0A 2ZC3B 4YOFA 1XX2A 3E2KA 3P01A 5CRFA 3IH8A 1IELA 4WF0A 4OOLA 3QP4A 4I5SA 5HX9A 3BQ8A 3S22A 1IYOA 2BASA 4K91A 3CLOA 4NG2A 5HWTA 1M40A 5DTKA 2A2LA 1PFLA 4Y17A 2VJWA 2ZQCA 4CJNA 3MJQA 4EETB 4LV3A 5LBRA 3UDXA 1MWUA 3EQUA 2VGJA 3M6HA 3SOIA 3RXWA 3DWKA 2ZQDA 3F1PB 2I9VA 2Y2PA 4DE0A 2OAP1 3EQVA 3LR5A 1NZOA 3D72A 3DBAA 4OH0A 3FPVA 3OOVA 3IS2B 4KZ6A 5J7EA 1SDEA 4QY5A 4ZDXA 1TS6A 1OT9A 1XXMA 3UB8A 3GV9A 3QP2A 2W3DA 3HL9A 3VP0A 5M19A 2Y2LA 1FSYA 5AQAA 2KDKA 4MN5A 3W4QA 3RFBA 3LCEA 1ONHA 1L0FA 1SKOA 3O5YA 1ESUA 2ZMFA 1MPLA 2ACGA 3TG9A 4BD1A 2QMIA 2W27A 5DFXA 2J3WA 4Y3IA 2JKTM 4BL3A 2QJ5A 1DJAA 2ZOIA 1ERQA 3NC8A 3F1NA 4WLAA 3MBZA 1FR6A 4H6JB 3ZG9B 2YKFA 4JF6A 2Y59A 3K3CA 1BSGA 4X68A 3P09A 4QPRA 3E2LA 4S2MA 1K54A 3QNBA 1LI9A 2ZQ8A 1CI9A 4II7A 4B9OA 2EXAA 2A24B 1HVBA 4DN0A 1KE0A 5DF8A 3W4PA 3LY4A 3SZTA 2PU2A 1TS8A 4QD4A 2GDNA 3C4OA 1FCOA 2ZD8A 1IYSA 4HJ4A 2B02A 1CEFA 3T4OA 2PAVP 3ZYTA 2OOLA 3UNWA 3KO6A 3JYIA 4EWFA 4LV2A 4YFMA 4OPRA 2PYRA 1TVFA 3LIEA 1RGYA 4WMCA 1BUEA 3ZVWA 2E8JA 3V39A 1H8ZA 2WKQA 3BLSA 5AVFA 2V20A 3LFVA 1L3LA 3RTYA 3VP2A 1BYWA 1XJ6A 1H8MA 1XJ3A 5CTNA 1TS0A 3T4SA 5TBMA 1Z09A 4EV4A 3UPNA 3LGOA 3Q81A 3BJNA 1ONGA 5EVID 1SHVA 5HAIA 4C75A 2P7JA 3UB5P 4DXCA 2HJ9C 4AFIA 4RX3A 5FATA 1SKOB 5F83A 2XK1A 4HOIA 4BBTA 3BY9A 4PM7A 5FQMA 5L10A 3IQAA 1K0KA 5DF9A 4PPRA 5HL6A 1IKIA 4WEJA 5FQ9A 3ZNYA 4OLDA 2WGWA 3S4XA 3UDIA 4GOGA 4MLLA 3BRMA 1LL8A 2WK0A 4EBLA 1G28A 5DJUA 3A3EA 3QP5A 5A90A 4NKPA 5FQIA 3FC7A 2VGLM 2XA7S 5TFQA 3V5MA 4BD0A 4BJPA 1PWDA 2W3GA 1FQGA 3N8LA 1GSXA 4RYEA 4HBTA 4HESA 2ZM0A 3CWFA 3BY8A 2PD7A 5I94A 2HP6A 3PBQA 1Y54A 4IJGA 4ARZA 3QHYA 2H10A 2DMWA 1S67L 1K6RA 2O0YA 5FDSA 4GZBA 4YNRA 2W1RA 1W7FA 2JBFA 2XEPA 3NIAA 4PM6A 2VLGA 4JXSA 2Z6DA 1OMEA 2XDMA 1MBLA 4KUOA 4WZ5C 4DJ3A 1FR1A 1PWCA 1LLBA 1Z6FA 2ZQ7A 2X71A 5F5YA 1KDWA 3MMHA 5F82A 3SH8A 5TBMB 4N1HA 2HZ5A 4XXRA 5HDDA 3BWLA 3IHAA 3FG8A 2P9VA 1I2WA 2ZC5B 2J9OA 3MS6A 2H5SA 4FCFA 4D60A 2FFFB 2GJ3A 1PZOA 3T12B 1E3UD 4XUXA 4JLFA 1XGIA 1TEMA 3WS5A 1XGJA 4F94A 2O9CA 4OP5A 3C30A 4O01A 5IT5A 1KGEA 2FZ0A 1ZG6A 5CGSA 3ZG8B 2HDSA 5HFOA 4GS9A 2G7UA 5HAQA 3PHYA 4OKPA 4WM9A 3VOYA 1V9YA 4ESPA 1U60A 1SDNA 4XUZA 2XR0A 4NEED 3RXXA 3HLDA 3VV4A 1YAXA 2I72A 2PD8A 4E3LA 4S2OA 5CXWA 4EEPA 2WAEA 2K31A 1JTGA 4BENA 3HJKA 3ZCZA 2XFTA 1L2SA 4BBUA 1KE3A 3WRZA 5G4YA 3K2NA 1E4DA 3G6OA 2WUQA 1CF0A 4E04A 4E3MA 4NXBA 3O3VA 4CLCB 4G3VA 4KZ4A 2EX6A 4GDNA 2EX2A 1ZC2A 5AQ7A 4MNRA 5KMWA 4Y2FA 4HBUA 1OTDA 3VOZA 5GLDA 5FEGA 5F6AA 4X6TA 4GNUA 1DY6A 5JYPA 3H7WA 4NXEA 1KVLA 3E4QA 4BL2A 3NECA 4I3AA 2WKRA 1OTAA 3TW8A 1XJ4A 3P7NA 1G6AA 2P74A 3DTIA 3HVFA 1GHMA 3IS2A 4HP4A 3MQOA 3PYPA 2NUTC 3HLGA 1W5DA 5FAQA 4EXOA 4F3LB 5HPIA 4JGPA 1DP8A 4ZTKA 2ZC6B 2J9PA 4G3WA 1ZKJA 4OOYA 3OPLA 3WS0A 1K25A 4FSFA 4IEDA 1L0DA 1YSPA 1PRQA 2P08A 2INWA 3PXPA 1BLSA 1S4RA 3CITA 3LR4A 4GS9B 1GHPA 1F2KA 3O88A 5HWWA 4Z9QA 2XD1A 3V3SA 3K3DA 1RGZA 2Y4AA 5HD3A 1SKFA 2HDRA 1HLUP 2VGLS 4DMZA 5E2HA 4X1LA 3ZDJA 3T4TA 4O0PA 3B42A 3VE3A 2WGIA 4HQAA 4MN6A 2Y2JA 4A5RA 3UE6A 1O07A 1W79A 2XF3A 2ZC7A 3M2JA 3NULA 2PDRA 4QY6A 1MKIA 5J8XA 4GLQA 4K0WA 2XA7M 5CERA 1MXOA 1BULA 2UWXA 4N92A 2EFXA 4PMAA 1GCEA 1Q2PA 3LICA 5FI6A 5TR7A 4L0LA 3HLWA 4S2IA 2J7VA 3GTCA 1SZVA 4P6ZM 4O7DA 5DVAA 4I39A 4FH4A 1K56A 5HAPA 1IKGA 3A0SA 3ITAA 1ALQA 3JPUA 2D01A 4JF5A 3H7WB 2PR6A 4FUWA 1H8YA 1NYYA 3BFGA 1RCJA 3N8SA 1KDSA 3VP1A 4CLCC 4JGOA 2Y55A 1XKZA 4RA7A 4E3OA 4JXGA 1VEUA 2OWHA 4OOMA 1S66L 4X56A 3NJAA 4Z1WA 1LHYA 3C5AA 4HH2A 4LV0A 5HW3A 2ZOHA 4EU0A 2HF6A 4EUVA 3Q7VB 2V8FA 1L0GA 3OZHA 3VMAA 2JKRM 3S7OA 3IX8A 3OPHA 2XQZA 2EFUA 4WBGA 2MJ6A 3A0VA 3PTEA 3GVBA 3MXQA 2FH5A 1NXYA 4BWIA 4EERA 1G6OA 4X53A 2VEAA 5CEBA 1MWSA 4JGQA 2CC1A 3IH9A 1NWZA 3DTKA 4OPYA 3ZQ5A 3KYQA 4OPZA 4E3NA 5DTTA 2ZLYA 4DE1A 3P98A 5CECA 3T50A 4KG2A 3VOLA 3CPTA 5G18A 3U2AA 3E4PA 1A0KA 5A92A 3S7PA 3IXBA 2A49A 2JE5A 4UQIM 4S2PA 1T1CA 3SS3A 4KZ5A 1Y4OA 3T1RA 4Y0UA 4G3KA 3SS4A 1YQSA 2QYBA 5DKKA 3LYXA 4KQQA 3IBRA 4KQDA 4RVAA 1NRJA 2XROA 3WS1A 5TGFA 5CX7A 3MKFA 2LB9A 4LCLA 3MXRA 4DRTA 4JBFA 4GHIA 5M1AA 1NLYA 4P6BA 3C8CA 5EECA 2ZL1A 1OTEA 2L0WA 3HCYA 5J3WA 2D02A 5DFYA 3VSLA 5L09A 3C38A 2EX9A 5CGWA 3BFCA 1O7EA 4U3TA 2V8CA 4DJ2A 4QJGA 1EI5A 2J80A 4EQ1A 2QJ7A 3E4OA 5A91A 3L7HA 4KQRA 1LSWA 4PAUA 1JWVA 3CZDA 1XA7A 4MCWA 2G2WA 5CGXA 3BM6A 1NRFA 2OAQ1 5AJGA 5E43A 1W8YA 1VEUB 2JKTI 4KZBA 4Q0IA 2HJEA 3W2ZA 4X69A 4R0QA 3FKWA 2WYXA 5MC7A 2O99A 3F1OA 5J4EA 3B33A 2VA0A 4IBRA 3LI9A 1N9OA 3LO7A 3FWLA 5EE8A 4FD8A 4Q8IA 4FOFA 4N1XA 2B95A 4M4XA 1W63M 1T19A 1VETA 4HHDA 2V0UA 1YMSA 1D7EA 4DDSA 4S2LA 4Y15A 2EWWA 2Y2GA 4DXBA 2IA2A 5HDSA 1K57A 4CPKA 4ZJ1A 4KZ9A 3CPTB 3LIBA 5F69A 4I3JA 3D4FA 3CHWP 2BG1A 3HREA 4WYYA 4X55A 2VX8A 3VFFA 3GDIA 1MWRA 4R4SA 1HD8A 3D3OA 3N7WA 3MQQA 1Q2QA 2O9BA 2CMNA 1DJBA 2B5RA 4LV1A 3UN7A 1CI8A 4DDYA 3SS5A 4GHIB 1F98A 3ZG5A 1MKMA 4DF6A 5AQBA 4ETXA 1L0EA 1OT6A 2GNXA 2ZL1B 1LL9A 2Z2MB 2PT7A 3GMWA 4P6ZS 3NI9A 4R3JA 3IWOA 1V9ZA 1M6KA 4LLOB 3U4LP 1QMFA 1LSXA 4QU3A 5EOOA 1UGUA 3MSHA 5F68A 2GX5A 4K08A 4LENA 4QB8A 4CLCA 4X1MA 1KGFA 1KOUA 2Y2KA 5E2EA 2QZ6A 3I7JA 4E6XA 1I2SA 1TDLA 1H5XA 3KYEA 3ZGAB 3UPOA 1MWTA 2W3HA 3MKEA 3UMEA 3N8RA 3RH8B 5GL9A 2VV7A 4M3KA 3F1OB 4O8GA 3TE8A 1SCWA 2B18A 1W63Q 3LIFA 1K55A 1UWPX 5TJJA 2V2FF 3BECA 3S7QA 1KVMA 3JVVA 5EM1A 4GD6A 3DAVA 2GZAA 4R3AA 3Q7ZA 1S6RA 4I3IA 2ZC4B 2J3TC 3DWZA 3TRCA 3IX4A 1VETB 4F3LA 4KQOA 4C6YA 1WYBA 1G68A 2W0NA 1K56D 4HJ3A 1TF1A 3VP3A 3GQZA 3E98A 3T1QB 3GR2A 5DJTA 4PKYA 3R7WB 5KSHA 5M18A 5E2FA 2FFYA 2Y2MA 5FAOA 2Y8HA 4HJ6A 3UY6A 1F9IA 4UQIS 4WL9A 2E8IA 3NOUC 1I5QA 4Y13A 4N9LA 2R9XA 3ZG7B 4LFUA 5DKLA 2ZQAA 4CLCE 3ZG0A 1NYMA 3AGDA 4Q0HA 2KX6A 2Y2NA 3CUEA 3RJUA 3HLFA 5G4ZA 1YMXA 1LL5A 3HUMA 4KUKA 5EUAA 1KE4A 1FIKA 2OWJA 4EESA 3BFEA 3QP8A 5C5KA 3ZHHA 2JN7A 4ZAMA 5KIZA 4KZ8A 5EVIA 1TS7A 2RCXA 3A3DA 4IHQA 3Q82A 3T1SA 1LI0A 4OLGA 4E3KA 2Z6CA 2ZJ9A 1JVJA 2BLSA 2Y2OA 3EOIA 2ZMAA 4N9KA 4YINA 4HY8A 3D9YA 2ZBBA 3T4QA 5GHZA 4L9GA 4L9EA 3B3XA 3G31A 3IHBA 1DJCA 2V0WA 4PHTA 5AVEA 4GW9A 2OLUA 4DKIA 5CHUA 3PBRA 5AQ9A 3KSGA 2PHYA 3VFHA 2J8YA 4WELA 1KGGA 2OSUA 5GLAA 2VKSA 3IF6A 3Q7VA 4QHCA 1F5MA 1DRMA 4WMCD 1T1BA 4ID4A 1PWGA 3MFXA 4MBFA 3LUQA 4BBVA 4KENB 5HZHA 3GSGA 3L9KA 3KX0X 3S7NA 2VV8A 5EFWA 3NDEA 1MZUA 4XT2A 1DP9A 3CAXA 3C4PA 3VP4A 3UB6A 4BMWA 4NK3A 3T4KA 2PYPA 4ZJ3A 2Q0OA 1S1ZA 1PI4A 3M6BA 3QP1A 2V1ZA 2HDUA 3EGXC 3SH7A 4Y0OA 1YLJA 3FPWA 5A8BA 3CG5A 4GDBA 3KYZA 2R78A 1K57C 1ES4A 3HUNA 5BOHA 4JF4A 1Y28A 1XJ2A 2XFSA 4HI4A 2W3EA 3N6IA 4GKUA 3ZNTA 4GB7A 1BLHA 2L4RA 3H82A 4ZBEA 3ULFA 3T1XA 5DTSA 1BZAA 3M2KA 4CQHA 2QWSA 3G32A 1BLPA 4UA7A 4FTXA 4HIAA 3HBRA 3MF0A 5EVIB 2A3UA 4NETA 4GJ4A 5L2FA 2JKGA 5HARA 1P9RA 1K4EA 3DW0A 5JYOA 1K6SA 3OPPA 1FOFA 3BLMA 5CEDA 1E3UA 3FYZA 3ICYA 4UAAA 1XA1A 4EW7A 3A3FA 2W1TA 3T4LA 3W4OA 2G2UA 1VHMA 3PBNA 3UO9A 4RX2A 2JC7A 3BQAA 3MQ0A 4KG5A 3FV7A 4UA6A 2PBYA 4PM8A 4LGWA 1GA0A 3BYDA 3G4PA 4P85A 4UEYA 3NHQA 3EEHA 5FDHA 4JPMA 3IF6B 3DTMA 4Y0TA 1VQQA 3B47A 5L8MA 3O86A 2Z2LB 2UV0E 1K55C 2C6WB 2K2NA 1YKDA 4PKYG 5F1FA 4CLCD 3KSIA 2JCHA 1J3WA 3IXDA 4XT2B 2ZMVA 3UPPA 3H9WA 3UE3A 5EOEA 5IS1A 2Y79A 1YPRA 1NY0A 5GHYA 2NUPC 4MEZA 3IF5A 5IU1A 3V67A 4GN2A 1OTBA 1N9BA 3IX3A 5FQKA 5L07A 1H0MA 1PNEA 2IWCA 3G35A 4ZRRA 5GHXA 2DNSA 4LRXC 3NCKA 2HGVA 4Y5FA 5HSQA 2Y2IA 1YLWA 3TOIA 1WYCA 3OLOA 3Q07A 4R70A 3PAGA 4R23A 4B4XA 2H0YA 4P0MA 2K7SA 2YKHA 1PIOA 3SH9A 3H82B 3R4KA 1XPBA 3LEZA 3IWQA 2WKEA 3FZCA 5FEFA 1ODVA 4MDZA 3A3IA 5FASA 4OQIA 4EEUA 1PW1A 4OQ0A 3CUEC 1ES2A 3LY3A 4DE3A 5FI7A 1BLCA 4R3BA 2JKRI 1CJFA 1ERMA 3C2WA 3AGEA 4Q0JA 4EBNA 1C3BA 4S2NC 4R1GA 1GSVA 2XD5A 4KZ7A 5GLCA 3DTEA 3G34A 4R6LA 1FCMA 2W1TB 2VZWA 3MZFA 4B4ZA 4HH3A 3UB7A 3BFDA 4MBKA 2M7VA 1K38A 1H3QA 3WRTA 3EWKA 5EVIC 5HPFA 1YLPA 1ZG4A 1P97A 2IWDA 5FSRA 4S2JA 4HNBA 4S2KA 4U0TA 1IFQA 4D2OA 4MN7A 2EX8A 5FQJA 4OQHA 2KLIA 1NZUA 1IEMA 4E6WA 2WKIA 2Y2QA 1GSWA 1MY8A 3WWXA 2JKFA 1VB6A 3SW1A 3EGDC 1IOUA 2X01A 4ETZA 4UHUA 3NOPC 1STZA 4GD8A 1LSVA 3MZDA 3FKVA 3HLCA 4JKTA 3UB9A 4NXGA 2WKHA 1VM1A 1N4OA 3ZFZA 2M7UA 5EVLA 3BW6A 3IXHA 1ZHHB 3IF6C 5EM0A 3R7WA 3A0RA 4L9FA 1OJ5A 3OBFA 2O9AA 3KSHA 4BLMA 3WS2A 3F1NB 3NDGA 1JWZA 3MFDA 3ZVTA 2WZZA 2ZM2A 3EEAA 4DE2A 4BQMA 2X02A 3NY4A 1AWIA 4LRYC 4C3QA 2C5WB 3KSFA 3BFFA 4IVKA 1E25A 3OCNA 1ES3A 2DRWA 3PAEA 2ZQ9A 2IWBA 3UE1A 4R4RA 2AVXA 3CJMA 3WS4A 1BTLA 4WN5A 3W8KA 5F1GA 3MR0A 3C7VA 4UA9A 3HLBA 2H0TA 1TD5A 3NBLA 1ESIA 3UMDA 4IUHA 1WA9A 1PW8A 1PZPA 3QP6A 5FI2A 2HPBA 2V1AA 3GRJA 3LIDA 1TDGA 3LIAA 3QNCA 1OJGA 3VSKA 2VV6A 5HD5A 4R38A 4U0XA 1S1YA 4OP8A 3LR0A 3MZEA 4JXWA 1T1AA 3G2YA 1LT0A 2QHKA 2V9AA 4E3IA 1X0OA 4OVDA 4WZ4A 1CQAA 4IUKA 5KZHA 4LRZE 5D3OA 1J9MA 1YLYA 2M1CA 2QPNA
chains in the Genus database with same CATH topology
3ISGA 5CHUA 2HP5A 3PBRA 5CTNA 5EPHA 1LHYA 1GA9A 5AQ9A 3C5AA 4LV0A 5HW3A 4EV4A 3UPNA 3Q81A 5CTMA 3VFHA 2J8YA 1ONGA 3HLEA 4WELA 5EVID 1SHVA 5HAIA 4C75A 1KGGA 2OSUA 3Q7VB 5GLAA 4DXCA 3ITBA 3PBOA 1L0GA 3IF6A 2ZM8A 3OZHA 3Q7VA 4QHCA 3VMAA 3OPHA 4WMCD 1EWZA 4ID4A 1PWGA 2RL3A 4MBFA 2XLNA 4KENB 4RX3A 5FATA 2XQZA 3TSGA 2EFUA 5F83A 4WBGA 3GSGA 4IVIA 2XK1A 3PTEA 4Y7PA 3GVBA 1BT5A 1NXYA 3NDEA 4PM7A 5FQMA 4X53A 3IQAA 5DF9A 4PM5A 5CEBA 1MWSA 4PM9A 1RP5A 2CC1A 3C4PA 4PPRA 3VP4A 4NK3A 3IH9A 4ZJ3A 1PI4A 3CMZA 1HTZA 3M6BA 4OPYA 1IKIA 2HP9A 2V1ZA 2HDUA 2WGWB 4K0XA 4OPZA 4WEJA 2WAFA 5FQ9A 3ZNYA 4OLDA 5DTTA 4E3NA 3SH7A 2ZLYA 4DE1A 2WGWA 3N4IA 3S4XA 3P98A 1PI5A 4Y0OA 5CECA 1YLJA 3UDIA 4GOGA 4LCMA 1EROA 4KG2A 1IYPA 4MLLA 3BRMA 1HZOA 3Q1FA 2WK0A 5FAPA 3CG5A 4EBLA 3A3JA 5G18A 1GHIA 3V3RA 1CK3A 4GDBA 3A3EA 1NJ4A 5U47A 1W8QA 5A92A 3IXBA 5A90A 1K57C 1ES4A 2A49A 2JE5A 3HUNA 5FQIA 4S2PA 5BOHA 4JF4A 1JTDA 3SS3A 4KZ5A 2Q9NA 2XFSA 4Y0UA 5CHMA 3SS4A 1YQSA 5TFQA 3V5MA 4BD0A 4KQQA 4BJPA 1PWDA 4E3JA 2Y2HA 2DCFA 3N6IA 4GKUA 3ZNTA 1FQGA 4RVAA 1FSWA 1QMEA 4GB7A 3N8LA 4RYEA 1BLHA 4HBTA 4ZBEA 3WS1A 5KSCA 4S2NA 1YT4A 4HESA 5TGFA 5DTSA 1BZAA 3M2KA 3MKFA 4LCLA 2ZM0A 3MXRA 3G32A 4IBXA 4JBFA 4DRTA 1BLPA 5M1AA 2WGVA 5I94A 2HP6A 4UA7A 3PBQA 4P6BA 1K54C 3HBRA 5EECA 1Y54A 3G2ZA 5EVIB 3OPRA 4EQIA 2A3UA 3QHYA 4NETA 2H10A 1K4FA 3VSLA 2VGKA 5L2FA 2EX9A 5HARA 5CGWA 1K6RA 3BFCA 4OQGA 1K4EA 3DW0A 4GZBA 1FCNA 1O7EA 4U3TA 5HL1A 5JYOA 1K6SA 4QJGA 1W7FA 3UE0A 1EI5A 2JBFA 2XEPA 3OPPA 3NIAA 4PM6A 1FOFA 3BLMA 4JXSA 5A91A 3V50A 4KG6A 5CEDA 4KQRA 1OMEA 1E3UA 1S0WA 3FYZA 1JWVA 2XDMA 4UAAA 1MBLA 3CZDA 1XA1A 4WZ5C 1XA7A 3IXGA 2G2WA 5CGXA 3BM6A 1FR1A 1NRFA 1ES5A 2WZXA 3A3FA 1PWCA 1LLBA 1Z6FA 1WE4A 5E43A 3W4OA 1W8YA 2G2UA 2R9WA 4KZBA 3PBNA 3UO9A 2ZQ7A 4RX2A 2JC7A 2X71A 3OCLA 4KG5A 1YM1A 3FV7A 4UA6A 1KDWA 2PBYA 4PM8A 2PU4A 5F82A 1AXBA 4X69A 1YLZA 1GA0A 2WADA 3BYDA 4R0QA 3FKWA 3SH8A 4N1HA 2WYXA 4MBHA 4KZAA 4P87A 3G4PA 4P85A 4XXRA 3PBTA 3IHAA 3G30A 5FDHA 4JPMA 2P9VB 4IBRA 4KZ3A 3IF6B 3DTMA 2P9VA 1I2WA 2ZC5B 3S1YA 2J9OA 4Y0TA 1VQQA 3LO7A 3FWLA 5EE8A 3O86A 2Z2LB 2H5SA 1K55C 4FCFA 4FD8A 2Y91A 4Q8IA 2FFFB 4N1XA 2C6WB 1PZOA 5F1FA 1E3UD 2JCHA 4XUXA 4EUZA 3IXDA 5FQQA 3UPPA 3IWIA 3O87A 1XGIA 1TEMA 3C7UA 4JLFA 3UE3A 3WS5A 1XGJA 5EOEA 4F94A 4OP5A 1NY0A 5GHYA 1YMSA 1KGEA 4MEZA 3IF5A 4DDSA 4EBPA 1ZG6A 5CGSA 4S2LA 3ZG8B 2HDSA 4GN2A 1N9BA 5HFOA 5FQKA 2Y2GA 4DXBA 3BEBA 4HEFA 4CPKA 1K57A 4ZJ1A 2IWCA 3G35A 4KZ9A 5HAQA 5GHXA 1YLTA 2DNSA 4OKPA 4WM9A 3NCKA 2OLVA 3D4FA 2BG1A 3VOYA 3HREA 4WYYA 4X55A 4OONA 4ZJ2A 1PYYA 1U60A 3VFFA 1SDNA 2Y2IA 4XUZA 4DDYA 1YLWA 2XR0A 3RXXA 3HLDA 3TOIA 1MWRA 1WYCA 3HUOA 3IT9A 5CHJA 5A93A 3Q07A 2I72A 3UDFA 4R4SA 5GLBA 1IYQA 1HD8A 3PAGA 4R23A 5E2GA 4B4XA 2H0YA 3N7WA 2HDQA 1Q2QA 4P0MA 4E3LA 1PIOA 4S2OA 5IHVA 3SH9A 2EXBA 1DJBA 1JWPA 4H8RA 4OPQA 5CXWA 1XPBA 2B5RA 4LV1A 2WAEA 1CI8A 2XGNA 3LEZA 5DF7A 3IWQA 2WKEA 2OV5A 3FZCA 3SS5A 1JTGA 3ZG5A 4DF6A 3MXSA 3OC2A 5AQBA 4BENA 5FA7A 1CEGA 3ZCZA 1L0EA 3A3IA 3PBSA 2XFTA 1LL9A 1L2SA 5FASA 1KE3A 4OQIA 1XP4A 2Z2MB 3AGFA 3GMWA 3WRZA 4JXVA 3NI9A 4R3JA 3IWOA 4FH2A 1PW1A 1E4DA 4OQ0A 2Q9MA 1ES2A 1M6KA 4WEKA 3LY3A 4DE3A 2WUQA 5FI7A 1QMFA 2XH9A 4B88A 1BLCA 4QU3A 4WZ5A 5EOOA 2ZC3B 4R3BA 1XX2A 4E3MA 3E2KA 3O3VA 4LENA 4QB8A 5CRFA 3IH8A 4KZ4A 1ERMA 1IELA 2EX6A 4OOLA 3AGEA 1KGFA 4GDNA 5HX9A 4EBNA 1C3BA 2EX2A 4R1GA 4S2NC 2XD5A 4KZ7A 1ZC2A 2Y2KA 5GLCA 3S22A 5E2EA 1IYOA 2QZ6A 3I7JA 4E6XA 4K91A 3G34A 4MNRA 5AQ7A 1FCMA 3MZFA 5KMWA 4B4ZA 1I2SA 1TDLA 1H5XA 3BFDA 1M40A 4HBUA 4MBKA 3ZGAB 5DTKA 3UPOA 1K38A 3WRTA 1MWTA 3VOZA 5EVIC 3MKEA 5GLDA 1YLPA 1ZG4A 2IWDA 5FSRA 2ZQCA 4S2JA 4X6TA 4CJNA 3N8RA 4GNUA 5GL9A 4LV3A 3UDXA 4M3KA 1DY6A 1MWUA 1SCWA 3EQUA 4S2KA 4U0TA 4D2OA 2EX8A 5FQJA 1KVLA 5JYPA 2VGJA 4BL2A 1K55A 3M6HA 4OQHA 3DWKA 3RXWA 3SOIA 2ZQDA 2V2FF 1NZUA 3BECA 1IEMA 4E6WA 2Y2PA 2WKIA 2Y2QA 4DE0A 3EQVA 1NZOA 1G6AA 1MY8A 2P74A 4OH0A 4KZ6A 3WWXA 3HVFA 1KVMA 4GD6A 1SDEA 4QY5A 4ZDXA 1GHMA 1XXMA 3GV9A 3Q7ZA 1S6RA 2ZC4B 2X01A 3HLGA 4UHUA 1W5DA 5FAQA 3DWZA 4GD8A 3HL9A 4ZTKA 3MZDA 3FKVA 4KQOA 3VP0A 4C6YA 1WYBA 3HLCA 1G68A 2ZC6B 2J9PA 4JKTA 5M19A 2Y2LA 1ZKJA 3UN7A 1K56D 3OPLA 4OOYA 1FSYA 3WS0A 1K25A 2WKHA 4FSFA 3VP3A 4IEDA 5AQAA 1L0DA 1VM1A 3W4QA 1N4OA 3GQZA 3LCEA 1ONHA 3GR2A 1BLSA 3ZFZA 1L0FA 5EVLA 3IXHA 1GHPA 3O88A 4Z9QA 5KSHA 3IF6C 1ESUA 2XD1A 3V3SA 1MPLA 5M18A 3TG9A 4BD1A 1RGZA 2Y4AA 2QMIA 5E2FA 2FFYA 2Y2MA 5FAOA 4BLMA 1SKFA 3UY6A 2HDRA 3WS2A 2E8IA 4BL3A 1DJAA 1I5QA 3NDGA 1ERQA 5E2HA 3NC8A 4N9LA 3ZDJA 3MBZA 1FR6A 1JWZA 2R9XA 3ZG7B 3MFDA 3ZVTA 2WZZA 2ZM2A 3ZG9B 2WGIA 2ZQAA 4DE2A 4JF6A 2Y59A 4BQMA 3ZG0A 2X02A 3NY4A 1BSGA 1NYMA 3AGDA 4X68A 3P09A 2Y2JA 3E2LA 4C3QA 4S2MA 4A5RA 1K54A 2C5WB 3QNBA 3BFFA 1LI9A 2ZQ8A 1O07A 1CI9A 1W79A 4IVKA 2XF3A 1E25A 2EXAA 2ZC7A 2Y2NA 3RJUA 3OCNA 1ES3A 3M2JA 4QY6A 1HVBA 1KE0A 1MKIA 2DRWA 5DF8A 3PAEA 3W4PA 2ZQ9A 5J8XA 3LY4A 2IWBA 3HLFA 3UE1A 4R4RA 1YMXA 3CJMA 4K0WA 3WS4A 1BTLA 1LL5A 5CERA 3W8KA 1MXOA 3HUMA 5F1GA 2PU2A 5EUAA 4QD4A 1BULA 2GDNA 3C7VA 1KE4A 2UWXA 3C4OA 4N92A 2EFXA 1FCOA 2ZD8A 1GCEA 3BFEA 3HLBA 4PMAA 4UA9A 2H0TA 1Q2PA 1IYSA 5FI6A 5TR7A 4L0LA 3NBLA 3HLWA 1ESIA 3ZHHA 1CEFA 4S2IA 4ZAMA 2J7VA 1PW8A 3UNWA 4KZ8A 3GTCA 1PZPA 5EVIA 3JYIA 4EWFA 2RCXA 5FI2A 2HPBA 3A3DA 4LV2A 4YFMA 4O7DA 4OPRA 3GRJA 1TVFA 3Q82A 5DVAA 4FH4A 1TDGA 3QNCA 1K56A 3VSKA 1IKGA 5HAPA 1LI0A 1RGYA 3ITAA 4WMCA 1ALQA 4OLGA 4E3KA 1BUEA 4U0XA 2ZJ9A 1JVJA 2BLSA 2Y2OA 3ZVWA 4OP8A 4JF5A 2ZMAA 4N9KA 4YINA 3MZEA 3V39A 4JXWA 3G2YA 5GHZA 1H8ZA 1H8YA 4E3IA 3B3XA 1NYYA 3BFGA 1RCJA 3N8SA 1KDSA 4OVDA 3G31A 4WZ4A 3VP1A 3IHBA 3BLSA 2Y55A 1DJCA 5KZHA 2V20A 1XKZA 4RA7A 5D3OA 1J9MA 4E3OA 4JXGA 1YLYA 2OLUA 4DKIA 4OOMA 2QPNA 3VP2A 4X56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ISG A;  5CHU A;  2HP5 A;  3PBR A;  5CTN A;  5EPH A;  1LHY A;  1GA9 A;  5AQ9 A;  3C5A A;  4LV0 A;  5HW3 A;  4EV4 A;  3UPN A;  3Q81 A;  5CTM A;  3VFH A;  2J8Y A;  1ONG A;  3HLE A;  4WEL A;  5EVI D;  1SHV A;  5HAI A;  4C75 A;  1KGG A;  2OSU A;  3Q7V B;  5GLA A;  4DXC A;  3ITB A;  3PBO A;  1L0G A;  3IF6 A;  2ZM8 A;  3OZH A;  3Q7V A;  4QHC A;  3VMA A;  3OPH A;  4WMC D;  1EWZ A;  4ID4 A;  1PWG A;  2RL3 A;  4MBF A;  2XLN A;  4KEN B;  4RX3 A;  5FAT A;  2XQZ A;  3TSG A;  2EFU A;  5F83 A;  4WBG A;  3GSG A;  4IVI A;  2XK1 A;  3PTE A;  4Y7P A;  3GVB A;  1BT5 A;  1NXY A;  3NDE A;  4PM7 A;  5FQM A;  4X53 A;  3IQA A;  5DF9 A;  4PM5 A;  5CEB A;  1MWS A;  4PM9 A;  1RP5 A;  2CC1 A;  3C4P A;  4PPR A;  3VP4 A;  4NK3 A;  3IH9 A;  4ZJ3 A;  1PI4 A;  3CMZ A;  1HTZ A;  3M6B A;  4OPY A;  1IKI A;  2HP9 A;  2V1Z A;  2HDU A;  2WGW B;  4K0X A;  4OPZ A;  4WEJ A;  2WAF A;  5FQ9 A;  3ZNY A;  4OLD A;  5DTT A;  4E3N A;  3SH7 A;  2ZLY A;  4DE1 A;  2WGW A;  3N4I A;  3S4X A;  3P98 A;  1PI5 A;  4Y0O A;  5CEC A;  1YLJ A;  3UDI A;  4GOG A;  4LCM A;  1ERO A;  4KG2 A;  1IYP A;  4MLL A;  3BRM A;  1HZO A;  3Q1F A;  2WK0 A;  5FAP A;  3CG5 A;  4EBL A;  3A3J A;  5G18 A;  1GHI A;  3V3R A;  1CK3 A;  4GDB A;  3A3E A;  1NJ4 A;  5U47 A;  1W8Q A;  5A92 A;  3IXB A;  5A90 A;  1K57 C;  1ES4 A;  2A49 A;  2JE5 A;  3HUN A;  5FQI A;  4S2P A;  5BOH A;  4JF4 A;  1JTD A;  3SS3 A;  4KZ5 A;  2Q9N A;  2XFS A;  4Y0U A;  5CHM A;  3SS4 A;  1YQS A;  5TFQ A;  3V5M A;  4BD0 A;  4KQQ A;  4BJP A;  1PWD A;  4E3J A;  2Y2H A;  2DCF A;  3N6I A;  4GKU A;  3ZNT A;  1FQG A;  4RVA A;  1FSW A;  1QME A;  4GB7 A;  3N8L A;  4RYE A;  1BLH A;  4HBT A;  4ZBE A;  3WS1 A;  5KSC A;  4S2N A;  1YT4 A;  4HES A;  5TGF A;  5DTS A;  1BZA A;  3M2K A;  3MKF A;  4LCL A;  2ZM0 A;  3MXR A;  3G32 A;  4IBX A;  4JBF A;  4DRT A;  1BLP A;  5M1A A;  2WGV A;  5I94 A;  2HP6 A;  4UA7 A;  3PBQ A;  4P6B A;  1K54 C;  3HBR A;  5EEC A;  1Y54 A;  3G2Z A;  5EVI B;  3OPR A;  4EQI A;  2A3U A;  3QHY A;  4NET A;  2H10 A;  1K4F A;  3VSL A;  2VGK A;  5L2F A;  2EX9 A;  5HAR A;  5CGW A;  1K6R A;  3BFC A;  4OQG A;  1K4E A;  3DW0 A;  4GZB A;  1FCN A;  1O7E A;  4U3T A;  5HL1 A;  5JYO A;  1K6S A;  4QJG A;  1W7F A;  3UE0 A;  1EI5 A;  2JBF A;  2XEP A;  3OPP A;  3NIA A;  4PM6 A;  1FOF A;  3BLM A;  4JXS A;  5A91 A;  3V50 A;  4KG6 A;  5CED A;  4KQR A;  1OME A;  1E3U A;  1S0W A;  3FYZ A;  1JWV A;  2XDM A;  4UAA A;  1MBL A;  3CZD A;  1XA1 A;  4WZ5 C;  1XA7 A;  3IXG A;  2G2W A;  5CGX A;  3BM6 A;  1FR1 A;  1NRF A;  1ES5 A;  2WZX A;  3A3F A;  1PWC A;  1LLB A;  1Z6F A;  1WE4 A;  5E43 A;  3W4O A;  1W8Y A;  2G2U A;  2R9W A;  4KZB A;  3PBN A;  3UO9 A;  2ZQ7 A;  4RX2 A;  2JC7 A;  2X71 A;  3OCL A;  4KG5 A;  1YM1 A;  3FV7 A;  4UA6 A;  1KDW A;  2PBY A;  4PM8 A;  2PU4 A;  5F82 A;  1AXB A;  4X69 A;  1YLZ A;  1GA0 A;  2WAD A;  3BYD A;  4R0Q A;  3FKW A;  3SH8 A;  4N1H A;  2WYX A;  4MBH A;  4KZA A;  4P87 A;  3G4P A;  4P85 A;  4XXR A;  3PBT A;  3IHA A;  3G30 A;  5FDH A;  4JPM A;  2P9V B;  4IBR A;  4KZ3 A;  3IF6 B;  3DTM A;  2P9V A;  1I2W A;  2ZC5 B;  3S1Y A;  2J9O A;  4Y0T A;  1VQQ A;  3LO7 A;  3FWL A;  5EE8 A;  3O86 A;  2Z2L B;  2H5S A;  1K55 C;  4FCF A;  4FD8 A;  2Y91 A;  4Q8I A;  2FFF B;  4N1X A;  2C6W B;  1PZO A;  5F1F A;  1E3U D;  2JCH A;  4XUX A;  4EUZ A;  3IXD A;  5FQQ A;  3UPP A;  3IWI A;  3O87 A;  1XGI A;  1TEM A;  3C7U A;  4JLF A;  3UE3 A;  3WS5 A;  1XGJ A;  5EOE A;  4F94 A;  4OP5 A;  1NY0 A;  5GHY A;  1YMS A;  1KGE A;  4MEZ A;  3IF5 A;  4DDS A;  4EBP A;  1ZG6 A;  5CGS A;  4S2L A;  3ZG8 B;  2HDS A;  4GN2 A;  1N9B A;  5HFO A;  5FQK A;  2Y2G A;  4DXB A;  3BEB A;  4HEF A;  4CPK A;  1K57 A;  4ZJ1 A;  2IWC A;  3G35 A;  4KZ9 A;  5HAQ A;  5GHX A;  1YLT A;  2DNS A;  4OKP A;  4WM9 A;  3NCK A;  2OLV A;  3D4F A;  2BG1 A;  3VOY A;  3HRE A;  4WYY A;  4X55 A;  4OON A;  4ZJ2 A;  1PYY A;  1U60 A;  3VFF A;  1SDN A;  2Y2I A;  4XUZ A;  4DDY A;  1YLW A;  2XR0 A;  3RXX A;  3HLD A;  3TOI A;  1MWR A;  1WYC A;  3HUO A;  3IT9 A;  5CHJ A;  5A93 A;  3Q07 A;  2I72 A;  3UDF A;  4R4S A;  5GLB A;  1IYQ A;  1HD8 A;  3PAG A;  4R23 A;  5E2G A;  4B4X A;  2H0Y A;  3N7W A;  2HDQ A;  1Q2Q A;  4P0M A;  4E3L A;  1PIO A;  4S2O A;  5IHV A;  3SH9 A;  2EXB A;  1DJB A;  1JWP A;  4H8R A;  4OPQ A;  5CXW A;  1XPB A;  2B5R A;  4LV1 A;  2WAE A;  1CI8 A;  2XGN A;  3LEZ A;  5DF7 A;  3IWQ A;  2WKE A;  2OV5 A;  3FZC A;  3SS5 A;  1JTG A;  3ZG5 A;  4DF6 A;  3MXS A;  3OC2 A;  5AQB A;  4BEN A;  5FA7 A;  1CEG A;  3ZCZ A;  1L0E A;  3A3I A;  3PBS A;  2XFT A;  1LL9 A;  1L2S A;  5FAS A;  1KE3 A;  4OQI A;  1XP4 A;  2Z2M B;  3AGF A;  3GMW A;  3WRZ A;  4JXV A;  3NI9 A;  4R3J A;  3IWO A;  4FH2 A;  1PW1 A;  1E4D A;  4OQ0 A;  2Q9M A;  1ES2 A;  1M6K A;  4WEK A;  3LY3 A;  4DE3 A;  2WUQ A;  5FI7 A;  1QMF A;  2XH9 A;  4B88 A;  1BLC A;  4QU3 A;  4WZ5 A;  5EOO A;  2ZC3 B;  4R3B A;  1XX2 A;  4E3M A;  3E2K A;  3O3V A;  4LEN A;  4QB8 A;  5CRF A;  3IH8 A;  4KZ4 A;  1ERM A;  1IEL A;  2EX6 A;  4OOL A;  3AGE A;  1KGF A;  4GDN A;  5HX9 A;  4EBN A;  1C3B A;  2EX2 A;  4R1G A;  4S2N C;  2XD5 A;  4KZ7 A;  1ZC2 A;  2Y2K A;  5GLC A;  3S22 A;  5E2E A;  1IYO A;  2QZ6 A;  3I7J A;  4E6X A;  4K91 A;  3G34 A;  4MNR A;  5AQ7 A;  1FCM A;  3MZF A;  5KMW A;  4B4Z A;  1I2S A;  1TDL A;  1H5X A;  3BFD A;  1M40 A;  4HBU A;  4MBK A;  3ZGA B;  5DTK A;  3UPO A;  1K38 A;  3WRT A;  1MWT A;  3VOZ A;  5EVI C;  3MKE A;  5GLD A;  1YLP A;  1ZG4 A;  2IWD A;  5FSR A;  2ZQC A;  4S2J A;  4X6T A;  4CJN A;  3N8R A;  4GNU A;  5GL9 A;  4LV3 A;  3UDX A;  4M3K A;  1DY6 A;  1MWU A;  1SCW A;  3EQU A;  4S2K A;  4U0T A;  4D2O A;  2EX8 A;  5FQJ A;  1KVL A;  5JYP A;  2VGJ A;  4BL2 A;  1K55 A;  3M6H A;  4OQH A;  3DWK A;  3RXW A;  3SOI A;  2ZQD A;  2V2F F;  1NZU A;  3BEC A;  1IEM A;  4E6W A;  2Y2P A;  2WKI A;  2Y2Q A;  4DE0 A;  3EQV A;  1NZO A;  1G6A A;  1MY8 A;  2P74 A;  4OH0 A;  4KZ6 A;  3WWX A;  3HVF A;  1KVM A;  4GD6 A;  1SDE A;  4QY5 A;  4ZDX A;  1GHM A;  1XXM A;  3GV9 A;  3Q7Z A;  1S6R A;  2ZC4 B;  2X01 A;  3HLG A;  4UHU A;  1W5D A;  5FAQ A;  3DWZ A;  4GD8 A;  3HL9 A;  4ZTK A;  3MZD A;  3FKV A;  4KQO A;  3VP0 A;  4C6Y A;  1WYB A;  3HLC A;  1G68 A;  2ZC6 B;  2J9P A;  4JKT A;  5M19 A;  2Y2L A;  1ZKJ A;  3UN7 A;  1K56 D;  3OPL A;  4OOY A;  1FSY A;  3WS0 A;  1K25 A;  2WKH A;  4FSF A;  3VP3 A;  4IED A;  5AQA A;  1L0D A;  1VM1 A;  3W4Q A;  1N4O A;  3GQZ A;  3LCE A;  1ONH A;  3GR2 A;  1BLS A;  3ZFZ A;  1L0F A;  5EVL A;  3IXH A;  1GHP A;  3O88 A;  4Z9Q A;  5KSH A;  3IF6 C;  1ESU A;  2XD1 A;  3V3S A;  1MPL A;  5M18 A;  3TG9 A;  4BD1 A;  1RGZ A;  2Y4A A;  2QMI A;  5E2F A;  2FFY A;  2Y2M A;  5FAO A;  4BLM A;  1SKF A;  3UY6 A;  2HDR A;  3WS2 A;  2E8I A;  4BL3 A;  1DJA A;  1I5Q A;  3NDG A;  1ERQ A;  5E2H A;  3NC8 A;  4N9L A;  3ZDJ A;  3MBZ A;  1FR6 A;  1JWZ A;  2R9X A;  3ZG7 B;  3MFD A;  3ZVT A;  2WZZ A;  2ZM2 A;  3ZG9 B;  2WGI A;  2ZQA A;  4DE2 A;  4JF6 A;  2Y59 A;  4BQM A;  3ZG0 A;  2X02 A;  3NY4 A;  1BSG A;  1NYM A;  3AGD A;  4X68 A;  3P09 A;  2Y2J A;  3E2L A;  4C3Q A;  4S2M A;  4A5R A;  1K54 A;  2C5W B;  3QNB A;  3BFF A;  1LI9 A;  2ZQ8 A;  1O07 A;  1CI9 A;  1W79 A;  4IVK A;  2XF3 A;  1E25 A;  2EXA A;  2ZC7 A;  2Y2N A;  3RJU A;  3OCN A;  1ES3 A;  3M2J A;  4QY6 A;  1HVB A;  1KE0 A;  1MKI A;  2DRW A;  5DF8 A;  3PAE A;  3W4P A;  2ZQ9 A;  5J8X A;  3LY4 A;  2IWB A;  3HLF A;  3UE1 A;  4R4R A;  1YMX A;  3CJM A;  4K0W A;  3WS4 A;  1BTL A;  1LL5 A;  5CER A;  3W8K A;  1MXO A;  3HUM A;  5F1G A;  2PU2 A;  5EUA A;  4QD4 A;  1BUL A;  2GDN A;  3C7V A;  1KE4 A;  2UWX A;  3C4O A;  4N92 A;  2EFX A;  1FCO A;  2ZD8 A;  1GCE A;  3BFE A;  3HLB A;  4PMA A;  4UA9 A;  2H0T A;  1Q2P A;  1IYS A;  5FI6 A;  5TR7 A;  4L0L A;  3NBL A;  3HLW A;  1ESI A;  3ZHH A;  1CEF A;  4S2I A;  4ZAM A;  2J7V A;  1PW8 A;  3UNW A;  4KZ8 A;  3GTC A;  1PZP A;  5EVI A;  3JYI A;  4EWF A;  2RCX A;  5FI2 A;  2HPB A;  3A3D A;  4LV2 A;  4YFM A;  4O7D A;  4OPR A;  3GRJ A;  1TVF A;  3Q82 A;  5DVA A;  4FH4 A;  1TDG A;  3QNC A;  1K56 A;  3VSK A;  1IKG A;  5HAP A;  1LI0 A;  1RGY A;  3ITA A;  4WMC A;  1ALQ A;  4OLG A;  4E3K A;  1BUE A;  4U0X A;  2ZJ9 A;  1JVJ A;  2BLS A;  2Y2O A;  3ZVW A;  4OP8 A;  4JF5 A;  2ZMA A;  4N9K A;  4YIN A;  3MZE A;  3V39 A;  4JXW A;  3G2Y A;  5GHZ A;  1H8Z A;  1H8Y A;  4E3I A;  3B3X A;  1NYY A;  3BFG A;  1RCJ A;  3N8S A;  1KDS A;  4OVD A;  3G31 A;  4WZ4 A;  3VP1 A;  3IHB A;  3BLS A;  2Y55 A;  1DJC A;  5KZH A;  2V20 A;  1XKZ A;  4RA7 A;  5D3O A;  1J9M A;  4E3O A;  4JXG A;  1YLY A;  2OLU A;  4DKI A;  4OOM A;  2QPN A;  3VP2 A;  4X56 A; 
#chains in the Genus database with same CATH topology
 3ISG A;  2HP5 A;  5EPH A;  1GA9 A;  1D06 A;  5CTM A;  3HLE A;  2JHE A;  3ITB A;  3PBO A;  2ZM8 A;  1EWZ A;  2RL3 A;  2XLN A;  3TSG A;  4IVI A;  4HP9 A;  1OPX A;  4Y7P A;  1BT5 A;  2PBD P;  4PM5 A;  2VK3 A;  4PM9 A;  1RP5 A;  5HWV A;  2J3T D;  3PR6 A;  4NXF A;  3CMZ A;  1HTZ A;  2HP9 A;  4K0X A;  2WGW B;  2WAF A;  3N4I A;  3JVU A;  1PI5 A;  1ZTU A;  3CI6 A;  2LB5 A;  4LCM A;  1ERO A;  1IYP A;  1HZO A;  3Q1F A;  5FAP A;  3A3J A;  3V3R A;  1GHI A;  1CK3 A;  1NJ4 A;  5U47 A;  1W8Q A;  1JTD A;  2Q9N A;  5CHM A;  3LR3 A;  1DP6 A;  4E3J A;  2Y2H A;  2DCF A;  3LI8 A;  1FSW A;  1QME A;  5KSC A;  4S2N A;  1YT4 A;  4IBX A;  4X25 A;  3HJI A;  2WGV A;  2PRF A;  2W3F A;  3LEQ A;  1K54 C;  1OTI A;  4ARZ B;  3G2Z A;  4MMN A;  3OPR A;  4EQI A;  1K4F A;  5FL3 A;  2VGK A;  1FIL A;  4OQG A;  1FCN A;  5HL1 A;  2QKP A;  3UE0 A;  3V50 A;  4KG6 A;  3GEC A;  1G5U A;  4JGR A;  4WUJ A;  1S0W A;  5EVE A;  3T4J A;  3NOT C;  4ME4 A;  2WKP A;  3IXG A;  2HV1 A;  1ES5 A;  1P9W A;  2WZX A;  4RQ9 A;  2H28 A;  1WE4 A;  2R9W A;  2PR5 A;  3E0Y A;  3OCL A;  1YM1 A;  2PU4 A;  1AXB A;  1YLZ A;  2WAD A;  4I38 A;  2EWV A;  4MBH A;  4KZA A;  4P87 A;  3PBT A;  2V1B A;  1ACF A;  3G30 A;  2P9V B;  4KZ3 A;  1N9N A;  3F1P A;  3S1Y A;  3IBJ A;  1S4S A;  1XFQ A;  4LPZ A;  2P04 A;  2Y91 A;  4B93 A;  1JNU A;  2L1M A;  1D1J A;  4EUZ A;  5FQQ A;  3IWI A;  3O87 A;  3C7U A;  1P0Z A;  5K5B A;  1XFN A;  4EBP A;  1NLZ A;  2BTF P;  4GCZ A;  3BEB A;  4HEF A;  4QWO A;  1YLT A;  5HDC A;  5I5L A;  4YWZ A;  2OLV A;  1UWN X;  4OON A;  4ZJ2 A;  1PYY A;  1YSQ A;  5EV0 A;  3HUO A;  3IT9 A;  5A93 A;  5CHJ A;  1T18 A;  4H6J A;  3UDF A;  5GLB A;  1IYQ A;  5E2G A;  2HDQ A;  5IHV A;  1N9L A;  2EXB A;  1JWP A;  4H8R A;  4OPQ A;  5DF7 A;  2OV5 A;  2XGN A;  1MC0 A;  2EA9 A;  3MXS A;  3OC2 A;  5FA7 A;  1CEG A;  2KOI A;  2A24 A;  3PBS A;  3VE4 A;  3TJZ C;  1XP4 A;  3AGF A;  4JXV A;  2XSS A;  4FH2 A;  2Q9M A;  4WEK A;  2XRN A;  2XH9 A;  4B88 A;  4WZ5 A;  1EW0 A;  2ZC3 B;  4YOF A;  1XX2 A;  3E2K A;  3P01 A;  5CRF A;  3IH8 A;  1IEL A;  4WF0 A;  4OOL A;  3QP4 A;  4I5S A;  5HX9 A;  3BQ8 A;  3S22 A;  1IYO A;  2BAS A;  4K91 A;  3CLO A;  4NG2 A;  5HWT A;  1M40 A;  5DTK A;  2A2L A;  1PFL A;  4Y17 A;  2VJW A;  2ZQC A;  4CJN A;  3MJQ A;  4EET B;  4LV3 A;  5LBR A;  3UDX A;  1MWU A;  3EQU A;  2VGJ A;  3M6H A;  3SOI A;  3RXW A;  3DWK A;  2ZQD A;  3F1P B;  2I9V A;  2Y2P A;  4DE0 A;  2OAP 1;  3EQV A;  3LR5 A;  1NZO A;  3D72 A;  3DBA A;  4OH0 A;  3FPV A;  3OOV A;  3IS2 B;  4KZ6 A;  5J7E A;  1SDE A;  4QY5 A;  4ZDX A;  1TS6 A;  1OT9 A;  1XXM A;  3UB8 A;  3GV9 A;  3QP2 A;  2W3D A;  3HL9 A;  3VP0 A;  5M19 A;  2Y2L A;  1FSY A;  5AQA A;  2KDK A;  4MN5 A;  3W4Q A;  3RFB A;  3LCE A;  1ONH A;  1L0F A;  1SKO A;  3O5Y A;  1ESU A;  2ZMF A;  1MPL A;  2ACG A;  3TG9 A;  4BD1 A;  2QMI A;  2W27 A;  5DFX A;  2J3W A;  4Y3I A;  2JKT M;  4BL3 A;  2QJ5 A;  1DJA A;  2ZOI A;  1ERQ A;  3NC8 A;  3F1N A;  4WLA A;  3MBZ A;  1FR6 A;  4H6J B;  3ZG9 B;  2YKF A;  4JF6 A;  2Y59 A;  3K3C A;  1BSG A;  4X68 A;  3P09 A;  4QPR A;  3E2L A;  4S2M A;  1K54 A;  3QNB A;  1LI9 A;  2ZQ8 A;  1CI9 A;  4II7 A;  4B9O A;  2EXA A;  2A24 B;  1HVB A;  4DN0 A;  1KE0 A;  5DF8 A;  3W4P A;  3LY4 A;  3SZT A;  2PU2 A;  1TS8 A;  4QD4 A;  2GDN A;  3C4O A;  1FCO A;  2ZD8 A;  1IYS A;  4HJ4 A;  2B02 A;  1CEF A;  3T4O A;  2PAV P;  3ZYT A;  2OOL A;  3UNW A;  3KO6 A;  3JYI A;  4EWF A;  4LV2 A;  4YFM A;  4OPR A;  2PYR A;  1TVF A;  3LIE A;  1RGY A;  4WMC A;  1BUE A;  3ZVW A;  2E8J A;  3V39 A;  1H8Z A;  2WKQ A;  3BLS A;  5AVF A;  2V20 A;  3LFV A;  1L3L A;  3RTY A;  3VP2 A;  1BYW A;  1XJ6 A;  1H8M A;  1XJ3 A;  5CTN A;  1TS0 A;  3T4S A;  5TBM A;  1Z09 A;  4EV4 A;  3UPN A;  3LGO A;  3Q81 A;  3BJN A;  1ONG A;  5EVI D;  1SHV A;  5HAI A;  4C75 A;  2P7J A;  3UB5 P;  4DXC A;  2HJ9 C;  4AFI A;  4RX3 A;  5FAT A;  1SKO B;  5F83 A;  2XK1 A;  4HOI A;  4BBT A;  3BY9 A;  4PM7 A;  5FQM A;  5L10 A;  3IQA A;  1K0K A;  5DF9 A;  4PPR A;  5HL6 A;  1IKI A;  4WEJ A;  5FQ9 A;  3ZNY A;  4OLD A;  2WGW A;  3S4X A;  3UDI A;  4GOG A;  4MLL A;  3BRM A;  1LL8 A;  2WK0 A;  4EBL A;  1G28 A;  5DJU A;  3A3E A;  3QP5 A;  5A90 A;  4NKP A;  5FQI A;  3FC7 A;  2VGL M;  2XA7 S;  5TFQ A;  3V5M A;  4BD0 A;  4BJP A;  1PWD A;  2W3G A;  1FQG A;  3N8L A;  1GSX A;  4RYE A;  4HBT A;  4HES A;  2ZM0 A;  3CWF A;  3BY8 A;  2PD7 A;  5I94 A;  2HP6 A;  3PBQ A;  1Y54 A;  4IJG A;  4ARZ A;  3QHY A;  2H10 A;  2DMW A;  1S67 L;  1K6R A;  2O0Y A;  5FDS A;  4GZB A;  4YNR A;  2W1R A;  1W7F A;  2JBF A;  2XEP A;  3NIA A;  4PM6 A;  2VLG A;  4JXS A;  2Z6D A;  1OME A;  2XDM A;  1MBL A;  4KUO A;  4WZ5 C;  4DJ3 A;  1FR1 A;  1PWC A;  1LLB A;  1Z6F A;  2ZQ7 A;  2X71 A;  5F5Y A;  1KDW A;  3MMH A;  5F82 A;  3SH8 A;  5TBM B;  4N1H A;  2HZ5 A;  4XXR A;  5HDD A;  3BWL A;  3IHA A;  3FG8 A;  2P9V A;  1I2W A;  2ZC5 B;  2J9O A;  3MS6 A;  2H5S A;  4FCF A;  4D60 A;  2FFF B;  2GJ3 A;  1PZO A;  3T12 B;  1E3U D;  4XUX A;  4JLF A;  1XGI A;  1TEM A;  3WS5 A;  1XGJ A;  4F94 A;  2O9C A;  4OP5 A;  3C30 A;  4O01 A;  5IT5 A;  1KGE A;  2FZ0 A;  1ZG6 A;  5CGS A;  3ZG8 B;  2HDS A;  5HFO A;  4GS9 A;  2G7U A;  5HAQ A;  3PHY A;  4OKP A;  4WM9 A;  3VOY A;  1V9Y A;  4ESP A;  1U60 A;  1SDN A;  4XUZ A;  2XR0 A;  4NEE D;  3RXX A;  3HLD A;  3VV4 A;  1YAX A;  2I72 A;  2PD8 A;  4E3L A;  4S2O A;  5CXW A;  4EEP A;  2WAE A;  2K31 A;  1JTG A;  4BEN A;  3HJK A;  3ZCZ A;  2XFT A;  1L2S A;  4BBU A;  1KE3 A;  3WRZ A;  5G4Y A;  3K2N A;  1E4D A;  3G6O A;  2WUQ A;  1CF0 A;  4E04 A;  4E3M A;  4NXB A;  3O3V A;  4CLC B;  4G3V A;  4KZ4 A;  2EX6 A;  4GDN A;  2EX2 A;  1ZC2 A;  5AQ7 A;  4MNR A;  5KMW A;  4Y2F A;  4HBU A;  1OTD A;  3VOZ A;  5GLD A;  5FEG A;  5F6A A;  4X6T A;  4GNU A;  1DY6 A;  5JYP A;  3H7W A;  4NXE A;  1KVL A;  3E4Q A;  4BL2 A;  3NEC A;  4I3A A;  2WKR A;  1OTA A;  3TW8 A;  1XJ4 A;  3P7N A;  1G6A A;  2P74 A;  3DTI A;  3HVF A;  1GHM A;  3IS2 A;  4HP4 A;  3MQO A;  3PYP A;  2NUT C;  3HLG A;  1W5D A;  5FAQ A;  4EXO A;  4F3L B;  5HPI A;  4JGP A;  1DP8 A;  4ZTK A;  2ZC6 B;  2J9P A;  4G3W A;  1ZKJ A;  4OOY A;  3OPL A;  3WS0 A;  1K25 A;  4FSF A;  4IED A;  1L0D A;  1YSP A;  1PRQ A;  2P08 A;  2INW A;  3PXP A;  1BLS A;  1S4R A;  3CIT A;  3LR4 A;  4GS9 B;  1GHP A;  1F2K A;  3O88 A;  5HWW A;  4Z9Q A;  2XD1 A;  3V3S A;  3K3D A;  1RGZ A;  2Y4A A;  5HD3 A;  1SKF A;  2HDR A;  1HLU P;  2VGL S;  4DMZ A;  5E2H A;  4X1L A;  3ZDJ A;  3T4T A;  4O0P A;  3B42 A;  3VE3 A;  2WGI A;  4HQA A;  4MN6 A;  2Y2J A;  4A5R A;  3UE6 A;  1O07 A;  1W79 A;  2XF3 A;  2ZC7 A;  3M2J A;  3NUL A;  2PDR A;  4QY6 A;  1MKI A;  5J8X A;  4GLQ A;  4K0W A;  2XA7 M;  5CER A;  1MXO A;  1BUL A;  2UWX A;  4N92 A;  2EFX A;  4PMA A;  1GCE A;  1Q2P A;  3LIC A;  5FI6 A;  5TR7 A;  4L0L A;  3HLW A;  4S2I A;  2J7V A;  3GTC A;  1SZV A;  4P6Z M;  4O7D A;  5DVA A;  4I39 A;  4FH4 A;  1K56 A;  5HAP A;  1IKG A;  3A0S A;  3ITA A;  1ALQ A;  3JPU A;  2D01 A;  4JF5 A;  3H7W B;  2PR6 A;  4FUW A;  1H8Y A;  1NYY A;  3BFG A;  1RCJ A;  3N8S A;  1KDS A;  3VP1 A;  4CLC C;  4JGO A;  2Y55 A;  1XKZ A;  4RA7 A;  4E3O A;  4JXG A;  1VEU A;  2OWH A;  4OOM A;  1S66 L;  4X56 A;  3NJA A;  4Z1W A;  1LHY A;  3C5A A;  4HH2 A;  4LV0 A;  5HW3 A;  2ZOH A;  4EU0 A;  2HF6 A;  4EUV A;  3Q7V B;  2V8F A;  1L0G A;  3OZH A;  3VMA A;  2JKR M;  3S7O A;  3IX8 A;  3OPH A;  2XQZ A;  2EFU A;  4WBG A;  2MJ6 A;  3A0V A;  3PTE A;  3GVB A;  3MXQ A;  2FH5 A;  1NXY A;  4BWI A;  4EER A;  1G6O A;  4X53 A;  2VEA A;  5CEB A;  1MWS A;  4JGQ A;  2CC1 A;  3IH9 A;  1NWZ A;  3DTK A;  4OPY A;  3ZQ5 A;  3KYQ A;  4OPZ A;  4E3N A;  5DTT A;  2ZLY A;  4DE1 A;  3P98 A;  5CEC A;  3T50 A;  4KG2 A;  3VOL A;  3CPT A;  5G18 A;  3U2A A;  3E4P A;  1A0K A;  5A92 A;  3S7P A;  3IXB A;  2A49 A;  2JE5 A;  4UQI M;  4S2P A;  1T1C A;  3SS3 A;  4KZ5 A;  1Y4O A;  3T1R A;  4Y0U A;  4G3K A;  3SS4 A;  1YQS A;  2QYB A;  5DKK A;  3LYX A;  4KQQ A;  3IBR A;  4KQD A;  4RVA A;  1NRJ A;  2XRO A;  3WS1 A;  5TGF A;  5CX7 A;  3MKF A;  2LB9 A;  4LCL A;  3MXR A;  4DRT A;  4JBF A;  4GHI A;  5M1A A;  1NLY A;  4P6B A;  3C8C A;  5EEC A;  2ZL1 A;  1OTE A;  2L0W A;  3HCY A;  5J3W A;  2D02 A;  5DFY A;  3VSL A;  5L09 A;  3C38 A;  2EX9 A;  5CGW A;  3BFC A;  1O7E A;  4U3T A;  2V8C A;  4DJ2 A;  4QJG A;  1EI5 A;  2J80 A;  4EQ1 A;  2QJ7 A;  3E4O A;  5A91 A;  3L7H A;  4KQR A;  1LSW A;  4PAU A;  1JWV A;  3CZD A;  1XA7 A;  4MCW A;  2G2W A;  5CGX A;  3BM6 A;  1NRF A;  2OAQ 1;  5AJG A;  5E43 A;  1W8Y A;  1VEU B;  2JKT I;  4KZB A;  4Q0I A;  2HJE A;  3W2Z A;  4X69 A;  4R0Q A;  3FKW A;  2WYX A;  5MC7 A;  2O99 A;  3F1O A;  5J4E A;  3B33 A;  2VA0 A;  4IBR A;  3LI9 A;  1N9O A;  3LO7 A;  3FWL A;  5EE8 A;  4FD8 A;  4Q8I A;  4FOF A;  4N1X A;  2B95 A;  4M4X A;  1W63 M;  1T19 A;  1VET A;  4HHD A;  2V0U A;  1YMS A;  1D7E A;  4DDS A;  4S2L A;  4Y15 A;  2EWW A;  2Y2G A;  4DXB A;  2IA2 A;  5HDS A;  1K57 A;  4CPK A;  4ZJ1 A;  4KZ9 A;  3CPT B;  3LIB A;  5F69 A;  4I3J A;  3D4F A;  3CHW P;  2BG1 A;  3HRE A;  4WYY A;  4X55 A;  2VX8 A;  3VFF A;  3GDI A;  1MWR A;  4R4S A;  1HD8 A;  3D3O A;  3N7W A;  3MQQ A;  1Q2Q A;  2O9B A;  2CMN A;  1DJB A;  2B5R A;  4LV1 A;  3UN7 A;  1CI8 A;  4DDY A;  3SS5 A;  4GHI B;  1F98 A;  3ZG5 A;  1MKM A;  4DF6 A;  5AQB A;  4ETX A;  1L0E A;  1OT6 A;  2GNX A;  2ZL1 B;  1LL9 A;  2Z2M B;  2PT7 A;  3GMW A;  4P6Z S;  3NI9 A;  4R3J A;  3IWO A;  1V9Z A;  1M6K A;  4LLO B;  3U4L P;  1QMF A;  1LSX A;  4QU3 A;  5EOO A;  1UGU A;  3MSH A;  5F68 A;  2GX5 A;  4K08 A;  4LEN A;  4QB8 A;  4CLC A;  4X1M A;  1KGF A;  1KOU A;  2Y2K A;  5E2E A;  2QZ6 A;  3I7J A;  4E6X A;  1I2S A;  1TDL A;  1H5X A;  3KYE A;  3ZGA B;  3UPO A;  1MWT A;  2W3H A;  3MKE A;  3UME A;  3N8R A;  3RH8 B;  5GL9 A;  2VV7 A;  4M3K A;  3F1O B;  4O8G A;  3TE8 A;  1SCW A;  2B18 A;  1W63 Q;  3LIF A;  1K55 A;  1UWP X;  5TJJ A;  2V2F F;  3BEC A;  3S7Q A;  1KVM A;  3JVV A;  5EM1 A;  4GD6 A;  3DAV A;  2GZA A;  4R3A A;  3Q7Z A;  1S6R A;  4I3I A;  2ZC4 B;  2J3T C;  3DWZ A;  3TRC A;  3IX4 A;  1VET B;  4F3L A;  4KQO A;  4C6Y A;  1WYB A;  1G68 A;  2W0N A;  1K56 D;  4HJ3 A;  1TF1 A;  3VP3 A;  3GQZ A;  3E98 A;  3T1Q B;  3GR2 A;  5DJT A;  4PKY A;  3R7W B;  5KSH A;  5M18 A;  5E2F A;  2FFY A;  2Y2M A;  5FAO A;  2Y8H A;  4HJ6 A;  3UY6 A;  1F9I A;  4UQI S;  4WL9 A;  2E8I A;  3NOU C;  1I5Q A;  4Y13 A;  4N9L A;  2R9X A;  3ZG7 B;  4LFU A;  5DKL A;  2ZQA A;  4CLC E;  3ZG0 A;  1NYM A;  3AGD A;  4Q0H A;  2KX6 A;  2Y2N A;  3CUE A;  3RJU A;  3HLF A;  5G4Z A;  1YMX A;  1LL5 A;  3HUM A;  4KUK A;  5EUA A;  1KE4 A;  1FIK A;  2OWJ A;  4EES A;  3BFE A;  3QP8 A;  5C5K A;  3ZHH A;  2JN7 A;  4ZAM A;  5KIZ A;  4KZ8 A;  5EVI A;  1TS7 A;  2RCX A;  3A3D A;  4IHQ A;  3Q82 A;  3T1S A;  1LI0 A;  4OLG A;  4E3K A;  2Z6C A;  2ZJ9 A;  1JVJ A;  2BLS A;  2Y2O A;  3EOI A;  2ZMA A;  4N9K A;  4YIN A;  4HY8 A;  3D9Y A;  2ZBB A;  3T4Q A;  5GHZ A;  4L9G A;  4L9E A;  3B3X A;  3G31 A;  3IHB A;  1DJC A;  2V0W A;  4PHT A;  5AVE A;  4GW9 A;  2OLU A;  4DKI A;  5CHU A;  3PBR A;  5AQ9 A;  3KSG A;  2PHY A;  3VFH A;  2J8Y A;  4WEL A;  1KGG A;  2OSU A;  5GLA A;  2VKS A;  3IF6 A;  3Q7V A;  4QHC A;  1F5M A;  1DRM A;  4WMC D;  1T1B A;  4ID4 A;  1PWG A;  3MFX A;  4MBF A;  3LUQ A;  4BBV A;  4KEN B;  5HZH A;  3GSG A;  3L9K A;  3KX0 X;  3S7N A;  2VV8 A;  5EFW A;  3NDE A;  1MZU A;  4XT2 A;  1DP9 A;  3CAX A;  3C4P A;  3VP4 A;  3UB6 A;  4BMW A;  4NK3 A;  3T4K A;  2PYP A;  4ZJ3 A;  2Q0O A;  1S1Z A;  1PI4 A;  3M6B A;  3QP1 A;  2V1Z A;  2HDU A;  3EGX C;  3SH7 A;  4Y0O A;  1YLJ A;  3FPW A;  5A8B A;  3CG5 A;  4GDB A;  3KYZ A;  2R78 A;  1K57 C;  1ES4 A;  3HUN A;  5BOH A;  4JF4 A;  1Y28 A;  1XJ2 A;  2XFS A;  4HI4 A;  2W3E A;  3N6I A;  4GKU A;  3ZNT A;  4GB7 A;  1BLH A;  2L4R A;  3H82 A;  4ZBE A;  3ULF A;  3T1X A;  5DTS A;  1BZA A;  3M2K A;  4CQH A;  2QWS A;  3G32 A;  1BLP A;  4UA7 A;  4FTX A;  4HIA A;  3HBR A;  3MF0 A;  5EVI B;  2A3U A;  4NET A;  4GJ4 A;  5L2F A;  2JKG A;  5HAR A;  1P9R A;  1K4E A;  3DW0 A;  5JYO A;  1K6S A;  3OPP A;  1FOF A;  3BLM A;  5CED A;  1E3U A;  3FYZ A;  3ICY A;  4UAA A;  1XA1 A;  4EW7 A;  3A3F A;  2W1T A;  3T4L A;  3W4O A;  2G2U A;  1VHM A;  3PBN A;  3UO9 A;  4RX2 A;  2JC7 A;  3BQA A;  3MQ0 A;  4KG5 A;  3FV7 A;  4UA6 A;  2PBY A;  4PM8 A;  4LGW A;  1GA0 A;  3BYD A;  3G4P A;  4P85 A;  4UEY A;  3NHQ A;  3EEH A;  5FDH A;  4JPM A;  3IF6 B;  3DTM A;  4Y0T A;  1VQQ A;  3B47 A;  5L8M A;  3O86 A;  2Z2L B;  2UV0 E;  1K55 C;  2C6W B;  2K2N A;  1YKD A;  4PKY G;  5F1F A;  4CLC D;  3KSI A;  2JCH A;  1J3W A;  3IXD A;  4XT2 B;  2ZMV A;  3UPP A;  3H9W A;  3UE3 A;  5EOE A;  5IS1 A;  2Y79 A;  1YPR A;  1NY0 A;  5GHY A;  2NUP C;  4MEZ A;  3IF5 A;  5IU1 A;  3V67 A;  4GN2 A;  1OTB A;  1N9B A;  3IX3 A;  5FQK A;  5L07 A;  1H0M A;  1PNE A;  2IWC A;  3G35 A;  4ZRR A;  5GHX A;  2DNS A;  4LRX C;  3NCK A;  2HGV A;  4Y5F A;  5HSQ A;  2Y2I A;  1YLW A;  3TOI A;  1WYC A;  3OLO A;  3Q07 A;  4R70 A;  3PAG A;  4R23 A;  4B4X A;  2H0Y A;  4P0M A;  2K7S A;  2YKH A;  1PIO A;  3SH9 A;  3H82 B;  3R4K A;  1XPB A;  3LEZ A;  3IWQ A;  2WKE A;  3FZC A;  5FEF A;  1ODV A;  4MDZ A;  3A3I A;  5FAS A;  4OQI A;  4EEU A;  1PW1 A;  4OQ0 A;  3CUE C;  1ES2 A;  3LY3 A;  4DE3 A;  5FI7 A;  1BLC A;  4R3B A;  2JKR I;  1CJF A;  1ERM A;  3C2W A;  3AGE A;  4Q0J A;  4EBN A;  1C3B A;  4S2N C;  4R1G A;  1GSV A;  2XD5 A;  4KZ7 A;  5GLC A;  3DTE A;  3G34 A;  4R6L A;  1FCM A;  2W1T B;  2VZW A;  3MZF A;  4B4Z A;  4HH3 A;  3UB7 A;  3BFD A;  4MBK A;  2M7V A;  1K38 A;  1H3Q A;  3WRT A;  3EWK A;  5EVI C;  5HPF A;  1YLP A;  1ZG4 A;  1P97 A;  2IWD A;  5FSR A;  4S2J A;  4HNB A;  4S2K A;  4U0T A;  1IFQ A;  4D2O A;  4MN7 A;  2EX8 A;  5FQJ A;  4OQH A;  2KLI A;  1NZU A;  1IEM A;  4E6W A;  2WKI A;  2Y2Q A;  1GSW A;  1MY8 A;  3WWX A;  2JKF A;  1VB6 A;  3SW1 A;  3EGD C;  1IOU A;  2X01 A;  4ETZ A;  4UHU A;  3NOP C;  1STZ A;  4GD8 A;  1LSV A;  3MZD A;  3FKV A;  3HLC A;  4JKT A;  3UB9 A;  4NXG A;  2WKH A;  1VM1 A;  1N4O A;  3ZFZ A;  2M7U A;  5EVL A;  3BW6 A;  3IXH A;  1ZHH B;  3IF6 C;  5EM0 A;  3R7W A;  3A0R A;  4L9F A;  1OJ5 A;  3OBF A;  2O9A A;  3KSH A;  4BLM A;  3WS2 A;  3F1N B;  3NDG A;  1JWZ A;  3MFD A;  3ZVT A;  2WZZ A;  2ZM2 A;  3EEA A;  4DE2 A;  4BQM A;  2X02 A;  3NY4 A;  1AWI A;  4LRY C;  4C3Q A;  2C5W B;  3KSF A;  3BFF A;  4IVK A;  1E25 A;  3OCN A;  1ES3 A;  2DRW A;  3PAE A;  2ZQ9 A;  2IWB A;  3UE1 A;  4R4R A;  2AVX A;  3CJM A;  3WS4 A;  1BTL A;  4WN5 A;  3W8K A;  5F1G A;  3MR0 A;  3C7V A;  4UA9 A;  3HLB A;  2H0T A;  1TD5 A;  3NBL A;  1ESI A;  3UMD A;  4IUH A;  1WA9 A;  1PW8 A;  1PZP A;  3QP6 A;  5FI2 A;  2HPB A;  2V1A A;  3GRJ A;  3LID A;  1TDG A;  3LIA A;  3QNC A;  1OJG A;  3VSK A;  2VV6 A;  5HD5 A;  4R38 A;  4U0X A;  1S1Y A;  4OP8 A;  3LR0 A;  3MZE A;  4JXW A;  1T1A A;  3G2Y A;  1LT0 A;  2QHK A;  2V9A A;  4E3I A;  1X0O A;  4OVD A;  4WZ4 A;  1CQA A;  4IUK A;  5KZH A;  4LRZ E;  5D3O A;  1J9M A;  1YLY A;  2M1C A;  2QPN A; 
#chains in the Genus database with same CATH homology
 3ISG A;  5CHU A;  2HP5 A;  3PBR A;  5CTN A;  5EPH A;  1LHY A;  1GA9 A;  5AQ9 A;  3C5A A;  4LV0 A;  5HW3 A;  4EV4 A;  3UPN A;  3Q81 A;  5CTM A;  3VFH A;  2J8Y A;  1ONG A;  3HLE A;  4WEL A;  5EVI D;  1SHV A;  5HAI A;  4C75 A;  1KGG A;  2OSU A;  3Q7V B;  5GLA A;  4DXC A;  3ITB A;  3PBO A;  1L0G A;  3IF6 A;  2ZM8 A;  3OZH A;  3Q7V A;  4QHC A;  3VMA A;  3OPH A;  4WMC D;  1EWZ A;  4ID4 A;  1PWG A;  2RL3 A;  4MBF A;  2XLN A;  4KEN B;  4RX3 A;  5FAT A;  2XQZ A;  3TSG A;  2EFU A;  5F83 A;  4WBG A;  3GSG A;  4IVI A;  2XK1 A;  3PTE A;  4Y7P A;  3GVB A;  1BT5 A;  1NXY A;  3NDE A;  4PM7 A;  5FQM A;  4X53 A;  3IQA A;  5DF9 A;  4PM5 A;  5CEB A;  1MWS A;  4PM9 A;  1RP5 A;  2CC1 A;  3C4P A;  4PPR A;  3VP4 A;  4NK3 A;  3IH9 A;  4ZJ3 A;  1PI4 A;  3CMZ A;  1HTZ A;  3M6B A;  4OPY A;  1IKI A;  2HP9 A;  2V1Z A;  2HDU A;  2WGW B;  4K0X A;  4OPZ A;  4WEJ A;  2WAF A;  5FQ9 A;  3ZNY A;  4OLD A;  5DTT A;  4E3N A;  3SH7 A;  2ZLY A;  4DE1 A;  2WGW A;  3N4I A;  3S4X A;  3P98 A;  1PI5 A;  4Y0O A;  5CEC A;  1YLJ A;  3UDI A;  4GOG A;  4LCM A;  1ERO A;  4KG2 A;  1IYP A;  4MLL A;  3BRM A;  1HZO A;  3Q1F A;  2WK0 A;  5FAP A;  3CG5 A;  4EBL A;  3A3J A;  5G18 A;  1GHI A;  3V3R A;  1CK3 A;  4GDB A;  3A3E A;  1NJ4 A;  5U47 A;  1W8Q A;  5A92 A;  3IXB A;  5A90 A;  1K57 C;  1ES4 A;  2A49 A;  2JE5 A;  3HUN A;  5FQI A;  4S2P A;  5BOH A;  4JF4 A;  1JTD A;  3SS3 A;  4KZ5 A;  2Q9N A;  2XFS A;  4Y0U A;  5CHM A;  3SS4 A;  1YQS A;  5TFQ A;  3V5M A;  4BD0 A;  4KQQ A;  4BJP A;  1PWD A;  4E3J A;  2Y2H A;  2DCF A;  3N6I A;  4GKU A;  3ZNT A;  1FQG A;  4RVA A;  1FSW A;  1QME A;  4GB7 A;  3N8L A;  4RYE A;  1BLH A;  4HBT A;  4ZBE A;  3WS1 A;  5KSC A;  4S2N A;  1YT4 A;  4HES A;  5TGF A;  5DTS A;  1BZA A;  3M2K A;  3MKF A;  4LCL A;  2ZM0 A;  3MXR A;  3G32 A;  4IBX A;  4JBF A;  4DRT A;  1BLP A;  5M1A A;  2WGV A;  5I94 A;  2HP6 A;  4UA7 A;  3PBQ A;  4P6B A;  1K54 C;  3HBR A;  5EEC A;  1Y54 A;  3G2Z A;  5EVI B;  3OPR A;  4EQI A;  2A3U A;  3QHY A;  4NET A;  2H10 A;  1K4F A;  3VSL A;  2VGK A;  5L2F A;  2EX9 A;  5HAR A;  5CGW A;  1K6R A;  3BFC A;  4OQG A;  1K4E A;  3DW0 A;  4GZB A;  1FCN A;  1O7E A;  4U3T A;  5HL1 A;  5JYO A;  1K6S A;  4QJG A;  1W7F A;  3UE0 A;  1EI5 A;  2JBF A;  2XEP A;  3OPP A;  3NIA A;  4PM6 A;  1FOF A;  3BLM A;  4JXS A;  5A91 A;  3V50 A;  4KG6 A;  5CED A;  4KQR A;  1OME A;  1E3U A;  1S0W A;  3FYZ A;  1JWV A;  2XDM A;  4UAA A;  1MBL A;  3CZD A;  1XA1 A;  4WZ5 C;  1XA7 A;  3IXG A;  2G2W A;  5CGX A;  3BM6 A;  1FR1 A;  1NRF A;  1ES5 A;  2WZX A;  3A3F A;  1PWC A;  1LLB A;  1Z6F A;  1WE4 A;  5E43 A;  3W4O A;  1W8Y A;  2G2U A;  2R9W A;  4KZB A;  3PBN A;  3UO9 A;  2ZQ7 A;  4RX2 A;  2JC7 A;  2X71 A;  3OCL A;  4KG5 A;  1YM1 A;  3FV7 A;  4UA6 A;  1KDW A;  2PBY A;  4PM8 A;  2PU4 A;  5F82 A;  1AXB A;  4X69 A;  1YLZ A;  1GA0 A;  2WAD A;  3BYD A;  4R0Q A;  3FKW A;  3SH8 A;  4N1H A;  2WYX A;  4MBH A;  4KZA A;  4P87 A;  3G4P A;  4P85 A;  4XXR A;  3PBT A;  3IHA A;  3G30 A;  5FDH A;  4JPM A;  2P9V B;  4IBR A;  4KZ3 A;  3IF6 B;  3DTM A;  2P9V A;  1I2W A;  2ZC5 B;  3S1Y A;  2J9O A;  4Y0T A;  1VQQ A;  3LO7 A;  3FWL A;  5EE8 A;  3O86 A;  2Z2L B;  2H5S A;  1K55 C;  4FCF A;  4FD8 A;  2Y91 A;  4Q8I A;  2FFF B;  4N1X A;  2C6W B;  1PZO A;  5F1F A;  1E3U D;  2JCH A;  4XUX A;  4EUZ A;  3IXD A;  5FQQ A;  3UPP A;  3IWI A;  3O87 A;  1XGI A;  1TEM A;  3C7U A;  4JLF A;  3UE3 A;  3WS5 A;  1XGJ A;  5EOE A;  4F94 A;  4OP5 A;  1NY0 A;  5GHY A;  1YMS A;  1KGE A;  4MEZ A;  3IF5 A;  4DDS A;  4EBP A;  1ZG6 A;  5CGS A;  4S2L A;  3ZG8 B;  2HDS A;  4GN2 A;  1N9B A;  5HFO A;  5FQK A;  2Y2G A;  4DXB A;  3BEB A;  4HEF A;  4CPK A;  1K57 A;  4ZJ1 A;  2IWC A;  3G35 A;  4KZ9 A;  5HAQ A;  5GHX A;  1YLT A;  2DNS A;  4OKP A;  4WM9 A;  3NCK A;  2OLV A;  3D4F A;  2BG1 A;  3VOY A;  3HRE A;  4WYY A;  4X55 A;  4OON A;  4ZJ2 A;  1PYY A;  1U60 A;  3VFF A;  1SDN A;  2Y2I A;  4XUZ A;  4DDY A;  1YLW A;  2XR0 A;  3RXX A;  3HLD A;  3TOI A;  1MWR A;  1WYC A;  3HUO A;  3IT9 A;  5CHJ A;  5A93 A;  3Q07 A;  2I72 A;  3UDF A;  4R4S A;  5GLB A;  1IYQ A;  1HD8 A;  3PAG A;  4R23 A;  5E2G A;  4B4X A;  2H0Y A;  3N7W A;  2HDQ A;  1Q2Q A;  4P0M A;  4E3L A;  1PIO A;  4S2O A;  5IHV A;  3SH9 A;  2EXB A;  1DJB A;  1JWP A;  4H8R A;  4OPQ A;  5CXW A;  1XPB A;  2B5R A;  4LV1 A;  2WAE A;  1CI8 A;  2XGN A;  3LEZ A;  5DF7 A;  3IWQ A;  2WKE A;  2OV5 A;  3FZC A;  3SS5 A;  1JTG A;  3ZG5 A;  4DF6 A;  3MXS A;  3OC2 A;  5AQB A;  4BEN A;  5FA7 A;  1CEG A;  3ZCZ A;  1L0E A;  3A3I A;  3PBS A;  2XFT A;  1LL9 A;  1L2S A;  5FAS A;  1KE3 A;  4OQI A;  1XP4 A;  2Z2M B;  3AGF A;  3GMW A;  3WRZ A;  4JXV A;  3NI9 A;  4R3J A;  3IWO A;  4FH2 A;  1PW1 A;  1E4D A;  4OQ0 A;  2Q9M A;  1ES2 A;  1M6K A;  4WEK A;  3LY3 A;  4DE3 A;  2WUQ A;  5FI7 A;  1QMF A;  2XH9 A;  4B88 A;  1BLC A;  4QU3 A;  4WZ5 A;  5EOO A;  2ZC3 B;  4R3B A;  1XX2 A;  4E3M A;  3E2K A;  3O3V A;  4LEN A;  4QB8 A;  5CRF A;  3IH8 A;  4KZ4 A;  1ERM A;  1IEL A;  2EX6 A;  4OOL A;  3AGE A;  1KGF A;  4GDN A;  5HX9 A;  4EBN A;  1C3B A;  2EX2 A;  4R1G A;  4S2N C;  2XD5 A;  4KZ7 A;  1ZC2 A;  2Y2K A;  5GLC A;  3S22 A;  5E2E A;  1IYO A;  2QZ6 A;  3I7J A;  4E6X A;  4K91 A;  3G34 A;  4MNR A;  5AQ7 A;  1FCM A;  3MZF A;  5KMW A;  4B4Z A;  1I2S A;  1TDL A;  1H5X A;  3BFD A;  1M40 A;  4HBU A;  4MBK A;  3ZGA B;  5DTK A;  3UPO A;  1K38 A;  3WRT A;  1MWT A;  3VOZ A;  5EVI C;  3MKE A;  5GLD A;  1YLP A;  1ZG4 A;  2IWD A;  5FSR A;  2ZQC A;  4S2J A;  4X6T A;  4CJN A;  3N8R A;  4GNU A;  5GL9 A;  4LV3 A;  3UDX A;  4M3K A;  1DY6 A;  1MWU A;  1SCW A;  3EQU A;  4S2K A;  4U0T A;  4D2O A;  2EX8 A;  5FQJ A;  1KVL A;  5JYP A;  2VGJ A;  4BL2 A;  1K55 A;  3M6H A;  4OQH A;  3DWK A;  3RXW A;  3SOI A;  2ZQD A;  2V2F F;  1NZU A;  3BEC A;  1IEM A;  4E6W A;  2Y2P A;  2WKI A;  2Y2Q A;  4DE0 A;  3EQV A;  1NZO A;  1G6A A;  1MY8 A;  2P74 A;  4OH0 A;  4KZ6 A;  3WWX A;  3HVF A;  1KVM A;  4GD6 A;  1SDE A;  4QY5 A;  4ZDX A;  1GHM A;  1XXM A;  3GV9 A;  3Q7Z A;  1S6R A;  2ZC4 B;  2X01 A;  3HLG A;  4UHU A;  1W5D A;  5FAQ A;  3DWZ A;  4GD8 A;  3HL9 A;  4ZTK A;  3MZD A;  3FKV A;  4KQO A;  3VP0 A;  4C6Y A;  1WYB A;  3HLC A;  1G68 A;  2ZC6 B;  2J9P A;  4JKT A;  5M19 A;  2Y2L A;  1ZKJ A;  3UN7 A;  1K56 D;  3OPL A;  4OOY A;  1FSY A;  3WS0 A;  1K25 A;  2WKH A;  4FSF A;  3VP3 A;  4IED A;  5AQA A;  1L0D A;  1VM1 A;  3W4Q A;  1N4O A;  3GQZ A;  3LCE A;  1ONH A;  3GR2 A;  1BLS A;  3ZFZ A;  1L0F A;  5EVL A;  3IXH A;  1GHP A;  3O88 A;  4Z9Q A;  5KSH A;  3IF6 C;  1ESU A;  2XD1 A;  3V3S A;  1MPL A;  5M18 A;  3TG9 A;  4BD1 A;  1RGZ A;  2Y4A A;  2QMI A;  5E2F A;  2FFY A;  2Y2M A;  5FAO A;  4BLM A;  1SKF A;  3UY6 A;  2HDR A;  3WS2 A;  2E8I A;  4BL3 A;  1DJA A;  1I5Q A;  3NDG A;  1ERQ A;  5E2H A;  3NC8 A;  4N9L A;  3ZDJ A;  3MBZ A;  1FR6 A;  1JWZ A;  2R9X A;  3ZG7 B;  3MFD A;  3ZVT A;  2WZZ A;  2ZM2 A;  3ZG9 B;  2WGI A;  2ZQA A;  4DE2 A;  4JF6 A;  2Y59 A;  4BQM A;  3ZG0 A;  2X02 A;  3NY4 A;  1BSG A;  1NYM A;  3AGD A;  4X68 A;  3P09 A;  2Y2J A;  3E2L A;  4C3Q A;  4S2M A;  4A5R A;  1K54 A;  2C5W B;  3QNB A;  3BFF A;  1LI9 A;  2ZQ8 A;  1O07 A;  1CI9 A;  1W79 A;  4IVK A;  2XF3 A;  1E25 A;  2EXA A;  2ZC7 A;  2Y2N A;  3RJU A;  3OCN A;  1ES3 A;  3M2J A;  4QY6 A;  1HVB A;  1KE0 A;  1MKI A;  2DRW A;  5DF8 A;  3PAE A;  3W4P A;  2ZQ9 A;  5J8X A;  3LY4 A;  2IWB A;  3HLF A;  3UE1 A;  4R4R A;  1YMX A;  3CJM A;  4K0W A;  3WS4 A;  1BTL A;  1LL5 A;  5CER A;  3W8K A;  1MXO A;  3HUM A;  5F1G A;  2PU2 A;  5EUA A;  4QD4 A;  1BUL A;  2GDN A;  3C7V A;  1KE4 A;  2UWX A;  3C4O A;  4N92 A;  2EFX A;  1FCO A;  2ZD8 A;  1GCE A;  3BFE A;  3HLB A;  4PMA A;  4UA9 A;  2H0T A;  1Q2P A;  1IYS A;  5FI6 A;  5TR7 A;  4L0L A;  3NBL A;  3HLW A;  1ESI A;  3ZHH A;  1CEF A;  4S2I A;  4ZAM A;  2J7V A;  1PW8 A;  3UNW A;  4KZ8 A;  3GTC A;  1PZP A;  5EVI A;  3JYI A;  4EWF A;  2RCX A;  5FI2 A;  2HPB A;  3A3D A;  4LV2 A;  4YFM A;  4O7D A;  4OPR A;  3GRJ A;  1TVF A;  3Q82 A;  5DVA A;  4FH4 A;  1TDG A;  3QNC A;  1K56 A;  3VSK A;  1IKG A;  5HAP A;  1LI0 A;  1RGY A;  3ITA A;  4WMC A;  1ALQ A;  4OLG A;  4E3K A;  1BUE A;  4U0X A;  2ZJ9 A;  1JVJ A;  2BLS A;  2Y2O A;  3ZVW A;  4OP8 A;  4JF5 A;  2ZMA A;  4N9K A;  4YIN A;  3MZE A;  3V39 A;  4JXW A;  3G2Y A;  5GHZ A;  1H8Z A;  1H8Y A;  4E3I A;  3B3X A;  1NYY A;  3BFG A;  1RCJ A;  3N8S A;  1KDS A;  4OVD A;  3G31 A;  4WZ4 A;  3VP1 A;  3IHB A;  3BLS A;  2Y55 A;  1DJC A;  5KZH A;  2V20 A;  1XKZ A;  4RA7 A;  5D3O A;  1J9M A;  4E3O A;  4JXG A;  1YLY A;  2OLU A;  4DKI A;  4OOM A;  2QPN A;  3VP2 A;  4X56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...