3G35A

Ctx-m-9 class a beta-lactamase complexed with compound 12 (f13)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
260
structure length
259
Chain Sequence
b'AVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase CTX-M-9a
publication title Molecular docking and ligand specificity in fragment-based inhibitor discovery
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 94
structure length 259
sequence length 260
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3g35A00
3V50A 3NIAA 1BLHA 1K4FA 5FA7A 3G34A 2PU2A 4JF4A 3ZG7B 5AQAA 4KZ9A 2OV5A 1JWZA 3VOYA 1BLPA 1ES3A 1DY6A 1Q2QA 2Y4AA 2ZM0A 3NBLA 4MLLA 4E3JA 1NJ4A 4XUZA 3ZHHA 3W8KA 3ZFZA 1IYSA 4JXVA 3W4OA 5FQMA 1E4DA 2A49A 3SH8A 4MBKA 5E2GA 1FR6A 5IHVA 4UA9A 4E3OA 4JXGA 3ZNTA 1I2SA 2C6WB 1NRFA 3LY4A 2GDNA 4K0WA 4N1XA 4R4RA 3RXWA 3ZG0A 1K25A 5GLCA 5F1FA 3HL9A 2XFSA 3NY4A 5DTSA 4QD4A 3ZVWA 1K54A 1K54C 1PWGA 2G2UA 1G68A 2XLNA 4BD0A 2WGIA 1MXOA 3G31A 4RVAA 5CGWA 4LV1A 3O3VA 3OPLA 3N8SA 2ZC6B 1CI9A 4KG2A 2OSUA 2CC1A 3DW0A 3FZCA 4OQHA 4OOLA 4QB8A 4FD8A 3NCKA 3ISGA 3S22A 5F82A 4DF6A 5HL1A 3OC2A 4C3QA 2ZC5B 4PM6A 4WEKA 3NDGA 3GMWA 4HBUA 4WELA 3PBTA 1K6SA 2OLVA 3ZG8B 1IKGA 5FAQA 5DF7A 2IWDA 3S1YA 2V1ZA 1KDSA 3IF5A 4PM7A 4OPZA 3ZGAB 1YQSA 2EXBA 4OH0A 4IVKA 3ITBA 3IF6B 4OOMA 3HLEA 4RYEA 4JF6A 1FR1A 4O7DA 1MBLA 5FQKA 1O07A 1K4EA 4WM9A 3IWQA 2XD5A 2HDQA 3TG9A 3OCNA 2B5RA 4FH2A 3UO9A 4KZBA 3Q7ZA 4X56A 1JWPA 1H8ZA 4E6WA 3Q81A 5CRFA 3QHYA 3VP0A 1L0GA 3RXXA 2HPBA 1MWUA 2X71A 1KGEA 3NC8A 5CGXA 1RGYA 4BJPA 1AXBA 4B4XA 3JYIA 5EVIB 5EECA 2ZJ9A 4DE3A 2ZQ9A 4OLGA 1EI5A 1GA0A 4ZTKA 1BT5A 3GTCA 2Y59A 1PW1A 3SH7A 1YM1A 2WZZA 2Y2GA 2FFFB 1MY8A 3VMAA 3QNBA 5FSRA 3LO7A 1LI9A 2P9VA 3IXBA 1ZC2A 3G35A 4JXSA 2ZQDA 2J9PA 3IT9A 1Y54A 3SS3A 4D2OA 4WEJA 5DF9A 3DWKA 3HLWA 4R23A 4GNUA 3A3FA 5M18A 3C4PA 3CMZA 3IH9A 3SH9A 3SS5A 5EVLA 4BLMA 4DE2A 2JCHA 2HP5A 4JBFA 2G2WA 3WS2A 2RL3A 4OLDA 4KG6A 1G6AA 3BEBA 2ZC3B 4H8RA 4Y7PA 1XP4A 5FAPA 2V2FF 3MXSA 1SDNA 2RCXA 5M19A 5AQ9A 4B88A 4KZ4A 4IVIA 3MZEA 4PM9A 3OZHA 4ZAMA 4N9KA 5EOEA 4QJGA 5FI2A 4LCLA 3WS0A 2X01A 2Z2MB 1SKFA 3AGFA 1PWDA 3HUOA 4LCMA 3IHBA 3IQAA 4E3MA 4WZ5A 5KSCA 4WZ5C 3VP2A 4MBHA 4WBGA 3UPOA 1K56A 1QMFA 1K55A 4LENA 1K55C 5CHUA 1MWTA 3NDEA 3UDIA 3UDFA 3OCLA 3W4PA 1MWRA 2Y2LA 5FDHA 2J9OA 4P0MA 4U3TA 1TEMA 5M1AA 3UN7A 3BM6A 4X69A 3NI9A 1E3UA 5G18A 4EBLA 1KVLA 1RGZA 1H8YA 2ZM2A 3IWIA 2XEPA 4ZJ2A 5FI7A 1KGFA 1XA7A 1YMSA 2Y2KA 4X53A 4YINA 5HAQA 3WS4A 3IXDA 1NYMA 2A3UA 4EBPA 1E25A 3MKEA 1Z6FA 2XQZA 4LV3A 1KE3A 5FASA 5TGFA 2XH9A 1K57A 2ZC4B 5CHMA 5CERA 1K57C 1BLCA 1BUEA 1DJBA 3LY3A 5KMWA 4BD1A 5KSHA 4MEZA 1MKIA 1CEGA 1ES5A 4DE1A 4KZ8A 5E2EA 4WZ4A 2Y2IA 3Q7VB 4OPYA 2UWXA 1YLPA 2WYXA 3HUNA 4NK3A 3AGEA 4E6XA 1DJAA 4DXCA 2PU4A 1W8YA 1IEMA 3VP1A 1PW8A 4X6TA 1ZKJA 2EXAA 5I94A 3GR2A 4IBRA 3BYDA 4RX3A 3MXRA 1ERMA 1ESIA 1PI4A 1HZOA 1EROA 4N92A 4KZ3A 3WRZA 4QU3A 1PYYA 3BFDA 3P98A 5HAIA 4X55A 2ZMAA 3VOZA 2EX6A 3G4PA 4KZ5A 2C5WB 2VGKA 3PBRA 4S2NA 4S2NC 3A3DA 1H5XA 1JTGA 1XPBA 3PAGA 3CG5A 4EQIA 3GQZA 4XUXA 5HFOA 5CECA 1YT4A 4JXWA 3BFCA 4KQOA 3C7UA 1W7FA 3FKVA 1RCJA 1SCWA 1XGIA 1IYOA 3LEZA 4FCFA 4E3KA 3MZDA 4DE0A 4JLFA 4C6YA 5E2FA 5CTNA 1CK3A 4OOYA 2XFTA 2J7VA 5TR7A 3V3SA 4KG5A 5U47A 4KQRA 4U0XA 4N1HA 4FH4A 5HX9A 1NZOA 1GHMA 1I5QA 1YLTA 5FATA 2WUQA 5F83A 4UA7A 3MKFA 2ZQ8A 3GV9A 4ZBEA 4CPKA 1MPLA 1W5DA 1VM1A 4OKPA 1GCEA 1MWSA 4OPQA 5A92A 1IYPA 5A93A 3C7VA 1BSGA 3LCEA 1ZG4A 3N7WA 5E2HA 1N4OA 3HUMA 1FOFA 2P74A 2WGWA 4IBXA 1NY0A 3ZG5A 4P87A 4KZ7A 2QZ6A 3I7JA 1HD8A 4RA7A 5EOOA 5CXWA 4K0XA 4GDNA 1QMEA 1K56D 4UHUA 4LV0A 2HDRA 4GB7A 4JF5A 4ZJ3A 3CZDA 4Y0TA 3PBQA 1YLJA 1E3UD 1CI8A 1GHIA 1PIOA 3ITAA 5CTMA 4DXBA 2XR0A 1DJCA 3ZDJA 4KZAA 4Q8IA 4M3KA 1LL5A 3BFEA 4R1GA 5GHZA 4GKUA 1FCOA 1ESUA 4HEFA 3HBRA 4NETA 5DF8A 1O7EA 2X02A 5A90A 3SS4A 3PBSA 1XGJA 2EFXA 3MBZA 5GHXA 5FQJA 1KDWA 1TDGA 4S2PA 1LL9A 3UY6A 4L0LA 2XD1A 5EUAA 1K38A 1L0EA 4EBNA 2Y2NA 2WAFA 2XGNA 2I72A 3BFGA 3A3EA 1XXMA 3SOIA 3GRJA 1BLSA 4BQMA 5CEDA 3A3JA 5HW3A 4OP8A 2H0YA 2HP6A 5TFQA 1SDEA 2Y2OA 4WMCA 2XK1A 4DDYA 4EUZA 2ZQCA 5GL9A 2BLSA 1LHYA 4EWFA 3V5MA 2H0TA 4BENA 3HLDA 4S2KA 2P9VB 4OQ0A 4U0TA 4XXRA 5GHYA 3IHAA 3UNWA 3BLMA 3M6HA 2WKHA 1ZG6A 3N6IA 5DVAA 4KQQA 4Z9QA 5F1GA 2IWBA 3GSGA 4WYYA 5E43A 1NZUA 3FYZA 4BL2A 3Q1FA 1EWZA 1NYYA 4GD6A 3DTMA 3VSLA 4S2LA 3WS5A 4B4ZA 3O87A 5HAPA 4OONA 3W4QA 4R4SA 4LV2A 2Y2PA 4JPMA 3TSGA 1XA1A 3E2KA 3Q82A 2EFUA 2V20A 5BOHA 1KGGA 1YMXA 1HVBA 1N9BA 2Q9NA 3PAEA 1GA9A 4QHCA 5AQBA 4DRTA 1ES4A 2ZM8A 1ES2A 5CEBA 3C4OA 3IF6A 5GLBA 3IF6C 3UE1A 2HDSA 1SHVA 2Y2QA 1S0WA 1YLWA 1NXYA 2FFYA 4PMAA 3VFFA 3HLFA 5HARA 3BFFA 2R9WA 1JVJA 2H10A 4GDBA 2JE5A 3ZNYA 3O88A 5FI6A 2BG1A 4QY5A 4DKIA 5GLAA 4JKTA 1M40A 4MBFA 4R3BA 4S2IA 1IYQA 3EQVA 4GN2A 5JYOA 3EQUA 4GOGA 4OPRA 3V3RA 2XDMA 3UPPA 1JTDA 5AQ7A 5EVIA 1L0DA 5EVIC 3OPPA 2EX2A 1Q2PA 3B3XA 3G2YA 3MFDA 5JYPA 4X68A 2HDUA 2PBYA 4P85A 2JBFA 1RP5A 1BULA 4HESA 3Q07A 3RJUA 3IXGA 1TDLA 3G30A 1W79A 2QMIA 1K6RA 1XX2A 3HREA 4ID4A 4Y0UA 1ONHA 3O86A 3UPNA 1BTLA 4C75A 5GLDA 3WS1A 4EV4A 4OQGA 1TVFA 5FQQA 3ZCZA 3VSKA 2Y55A 3VFHA 5KZHA 3BECA 3G2ZA 2DCFA 1PI5A 2Y91A 1WYBA 3A3IA 1KE0A 4PM5A 4KENB 1CEFA 5D3OA 1M6KA 3C5AA 2DRWA 1LLBA 1C3BA 3HLCA 4R3JA 2ZLYA 2Q9MA 1ERQA 1ALQA 4QY6A 4E3NA 1VQQA 1L0FA 2VGJA 3N8RA 5DTTA 2WADA 3ZVTA 4E3LA 1L2SA 1WYCA 3P09A 4WMCD 4MNRA 2IWCA 2Y2MA 3M6BA 4YFMA 2OLUA 4IEDA 2Y2HA 1FSWA 2Y2JA 1J9MA 3OPRA 4FSFA 4PM8A 4Y0OA 3UE3A 3N4IA 5FQ9A 3D4FA 1IKIA 1LI0A 4E3IA 1YLZA 4OQIA 3MZFA 4R0QA 2WZXA 1FSYA 1GHPA 2WKEA 3G32A 1W8QA 3PBNA 3FKWA 4OVDA 4OP5A 2WKIA 1BZAA 4A5RA 3AGDA 3E2LA 2ZQAA 4GD8A 4HBTA 3FWLA 1JWVA 1PWCA 3BLSA 3VP4A 2H5SA 2ZD8A 4UA6A 3M2JA 2ZC7A 4BL3A 3OPHA 3VP3A 1KE4A 3BRMA 4P6BA 4DDSA 3GVBA 1KVMA 2WAEA 2EX8A 5L2FA 4F94A 2WK0A 2ZQ7A 1YLYA 3UE0A 3M2KA 4ZDXA 5EPHA 3S4XA 2JC7A 2DNSA 3CJMA 3PTEA 1OMEA 4S2OA 4ZJ1A 2WGWB 3PBOA 3Q7VA 5CGSA 2WGVA 4RX2A 1U60A 5DTKA 1IELA 1WE4A 1ONGA 3HLGA 5EE8A 2R9XA 1HTZA 2EX9A 3FV7A 3QNCA 4KZ6A 2Z2LB 3IXHA 3V39A 2QPNA 5CHJA 1FQGA 3IH8A 4S2MA 5FQIA 4S2JA 5A91A 2XF3A 4K91A 3WWXA 4CJNA 2HP9A 5J8XA 1S6RA 1PZOA 5EVID 3N8LA 3TOIA 5FAOA 3IWOA 2E8IA 1FCMA 4GZBA 4N9LA 4PPRA 1FCNA 1PZPA 1XKZA 3DWZA 1I2WA 3WRTA 3HVFA 4UAAA 3UDXA 3HLBA 2J8YA 3ZG9B
chains in the Genus database with same CATH superfamily
3ZG7B 1BLPA 3NBLA 3CLOA 4HNBA 3W8KA 3W4OA 3JPUA 3IBRA 4R4RA 3LY4A 4JGPA 3ZG0A 3UMEA 5GLCA 3DTEA 3HL9A 4BD0A 2WGIA 5CGWA 2HGVA 4LV1A 3O3VA 4LRXC 1NWZA 1CI9A 4KG2A 3FZCA 2CC1A 4OQHA 3ZNTA 4DF6A 3NCKA 3S22A 5HL1A 1GSWA 3OC2A 4WEKA 5AVFA 3D9YA 4MCWA 2IWDA 2V1ZA 3IF5A 4PM7A 3ZGAB 4OH0A 2AVXA 1O07A 4WM9A 3IWQA 4I3JA 4I3AA 3EEHA 2B5RA 4KZBA 4X56A 1JWPA 3Q81A 3VP0A 2VLGA 4FTXA 2X71A 1RGYA 4BJPA 4NXGA 4PAUA 4OLGA 1EI5A 4ZTKA 1PW1A 2VGLM 2FFFB 4NXFA 3VMAA 1X0OA 2P9VA 2VA0A 3IXBA 3MFXA 3IT9A 1S4SA 5DF9A 3EGXC 4GNUA 3G6OA 3F1OB 3IH9A 2HP5A 3WS2A 1G6AA 2E8JA 2RCXA 5M19A 4KZ4A 4PM9A 5HD5A 4I3IA 3HJKA 3TJZC 1OJGA 1STZA 5DKLA 1WA9A 4LCMA 4Y13A 4DJ2A 4NG2A 3A0RA 3KX0X 3VP2A 4MBHA 3IX4A 1J3WA 4XT2B 3NDEA 3OCLA 1MWRA 2INWA 4P0MA 4GLQA 4EBLA 2LB5A 1H8YA 3T4OA 1D7EA 1Z09A 1W63Q 1KGFA 4X53A 4G3KA 3IXDA 3D3OA 2B18A 4EBPA 5TGFA 1K57A 1K57C 4PHTA 1BUEA 5KMWA 1CEGA 4LLOB 4WN5A 2UWXA 2FZ0A 5K5BA 3FPVA 1DJAA 2Y8HA 2PU4A 1IFQA 4X1LA 3C2WA 5I94A 3BYDA 4RX3A 3MXQA 3NHQA 1EROA 4N92A 4KZ3A 4H6JA 4QU3A 5C5KA 3LR4A 3G4PA 3A3DA 1H5XA 3GQZA 4XUXA 2MJ6A 3H82B 5CECA 2V0UA 4JXWA 4KQOA 3C7UA 3FKVA 3MZDA 4JLFA 4CLCE 1CK3A 4OOYA 3QP1A 5TR7A 4KG5A 1N9OA 5U47A 4KQRA 1GHMA 1YLTA 2WUQA 2VZWA 2EWWA 3MKFA 2PYPA 2W1RA 3LEQA 3LFVA 3P7NA 3BQAA 1MPLA 1VM1A 3CPTA 1BYWA 2DMWA 4OPQA 3T4LA 3HUMA 4IBXA 1NY0A 1HD8A 3ULFA 5CXWA 4F3LB 4GDNA 3B47A 1QMEA 5CTMA 4DXBA 3ITAA 5EM0A 5FDSA 4FOFA 4KZAA 2B02A 4UQIM 5L8MA 1O7EA 5A90A 2VJWA 1XGJA 1DP6A 2QKPA 1UWNX 3QP4A 2XD1A 4NXEA 4DN0A 4EBNA 2Y2NA 2I72A 2V1AA 5CEDA 1PNEA 5F69A 4WMCA 4HH2A 5IU1A 1V9ZA 4S2KA 3EEAA 2L4RA 5GHYA 1S67L 2PHYA 1H8MA 5F68A 3M6HA 1ZG6A 3GSGA 4WYYA 4NKPA 4WL9A 3VSLA 2Q0OA 4OONA 2QHKA 5HDCA 4KQDA 4R4SA 5HL6A 3EOIA 1XA1A 3Q82A 4KUOA 1YMXA 1GA9A 5AQBA 4IUHA 1D1JA 3LIAA 4PKYG 2HDSA 2FFYA 2XROA 3VFFA 2BASA 5HARA 3BFFA 1JVJA 3LR0A 4QY5A 4P6ZM 5GLAA 1M40A 4MBFA 4GOGA 2XDMA 3UE6A 1ZTUA 1L0DA 2EX2A 4NXBA 5G4ZA 4GCZA 2JBFA 3IXGA 2PD7A 2VKSA 3UB5P 3HREA 1K6RA 4Y0UA 5HPFA 2PT7A 3WS1A 1TVFA 2PDRA 2OWHA 1MZUA 2DCFA 1PI5A 1WYBA 3F1OA 1KE0A 2HF6A 2QJ5A 4PM5A 4LGWA 2L1MA 4QY6A 4E3NA 5DTTA 3E4QA 3CUEA 3CUEC 3LI8A 4WMCD 3P09A 5EM1A 5J3WA 2PAVP 4IEDA 4GHIB 4ZRRA 2Y2HA 4FSFA 2Y2JA 3UE3A 1XJ4A 4XT2A 3LIFA 5HPIA 4OQIA 4R0QA 1W8QA 3PBNA 4OVDA 3BWLA 4YWZA 3E2LA 2ZQAA 4GD8A 2H5SA 2VV8A 3OPHA 4Z1WA 1KVMA 3UE0A 3S7OA 3E4OA 2JC7A 3OLOA 3PHYA 4S2OA 3PBOA 5CGSA 5HD3A 5IT5A 1YSQA 1U60A 5DTKA 1P0ZA 1P97A 2EX9A 4KZ6A 3V39A 2GJ3A 2PYRA 4GW9A 5J8XA 4CJNA 4GZBA 4PPRA 1PZPA 1XKZA 3WRTA 4FUWA 3UDXA 3MQQA 1F9IA 3H82A 3V50A 1BLHA 5FA7A 2PU2A 5AQAA 4KZ9A 1JWZA 4B9OA 3MR0A 2ZM0A 3ZFZA 5FQMA 3B42A 1AWIA 4MBKA 5E2GA 1FR6A 1PRQA 3NY4A 5DTSA 3ZVWA 1PWGA 3SZTA 1G68A 1V9YA 1MXOA 2WKPA 3OPLA 2ZC6B 2OSUA 4F3LA 4C3QA 4O01A 3NDGA 4HBUA 4ETXA 3PBTA 2OAP1 4GJ4A 4RQ9A 1IKGA 5EFWA 1KDSA 5AVEA 3UB6A 4OOMA 3LR3A 1FIKA 5FQKA 4QWOA 4HJ6A 2XD5A 4MDZA 2HDQA 3TG9A 4EETB 4FH2A 3Q7ZA 3LUQA 3U4LP 1H8ZA 3QHYA 2I9VA 5CGXA 1KGEA 3NC8A 2H28A 4B4XA 3VE3A 5L09A 4GS9B 2ZQ9A 3QP6A 2Y59A 1A0KA 4WF0A 5KIZA 3LO7A 1ZC2A 2HJEA 2J9PA 3T1RA 3DWKA 3HLWA 4KUKA 2K2NA 4R23A 2CMNA 3CMZA 3T4KA 5EVLA 3E0YA 3TRCA 1SZVA 3CPTB 2ZC3B 1XP4A 2V2FF 3MXSA 1SDNA 4X25A 4R3AA 4R38A 3OZHA 4IHQA 4QJGA 2K31A 4LCLA 3WS0A 1SKFA 3AGFA 3IHBA 3IQAA 4WZ5A 4WZ5C 4WBGA 3UPOA 3LIDA 4LPZA 4LENA 3T12B 2XA7M 3W4PA 2J9OA 4U3TA 5DFXA 3BM6A 3E4PA 1E3UA 4L9EA 1OJ5A 2XEPA 4ZJ2A 3HJIA 3JVVA 1YMSA 4B93A 1NYMA 2A3UA 1DP8A 1E25A 4LV3A 1Z6FA 2J80A 2VV6A 2PR6A 1S4RA 3LY3A 3VE4A 3T1XA 2J3WA 4MEZA 1MKIA 1XJ2A 4KZ8A 5E2EA 1UGUA 4WZ4A 2Y2IA 1LSXA 1YLPA 2WYXA 4E6XA 2V9AA 3LYXA 1IEMA 2W1TA 3VP1A 2XRNA 4X6TA 2ZOIA 1ZKJA 2EXAA 3BY8A 5HDSA 3MXRA 2R78A 1ESIA 3SW1A 3BFDA 5HAIA 2ZMFA 3VOZA 2VGKA 3LI9A 3KSIA 4GHIA 2NUTC 1XPBA 4LFUA 4L9GA 3LR5A 1IYOA 3LEZA 4FCFA 2B95A 5E2FA 3K3CA 3V3SA 4CQHA 2V0WA 2VK3A 1NZOA 1I5QA 1N9LA 4UA7A 2ZQ8A 4ZBEA 2M1CA 1MC0A 4YOFA 4OKPA 1W5DA 5A93A 1ZG4A 1FOFA 2P74A 1P9RA 2QZ6A 4K0XA 2OOLA 4PKYA 1S1ZA 1E3UD 1GHIA 3MJQA 4HIAA 4Q8IA 5GHZA 4GKUA 1FCOA 1ESUA 3T4SA 4Y3IA 3SS4A 1KDWA 3UY6A 1NRJA 1L0EA 4ME4A 2XGNA 3CITA 3SOIA 4HOIA 3GRJA 4BQMA 3F1PB 5TFQA 2O0YA 2Y2OA 2XK1A 4EUZA 2BLSA 3HLDA 4XXRA 2PD8A 1LT0A 3N6IA 4KQQA 2IWBA 3UB9A 1EWZA 3RFBA 4JGQA 2EWVA 4JPMA 3TSGA 3E2KA 1KGGA 1YAXA 3PAEA 4DRTA 5GLBA 3QP8A 3UE1A 1SHVA 1S0WA 3HLFA 5IS1A 3L7HA 2R9WA 2H10A 4GDBA 1VHMA 3ZNYA 3O88A 5FI6A 4DKIA 1GSXA 4R3BA 4EW7A 4GN2A 2NUPC 4G3VA 3V3RA 3UPPA 1T1CA 3MQ0A 3OPPA 4GS9A 3B3XA 4BMWA 4HY8A 4X68A 1BULA 3RJUA 4IJGA 3G30A 3UPNA 1BTLA 4C75A 5FQQA 2W3EA 2Y55A 3VFHA 3G2ZA 3BECA 2Y91A 4YNRA 3A3IA 2YKFA 4KENB 3C5AA 2DRWA 3HLCA 4R3JA 5TJJA 3MSHA 2VGJA 3N8RA 2IA2A 2J3TC 3ZVTA 4E3LA 4D60A 3TW8A 4YFMA 4PM8A 2Z6CA 3D4FA 4EESA 1YLZA 3JVUA 3MZFA 3FKWA 4OP5A 1BZAA 1F98A 1LSWA 1LSVA 1PWCA 1GSVA 3UMDA 3VP4A 3PXPA 3M2JA 2ZC7A 4P6BA 3T4TA 3VOLA 3GVBA 5LBRA 2EX8A 4F94A 2WK0A 1YLYA 4ZDXA 3S4XA 2DNSA 3CJMA 4ZJ1A 2O9AA 2WGWB 4WUJA 2WGVA 5L07A 1WE4A 1XJ3A 3IXHA 1CF0A 5FQIA 3WWXA 5A91A 2XF3A 4K91A 3H9WA 3F1NB 1DRMA 1PZOA 3V67A 4L9FA 1TS0A 1FCMA 2E8IA 1FCNA 1I2WA 3HLBA 3ZG9B 3NIAA 1TD5A 1K4FA 2W0NA 3G34A 1SKOB 5DJUA 3VOYA 3EWKA 4MLLA 1Q2QA 4Y15A 3IX8A 4ARZA 1NJ4A 1E4DA 2A49A 4UA9A 4E3OA 4JXGA 2C6WB 1NRFA 2GDNA 5HDDA 1K25A 3NOUC 1K54A 2J3TD 1K54C 4HP9A 2HV1A 3CHWP 3DW0A 2JKRI 4OOLA 4I5SA 4Y5FA 5F82A 1XJ6A 1T18A 5F5YA 2L0WA 1YPRA 2LB9A 3ICYA 2OLVA 3ZG8B 2JKGA 3CI6A 5FAQA 5DF7A 4OPZA 1YQSA 4MN6A 4O0PA 3ITBA 4E04A 3IF6B 3HLEA 2W1TB 1FR1A 5FEFA 1H3QA 3OCNA 3KYZA 4E6WA 1TS7A 4IUKA 1L0GA 4HH3A 3RXXA 3O5YA 1VB6A 5EVIB 3F1PA 5EECA 2ZJ9A 4DE3A 1T19A 2D02A 1GA0A 3QP5A 1BT5A 3A0SA 3GTCA 3SH7A 1YM1A 1G6OA 2WZZA 2Y2GA 3QNBA 4EEUA 1LI9A 3G35A 2ZQDA 3E98A 4WEJA 4P6ZS 1OTEA 3A3FA 3C4PA 3SH9A 3SS5A 2JCHA 2RL3A 3IX3A 2W3GA 4OLDA 4KG6A 4H8RA 4Y7PA 4ETZA 4N9KA 5EOEA 4BBTA 1KOUA 1XFQA 1TS6A 2X01A 1NLZA 3QP2A 3NOPC 2QYBA 5KSCA 1K56A 1QMFA 2HZ5A 3DAVA 3UDFA 3KYEA 5FDHA 5M1AA 1TEMA 5G18A 3MS6A 2VEAA 1PFLA 3IWIA 1VEUB 1XA7A 4YINA 3S7PA 3MKEA 2XQZA 1KE3A 5FASA 2XH9A 2JKTI 5CHMA 2ZC4B 4BD1A 1ES5A 1ZHHB 3T50A 4Y2FA 4NK3A 3AGEA 4DXCA 3KSGA 3K2NA 3DTKA 3GR2A 2JN7A 3WRZA 1HZOA 2ZMAA 2EX6A 2C5WB 4JGRA 4S2NA 4S2NC 1D06A 4EQIA 2JKFA 5HFOA 4Q0IA 1YT4A 3K3DA 1W7FA 1RCJA 1SCWA 1OTIA 4DE0A 3LIEA 2XFTA 5F6AA 4U0XA 4N1HA 4FH4A 5HX9A 2QJ7A 4O8GA 5FATA 3PR6A 3C30A 3GV9A 4BWIA 2Y79A 2O99A 1GCEA 5A92A 1IYPA 3C7VA 3LCEA 2V8CA 4X1MA 5E2HA 2WGWA 2ZOHA 3TE8A 4RA7A 1F5MA 1K56D 4UHUA 4GB7A 3CZDA 4Y0TA 3FC7A 3PBQA 1PIOA 1CI8A 3F1NA 2XR0A 1DJCA 4I39A 3GDIA 4M3KA 4R1GA 5TBMB 3ZQ5A 4HEFA 3HBRA 5HSQA 3P01A 5DF8A 2EFXA 1SKOA 1S66L 1LL9A 3D72A 1K38A 3VV4A 1XXMA 1BLSA 3A3JA 5HW3A 4OP8A 2K7SA 1SDEA 2ZQCA 5GL9A 3R7WB 3OOVA 4EWFA 3V5MA 1OT6A 4BENA 1MKMA 4OQ0A 3IHAA 3UNWA 3BLMA 2WKHA 1NZUA 3FYZA 3Q1FA 4GD6A 3DTMA 5HAPA 3WS5A 3O87A 1FILA 2Y2PA 1DP9A 4HJ4A 1IOUA 1HVBA 1N9BA 5EVEA 2Q9NA 4HP4A 4QHCA 2FH5A 2ZM8A 1ES2A 3C4OA 3B33A 3MQOA 3IF6A 3IF6C 2Y2QA 1NXYA 3PYPA 4EEPA 3NJAA 1ACFA 3BW6A 2JE5A 2BG1A 2ZBBA 4S2IA 3R4KA 5JYOA 3EQUA 1Y28A 3GECA 5EVIA 5EVIC 4BBUA 1Q2PA 3G2YA 2HDUA 1RP5A 3Q07A 1TDLA 4ID4A 2PRFA 4EV4A 3IS2B 3CAXA 4G3WA 4II7A 4OQGA 4ARZB 3ZCZA 3VSKA 4MMNA 2PR5A 2XA7S 5KZHA 1OTAA 2VX8A 5D3OA 1M6KA 3CWFA 1LLBA 1C3BA 2W3FA 2ZLYA 2Q9MA 2ZL1A 4DMZA 4EERA 1VQQA 4DJ3A 2WADA 3U2AA 2VV7A 2GNXA 1WYCA 2IWCA 4I38A 2Y2MA 3LICA 3M6BA 4Y17A 1FSWA 4Y0OA 2XSSA 3OPRA 2YKHA 2GZAA 2W3DA 2M7UA 1LI0A 4EXOA 1FSYA 2WZXA 4CLCB 3KSFA 1VEUA 4UA6A 3BRMA 4DDSA 2WAEA 5J7EA 5L2FA 4Q0HA 3C8CA 1OMEA 2UV0E 3A0VA 4RX2A 1XFNA 1IELA 3HLGA 1HTZA 2Z2LB 3T1SA 3OBFA 2QPNA 5CHJA 4S2MA 3IH8A 4ESPA 5EVID 3TOIA 5FAOA 2JKRM 3T4JA 3DWZA 3HVFA 4UAAA 2VGLS 2J8YA 3KSHA 1OTBA 2A2LA 1Y4OA 2WKQA 4JF4A 2OV5A 1N9NA 1ES3A 1DY6A 2Y4AA 1W63M 2D01A 1TF1A 4E3JA 2WKRA 4XUZA 3ZHHA 1IYSA 4JXVA 3SH8A 5IHVA 3T4QA 1I2SA 4N1XA 4K0WA 3RXWA 4C6YA 2OWJA 5F1FA 2XFSA 4QD4A 2G2UA 2XLNA 3G31A 4RVAA 3N8SA 4A5RA 3NULA 4QB8A 4FD8A 3ISGA 5L10A 2ZC5B 4PM6A 3GMWA 3H7WA 4WELA 1OPXA 1K6SA 3S7QA 5J4EA 1OT9A 3S1YA 2EXBA 5TBMA 4IVKA 4R6LA 4RYEA 3L9KA 4JF6A 4O7DA 1MBLA 1K4EA 4AFIA 2V8FA 3UO9A 1K0KA 4R70A 1EW0A 5CRFA 4EUVA 2KLIA 2HPBA 1MWUA 1AXBA 5EV0A 3JYIA 4QPRA 5G4YA 3R7WA 1HLUP 1MY8A 5FL3A 3W2ZA 5FSRA 5DKKA 1T1BA 4JXSA 4WLAA 1Y54A 3SS3A 3KYQA 4D2OA 3LIBA 5M18A 4BLMA 4DE2A 4JBFA 2G2WA 3BEBA 5FAPA 2JKTM 5AQ9A 4B88A 4IVIA 3MZEA 4ZAMA 1VETB 5FI2A 2KOIA 2Z2MB 2EA9A 1PWDA 3HUOA 2P08A 1LL8A 4E3MA 1K55A 1K55C 5CHUA 1MWTA 3UDIA 2Y2LA 3MMHA 3UN7A 3HCYA 3NI9A 4X69A 2JHEA 1KVLA 1RGZA 2ZM2A 2O9CA 5FI7A 2A24B 2Y2KA 1JNUA 3T1QB 5HAQA 3WS4A 3RTYA 3IS2A 4EQ1A 4HHDA 5CERA 3BY9A 1BLCA 1DJBA 5KSHA 4DE1A 4K08A 3Q7VB 4OPYA 4UQIS 3HUNA 1CQAA 1W8YA 2P7JA 1PW8A 1UWPX 4IBRA 1S1YA 1ERMA 1PI4A 5AJGA 1PYYA 3P98A 4X55A 4KZ5A 3PBRA 1YKDA 1JTGA 3PAGA 3CG5A 5HWTA 3BFCA 1XGIA 4UEYA 4E3KA 4CLCA 4CLCC 5CTNA 4BBVA 1G28A 4Q0JA 2V1BA 2J7VA 5F83A 3BJNA 5FEGA 3FPWA 4CPKA 1MWSA 1P9WA 1BSGA 3N7WA 1N4OA 3ZG5A 3DTIA 2P04A 4P87A 4KZ7A 3I7JA 5EOOA 4HJ3A 4LV0A 2HDRA 3LGOA 4JF5A 4ZJ3A 1TS8A 1YLJA 5HWWA 2OAQ1 3ZDJA 1LL5A 3BFEA 4NETA 2X02A 2ZL1B 3PBSA 1H0MA 3MBZA 5GHXA 5FQJA 1TDGA 4S2PA 4L0LA 5EUAA 2WAFA 3BFGA 3A3EA 2G7UA 3BQ8A 2H0YA 2HP6A 1CJFA 5DJTA 4DDYA 3RH8B 1LHYA 2H0TA 2P9VB 4U0TA 1F2KA 2ACGA 5DVAA 4Z9QA 5F1GA 5E43A 2W27A 2W3HA 4BL2A 1NYYA 5HZHA 4B4ZA 4S2LA 5MC7A 3W4QA 4NEED 3UB7A 4LV2A 3C38A 4MN7A 2EFUA 2V20A 5BOHA 5A8BA 4CLCD 1YSPA 1ES4A 5CEBA 2ZMVA 5DFYA 1YLWA 4PMAA 3EGDC 2QWSA 4JKTA 1IYQA 3EQVA 5CX7A 4OPRA 1JTDA 5AQ7A 3ZYTA 2PBDP 3MFDA 5JYPA 2PBYA 4P85A 4HESA 1W79A 2QMIA 1XX2A 3NECA 3UB8A 1ONHA 3O86A 5GLDA 2HJ9C 2GX5A 1L3LA 4HQAA 1CEFA 2BTFP 3S7NA 4MN5A 3KO6A 1ODVA 1G5UA 5I5LA 1ERQA 1ALQA 1L0FA 2KX6A 4EU0A 1VETA 4H6JB 2Z6DA 3H7WB 1L2SA 1NLYA 4JGOA 4MNRA 2OLUA 5HWVA 1J9MA 3N4IA 1OTDA 5FQ9A 1IKIA 4E3IA 1GHPA 2WKEA 3G32A 2WKIA 3AGDA 2A24A 4HBTA 3FWLA 1JWVA 3BLSA 4LRYC 2M7VA 2ZD8A 4M4XA 3DBAA 4BL3A 3VP3A 1KE4A 4HI4A 3NOTC 2ZQ7A 3M2KA 5EPHA 3IBJA 3PTEA 3Q7VA 1T1AA 1ONGA 5EE8A 2R9XA 3FV7A 3QNCA 2O9BA 1FQGA 4LRZE 4S2JA 2HP9A 1S6RA 3N8LA 2KDKA 3IWOA 4N9LA 3MF0A 3FG8A
chains in the Genus database with same CATH topology
3V50A 3NIAA 1BLHA 1K4FA 5FA7A 3G34A 2PU2A 4JF4A 3ZG7B 5AQAA 4KZ9A 2OV5A 1JWZA 3VOYA 1BLPA 1ES3A 1DY6A 1Q2QA 2Y4AA 2ZM0A 3NBLA 4MLLA 4E3JA 1NJ4A 4XUZA 3ZHHA 3W8KA 3ZFZA 1IYSA 4JXVA 3W4OA 5FQMA 1E4DA 2A49A 3SH8A 4MBKA 5E2GA 1FR6A 5IHVA 4UA9A 4E3OA 4JXGA 3ZNTA 1I2SA 2C6WB 1NRFA 3LY4A 2GDNA 4K0WA 4N1XA 4R4RA 3RXWA 3ZG0A 1K25A 5GLCA 5F1FA 3HL9A 2XFSA 3NY4A 5DTSA 4QD4A 3ZVWA 1K54A 1K54C 1PWGA 2G2UA 1G68A 2XLNA 4BD0A 2WGIA 1MXOA 3G31A 4RVAA 5CGWA 4LV1A 3O3VA 3OPLA 3N8SA 2ZC6B 1CI9A 4KG2A 2OSUA 2CC1A 3DW0A 3FZCA 4OQHA 4OOLA 4QB8A 4FD8A 3NCKA 3ISGA 3S22A 5F82A 4DF6A 5HL1A 3OC2A 4C3QA 2ZC5B 4PM6A 4WEKA 3NDGA 3GMWA 4HBUA 4WELA 3PBTA 1K6SA 2OLVA 3ZG8B 1IKGA 5FAQA 5DF7A 2IWDA 3S1YA 2V1ZA 1KDSA 3IF5A 4PM7A 4OPZA 3ZGAB 1YQSA 2EXBA 4OH0A 4IVKA 3ITBA 3IF6B 4OOMA 3HLEA 4RYEA 4JF6A 1FR1A 4O7DA 1MBLA 5FQKA 1O07A 1K4EA 4WM9A 3IWQA 2XD5A 2HDQA 3TG9A 3OCNA 2B5RA 4FH2A 3UO9A 4KZBA 3Q7ZA 4X56A 1JWPA 1H8ZA 4E6WA 3Q81A 5CRFA 3QHYA 3VP0A 1L0GA 3RXXA 2HPBA 1MWUA 2X71A 1KGEA 3NC8A 5CGXA 1RGYA 4BJPA 1AXBA 4B4XA 3JYIA 5EVIB 5EECA 2ZJ9A 4DE3A 2ZQ9A 4OLGA 1EI5A 1GA0A 4ZTKA 1BT5A 3GTCA 2Y59A 1PW1A 3SH7A 1YM1A 2WZZA 2Y2GA 2FFFB 1MY8A 3VMAA 3QNBA 5FSRA 3LO7A 1LI9A 2P9VA 3IXBA 1ZC2A 3G35A 4JXSA 2ZQDA 2J9PA 3IT9A 1Y54A 3SS3A 4D2OA 4WEJA 5DF9A 3DWKA 3HLWA 4R23A 4GNUA 3A3FA 5M18A 3C4PA 3CMZA 3IH9A 3SH9A 3SS5A 5EVLA 4BLMA 4DE2A 2JCHA 2HP5A 4JBFA 2G2WA 3WS2A 2RL3A 4OLDA 4KG6A 1G6AA 3BEBA 2ZC3B 4H8RA 4Y7PA 1XP4A 5FAPA 2V2FF 3MXSA 1SDNA 2RCXA 5M19A 5AQ9A 4B88A 4KZ4A 4IVIA 3MZEA 4PM9A 3OZHA 4ZAMA 4N9KA 5EOEA 4QJGA 5FI2A 4LCLA 3WS0A 2X01A 2Z2MB 1SKFA 3AGFA 1PWDA 3HUOA 4LCMA 3IHBA 3IQAA 4E3MA 4WZ5A 5KSCA 4WZ5C 3VP2A 4MBHA 4WBGA 3UPOA 1K56A 1QMFA 1K55A 4LENA 1K55C 5CHUA 1MWTA 3NDEA 3UDIA 3UDFA 3OCLA 3W4PA 1MWRA 2Y2LA 5FDHA 2J9OA 4P0MA 4U3TA 1TEMA 5M1AA 3UN7A 3BM6A 4X69A 3NI9A 1E3UA 5G18A 4EBLA 1KVLA 1RGZA 1H8YA 2ZM2A 3IWIA 2XEPA 4ZJ2A 5FI7A 1KGFA 1XA7A 1YMSA 2Y2KA 4X53A 4YINA 5HAQA 3WS4A 3IXDA 1NYMA 2A3UA 4EBPA 1E25A 3MKEA 1Z6FA 2XQZA 4LV3A 1KE3A 5FASA 5TGFA 2XH9A 1K57A 2ZC4B 5CHMA 5CERA 1K57C 1BLCA 1BUEA 1DJBA 3LY3A 5KMWA 4BD1A 5KSHA 4MEZA 1MKIA 1CEGA 1ES5A 4DE1A 4KZ8A 5E2EA 4WZ4A 2Y2IA 3Q7VB 4OPYA 2UWXA 1YLPA 2WYXA 3HUNA 4NK3A 3AGEA 4E6XA 1DJAA 4DXCA 2PU4A 1W8YA 1IEMA 3VP1A 1PW8A 4X6TA 1ZKJA 2EXAA 5I94A 3GR2A 4IBRA 3BYDA 4RX3A 3MXRA 1ERMA 1ESIA 1PI4A 1HZOA 1EROA 4N92A 4KZ3A 3WRZA 4QU3A 1PYYA 3BFDA 3P98A 5HAIA 4X55A 2ZMAA 3VOZA 2EX6A 3G4PA 4KZ5A 2C5WB 2VGKA 3PBRA 4S2NA 4S2NC 3A3DA 1H5XA 1JTGA 1XPBA 3PAGA 3CG5A 4EQIA 3GQZA 4XUXA 5HFOA 5CECA 1YT4A 4JXWA 3BFCA 4KQOA 3C7UA 1W7FA 3FKVA 1RCJA 1SCWA 1XGIA 1IYOA 3LEZA 4FCFA 4E3KA 3MZDA 4DE0A 4JLFA 4C6YA 5E2FA 5CTNA 1CK3A 4OOYA 2XFTA 2J7VA 5TR7A 3V3SA 4KG5A 5U47A 4KQRA 4U0XA 4N1HA 4FH4A 5HX9A 1NZOA 1GHMA 1I5QA 1YLTA 5FATA 2WUQA 5F83A 4UA7A 3MKFA 2ZQ8A 3GV9A 4ZBEA 4CPKA 1MPLA 1W5DA 1VM1A 4OKPA 1GCEA 1MWSA 4OPQA 5A92A 1IYPA 5A93A 3C7VA 1BSGA 3LCEA 1ZG4A 3N7WA 5E2HA 1N4OA 3HUMA 1FOFA 2P74A 2WGWA 4IBXA 1NY0A 3ZG5A 4P87A 4KZ7A 2QZ6A 3I7JA 1HD8A 4RA7A 5EOOA 5CXWA 4K0XA 4GDNA 1QMEA 1K56D 4UHUA 4LV0A 2HDRA 4GB7A 4JF5A 4ZJ3A 3CZDA 4Y0TA 3PBQA 1YLJA 1E3UD 1CI8A 1GHIA 1PIOA 3ITAA 5CTMA 4DXBA 2XR0A 1DJCA 3ZDJA 4KZAA 4Q8IA 4M3KA 1LL5A 3BFEA 4R1GA 5GHZA 4GKUA 1FCOA 1ESUA 4HEFA 3HBRA 4NETA 5DF8A 1O7EA 2X02A 5A90A 3SS4A 3PBSA 1XGJA 2EFXA 3MBZA 5GHXA 5FQJA 1KDWA 1TDGA 4S2PA 1LL9A 3UY6A 4L0LA 2XD1A 5EUAA 1K38A 1L0EA 4EBNA 2Y2NA 2WAFA 2XGNA 2I72A 3BFGA 3A3EA 1XXMA 3SOIA 3GRJA 1BLSA 4BQMA 5CEDA 3A3JA 5HW3A 4OP8A 2H0YA 2HP6A 5TFQA 1SDEA 2Y2OA 4WMCA 2XK1A 4DDYA 4EUZA 2ZQCA 5GL9A 2BLSA 1LHYA 4EWFA 3V5MA 2H0TA 4BENA 3HLDA 4S2KA 2P9VB 4OQ0A 4U0TA 4XXRA 5GHYA 3IHAA 3UNWA 3BLMA 3M6HA 2WKHA 1ZG6A 3N6IA 5DVAA 4KQQA 4Z9QA 5F1GA 2IWBA 3GSGA 4WYYA 5E43A 1NZUA 3FYZA 4BL2A 3Q1FA 1EWZA 1NYYA 4GD6A 3DTMA 3VSLA 4S2LA 3WS5A 4B4ZA 3O87A 5HAPA 4OONA 3W4QA 4R4SA 4LV2A 2Y2PA 4JPMA 3TSGA 1XA1A 3E2KA 3Q82A 2EFUA 2V20A 5BOHA 1KGGA 1YMXA 1HVBA 1N9BA 2Q9NA 3PAEA 1GA9A 4QHCA 5AQBA 4DRTA 1ES4A 2ZM8A 1ES2A 5CEBA 3C4OA 3IF6A 5GLBA 3IF6C 3UE1A 2HDSA 1SHVA 2Y2QA 1S0WA 1YLWA 1NXYA 2FFYA 4PMAA 3VFFA 3HLFA 5HARA 3BFFA 2R9WA 1JVJA 2H10A 4GDBA 2JE5A 3ZNYA 3O88A 5FI6A 2BG1A 4QY5A 4DKIA 5GLAA 4JKTA 1M40A 4MBFA 4R3BA 4S2IA 1IYQA 3EQVA 4GN2A 5JYOA 3EQUA 4GOGA 4OPRA 3V3RA 2XDMA 3UPPA 1JTDA 5AQ7A 5EVIA 1L0DA 5EVIC 3OPPA 2EX2A 1Q2PA 3B3XA 3G2YA 3MFDA 5JYPA 4X68A 2HDUA 2PBYA 4P85A 2JBFA 1RP5A 1BULA 4HESA 3Q07A 3RJUA 3IXGA 1TDLA 3G30A 1W79A 2QMIA 1K6RA 1XX2A 3HREA 4ID4A 4Y0UA 1ONHA 3O86A 3UPNA 1BTLA 4C75A 5GLDA 3WS1A 4EV4A 4OQGA 1TVFA 5FQQA 3ZCZA 3VSKA 2Y55A 3VFHA 5KZHA 3BECA 3G2ZA 2DCFA 1PI5A 2Y91A 1WYBA 3A3IA 1KE0A 4PM5A 4KENB 1CEFA 5D3OA 1M6KA 3C5AA 2DRWA 1LLBA 1C3BA 3HLCA 4R3JA 2ZLYA 2Q9MA 1ERQA 1ALQA 4QY6A 4E3NA 1VQQA 1L0FA 2VGJA 3N8RA 5DTTA 2WADA 3ZVTA 4E3LA 1L2SA 1WYCA 3P09A 4WMCD 4MNRA 2IWCA 2Y2MA 3M6BA 4YFMA 2OLUA 4IEDA 2Y2HA 1FSWA 2Y2JA 1J9MA 3OPRA 4FSFA 4PM8A 4Y0OA 3UE3A 3N4IA 5FQ9A 3D4FA 1IKIA 1LI0A 4E3IA 1YLZA 4OQIA 3MZFA 4R0QA 2WZXA 1FSYA 1GHPA 2WKEA 3G32A 1W8QA 3PBNA 3FKWA 4OVDA 4OP5A 2WKIA 1BZAA 4A5RA 3AGDA 3E2LA 2ZQAA 4GD8A 4HBTA 3FWLA 1JWVA 1PWCA 3BLSA 3VP4A 2H5SA 2ZD8A 4UA6A 3M2JA 2ZC7A 4BL3A 3OPHA 3VP3A 1KE4A 3BRMA 4P6BA 4DDSA 3GVBA 1KVMA 2WAEA 2EX8A 5L2FA 4F94A 2WK0A 2ZQ7A 1YLYA 3UE0A 3M2KA 4ZDXA 5EPHA 3S4XA 2JC7A 2DNSA 3CJMA 3PTEA 1OMEA 4S2OA 4ZJ1A 2WGWB 3PBOA 3Q7VA 5CGSA 2WGVA 4RX2A 1U60A 5DTKA 1IELA 1WE4A 1ONGA 3HLGA 5EE8A 2R9XA 1HTZA 2EX9A 3FV7A 3QNCA 4KZ6A 2Z2LB 3IXHA 3V39A 2QPNA 5CHJA 1FQGA 3IH8A 4S2MA 5FQIA 4S2JA 5A91A 2XF3A 4K91A 3WWXA 4CJNA 2HP9A 5J8XA 1S6RA 1PZOA 5EVID 3N8LA 3TOIA 5FAOA 3IWOA 2E8IA 1FCMA 4GZBA 4N9LA 4PPRA 1FCNA 1PZPA 1XKZA 3DWZA 1I2WA 3WRTA 3HVFA 4UAAA 3UDXA 3HLBA 2J8YA 3ZG9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V50 A;  3NIA A;  1BLH A;  1K4F A;  5FA7 A;  3G34 A;  2PU2 A;  4JF4 A;  3ZG7 B;  5AQA A;  4KZ9 A;  2OV5 A;  1JWZ A;  3VOY A;  1BLP A;  1ES3 A;  1DY6 A;  1Q2Q A;  2Y4A A;  2ZM0 A;  3NBL A;  4MLL A;  4E3J A;  1NJ4 A;  4XUZ A;  3ZHH A;  3W8K A;  3ZFZ A;  1IYS A;  4JXV A;  3W4O A;  5FQM A;  1E4D A;  2A49 A;  3SH8 A;  4MBK A;  5E2G A;  1FR6 A;  5IHV A;  4UA9 A;  4E3O A;  4JXG A;  3ZNT A;  1I2S A;  2C6W B;  1NRF A;  3LY4 A;  2GDN A;  4K0W A;  4N1X A;  4R4R A;  3RXW A;  3ZG0 A;  1K25 A;  5GLC A;  5F1F A;  3HL9 A;  2XFS A;  3NY4 A;  5DTS A;  4QD4 A;  3ZVW A;  1K54 A;  1K54 C;  1PWG A;  2G2U A;  1G68 A;  2XLN A;  4BD0 A;  2WGI A;  1MXO A;  3G31 A;  4RVA A;  5CGW A;  4LV1 A;  3O3V A;  3OPL A;  3N8S A;  2ZC6 B;  1CI9 A;  4KG2 A;  2OSU A;  2CC1 A;  3DW0 A;  3FZC A;  4OQH A;  4OOL A;  4QB8 A;  4FD8 A;  3NCK A;  3ISG A;  3S22 A;  5F82 A;  4DF6 A;  5HL1 A;  3OC2 A;  4C3Q A;  2ZC5 B;  4PM6 A;  4WEK A;  3NDG A;  3GMW A;  4HBU A;  4WEL A;  3PBT A;  1K6S A;  2OLV A;  3ZG8 B;  1IKG A;  5FAQ A;  5DF7 A;  2IWD A;  3S1Y A;  2V1Z A;  1KDS A;  3IF5 A;  4PM7 A;  4OPZ A;  3ZGA B;  1YQS A;  2EXB A;  4OH0 A;  4IVK A;  3ITB A;  3IF6 B;  4OOM A;  3HLE A;  4RYE A;  4JF6 A;  1FR1 A;  4O7D A;  1MBL A;  5FQK A;  1O07 A;  1K4E A;  4WM9 A;  3IWQ A;  2XD5 A;  2HDQ A;  3TG9 A;  3OCN A;  2B5R A;  4FH2 A;  3UO9 A;  4KZB A;  3Q7Z A;  4X56 A;  1JWP A;  1H8Z A;  4E6W A;  3Q81 A;  5CRF A;  3QHY A;  3VP0 A;  1L0G A;  3RXX A;  2HPB A;  1MWU A;  2X71 A;  1KGE A;  3NC8 A;  5CGX A;  1RGY A;  4BJP A;  1AXB A;  4B4X A;  3JYI A;  5EVI B;  5EEC A;  2ZJ9 A;  4DE3 A;  2ZQ9 A;  4OLG A;  1EI5 A;  1GA0 A;  4ZTK A;  1BT5 A;  3GTC A;  2Y59 A;  1PW1 A;  3SH7 A;  1YM1 A;  2WZZ A;  2Y2G A;  2FFF B;  1MY8 A;  3VMA A;  3QNB A;  5FSR A;  3LO7 A;  1LI9 A;  2P9V A;  3IXB A;  1ZC2 A;  3G35 A;  4JXS A;  2ZQD A;  2J9P A;  3IT9 A;  1Y54 A;  3SS3 A;  4D2O A;  4WEJ A;  5DF9 A;  3DWK A;  3HLW A;  4R23 A;  4GNU A;  3A3F A;  5M18 A;  3C4P A;  3CMZ A;  3IH9 A;  3SH9 A;  3SS5 A;  5EVL A;  4BLM A;  4DE2 A;  2JCH A;  2HP5 A;  4JBF A;  2G2W A;  3WS2 A;  2RL3 A;  4OLD A;  4KG6 A;  1G6A A;  3BEB A;  2ZC3 B;  4H8R A;  4Y7P A;  1XP4 A;  5FAP A;  2V2F F;  3MXS A;  1SDN A;  2RCX A;  5M19 A;  5AQ9 A;  4B88 A;  4KZ4 A;  4IVI A;  3MZE A;  4PM9 A;  3OZH A;  4ZAM A;  4N9K A;  5EOE A;  4QJG A;  5FI2 A;  4LCL A;  3WS0 A;  2X01 A;  2Z2M B;  1SKF A;  3AGF A;  1PWD A;  3HUO A;  4LCM A;  3IHB A;  3IQA A;  4E3M A;  4WZ5 A;  5KSC A;  4WZ5 C;  3VP2 A;  4MBH A;  4WBG A;  3UPO A;  1K56 A;  1QMF A;  1K55 A;  4LEN A;  1K55 C;  5CHU A;  1MWT A;  3NDE A;  3UDI A;  3UDF A;  3OCL A;  3W4P A;  1MWR A;  2Y2L A;  5FDH A;  2J9O A;  4P0M A;  4U3T A;  1TEM A;  5M1A A;  3UN7 A;  3BM6 A;  4X69 A;  3NI9 A;  1E3U A;  5G18 A;  4EBL A;  1KVL A;  1RGZ A;  1H8Y A;  2ZM2 A;  3IWI A;  2XEP A;  4ZJ2 A;  5FI7 A;  1KGF A;  1XA7 A;  1YMS A;  2Y2K A;  4X53 A;  4YIN A;  5HAQ A;  3WS4 A;  3IXD A;  1NYM A;  2A3U A;  4EBP A;  1E25 A;  3MKE A;  1Z6F A;  2XQZ A;  4LV3 A;  1KE3 A;  5FAS A;  5TGF A;  2XH9 A;  1K57 A;  2ZC4 B;  5CHM A;  5CER A;  1K57 C;  1BLC A;  1BUE A;  1DJB A;  3LY3 A;  5KMW A;  4BD1 A;  5KSH A;  4MEZ A;  1MKI A;  1CEG A;  1ES5 A;  4DE1 A;  4KZ8 A;  5E2E A;  4WZ4 A;  2Y2I A;  3Q7V B;  4OPY A;  2UWX A;  1YLP A;  2WYX A;  3HUN A;  4NK3 A;  3AGE A;  4E6X A;  1DJA A;  4DXC A;  2PU4 A;  1W8Y A;  1IEM A;  3VP1 A;  1PW8 A;  4X6T A;  1ZKJ A;  2EXA A;  5I94 A;  3GR2 A;  4IBR A;  3BYD A;  4RX3 A;  3MXR A;  1ERM A;  1ESI A;  1PI4 A;  1HZO A;  1ERO A;  4N92 A;  4KZ3 A;  3WRZ A;  4QU3 A;  1PYY A;  3BFD A;  3P98 A;  5HAI A;  4X55 A;  2ZMA A;  3VOZ A;  2EX6 A;  3G4P A;  4KZ5 A;  2C5W B;  2VGK A;  3PBR A;  4S2N A;  4S2N C;  3A3D A;  1H5X A;  1JTG A;  1XPB A;  3PAG A;  3CG5 A;  4EQI A;  3GQZ A;  4XUX A;  5HFO A;  5CEC A;  1YT4 A;  4JXW A;  3BFC A;  4KQO A;  3C7U A;  1W7F A;  3FKV A;  1RCJ A;  1SCW A;  1XGI A;  1IYO A;  3LEZ A;  4FCF A;  4E3K A;  3MZD A;  4DE0 A;  4JLF A;  4C6Y A;  5E2F A;  5CTN A;  1CK3 A;  4OOY A;  2XFT A;  2J7V A;  5TR7 A;  3V3S A;  4KG5 A;  5U47 A;  4KQR A;  4U0X A;  4N1H A;  4FH4 A;  5HX9 A;  1NZO A;  1GHM A;  1I5Q A;  1YLT A;  5FAT A;  2WUQ A;  5F83 A;  4UA7 A;  3MKF A;  2ZQ8 A;  3GV9 A;  4ZBE A;  4CPK A;  1MPL A;  1W5D A;  1VM1 A;  4OKP A;  1GCE A;  1MWS A;  4OPQ A;  5A92 A;  1IYP A;  5A93 A;  3C7V A;  1BSG A;  3LCE A;  1ZG4 A;  3N7W A;  5E2H A;  1N4O A;  3HUM A;  1FOF A;  2P74 A;  2WGW A;  4IBX A;  1NY0 A;  3ZG5 A;  4P87 A;  4KZ7 A;  2QZ6 A;  3I7J A;  1HD8 A;  4RA7 A;  5EOO A;  5CXW A;  4K0X A;  4GDN A;  1QME A;  1K56 D;  4UHU A;  4LV0 A;  2HDR A;  4GB7 A;  4JF5 A;  4ZJ3 A;  3CZD A;  4Y0T A;  3PBQ A;  1YLJ A;  1E3U D;  1CI8 A;  1GHI A;  1PIO A;  3ITA A;  5CTM A;  4DXB A;  2XR0 A;  1DJC A;  3ZDJ A;  4KZA A;  4Q8I A;  4M3K A;  1LL5 A;  3BFE A;  4R1G A;  5GHZ A;  4GKU A;  1FCO A;  1ESU A;  4HEF A;  3HBR A;  4NET A;  5DF8 A;  1O7E A;  2X02 A;  5A90 A;  3SS4 A;  3PBS A;  1XGJ A;  2EFX A;  3MBZ A;  5GHX A;  5FQJ A;  1KDW A;  1TDG A;  4S2P A;  1LL9 A;  3UY6 A;  4L0L A;  2XD1 A;  5EUA A;  1K38 A;  1L0E A;  4EBN A;  2Y2N A;  2WAF A;  2XGN A;  2I72 A;  3BFG A;  3A3E A;  1XXM A;  3SOI A;  3GRJ A;  1BLS A;  4BQM A;  5CED A;  3A3J A;  5HW3 A;  4OP8 A;  2H0Y A;  2HP6 A;  5TFQ A;  1SDE A;  2Y2O A;  4WMC A;  2XK1 A;  4DDY A;  4EUZ A;  2ZQC A;  5GL9 A;  2BLS A;  1LHY A;  4EWF A;  3V5M A;  2H0T A;  4BEN A;  3HLD A;  4S2K A;  2P9V B;  4OQ0 A;  4U0T A;  4XXR A;  5GHY A;  3IHA A;  3UNW A;  3BLM A;  3M6H A;  2WKH A;  1ZG6 A;  3N6I A;  5DVA A;  4KQQ A;  4Z9Q A;  5F1G A;  2IWB A;  3GSG A;  4WYY A;  5E43 A;  1NZU A;  3FYZ A;  4BL2 A;  3Q1F A;  1EWZ A;  1NYY A;  4GD6 A;  3DTM A;  3VSL A;  4S2L A;  3WS5 A;  4B4Z A;  3O87 A;  5HAP A;  4OON A;  3W4Q A;  4R4S A;  4LV2 A;  2Y2P A;  4JPM A;  3TSG A;  1XA1 A;  3E2K A;  3Q82 A;  2EFU A;  2V20 A;  5BOH A;  1KGG A;  1YMX A;  1HVB A;  1N9B A;  2Q9N A;  3PAE A;  1GA9 A;  4QHC A;  5AQB A;  4DRT A;  1ES4 A;  2ZM8 A;  1ES2 A;  5CEB A;  3C4O A;  3IF6 A;  5GLB A;  3IF6 C;  3UE1 A;  2HDS A;  1SHV A;  2Y2Q A;  1S0W A;  1YLW A;  1NXY A;  2FFY A;  4PMA A;  3VFF A;  3HLF A;  5HAR A;  3BFF A;  2R9W A;  1JVJ A;  2H10 A;  4GDB A;  2JE5 A;  3ZNY A;  3O88 A;  5FI6 A;  2BG1 A;  4QY5 A;  4DKI A;  5GLA A;  4JKT A;  1M40 A;  4MBF A;  4R3B A;  4S2I A;  1IYQ A;  3EQV A;  4GN2 A;  5JYO A;  3EQU A;  4GOG A;  4OPR A;  3V3R A;  2XDM A;  3UPP A;  1JTD A;  5AQ7 A;  5EVI A;  1L0D A;  5EVI C;  3OPP A;  2EX2 A;  1Q2P A;  3B3X A;  3G2Y A;  3MFD A;  5JYP A;  4X68 A;  2HDU A;  2PBY A;  4P85 A;  2JBF A;  1RP5 A;  1BUL A;  4HES A;  3Q07 A;  3RJU A;  3IXG A;  1TDL A;  3G30 A;  1W79 A;  2QMI A;  1K6R A;  1XX2 A;  3HRE A;  4ID4 A;  4Y0U A;  1ONH A;  3O86 A;  3UPN A;  1BTL A;  4C75 A;  5GLD A;  3WS1 A;  4EV4 A;  4OQG A;  1TVF A;  5FQQ A;  3ZCZ A;  3VSK A;  2Y55 A;  3VFH A;  5KZH A;  3BEC A;  3G2Z A;  2DCF A;  1PI5 A;  2Y91 A;  1WYB A;  3A3I A;  1KE0 A;  4PM5 A;  4KEN B;  1CEF A;  5D3O A;  1M6K A;  3C5A A;  2DRW A;  1LLB A;  1C3B A;  3HLC A;  4R3J A;  2ZLY A;  2Q9M A;  1ERQ A;  1ALQ A;  4QY6 A;  4E3N A;  1VQQ A;  1L0F A;  2VGJ A;  3N8R A;  5DTT A;  2WAD A;  3ZVT A;  4E3L A;  1L2S A;  1WYC A;  3P09 A;  4WMC D;  4MNR A;  2IWC A;  2Y2M A;  3M6B A;  4YFM A;  2OLU A;  4IED A;  2Y2H A;  1FSW A;  2Y2J A;  1J9M A;  3OPR A;  4FSF A;  4PM8 A;  4Y0O A;  3UE3 A;  3N4I A;  5FQ9 A;  3D4F A;  1IKI A;  1LI0 A;  4E3I A;  1YLZ A;  4OQI A;  3MZF A;  4R0Q A;  2WZX A;  1FSY A;  1GHP A;  2WKE A;  3G32 A;  1W8Q A;  3PBN A;  3FKW A;  4OVD A;  4OP5 A;  2WKI A;  1BZA A;  4A5R A;  3AGD A;  3E2L A;  2ZQA A;  4GD8 A;  4HBT A;  3FWL A;  1JWV A;  1PWC A;  3BLS A;  3VP4 A;  2H5S A;  2ZD8 A;  4UA6 A;  3M2J A;  2ZC7 A;  4BL3 A;  3OPH A;  3VP3 A;  1KE4 A;  3BRM A;  4P6B A;  4DDS A;  3GVB A;  1KVM A;  2WAE A;  2EX8 A;  5L2F A;  4F94 A;  2WK0 A;  2ZQ7 A;  1YLY A;  3UE0 A;  3M2K A;  4ZDX A;  5EPH A;  3S4X A;  2JC7 A;  2DNS A;  3CJM A;  3PTE A;  1OME A;  4S2O A;  4ZJ1 A;  2WGW B;  3PBO A;  3Q7V A;  5CGS A;  2WGV A;  4RX2 A;  1U60 A;  5DTK A;  1IEL A;  1WE4 A;  1ONG A;  3HLG A;  5EE8 A;  2R9X A;  1HTZ A;  2EX9 A;  3FV7 A;  3QNC A;  4KZ6 A;  2Z2L B;  3IXH A;  3V39 A;  2QPN A;  5CHJ A;  1FQG A;  3IH8 A;  4S2M A;  5FQI A;  4S2J A;  5A91 A;  2XF3 A;  4K91 A;  3WWX A;  4CJN A;  2HP9 A;  5J8X A;  1S6R A;  1PZO A;  5EVI D;  3N8L A;  3TOI A;  5FAO A;  3IWO A;  2E8I A;  1FCM A;  4GZB A;  4N9L A;  4PPR A;  1FCN A;  1PZP A;  1XKZ A;  3DWZ A;  1I2W A;  3WRT A;  3HVF A;  4UAA A;  3UDX A;  3HLB A;  2J8Y A;  3ZG9 B; 
#chains in the Genus database with same CATH topology
 3ZG7 B;  1BLP A;  3NBL A;  3CLO A;  4HNB A;  3W8K A;  3W4O A;  3JPU A;  3IBR A;  4R4R A;  3LY4 A;  4JGP A;  3ZG0 A;  3UME A;  5GLC A;  3DTE A;  3HL9 A;  4BD0 A;  2WGI A;  5CGW A;  2HGV A;  4LV1 A;  3O3V A;  4LRX C;  1NWZ A;  1CI9 A;  4KG2 A;  3FZC A;  2CC1 A;  4OQH A;  3ZNT A;  4DF6 A;  3NCK A;  3S22 A;  5HL1 A;  1GSW A;  3OC2 A;  4WEK A;  5AVF A;  3D9Y A;  4MCW A;  2IWD A;  2V1Z A;  3IF5 A;  4PM7 A;  3ZGA B;  4OH0 A;  2AVX A;  1O07 A;  4WM9 A;  3IWQ A;  4I3J A;  4I3A A;  3EEH A;  2B5R A;  4KZB A;  4X56 A;  1JWP A;  3Q81 A;  3VP0 A;  2VLG A;  4FTX A;  2X71 A;  1RGY A;  4BJP A;  4NXG A;  4PAU A;  4OLG A;  1EI5 A;  4ZTK A;  1PW1 A;  2VGL M;  2FFF B;  4NXF A;  3VMA A;  1X0O A;  2P9V A;  2VA0 A;  3IXB A;  3MFX A;  3IT9 A;  1S4S A;  5DF9 A;  3EGX C;  4GNU A;  3G6O A;  3F1O B;  3IH9 A;  2HP5 A;  3WS2 A;  1G6A A;  2E8J A;  2RCX A;  5M19 A;  4KZ4 A;  4PM9 A;  5HD5 A;  4I3I A;  3HJK A;  3TJZ C;  1OJG A;  1STZ A;  5DKL A;  1WA9 A;  4LCM A;  4Y13 A;  4DJ2 A;  4NG2 A;  3A0R A;  3KX0 X;  3VP2 A;  4MBH A;  3IX4 A;  1J3W A;  4XT2 B;  3NDE A;  3OCL A;  1MWR A;  2INW A;  4P0M A;  4GLQ A;  4EBL A;  2LB5 A;  1H8Y A;  3T4O A;  1D7E A;  1Z09 A;  1W63 Q;  1KGF A;  4X53 A;  4G3K A;  3IXD A;  3D3O A;  2B18 A;  4EBP A;  5TGF A;  1K57 A;  1K57 C;  4PHT A;  1BUE A;  5KMW A;  1CEG A;  4LLO B;  4WN5 A;  2UWX A;  2FZ0 A;  5K5B A;  3FPV A;  1DJA A;  2Y8H A;  2PU4 A;  1IFQ A;  4X1L A;  3C2W A;  5I94 A;  3BYD A;  4RX3 A;  3MXQ A;  3NHQ A;  1ERO A;  4N92 A;  4KZ3 A;  4H6J A;  4QU3 A;  5C5K A;  3LR4 A;  3G4P A;  3A3D A;  1H5X A;  3GQZ A;  4XUX A;  2MJ6 A;  3H82 B;  5CEC A;  2V0U A;  4JXW A;  4KQO A;  3C7U A;  3FKV A;  3MZD A;  4JLF A;  4CLC E;  1CK3 A;  4OOY A;  3QP1 A;  5TR7 A;  4KG5 A;  1N9O A;  5U47 A;  4KQR A;  1GHM A;  1YLT A;  2WUQ A;  2VZW A;  2EWW A;  3MKF A;  2PYP A;  2W1R A;  3LEQ A;  3LFV A;  3P7N A;  3BQA A;  1MPL A;  1VM1 A;  3CPT A;  1BYW A;  2DMW A;  4OPQ A;  3T4L A;  3HUM A;  4IBX A;  1NY0 A;  1HD8 A;  3ULF A;  5CXW A;  4F3L B;  4GDN A;  3B47 A;  1QME A;  5CTM A;  4DXB A;  3ITA A;  5EM0 A;  5FDS A;  4FOF A;  4KZA A;  2B02 A;  4UQI M;  5L8M A;  1O7E A;  5A90 A;  2VJW A;  1XGJ A;  1DP6 A;  2QKP A;  1UWN X;  3QP4 A;  2XD1 A;  4NXE A;  4DN0 A;  4EBN A;  2Y2N A;  2I72 A;  2V1A A;  5CED A;  1PNE A;  5F69 A;  4WMC A;  4HH2 A;  5IU1 A;  1V9Z A;  4S2K A;  3EEA A;  2L4R A;  5GHY A;  1S67 L;  2PHY A;  1H8M A;  5F68 A;  3M6H A;  1ZG6 A;  3GSG A;  4WYY A;  4NKP A;  4WL9 A;  3VSL A;  2Q0O A;  4OON A;  2QHK A;  5HDC A;  4KQD A;  4R4S A;  5HL6 A;  3EOI A;  1XA1 A;  3Q82 A;  4KUO A;  1YMX A;  1GA9 A;  5AQB A;  4IUH A;  1D1J A;  3LIA A;  4PKY G;  2HDS A;  2FFY A;  2XRO A;  3VFF A;  2BAS A;  5HAR A;  3BFF A;  1JVJ A;  3LR0 A;  4QY5 A;  4P6Z M;  5GLA A;  1M40 A;  4MBF A;  4GOG A;  2XDM A;  3UE6 A;  1ZTU A;  1L0D A;  2EX2 A;  4NXB A;  5G4Z A;  4GCZ A;  2JBF A;  3IXG A;  2PD7 A;  2VKS A;  3UB5 P;  3HRE A;  1K6R A;  4Y0U A;  5HPF A;  2PT7 A;  3WS1 A;  1TVF A;  2PDR A;  2OWH A;  1MZU A;  2DCF A;  1PI5 A;  1WYB A;  3F1O A;  1KE0 A;  2HF6 A;  2QJ5 A;  4PM5 A;  4LGW A;  2L1M A;  4QY6 A;  4E3N A;  5DTT A;  3E4Q A;  3CUE A;  3CUE C;  3LI8 A;  4WMC D;  3P09 A;  5EM1 A;  5J3W A;  2PAV P;  4IED A;  4GHI B;  4ZRR A;  2Y2H A;  4FSF A;  2Y2J A;  3UE3 A;  1XJ4 A;  4XT2 A;  3LIF A;  5HPI A;  4OQI A;  4R0Q A;  1W8Q A;  3PBN A;  4OVD A;  3BWL A;  4YWZ A;  3E2L A;  2ZQA A;  4GD8 A;  2H5S A;  2VV8 A;  3OPH A;  4Z1W A;  1KVM A;  3UE0 A;  3S7O A;  3E4O A;  2JC7 A;  3OLO A;  3PHY A;  4S2O A;  3PBO A;  5CGS A;  5HD3 A;  5IT5 A;  1YSQ A;  1U60 A;  5DTK A;  1P0Z A;  1P97 A;  2EX9 A;  4KZ6 A;  3V39 A;  2GJ3 A;  2PYR A;  4GW9 A;  5J8X A;  4CJN A;  4GZB A;  4PPR A;  1PZP A;  1XKZ A;  3WRT A;  4FUW A;  3UDX A;  3MQQ A;  1F9I A;  3H82 A;  3V50 A;  1BLH A;  5FA7 A;  2PU2 A;  5AQA A;  4KZ9 A;  1JWZ A;  4B9O A;  3MR0 A;  2ZM0 A;  3ZFZ A;  5FQM A;  3B42 A;  1AWI A;  4MBK A;  5E2G A;  1FR6 A;  1PRQ A;  3NY4 A;  5DTS A;  3ZVW A;  1PWG A;  3SZT A;  1G68 A;  1V9Y A;  1MXO A;  2WKP A;  3OPL A;  2ZC6 B;  2OSU A;  4F3L A;  4C3Q A;  4O01 A;  3NDG A;  4HBU A;  4ETX A;  3PBT A;  2OAP 1;  4GJ4 A;  4RQ9 A;  1IKG A;  5EFW A;  1KDS A;  5AVE A;  3UB6 A;  4OOM A;  3LR3 A;  1FIK A;  5FQK A;  4QWO A;  4HJ6 A;  2XD5 A;  4MDZ A;  2HDQ A;  3TG9 A;  4EET B;  4FH2 A;  3Q7Z A;  3LUQ A;  3U4L P;  1H8Z A;  3QHY A;  2I9V A;  5CGX A;  1KGE A;  3NC8 A;  2H28 A;  4B4X A;  3VE3 A;  5L09 A;  4GS9 B;  2ZQ9 A;  3QP6 A;  2Y59 A;  1A0K A;  4WF0 A;  5KIZ A;  3LO7 A;  1ZC2 A;  2HJE A;  2J9P A;  3T1R A;  3DWK A;  3HLW A;  4KUK A;  2K2N A;  4R23 A;  2CMN A;  3CMZ A;  3T4K A;  5EVL A;  3E0Y A;  3TRC A;  1SZV A;  3CPT B;  2ZC3 B;  1XP4 A;  2V2F F;  3MXS A;  1SDN A;  4X25 A;  4R3A A;  4R38 A;  3OZH A;  4IHQ A;  4QJG A;  2K31 A;  4LCL A;  3WS0 A;  1SKF A;  3AGF A;  3IHB A;  3IQA A;  4WZ5 A;  4WZ5 C;  4WBG A;  3UPO A;  3LID A;  4LPZ A;  4LEN A;  3T12 B;  2XA7 M;  3W4P A;  2J9O A;  4U3T A;  5DFX A;  3BM6 A;  3E4P A;  1E3U A;  4L9E A;  1OJ5 A;  2XEP A;  4ZJ2 A;  3HJI A;  3JVV A;  1YMS A;  4B93 A;  1NYM A;  2A3U A;  1DP8 A;  1E25 A;  4LV3 A;  1Z6F A;  2J80 A;  2VV6 A;  2PR6 A;  1S4R A;  3LY3 A;  3VE4 A;  3T1X A;  2J3W A;  4MEZ A;  1MKI A;  1XJ2 A;  4KZ8 A;  5E2E A;  1UGU A;  4WZ4 A;  2Y2I A;  1LSX A;  1YLP A;  2WYX A;  4E6X A;  2V9A A;  3LYX A;  1IEM A;  2W1T A;  3VP1 A;  2XRN A;  4X6T A;  2ZOI A;  1ZKJ A;  2EXA A;  3BY8 A;  5HDS A;  3MXR A;  2R78 A;  1ESI A;  3SW1 A;  3BFD A;  5HAI A;  2ZMF A;  3VOZ A;  2VGK A;  3LI9 A;  3KSI A;  4GHI A;  2NUT C;  1XPB A;  4LFU A;  4L9G A;  3LR5 A;  1IYO A;  3LEZ A;  4FCF A;  2B95 A;  5E2F A;  3K3C A;  3V3S A;  4CQH A;  2V0W A;  2VK3 A;  1NZO A;  1I5Q A;  1N9L A;  4UA7 A;  2ZQ8 A;  4ZBE A;  2M1C A;  1MC0 A;  4YOF A;  4OKP A;  1W5D A;  5A93 A;  1ZG4 A;  1FOF A;  2P74 A;  1P9R A;  2QZ6 A;  4K0X A;  2OOL A;  4PKY A;  1S1Z A;  1E3U D;  1GHI A;  3MJQ A;  4HIA A;  4Q8I A;  5GHZ A;  4GKU A;  1FCO A;  1ESU A;  3T4S A;  4Y3I A;  3SS4 A;  1KDW A;  3UY6 A;  1NRJ A;  1L0E A;  4ME4 A;  2XGN A;  3CIT A;  3SOI A;  4HOI A;  3GRJ A;  4BQM A;  3F1P B;  5TFQ A;  2O0Y A;  2Y2O A;  2XK1 A;  4EUZ A;  2BLS A;  3HLD A;  4XXR A;  2PD8 A;  1LT0 A;  3N6I A;  4KQQ A;  2IWB A;  3UB9 A;  1EWZ A;  3RFB A;  4JGQ A;  2EWV A;  4JPM A;  3TSG A;  3E2K A;  1KGG A;  1YAX A;  3PAE A;  4DRT A;  5GLB A;  3QP8 A;  3UE1 A;  1SHV A;  1S0W A;  3HLF A;  5IS1 A;  3L7H A;  2R9W A;  2H10 A;  4GDB A;  1VHM A;  3ZNY A;  3O88 A;  5FI6 A;  4DKI A;  1GSX A;  4R3B A;  4EW7 A;  4GN2 A;  2NUP C;  4G3V A;  3V3R A;  3UPP A;  1T1C A;  3MQ0 A;  3OPP A;  4GS9 A;  3B3X A;  4BMW A;  4HY8 A;  4X68 A;  1BUL A;  3RJU A;  4IJG A;  3G30 A;  3UPN A;  1BTL A;  4C75 A;  5FQQ A;  2W3E A;  2Y55 A;  3VFH A;  3G2Z A;  3BEC A;  2Y91 A;  4YNR A;  3A3I A;  2YKF A;  4KEN B;  3C5A A;  2DRW A;  3HLC A;  4R3J A;  5TJJ A;  3MSH A;  2VGJ A;  3N8R A;  2IA2 A;  2J3T C;  3ZVT A;  4E3L A;  4D60 A;  3TW8 A;  4YFM A;  4PM8 A;  2Z6C A;  3D4F A;  4EES A;  1YLZ A;  3JVU A;  3MZF A;  3FKW A;  4OP5 A;  1BZA A;  1F98 A;  1LSW A;  1LSV A;  1PWC A;  1GSV A;  3UMD A;  3VP4 A;  3PXP A;  3M2J A;  2ZC7 A;  4P6B A;  3T4T A;  3VOL A;  3GVB A;  5LBR A;  2EX8 A;  4F94 A;  2WK0 A;  1YLY A;  4ZDX A;  3S4X A;  2DNS A;  3CJM A;  4ZJ1 A;  2O9A A;  2WGW B;  4WUJ A;  2WGV A;  5L07 A;  1WE4 A;  1XJ3 A;  3IXH A;  1CF0 A;  5FQI A;  3WWX A;  5A91 A;  2XF3 A;  4K91 A;  3H9W A;  3F1N B;  1DRM A;  1PZO A;  3V67 A;  4L9F A;  1TS0 A;  1FCM A;  2E8I A;  1FCN A;  1I2W A;  3HLB A;  3ZG9 B;  3NIA A;  1TD5 A;  1K4F A;  2W0N A;  3G34 A;  1SKO B;  5DJU A;  3VOY A;  3EWK A;  4MLL A;  1Q2Q A;  4Y15 A;  3IX8 A;  4ARZ A;  1NJ4 A;  1E4D A;  2A49 A;  4UA9 A;  4E3O A;  4JXG A;  2C6W B;  1NRF A;  2GDN A;  5HDD A;  1K25 A;  3NOU C;  1K54 A;  2J3T D;  1K54 C;  4HP9 A;  2HV1 A;  3CHW P;  3DW0 A;  2JKR I;  4OOL A;  4I5S A;  4Y5F A;  5F82 A;  1XJ6 A;  1T18 A;  5F5Y A;  2L0W A;  1YPR A;  2LB9 A;  3ICY A;  2OLV A;  3ZG8 B;  2JKG A;  3CI6 A;  5FAQ A;  5DF7 A;  4OPZ A;  1YQS A;  4MN6 A;  4O0P A;  3ITB A;  4E04 A;  3IF6 B;  3HLE A;  2W1T B;  1FR1 A;  5FEF A;  1H3Q A;  3OCN A;  3KYZ A;  4E6W A;  1TS7 A;  4IUK A;  1L0G A;  4HH3 A;  3RXX A;  3O5Y A;  1VB6 A;  5EVI B;  3F1P A;  5EEC A;  2ZJ9 A;  4DE3 A;  1T19 A;  2D02 A;  1GA0 A;  3QP5 A;  1BT5 A;  3A0S A;  3GTC A;  3SH7 A;  1YM1 A;  1G6O A;  2WZZ A;  2Y2G A;  3QNB A;  4EEU A;  1LI9 A;  3G35 A;  2ZQD A;  3E98 A;  4WEJ A;  4P6Z S;  1OTE A;  3A3F A;  3C4P A;  3SH9 A;  3SS5 A;  2JCH A;  2RL3 A;  3IX3 A;  2W3G A;  4OLD A;  4KG6 A;  4H8R A;  4Y7P A;  4ETZ A;  4N9K A;  5EOE A;  4BBT A;  1KOU A;  1XFQ A;  1TS6 A;  2X01 A;  1NLZ A;  3QP2 A;  3NOP C;  2QYB A;  5KSC A;  1K56 A;  1QMF A;  2HZ5 A;  3DAV A;  3UDF A;  3KYE A;  5FDH A;  5M1A A;  1TEM A;  5G18 A;  3MS6 A;  2VEA A;  1PFL A;  3IWI A;  1VEU B;  1XA7 A;  4YIN A;  3S7P A;  3MKE A;  2XQZ A;  1KE3 A;  5FAS A;  2XH9 A;  2JKT I;  5CHM A;  2ZC4 B;  4BD1 A;  1ES5 A;  1ZHH B;  3T50 A;  4Y2F A;  4NK3 A;  3AGE A;  4DXC A;  3KSG A;  3K2N A;  3DTK A;  3GR2 A;  2JN7 A;  3WRZ A;  1HZO A;  2ZMA A;  2EX6 A;  2C5W B;  4JGR A;  4S2N A;  4S2N C;  1D06 A;  4EQI A;  2JKF A;  5HFO A;  4Q0I A;  1YT4 A;  3K3D A;  1W7F A;  1RCJ A;  1SCW A;  1OTI A;  4DE0 A;  3LIE A;  2XFT A;  5F6A A;  4U0X A;  4N1H A;  4FH4 A;  5HX9 A;  2QJ7 A;  4O8G A;  5FAT A;  3PR6 A;  3C30 A;  3GV9 A;  4BWI A;  2Y79 A;  2O99 A;  1GCE A;  5A92 A;  1IYP A;  3C7V A;  3LCE A;  2V8C A;  4X1M A;  5E2H A;  2WGW A;  2ZOH A;  3TE8 A;  4RA7 A;  1F5M A;  1K56 D;  4UHU A;  4GB7 A;  3CZD A;  4Y0T A;  3FC7 A;  3PBQ A;  1PIO A;  1CI8 A;  3F1N A;  2XR0 A;  1DJC A;  4I39 A;  3GDI A;  4M3K A;  4R1G A;  5TBM B;  3ZQ5 A;  4HEF A;  3HBR A;  5HSQ A;  3P01 A;  5DF8 A;  2EFX A;  1SKO A;  1S66 L;  1LL9 A;  3D72 A;  1K38 A;  3VV4 A;  1XXM A;  1BLS A;  3A3J A;  5HW3 A;  4OP8 A;  2K7S A;  1SDE A;  2ZQC A;  5GL9 A;  3R7W B;  3OOV A;  4EWF A;  3V5M A;  1OT6 A;  4BEN A;  1MKM A;  4OQ0 A;  3IHA A;  3UNW A;  3BLM A;  2WKH A;  1NZU A;  3FYZ A;  3Q1F A;  4GD6 A;  3DTM A;  5HAP A;  3WS5 A;  3O87 A;  1FIL A;  2Y2P A;  1DP9 A;  4HJ4 A;  1IOU A;  1HVB A;  1N9B A;  5EVE A;  2Q9N A;  4HP4 A;  4QHC A;  2FH5 A;  2ZM8 A;  1ES2 A;  3C4O A;  3B33 A;  3MQO A;  3IF6 A;  3IF6 C;  2Y2Q A;  1NXY A;  3PYP A;  4EEP A;  3NJA A;  1ACF A;  3BW6 A;  2JE5 A;  2BG1 A;  2ZBB A;  4S2I A;  3R4K A;  5JYO A;  3EQU A;  1Y28 A;  3GEC A;  5EVI A;  5EVI C;  4BBU A;  1Q2P A;  3G2Y A;  2HDU A;  1RP5 A;  3Q07 A;  1TDL A;  4ID4 A;  2PRF A;  4EV4 A;  3IS2 B;  3CAX A;  4G3W A;  4II7 A;  4OQG A;  4ARZ B;  3ZCZ A;  3VSK A;  4MMN A;  2PR5 A;  2XA7 S;  5KZH A;  1OTA A;  2VX8 A;  5D3O A;  1M6K A;  3CWF A;  1LLB A;  1C3B A;  2W3F A;  2ZLY A;  2Q9M A;  2ZL1 A;  4DMZ A;  4EER A;  1VQQ A;  4DJ3 A;  2WAD A;  3U2A A;  2VV7 A;  2GNX A;  1WYC A;  2IWC A;  4I38 A;  2Y2M A;  3LIC A;  3M6B A;  4Y17 A;  1FSW A;  4Y0O A;  2XSS A;  3OPR A;  2YKH A;  2GZA A;  2W3D A;  2M7U A;  1LI0 A;  4EXO A;  1FSY A;  2WZX A;  4CLC B;  3KSF A;  1VEU A;  4UA6 A;  3BRM A;  4DDS A;  2WAE A;  5J7E A;  5L2F A;  4Q0H A;  3C8C A;  1OME A;  2UV0 E;  3A0V A;  4RX2 A;  1XFN A;  1IEL A;  3HLG A;  1HTZ A;  2Z2L B;  3T1S A;  3OBF A;  2QPN A;  5CHJ A;  4S2M A;  3IH8 A;  4ESP A;  5EVI D;  3TOI A;  5FAO A;  2JKR M;  3T4J A;  3DWZ A;  3HVF A;  4UAA A;  2VGL S;  2J8Y A;  3KSH A;  1OTB A;  2A2L A;  1Y4O A;  2WKQ A;  4JF4 A;  2OV5 A;  1N9N A;  1ES3 A;  1DY6 A;  2Y4A A;  1W63 M;  2D01 A;  1TF1 A;  4E3J A;  2WKR A;  4XUZ A;  3ZHH A;  1IYS A;  4JXV A;  3SH8 A;  5IHV A;  3T4Q A;  1I2S A;  4N1X A;  4K0W A;  3RXW A;  4C6Y A;  2OWJ A;  5F1F A;  2XFS A;  4QD4 A;  2G2U A;  2XLN A;  3G31 A;  4RVA A;  3N8S A;  4A5R A;  3NUL A;  4QB8 A;  4FD8 A;  3ISG A;  5L10 A;  2ZC5 B;  4PM6 A;  3GMW A;  3H7W A;  4WEL A;  1OPX A;  1K6S A;  3S7Q A;  5J4E A;  1OT9 A;  3S1Y A;  2EXB A;  5TBM A;  4IVK A;  4R6L A;  4RYE A;  3L9K A;  4JF6 A;  4O7D A;  1MBL A;  1K4E A;  4AFI A;  2V8F A;  3UO9 A;  1K0K A;  4R70 A;  1EW0 A;  5CRF A;  4EUV A;  2KLI A;  2HPB A;  1MWU A;  1AXB A;  5EV0 A;  3JYI A;  4QPR A;  5G4Y A;  3R7W A;  1HLU P;  1MY8 A;  5FL3 A;  3W2Z A;  5FSR A;  5DKK A;  1T1B A;  4JXS A;  4WLA A;  1Y54 A;  3SS3 A;  3KYQ A;  4D2O A;  3LIB A;  5M18 A;  4BLM A;  4DE2 A;  4JBF A;  2G2W A;  3BEB A;  5FAP A;  2JKT M;  5AQ9 A;  4B88 A;  4IVI A;  3MZE A;  4ZAM A;  1VET B;  5FI2 A;  2KOI A;  2Z2M B;  2EA9 A;  1PWD A;  3HUO A;  2P08 A;  1LL8 A;  4E3M A;  1K55 A;  1K55 C;  5CHU A;  1MWT A;  3UDI A;  2Y2L A;  3MMH A;  3UN7 A;  3HCY A;  3NI9 A;  4X69 A;  2JHE A;  1KVL A;  1RGZ A;  2ZM2 A;  2O9C A;  5FI7 A;  2A24 B;  2Y2K A;  1JNU A;  3T1Q B;  5HAQ A;  3WS4 A;  3RTY A;  3IS2 A;  4EQ1 A;  4HHD A;  5CER A;  3BY9 A;  1BLC A;  1DJB A;  5KSH A;  4DE1 A;  4K08 A;  3Q7V B;  4OPY A;  4UQI S;  3HUN A;  1CQA A;  1W8Y A;  2P7J A;  1PW8 A;  1UWP X;  4IBR A;  1S1Y A;  1ERM A;  1PI4 A;  5AJG A;  1PYY A;  3P98 A;  4X55 A;  4KZ5 A;  3PBR A;  1YKD A;  1JTG A;  3PAG A;  3CG5 A;  5HWT A;  3BFC A;  1XGI A;  4UEY A;  4E3K A;  4CLC A;  4CLC C;  5CTN A;  4BBV A;  1G28 A;  4Q0J A;  2V1B A;  2J7V A;  5F83 A;  3BJN A;  5FEG A;  3FPW A;  4CPK A;  1MWS A;  1P9W A;  1BSG A;  3N7W A;  1N4O A;  3ZG5 A;  3DTI A;  2P04 A;  4P87 A;  4KZ7 A;  3I7J A;  5EOO A;  4HJ3 A;  4LV0 A;  2HDR A;  3LGO A;  4JF5 A;  4ZJ3 A;  1TS8 A;  1YLJ A;  5HWW A;  2OAQ 1;  3ZDJ A;  1LL5 A;  3BFE A;  4NET A;  2X02 A;  2ZL1 B;  3PBS A;  1H0M A;  3MBZ A;  5GHX A;  5FQJ A;  1TDG A;  4S2P A;  4L0L A;  5EUA A;  2WAF A;  3BFG A;  3A3E A;  2G7U A;  3BQ8 A;  2H0Y A;  2HP6 A;  1CJF A;  5DJT A;  4DDY A;  3RH8 B;  1LHY A;  2H0T A;  2P9V B;  4U0T A;  1F2K A;  2ACG A;  5DVA A;  4Z9Q A;  5F1G A;  5E43 A;  2W27 A;  2W3H A;  4BL2 A;  1NYY A;  5HZH A;  4B4Z A;  4S2L A;  5MC7 A;  3W4Q A;  4NEE D;  3UB7 A;  4LV2 A;  3C38 A;  4MN7 A;  2EFU A;  2V20 A;  5BOH A;  5A8B A;  4CLC D;  1YSP A;  1ES4 A;  5CEB A;  2ZMV A;  5DFY A;  1YLW A;  4PMA A;  3EGD C;  2QWS A;  4JKT A;  1IYQ A;  3EQV A;  5CX7 A;  4OPR A;  1JTD A;  5AQ7 A;  3ZYT A;  2PBD P;  3MFD A;  5JYP A;  2PBY A;  4P85 A;  4HES A;  1W79 A;  2QMI A;  1XX2 A;  3NEC A;  3UB8 A;  1ONH A;  3O86 A;  5GLD A;  2HJ9 C;  2GX5 A;  1L3L A;  4HQA A;  1CEF A;  2BTF P;  3S7N A;  4MN5 A;  3KO6 A;  1ODV A;  1G5U A;  5I5L A;  1ERQ A;  1ALQ A;  1L0F A;  2KX6 A;  4EU0 A;  1VET A;  4H6J B;  2Z6D A;  3H7W B;  1L2S A;  1NLY A;  4JGO A;  4MNR A;  2OLU A;  5HWV A;  1J9M A;  3N4I A;  1OTD A;  5FQ9 A;  1IKI A;  4E3I A;  1GHP A;  2WKE A;  3G32 A;  2WKI A;  3AGD A;  2A24 A;  4HBT A;  3FWL A;  1JWV A;  3BLS A;  4LRY C;  2M7V A;  2ZD8 A;  4M4X A;  3DBA A;  4BL3 A;  3VP3 A;  1KE4 A;  4HI4 A;  3NOT C;  2ZQ7 A;  3M2K A;  5EPH A;  3IBJ A;  3PTE A;  3Q7V A;  1T1A A;  1ONG A;  5EE8 A;  2R9X A;  3FV7 A;  3QNC A;  2O9B A;  1FQG A;  4LRZ E;  4S2J A;  2HP9 A;  1S6R A;  3N8L A;  2KDK A;  3IWO A;  4N9L A;  3MF0 A;  3FG8 A; 
#chains in the Genus database with same CATH homology
 3V50 A;  3NIA A;  1BLH A;  1K4F A;  5FA7 A;  3G34 A;  2PU2 A;  4JF4 A;  3ZG7 B;  5AQA A;  4KZ9 A;  2OV5 A;  1JWZ A;  3VOY A;  1BLP A;  1ES3 A;  1DY6 A;  1Q2Q A;  2Y4A A;  2ZM0 A;  3NBL A;  4MLL A;  4E3J A;  1NJ4 A;  4XUZ A;  3ZHH A;  3W8K A;  3ZFZ A;  1IYS A;  4JXV A;  3W4O A;  5FQM A;  1E4D A;  2A49 A;  3SH8 A;  4MBK A;  5E2G A;  1FR6 A;  5IHV A;  4UA9 A;  4E3O A;  4JXG A;  3ZNT A;  1I2S A;  2C6W B;  1NRF A;  3LY4 A;  2GDN A;  4K0W A;  4N1X A;  4R4R A;  3RXW A;  3ZG0 A;  1K25 A;  5GLC A;  5F1F A;  3HL9 A;  2XFS A;  3NY4 A;  5DTS A;  4QD4 A;  3ZVW A;  1K54 A;  1K54 C;  1PWG A;  2G2U A;  1G68 A;  2XLN A;  4BD0 A;  2WGI A;  1MXO A;  3G31 A;  4RVA A;  5CGW A;  4LV1 A;  3O3V A;  3OPL A;  3N8S A;  2ZC6 B;  1CI9 A;  4KG2 A;  2OSU A;  2CC1 A;  3DW0 A;  3FZC A;  4OQH A;  4OOL A;  4QB8 A;  4FD8 A;  3NCK A;  3ISG A;  3S22 A;  5F82 A;  4DF6 A;  5HL1 A;  3OC2 A;  4C3Q A;  2ZC5 B;  4PM6 A;  4WEK A;  3NDG A;  3GMW A;  4HBU A;  4WEL A;  3PBT A;  1K6S A;  2OLV A;  3ZG8 B;  1IKG A;  5FAQ A;  5DF7 A;  2IWD A;  3S1Y A;  2V1Z A;  1KDS A;  3IF5 A;  4PM7 A;  4OPZ A;  3ZGA B;  1YQS A;  2EXB A;  4OH0 A;  4IVK A;  3ITB A;  3IF6 B;  4OOM A;  3HLE A;  4RYE A;  4JF6 A;  1FR1 A;  4O7D A;  1MBL A;  5FQK A;  1O07 A;  1K4E A;  4WM9 A;  3IWQ A;  2XD5 A;  2HDQ A;  3TG9 A;  3OCN A;  2B5R A;  4FH2 A;  3UO9 A;  4KZB A;  3Q7Z A;  4X56 A;  1JWP A;  1H8Z A;  4E6W A;  3Q81 A;  5CRF A;  3QHY A;  3VP0 A;  1L0G A;  3RXX A;  2HPB A;  1MWU A;  2X71 A;  1KGE A;  3NC8 A;  5CGX A;  1RGY A;  4BJP A;  1AXB A;  4B4X A;  3JYI A;  5EVI B;  5EEC A;  2ZJ9 A;  4DE3 A;  2ZQ9 A;  4OLG A;  1EI5 A;  1GA0 A;  4ZTK A;  1BT5 A;  3GTC A;  2Y59 A;  1PW1 A;  3SH7 A;  1YM1 A;  2WZZ A;  2Y2G A;  2FFF B;  1MY8 A;  3VMA A;  3QNB A;  5FSR A;  3LO7 A;  1LI9 A;  2P9V A;  3IXB A;  1ZC2 A;  3G35 A;  4JXS A;  2ZQD A;  2J9P A;  3IT9 A;  1Y54 A;  3SS3 A;  4D2O A;  4WEJ A;  5DF9 A;  3DWK A;  3HLW A;  4R23 A;  4GNU A;  3A3F A;  5M18 A;  3C4P A;  3CMZ A;  3IH9 A;  3SH9 A;  3SS5 A;  5EVL A;  4BLM A;  4DE2 A;  2JCH A;  2HP5 A;  4JBF A;  2G2W A;  3WS2 A;  2RL3 A;  4OLD A;  4KG6 A;  1G6A A;  3BEB A;  2ZC3 B;  4H8R A;  4Y7P A;  1XP4 A;  5FAP A;  2V2F F;  3MXS A;  1SDN A;  2RCX A;  5M19 A;  5AQ9 A;  4B88 A;  4KZ4 A;  4IVI A;  3MZE A;  4PM9 A;  3OZH A;  4ZAM A;  4N9K A;  5EOE A;  4QJG A;  5FI2 A;  4LCL A;  3WS0 A;  2X01 A;  2Z2M B;  1SKF A;  3AGF A;  1PWD A;  3HUO A;  4LCM A;  3IHB A;  3IQA A;  4E3M A;  4WZ5 A;  5KSC A;  4WZ5 C;  3VP2 A;  4MBH A;  4WBG A;  3UPO A;  1K56 A;  1QMF A;  1K55 A;  4LEN A;  1K55 C;  5CHU A;  1MWT A;  3NDE A;  3UDI A;  3UDF A;  3OCL A;  3W4P A;  1MWR A;  2Y2L A;  5FDH A;  2J9O A;  4P0M A;  4U3T A;  1TEM A;  5M1A A;  3UN7 A;  3BM6 A;  4X69 A;  3NI9 A;  1E3U A;  5G18 A;  4EBL A;  1KVL A;  1RGZ A;  1H8Y A;  2ZM2 A;  3IWI A;  2XEP A;  4ZJ2 A;  5FI7 A;  1KGF A;  1XA7 A;  1YMS A;  2Y2K A;  4X53 A;  4YIN A;  5HAQ A;  3WS4 A;  3IXD A;  1NYM A;  2A3U A;  4EBP A;  1E25 A;  3MKE A;  1Z6F A;  2XQZ A;  4LV3 A;  1KE3 A;  5FAS A;  5TGF A;  2XH9 A;  1K57 A;  2ZC4 B;  5CHM A;  5CER A;  1K57 C;  1BLC A;  1BUE A;  1DJB A;  3LY3 A;  5KMW A;  4BD1 A;  5KSH A;  4MEZ A;  1MKI A;  1CEG A;  1ES5 A;  4DE1 A;  4KZ8 A;  5E2E A;  4WZ4 A;  2Y2I A;  3Q7V B;  4OPY A;  2UWX A;  1YLP A;  2WYX A;  3HUN A;  4NK3 A;  3AGE A;  4E6X A;  1DJA A;  4DXC A;  2PU4 A;  1W8Y A;  1IEM A;  3VP1 A;  1PW8 A;  4X6T A;  1ZKJ A;  2EXA A;  5I94 A;  3GR2 A;  4IBR A;  3BYD A;  4RX3 A;  3MXR A;  1ERM A;  1ESI A;  1PI4 A;  1HZO A;  1ERO A;  4N92 A;  4KZ3 A;  3WRZ A;  4QU3 A;  1PYY A;  3BFD A;  3P98 A;  5HAI A;  4X55 A;  2ZMA A;  3VOZ A;  2EX6 A;  3G4P A;  4KZ5 A;  2C5W B;  2VGK A;  3PBR A;  4S2N A;  4S2N C;  3A3D A;  1H5X A;  1JTG A;  1XPB A;  3PAG A;  3CG5 A;  4EQI A;  3GQZ A;  4XUX A;  5HFO A;  5CEC A;  1YT4 A;  4JXW A;  3BFC A;  4KQO A;  3C7U A;  1W7F A;  3FKV A;  1RCJ A;  1SCW A;  1XGI A;  1IYO A;  3LEZ A;  4FCF A;  4E3K A;  3MZD A;  4DE0 A;  4JLF A;  4C6Y A;  5E2F A;  5CTN A;  1CK3 A;  4OOY A;  2XFT A;  2J7V A;  5TR7 A;  3V3S A;  4KG5 A;  5U47 A;  4KQR A;  4U0X A;  4N1H A;  4FH4 A;  5HX9 A;  1NZO A;  1GHM A;  1I5Q A;  1YLT A;  5FAT A;  2WUQ A;  5F83 A;  4UA7 A;  3MKF A;  2ZQ8 A;  3GV9 A;  4ZBE A;  4CPK A;  1MPL A;  1W5D A;  1VM1 A;  4OKP A;  1GCE A;  1MWS A;  4OPQ A;  5A92 A;  1IYP A;  5A93 A;  3C7V A;  1BSG A;  3LCE A;  1ZG4 A;  3N7W A;  5E2H A;  1N4O A;  3HUM A;  1FOF A;  2P74 A;  2WGW A;  4IBX A;  1NY0 A;  3ZG5 A;  4P87 A;  4KZ7 A;  2QZ6 A;  3I7J A;  1HD8 A;  4RA7 A;  5EOO A;  5CXW A;  4K0X A;  4GDN A;  1QME A;  1K56 D;  4UHU A;  4LV0 A;  2HDR A;  4GB7 A;  4JF5 A;  4ZJ3 A;  3CZD A;  4Y0T A;  3PBQ A;  1YLJ A;  1E3U D;  1CI8 A;  1GHI A;  1PIO A;  3ITA A;  5CTM A;  4DXB A;  2XR0 A;  1DJC A;  3ZDJ A;  4KZA A;  4Q8I A;  4M3K A;  1LL5 A;  3BFE A;  4R1G A;  5GHZ A;  4GKU A;  1FCO A;  1ESU A;  4HEF A;  3HBR A;  4NET A;  5DF8 A;  1O7E A;  2X02 A;  5A90 A;  3SS4 A;  3PBS A;  1XGJ A;  2EFX A;  3MBZ A;  5GHX A;  5FQJ A;  1KDW A;  1TDG A;  4S2P A;  1LL9 A;  3UY6 A;  4L0L A;  2XD1 A;  5EUA A;  1K38 A;  1L0E A;  4EBN A;  2Y2N A;  2WAF A;  2XGN A;  2I72 A;  3BFG A;  3A3E A;  1XXM A;  3SOI A;  3GRJ A;  1BLS A;  4BQM A;  5CED A;  3A3J A;  5HW3 A;  4OP8 A;  2H0Y A;  2HP6 A;  5TFQ A;  1SDE A;  2Y2O A;  4WMC A;  2XK1 A;  4DDY A;  4EUZ A;  2ZQC A;  5GL9 A;  2BLS A;  1LHY A;  4EWF A;  3V5M A;  2H0T A;  4BEN A;  3HLD A;  4S2K A;  2P9V B;  4OQ0 A;  4U0T A;  4XXR A;  5GHY A;  3IHA A;  3UNW A;  3BLM A;  3M6H A;  2WKH A;  1ZG6 A;  3N6I A;  5DVA A;  4KQQ A;  4Z9Q A;  5F1G A;  2IWB A;  3GSG A;  4WYY A;  5E43 A;  1NZU A;  3FYZ A;  4BL2 A;  3Q1F A;  1EWZ A;  1NYY A;  4GD6 A;  3DTM A;  3VSL A;  4S2L A;  3WS5 A;  4B4Z A;  3O87 A;  5HAP A;  4OON A;  3W4Q A;  4R4S A;  4LV2 A;  2Y2P A;  4JPM A;  3TSG A;  1XA1 A;  3E2K A;  3Q82 A;  2EFU A;  2V20 A;  5BOH A;  1KGG A;  1YMX A;  1HVB A;  1N9B A;  2Q9N A;  3PAE A;  1GA9 A;  4QHC A;  5AQB A;  4DRT A;  1ES4 A;  2ZM8 A;  1ES2 A;  5CEB A;  3C4O A;  3IF6 A;  5GLB A;  3IF6 C;  3UE1 A;  2HDS A;  1SHV A;  2Y2Q A;  1S0W A;  1YLW A;  1NXY A;  2FFY A;  4PMA A;  3VFF A;  3HLF A;  5HAR A;  3BFF A;  2R9W A;  1JVJ A;  2H10 A;  4GDB A;  2JE5 A;  3ZNY A;  3O88 A;  5FI6 A;  2BG1 A;  4QY5 A;  4DKI A;  5GLA A;  4JKT A;  1M40 A;  4MBF A;  4R3B A;  4S2I A;  1IYQ A;  3EQV A;  4GN2 A;  5JYO A;  3EQU A;  4GOG A;  4OPR A;  3V3R A;  2XDM A;  3UPP A;  1JTD A;  5AQ7 A;  5EVI A;  1L0D A;  5EVI C;  3OPP A;  2EX2 A;  1Q2P A;  3B3X A;  3G2Y A;  3MFD A;  5JYP A;  4X68 A;  2HDU A;  2PBY A;  4P85 A;  2JBF A;  1RP5 A;  1BUL A;  4HES A;  3Q07 A;  3RJU A;  3IXG A;  1TDL A;  3G30 A;  1W79 A;  2QMI A;  1K6R A;  1XX2 A;  3HRE A;  4ID4 A;  4Y0U A;  1ONH A;  3O86 A;  3UPN A;  1BTL A;  4C75 A;  5GLD A;  3WS1 A;  4EV4 A;  4OQG A;  1TVF A;  5FQQ A;  3ZCZ A;  3VSK A;  2Y55 A;  3VFH A;  5KZH A;  3BEC A;  3G2Z A;  2DCF A;  1PI5 A;  2Y91 A;  1WYB A;  3A3I A;  1KE0 A;  4PM5 A;  4KEN B;  1CEF A;  5D3O A;  1M6K A;  3C5A A;  2DRW A;  1LLB A;  1C3B A;  3HLC A;  4R3J A;  2ZLY A;  2Q9M A;  1ERQ A;  1ALQ A;  4QY6 A;  4E3N A;  1VQQ A;  1L0F A;  2VGJ A;  3N8R A;  5DTT A;  2WAD A;  3ZVT A;  4E3L A;  1L2S A;  1WYC A;  3P09 A;  4WMC D;  4MNR A;  2IWC A;  2Y2M A;  3M6B A;  4YFM A;  2OLU A;  4IED A;  2Y2H A;  1FSW A;  2Y2J A;  1J9M A;  3OPR A;  4FSF A;  4PM8 A;  4Y0O A;  3UE3 A;  3N4I A;  5FQ9 A;  3D4F A;  1IKI A;  1LI0 A;  4E3I A;  1YLZ A;  4OQI A;  3MZF A;  4R0Q A;  2WZX A;  1FSY A;  1GHP A;  2WKE A;  3G32 A;  1W8Q A;  3PBN A;  3FKW A;  4OVD A;  4OP5 A;  2WKI A;  1BZA A;  4A5R A;  3AGD A;  3E2L A;  2ZQA A;  4GD8 A;  4HBT A;  3FWL A;  1JWV A;  1PWC A;  3BLS A;  3VP4 A;  2H5S A;  2ZD8 A;  4UA6 A;  3M2J A;  2ZC7 A;  4BL3 A;  3OPH A;  3VP3 A;  1KE4 A;  3BRM A;  4P6B A;  4DDS A;  3GVB A;  1KVM A;  2WAE A;  2EX8 A;  5L2F A;  4F94 A;  2WK0 A;  2ZQ7 A;  1YLY A;  3UE0 A;  3M2K A;  4ZDX A;  5EPH A;  3S4X A;  2JC7 A;  2DNS A;  3CJM A;  3PTE A;  1OME A;  4S2O A;  4ZJ1 A;  2WGW B;  3PBO A;  3Q7V A;  5CGS A;  2WGV A;  4RX2 A;  1U60 A;  5DTK A;  1IEL A;  1WE4 A;  1ONG A;  3HLG A;  5EE8 A;  2R9X A;  1HTZ A;  2EX9 A;  3FV7 A;  3QNC A;  4KZ6 A;  2Z2L B;  3IXH A;  3V39 A;  2QPN A;  5CHJ A;  1FQG A;  3IH8 A;  4S2M A;  5FQI A;  4S2J A;  5A91 A;  2XF3 A;  4K91 A;  3WWX A;  4CJN A;  2HP9 A;  5J8X A;  1S6R A;  1PZO A;  5EVI D;  3N8L A;  3TOI A;  5FAO A;  3IWO A;  2E8I A;  1FCM A;  4GZB A;  4N9L A;  4PPR A;  1FCN A;  1PZP A;  1XKZ A;  3DWZ A;  1I2W A;  3WRT A;  3HVF A;  4UAA A;  3UDX A;  3HLB A;  2J8Y A;  3ZG9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...