4NXBA

Crystal structure of ilov-i486(2lt) at ph 7.0
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
108
Chain Sequence
KNFVITDPRLPDNPIIFASDGFLELTEYSREEILGRNARFLQGPETDQATVQKIRDAIRDQRETTVQLINYTKSGKKFWNLLHLQPVRDQKGELQYFGVQLDGSDHVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phototropin-2
publication title Significant Expansion of Fluorescent Protein Sensing Ability through the Genetic Incorporation of Superior Photo-Induced Electron-Transfer Quenchers
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Flavoprotein, fluorescent protein
total genus 30
structure length 108
sequence length 109
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4nxbA00
4KQDA 4MN6A 3IS2B 4H6JA 5IU1A 1OT6A 3MQQA 4WF0A 1N9OA 1ODVA 4XT2A 3MR0A 3VE4A 4RQ9A 3LIBA 4HP4A 4I5SA 4E04A 3IS2A 3RTYA 4I3AA 3LUQA 4WL9A 3NOTC 1T1BA 3NOUC 4EQ1A 1XJ2A 3OLOA 2PD7A 5J7EA 5I5LA 3UE6A 4R38A 3CWFA 5AVFA 1S66L 4NXFA 2L4RA 2I9VA 5DKKA 3E4QA 3A0VA 1X0OA 2QJ7A 2V1BA 3LICA 1OTEA 1D7EA 4WUJA 4JGOA 1P0ZA 4EETB 3GDIA 3PHYA 4GHIB 4HH3A 1P97A 5HWWA 5EFWA 1XJ4A 5IS1A 2M1CA 5HD5A 3ZQ5A 2ZBBA 3FC7A 4PKYA 5HDSA 2P7JA 3RH8B 1GSVA 1S1YA 3G6OA 4NXEA 4LRZE 1MZUA 2V0UA 1DP8A 3LIDA 1S4SA 4R70A 1XJ6A 3EEHA 3T50A 4BBTA 2PDRA 3BY9A 3F1OB 1WA9A 4H6JB 3H9WA 4EERA 3LI8A 1VB6A 4K08A 4XT2B 1TS6A 4LLOB 1EW0A 1NWZA 4LRYC 2VV7A 3F1OA 3P7NA 5TBMB 1XJ3A 5DJTA 5DKLA 2PYRA 5F6AA 2KX6A 4R3AA 5HWVA 5TBMA 4NXGA 4F3LB 3H7WB 1JNUA 3MQOA 4GS9A 5DJUA 1T18A 2R78A 3MXQA 5A8BA 4L9EA 3IBRA 1UWPX 4HP9A 2PHYA 1TS8A 4DJ2A 1G28A 2QJ5A 3UMEA 1DP6A 4F3LA 3H7WA 3H82B 1V9YA 3UB9A 1T1AA 3F1PB 3F1NB 1GSWA 5HZHA 1OTBA 2YKHA 4EW7A 5KIZA 2WKRA 3B33A 2L1MA 2W27A 5F68A 4EXOA 3H82A 3UB7A 3UMDA 5AVEA 1BYWA 2H28A 2VEAA 3F1PA 3F1NA 5F69A 4I3JA 2V0WA 4GW9A 2CMNA 3LIEA 4LRXC 5G4YA 1LSWA 4KUOA 2ZOHA 1S4RA 4L9FA 4DJ3A 1S1ZA 5F5YA 4HOIA 4HNBA 2PR5A 1DRMA 2HV1A 4HJ3A 1T19A 3UB8A 2QHKA 2WKPA 1XFNA 4EEUA 5J3WA 3ICYA 2PYPA 2L0WA 2EA9A 2JN7A 3NHQA 4HJ4A 3VE3A 4HJ6A 4WN5A 2KDKA 1T1CA 1OTIA 3CAXA 2K7SA 1UGUA 4NXBA 1OJ5A 4I39A 1LSXA 5HSQA 3E4OA 4BBUA 2BASA 4I38A 4GS9B 2D01A 3E4PA 2W0NA 4M4XA 4JGQA 2VLGA 3CLOA 3A0SA 1OTAA 4HY8A 1UWNX 2GJ3A 1DP9A 4I3IA 3LIAA 5J4EA 4KUKA 3ULFA 4EEPA 4B9OA 3GECA 4L9GA 3LYXA 3C8CA 2WKQA 1Y28A 2A24B 1OJGA 5HDCA 4MN5A 3FG8A 2PD8A 3NJAA 1LL8A 5HD3A 4YWZA 2VV8A 3HJIA 3K3CA 2QKPA 1XFQA 2OWJA 2VV6A 3NOPC 4JGPA 2A24A 1N9NA 5G4ZA 4R6LA 3A0RA 3HJKA 4HH2A 2QWSA 2B02A 3UB6A 4JGRA 3D72A 2YKFA 4HIAA 1D06A 4HI4A 4BBVA 2JHEA 2J80A 2Z6CA 1TS7A 2D02A 2OOLA 3C2WA 4WLAA 5HWTA 2OWHA 4HQAA 4GCZA 2ZOIA 1OTDA 1S67L 5HDDA 3LI9A 1F98A 4LPZA 2V1AA 1KOUA 1N9LA 3EWKA 3SW1A 4EESA 4GHIA 2PR6A 3KX0X 1F9IA 2Z6DA 2V9AA 4HHDA 3VOLA 1OT9A 1LSVA 1TS0A 3PYPA 3LIFA 3BWLA 1GSXA 2INWA 3K3DA 1V9ZA 3MFXA 3BY8A 4PKYG 3MJQA 1LT0A
chains in the Genus database with same CATH superfamily
1ACFA 2WKHA 3OBFA 3IS2B 1M6KA 5TR7A 4H6JA 5IU1A 2ZM8A 1PZPA 4DMZA 4WF0A 1K6SA 3LEZA 3N6IA 4X56A 5HL1A 3UPNA 2WADA 5LBRA 2WYXA 1ERMA 1W63Q 4B4ZA 3D3OA 5HW3A 1AXBA 4GDBA 4WL9A 3TSGA 4G3WA 4S2NC 2M7UA 2PU2A 3T1XA 3OLOA 4KZAA 1LI9A 5AQ7A 5E2EA 3PBOA 4OOLA 4UEYA 3CWFA 1VEUA 1O07A 4OQIA 3GMWA 1MPLA 3CZDA 3BW6A 2NUPC 1S66L 2EFXA 3HLBA 5GHYA 3MZEA 3OCNA 4UA9A 4E3LA 1X0OA 3S7QA 4P87A 4IBXA 1WE4A 3ZVWA 3LR3A 1OTEA 4IEDA 2JCHA 4O8GA 4GDNA 2P9VB 2Y2PA 3GDIA 1GHPA 3PHYA 5CGWA 3E2KA 1P97A 1H0MA 2XSSA 3JPUA 4EWFA 4E3MA 2KOIA 1IKGA 2ZBBA 5HDSA 4E3NA 2P7JA 2Y2HA 4N9KA 3IWOA 1GSVA 3N8RA 5FQIA 4NXEA 1MZUA 4FTXA 3VP2A 1S4SA 1PW1A 1G68A 3D9YA 3DWZA 4E3OA 1NRFA 2M7VA 2FZ0A 2JKTM 3ISGA 3V67A 4BBTA 2EX2A 3BY9A 3BQAA 4CQHA 4GJ4A 2J8YA 4WM9A 1AWIA 1XP4A 4DDSA 5FSRA 1TS6A 1MWRA 4KQRA 1EW0A 4QY6A 4ETZA 3F1OA 3P7NA 1OPXA 3ZGAB 3SS5A 1SKOA 4WZ5A 3P01A 2JKTI 3MQ0A 4Q0JA 2VKSA 3KYZA 2ZD8A 4C75A 3VP0A 3DTIA 4FH2A 4JF4A 5F6AA 1MWSA 2KX6A 2EWVA 4NXGA 4GS9A 3QP2A 2ZMFA 3NI9A 1YM1A 3BJNA 2B95A 4KQOA 2XROA 2H0YA 5FEFA 4F3LA 3H7WA 3H82B 1V9YA 2QMIA 1TEMA 3T4KA 5EUAA 3AGFA 3L9KA 2QZ6A 1MC0A 5L10A 2YKHA 2Q0OA 2W27A 3ZVTA 1L0DA 1PIOA 2XFTA 1XKZA 5EM1A 3ZNYA 4Y17A 4R3JA 3F1PA 2HP9A 3F1NA 2RCXA 5KSCA 1JWZA 2ZC6B 4CLCA 3O3VA 4Y0TA 3HL9A 1LSWA 1ES4A 3ZCZA 4JXSA 5FL3A 2VGLS 1BLCA 1ALQA 5FAQA 4L9FA 4DJ3A 2OLVA 2DRWA 5F5YA 5EVIC 3ZG7B 2EWWA 3KSFA 4R3BA 3BM6A 4HNBA 1C3BA 5CXWA 2PR5A 4DDYA 1DRMA 4HJ3A 3VP4A 1Y4OA 2FH5A 1MXOA 5GHZA 2WZXA 4ESPA 3TW8A 4N1XA 3T4OA 3MMHA 5E43A 2L0WA 2ZM2A 4KG5A 5E2FA 1YLPA 2VK3A 4DRTA 4WN5A 4JLFA 5EVEA 1UGUA 1OJ5A 3M6BA 4B4XA 4Y3IA 3V3RA 1MWTA 4BBUA 5F1GA 3TE8A 1ESIA 4QPRA 4QY5A 3UE3A 3G2YA 5F1FA 3DTEA 2W0NA 1FOFA 5F82A 5A90A 4JGQA 2VLGA 3CLOA 4DE1A 2PAVP 1UWNX 1RGYA 2X02A 2O9BA 2R9WA 2J3TD 3MBZA 5L07A 1E3UD 3LIAA 3S7PA 4Y7PA 3DBAA 3G35A 5J4EA 4KUKA 2ACGA 4H8RA 4EEPA 1XPBA 3NDGA 3IXBA 1J9MA 2H0TA 1FSYA 2RL3A 2ZQ8A 3BFFA 5FQMA 4OQHA 3N8SA 3LR5A 1LL8A 2Y2MA 4OP8A 3K3CA 1JTDA 2OWJA 2VV6A 5HAPA 4WMCD 1KE0A 3A3IA 3A0RA 4IUHA 3WS2A 4S2NA 4OPQA 3PAEA 4RX3A 3IXHA 5CHMA 3DW0A 4L0LA 3JYIA 5HFOA 2XA7M 2Y2JA 4ZTKA 4EUVA 4UHUA 4WZ4A 1KE4A 3OC2A 3C4PA 3HLCA 1HD8A 3LEQA 2J80A 3MSHA 4MBHA 3OPPA 3ZG5A 4U0TA 1H5XA 2K2NA 3C2WA 3O87A 4JF5A 2O9AA 1S67L 3PXPA 3LI9A 1BT5A 3G2ZA 1JWPA 1F98A 2XQZA 2W1TB 1N9LA 1XGIA 4ZAMA 5L09A 5FDSA 1LLBA 2WZZA 4WZ5C 2ZJ9A 3KX0X 1DJBA 1OT9A 3QHYA 1YAXA 3QNCA 3W8KA 4CPKA 1LSVA 3BWLA 2C5WB 3V5MA 2ZC5B 1L0GA 3BY8A 3NY4A 2JBFA 5FQQA 1DJAA 4N92A 4RYEA 1ZTUA 3IF5A 1JVJA 2PT7A 4MN6A 1HZOA 3MS6A 4Q0IA 5EOEA 3IWQA 2FFYA 1ODVA 3MR0A 2OLUA 4RQ9A 5MC7A 4LFUA 3RTYA 3FZCA 1ESUA 3BFCA 5FQ9A 3IBJA 1TDLA 3NOTC 1T1BA 2XD1A 2OAQ1 1YKDA 4MBKA 4E3KA 2C6WB 1K56D 2HP6A 2PD7A 2Y4AA 5J7EA 5AVFA 1MKIA 3B42A 1IKIA 3VSKA 3AGDA 1K6RA 4S2IA 3D4FA 4OP5A 4ZJ1A 4KZ9A 2LB9A 2KLIA 4IHQA 3BRMA 4D2OA 3OPHA 2V1BA 3LICA 2BTFP 5M18A 3I7JA 4JGOA 1P0ZA 3DAVA 5GLDA 4GLQA 3IF6B 5HWWA 4GB7A 1PI5A 5JYOA 1RP5A 2M1CA 3T4QA 1NJ4A 4RA7A 3EQUA 4JXGA 3W4QA 5DF8A 4U3TA 1JWVA 3BFEA 5HAIA 4R4RA 2HF6A 1S1YA 4KZ4A 4LRZE 2XFSA 1KDSA 1DP8A 3LIDA 1LL9A 2EXBA 4PM7A 3UDXA 3T50A 2VX8A 1YSPA 4NG2A 4XUZA 3LI8A 5CHJA 2V1ZA 4ARZA 1TD5A 4XT2B 4KG2A 3LY4A 3NULA 2BG1A 1PFLA 1Y54A 3HVFA 5EOOA 5DTSA 4LRYC 1KGEA 2VV7A 5AQBA 1PNEA 5DJTA 1Z6FA 3TRCA 3G4PA 3Q7ZA 4N9LA 3CJMA 4JF6A 5TBMA 3MQOA 4AFIA 2W3FA 3FKWA 4OPZA 4R1GA 1FIKA 2XA7S 1W8YA 2R78A 3MXQA 3JVVA 2HDRA 3WWXA 4HP9A 4KZ7A 2XF3A 1G28A 2JE5A 2QPNA 4BLMA 3CPTB 1L0FA 5HZHA 5KIZA 2WKRA 5GLCA 3MFDA 1G6AA 5JYPA 2MJ6A 2XEPA 4PM5A 4WELA 3UB7A 5TGFA 4DE3A 5AVEA 4ZRRA 1ES5A 3ZFZA 5F69A 1FQGA 3T1QB 5I94A 5GL9A 3LIEA 1TF1A 4LRXC 3AGEA 3N4IA 1K0KA 2ZOHA 3P98A 4UAAA 1S1ZA 3VV4A 4HOIA 1KDWA 2J3WA 1DY6A 1QMEA 5FI2A 3QP8A 4GKUA 5GHXA 3PBSA 2HV1A 2JKFA 1T19A 3UB8A 1XFNA 3HLEA 4P0MA 1FCMA 2W3HA 3MXRA 2P74A 2PYPA 1LL5A 2EA9A 3N8LA 4DE0A 1NYYA 4X68A 2ZL1B 3KSHA 5HAQA 4PMAA 2ZLYA 3VSLA 4LCLA 5EE8A 2R9XA 4HJ6A 1MY8A 1YLZA 2WUQA 2KDKA 2XRNA 2Y2GA 4WMCA 5DVAA 3UB5P 4O7DA 3QNBA 1VHMA 3S22A 5HSQA 5L2FA 3E4OA 3JVUA 4JBFA 4S2PA 2Y2KA 3NECA 4I38A 4DXCA 5DFXA 4MMNA 1H8ZA 2HP5A 1I5QA 3HUOA 2JC7A 4UA6A 1O7EA 3SH8A 3A0SA 1OTAA 5CGXA 4HY8A 3FWLA 3M2KA 4FSFA 3W4OA 3O86A 4IVIA 1K57C 1XA1A 1YSQA 4MDZA 1NRJA 1J3WA 1DP9A 4I3IA 4B93A 2LB5A 2ZC7A 4MCWA 1VETA 5CRFA 1IFQA 3GECA 4S2KA 2ZC4B 4OQGA 4FCFA 1SHVA 2A24B 2WGWB 3FG8A 3CG5A 3MKFA 4NKPA 4CLCE 5HD3A 1FR1A 4X6TA 2IA2A 3OPRA 5G4ZA 2HDSA 3HBRA 2PU4A 2O9CA 3GR2A 4CJNA 3E2LA 4OOMA 3HJKA 4PM6A 4HH2A 5FI7A 3UDIA 2X71A 1N4OA 2Z2MB 2W3EA 3UB6A 1BLPA 3LGOA 1GA0A 1K54C 3PBRA 4HEFA 2P04A 1YLWA 5M19A 4NEED 4BENA 1D1JA 3D72A 3FV7A 3HLFA 3O88A 3S7NA 3FKVA 2JHEA 1LI0A 4X53A 5HWTA 5EVIB 2OWHA 5HDDA 2H10A 1VQQA 3IHBA 5E2HA 4X1MA 4LPZA 1TDGA 4OQ0A 1SCWA 3V39A 3UE0A 5FASA 1YLJA 3U2AA 1JTGA 1K56A 2PR6A 2P08A 4O0PA 1F9IA 2V2FF 2V9AA 4P6BA 3VOLA 3G34A 3PYPA 1FR6A 4E6WA 1ZG6A 3K3DA 3SH9A 2B5RA 3T4SA 3MFXA 4DF6A 3IHAA 1FILA 3MJQA 3Q7VA 1FCOA 1LT0A 1CQAA 4DN0A 2H5SA 1L3LA 3G31A 4E3IA 4GD6A 2AVXA 1OT6A 1PYYA 3KSIA 3MQQA 4D60A 5AJGA 1CJFA 1N9OA 4XT2A 3S7OA 1YLYA 3O5YA 4HP4A 1SZVA 4I5SA 3IS2A 4I3AA 3ZG9B 4IBRA 1W5DA 5DF7A 3BFDA 4P6ZM 1VEUB 1ZKJA 1Q2QA 4EQ1A 4RVAA 1XJ2A 2G2WA 2HPBA 3B47A 4QJGA 4OONA 3UE6A 4EBNA 1H3QA 3EEAA 1U60A 2NUTC 3PBTA 4LV3A 3VOYA 4DXBA 4NXFA 2L4RA 2J3TC 2I9VA 3G32A 3QP4A 3Q81A 4UA7A 1EI5A 4FH4A 4YINA 5EPHA 5CTMA 4BL2A 2Y59A 4QD4A 1NLZA 2VJWA 3MZDA 4HH3A 4YFMA 1RGZA 3BEBA 1XJ4A 3M6HA 2Z2LB 3ZHHA 5HD5A 3FC7A 3ZQ5A 2P9VA 3HLGA 3UO9A 5TFQA 5L8MA 4OPRA 3RH8B 1F2KA 3B3XA 4MBFA 1P9WA 1OMEA 4X25A 4R70A 3IQAA 1W7FA 1XJ6A 1DJCA 3KYEA 4ME4A 1IOUA 3TOIA 2PDRA 5J8XA 4HBUA 2GZAA 2XLNA 3F1OB 3WRTA 4EBLA 4C3QA 4ZDXA 1SKOB 2ZQ9A 1VB6A 4K08A 3WS0A 3R4KA 3OCLA 3QP1A 2X01A 4GZBA 5CEBA 3E98A 5KSHA 2BLSA 4MN7A 5DKLA 2Y2IA 5FEGA 4Z9QA 3LCEA 5A91A 2IWDA 4R3AA 5HWVA 4Y15A 4Y5FA 4E6XA 1XA7A 3H7WB 4F3LB 5FQJA 1EWZA 2IWBA 3HLWA 4HESA 1FCNA 3PTEA 3T4TA 1HVBA 2HJ9C 3C7VA 3IBRA 3GRJA 3SZTA 1LHYA 5DFYA 1TS8A 2QJ5A 1DP6A 1K57A 3UB9A 3SS3A 2WAFA 1T1AA 3F1PB 3LR4A 3BLMA 3F1NB 1GSWA 3DWKA 4CLCB 3V3SA 5F68A 3MZFA 3H82A 1H8YA 1IYQA 3UMDA 1BYWA 2H28A 2VEAA 2EX6A 3A3FA 3C7UA 2A49A 2J9PA 2W1RA 3OOVA 4EUZA 4NK3A 4MNRA 4GW9A 4KQQA 5FA7A 2CMNA 4KZ3A 5G4YA 1HLUP 3NBLA 4KUOA 1IYSA 1K4FA 1S4RA 4R0QA 2IWCA 3IF6C 3EQVA 2ZMVA 5CX7A 3NCKA 5FDHA 3ITAA 3S1YA 4IJGA 2E8JA 4R4SA 4ZBEA 1IEMA 1K54A 2EX9A 5IHVA 2QHKA 5GLBA 4YNRA 3T1SA 4LV0A 4OLGA 5EVLA 4KZBA 3E0YA 2JKGA 3WRZA 4BJPA 4XXRA 1ONHA 5F83A 2JN7A 1SKFA 3BFGA 4QHCA 2HDUA 1ZG4A 4WEJA 3VE3A 2Y8HA 4PAUA 4S2MA 3HCYA 4KZ6A 5CECA 4X69A 2HGVA 1OTIA 2K7SA 4NXBA 4NETA 2ZQAA 3UPPA 4P6ZS 1YLTA 3PR6A 2BASA 3CITA 1TVFA 3M2JA 3IXDA 4N1HA 4M4XA 3MXSA 3FPWA 5EECA 1KGFA 5U47A 3TG9A 3EOIA 1Z09A 4F94A 4UQIS 5CERA 2O99A 3EGXC 3HLDA 4OKPA 4EU0A 5BOHA 4B9OA 1IELA 3CMZA 2UWXA 4L9GA 3CI6A 3C8CA 2WKQA 1OJGA 2HDQA 2OSUA 5HDCA 3FYZA 3UY6A 2GNXA 4MN5A 3SS4A 2PD8A 1YMSA 3RXWA 3NJAA 1XGJA 2Q9MA 3HJIA 1STZA 3HREA 2QKPA 4JGPA 1N9NA 3CUEA 4DKIA 4R6LA 3SOIA 2OAP1 5D3OA 4K91A 2Y91A 4Y2FA 3UNWA 1GHMA 1MKMA 2B02A 3UDFA 3VFFA 5CEDA 4GNUA 1SDNA 3UN7A 2Y55A 3RFBA 4X55A 4JKTA 2WKEA 2YKFA 4MLLA 4HIAA 2G7UA 4HI4A 4BBVA 1YQSA 1E3UA 2DNSA 4S2JA 3Q07A 1ES2A 3L7HA 4BL3A 3A3EA 1TS7A 4QB8A 4G3KA 2D02A 4K0WA 3VP3A 2ZOIA 4GD8A 1OTDA 4XUXA 1MBLA 3C38A 2V1AA 3EWKA 5DTKA 4IVKA 1GA9A 5A92A 1Q2PA 5M1AA 3NC8A 5E2GA 2W1TA 4JXVA 1KE3A 5DTTA 2Y2QA 4P85A 3LIFA 1GSXA 1V9ZA 3K2NA 1E25A 3GTCA 4R23A 2Y2OA 4II7A 1ES3A 2E8IA 1XX2A 2B18A 4PKYG 4KG6A 4M3KA 5K5BA 2ZQDA 2ZMAA 1I2SA 1IYOA 3IXGA 4KQDA 3IX4A 2GX5A 4OLDA 3BLSA 2DMWA 3PAGA 3VE4A 3LIBA 1PZOA 5GLAA 4E04A 4KENB 1A0KA 3LUQA 4OPYA 4LV1A 4ZJ3A 3LR0A 2XD5A 3BECA 3NOUC 2FFFB 5EVID 2EXAA 2PBDP 1K38A 1G5UA 4E3JA 5I5LA 4R38A 3C4OA 3C5AA 3ZG8B 3ITBA 1NYMA 4Q0HA 1FSWA 5EV0A 3VMAA 2CC1A 3SH7A 4DE2A 5DKKA 3E4QA 3NDEA 4BMWA 3A0VA 3ZG0A 4Z1WA 1SDEA 2QJ7A 1MWUA 1D7EA 4WUJA 4Q8IA 2WK0A 1BLHA 1K25A 4FD8A 5CHUA 3QP6A 4EETB 3PBQA 4GHIB 1XXMA 3LY3A 2QYBA 4FOFA 5EFWA 4JXWA 1K55C 5IS1A 4ZJ2A 4K0XA 4BQMA 1NY0A 4PKYA 3P09A 3R7WB 2UV0E 3W2ZA 4BD0A 4LGWA 5EM0A 3IF6A 4GOGA 5A93A 3BQ8A 3T4JA 3RJUA 3G6OA 2WGIA 4OOYA 2V0UA 5HPIA 4EV4A 1PWDA 4Y13A 1L2SA 1BLSA 3EEHA 2ZQ7A 4ARZB 1G6OA 5KZHA 2ZQCA 3KYQA 3FPVA 1WA9A 2HZ5A 4H6JB 2VGJA 3DTMA 3H9WA 4EERA 2XDMA 5AQAA 1CI8A 1HTZA 4LV2A 4QU3A 1PWCA 3OPLA 4LLOB 2VGKA 1NWZA 3IX3A 2WAEA 5TBMB 2ZM0A 4KZ5A 4ID4A 4Y0OA 1XJ3A 2K31A 2A3UA 2PYRA 1WYCA 4JPMA 2J9OA 4FUWA 3IX8A 2XK1A 3HUNA 1BUEA 3CUEC 3RXXA 1JNUA 1P9RA 1S6RA 4U0XA 5DJUA 1ZC2A 1T18A 3IT9A 5CGSA 4LCMA 5A8BA 4L9EA 1UWPX 2PHYA 4DJ2A 3UMEA 1GCEA 3GQZA 5FQKA 1CEFA 1OTBA 4EW7A 3B33A 2L1MA 2XR0A 4EXOA 3W4PA 1PI4A 4UQIM 4Y0UA 2WKIA 2JKRM 4BWIA 3CPTA 4I3JA 2V0WA 5TJJA 5FAOA 2OV5A 3A3DA 1W63M 2W3GA 1CI9A 4X1LA 3GSGA 4IUKA 5HL6A 4S2OA 4QWOA 1ZHHB 3ZNTA 1NZOA 3MKEA 1CK3A 3T12B 1NLYA 2JKRI 2PRFA 1KGGA 1VM1A 2WKPA 2XH9A 3KSGA 4EEUA 3ZDJA 4PHTA 1M40A 5J3WA 3ICYA 4MEZA 3NHQA 3PBNA 3EGDC 4HJ4A 4C6YA 1L0EA 5C5KA 4BD1A 2PBYA 3UPOA 4LENA 1T1CA 1RCJA 1EROA 3CAXA 1PRQA 1YT4A 4I39A 1LSXA 2ZL1A 2HJEA 1KVMA 4WYYA 3C30A 2V8FA 1NXYA 4CLCD 2VA0A 4GS9B 2D01A 2O0YA 3S4XA 3VOZA 3E4PA 4OVDA 1ERQA 1PW8A 1VETB 2EFUA 1PWGA 3GV9A 3LO7A 5DF9A 4KZ8A 4B88A 2GJ3A 1BSGA 2DCFA 2Y2LA 4ETXA 3WS5A 3Q1FA 1S0WA 3LFVA 3ULFA 3BYDA 2Y79A 1GHIA 2VZWA 2GDNA 1K4EA 2XGNA 2Y2NA 1CF0A 3CHWP 3LYXA 1Y28A 2G2UA 3T4LA 4WEKA 4PM8A 4A5RA 5HX9A 4G3VA 4EBPA 1YPRA 4CLCC 4YWZA 2VV8A 1XFQA 3NOPC 1W8QA 2A24A 3WS4A 3TJZC 4EQIA 4YOFA 2WGWA 1BZAA 3MF0A 2QWSA 4O01A 3VFHA 3KO6A 4HBTA 3NIAA 4PM9A 3OZHA 4JGRA 3WS1A 3Q82A 3DTKA 3ZYTA 5KMWA 2I72A 3IH8A 2V8CA 1D06A 1YMXA 3N7WA 1BTLA 1W79A 2A2LA 4OH0A 5HARA 5IT5A 2Z6CA 4WLAA 2OOLA 2W3DA 4HQAA 4GCZA 3GVBA 1IYPA 1E4DA 1KOUA 3SW1A 3G30A 1F5MA 1WYBA 4EESA 5FAPA 4GHIA 4PPRA 1NZUA 3VP1A 2Q9NA 5EVIA 1K55A 2EX8A 1QMFA 3UE1A 2Z6DA 2VGLM 4HHDA 3R7WA 5FI6A 3IWIA 2V20A 5CTNA 5G18A 3Q7VB 3IH9A 1TS0A 3T1RA 2WGVA 4WBGA 1KVLA 2INWA 4S2LA 1H8MA 2ZC3B 1ONGA 4GN2A 1CEGA 3HUMA 4RX2A 3A3JA 1I2WA 3U4LP 5FATA 5AQ9A 1BULA 1N9BA 3QP5A 3V50A 5HPFA 2J7VA
chains in the Genus database with same CATH topology
4KQDA 2PT7A 4MN6A 2GX5A 4DN0A 3OBFA 3IS2B 4Q0IA 4H6JA 5IU1A 1OT6A 3KSIA 3MQQA 4DMZA 4WF0A 5AJGA 2DMWA 1N9OA 1ODVA 4XT2A 3S7OA 3MR0A 3VE4A 3O5YA 4RQ9A 3LIBA 4HP4A 4I5SA 4E04A 5MC7A 3IS2A 3RTYA 5LBRA 4I3AA 1W63Q 3LUQA 3D3OA 3IBJA 3LR0A 4P6ZM 4WL9A 3NOTC 4G3WA 1T1BA 3NOUC 2M7UA 2OAQ1 4EQ1A 1YKDA 1XJ2A 3OLOA 2PD7A 3B47A 5J7EA 3PBOA 5I5LA 3UE6A 4OOLA 1H3QA 4UEYA 3EEAA 4R38A 3CWFA 5AVFA 2NUTC 3B42A 3PBTA 3BW6A 2NUPC 1S66L 4Q0HA 4NXFA 2L4RA 2J3TC 2I9VA 5DKKA 3OCNA 3E4QA 4BMWA 3A0VA 1X0OA 3S7QA 2LB9A 2KLIA 4IHQA 4Z1WA 2QJ7A 2V1BA 3LICA 3LR3A 1OTEA 4O8GA 1D7EA 4WUJA 4JGOA 1P0ZA 4EETB 3GDIA 3PHYA 3PBQA 4GHIB 4GLQA 1NLZA 2VJWA 4HH3A 1P97A 5HWWA 2QYBA 4FOFA 5EFWA 2XSSA 1XJ4A 5IS1A 2M1CA 2KOIA 5HD5A 3FC7A 2ZBBA 3T4QA 3ZQ5A 4PKYA 5HDSA 3R7WB 3EQUA 5L8MA 2P7JA 3W2ZA 3RH8B 1GSVA 3BQ8A 3T4JA 2HF6A 1S1YA 3G6OA 4NXEA 4LRZE 1MZUA 2V0UA 1P9WA 5HPIA 1DP8A 3LIDA 1S4SA 4R70A 1XJ6A 4ME4A 3EEHA 2M7VA 4ARZB 2FZ0A 2JKTM 1G6OA 1IOUA 3T50A 2VX8A 1YSPA 3V67A 4BBTA 2PDRA 2GZAA 3BY9A 3KYQA 3FPVA 3F1OB 1WA9A 3BQAA 4H6JB 4CQHA 3H9WA 4EERA 3LI8A 4GJ4A 1VB6A 4K08A 4ARZA 1TD5A 4XT2B 3R4KA 1TS6A 4LLOB 1EW0A 4ETZA 3OCLA 1NWZA 4LRYC 2VV7A 3F1OA 3P7NA 1OPXA 5TBMB 3P01A 2JKTI 3MQ0A 3E98A 4Q0JA 5KSHA 2VKSA 3KYZA 4MN7A 1XJ3A 2K31A 5DJTA 5DKLA 2PYRA 3TRCA 5F6AA 2KX6A 4R3AA 5HWVA 4Y5FA 5TBMA 3CUEC 2EWVA 4NXGA 3H7WB 4F3LB 1JNUA 1P9RA 3MQOA 4GS9A 4AFIA 2W3FA 5DJUA 1T18A 2XA7S 2ZMFA 3T4TA 2R78A 3MXQA 3JVVA 2HJ9C 5A8BA 4L9EA 3IBRA 1UWPX 3BJNA 4HP9A 2PHYA 1TS8A 5DFYA 4DJ2A 4KQOA 1G28A 2QJ5A 3UMEA 2XROA 1DP6A 4F3LA 3H7WA 3H82B 1V9YA 3UB9A 3T4KA 1T1AA 3F1PB 3LR4A 3F1NB 1GSWA 5HZHA 1MC0A 1OTBA 2YKHA 4EW7A 5KIZA 2WKRA 4CLCB 3B33A 2L1MA 2W27A 5F68A 4EXOA 2MJ6A 3H82A 4UQIM 4WELA 3UB7A 3UMDA 5AVEA 1BYWA 2H28A 2JKRM 4ZRRA 2VEAA 4BWIA 3F1PA 3F1NA 5F69A 2W1RA 3OOVA 4I3JA 2V0WA 5TJJA 4GW9A 4CLCA 2CMNA 3LIEA 1TF1A 4LRXC 1W63M 2W3GA 5G4YA 1LSWA 4KUOA 2ZOHA 1S4RA 5FL3A 2VGLS 4IUKA 4L9FA 5HL6A 4DJ3A 1S1ZA 3EQVA 2ZMVA 5F5YA 5CX7A 3VV4A 1ZHHB 4HOIA 2EWWA 3KSFA 4HNBA 2J3WA 4IJGA 2PR5A 1DRMA 1NLYA 3PBSA 2JKRI 2HV1A 4HJ3A 1T19A 3UB8A 2QHKA 2WKPA 2FH5A 4YNRA 3KSGA 1XFNA 4EEUA 3E0YA 4BJPA 2W3HA 4PHTA 3TW8A 5J3WA 3ICYA 2PYPA 3MMHA 3T4OA 2L0WA 2EA9A 2JN7A 3NHQA 3PBNA 3EGDC 3KSHA 4HJ4A 4WEJA 3VE3A 5C5KA 2Y8HA 4HJ6A 4PAUA 3HCYA 2HGVA 4WN5A 2KDKA 1T1CA 2XRNA 1OTIA 3CAXA 2K7SA 1UGUA 4NXBA 1OJ5A 4I39A 1LSXA 1VHMA 2HJEA 5HSQA 4Y3IA 4P6ZS 3E4OA 3JVUA 3C30A 4BBUA 3PR6A 4CLCD 2BASA 2VA0A 4I38A 3TE8A 4GS9B 4QPRA 5DFXA 4MMNA 2D01A 3CITA 2O0YA 3UE3A 3E4PA 2W0NA 4M4XA 4JGQA 2VLGA 3CLOA 3FPWA 3A0SA 1OTAA 4HY8A 5DF9A 4FSFA 1UWNX 2GJ3A 1YSQA 4MDZA 1NRJA 3EOIA 2O9BA 4ETXA 2J3TD 1DP9A 4I3IA 4B93A 3LIAA 4UQIS 3S7PA 2O99A 3DBAA 3EGXC 5J4EA 4KUKA 3LFVA 3ULFA 4EU0A 2LB5A 2Y79A 4MCWA 4EEPA 2VZWA 1IFQA 4B9OA 3GECA 4L9GA 3CI6A 3LYXA 3C8CA 2WKQA 1Y28A 3T4LA 2A24B 1OJGA 5HDCA 2GNXA 4WEKA 4MN5A 3FG8A 2PD8A 4G3VA 4NKPA 3LR5A 3NJAA 4CLCC 4CLCE 1LL8A 5HD3A 4YWZA 2VV8A 3HJIA 3K3CA 1STZA 2IA2A 2QKPA 1XFQA 2OWJA 2VV6A 3NOPC 4JGPA 2A24A 1N9NA 3CUEA 5G4ZA 4R6LA 2O9CA 3TJZC 4YOFA 2OAP1 4OOMA 3A0RA 3HJKA 3MF0A 4IUHA 4HH2A 2QWSA 4O01A 4Y2FA 3KO6A 1MKMA 2B02A 2W3EA 3UB6A 4L0LA 4JGRA 3PBRA 2XA7M 2P04A 4EUVA 3ZYTA 4NEED 3RFBA 3D72A 3S7NA 3OC2A 2YKFA 4HIAA 1D06A 2A2LA 2G7UA 4HI4A 4BBVA 2JHEA 5IT5A 2J80A 2Z6CA 1TS7A 2K2NA 4G3KA 2D02A 2OOLA 3C2WA 4WLAA 2W3DA 5HWTA 2OWHA 4HQAA 4GCZA 2ZOIA 1OTDA 1S67L 2O9AA 5HDDA 3C38A 3PXPA 3LI9A 1F98A 4LPZA 2W1TB 2V1AA 1KOUA 1N9LA 3EWKA 3SW1A 1F5MA 4EESA 4GHIA 3U2AA 2PR6A 2P08A 4O0PA 3KX0X 1F9IA 2Z6DA 2VGLM 2V9AA 2W1TA 4HHDA 3R7WA 3VOLA 1OT9A 1YAXA 1LSVA 1TS0A 3PYPA 3LIFA 3BWLA 1GSXA 2INWA 3K3DA 1V9ZA 1H8MA 3K2NA 3T4SA 3MFXA 3BY8A 4II7A 2B18A 4PKYG 3MJQA 5HPFA 5K5BA 1LT0A 1ZTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KQD A;  4MN6 A;  3IS2 B;  4H6J A;  5IU1 A;  1OT6 A;  3MQQ A;  4WF0 A;  1N9O A;  1ODV A;  4XT2 A;  3MR0 A;  3VE4 A;  4RQ9 A;  3LIB A;  4HP4 A;  4I5S A;  4E04 A;  3IS2 A;  3RTY A;  4I3A A;  3LUQ A;  4WL9 A;  3NOT C;  1T1B A;  3NOU C;  4EQ1 A;  1XJ2 A;  3OLO A;  2PD7 A;  5J7E A;  5I5L A;  3UE6 A;  4R38 A;  3CWF A;  5AVF A;  1S66 L;  4NXF A;  2L4R A;  2I9V A;  5DKK A;  3E4Q A;  3A0V A;  1X0O A;  2QJ7 A;  2V1B A;  3LIC A;  1OTE A;  1D7E A;  4WUJ A;  4JGO A;  1P0Z A;  4EET B;  3GDI A;  3PHY A;  4GHI B;  4HH3 A;  1P97 A;  5HWW A;  5EFW A;  1XJ4 A;  5IS1 A;  2M1C A;  5HD5 A;  3ZQ5 A;  2ZBB A;  3FC7 A;  4PKY A;  5HDS A;  2P7J A;  3RH8 B;  1GSV A;  1S1Y A;  3G6O A;  4NXE A;  4LRZ E;  1MZU A;  2V0U A;  1DP8 A;  3LID A;  1S4S A;  4R70 A;  1XJ6 A;  3EEH A;  3T50 A;  4BBT A;  2PDR A;  3BY9 A;  3F1O B;  1WA9 A;  4H6J B;  3H9W A;  4EER A;  3LI8 A;  1VB6 A;  4K08 A;  4XT2 B;  1TS6 A;  4LLO B;  1EW0 A;  1NWZ A;  4LRY C;  2VV7 A;  3F1O A;  3P7N A;  5TBM B;  1XJ3 A;  5DJT A;  5DKL A;  2PYR A;  5F6A A;  2KX6 A;  4R3A A;  5HWV A;  5TBM A;  4NXG A;  4F3L B;  3H7W B;  1JNU A;  3MQO A;  4GS9 A;  5DJU A;  1T18 A;  2R78 A;  3MXQ A;  5A8B A;  4L9E A;  3IBR A;  1UWP X;  4HP9 A;  2PHY A;  1TS8 A;  4DJ2 A;  1G28 A;  2QJ5 A;  3UME A;  1DP6 A;  4F3L A;  3H7W A;  3H82 B;  1V9Y A;  3UB9 A;  1T1A A;  3F1P B;  3F1N B;  1GSW A;  5HZH A;  1OTB A;  2YKH A;  4EW7 A;  5KIZ A;  2WKR A;  3B33 A;  2L1M A;  2W27 A;  5F68 A;  4EXO A;  3H82 A;  3UB7 A;  3UMD A;  5AVE A;  1BYW A;  2H28 A;  2VEA A;  3F1P A;  3F1N A;  5F69 A;  4I3J A;  2V0W A;  4GW9 A;  2CMN A;  3LIE A;  4LRX C;  5G4Y A;  1LSW A;  4KUO A;  2ZOH A;  1S4R A;  4L9F A;  4DJ3 A;  1S1Z A;  5F5Y A;  4HOI A;  4HNB A;  2PR5 A;  1DRM A;  2HV1 A;  4HJ3 A;  1T19 A;  3UB8 A;  2QHK A;  2WKP A;  1XFN A;  4EEU A;  5J3W A;  3ICY A;  2PYP A;  2L0W A;  2EA9 A;  2JN7 A;  3NHQ A;  4HJ4 A;  3VE3 A;  4HJ6 A;  4WN5 A;  2KDK A;  1T1C A;  1OTI A;  3CAX A;  2K7S A;  1UGU A;  4NXB A;  1OJ5 A;  4I39 A;  1LSX A;  5HSQ A;  3E4O A;  4BBU A;  2BAS A;  4I38 A;  4GS9 B;  2D01 A;  3E4P A;  2W0N A;  4M4X A;  4JGQ A;  2VLG A;  3CLO A;  3A0S A;  1OTA A;  4HY8 A;  1UWN X;  2GJ3 A;  1DP9 A;  4I3I A;  3LIA A;  5J4E A;  4KUK A;  3ULF A;  4EEP A;  4B9O A;  3GEC A;  4L9G A;  3LYX A;  3C8C A;  2WKQ A;  1Y28 A;  2A24 B;  1OJG A;  5HDC A;  4MN5 A;  3FG8 A;  2PD8 A;  3NJA A;  1LL8 A;  5HD3 A;  4YWZ A;  2VV8 A;  3HJI A;  3K3C A;  2QKP A;  1XFQ A;  2OWJ A;  2VV6 A;  3NOP C;  4JGP A;  2A24 A;  1N9N A;  5G4Z A;  4R6L A;  3A0R A;  3HJK A;  4HH2 A;  2QWS A;  2B02 A;  3UB6 A;  4JGR A;  3D72 A;  2YKF A;  4HIA A;  1D06 A;  4HI4 A;  4BBV A;  2JHE A;  2J80 A;  2Z6C A;  1TS7 A;  2D02 A;  2OOL A;  3C2W A;  4WLA A;  5HWT A;  2OWH A;  4HQA A;  4GCZ A;  2ZOI A;  1OTD A;  1S67 L;  5HDD A;  3LI9 A;  1F98 A;  4LPZ A;  2V1A A;  1KOU A;  1N9L A;  3EWK A;  3SW1 A;  4EES A;  4GHI A;  2PR6 A;  3KX0 X;  1F9I A;  2Z6D A;  2V9A A;  4HHD A;  3VOL A;  1OT9 A;  1LSV A;  1TS0 A;  3PYP A;  3LIF A;  3BWL A;  1GSX A;  2INW A;  3K3D A;  1V9Z A;  3MFX A;  3BY8 A;  4PKY G;  3MJQ A;  1LT0 A; 
#chains in the Genus database with same CATH topology
 1ACF A;  2WKH A;  3OBF A;  3IS2 B;  1M6K A;  5TR7 A;  4H6J A;  5IU1 A;  2ZM8 A;  1PZP A;  4DMZ A;  4WF0 A;  1K6S A;  3LEZ A;  3N6I A;  4X56 A;  5HL1 A;  3UPN A;  2WAD A;  5LBR A;  2WYX A;  1ERM A;  1W63 Q;  4B4Z A;  3D3O A;  5HW3 A;  1AXB A;  4GDB A;  4WL9 A;  3TSG A;  4G3W A;  4S2N C;  2M7U A;  2PU2 A;  3T1X A;  3OLO A;  4KZA A;  1LI9 A;  5AQ7 A;  5E2E A;  3PBO A;  4OOL A;  4UEY A;  3CWF A;  1VEU A;  1O07 A;  4OQI A;  3GMW A;  1MPL A;  3CZD A;  3BW6 A;  2NUP C;  1S66 L;  2EFX A;  3HLB A;  5GHY A;  3MZE A;  3OCN A;  4UA9 A;  4E3L A;  1X0O A;  3S7Q A;  4P87 A;  4IBX A;  1WE4 A;  3ZVW A;  3LR3 A;  1OTE A;  4IED A;  2JCH A;  4O8G A;  4GDN A;  2P9V B;  2Y2P A;  3GDI A;  1GHP A;  3PHY A;  5CGW A;  3E2K A;  1P97 A;  1H0M A;  2XSS A;  3JPU A;  4EWF A;  4E3M A;  2KOI A;  1IKG A;  2ZBB A;  5HDS A;  4E3N A;  2P7J A;  2Y2H A;  4N9K A;  3IWO A;  1GSV A;  3N8R A;  5FQI A;  4NXE A;  1MZU A;  4FTX A;  3VP2 A;  1S4S A;  1PW1 A;  1G68 A;  3D9Y A;  3DWZ A;  4E3O A;  1NRF A;  2M7V A;  2FZ0 A;  2JKT M;  3ISG A;  3V67 A;  4BBT A;  2EX2 A;  3BY9 A;  3BQA A;  4CQH A;  4GJ4 A;  2J8Y A;  4WM9 A;  1AWI A;  1XP4 A;  4DDS A;  5FSR A;  1TS6 A;  1MWR A;  4KQR A;  1EW0 A;  4QY6 A;  4ETZ A;  3F1O A;  3P7N A;  1OPX A;  3ZGA B;  3SS5 A;  1SKO A;  4WZ5 A;  3P01 A;  2JKT I;  3MQ0 A;  4Q0J A;  2VKS A;  3KYZ A;  2ZD8 A;  4C75 A;  3VP0 A;  3DTI A;  4FH2 A;  4JF4 A;  5F6A A;  1MWS A;  2KX6 A;  2EWV A;  4NXG A;  4GS9 A;  3QP2 A;  2ZMF A;  3NI9 A;  1YM1 A;  3BJN A;  2B95 A;  4KQO A;  2XRO A;  2H0Y A;  5FEF A;  4F3L A;  3H7W A;  3H82 B;  1V9Y A;  2QMI A;  1TEM A;  3T4K A;  5EUA A;  3AGF A;  3L9K A;  2QZ6 A;  1MC0 A;  5L10 A;  2YKH A;  2Q0O A;  2W27 A;  3ZVT A;  1L0D A;  1PIO A;  2XFT A;  1XKZ A;  5EM1 A;  3ZNY A;  4Y17 A;  4R3J A;  3F1P A;  2HP9 A;  3F1N A;  2RCX A;  5KSC A;  1JWZ A;  2ZC6 B;  4CLC A;  3O3V A;  4Y0T A;  3HL9 A;  1LSW A;  1ES4 A;  3ZCZ A;  4JXS A;  5FL3 A;  2VGL S;  1BLC A;  1ALQ A;  5FAQ A;  4L9F A;  4DJ3 A;  2OLV A;  2DRW A;  5F5Y A;  5EVI C;  3ZG7 B;  2EWW A;  3KSF A;  4R3B A;  3BM6 A;  4HNB A;  1C3B A;  5CXW A;  2PR5 A;  4DDY A;  1DRM A;  4HJ3 A;  3VP4 A;  1Y4O A;  2FH5 A;  1MXO A;  5GHZ A;  2WZX A;  4ESP A;  3TW8 A;  4N1X A;  3T4O A;  3MMH A;  5E43 A;  2L0W A;  2ZM2 A;  4KG5 A;  5E2F A;  1YLP A;  2VK3 A;  4DRT A;  4WN5 A;  4JLF A;  5EVE A;  1UGU A;  1OJ5 A;  3M6B A;  4B4X A;  4Y3I A;  3V3R A;  1MWT A;  4BBU A;  5F1G A;  3TE8 A;  1ESI A;  4QPR A;  4QY5 A;  3UE3 A;  3G2Y A;  5F1F A;  3DTE A;  2W0N A;  1FOF A;  5F82 A;  5A90 A;  4JGQ A;  2VLG A;  3CLO A;  4DE1 A;  2PAV P;  1UWN X;  1RGY A;  2X02 A;  2O9B A;  2R9W A;  2J3T D;  3MBZ A;  5L07 A;  1E3U D;  3LIA A;  3S7P A;  4Y7P A;  3DBA A;  3G35 A;  5J4E A;  4KUK A;  2ACG A;  4H8R A;  4EEP A;  1XPB A;  3NDG A;  3IXB A;  1J9M A;  2H0T A;  1FSY A;  2RL3 A;  2ZQ8 A;  3BFF A;  5FQM A;  4OQH A;  3N8S A;  3LR5 A;  1LL8 A;  2Y2M A;  4OP8 A;  3K3C A;  1JTD A;  2OWJ A;  2VV6 A;  5HAP A;  4WMC D;  1KE0 A;  3A3I A;  3A0R A;  4IUH A;  3WS2 A;  4S2N A;  4OPQ A;  3PAE A;  4RX3 A;  3IXH A;  5CHM A;  3DW0 A;  4L0L A;  3JYI A;  5HFO A;  2XA7 M;  2Y2J A;  4ZTK A;  4EUV A;  4UHU A;  4WZ4 A;  1KE4 A;  3OC2 A;  3C4P A;  3HLC A;  1HD8 A;  3LEQ A;  2J80 A;  3MSH A;  4MBH A;  3OPP A;  3ZG5 A;  4U0T A;  1H5X A;  2K2N A;  3C2W A;  3O87 A;  4JF5 A;  2O9A A;  1S67 L;  3PXP A;  3LI9 A;  1BT5 A;  3G2Z A;  1JWP A;  1F98 A;  2XQZ A;  2W1T B;  1N9L A;  1XGI A;  4ZAM A;  5L09 A;  5FDS A;  1LLB A;  2WZZ A;  4WZ5 C;  2ZJ9 A;  3KX0 X;  1DJB A;  1OT9 A;  3QHY A;  1YAX A;  3QNC A;  3W8K A;  4CPK A;  1LSV A;  3BWL A;  2C5W B;  3V5M A;  2ZC5 B;  1L0G A;  3BY8 A;  3NY4 A;  2JBF A;  5FQQ A;  1DJA A;  4N92 A;  4RYE A;  1ZTU A;  3IF5 A;  1JVJ A;  2PT7 A;  4MN6 A;  1HZO A;  3MS6 A;  4Q0I A;  5EOE A;  3IWQ A;  2FFY A;  1ODV A;  3MR0 A;  2OLU A;  4RQ9 A;  5MC7 A;  4LFU A;  3RTY A;  3FZC A;  1ESU A;  3BFC A;  5FQ9 A;  3IBJ A;  1TDL A;  3NOT C;  1T1B A;  2XD1 A;  2OAQ 1;  1YKD A;  4MBK A;  4E3K A;  2C6W B;  1K56 D;  2HP6 A;  2PD7 A;  2Y4A A;  5J7E A;  5AVF A;  1MKI A;  3B42 A;  1IKI A;  3VSK A;  3AGD A;  1K6R A;  4S2I A;  3D4F A;  4OP5 A;  4ZJ1 A;  4KZ9 A;  2LB9 A;  2KLI A;  4IHQ A;  3BRM A;  4D2O A;  3OPH A;  2V1B A;  3LIC A;  2BTF P;  5M18 A;  3I7J A;  4JGO A;  1P0Z A;  3DAV A;  5GLD A;  4GLQ A;  3IF6 B;  5HWW A;  4GB7 A;  1PI5 A;  5JYO A;  1RP5 A;  2M1C A;  3T4Q A;  1NJ4 A;  4RA7 A;  3EQU A;  4JXG A;  3W4Q A;  5DF8 A;  4U3T A;  1JWV A;  3BFE A;  5HAI A;  4R4R A;  2HF6 A;  1S1Y A;  4KZ4 A;  4LRZ E;  2XFS A;  1KDS A;  1DP8 A;  3LID A;  1LL9 A;  2EXB A;  4PM7 A;  3UDX A;  3T50 A;  2VX8 A;  1YSP A;  4NG2 A;  4XUZ A;  3LI8 A;  5CHJ A;  2V1Z A;  4ARZ A;  1TD5 A;  4XT2 B;  4KG2 A;  3LY4 A;  3NUL A;  2BG1 A;  1PFL A;  1Y54 A;  3HVF A;  5EOO A;  5DTS A;  4LRY C;  1KGE A;  2VV7 A;  5AQB A;  1PNE A;  5DJT A;  1Z6F A;  3TRC A;  3G4P A;  3Q7Z A;  4N9L A;  3CJM A;  4JF6 A;  5TBM A;  3MQO A;  4AFI A;  2W3F A;  3FKW A;  4OPZ A;  4R1G A;  1FIK A;  2XA7 S;  1W8Y A;  2R78 A;  3MXQ A;  3JVV A;  2HDR A;  3WWX A;  4HP9 A;  4KZ7 A;  2XF3 A;  1G28 A;  2JE5 A;  2QPN A;  4BLM A;  3CPT B;  1L0F A;  5HZH A;  5KIZ A;  2WKR A;  5GLC A;  3MFD A;  1G6A A;  5JYP A;  2MJ6 A;  2XEP A;  4PM5 A;  4WEL A;  3UB7 A;  5TGF A;  4DE3 A;  5AVE A;  4ZRR A;  1ES5 A;  3ZFZ A;  5F69 A;  1FQG A;  3T1Q B;  5I94 A;  5GL9 A;  3LIE A;  1TF1 A;  4LRX C;  3AGE A;  3N4I A;  1K0K A;  2ZOH A;  3P98 A;  4UAA A;  1S1Z A;  3VV4 A;  4HOI A;  1KDW A;  2J3W A;  1DY6 A;  1QME A;  5FI2 A;  3QP8 A;  4GKU A;  5GHX A;  3PBS A;  2HV1 A;  2JKF A;  1T19 A;  3UB8 A;  1XFN A;  3HLE A;  4P0M A;  1FCM A;  2W3H A;  3MXR A;  2P74 A;  2PYP A;  1LL5 A;  2EA9 A;  3N8L A;  4DE0 A;  1NYY A;  4X68 A;  2ZL1 B;  3KSH A;  5HAQ A;  4PMA A;  2ZLY A;  3VSL A;  4LCL A;  5EE8 A;  2R9X A;  4HJ6 A;  1MY8 A;  1YLZ A;  2WUQ A;  2KDK A;  2XRN A;  2Y2G A;  4WMC A;  5DVA A;  3UB5 P;  4O7D A;  3QNB A;  1VHM A;  3S22 A;  5HSQ A;  5L2F A;  3E4O A;  3JVU A;  4JBF A;  4S2P A;  2Y2K A;  3NEC A;  4I38 A;  4DXC A;  5DFX A;  4MMN A;  1H8Z A;  2HP5 A;  1I5Q A;  3HUO A;  2JC7 A;  4UA6 A;  1O7E A;  3SH8 A;  3A0S A;  1OTA A;  5CGX A;  4HY8 A;  3FWL A;  3M2K A;  4FSF A;  3W4O A;  3O86 A;  4IVI A;  1K57 C;  1XA1 A;  1YSQ A;  4MDZ A;  1NRJ A;  1J3W A;  1DP9 A;  4I3I A;  4B93 A;  2LB5 A;  2ZC7 A;  4MCW A;  1VET A;  5CRF A;  1IFQ A;  3GEC A;  4S2K A;  2ZC4 B;  4OQG A;  4FCF A;  1SHV A;  2A24 B;  2WGW B;  3FG8 A;  3CG5 A;  3MKF A;  4NKP A;  4CLC E;  5HD3 A;  1FR1 A;  4X6T A;  2IA2 A;  3OPR A;  5G4Z A;  2HDS A;  3HBR A;  2PU4 A;  2O9C A;  3GR2 A;  4CJN A;  3E2L A;  4OOM A;  3HJK A;  4PM6 A;  4HH2 A;  5FI7 A;  3UDI A;  2X71 A;  1N4O A;  2Z2M B;  2W3E A;  3UB6 A;  1BLP A;  3LGO A;  1GA0 A;  1K54 C;  3PBR A;  4HEF A;  2P04 A;  1YLW A;  5M19 A;  4NEE D;  4BEN A;  1D1J A;  3D72 A;  3FV7 A;  3HLF A;  3O88 A;  3S7N A;  3FKV A;  2JHE A;  1LI0 A;  4X53 A;  5HWT A;  5EVI B;  2OWH A;  5HDD A;  2H10 A;  1VQQ A;  3IHB A;  5E2H A;  4X1M A;  4LPZ A;  1TDG A;  4OQ0 A;  1SCW A;  3V39 A;  3UE0 A;  5FAS A;  1YLJ A;  3U2A A;  1JTG A;  1K56 A;  2PR6 A;  2P08 A;  4O0P A;  1F9I A;  2V2F F;  2V9A A;  4P6B A;  3VOL A;  3G34 A;  3PYP A;  1FR6 A;  4E6W A;  1ZG6 A;  3K3D A;  3SH9 A;  2B5R A;  3T4S A;  3MFX A;  4DF6 A;  3IHA A;  1FIL A;  3MJQ A;  3Q7V A;  1FCO A;  1LT0 A;  1CQA A;  4DN0 A;  2H5S A;  1L3L A;  3G31 A;  4E3I A;  4GD6 A;  2AVX A;  1OT6 A;  1PYY A;  3KSI A;  3MQQ A;  4D60 A;  5AJG A;  1CJF A;  1N9O A;  4XT2 A;  3S7O A;  1YLY A;  3O5Y A;  4HP4 A;  1SZV A;  4I5S A;  3IS2 A;  4I3A A;  3ZG9 B;  4IBR A;  1W5D A;  5DF7 A;  3BFD A;  4P6Z M;  1VEU B;  1ZKJ A;  1Q2Q A;  4EQ1 A;  4RVA A;  1XJ2 A;  2G2W A;  2HPB A;  3B47 A;  4QJG A;  4OON A;  3UE6 A;  4EBN A;  1H3Q A;  3EEA A;  1U60 A;  2NUT C;  3PBT A;  4LV3 A;  3VOY A;  4DXB A;  4NXF A;  2L4R A;  2J3T C;  2I9V A;  3G32 A;  3QP4 A;  3Q81 A;  4UA7 A;  1EI5 A;  4FH4 A;  4YIN A;  5EPH A;  5CTM A;  4BL2 A;  2Y59 A;  4QD4 A;  1NLZ A;  2VJW A;  3MZD A;  4HH3 A;  4YFM A;  1RGZ A;  3BEB A;  1XJ4 A;  3M6H A;  2Z2L B;  3ZHH A;  5HD5 A;  3FC7 A;  3ZQ5 A;  2P9V A;  3HLG A;  3UO9 A;  5TFQ A;  5L8M A;  4OPR A;  3RH8 B;  1F2K A;  3B3X A;  4MBF A;  1P9W A;  1OME A;  4X25 A;  4R70 A;  3IQA A;  1W7F A;  1XJ6 A;  1DJC A;  3KYE A;  4ME4 A;  1IOU A;  3TOI A;  2PDR A;  5J8X A;  4HBU A;  2GZA A;  2XLN A;  3F1O B;  3WRT A;  4EBL A;  4C3Q A;  4ZDX A;  1SKO B;  2ZQ9 A;  1VB6 A;  4K08 A;  3WS0 A;  3R4K A;  3OCL A;  3QP1 A;  2X01 A;  4GZB A;  5CEB A;  3E98 A;  5KSH A;  2BLS A;  4MN7 A;  5DKL A;  2Y2I A;  5FEG A;  4Z9Q A;  3LCE A;  5A91 A;  2IWD A;  4R3A A;  5HWV A;  4Y15 A;  4Y5F A;  4E6X A;  1XA7 A;  3H7W B;  4F3L B;  5FQJ A;  1EWZ A;  2IWB A;  3HLW A;  4HES A;  1FCN A;  3PTE A;  3T4T A;  1HVB A;  2HJ9 C;  3C7V A;  3IBR A;  3GRJ A;  3SZT A;  1LHY A;  5DFY A;  1TS8 A;  2QJ5 A;  1DP6 A;  1K57 A;  3UB9 A;  3SS3 A;  2WAF A;  1T1A A;  3F1P B;  3LR4 A;  3BLM A;  3F1N B;  1GSW A;  3DWK A;  4CLC B;  3V3S A;  5F68 A;  3MZF A;  3H82 A;  1H8Y A;  1IYQ A;  3UMD A;  1BYW A;  2H28 A;  2VEA A;  2EX6 A;  3A3F A;  3C7U A;  2A49 A;  2J9P A;  2W1R A;  3OOV A;  4EUZ A;  4NK3 A;  4MNR A;  4GW9 A;  4KQQ A;  5FA7 A;  2CMN A;  4KZ3 A;  5G4Y A;  1HLU P;  3NBL A;  4KUO A;  1IYS A;  1K4F A;  1S4R A;  4R0Q A;  2IWC A;  3IF6 C;  3EQV A;  2ZMV A;  5CX7 A;  3NCK A;  5FDH A;  3ITA A;  3S1Y A;  4IJG A;  2E8J A;  4R4S A;  4ZBE A;  1IEM A;  1K54 A;  2EX9 A;  5IHV A;  2QHK A;  5GLB A;  4YNR A;  3T1S A;  4LV0 A;  4OLG A;  5EVL A;  4KZB A;  3E0Y A;  2JKG A;  3WRZ A;  4BJP A;  4XXR A;  1ONH A;  5F83 A;  2JN7 A;  1SKF A;  3BFG A;  4QHC A;  2HDU A;  1ZG4 A;  4WEJ A;  3VE3 A;  2Y8H A;  4PAU A;  4S2M A;  3HCY A;  4KZ6 A;  5CEC A;  4X69 A;  2HGV A;  1OTI A;  2K7S A;  4NXB A;  4NET A;  2ZQA A;  3UPP A;  4P6Z S;  1YLT A;  3PR6 A;  2BAS A;  3CIT A;  1TVF A;  3M2J A;  3IXD A;  4N1H A;  4M4X A;  3MXS A;  3FPW A;  5EEC A;  1KGF A;  5U47 A;  3TG9 A;  3EOI A;  1Z09 A;  4F94 A;  4UQI S;  5CER A;  2O99 A;  3EGX C;  3HLD A;  4OKP A;  4EU0 A;  5BOH A;  4B9O A;  1IEL A;  3CMZ A;  2UWX A;  4L9G A;  3CI6 A;  3C8C A;  2WKQ A;  1OJG A;  2HDQ A;  2OSU A;  5HDC A;  3FYZ A;  3UY6 A;  2GNX A;  4MN5 A;  3SS4 A;  2PD8 A;  1YMS A;  3RXW A;  3NJA A;  1XGJ A;  2Q9M A;  3HJI A;  1STZ A;  3HRE A;  2QKP A;  4JGP A;  1N9N A;  3CUE A;  4DKI A;  4R6L A;  3SOI A;  2OAP 1;  5D3O A;  4K91 A;  2Y91 A;  4Y2F A;  3UNW A;  1GHM A;  1MKM A;  2B02 A;  3UDF A;  3VFF A;  5CED A;  4GNU A;  1SDN A;  3UN7 A;  2Y55 A;  3RFB A;  4X55 A;  4JKT A;  2WKE A;  2YKF A;  4MLL A;  4HIA A;  2G7U A;  4HI4 A;  4BBV A;  1YQS A;  1E3U A;  2DNS A;  4S2J A;  3Q07 A;  1ES2 A;  3L7H A;  4BL3 A;  3A3E A;  1TS7 A;  4QB8 A;  4G3K A;  2D02 A;  4K0W A;  3VP3 A;  2ZOI A;  4GD8 A;  1OTD A;  4XUX A;  1MBL A;  3C38 A;  2V1A A;  3EWK A;  5DTK A;  4IVK A;  1GA9 A;  5A92 A;  1Q2P A;  5M1A A;  3NC8 A;  5E2G A;  2W1T A;  4JXV A;  1KE3 A;  5DTT A;  2Y2Q A;  4P85 A;  3LIF A;  1GSX A;  1V9Z A;  3K2N A;  1E25 A;  3GTC A;  4R23 A;  2Y2O A;  4II7 A;  1ES3 A;  2E8I A;  1XX2 A;  2B18 A;  4PKY G;  4KG6 A;  4M3K A;  5K5B A;  2ZQD A;  2ZMA A;  1I2S A;  1IYO A;  3IXG A;  4KQD A;  3IX4 A;  2GX5 A;  4OLD A;  3BLS A;  2DMW A;  3PAG A;  3VE4 A;  3LIB A;  1PZO A;  5GLA A;  4E04 A;  4KEN B;  1A0K A;  3LUQ A;  4OPY A;  4LV1 A;  4ZJ3 A;  3LR0 A;  2XD5 A;  3BEC A;  3NOU C;  2FFF B;  5EVI D;  2EXA A;  2PBD P;  1K38 A;  1G5U A;  4E3J A;  5I5L A;  4R38 A;  3C4O A;  3C5A A;  3ZG8 B;  3ITB A;  1NYM A;  4Q0H A;  1FSW A;  5EV0 A;  3VMA A;  2CC1 A;  3SH7 A;  4DE2 A;  5DKK A;  3E4Q A;  3NDE A;  4BMW A;  3A0V A;  3ZG0 A;  4Z1W A;  1SDE A;  2QJ7 A;  1MWU A;  1D7E A;  4WUJ A;  4Q8I A;  2WK0 A;  1BLH A;  1K25 A;  4FD8 A;  5CHU A;  3QP6 A;  4EET B;  3PBQ A;  4GHI B;  1XXM A;  3LY3 A;  2QYB A;  4FOF A;  5EFW A;  4JXW A;  1K55 C;  5IS1 A;  4ZJ2 A;  4K0X A;  4BQM A;  1NY0 A;  4PKY A;  3P09 A;  3R7W B;  2UV0 E;  3W2Z A;  4BD0 A;  4LGW A;  5EM0 A;  3IF6 A;  4GOG A;  5A93 A;  3BQ8 A;  3T4J A;  3RJU A;  3G6O A;  2WGI A;  4OOY A;  2V0U A;  5HPI A;  4EV4 A;  1PWD A;  4Y13 A;  1L2S A;  1BLS A;  3EEH A;  2ZQ7 A;  4ARZ B;  1G6O A;  5KZH A;  2ZQC A;  3KYQ A;  3FPV A;  1WA9 A;  2HZ5 A;  4H6J B;  2VGJ A;  3DTM A;  3H9W A;  4EER A;  2XDM A;  5AQA A;  1CI8 A;  1HTZ A;  4LV2 A;  4QU3 A;  1PWC A;  3OPL A;  4LLO B;  2VGK A;  1NWZ A;  3IX3 A;  2WAE A;  5TBM B;  2ZM0 A;  4KZ5 A;  4ID4 A;  4Y0O A;  1XJ3 A;  2K31 A;  2A3U A;  2PYR A;  1WYC A;  4JPM A;  2J9O A;  4FUW A;  3IX8 A;  2XK1 A;  3HUN A;  1BUE A;  3CUE C;  3RXX A;  1JNU A;  1P9R A;  1S6R A;  4U0X A;  5DJU A;  1ZC2 A;  1T18 A;  3IT9 A;  5CGS A;  4LCM A;  5A8B A;  4L9E A;  1UWP X;  2PHY A;  4DJ2 A;  3UME A;  1GCE A;  3GQZ A;  5FQK A;  1CEF A;  1OTB A;  4EW7 A;  3B33 A;  2L1M A;  2XR0 A;  4EXO A;  3W4P A;  1PI4 A;  4UQI M;  4Y0U A;  2WKI A;  2JKR M;  4BWI A;  3CPT A;  4I3J A;  2V0W A;  5TJJ A;  5FAO A;  2OV5 A;  3A3D A;  1W63 M;  2W3G A;  1CI9 A;  4X1L A;  3GSG A;  4IUK A;  5HL6 A;  4S2O A;  4QWO A;  1ZHH B;  3ZNT A;  1NZO A;  3MKE A;  1CK3 A;  3T12 B;  1NLY A;  2JKR I;  2PRF A;  1KGG A;  1VM1 A;  2WKP A;  2XH9 A;  3KSG A;  4EEU A;  3ZDJ A;  4PHT A;  1M40 A;  5J3W A;  3ICY A;  4MEZ A;  3NHQ A;  3PBN A;  3EGD C;  4HJ4 A;  4C6Y A;  1L0E A;  5C5K A;  4BD1 A;  2PBY A;  3UPO A;  4LEN A;  1T1C A;  1RCJ A;  1ERO A;  3CAX A;  1PRQ A;  1YT4 A;  4I39 A;  1LSX A;  2ZL1 A;  2HJE A;  1KVM A;  4WYY A;  3C30 A;  2V8F A;  1NXY A;  4CLC D;  2VA0 A;  4GS9 B;  2D01 A;  2O0Y A;  3S4X A;  3VOZ A;  3E4P A;  4OVD A;  1ERQ A;  1PW8 A;  1VET B;  2EFU A;  1PWG A;  3GV9 A;  3LO7 A;  5DF9 A;  4KZ8 A;  4B88 A;  2GJ3 A;  1BSG A;  2DCF A;  2Y2L A;  4ETX A;  3WS5 A;  3Q1F A;  1S0W A;  3LFV A;  3ULF A;  3BYD A;  2Y79 A;  1GHI A;  2VZW A;  2GDN A;  1K4E A;  2XGN A;  2Y2N A;  1CF0 A;  3CHW P;  3LYX A;  1Y28 A;  2G2U A;  3T4L A;  4WEK A;  4PM8 A;  4A5R A;  5HX9 A;  4G3V A;  4EBP A;  1YPR A;  4CLC C;  4YWZ A;  2VV8 A;  1XFQ A;  3NOP C;  1W8Q A;  2A24 A;  3WS4 A;  3TJZ C;  4EQI A;  4YOF A;  2WGW A;  1BZA A;  3MF0 A;  2QWS A;  4O01 A;  3VFH A;  3KO6 A;  4HBT A;  3NIA A;  4PM9 A;  3OZH A;  4JGR A;  3WS1 A;  3Q82 A;  3DTK A;  3ZYT A;  5KMW A;  2I72 A;  3IH8 A;  2V8C A;  1D06 A;  1YMX A;  3N7W A;  1BTL A;  1W79 A;  2A2L A;  4OH0 A;  5HAR A;  5IT5 A;  2Z6C A;  4WLA A;  2OOL A;  2W3D A;  4HQA A;  4GCZ A;  3GVB A;  1IYP A;  1E4D A;  1KOU A;  3SW1 A;  3G30 A;  1F5M A;  1WYB A;  4EES A;  5FAP A;  4GHI A;  4PPR A;  1NZU A;  3VP1 A;  2Q9N A;  5EVI A;  1K55 A;  2EX8 A;  1QMF A;  3UE1 A;  2Z6D A;  2VGL M;  4HHD A;  3R7W A;  5FI6 A;  3IWI A;  2V20 A;  5CTN A;  5G18 A;  3Q7V B;  3IH9 A;  1TS0 A;  3T1R A;  2WGV A;  4WBG A;  1KVL A;  2INW A;  4S2L A;  1H8M A;  2ZC3 B;  1ONG A;  4GN2 A;  1CEG A;  3HUM A;  4RX2 A;  3A3J A;  1I2W A;  3U4L P;  5FAT A;  5AQ9 A;  1BUL A;  1N9B A;  3QP5 A;  3V50 A;  5HPF A;  2J7V A; 
#chains in the Genus database with same CATH homology
 4KQD A;  2PT7 A;  4MN6 A;  2GX5 A;  4DN0 A;  3OBF A;  3IS2 B;  4Q0I A;  4H6J A;  5IU1 A;  1OT6 A;  3KSI A;  3MQQ A;  4DMZ A;  4WF0 A;  5AJG A;  2DMW A;  1N9O A;  1ODV A;  4XT2 A;  3S7O A;  3MR0 A;  3VE4 A;  3O5Y A;  4RQ9 A;  3LIB A;  4HP4 A;  4I5S A;  4E04 A;  5MC7 A;  3IS2 A;  3RTY A;  5LBR A;  4I3A A;  1W63 Q;  3LUQ A;  3D3O A;  3IBJ A;  3LR0 A;  4P6Z M;  4WL9 A;  3NOT C;  4G3W A;  1T1B A;  3NOU C;  2M7U A;  2OAQ 1;  4EQ1 A;  1YKD A;  1XJ2 A;  3OLO A;  2PD7 A;  3B47 A;  5J7E A;  3PBO A;  5I5L A;  3UE6 A;  4OOL A;  1H3Q A;  4UEY A;  3EEA A;  4R38 A;  3CWF A;  5AVF A;  2NUT C;  3B42 A;  3PBT A;  3BW6 A;  2NUP C;  1S66 L;  4Q0H A;  4NXF A;  2L4R A;  2J3T C;  2I9V A;  5DKK A;  3OCN A;  3E4Q A;  4BMW A;  3A0V A;  1X0O A;  3S7Q A;  2LB9 A;  2KLI A;  4IHQ A;  4Z1W A;  2QJ7 A;  2V1B A;  3LIC A;  3LR3 A;  1OTE A;  4O8G A;  1D7E A;  4WUJ A;  4JGO A;  1P0Z A;  4EET B;  3GDI A;  3PHY A;  3PBQ A;  4GHI B;  4GLQ A;  1NLZ A;  2VJW A;  4HH3 A;  1P97 A;  5HWW A;  2QYB A;  4FOF A;  5EFW A;  2XSS A;  1XJ4 A;  5IS1 A;  2M1C A;  2KOI A;  5HD5 A;  3FC7 A;  2ZBB A;  3T4Q A;  3ZQ5 A;  4PKY A;  5HDS A;  3R7W B;  3EQU A;  5L8M A;  2P7J A;  3W2Z A;  3RH8 B;  1GSV A;  3BQ8 A;  3T4J A;  2HF6 A;  1S1Y A;  3G6O A;  4NXE A;  4LRZ E;  1MZU A;  2V0U A;  1P9W A;  5HPI A;  1DP8 A;  3LID A;  1S4S A;  4R70 A;  1XJ6 A;  4ME4 A;  3EEH A;  2M7V A;  4ARZ B;  2FZ0 A;  2JKT M;  1G6O A;  1IOU A;  3T50 A;  2VX8 A;  1YSP A;  3V67 A;  4BBT A;  2PDR A;  2GZA A;  3BY9 A;  3KYQ A;  3FPV A;  3F1O B;  1WA9 A;  3BQA A;  4H6J B;  4CQH A;  3H9W A;  4EER A;  3LI8 A;  4GJ4 A;  1VB6 A;  4K08 A;  4ARZ A;  1TD5 A;  4XT2 B;  3R4K A;  1TS6 A;  4LLO B;  1EW0 A;  4ETZ A;  3OCL A;  1NWZ A;  4LRY C;  2VV7 A;  3F1O A;  3P7N A;  1OPX A;  5TBM B;  3P01 A;  2JKT I;  3MQ0 A;  3E98 A;  4Q0J A;  5KSH A;  2VKS A;  3KYZ A;  4MN7 A;  1XJ3 A;  2K31 A;  5DJT A;  5DKL A;  2PYR A;  3TRC A;  5F6A A;  2KX6 A;  4R3A A;  5HWV A;  4Y5F A;  5TBM A;  3CUE C;  2EWV A;  4NXG A;  3H7W B;  4F3L B;  1JNU A;  1P9R A;  3MQO A;  4GS9 A;  4AFI A;  2W3F A;  5DJU A;  1T18 A;  2XA7 S;  2ZMF A;  3T4T A;  2R78 A;  3MXQ A;  3JVV A;  2HJ9 C;  5A8B A;  4L9E A;  3IBR A;  1UWP X;  3BJN A;  4HP9 A;  2PHY A;  1TS8 A;  5DFY A;  4DJ2 A;  4KQO A;  1G28 A;  2QJ5 A;  3UME A;  2XRO A;  1DP6 A;  4F3L A;  3H7W A;  3H82 B;  1V9Y A;  3UB9 A;  3T4K A;  1T1A A;  3F1P B;  3LR4 A;  3F1N B;  1GSW A;  5HZH A;  1MC0 A;  1OTB A;  2YKH A;  4EW7 A;  5KIZ A;  2WKR A;  4CLC B;  3B33 A;  2L1M A;  2W27 A;  5F68 A;  4EXO A;  2MJ6 A;  3H82 A;  4UQI M;  4WEL A;  3UB7 A;  3UMD A;  5AVE A;  1BYW A;  2H28 A;  2JKR M;  4ZRR A;  2VEA A;  4BWI A;  3F1P A;  3F1N A;  5F69 A;  2W1R A;  3OOV A;  4I3J A;  2V0W A;  5TJJ A;  4GW9 A;  4CLC A;  2CMN A;  3LIE A;  1TF1 A;  4LRX C;  1W63 M;  2W3G A;  5G4Y A;  1LSW A;  4KUO A;  2ZOH A;  1S4R A;  5FL3 A;  2VGL S;  4IUK A;  4L9F A;  5HL6 A;  4DJ3 A;  1S1Z A;  3EQV A;  2ZMV A;  5F5Y A;  5CX7 A;  3VV4 A;  1ZHH B;  4HOI A;  2EWW A;  3KSF A;  4HNB A;  2J3W A;  4IJG A;  2PR5 A;  1DRM A;  1NLY A;  3PBS A;  2JKR I;  2HV1 A;  4HJ3 A;  1T19 A;  3UB8 A;  2QHK A;  2WKP A;  2FH5 A;  4YNR A;  3KSG A;  1XFN A;  4EEU A;  3E0Y A;  4BJP A;  2W3H A;  4PHT A;  3TW8 A;  5J3W A;  3ICY A;  2PYP A;  3MMH A;  3T4O A;  2L0W A;  2EA9 A;  2JN7 A;  3NHQ A;  3PBN A;  3EGD C;  3KSH A;  4HJ4 A;  4WEJ A;  3VE3 A;  5C5K A;  2Y8H A;  4HJ6 A;  4PAU A;  3HCY A;  2HGV A;  4WN5 A;  2KDK A;  1T1C A;  2XRN A;  1OTI A;  3CAX A;  2K7S A;  1UGU A;  4NXB A;  1OJ5 A;  4I39 A;  1LSX A;  1VHM A;  2HJE A;  5HSQ A;  4Y3I A;  4P6Z S;  3E4O A;  3JVU A;  3C30 A;  4BBU A;  3PR6 A;  4CLC D;  2BAS A;  2VA0 A;  4I38 A;  3TE8 A;  4GS9 B;  4QPR A;  5DFX A;  4MMN A;  2D01 A;  3CIT A;  2O0Y A;  3UE3 A;  3E4P A;  2W0N A;  4M4X A;  4JGQ A;  2VLG A;  3CLO A;  3FPW A;  3A0S A;  1OTA A;  4HY8 A;  5DF9 A;  4FSF A;  1UWN X;  2GJ3 A;  1YSQ A;  4MDZ A;  1NRJ A;  3EOI A;  2O9B A;  4ETX A;  2J3T D;  1DP9 A;  4I3I A;  4B93 A;  3LIA A;  4UQI S;  3S7P A;  2O99 A;  3DBA A;  3EGX C;  5J4E A;  4KUK A;  3LFV A;  3ULF A;  4EU0 A;  2LB5 A;  2Y79 A;  4MCW A;  4EEP A;  2VZW A;  1IFQ A;  4B9O A;  3GEC A;  4L9G A;  3CI6 A;  3LYX A;  3C8C A;  2WKQ A;  1Y28 A;  3T4L A;  2A24 B;  1OJG A;  5HDC A;  2GNX A;  4WEK A;  4MN5 A;  3FG8 A;  2PD8 A;  4G3V A;  4NKP A;  3LR5 A;  3NJA A;  4CLC C;  4CLC E;  1LL8 A;  5HD3 A;  4YWZ A;  2VV8 A;  3HJI A;  3K3C A;  1STZ A;  2IA2 A;  2QKP A;  1XFQ A;  2OWJ A;  2VV6 A;  3NOP C;  4JGP A;  2A24 A;  1N9N A;  3CUE A;  5G4Z A;  4R6L A;  2O9C A;  3TJZ C;  4YOF A;  2OAP 1;  4OOM A;  3A0R A;  3HJK A;  3MF0 A;  4IUH A;  4HH2 A;  2QWS A;  4O01 A;  4Y2F A;  3KO6 A;  1MKM A;  2B02 A;  2W3E A;  3UB6 A;  4L0L A;  4JGR A;  3PBR A;  2XA7 M;  2P04 A;  4EUV A;  3ZYT A;  4NEE D;  3RFB A;  3D72 A;  3S7N A;  3OC2 A;  2YKF A;  4HIA A;  1D06 A;  2A2L A;  2G7U A;  4HI4 A;  4BBV A;  2JHE A;  5IT5 A;  2J80 A;  2Z6C A;  1TS7 A;  2K2N A;  4G3K A;  2D02 A;  2OOL A;  3C2W A;  4WLA A;  2W3D A;  5HWT A;  2OWH A;  4HQA A;  4GCZ A;  2ZOI A;  1OTD A;  1S67 L;  2O9A A;  5HDD A;  3C38 A;  3PXP A;  3LI9 A;  1F98 A;  4LPZ A;  2W1T B;  2V1A A;  1KOU A;  1N9L A;  3EWK A;  3SW1 A;  1F5M A;  4EES A;  4GHI A;  3U2A A;  2PR6 A;  2P08 A;  4O0P A;  3KX0 X;  1F9I A;  2Z6D A;  2VGL M;  2V9A A;  2W1T A;  4HHD A;  3R7W A;  3VOL A;  1OT9 A;  1YAX A;  1LSV A;  1TS0 A;  3PYP A;  3LIF A;  3BWL A;  1GSX A;  2INW A;  3K3D A;  1V9Z A;  1H8M A;  3K2N A;  3T4S A;  3MFX A;  3BY8 A;  4II7 A;  2B18 A;  4PKY G;  3MJQ A;  5HPF A;  5K5B A;  1LT0 A;  1ZTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...