4NXBA

Crystal structure of ilov-i486(2lt) at ph 7.0
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
108
Chain Sequence
KNFVITDPRLPDNPIIFASDGFLELTEYSREEILGRNARFLQGPETDQATVQKIRDAIRDQRETTVQLINYTKSGKKFWNLLHLQPVRDQKGELQYFGVQLDGSDHVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phototropin-2
publication title Significant Expansion of Fluorescent Protein Sensing Ability through the Genetic Incorporation of Superior Photo-Induced Electron-Transfer Quenchers
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Flavoprotein, fluorescent protein
total genus 30
structure length 108
sequence length 109
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4nxbA00
2BASA 2V0UA 2PR5A 3K3CA 2K7SA 4HH3A 3BY9A 4R6LA 5HWVA 5DKLA 2PHYA 3IS2A 4I38A 1UWPX 1EW0A 4H6JB 3K3DA 3SW1A 1UGUA 3LIDA 4BBUA 2D02A 4KQDA 2V0WA 4NXBA 1OJ5A 1Y28A 3H82B 2V1BA 4B9OA 1DP8A 4L9EA 1G28A 1T1CA 4GS9A 4F3LB 1T1AA 4GCZA 3A0VA 3UB7A 4HIAA 1LSVA 4HNBA 1JNUA 5G4YA 5HWWA 3T50A 3UMDA 1OJGA 4GHIA 2Z6CA 3NJAA 1KOUA 4JGOA 3A0SA 4HY8A 2KX6A 2VV7A 5HWTA 3LYXA 1LSWA 5EFWA 4EEPA 4KUKA 2L0WA 3H9WA 4NXEA 1T19A 4HOIA 5HD3A 4RQ9A 3LUQA 2VV6A 1OT6A 4LRYC 2D01A 3H7WB 4MN6A 1S67L 3PYPA 1OTEA 4EXOA 2HV1A 1DP6A 2Z6DA 1D06A 4LPZA 3F1OA 4EESA 1GSVA 1LT0A 3NHQA 2EA9A 2QKPA 1T18A 1UWNX 4JGRA 1VB6A 4LRZE 5F68A 2H28A 2OWHA 1LL8A 5AVFA 1OTBA 4DJ2A 1XFNA 4PKYG 1D7EA 5HSQA 1P97A 4E04A 3F1PB 4I3IA 3ULFA 3BY8A 2WKQA 3CLOA 5HD5A 1S1YA 5KIZA 2WKPA 3C2WA 3LI9A 1S1ZA 3PHYA 3LIBA 3G6OA 1WA9A 3HJIA 4HJ4A 3C8CA 3MQQA 2I9VA 3KX0X 1XJ2A 5HZHA 4R70A 3IS2B 3LIFA 2ZOHA 3D72A 2WKRA 4EW7A 2YKFA 2VEAA 2R78A 4HP4A 4XT2B 4HH2A 2YKHA 3GDIA 1TS0A 3LIEA 3B33A 1N9LA 5I5LA 1T1BA 2V1AA 2PD7A 4GS9B 1F9IA 3UB6A 1S4RA 4NXGA 1XJ3A 1DP9A 3VE4A 3UB8A 4YWZA 4WL9A 3MQOA 2VV8A 2PR6A 2PDRA 3RTYA 1N9NA 4GHIB 1DRMA 4KUOA 2P7JA 4HJ6A 2J80A 3FG8A 5TBMA 5DJUA 3OLOA 4M4XA 4JGPA 2W27A 2QWSA 1GSWA 3H7WA 4I5SA 3RH8B 4GW9A 2L4RA 3E4QA 5J4EA 4PKYA 2JHEA 3F1NA 3F1OB 3NOPC 3P7NA 1ODVA 2KDKA 2A24A 1TS6A 2ZBBA 4BBTA 4DJ3A 4HJ3A 1X0OA 4WN5A 2OOLA 5A8BA 2PYRA 1MZUA 3MFXA 5HDCA 3LI8A 5HDSA 5J3WA 3MR0A 4WF0A 2QJ5A 4H6JA 5IS1A 2QHKA 2M1CA 3UE6A 5IU1A 1N9OA 2W0NA 3LICA 4EERA 3CWFA 1TS7A 3H82A 3UMEA 1S66L 2PD8A 1BYWA 1LSXA 4XT2A 3NOTC 4I3JA 3GECA 1P0ZA 4F3LA 1V9YA 1S4SA 5J7EA 3MJQA 5DJTA 4LRXC 2V9AA 1TS8A 3E4PA 4EEUA 4NXFA 2QJ7A 1OTDA 4EETB 3NOUC 4I3AA 3EEHA 4LLOB 2B02A 3CAXA 2PYPA 4HI4A 3FC7A 4HHDA 3HJKA 4R38A 2JN7A 4MN5A 5AVEA 4WLAA 5DKKA 3EWKA 2OWJA 2GJ3A 2ZOIA 1GSXA 1XJ4A 5F69A 4JGQA 1NWZA 5TBMB 1XJ6A 5F5YA 3MXQA 3ICYA 1F98A 3VOLA 3BWLA 4L9GA 1OTAA 1V9ZA 2CMNA 1XFQA 3E4OA 3LIAA 4K08A 4R3AA 3A0RA 3IBRA 4WUJA 2INWA 3VE3A 5HDDA 3F1NB 1OT9A 4L9FA 4BBVA 1OTIA 2A24B 4EQ1A 3UB9A 3ZQ5A 2VLGA 2L1MA 5F6AA 3F1PA 4HQAA 4I39A 5G4ZA 4HP9A
chains in the Genus database with same CATH superfamily
1ESUA 4X1MA 5K5BA 2WAFA 4OOMA 1GA9A 2Y2GA 3BY9A 2WKHA 3VP3A 3RXWA 5GLCA 2W3HA 3IS2A 5HARA 5HFOA 4BLMA 4O0PA 3AGFA 4H6JB 3SW1A 3GSGA 2D02A 3L9KA 4KQDA 4S2NC 1HTZA 2V0WA 1K0KA 1U60A 3T4SA 5CEBA 2V1BA 3TE8A 3EGDC 5EVIB 4WZ5C 3HLBA 1H3QA 4X25A 4RVAA 4L9EA 1T1CA 4II7A 3ZYTA 1K55C 4GS9A 4EQIA 1SKOA 2OLVA 5FAOA 4N1HA 4S2PA 1QMEA 2W3FA 3CUEC 4LV0A 2VZWA 1TDGA 4DE1A 1FCMA 1GHIA 3NI9A 2XFSA 1OJGA 2V8FA 4ETZA 1N4OA 2Z6CA 1KOUA 4GN2A 4EBNA 4OQIA 4E3JA 1MWSA 1ZG6A 4A5RA 1K54C 4PHTA 3A3EA 5HWTA 1Q2PA 3LYXA 3GV9A 1LSWA 4XXRA 2EWVA 2ZLYA 4EEPA 3NBLA 5TR7A 4NXEA 3AGDA 1G6OA 1YM1A 3S1YA 2Q9MA 4LRYC 5CGXA 3GR2A 2A49A 4MN6A 1XP4A 2FZ0A 2A2LA 1S67L 3PYPA 4EXOA 3QHYA 4MBHA 3B42A 1DP6A 2Z6DA 3VOZA 5FDHA 1FCNA 2ZMVA 1KE3A 4L0LA 1XXMA 1J3WA 1LT0A 1T18A 1UWNX 2IWCA 2HZ5A 4LENA 5AQ7A 1Z6FA 4LRZE 5L07A 5CGSA 5F82A 1O07A 1K57C 1LL8A 5DTTA 2XD1A 3UE1A 4ZDXA 1OTBA 3B3XA 2JCHA 1K56A 4DJ2A 2MJ6A 4Y13A 4QY6A 1D7EA 4Q0IA 2ZM0A 1P97A 1K38A 3EEAA 3GMWA 4E04A 1IKIA 1PW8A 3F1PB 3ZG5A 3IF6B 3ULFA 5AQ9A 3HLFA 5KIZA 2Y91A 1S1ZA 1FQGA 4CJNA 5CERA 4E3KA 4DRTA 3G6OA 1WYCA 2XA7S 1WA9A 1JTDA 3V3RA 3MXSA 4HJ4A 4U0XA 2PBYA 3KSFA 3VFHA 2FH5A 4QPRA 4K0XA 5EE8A 4R3BA 1ES5A 1JTGA 1G68A 2JC7A 4P0MA 1L3LA 2O0YA 3UPOA 5GLAA 1HVBA 5FA7A 2YKHA 2Z2LB 3QP8A 4BMWA 3T1QB 5EVEA 3B33A 1F2KA 2IWDA 4KQRA 1LI0A 5DTSA 4EUZA 2JKFA 3IXDA 2J9OA 5A93A 1BLPA 3UDIA 4EU0A 4G3VA 3UB6A 3LGOA 3SS3A 3VSKA 4KZ5A 2X01A 5MC7A 3DBAA 4E3LA 5FEFA 3AGEA 4EWFA 4DDYA 2PR6A 4OONA 3QP2A 1IYSA 4WMCD 2XF3A 2OSUA 1RP5A 3SS5A 4Q0HA 3IWQA 5DJUA 3OLOA 4DE0A 2QWSA 1GSWA 2J7VA 3WS1A 4MDZA 5EUAA 4P6ZS 3H7WA 4IEDA 4HBUA 1YSPA 3PBNA 2J9PA 1LHYA 2W1RA 4JBFA 5HL1A 3O88A 2EX2A 3UO9A 1EWZA 1W5DA 4X1LA 1FOFA 1W63M 4KZ8A 2KDKA 3HVFA 1SCWA 3T4OA 4DXBA 2ZBBA 3N8RA 4WN5A 2OOLA 3BLSA 3A3JA 1YLJA 1RCJA 1ZC2A 3A3IA 5CXWA 5AQBA 3IH9A 5GLBA 3OPLA 3C7VA 1ES4A 3E2LA 3PR6A 5EOEA 2KLIA 3BFCA 1K6SA 4WF0A 4DKIA 4MBFA 4DF6A 2QJ5A 5DVAA 4JF4A 1HLUP 4H6JA 5IS1A 4LV3A 3HREA 1BUEA 3LR4A 4GZBA 4JXSA 2ZQ9A 1PFLA 3G31A 3UMEA 2XK1A 5EVIA 2KOIA 2UWXA 3ZCZA 1LSXA 1DY6A 4FCFA 4WBGA 5FQIA 4KQQA 3GECA 3Q7ZA 1P0ZA 3N8LA 1V9YA 1YT4A 2JKTI 4PM7A 1CK3A 5M18A 4GB7A 2ZC4B 5FQQA 3FKVA 3E4PA 3EQVA 4NXFA 3R7WB 3ZVTA 2QJ7A 3C5AA 4CLCD 1KVLA 4KQOA 2ZM2A 2W3DA 1PI5A 1H8MA 4ETXA 3HJKA 2JN7A 2EWWA 4MLLA 4IUKA 3EWKA 4EUVA 3KYZA 1XJ4A 1I5QA 4BENA 3V67A 3GQZA 3MFDA 3D3OA 1CI9A 3IHBA 2W3GA 4WEKA 3VOLA 2NUPC 2HP9A 1OTAA 1V9ZA 3BJNA 4O7DA 4OOYA 1XFQA 3P09A 5EV0A 3W8KA 3IBRA 4OPRA 3IXGA 4JLFA 2Y2HA 2INWA 5HDDA 2C6WB 1OT9A 4BBVA 1OTIA 5HL6A 1H5XA 3JVUA 4ZRRA 4UA9A 2VGKA 3ZNTA 3NY4A 3F1PA 1L0DA 3IF6A 2VGJA 4HP9A 4QHCA 2HJ9C 2V0UA 3ZG9B 3K3CA 4ZJ3A 4HH3A 3PBSA 2ZD8A 4R6LA 3W4QA 1BLHA 3DWKA 2G7UA 3T12B 5DKLA 4C75A 3MS6A 2ZC3B 2ZL1A 4I38A 5A90A 1KGEA 2CC1A 4OQ0A 1OMEA 2Z2MB 4BBUA 2IA2A 2VGLS 4IBXA 4NXBA 2Y59A 1ACFA 2WAEA 3MZDA 4HEFA 1ZHHB 1LI9A 1MWRA 1SDNA 4O01A 2XGNA 1H0MA 3VSLA 3CPTB 5CGWA 1I2SA 2Y2KA 1E3UD 5G4YA 5HWWA 3T50A 4OKPA 1M6KA 3MBZA 1W8YA 1SHVA 3UE3A 2ZQ7A 4CLCB 3ZNYA 3QNCA 4BL2A 1H8YA 5GHYA 1LL5A 2HPBA 4CQHA 1FSYA 2KX6A 3EQUA 1W79A 2L0WA 1FR6A 3V39A 1YLTA 5AJGA 2DNSA 5HD3A 3Q07A 3S22A 3IF5A 3BRMA 3KYEA 2D01A 3H7WB 4HESA 1OTEA 3KYQA 3BQAA 3A3DA 1WYBA 1TD5A 3MF0A 2V8CA 4JXGA 2WADA 4E3OA 4EESA 1TEMA 2Y2NA 1GSVA 4BD0A 4ARZB 2Y2OA 1ONGA 4MNRA 2J3TC 2EA9A 3OOVA 3ZG8B 1VB6A 1ESIA 1PW1A 1L2SA 5HW3A 2HGVA 5FQ9A 2H28A 5FDSA 5AVFA 3NDGA 1TVFA 3OZHA 2EX6A 1STZA 1K4EA 1WE4A 4R23A 5HD5A 2VJWA 4N92A 2WKPA 3PHYA 4ME4A 4OQHA 3JYIA 2ZMFA 3LIBA 3DTIA 1MPLA 3VV4A 1YSQA 3HJIA 5FSRA 4X69A 3MQQA 3PBQA 2I9VA 3I7JA 3VP4A 1H8ZA 1P9WA 4R70A 4BD1A 5EM0A 2WKRA 3QNBA 4R4RA 5EVIC 5CHUA 2Y8HA 2XDMA 4HP4A 1PWDA 4UQIS 4LCMA 4KENB 3JPUA 2GNXA 3S7QA 3ZGAB 3R7WA 1G6AA 3C7UA 5I5LA 3OC2A 2RL3A 2P74A 1FILA 3KO6A 3G2ZA 5TGFA 1PRQA 1YPRA 4NEED 4FUWA 2PDRA 4U0TA 4QD4A 1IKGA 1DRMA 4KUOA 2P7JA 4WMCA 1FSWA 2JKTM 3FG8A 4M4XA 2DMWA 2E8JA 4ZTKA 3OCLA 4EBPA 3O3VA 5KMWA 3FWLA 3JVVA 3RH8B 4QB8A 4WYYA 4CLCE 1M40A 3RJUA 3DWZA 3BECA 3IXHA 3IXBA 5FEGA 4K0WA 1BT5A 1ES3A 3DAVA 4PKYA 4B93A 3F1OB 3UN7A 2P9VB 5FI2A 2V20A 5HPIA 1ODVA 5L09A 3S7PA 1TS6A 4PM5A 1DJBA 2C5WB 4DJ3A 1QMFA 1W7FA 3IF6C 5A8BA 3TSGA 2PBDP 4FH4A 2VX8A 1BSGA 4OP5A 2ZM8A 5HDSA 4UHUA 3SOIA 1XX2A 3BFFA 4YOFA 5EVLA 4JXWA 3RFBA 4E3NA 4MBKA 4Y0UA 3NULA 4IHQA 4BJPA 3QP1A 2ZL1B 3UE6A 1ES2A 5GHXA 5HPFA 3RXXA 1I2WA 4Y2FA 3OBFA 4GD6A 5FAPA 3CWFA 2M7VA 3ZVWA 1ERQA 4GDNA 1NZUA 1PYYA 5LBRA 1BULA 4XT2A 2EX8A 5KSCA 4JF6A 3BYDA 2NUTC 3PBOA 1S4SA 3CPTA 4LRXC 3Q81A 3T1RA 4EEUA 4Y0TA 4PPRA 1VETB 3BEBA 1OTDA 2JKGA 1MBLA 2P08A 3M2KA 1GA0A 4I3AA 2OV5A 4LLOB 4CLCA 1VM1A 4OVDA 1Y54A 3CAXA 1YAXA 3VMAA 4WM9A 2Y2JA 5IHVA 2XROA 4OQGA 4MEZA 4WLAA 5DKKA 2AVXA 3BFEA 4JGQA 2I72A 5TBMB 5TFQA 5KZHA 2B18A 3QP5A 2QMIA 5F5YA 3ICYA 3T4JA 4JKTA 1TF1A 3U4LP 3BLMA 3E4OA 4K08A 4R3AA 3A0RA 2WKIA 2J3WA 4OLGA 1XPBA 4ARZA 1NLZA 3LR3A 1NRJA 4DMZA 4KZBA 3VE3A 3T1SA 3V5MA 3HLEA 2H5SA 1PZPA 4KZ7A 3HLCA 2HDRA 3UB9A 3ZQ5A 2VLGA 4E3MA 1GHMA 4M3KA 5F6AA 3W2ZA 4HQAA 5G4ZA 1XA1A 3G35A 2BASA 4YNRA 4FH2A 3TW8A 3E2KA 4Y0OA 2ZQDA 3K2NA 4R3JA 1XKZA 1RGZA 5HWVA 3SH7A 3MKFA 5D3OA 3KSGA 1ONHA 1UWPX 5GL9A 3CMZA 4LV1A 3K3DA 5CRFA 5F1FA 1UGUA 5FQJA 4S2OA 5HAQA 1CF0A 1CI8A 3E98A 4Y17A 1OJ5A 3CI6A 1W8QA 5E2HA 3IQAA 1PZOA 1CEFA 5L8MA 2DCFA 3IBJA 4UAAA 4P85A 3ZHHA 1T1AA 4ZAMA 1PWGA 5DFXA 5C5KA 3UB7A 2M7UA 5FAQA 1JNUA 3BW6A 3V3SA 1E3UA 3M2JA 2XRNA 3W4OA 1L0FA 2E8IA 1GCEA 2Y2LA 3R4KA 3WRZA 1JWPA 3NJAA 3ITAA 1ERMA 4IBRA 4JGOA 1Z09A 4EBLA 4HY8A 3UE0A 2HP5A 1F5MA 3IHAA 5EFWA 2Y2IA 2EFXA 3H9WA 4R4SA 4RQ9A 3B47A 3BFGA 1OT6A 3SS4A 2EX9A 3WS2A 1DJCA 3WWXA 3HUOA 3UPPA 4Q8IA 2LB5A 3MKEA 5F83A 1K6RA 2O9AA 3PAGA 5L10A 2UV0E 4LPZA 3F1OA 2P9VA 1NLYA 4IVIA 3HBRA 3CZDA 1ZG4A 5AQAA 3PBTA 1NJ4A 2QYBA 2XLNA 2QKPA 3Q82A 4JGRA 1ALQA 2BTFP 5F68A 2OWHA 1XGIA 4OPYA 4KG6A 3G2YA 4C3QA 4GJ4A 4NETA 1J9MA 5HSQA 3OPHA 1K57A 4GNUA 4I3IA 3BY8A 3CLOA 1CEGA 3BFDA 2IWBA 4BWIA 3G34A 3LY4A 4P87A 1NZOA 3LI9A 3GVBA 3LEZA 3ITBA 1K4FA 3C8CA 2VK3A 2WGWB 5HZHA 3LIFA 2ZOHA 4ID4A 4YINA 2ZC6B 3CITA 3ZG7B 5CECA 5E2EA 2VEAA 3OCNA 2OAQ1 2R78A 5CHMA 4XT2B 4HH2A 4K91A 3GDIA 1GHPA 1TDLA 3LIEA 1AWIA 3O86A 1N9LA 4KG2A 1VETA 3N6IA 1T1BA 2Y2PA 2V1AA 3D4FA 4PMAA 4WZ4A 4GD8A 1S4RA 1XJ3A 4CLCC 4IJGA 1MKMA 1DP9A 3S4XA 2G2WA 4U3TA 4WELA 1NYMA 5FI7A 4OP8A 5JYOA 1NYYA 2R9WA 3TJZC 5U47A 3LCEA 3N4IA 3ZFZA 2VV8A 2EXAA 1N9NA 3HCYA 3UY6A 4GHIB 5FL3A 2HF6A 3VP2A 2FFFB 4FOFA 1O7EA 3VOYA 2J80A 4X53A 5KSHA 3WRTA 5TBMA 2WGIA 2ZJ9A 2W27A 4KG5A 2Q0OA 2V1ZA 3BQ8A 2RCXA 2Y2MA 3HLWA 3IWIA 4I5SA 2EFUA 3DTEA 4FD8A 4PM6A 5EECA 1VQQA 3E4QA 5J4EA 5F1GA 2HP6A 2WK0A 1CJFA 1PI4A 2Y79A 1BLCA 2JHEA 4Q0JA 3FPVA 3NOPC 5FATA 4S2LA 3VP0A 2HDQA 3O5YA 2ZC7A 4HJ3A 2WZZA 5IT5A 3P01A 2HDSA 2PAVP 2ZC5B 2PYRA 1MZUA 2B5RA 2XD5A 2JKRI 4JPMA 4QU3A 1S6RA 5HDCA 2XR0A 3UPNA 5J3WA 1FR1A 3MR0A 4MN7A 3VP1A 3DTKA 4N9KA 5GLDA 4BQMA 2Y2QA 2M1CA 3DW0A 5IU1A 2H10A 3PBRA 3CG5A 2W0NA 1P9RA 2PT7A 2JE5A 3V50A 4EERA 1EI5A 4E6WA 1S66L 5M19A 4DN0A 1JWVA 1SDEA 4DE2A 1BYWA 4YFMA 5EPHA 1PNEA 4GLQA 1IYOA 1YLYA 4OH0A 3C4OA 4IUHA 5DJTA 4D60A 2V9AA 1W63Q 1TS8A 3BM6A 2WYXA 4X68A 5EM1A 4PM9A 2XA7M 5E43A 1HZOA 2P04A 1JVJA 1KE0A 1KDWA 4EETB 3EGXC 3G32A 3NOUC 3EEHA 4LGWA 4ZJ1A 4S2MA 1IEMA 1XA7A 3FC7A 4OPQA 3IX8A 2J8YA 4R38A 4ZBEA 3P98A 3UNWA 3HLDA 5AVEA 3W4PA 1PWCA 1YLPA 3L7HA 4O8GA 2OWJA 2GJ3A 2Y4AA 1MC0A 3M6HA 3LO7A 1VEUB 1G5UA 5F69A 1NWZA 4D2OA 3NC8A 1XJ6A 4UEYA 4S2JA 1F98A 3ISGA 3LR0A 3NDEA 4QY5A 5CTNA 1SZVA 4L9GA 3WS5A 2VA0A 3IX4A 2CMNA 2O9BA 2W3EA 4S2IA 1YMSA 1YKDA 5FQKA 4KZAA 3SH8A 2XFTA 3QP6A 3F1NB 4JF5A 4L9FA 3Q7VB 5L2FA 3NECA 5HAPA 2XH9A 2A24B 4P6BA 4EQ1A 4F94A 2JBFA 3WS0A 4P6ZM 3GTCA 3UB5P 4B88A 3E0YA 4I39A 5DF8A 3S7NA 2PR5A 4H8RA 2K7SA 2WGVA 3FYZA 1HD8A 4RX3A 4N1XA 3PTEA 5M1AA 2WGWA 3MZEA 4HBTA 2PHYA 2H0YA 1EW0A 3TG9A 2B95A 3LIDA 1KE4A 2XEPA 2BLSA 4NK3A 3DTMA 1Y28A 3MZFA 4KZ4A 3H82B 4B9OA 4Z9QA 1IFQA 1DP8A 3S7OA 3C4PA 2W1TB 2PU2A 1G28A 3HUMA 3CJMA 1IOUA 4F3LB 2QZ6A 4GCZA 3A0VA 4X56A 5FI6A 3G30A 4HIAA 3C38A 3IH8A 5FASA 1LSVA 4HNBA 3WS4A 3IX3A 1YLZA 3ZG0A 3T4TA 5HAIA 3IWOA 2R9XA 2K2NA 3UMDA 4KZ6A 4GHIA 4OPZA 4E6XA 1SKFA 3ZDJA 4R0QA 1E25A 4UA6A 3A0SA 2VV7A 1AXBA 4LV2A 4NG2A 4PM8A 4OLDA 3MMHA 3VFFA 4C6YA 4KUKA 3N8SA 1T19A 4HOIA 3LUQA 5HX9A 2VV6A 2ZQAA 3HL9A 2OAP1 4WEJA 5CEDA 4QJGA 1MWTA 1A0KA 1MKIA 4GOGA 2ZQ8A 2HV1A 4UA7A 5BOHA 1YQSA 3PXPA 1D06A 2LB9A 1CQAA 3EOIA 5CTMA 1PIOA 5G18A 3NHQA 1K25A 3KSIA 4Y7PA 1K56D 2Q9NA 4FTXA 3D9YA 4LFUA 4BL3A 4XUXA 3QP4A 1IYPA 1XFNA 4PKYG 2QPNA 1BZAA 3C30A 4LCLA 2WKQA 1NRFA 1S1YA 1D1JA 3C2WA 2Y55A 4XUZA 2VKSA 2H0TA 3OPPA 4S2KA 5E2GA 5J8XA 4ESPA 2BG1A 3KX0X 1XJ2A 4IVKA 3IS2B 3D72A 3M6BA 4EW7A 3G4PA 2YKFA 4E3IA 1VHMA 1IYQA 4S2NA 2HJEA 2JKRM 4Y3IA 5DFYA 1TS0A 4WZ5A 4N9LA 3A3FA 3NIAA 1LLBA 3FZCA 2A3UA 1K55A 4Y5FA 2PD7A 4GS9B 1F9IA 2X02A 4NXGA 3FPWA 3LY3A 1SKOB 3VE4A 1ZTUA 3UB8A 4X55A 3CUEA 4WL9A 4YWZA 5JYPA 3MQOA 2ZQCA 2VGLM 3SZTA 2ACGA 3LEQA 2XQZA 3RTYA 5E2FA 5GHZA 5A91A 4ZJ2A 3UDFA 2PU4A 1VEUA 4HJ6A 1YLWA 1K54A 1Y4OA 4JGPA 3LFVA 4EV4A 3HLGA 3MQ0A 4KZ9A 2OLUA 1DJAA 4GW9A 3SH9A 3TOIA 1IELA 2L4RA 5TJJA 1KVMA 1ZKJA 3N7WA 3UDXA 3GRJA 1JWZA 4RYEA 4AFIA 1KDSA 3F1NA 2K31A 2O99A 3Q7VA 2J3TD 4PAUA 3P7NA 5EOOA 2A24A 1MXOA 5I94A 4RA7A 4BBTA 4MMNA 1LL9A 1X0OA 3LR5A 3T4KA 1FCOA 1BTLA 5DTKA 3T4QA 3MFXA 4QWOA 3LI8A 1KGFA 3OPRA 5CHJA 2WZXA 1YMXA 1XGJA 4G3WA 4DXCA 2XSSA 1L0GA 2QHKA 2FFYA 5DF7A 4Z1WA 1NXYA 1N9OA 5EVID 3LICA 4X6TA 4B4ZA 1TS7A 3H82A 3U2AA 2PD8A 5A92A 1BLSA 5DF9A 2PRFA 2W1TA 3NOTC 4I3JA 4F3LA 1MWUA 4DE3A 1KGGA 3NCKA 5J7EA 3MJQA 4DDSA 3T1XA 2O9CA 1NY0A 4JXVA 3FV7A 2GDNA 3T4LA 3FKWA 1RGYA 4OOLA 1Q2QA 3PAEA 4G3KA 3HUNA 2B02A 3MSHA 4NKPA 2WUQA 2PYPA 4HI4A 3CHWP 5FQMA 4HHDA 4RX2A 4MN5A 2GX5A 3KSHA 3Q1FA 2X71A 2G2UA 4UQIM 4GKUA 2EXBA 4KZ3A 1EROA 4CPKA 2ZOIA 1GSXA 1OPXA 4GDBA 2ZMAA 4MCWA 5CX7A 3IT9A 3MXQA 3TRCA 2WKEA 3MXRA 1L0EA 3BWLA 2DRWA 4R1GA 2V2FF 4Y15A 2HDUA 3LIAA 1C3BA 1S0WA 1MY8A 4WUJA 1FIKA 4B4XA 1E4DA 2GZAA 2L1MA 1N9BA 3O87A 4FSFA
chains in the Genus database with same CATH topology
3S7NA 2BASA 2HJ9C 2V0UA 2PR5A 3K3CA 4YNRA 2K7SA 5K5BA 3TW8A 4HH3A 4OOMA 3PBSA 3K2NA 3BY9A 4R6LA 5HWVA 2G7UA 5DKLA 2PHYA 2W3HA 3IS2A 3KSGA 4I38A 1UWPX 1EW0A 4O0PA 4H6JB 3K3DA 3SW1A 1UGUA 3LIDA 4BBUA 2D02A 2IA2A 4KQDA 2V0WA 3E98A 2VGLS 4NXBA 1OJ5A 1Y28A 3CI6A 3T4SA 3H82B 2V1BA 3TE8A 4B9OA 3EGDC 1IFQA 1DP8A 1ZHHB 5L8MA 3S7OA 1H3QA 2W1TB 3IBJA 4L9EA 1G28A 1T1CA 4II7A 1IOUA 3ZYTA 4GS9A 4O01A 4F3LB 1T1AA 4GCZA 3A0VA 5DFXA 5C5KA 3UB7A 2M7UA 4HIAA 3C38A 1LSVA 4HNBA 1JNUA 5G4YA 5HWWA 3BW6A 3T50A 3T4TA 2W3FA 3CUEC 2VZWA 2XRNA 3UE3A 2K2NA 3UMDA 4CLCB 1OJGA 3R4KA 4GHIA 4ETZA 2Z6CA 3NJAA 1KOUA 4JGOA 4CQHA 3A0SA 4HY8A 2KX6A 2VV7A 4PHTA 1F5MA 5HWTA 3MMHA 3LYXA 1LSWA 3EQUA 2EWVA 5EFWA 4EEPA 4KUKA 2L0WA 3H9WA 4NXEA 1G6OA 5AJGA 1T19A 4HOIA 5HD3A 4RQ9A 3LUQA 3B47A 2VV6A 1OT6A 4LRYC 2OAP1 2D01A 3H7WB 4MN6A 4WEJA 2FZ0A 2A2LA 1S67L 3PYPA 1OTEA 3KYQA 4EXOA 3BQAA 2HV1A 2LB5A 3B42A 1DP6A 2O9AA 2Z6DA 1TD5A 3PXPA 1D06A 2LB9A 4LPZA 3F1OA 3MF0A 2ZMVA 1NLYA 3EOIA 4L0LA 4EESA 3PBTA 1GSVA 4ARZB 1LT0A 2QYBA 3NHQA 3KSIA 2J3TC 2EA9A 2QKPA 3OOVA 1T18A 1UWNX 4JGRA 1VB6A 2HGVA 4LRZE 5F68A 2H28A 2OWHA 1LL8A 5AVFA 1OTBA 4GJ4A 4DJ2A 2MJ6A 1XFNA 4PKYG 1D7EA 4Q0IA 1P97A 5HSQA 3EEAA 4E04A 3C30A 3F1PB 1STZA 4I3IA 3ULFA 3BY8A 2WKQA 3CLOA 5HD5A 4BWIA 1S1YA 2VJWA 5KIZA 2WKPA 3C2WA 3LI9A 1S1ZA 3PHYA 4ME4A 2VKSA 2ZMFA 3LIBA 3VV4A 3G6OA 2XA7S 1YSQA 1WA9A 3HJIA 4HJ4A 3C8CA 3MQQA 3PBQA 3KSFA 2I9VA 3KX0X 2FH5A 1P9WA 1XJ2A 5HZHA 3IS2B 3LIFA 4R70A 2ZOHA 3D72A 2WKRA 4EW7A 4QPRA 2YKFA 2Y8HA 3CITA 1VHMA 2VEAA 3OCNA 2OAQ1 2R78A 2HJEA 4HP4A 2O0YA 2JKRM 4Y3IA 4UQIS 4XT2B 4HH2A 5DFYA 2YKHA 3GDIA 1TS0A 4BMWA 2GNXA 3LIEA 3S7QA 3B33A 1N9LA 3R7WA 5I5LA 1T1BA 3OC2A 4Y5FA 2V1AA 4EU0A 4G3VA 2PD7A 4GS9B 1F9IA 3UB6A 1S4RA 4NXGA 1XJ3A 4CLCC 3FPWA 4IJGA 1MKMA 3KO6A 1DP9A 4WELA 5MC7A 3DBAA 3VE4A 1ZTUA 3UB8A 4NEED 3CUEA 3TJZC 4WL9A 4YWZA 3MQOA 2VGLM 2VV8A 2PR6A 2PDRA 3RTYA 1N9NA 3HCYA 4GHIB 5FL3A 1DRMA 4KUOA 2HF6A 2P7JA 4Q0HA 4FOFA 4HJ6A 2J80A 2JKTM 3FG8A 5KSHA 5TBMA 5DJUA 3OLOA 4M4XA 2DMWA 4JGPA 3LFVA 2W27A 2QWSA 3OCLA 1GSWA 3BQ8A 4MDZA 3MQ0A 4P6ZS 3JVVA 3H7WA 4I5SA 3RH8B 4GW9A 1YSPA 4CLCE 3PBNA 2L4RA 5TJJA 3E4QA 5J4EA 2W1RA 4AFIA 2Y79A 4PKYA 2JHEA 4B93A 4Q0JA 3F1NA 2K31A 2O99A 3F1OB 3FPVA 3NOPC 2J3TD 4PAUA 3P7NA 1W63M 5HPIA 1ODVA 2KDKA 2A24A 3T4OA 3S7PA 1TS6A 2ZBBA 4BBTA 4DJ3A 4MMNA 3O5YA 4HJ3A 1X0OA 3LR5A 3T4KA 4WN5A 2OOLA 5IT5A 5A8BA 3P01A 2PYRA 1MZUA 2VX8A 3T4QA 3MFXA 2JKRI 5HDCA 3LI8A 5HDSA 3PR6A 4YOFA 2KLIA 5J3WA 3MR0A 4MN7A 4WF0A 3RFBA 4G3WA 2XSSA 2QJ5A 4IHQA 4H6JA 5IS1A 2QHKA 4BJPA 2M1CA 4Z1WA 3UE6A 5IU1A 3PBRA 5HPFA 3LR4A 1N9OA 2W0NA 4Y2FA 1P9RA 2PT7A 3LICA 3OBFA 4EERA 3CWFA 1TS7A 3H82A 3UMEA 3U2AA 1S66L 2M7VA 4DN0A 2PD8A 2KOIA 1BYWA 1LSXA 5DF9A 5LBRA 2W1TA 4XT2A 4GLQA 3NOTC 4I3JA 3GECA 1P0ZA 4F3LA 1V9YA 4IUHA 2NUTC 3PBOA 2JKTI 1S4SA 5J7EA 3MJQA 5DJTA 4LRXC 2V9AA 1W63Q 1TS8A 2O9CA 3E4PA 4EEUA 3EQVA 2XA7M 4NXFA 3R7WB 3T4LA 2QJ7A 4CLCD 1OTDA 2P04A 4OOLA 4EETB 3EGXC 2P08A 3NOUC 4I3AA 3EEHA 4G3KA 4LLOB 4CLCA 2B02A 4NKPA 4KQOA 3CAXA 2W3DA 2PYPA 4HI4A 3FC7A 1H8MA 4ETXA 1YAXA 4HHDA 3HJKA 4R38A 2JN7A 4MN5A 2EWWA 2GX5A 3KSHA 2XROA 5AVEA 4UQIM 4IUKA 4WLAA 5DKKA 3EWKA 4O8GA 2OWJA 4EUVA 2GJ3A 2ZOIA 3KYZA 1MC0A 1OPXA 1GSXA 1XJ4A 5F69A 4JGQA 1NWZA 3V67A 4MCWA 5TBMB 2B18A 5CX7A 1XJ6A 4UEYA 5F5YA 3D3OA 3MXQA 3ICYA 3TRCA 1F98A 3LR0A 2W3GA 4WEKA 3VOLA 3BWLA 2NUPC 3T4JA 4L9GA 1OTAA 1V9ZA 1TF1A 3BJNA 2VA0A 2CMNA 2O9BA 1XFQA 2W3EA 3E4OA 3LIAA 4K08A 4R3AA 3A0RA 1YKDA 2J3WA 3IBRA 4ARZA 4WUJA 1NLZA 3LR3A 1NRJA 4DMZA 2INWA 3VE3A 5HDDA 3F1NB 1OT9A 4L9FA 4BBVA 1OTIA 5HL6A 2GZAA 3JVUA 2A24B 4EQ1A 4ZRRA 3UB9A 3ZQ5A 2VLGA 2L1MA 4P6ZM 5F6AA 3W2ZA 3F1PA 3E0YA 4FSFA 4HQAA 4I39A 5G4ZA 4HP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BAS A;  2V0U A;  2PR5 A;  3K3C A;  2K7S A;  4HH3 A;  3BY9 A;  4R6L A;  5HWV A;  5DKL A;  2PHY A;  3IS2 A;  4I38 A;  1UWP X;  1EW0 A;  4H6J B;  3K3D A;  3SW1 A;  1UGU A;  3LID A;  4BBU A;  2D02 A;  4KQD A;  2V0W A;  4NXB A;  1OJ5 A;  1Y28 A;  3H82 B;  2V1B A;  4B9O A;  1DP8 A;  4L9E A;  1G28 A;  1T1C A;  4GS9 A;  4F3L B;  1T1A A;  4GCZ A;  3A0V A;  3UB7 A;  4HIA A;  1LSV A;  4HNB A;  1JNU A;  5G4Y A;  5HWW A;  3T50 A;  3UMD A;  1OJG A;  4GHI A;  2Z6C A;  3NJA A;  1KOU A;  4JGO A;  3A0S A;  4HY8 A;  2KX6 A;  2VV7 A;  5HWT A;  3LYX A;  1LSW A;  5EFW A;  4EEP A;  4KUK A;  2L0W A;  3H9W A;  4NXE A;  1T19 A;  4HOI A;  5HD3 A;  4RQ9 A;  3LUQ A;  2VV6 A;  1OT6 A;  4LRY C;  2D01 A;  3H7W B;  4MN6 A;  1S67 L;  3PYP A;  1OTE A;  4EXO A;  2HV1 A;  1DP6 A;  2Z6D A;  1D06 A;  4LPZ A;  3F1O A;  4EES A;  1GSV A;  1LT0 A;  3NHQ A;  2EA9 A;  2QKP A;  1T18 A;  1UWN X;  4JGR A;  1VB6 A;  4LRZ E;  5F68 A;  2H28 A;  2OWH A;  1LL8 A;  5AVF A;  1OTB A;  4DJ2 A;  1XFN A;  4PKY G;  1D7E A;  5HSQ A;  1P97 A;  4E04 A;  3F1P B;  4I3I A;  3ULF A;  3BY8 A;  2WKQ A;  3CLO A;  5HD5 A;  1S1Y A;  5KIZ A;  2WKP A;  3C2W A;  3LI9 A;  1S1Z A;  3PHY A;  3LIB A;  3G6O A;  1WA9 A;  3HJI A;  4HJ4 A;  3C8C A;  3MQQ A;  2I9V A;  3KX0 X;  1XJ2 A;  5HZH A;  4R70 A;  3IS2 B;  3LIF A;  2ZOH A;  3D72 A;  2WKR A;  4EW7 A;  2YKF A;  2VEA A;  2R78 A;  4HP4 A;  4XT2 B;  4HH2 A;  2YKH A;  3GDI A;  1TS0 A;  3LIE A;  3B33 A;  1N9L A;  5I5L A;  1T1B A;  2V1A A;  2PD7 A;  4GS9 B;  1F9I A;  3UB6 A;  1S4R A;  4NXG A;  1XJ3 A;  1DP9 A;  3VE4 A;  3UB8 A;  4YWZ A;  4WL9 A;  3MQO A;  2VV8 A;  2PR6 A;  2PDR A;  3RTY A;  1N9N A;  4GHI B;  1DRM A;  4KUO A;  2P7J A;  4HJ6 A;  2J80 A;  3FG8 A;  5TBM A;  5DJU A;  3OLO A;  4M4X A;  4JGP A;  2W27 A;  2QWS A;  1GSW A;  3H7W A;  4I5S A;  3RH8 B;  4GW9 A;  2L4R A;  3E4Q A;  5J4E A;  4PKY A;  2JHE A;  3F1N A;  3F1O B;  3NOP C;  3P7N A;  1ODV A;  2KDK A;  2A24 A;  1TS6 A;  2ZBB A;  4BBT A;  4DJ3 A;  4HJ3 A;  1X0O A;  4WN5 A;  2OOL A;  5A8B A;  2PYR A;  1MZU A;  3MFX A;  5HDC A;  3LI8 A;  5HDS A;  5J3W A;  3MR0 A;  4WF0 A;  2QJ5 A;  4H6J A;  5IS1 A;  2QHK A;  2M1C A;  3UE6 A;  5IU1 A;  1N9O A;  2W0N A;  3LIC A;  4EER A;  3CWF A;  1TS7 A;  3H82 A;  3UME A;  1S66 L;  2PD8 A;  1BYW A;  1LSX A;  4XT2 A;  3NOT C;  4I3J A;  3GEC A;  1P0Z A;  4F3L A;  1V9Y A;  1S4S A;  5J7E A;  3MJQ A;  5DJT A;  4LRX C;  2V9A A;  1TS8 A;  3E4P A;  4EEU A;  4NXF A;  2QJ7 A;  1OTD A;  4EET B;  3NOU C;  4I3A A;  3EEH A;  4LLO B;  2B02 A;  3CAX A;  2PYP A;  4HI4 A;  3FC7 A;  4HHD A;  3HJK A;  4R38 A;  2JN7 A;  4MN5 A;  5AVE A;  4WLA A;  5DKK A;  3EWK A;  2OWJ A;  2GJ3 A;  2ZOI A;  1GSX A;  1XJ4 A;  5F69 A;  4JGQ A;  1NWZ A;  5TBM B;  1XJ6 A;  5F5Y A;  3MXQ A;  3ICY A;  1F98 A;  3VOL A;  3BWL A;  4L9G A;  1OTA A;  1V9Z A;  2CMN A;  1XFQ A;  3E4O A;  3LIA A;  4K08 A;  4R3A A;  3A0R A;  3IBR A;  4WUJ A;  2INW A;  3VE3 A;  5HDD A;  3F1N B;  1OT9 A;  4L9F A;  4BBV A;  1OTI A;  2A24 B;  4EQ1 A;  3UB9 A;  3ZQ5 A;  2VLG A;  2L1M A;  5F6A A;  3F1P A;  4HQA A;  4I39 A;  5G4Z A;  4HP9 A; 
#chains in the Genus database with same CATH topology
 1ESU A;  4X1M A;  5K5B A;  2WAF A;  4OOM A;  1GA9 A;  2Y2G A;  3BY9 A;  2WKH A;  3VP3 A;  3RXW A;  5GLC A;  2W3H A;  3IS2 A;  5HAR A;  5HFO A;  4BLM A;  4O0P A;  3AGF A;  4H6J B;  3SW1 A;  3GSG A;  2D02 A;  3L9K A;  4KQD A;  4S2N C;  1HTZ A;  2V0W A;  1K0K A;  1U60 A;  3T4S A;  5CEB A;  2V1B A;  3TE8 A;  3EGD C;  5EVI B;  4WZ5 C;  3HLB A;  1H3Q A;  4X25 A;  4RVA A;  4L9E A;  1T1C A;  4II7 A;  3ZYT A;  1K55 C;  4GS9 A;  4EQI A;  1SKO A;  2OLV A;  5FAO A;  4N1H A;  4S2P A;  1QME A;  2W3F A;  3CUE C;  4LV0 A;  2VZW A;  1TDG A;  4DE1 A;  1FCM A;  1GHI A;  3NI9 A;  2XFS A;  1OJG A;  2V8F A;  4ETZ A;  1N4O A;  2Z6C A;  1KOU A;  4GN2 A;  4EBN A;  4OQI A;  4E3J A;  1MWS A;  1ZG6 A;  4A5R A;  1K54 C;  4PHT A;  3A3E A;  5HWT A;  1Q2P A;  3LYX A;  3GV9 A;  1LSW A;  4XXR A;  2EWV A;  2ZLY A;  4EEP A;  3NBL A;  5TR7 A;  4NXE A;  3AGD A;  1G6O A;  1YM1 A;  3S1Y A;  2Q9M A;  4LRY C;  5CGX A;  3GR2 A;  2A49 A;  4MN6 A;  1XP4 A;  2FZ0 A;  2A2L A;  1S67 L;  3PYP A;  4EXO A;  3QHY A;  4MBH A;  3B42 A;  1DP6 A;  2Z6D A;  3VOZ A;  5FDH A;  1FCN A;  2ZMV A;  1KE3 A;  4L0L A;  1XXM A;  1J3W A;  1LT0 A;  1T18 A;  1UWN X;  2IWC A;  2HZ5 A;  4LEN A;  5AQ7 A;  1Z6F A;  4LRZ E;  5L07 A;  5CGS A;  5F82 A;  1O07 A;  1K57 C;  1LL8 A;  5DTT A;  2XD1 A;  3UE1 A;  4ZDX A;  1OTB A;  3B3X A;  2JCH A;  1K56 A;  4DJ2 A;  2MJ6 A;  4Y13 A;  4QY6 A;  1D7E A;  4Q0I A;  2ZM0 A;  1P97 A;  1K38 A;  3EEA A;  3GMW A;  4E04 A;  1IKI A;  1PW8 A;  3F1P B;  3ZG5 A;  3IF6 B;  3ULF A;  5AQ9 A;  3HLF A;  5KIZ A;  2Y91 A;  1S1Z A;  1FQG A;  4CJN A;  5CER A;  4E3K A;  4DRT A;  3G6O A;  1WYC A;  2XA7 S;  1WA9 A;  1JTD A;  3V3R A;  3MXS A;  4HJ4 A;  4U0X A;  2PBY A;  3KSF A;  3VFH A;  2FH5 A;  4QPR A;  4K0X A;  5EE8 A;  4R3B A;  1ES5 A;  1JTG A;  1G68 A;  2JC7 A;  4P0M A;  1L3L A;  2O0Y A;  3UPO A;  5GLA A;  1HVB A;  5FA7 A;  2YKH A;  2Z2L B;  3QP8 A;  4BMW A;  3T1Q B;  5EVE A;  3B33 A;  1F2K A;  2IWD A;  4KQR A;  1LI0 A;  5DTS A;  4EUZ A;  2JKF A;  3IXD A;  2J9O A;  5A93 A;  1BLP A;  3UDI A;  4EU0 A;  4G3V A;  3UB6 A;  3LGO A;  3SS3 A;  3VSK A;  4KZ5 A;  2X01 A;  5MC7 A;  3DBA A;  4E3L A;  5FEF A;  3AGE A;  4EWF A;  4DDY A;  2PR6 A;  4OON A;  3QP2 A;  1IYS A;  4WMC D;  2XF3 A;  2OSU A;  1RP5 A;  3SS5 A;  4Q0H A;  3IWQ A;  5DJU A;  3OLO A;  4DE0 A;  2QWS A;  1GSW A;  2J7V A;  3WS1 A;  4MDZ A;  5EUA A;  4P6Z S;  3H7W A;  4IED A;  4HBU A;  1YSP A;  3PBN A;  2J9P A;  1LHY A;  2W1R A;  4JBF A;  5HL1 A;  3O88 A;  2EX2 A;  3UO9 A;  1EWZ A;  1W5D A;  4X1L A;  1FOF A;  1W63 M;  4KZ8 A;  2KDK A;  3HVF A;  1SCW A;  3T4O A;  4DXB A;  2ZBB A;  3N8R A;  4WN5 A;  2OOL A;  3BLS A;  3A3J A;  1YLJ A;  1RCJ A;  1ZC2 A;  3A3I A;  5CXW A;  5AQB A;  3IH9 A;  5GLB A;  3OPL A;  3C7V A;  1ES4 A;  3E2L A;  3PR6 A;  5EOE A;  2KLI A;  3BFC A;  1K6S A;  4WF0 A;  4DKI A;  4MBF A;  4DF6 A;  2QJ5 A;  5DVA A;  4JF4 A;  1HLU P;  4H6J A;  5IS1 A;  4LV3 A;  3HRE A;  1BUE A;  3LR4 A;  4GZB A;  4JXS A;  2ZQ9 A;  1PFL A;  3G31 A;  3UME A;  2XK1 A;  5EVI A;  2KOI A;  2UWX A;  3ZCZ A;  1LSX A;  1DY6 A;  4FCF A;  4WBG A;  5FQI A;  4KQQ A;  3GEC A;  3Q7Z A;  1P0Z A;  3N8L A;  1V9Y A;  1YT4 A;  2JKT I;  4PM7 A;  1CK3 A;  5M18 A;  4GB7 A;  2ZC4 B;  5FQQ A;  3FKV A;  3E4P A;  3EQV A;  4NXF A;  3R7W B;  3ZVT A;  2QJ7 A;  3C5A A;  4CLC D;  1KVL A;  4KQO A;  2ZM2 A;  2W3D A;  1PI5 A;  1H8M A;  4ETX A;  3HJK A;  2JN7 A;  2EWW A;  4MLL A;  4IUK A;  3EWK A;  4EUV A;  3KYZ A;  1XJ4 A;  1I5Q A;  4BEN A;  3V67 A;  3GQZ A;  3MFD A;  3D3O A;  1CI9 A;  3IHB A;  2W3G A;  4WEK A;  3VOL A;  2NUP C;  2HP9 A;  1OTA A;  1V9Z A;  3BJN A;  4O7D A;  4OOY A;  1XFQ A;  3P09 A;  5EV0 A;  3W8K A;  3IBR A;  4OPR A;  3IXG A;  4JLF A;  2Y2H A;  2INW A;  5HDD A;  2C6W B;  1OT9 A;  4BBV A;  1OTI A;  5HL6 A;  1H5X A;  3JVU A;  4ZRR A;  4UA9 A;  2VGK A;  3ZNT A;  3NY4 A;  3F1P A;  1L0D A;  3IF6 A;  2VGJ A;  4HP9 A;  4QHC A;  2HJ9 C;  2V0U A;  3ZG9 B;  3K3C A;  4ZJ3 A;  4HH3 A;  3PBS A;  2ZD8 A;  4R6L A;  3W4Q A;  1BLH A;  3DWK A;  2G7U A;  3T12 B;  5DKL A;  4C75 A;  3MS6 A;  2ZC3 B;  2ZL1 A;  4I38 A;  5A90 A;  1KGE A;  2CC1 A;  4OQ0 A;  1OME A;  2Z2M B;  4BBU A;  2IA2 A;  2VGL S;  4IBX A;  4NXB A;  2Y59 A;  1ACF A;  2WAE A;  3MZD A;  4HEF A;  1ZHH B;  1LI9 A;  1MWR A;  1SDN A;  4O01 A;  2XGN A;  1H0M A;  3VSL A;  3CPT B;  5CGW A;  1I2S A;  2Y2K A;  1E3U D;  5G4Y A;  5HWW A;  3T50 A;  4OKP A;  1M6K A;  3MBZ A;  1W8Y A;  1SHV A;  3UE3 A;  2ZQ7 A;  4CLC B;  3ZNY A;  3QNC A;  4BL2 A;  1H8Y A;  5GHY A;  1LL5 A;  2HPB A;  4CQH A;  1FSY A;  2KX6 A;  3EQU A;  1W79 A;  2L0W A;  1FR6 A;  3V39 A;  1YLT A;  5AJG A;  2DNS A;  5HD3 A;  3Q07 A;  3S22 A;  3IF5 A;  3BRM A;  3KYE A;  2D01 A;  3H7W B;  4HES A;  1OTE A;  3KYQ A;  3BQA A;  3A3D A;  1WYB A;  1TD5 A;  3MF0 A;  2V8C A;  4JXG A;  2WAD A;  4E3O A;  4EES A;  1TEM A;  2Y2N A;  1GSV A;  4BD0 A;  4ARZ B;  2Y2O A;  1ONG A;  4MNR A;  2J3T C;  2EA9 A;  3OOV A;  3ZG8 B;  1VB6 A;  1ESI A;  1PW1 A;  1L2S A;  5HW3 A;  2HGV A;  5FQ9 A;  2H28 A;  5FDS A;  5AVF A;  3NDG A;  1TVF A;  3OZH A;  2EX6 A;  1STZ A;  1K4E A;  1WE4 A;  4R23 A;  5HD5 A;  2VJW A;  4N92 A;  2WKP A;  3PHY A;  4ME4 A;  4OQH A;  3JYI A;  2ZMF A;  3LIB A;  3DTI A;  1MPL A;  3VV4 A;  1YSQ A;  3HJI A;  5FSR A;  4X69 A;  3MQQ A;  3PBQ A;  2I9V A;  3I7J A;  3VP4 A;  1H8Z A;  1P9W A;  4R70 A;  4BD1 A;  5EM0 A;  2WKR A;  3QNB A;  4R4R A;  5EVI C;  5CHU A;  2Y8H A;  2XDM A;  4HP4 A;  1PWD A;  4UQI S;  4LCM A;  4KEN B;  3JPU A;  2GNX A;  3S7Q A;  3ZGA B;  3R7W A;  1G6A A;  3C7U A;  5I5L A;  3OC2 A;  2RL3 A;  2P74 A;  1FIL A;  3KO6 A;  3G2Z A;  5TGF A;  1PRQ A;  1YPR A;  4NEE D;  4FUW A;  2PDR A;  4U0T A;  4QD4 A;  1IKG A;  1DRM A;  4KUO A;  2P7J A;  4WMC A;  1FSW A;  2JKT M;  3FG8 A;  4M4X A;  2DMW A;  2E8J A;  4ZTK A;  3OCL A;  4EBP A;  3O3V A;  5KMW A;  3FWL A;  3JVV A;  3RH8 B;  4QB8 A;  4WYY A;  4CLC E;  1M40 A;  3RJU A;  3DWZ A;  3BEC A;  3IXH A;  3IXB A;  5FEG A;  4K0W A;  1BT5 A;  1ES3 A;  3DAV A;  4PKY A;  4B93 A;  3F1O B;  3UN7 A;  2P9V B;  5FI2 A;  2V20 A;  5HPI A;  1ODV A;  5L09 A;  3S7P A;  1TS6 A;  4PM5 A;  1DJB A;  2C5W B;  4DJ3 A;  1QMF A;  1W7F A;  3IF6 C;  5A8B A;  3TSG A;  2PBD P;  4FH4 A;  2VX8 A;  1BSG A;  4OP5 A;  2ZM8 A;  5HDS A;  4UHU A;  3SOI A;  1XX2 A;  3BFF A;  4YOF A;  5EVL A;  4JXW A;  3RFB A;  4E3N A;  4MBK A;  4Y0U A;  3NUL A;  4IHQ A;  4BJP A;  3QP1 A;  2ZL1 B;  3UE6 A;  1ES2 A;  5GHX A;  5HPF A;  3RXX A;  1I2W A;  4Y2F A;  3OBF A;  4GD6 A;  5FAP A;  3CWF A;  2M7V A;  3ZVW A;  1ERQ A;  4GDN A;  1NZU A;  1PYY A;  5LBR A;  1BUL A;  4XT2 A;  2EX8 A;  5KSC A;  4JF6 A;  3BYD A;  2NUT C;  3PBO A;  1S4S A;  3CPT A;  4LRX C;  3Q81 A;  3T1R A;  4EEU A;  4Y0T A;  4PPR A;  1VET B;  3BEB A;  1OTD A;  2JKG A;  1MBL A;  2P08 A;  3M2K A;  1GA0 A;  4I3A A;  2OV5 A;  4LLO B;  4CLC A;  1VM1 A;  4OVD A;  1Y54 A;  3CAX A;  1YAX A;  3VMA A;  4WM9 A;  2Y2J A;  5IHV A;  2XRO A;  4OQG A;  4MEZ A;  4WLA A;  5DKK A;  2AVX A;  3BFE A;  4JGQ A;  2I72 A;  5TBM B;  5TFQ A;  5KZH A;  2B18 A;  3QP5 A;  2QMI A;  5F5Y A;  3ICY A;  3T4J A;  4JKT A;  1TF1 A;  3U4L P;  3BLM A;  3E4O A;  4K08 A;  4R3A A;  3A0R A;  2WKI A;  2J3W A;  4OLG A;  1XPB A;  4ARZ A;  1NLZ A;  3LR3 A;  1NRJ A;  4DMZ A;  4KZB A;  3VE3 A;  3T1S A;  3V5M A;  3HLE A;  2H5S A;  1PZP A;  4KZ7 A;  3HLC A;  2HDR A;  3UB9 A;  3ZQ5 A;  2VLG A;  4E3M A;  1GHM A;  4M3K A;  5F6A A;  3W2Z A;  4HQA A;  5G4Z A;  1XA1 A;  3G35 A;  2BAS A;  4YNR A;  4FH2 A;  3TW8 A;  3E2K A;  4Y0O A;  2ZQD A;  3K2N A;  4R3J A;  1XKZ A;  1RGZ A;  5HWV A;  3SH7 A;  3MKF A;  5D3O A;  3KSG A;  1ONH A;  1UWP X;  5GL9 A;  3CMZ A;  4LV1 A;  3K3D A;  5CRF A;  5F1F A;  1UGU A;  5FQJ A;  4S2O A;  5HAQ A;  1CF0 A;  1CI8 A;  3E98 A;  4Y17 A;  1OJ5 A;  3CI6 A;  1W8Q A;  5E2H A;  3IQA A;  1PZO A;  1CEF A;  5L8M A;  2DCF A;  3IBJ A;  4UAA A;  4P85 A;  3ZHH A;  1T1A A;  4ZAM A;  1PWG A;  5DFX A;  5C5K A;  3UB7 A;  2M7U A;  5FAQ A;  1JNU A;  3BW6 A;  3V3S A;  1E3U A;  3M2J A;  2XRN A;  3W4O A;  1L0F A;  2E8I A;  1GCE A;  2Y2L A;  3R4K A;  3WRZ A;  1JWP A;  3NJA A;  3ITA A;  1ERM A;  4IBR A;  4JGO A;  1Z09 A;  4EBL A;  4HY8 A;  3UE0 A;  2HP5 A;  1F5M A;  3IHA A;  5EFW A;  2Y2I A;  2EFX A;  3H9W A;  4R4S A;  4RQ9 A;  3B47 A;  3BFG A;  1OT6 A;  3SS4 A;  2EX9 A;  3WS2 A;  1DJC A;  3WWX A;  3HUO A;  3UPP A;  4Q8I A;  2LB5 A;  3MKE A;  5F83 A;  1K6R A;  2O9A A;  3PAG A;  5L10 A;  2UV0 E;  4LPZ A;  3F1O A;  2P9V A;  1NLY A;  4IVI A;  3HBR A;  3CZD A;  1ZG4 A;  5AQA A;  3PBT A;  1NJ4 A;  2QYB A;  2XLN A;  2QKP A;  3Q82 A;  4JGR A;  1ALQ A;  2BTF P;  5F68 A;  2OWH A;  1XGI A;  4OPY A;  4KG6 A;  3G2Y A;  4C3Q A;  4GJ4 A;  4NET A;  1J9M A;  5HSQ A;  3OPH A;  1K57 A;  4GNU A;  4I3I A;  3BY8 A;  3CLO A;  1CEG A;  3BFD A;  2IWB A;  4BWI A;  3G34 A;  3LY4 A;  4P87 A;  1NZO A;  3LI9 A;  3GVB A;  3LEZ A;  3ITB A;  1K4F A;  3C8C A;  2VK3 A;  2WGW B;  5HZH A;  3LIF A;  2ZOH A;  4ID4 A;  4YIN A;  2ZC6 B;  3CIT A;  3ZG7 B;  5CEC A;  5E2E A;  2VEA A;  3OCN A;  2OAQ 1;  2R78 A;  5CHM A;  4XT2 B;  4HH2 A;  4K91 A;  3GDI A;  1GHP A;  1TDL A;  3LIE A;  1AWI A;  3O86 A;  1N9L A;  4KG2 A;  1VET A;  3N6I A;  1T1B A;  2Y2P A;  2V1A A;  3D4F A;  4PMA A;  4WZ4 A;  4GD8 A;  1S4R A;  1XJ3 A;  4CLC C;  4IJG A;  1MKM A;  1DP9 A;  3S4X A;  2G2W A;  4U3T A;  4WEL A;  1NYM A;  5FI7 A;  4OP8 A;  5JYO A;  1NYY A;  2R9W A;  3TJZ C;  5U47 A;  3LCE A;  3N4I A;  3ZFZ A;  2VV8 A;  2EXA A;  1N9N A;  3HCY A;  3UY6 A;  4GHI B;  5FL3 A;  2HF6 A;  3VP2 A;  2FFF B;  4FOF A;  1O7E A;  3VOY A;  2J80 A;  4X53 A;  5KSH A;  3WRT A;  5TBM A;  2WGI A;  2ZJ9 A;  2W27 A;  4KG5 A;  2Q0O A;  2V1Z A;  3BQ8 A;  2RCX A;  2Y2M A;  3HLW A;  3IWI A;  4I5S A;  2EFU A;  3DTE A;  4FD8 A;  4PM6 A;  5EEC A;  1VQQ A;  3E4Q A;  5J4E A;  5F1G A;  2HP6 A;  2WK0 A;  1CJF A;  1PI4 A;  2Y79 A;  1BLC A;  2JHE A;  4Q0J A;  3FPV A;  3NOP C;  5FAT A;  4S2L A;  3VP0 A;  2HDQ A;  3O5Y A;  2ZC7 A;  4HJ3 A;  2WZZ A;  5IT5 A;  3P01 A;  2HDS A;  2PAV P;  2ZC5 B;  2PYR A;  1MZU A;  2B5R A;  2XD5 A;  2JKR I;  4JPM A;  4QU3 A;  1S6R A;  5HDC A;  2XR0 A;  3UPN A;  5J3W A;  1FR1 A;  3MR0 A;  4MN7 A;  3VP1 A;  3DTK A;  4N9K A;  5GLD A;  4BQM A;  2Y2Q A;  2M1C A;  3DW0 A;  5IU1 A;  2H10 A;  3PBR A;  3CG5 A;  2W0N A;  1P9R A;  2PT7 A;  2JE5 A;  3V50 A;  4EER A;  1EI5 A;  4E6W A;  1S66 L;  5M19 A;  4DN0 A;  1JWV A;  1SDE A;  4DE2 A;  1BYW A;  4YFM A;  5EPH A;  1PNE A;  4GLQ A;  1IYO A;  1YLY A;  4OH0 A;  3C4O A;  4IUH A;  5DJT A;  4D60 A;  2V9A A;  1W63 Q;  1TS8 A;  3BM6 A;  2WYX A;  4X68 A;  5EM1 A;  4PM9 A;  2XA7 M;  5E43 A;  1HZO A;  2P04 A;  1JVJ A;  1KE0 A;  1KDW A;  4EET B;  3EGX C;  3G32 A;  3NOU C;  3EEH A;  4LGW A;  4ZJ1 A;  4S2M A;  1IEM A;  1XA7 A;  3FC7 A;  4OPQ A;  3IX8 A;  2J8Y A;  4R38 A;  4ZBE A;  3P98 A;  3UNW A;  3HLD A;  5AVE A;  3W4P A;  1PWC A;  1YLP A;  3L7H A;  4O8G A;  2OWJ A;  2GJ3 A;  2Y4A A;  1MC0 A;  3M6H A;  3LO7 A;  1VEU B;  1G5U A;  5F69 A;  1NWZ A;  4D2O A;  3NC8 A;  1XJ6 A;  4UEY A;  4S2J A;  1F98 A;  3ISG A;  3LR0 A;  3NDE A;  4QY5 A;  5CTN A;  1SZV A;  4L9G A;  3WS5 A;  2VA0 A;  3IX4 A;  2CMN A;  2O9B A;  2W3E A;  4S2I A;  1YMS A;  1YKD A;  5FQK A;  4KZA A;  3SH8 A;  2XFT A;  3QP6 A;  3F1N B;  4JF5 A;  4L9F A;  3Q7V B;  5L2F A;  3NEC A;  5HAP A;  2XH9 A;  2A24 B;  4P6B A;  4EQ1 A;  4F94 A;  2JBF A;  3WS0 A;  4P6Z M;  3GTC A;  3UB5 P;  4B88 A;  3E0Y A;  4I39 A;  5DF8 A;  3S7N A;  2PR5 A;  4H8R A;  2K7S A;  2WGV A;  3FYZ A;  1HD8 A;  4RX3 A;  4N1X A;  3PTE A;  5M1A A;  2WGW A;  3MZE A;  4HBT A;  2PHY A;  2H0Y A;  1EW0 A;  3TG9 A;  2B95 A;  3LID A;  1KE4 A;  2XEP A;  2BLS A;  4NK3 A;  3DTM A;  1Y28 A;  3MZF A;  4KZ4 A;  3H82 B;  4B9O A;  4Z9Q A;  1IFQ A;  1DP8 A;  3S7O A;  3C4P A;  2W1T B;  2PU2 A;  1G28 A;  3HUM A;  3CJM A;  1IOU A;  4F3L B;  2QZ6 A;  4GCZ A;  3A0V A;  4X56 A;  5FI6 A;  3G30 A;  4HIA A;  3C38 A;  3IH8 A;  5FAS A;  1LSV A;  4HNB A;  3WS4 A;  3IX3 A;  1YLZ A;  3ZG0 A;  3T4T A;  5HAI A;  3IWO A;  2R9X A;  2K2N A;  3UMD A;  4KZ6 A;  4GHI A;  4OPZ A;  4E6X A;  1SKF A;  3ZDJ A;  4R0Q A;  1E25 A;  4UA6 A;  3A0S A;  2VV7 A;  1AXB A;  4LV2 A;  4NG2 A;  4PM8 A;  4OLD A;  3MMH A;  3VFF A;  4C6Y A;  4KUK A;  3N8S A;  1T19 A;  4HOI A;  3LUQ A;  5HX9 A;  2VV6 A;  2ZQA A;  3HL9 A;  2OAP 1;  4WEJ A;  5CED A;  4QJG A;  1MWT A;  1A0K A;  1MKI A;  4GOG A;  2ZQ8 A;  2HV1 A;  4UA7 A;  5BOH A;  1YQS A;  3PXP A;  1D06 A;  2LB9 A;  1CQA A;  3EOI A;  5CTM A;  1PIO A;  5G18 A;  3NHQ A;  1K25 A;  3KSI A;  4Y7P A;  1K56 D;  2Q9N A;  4FTX A;  3D9Y A;  4LFU A;  4BL3 A;  4XUX A;  3QP4 A;  1IYP A;  1XFN A;  4PKY G;  2QPN A;  1BZA A;  3C30 A;  4LCL A;  2WKQ A;  1NRF A;  1S1Y A;  1D1J A;  3C2W A;  2Y55 A;  4XUZ A;  2VKS A;  2H0T A;  3OPP A;  4S2K A;  5E2G A;  5J8X A;  4ESP A;  2BG1 A;  3KX0 X;  1XJ2 A;  4IVK A;  3IS2 B;  3D72 A;  3M6B A;  4EW7 A;  3G4P A;  2YKF A;  4E3I A;  1VHM A;  1IYQ A;  4S2N A;  2HJE A;  2JKR M;  4Y3I A;  5DFY A;  1TS0 A;  4WZ5 A;  4N9L A;  3A3F A;  3NIA A;  1LLB A;  3FZC A;  2A3U A;  1K55 A;  4Y5F A;  2PD7 A;  4GS9 B;  1F9I A;  2X02 A;  4NXG A;  3FPW A;  3LY3 A;  1SKO B;  3VE4 A;  1ZTU A;  3UB8 A;  4X55 A;  3CUE A;  4WL9 A;  4YWZ A;  5JYP A;  3MQO A;  2ZQC A;  2VGL M;  3SZT A;  2ACG A;  3LEQ A;  2XQZ A;  3RTY A;  5E2F A;  5GHZ A;  5A91 A;  4ZJ2 A;  3UDF A;  2PU4 A;  1VEU A;  4HJ6 A;  1YLW A;  1K54 A;  1Y4O A;  4JGP A;  3LFV A;  4EV4 A;  3HLG A;  3MQ0 A;  4KZ9 A;  2OLU A;  1DJA A;  4GW9 A;  3SH9 A;  3TOI A;  1IEL A;  2L4R A;  5TJJ A;  1KVM A;  1ZKJ A;  3N7W A;  3UDX A;  3GRJ A;  1JWZ A;  4RYE A;  4AFI A;  1KDS A;  3F1N A;  2K31 A;  2O99 A;  3Q7V A;  2J3T D;  4PAU A;  3P7N A;  5EOO A;  2A24 A;  1MXO A;  5I94 A;  4RA7 A;  4BBT A;  4MMN A;  1LL9 A;  1X0O A;  3LR5 A;  3T4K A;  1FCO A;  1BTL A;  5DTK A;  3T4Q A;  3MFX A;  4QWO A;  3LI8 A;  1KGF A;  3OPR A;  5CHJ A;  2WZX A;  1YMX A;  1XGJ A;  4G3W A;  4DXC A;  2XSS A;  1L0G A;  2QHK A;  2FFY A;  5DF7 A;  4Z1W A;  1NXY A;  1N9O A;  5EVI D;  3LIC A;  4X6T A;  4B4Z A;  1TS7 A;  3H82 A;  3U2A A;  2PD8 A;  5A92 A;  1BLS A;  5DF9 A;  2PRF A;  2W1T A;  3NOT C;  4I3J A;  4F3L A;  1MWU A;  4DE3 A;  1KGG A;  3NCK A;  5J7E A;  3MJQ A;  4DDS A;  3T1X A;  2O9C A;  1NY0 A;  4JXV A;  3FV7 A;  2GDN A;  3T4L A;  3FKW A;  1RGY A;  4OOL A;  1Q2Q A;  3PAE A;  4G3K A;  3HUN A;  2B02 A;  3MSH A;  4NKP A;  2WUQ A;  2PYP A;  4HI4 A;  3CHW P;  5FQM A;  4HHD A;  4RX2 A;  4MN5 A;  2GX5 A;  3KSH A;  3Q1F A;  2X71 A;  2G2U A;  4UQI M;  4GKU A;  2EXB A;  4KZ3 A;  1ERO A;  4CPK A;  2ZOI A;  1GSX A;  1OPX A;  4GDB A;  2ZMA A;  4MCW A;  5CX7 A;  3IT9 A;  3MXQ A;  3TRC A;  2WKE A;  3MXR A;  1L0E A;  3BWL A;  2DRW A;  4R1G A;  2V2F F;  4Y15 A;  2HDU A;  3LIA A;  1C3B A;  1S0W A;  1MY8 A;  4WUJ A;  1FIK A;  4B4X A;  1E4D A;  2GZA A;  2L1M A;  1N9B A;  3O87 A;  4FSF A; 
#chains in the Genus database with same CATH homology
 3S7N A;  2BAS A;  2HJ9 C;  2V0U A;  2PR5 A;  3K3C A;  4YNR A;  2K7S A;  5K5B A;  3TW8 A;  4HH3 A;  4OOM A;  3PBS A;  3K2N A;  3BY9 A;  4R6L A;  5HWV A;  2G7U A;  5DKL A;  2PHY A;  2W3H A;  3IS2 A;  3KSG A;  4I38 A;  1UWP X;  1EW0 A;  4O0P A;  4H6J B;  3K3D A;  3SW1 A;  1UGU A;  3LID A;  4BBU A;  2D02 A;  2IA2 A;  4KQD A;  2V0W A;  3E98 A;  2VGL S;  4NXB A;  1OJ5 A;  1Y28 A;  3CI6 A;  3T4S A;  3H82 B;  2V1B A;  3TE8 A;  4B9O A;  3EGD C;  1IFQ A;  1DP8 A;  1ZHH B;  5L8M A;  3S7O A;  1H3Q A;  2W1T B;  3IBJ A;  4L9E A;  1G28 A;  1T1C A;  4II7 A;  1IOU A;  3ZYT A;  4GS9 A;  4O01 A;  4F3L B;  1T1A A;  4GCZ A;  3A0V A;  5DFX A;  5C5K A;  3UB7 A;  2M7U A;  4HIA A;  3C38 A;  1LSV A;  4HNB A;  1JNU A;  5G4Y A;  5HWW A;  3BW6 A;  3T50 A;  3T4T A;  2W3F A;  3CUE C;  2VZW A;  2XRN A;  3UE3 A;  2K2N A;  3UMD A;  4CLC B;  1OJG A;  3R4K A;  4GHI A;  4ETZ A;  2Z6C A;  3NJA A;  1KOU A;  4JGO A;  4CQH A;  3A0S A;  4HY8 A;  2KX6 A;  2VV7 A;  4PHT A;  1F5M A;  5HWT A;  3MMH A;  3LYX A;  1LSW A;  3EQU A;  2EWV A;  5EFW A;  4EEP A;  4KUK A;  2L0W A;  3H9W A;  4NXE A;  1G6O A;  5AJG A;  1T19 A;  4HOI A;  5HD3 A;  4RQ9 A;  3LUQ A;  3B47 A;  2VV6 A;  1OT6 A;  4LRY C;  2OAP 1;  2D01 A;  3H7W B;  4MN6 A;  4WEJ A;  2FZ0 A;  2A2L A;  1S67 L;  3PYP A;  1OTE A;  3KYQ A;  4EXO A;  3BQA A;  2HV1 A;  2LB5 A;  3B42 A;  1DP6 A;  2O9A A;  2Z6D A;  1TD5 A;  3PXP A;  1D06 A;  2LB9 A;  4LPZ A;  3F1O A;  3MF0 A;  2ZMV A;  1NLY A;  3EOI A;  4L0L A;  4EES A;  3PBT A;  1GSV A;  4ARZ B;  1LT0 A;  2QYB A;  3NHQ A;  3KSI A;  2J3T C;  2EA9 A;  2QKP A;  3OOV A;  1T18 A;  1UWN X;  4JGR A;  1VB6 A;  2HGV A;  4LRZ E;  5F68 A;  2H28 A;  2OWH A;  1LL8 A;  5AVF A;  1OTB A;  4GJ4 A;  4DJ2 A;  2MJ6 A;  1XFN A;  4PKY G;  1D7E A;  4Q0I A;  1P97 A;  5HSQ A;  3EEA A;  4E04 A;  3C30 A;  3F1P B;  1STZ A;  4I3I A;  3ULF A;  3BY8 A;  2WKQ A;  3CLO A;  5HD5 A;  4BWI A;  1S1Y A;  2VJW A;  5KIZ A;  2WKP A;  3C2W A;  3LI9 A;  1S1Z A;  3PHY A;  4ME4 A;  2VKS A;  2ZMF A;  3LIB A;  3VV4 A;  3G6O A;  2XA7 S;  1YSQ A;  1WA9 A;  3HJI A;  4HJ4 A;  3C8C A;  3MQQ A;  3PBQ A;  3KSF A;  2I9V A;  3KX0 X;  2FH5 A;  1P9W A;  1XJ2 A;  5HZH A;  3IS2 B;  3LIF A;  4R70 A;  2ZOH A;  3D72 A;  2WKR A;  4EW7 A;  4QPR A;  2YKF A;  2Y8H A;  3CIT A;  1VHM A;  2VEA A;  3OCN A;  2OAQ 1;  2R78 A;  2HJE A;  4HP4 A;  2O0Y A;  2JKR M;  4Y3I A;  4UQI S;  4XT2 B;  4HH2 A;  5DFY A;  2YKH A;  3GDI A;  1TS0 A;  4BMW A;  2GNX A;  3LIE A;  3S7Q A;  3B33 A;  1N9L A;  3R7W A;  5I5L A;  1T1B A;  3OC2 A;  4Y5F A;  2V1A A;  4EU0 A;  4G3V A;  2PD7 A;  4GS9 B;  1F9I A;  3UB6 A;  1S4R A;  4NXG A;  1XJ3 A;  4CLC C;  3FPW A;  4IJG A;  1MKM A;  3KO6 A;  1DP9 A;  4WEL A;  5MC7 A;  3DBA A;  3VE4 A;  1ZTU A;  3UB8 A;  4NEE D;  3CUE A;  3TJZ C;  4WL9 A;  4YWZ A;  3MQO A;  2VGL M;  2VV8 A;  2PR6 A;  2PDR A;  3RTY A;  1N9N A;  3HCY A;  4GHI B;  5FL3 A;  1DRM A;  4KUO A;  2HF6 A;  2P7J A;  4Q0H A;  4FOF A;  4HJ6 A;  2J80 A;  2JKT M;  3FG8 A;  5KSH A;  5TBM A;  5DJU A;  3OLO A;  4M4X A;  2DMW A;  4JGP A;  3LFV A;  2W27 A;  2QWS A;  3OCL A;  1GSW A;  3BQ8 A;  4MDZ A;  3MQ0 A;  4P6Z S;  3JVV A;  3H7W A;  4I5S A;  3RH8 B;  4GW9 A;  1YSP A;  4CLC E;  3PBN A;  2L4R A;  5TJJ A;  3E4Q A;  5J4E A;  2W1R A;  4AFI A;  2Y79 A;  4PKY A;  2JHE A;  4B93 A;  4Q0J A;  3F1N A;  2K31 A;  2O99 A;  3F1O B;  3FPV A;  3NOP C;  2J3T D;  4PAU A;  3P7N A;  1W63 M;  5HPI A;  1ODV A;  2KDK A;  2A24 A;  3T4O A;  3S7P A;  1TS6 A;  2ZBB A;  4BBT A;  4DJ3 A;  4MMN A;  3O5Y A;  4HJ3 A;  1X0O A;  3LR5 A;  3T4K A;  4WN5 A;  2OOL A;  5IT5 A;  5A8B A;  3P01 A;  2PYR A;  1MZU A;  2VX8 A;  3T4Q A;  3MFX A;  2JKR I;  5HDC A;  3LI8 A;  5HDS A;  3PR6 A;  4YOF A;  2KLI A;  5J3W A;  3MR0 A;  4MN7 A;  4WF0 A;  3RFB A;  4G3W A;  2XSS A;  2QJ5 A;  4IHQ A;  4H6J A;  5IS1 A;  2QHK A;  4BJP A;  2M1C A;  4Z1W A;  3UE6 A;  5IU1 A;  3PBR A;  5HPF A;  3LR4 A;  1N9O A;  2W0N A;  4Y2F A;  1P9R A;  2PT7 A;  3LIC A;  3OBF A;  4EER A;  3CWF A;  1TS7 A;  3H82 A;  3UME A;  3U2A A;  1S66 L;  2M7V A;  4DN0 A;  2PD8 A;  2KOI A;  1BYW A;  1LSX A;  5DF9 A;  5LBR A;  2W1T A;  4XT2 A;  4GLQ A;  3NOT C;  4I3J A;  3GEC A;  1P0Z A;  4F3L A;  1V9Y A;  4IUH A;  2NUT C;  3PBO A;  2JKT I;  1S4S A;  5J7E A;  3MJQ A;  5DJT A;  4LRX C;  2V9A A;  1W63 Q;  1TS8 A;  2O9C A;  3E4P A;  4EEU A;  3EQV A;  2XA7 M;  4NXF A;  3R7W B;  3T4L A;  2QJ7 A;  4CLC D;  1OTD A;  2P04 A;  4OOL A;  4EET B;  3EGX C;  2P08 A;  3NOU C;  4I3A A;  3EEH A;  4G3K A;  4LLO B;  4CLC A;  2B02 A;  4NKP A;  4KQO A;  3CAX A;  2W3D A;  2PYP A;  4HI4 A;  3FC7 A;  1H8M A;  4ETX A;  1YAX A;  4HHD A;  3HJK A;  4R38 A;  2JN7 A;  4MN5 A;  2EWW A;  2GX5 A;  3KSH A;  2XRO A;  5AVE A;  4UQI M;  4IUK A;  4WLA A;  5DKK A;  3EWK A;  4O8G A;  2OWJ A;  4EUV A;  2GJ3 A;  2ZOI A;  3KYZ A;  1MC0 A;  1OPX A;  1GSX A;  1XJ4 A;  5F69 A;  4JGQ A;  1NWZ A;  3V67 A;  4MCW A;  5TBM B;  2B18 A;  5CX7 A;  1XJ6 A;  4UEY A;  5F5Y A;  3D3O A;  3MXQ A;  3ICY A;  3TRC A;  1F98 A;  3LR0 A;  2W3G A;  4WEK A;  3VOL A;  3BWL A;  2NUP C;  3T4J A;  4L9G A;  1OTA A;  1V9Z A;  1TF1 A;  3BJN A;  2VA0 A;  2CMN A;  2O9B A;  1XFQ A;  2W3E A;  3E4O A;  3LIA A;  4K08 A;  4R3A A;  3A0R A;  1YKD A;  2J3W A;  3IBR A;  4ARZ A;  4WUJ A;  1NLZ A;  3LR3 A;  1NRJ A;  4DMZ A;  2INW A;  3VE3 A;  5HDD A;  3F1N B;  1OT9 A;  4L9F A;  4BBV A;  1OTI A;  5HL6 A;  2GZA A;  3JVU A;  2A24 B;  4EQ1 A;  4ZRR A;  3UB9 A;  3ZQ5 A;  2VLG A;  2L1M A;  4P6Z M;  5F6A A;  3W2Z A;  3F1P A;  3E0Y A;  4FSF A;  4HQA A;  4I39 A;  5G4Z A;  4HP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...