4NXBA

Crystal structure of ilov-i486(2lt) at ph 7.0
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
108
Chain Sequence
b'KNFVITDPRLPDNPIIFASDGFLELTEYSREEILGRNARFLQGPETDQATVQKIRDAIRDQRETTVQLINYTKSGKKFWNLLHLQPVRDQKGELQYFGVQLDGSDHVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phototropin-2
publication title Significant Expansion of Fluorescent Protein Sensing Ability through the Genetic Incorporation of Superior Photo-Induced Electron-Transfer Quenchers
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Flavoprotein, fluorescent protein
total genus 30
structure length 108
sequence length 109
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4nxbA00
2QJ7A 4JGQA 5DJTA 4M4XA 3LIAA 1D7EA 1MZUA 4EEUA 4EW7A 3C8CA 2PYPA 3CAXA 4R6LA 4HQAA 5F6AA 2V1BA 4EEPA 1V9YA 4R3AA 4HJ3A 4BBTA 1OTDA 2Z6DA 3UB9A 3G6OA 2A24A 3UMEA 2L4RA 2PDRA 4BBVA 4I39A 2VV8A 2B02A 1BYWA 5KIZA 4B9OA 4K08A 5F5YA 2JHEA 1XJ3A 2VEAA 4NXEA 5TBMB 1OTAA 4L9FA 3VE4A 1TS6A 3BY9A 5HWVA 3NJAA 1WA9A 3NOUC 2JN7A 3F1PA 4H6JB 4NXBA 4MN5A 5HDSA 3MFXA 5HWWA 1XJ6A 3K3CA 4WLAA 2V1AA 1NWZA 4GHIB 2L0WA 1T18A 2ZOHA 1T1BA 4F3LB 2ZBBA 3NHQA 3LIBA 5HDDA 1LSXA 4NXFA 1LT0A 2PHYA 1UWNX 3FG8A 3UB7A 1TS7A 3EEHA 3EWKA 3VE3A 2J80A 2PR5A 5A8BA 5HZHA 1S1YA 5IS1A 3H82B 1OTIA 4KUOA 5DKKA 3UB6A 4PKYA 4HI4A 1G28A 5TBMA 2D02A 3H7WB 2QHKA 1EW0A 4KUKA 4HP9A 5AVEA 4LRXC 1N9LA 3RTYA 3B33A 4H6JA 4MN6A 1LSWA 2V0UA 2V9AA 3T50A 3LICA 4DJ2A 3BWLA 5HD3A 4GHIA 5EFWA 2H28A 5HDCA 1S4SA 1N9NA 5J7EA 1T1CA 3IBRA 1DP9A 4F3LA 1F9IA 4I38A 2PD7A 5HSQA 3PHYA 1P0ZA 4R70A 3CLOA 1XFQA 2PYRA 5HD5A 4HY8A 1TS8A 2ZOIA 2GJ3A 1OTBA 2KX6A 4WUJA 3KX0X 1GSWA 2QWSA 3A0RA 3H82A 4EERA 4WL9A 2VV6A 4JGRA 2WKPA 3H7WA 4I3AA 4NXGA 3VOLA 4KQDA 5G4YA 2HV1A 1P97A 1OT9A 3F1OB 1KOUA 4LRZE 3LIFA 4LLOB 3LIEA 4HNBA 1LSVA 2KDKA 4YWZA 5IU1A 2OWJA 4HP4A 3A0SA 1OT6A 1S1ZA 5J4EA 3LUQA 5DKLA 3C2WA 4DJ3A 4E04A 4HH3A 4HJ4A 1F98A 4I3IA 4EESA 1N9OA 3P7NA 1TS0A 2VLGA 2YKHA 3LIDA 4L9GA 1T1AA 1XFNA 1GSXA 3ICYA 3E4OA 2EA9A 4RQ9A 3NOPC 3ZQ5A 2I9VA 1DP8A 4LRYC 2PR6A 3CWFA 2QKPA 4JGOA 2D01A 4R38A 3F1NB 3UE6A 3GECA 2WKRA 3LI9A 4JGPA 4HOIA 3IS2B 1XJ4A 3MXQA 3F1OA 2INWA 2L1MA 2P7JA 3GDIA 3PYPA 1Y28A 5HWTA 1S66L 4WN5A 3SW1A 4GS9B 1OJ5A 4XT2B 2K7SA 5I5LA 1VB6A 4EETB 1LL8A 1X0OA 1DP6A 1V9ZA 4HJ6A 3E4QA 2CMNA 3D72A 3MQOA 3ULFA 3MJQA 1GSVA 2VV7A 4BBUA 1DRMA 2QJ5A 2M1CA 3A0VA 1ODVA 3OLOA 5AVFA 1JNUA 3F1NA 2V0WA 2BASA 2PD8A 2WKQA 3UMDA 1UGUA 1UWPX 3IS2A 2W27A 3MR0A 2OWHA 2W0NA 3HJKA 3BY8A 3LYXA 5DJUA 3UB8A 4HHDA 4L9EA 2R78A 1S4RA 4GS9A 5F68A 3K3DA 4EXOA 4HIAA 1D06A 3FC7A 3HJIA 5J3WA 4XT2A 2OOLA 2A24B 4EQ1A 4LPZA 1OJGA 3NOTC 3LI8A 1OTEA 1S67L 4I3JA 3H9WA 5G4ZA 3MQQA 4I5SA 4WF0A 4HH2A 4GW9A 2YKFA 1XJ2A 3F1PB 3E4PA 3RH8B 5F69A 4PKYG 2Z6CA 1T19A 4GCZA
chains in the Genus database with same CATH superfamily
2QJ7A 4JGQA 5DJTA 5J8XA 1PZPA 4LCMA 4H8RA 5E2HA 4NK3A 3R7WA 1I2WA 3G2ZA 4EEUA 3LCEA 4G3VA 2BTFP 2HDSA 2W3GA 2Y55A 4HQAA 5F6AA 1V9YA 3S7PA 3B3XA 4OQ0A 2EX6A 4BBTA 3G31A 5DVAA 1KE3A 3UB9A 2A49A 1IKGA 3UMEA 5KSHA 2L4RA 3V5MA 3OBFA 1ESIA 1JWPA 3CJMA 3HLGA 4I39A 5E2FA 4WM9A 4OQIA 4B9OA 1E25A 1NZUA 1YLTA 2JHEA 3CI6A 2J3TC 2B95A 1OTAA 4L9FA 1G5UA 2PT7A 5HWVA 5HAPA 4S2NA 5EM0A 3BFDA 1CEGA 3NOUC 1SKFA 2JN7A 3QNBA 5FATA 3K2NA 1QMEA 1H0MA 2Y2QA 3MFXA 4GD8A 4S2OA 4E6WA 3UN7A 4KZ6A 5CX7A 4DN0A 4DE2A 4X69A 1FCOA 4O01A 3LFVA 3ZG7B 4OOLA 3PBSA 3Q7ZA 4F3LB 3M2KA 1TEMA 3SH7A 3LIBA 2JC7A 2P74A 4NXFA 2PHYA 1UWNX 3FG8A 2QYBA 2BLSA 3V50A 4C75A 2EFUA 2PR5A 1AWIA 2Y91A 2CC1A 5AQ7A 4LENA 2V1ZA 1DJBA 1ONGA 3IX8A 4PKYA 1YQSA 5FQQA 4KENB 1G28A 4KZ7A 5TBMA 3UNWA 3MS6A 1WYBA 1EW0A 3UDIA 3CHWP 1YLJA 4ETZA 4UHUA 3UE1A 4H6JA 3ZG5A 2V0UA 3L9KA 4DRTA 5EVID 4DJ2A 3ZNYA 3EOIA 3MKFA 5HD3A 5EVIB 4DKIA 2FZ0A 1HVBA 1I5QA 5KSCA 1N9NA 3SS5A 4RX3A 1SKOA 1K25A 1EWZA 3EQUA 4I38A 5TR7A 5FASA 3PHYA 2Y79A 4WELA 3S1YA 4PM6A 2PYRA 1BLPA 3KSHA 1HLUP 4E6XA 1OTBA 3G35A 4AFIA 1W8QA 1CF0A 3RXXA 4WUJA 3KX0X 2BG1A 1GSWA 1Z6FA 3JVVA 3HUNA 3T1SA 4WL9A 4ID4A 3O88A 1F2KA 4E3KA 4NXGA 3IQAA 3LY3A 2K31A 2ZM2A 5CEBA 4KZ5A 4KQDA 5G4YA 2HV1A 4X68A 5EVLA 4JF4A 2Y2MA 2Y2GA 4F94A 1KOUA 4LRZE 4IEDA 4GDNA 1IYSA 5EV0A 1FCNA 3PBNA 5CRFA 4HNBA 4YWZA 5IU1A 3KO6A 5EM1A 4OPZA 4HP4A 3S4XA 3DAVA 1OT6A 3LUQA 4G3KA 3SH8A 1VHMA 3IT9A 4QWOA 3T1XA 2JKFA 2J9OA 3C38A 4HJ4A 5G18A 3T12B 4GDBA 1PZOA 3LIDA 1T1AA 4BLMA 1GSXA 2JKRM 3UB5P 3NIAA 4B4ZA 1XX2A 5E2EA 2EA9A 3EGDC 4R4RA 5BOHA 4HBTA 5D3OA 2E8IA 3CUEC 5GLBA 1YAXA 4WZ4A 2QKPA 3SS4A 3EQVA 1KDSA 3LI9A 4JGPA 4R3BA 2M7UA 3MSHA 1NLZA 3MQ0A 3HLWA 1PNEA 3C7UA 4IHQA 2DMWA 4OLGA 1XPBA 2L1MA 3VOYA 4ZJ2A 5FSRA 3TRCA 5CTNA 3A3EA 5TGFA 2J7VA 3SZTA 4GS9B 5A91A 2OLVA 5HARA 4WBGA 3ZG8B 2X01A 2ZC5B 3CPTB 4UQIM 2O9AA 3IXHA 3W2ZA 3MZDA 2XQZA 3MFDA 1ZHHB 2VV7A 3BFEA 3C7VA 3TSGA 2QZ6A 4Z1WA 2M1CA 1YPRA 4FSFA 2LB9A 3OLOA 3OPRA 5AJGA 2Q9MA 3KYQA 3M2JA 2WKQA 1UGUA 1CI9A 1NRJA 2VGKA 2IWDA 4LV2A 2W27A 4B4XA 1O07A 1KDWA 2OWHA 3V3SA 3HLFA 3LR5A 5L09A 3VSLA 5TJJA 3LYXA 3QP5A 3R7WB 3IXBA 2DRWA 4K91A 3UB8A 1PFLA 4L9EA 3MKEA 4P6ZS 1ES3A 5AQAA 4ESPA 4EXOA 1LL9A 4EUVA 2UV0E 4QY6A 3HJIA 5J3WA 4XT2A 3G4PA 1MWSA 5FAQA 1SDNA 4BQMA 4EQ1A 3T4QA 4FCFA 3VP1A 3UDFA 2ZLYA 3BFCA 1PWGA 4C6YA 2HDRA 3BM6A 4X56A 1ES5A 4CLCE 3UY6A 2XLNA 5EUAA 4BL2A 4L0LA 1ACFA 3EGXC 2Y8HA 3N8LA 4GW9A 5CXWA 2GNXA 2V8CA 4D2OA 5F83A 3GTCA 3TE8A 3W4OA 5FL3A 3FKWA 1M6KA 3MZEA 1JVJA 2FFYA 4PM9A 3DWKA 3IXDA 4GCZA 4DMZA 1NYYA 4M4XA 1YM1A 2V20A 3LIAA 2PRFA 1L3LA 5L2FA 1MZUA 1H8YA 2VZWA 2XA7S 4G3WA 3CAXA 3LEZA 3T4KA 4R6LA 3GSGA 3IF6A 2EWVA 2JBFA 4EEPA 1MY8A 4R3AA 4UA7A 1K55C 5HX9A 4P85A 2XD1A 2OAQ1 1W79A 4FH2A 4JPMA 4ME4A 1YLWA 4DE1A 1BYWA 3BECA 3JPUA 2R9WA 4GOGA 3ZVWA 4WEJA 4LV0A 4K08A 2EWWA 1WE4A 4N1HA 2VEAA 5TBMB 4HBUA 1H5XA 2PU2A 2ZQCA 2XDMA 3OPLA 4QPRA 4H6JB 4NXBA 4MN5A 1ERMA 3KYEA 3PBTA 1W8YA 3K3CA 4EBLA 3AGDA 4BJPA 4MBKA 2V1AA 1EROA 5FI7A 1XKZA 2Y2IA 1SKOB 1T1BA 2EXBA 1D1JA 4C3QA 1YSQA 5HDDA 1LT0A 1MPLA 1SDEA 3LR3A 1ALQA 2PU4A 3O87A 5CECA 4Q0HA 4JF5A 4Y17A 1YLZA 4E3IA 1TS7A 3E2KA 5CGXA 3VE3A 5A8BA 5HZHA 2VJWA 1S1YA 5IS1A 5HL6A 3V3RA 3KSFA 1OTIA 3MZFA 3WWXA 5CHUA 2D02A 3PAEA 4HEFA 1VQQA 4KUKA 4KQOA 5AVEA 1N9LA 3BEBA 5FDSA 2ZJ9A 3B33A 1Y4OA 3ZYTA 1LSWA 5EVEA 4Q0JA 1BULA 4S2PA 3LEQA 3T50A 1YMXA 3NBLA 4Y3IA 5TFQA 1ZG6A 3LICA 3S7OA 1CK3A 3HBRA 2VK3A 3DW0A 5EFWA 1JTDA 5J7EA 3FKVA 3IBRA 3CG5A 5GHXA 1CI8A 3QP4A 2PD7A 5HSQA 3FPVA 3C4OA 3HLCA 2EX9A 1P0ZA 3GR2A 4R70A 1RP5A 1RGZA 1TS8A 2ZC7A 4GKUA 4B93A 2GX5A 3ITBA 1W63M 5KZHA 3AGFA 4YINA 2WKPA 3H7WA 4I3AA 1EI5A 3HVFA 1P97A 1OT9A 2J9PA 5FEGA 5IT5A 2OV5A 4EU0A 4ZJ3A 5DTKA 5EE8A 5L8MA 1KGFA 2HDQA 5EVIC 3HL9A 5HFOA 1TD5A 3A0SA 3FZCA 2PBDP 3D4FA 1H3QA 1ONHA 2V8FA 2WADA 4S2JA 3UDXA 4LV3A 4EESA 2KOIA 2XROA 5FQIA 2WK0A 3MXSA 4M3KA 1XFNA 2IA2A 3ICYA 5DFXA 4EUZA 5KMWA 4LFUA 2JKGA 2M7VA 4QY5A 4NETA 1GHPA 1DP8A 3NULA 4LRYC 2PR6A 2ZC4B 2HGVA 3ZCZA 1BLHA 2ZC3B 4Y13A 3GECA 4DE0A 4HOIA 2ZQDA 3WS5A 2O9CA 4ZBEA 1FOFA 5GHZA 2Y2NA 2Z2LB 1STZA 5EPHA 1IYOA 4RVAA 4LV1A 1L0GA 2INWA 4CLCA 1C3BA 1W63Q 4N1XA 3O5YA 3HLDA 2ZD8A 2EX8A 3MBZA 3BFFA 5HWTA 2VGLS 2ZQ9A 2Y2KA 2Z2MB 3OPPA 4LGWA 5JYOA 2AVXA 1OJ5A 4S2LA 4MLLA 3G34A 4XT2B 5F1GA 2RCXA 4X25A 5C5KA 2Q0OA 1LL8A 2CMNA 3D72A 3WS4A 3MQOA 1N4OA 2FFFB 2VKSA 2ZC6B 2ZM0A 1DRMA 2J3WA 4OVDA 1JNUA 1VETA 1E3UA 3T1QB 2OLUA 5DF8A 2WAEA 4CQHA 1XA7A 3N8RA 2WGIA 1HZOA 5LBRA 1UWPX 3IXGA 4GZBA 5GLAA 3IS2A 1MC0A 4X6TA 5CEDA 4MN7A 2W0NA 4QU3A 3G32A 3WS2A 2ZL1A 4EBNA 5FEFA 2PBYA 3FV7A 5FI6A 4WZ5C 1NLYA 1CEFA 1PW8A 2EX2A 4KQQA 4OP5A 5HPFA 3IWQA 4S2KA 5DJUA 1GCEA 5EOEA 5GHYA 1TVFA 4MDZA 3A3FA 3IF6B 2MJ6A 3K3DA 4WMCD 1QMFA 3SH9A 2WGWA 4OPRA 2WKIA 1OJGA 1FCMA 5CHJA 4JXWA 1LL5A 2Y2OA 3QP6A 2HP6A 4KG5A 3ZFZA 3GV9A 1LI9A 3O86A 1FILA 4I3JA 2H5SA 4NKPA 3SS3A 4K0WA 2W3EA 4MCWA 4NG2A 4Y5FA 5A90A 4QJGA 4EWFA 5JYPA 4UAAA 3RH8B 4PKYG 1T19A 2H0TA 4IUKA 3UPOA 4Y15A 3G30A 1D7EA 3S7QA 1VEUA 3C8CA 2GDNA 4FD8A 2PYPA 3HUMA 5I94A 3DBAA 2V1BA 4R1GA 3QP1A 2ZQ7A 1KGEA 4HJ3A 1YLYA 4E3MA 4IBRA 3G6OA 3IH9A 1TF1A 4XXRA 2JKTM 4BBVA 1LHYA 3M6HA 2VV8A 4HESA 1OMEA 1XJ3A 2VX8A 3BQAA 2P04A 4X1MA 4S2NC 1TS6A 4O7DA 3BY9A 4MBFA 4R0QA 4DF6A 5CGSA 1XGIA 1XJ6A 1KGGA 3A3IA 5DFYA 1BLSA 3TJZC 1YT4A 2P9VA 2L0WA 4EQIA 1T18A 3NECA 2XSSA 2WKEA 3ISGA 3A3JA 3V39A 1NXYA 5FQ9A 4DDSA 3PBRA 4XUXA 3RFBA 2IWBA 4QD4A 3HLEA 3BQ8A 3EWKA 3DTMA 2J80A 2C5WB 1ZTUA 1FR1A 3LO7A 2XGNA 4XUZA 4KUOA 5DKKA 3UB6A 3W4PA 4OONA 3HCYA 2E8JA 4HI4A 4MBHA 3H7WB 2QHKA 2IWCA 1RCJA 4HP9A 2JE5A 3JYIA 4CJNA 5HW3A 4LRXC 3RTYA 4R23A 3PR6A 4OQGA 1H8ZA 4OKPA 3RJUA 3BFGA 2V9AA 2A3UA 4KZAA 1SCWA 3T1RA 1K6RA 3UPPA 1TDLA 4GHIA 4KZ4A 2H28A 5HDCA 1S4SA 3LR0A 1T1CA 1DP9A 2XF3A 5DTSA 4O0PA 4WMCA 4UA9A 2NUPC 2O9BA 4UA6A 4IJGA 2ZMVA 1AXBA 1BLCA 4HY8A 2ZOIA 4JXGA 4PM8A 2KX6A 3PBOA 4KZ9A 3DWZA 1FQGA 1P9WA 3A0RA 3H82A 3VP2A 1ZG4A 1K57A 2XFSA 1PWCA 3VOLA 4Y0OA 3S22A 1RGYA 3OCNA 3NDEA 4P87A 1Q2PA 4CLCD 4ZAMA 1GHIA 5HL1A 1PI5A 4IVKA 3LGOA 1SHVA 4CLCB 3CITA 1Z09A 1M40A 3LIFA 4FTXA 2KDKA 5DF7A 4RA7A 2V2FF 1L0FA 2XFTA 3G2YA 2OWJA 3UE3A 3A3DA 1G6AA 5J4EA 3B47A 5HAQA 5DKLA 3C2WA 2HJEA 4GNUA 4DJ3A 4MMNA 3HREA 1VM1A 4E04A 4OPYA 3AGEA 4PM7A 1A0KA 2W3DA 5GL9A 4I3IA 4ARZA 5K5BA 1N9OA 3P7NA 1TS0A 2YKHA 4L9GA 2WZZA 4BD0A 3QHYA 4OPQA 3LR4A 3E4OA 1BUEA 3C4PA 2W3HA 2I9VA 5FDHA 1MWUA 3GMWA 1E3UD 4UEYA 4JGOA 1VETB 2D01A 3N6IA 3UE6A 2WKRA 4Q8IA 2P08A 1I2SA 4S2MA 3PBQA 5FQMA 4S2IA 3TOIA 3IS2B 1KE4A 1IKIA 3MXQA 1JWVA 2ZL1B 1GHMA 3F1OA 4BD1A 3VSKA 3LY4A 2FH5A 1KVMA 1K6SA 3GRJA 4EV4A 1G68A 2Y4AA 4KG6A 4R3JA 1Y28A 3DTIA 2KLIA 4KZ8A 5FQKA 3UPNA 2WGVA 1DY6A 3DTEA 4Z9QA 4N92A 2K7SA 5I5LA 2WGWB 4KZ3A 2I72A 2Y2LA 1VB6A 5E43A 1MBLA 1YSPA 5GLDA 4KQRA 1DP6A 4HJ6A 3VFHA 3GVBA 3MF0A 1YLPA 3FYZA 4E3OA 4MEZA 4OLDA 1FR6A 2QJ5A 1KE0A 1WYCA 5L10A 4UQIS 4P6BA 3A0VA 1ES4A 1ODVA 3QP8A 5AVFA 3TW8A 3SOIA 3PTEA 3F1NA 3BW6A 5E2GA 2V0WA 2BASA 3M6BA 2PD8A 3UMDA 3N8SA 4YFMA 1TDGA 4P6ZM 1PIOA 3OCLA 3ITAA 4NEED 3CMZA 3HLBA 5L07A 3E2LA 3PXPA 3BY8A 1IOUA 1L2SA 4P0MA 1W7FA 1NRFA 1VEUB 3IBJA 2C6WB 1ERQA 1MKMA 1S4RA 5FA7A 4BL3A 1MXOA 2W1TA 1IELA 3Q7VA 4Y7PA 3NDGA 1D06A 3ZGAB 1NZOA 4X53A 4B88A 2ZMFA 5M1AA 3CZDA 3FWLA 1U60A 1S0WA 4JBFA 4E3NA 3LI8A 4E3JA 3P01A 4DE3A 3ZHHA 1OTEA 1S67L 3H9WA 1IEMA 2J3TD 5G4ZA 2ZMAA 4BMWA 4X1LA 3MQQA 4I5SA 1NJ4A 4HH2A 2WKHA 2HF6A 2YKFA 2XRNA 3VP4A 4PPRA 2X02A 1K56A 1XJ2A 2XA7M 1DJCA 1JTGA 2JCHA 3O3VA 4E3LA 1KVLA 4O8GA 3RXWA 4Q0IA 5F69A 2Z6CA 3W8KA 2ZQ8A 1J3WA 2P9VB 2QPNA 4R4SA 2WUQA 4EW7A 4JF6A 3IF6C 3ZVTA 2A2LA 2XR0A 3R4KA 3IX3A 1SZVA 1OTDA 5U47A 3IF5A 2Z6DA 2G2WA 1P9RA 3HUOA 1LLBA 2DNSA 1K55A 5HAIA 4JKTA 2Y2PA 3S7NA 2A24A 3PAGA 2PDRA 2ZM8A 4N9LA 1J9MA 4DDYA 5AQ9A 3E0YA 4II7A 2B02A 3ZG9B 2OAP1 3D3OA 5KIZA 3OPHA 4JXSA 3V67A 3U4LP 5F5YA 3T4TA 3BLMA 1YMSA 4NXEA 1K0KA 3VE4A 1H8MA 3VOZA 1K57C 1G6OA 1ES2A 3NJAA 1XA1A 4PM5A 1WA9A 4FH4A 4BENA 1K38A 2LB5A 4MNRA 3F1PA 1ZKJA 5HDSA 4FUWA 2HDUA 1IYPA 5HWWA 3Q07A 4YOFA 4Y0TA 3T4OA 5F82A 4WLAA 4GN2A 4U0TA 1NWZA 2WZXA 4GHIB 4KG2A 3Q1FA 4D60A 4Y2FA 4ZJ1A 2ZOHA 2O99A 4X55A 2JKRI 2W1RA 2ZBBA 2XEPA 3NHQA 4RYEA 1PI4A 4GD6A 1LSXA 4QB8A 3OOVA 3UB7A 2PAVP 3NI9A 1PYYA 5FI2A 3EEHA 3UE0A 3KSIA 4ZDXA 2O0YA 1N9BA 4PAUA 3C30A 1OPXA 3H82B 1XXMA 2DCFA 4ETXA 3GQZA 2GZAA 2H0YA 1HTZA 5DTTA 2EXAA 5FAPA 1K54A 3MXRA 4OH0A 4MN6A 1O7EA 2B5RA 3VMAA 2XH9A 4OP8A 4RX2A 2K2NA 1XP4A 2HZ5A 3WRTA 3NC8A 2Y2JA 2HPBA 3BWLA 3IWIA 2Y59A 3W4QA 5GLCA 1GA9A 3P09A 2HJ9C 4WYYA 4F3LA 1F9IA 3TG9A 2JKTI 3VFFA 1CJFA 3BJNA 4PHTA 3CLOA 1XFQA 3NY4A 4ARZB 5HD5A 1HD8A 1ESUA 2UWXA 2WYXA 1PW1A 2GJ3A 3BYDA 1PRQA 2WAFA 3NCKA 2QWSA 2EFXA 3D9YA 4U0XA 4EERA 2VV6A 1L0EA 1E4DA 5CERA 4FOFA 4JGRA 1IFQA 2H10A 1NYMA 2RL3A 3DTKA 3F1OB 3WS1A 4ZRRA 5FQJA 4LLOB 4CPKA 3LIEA 5CTMA 1LSVA 1IYQA 4GLQA 3IX4A 5EVIA 1GA0A 4QHCA 2G7UA 1S1ZA 4GJ4A 1K4FA 1K4EA 4DXBA 4HH3A 1BT5A 3MMHA 3EEAA 5EECA 3P98A 1F98A 1JWZA 4U3TA 2VLGA 3KYZA 3BRMA 2Y2HA 3ZDJA 1L0DA 1S6RA 4RQ9A 3C5AA 3NOPC 3BLSA 3ZQ5A 3CWFA 4IVIA 4R38A 2NUTC 3F1NB 3IHBA 1MWRA 3T4LA 5FAOA 3OC2A 2VGLM 1XJ4A 2Q9NA 4CLCC 3N7WA 4DXCA 1DJAA 3WS0A 3FPWA 2P7JA 2ZQAA 4ZTKA 3T4SA 4BWIA 5MC7A 3GDIA 3PYPA 3B42A 1MWTA 1S66L 2VA0A 3ZNTA 4A5RA 4WN5A 3SW1A 2W1TB 1W5DA 2HP9A 3L7HA 3Q7VB 3WRZA 4GB7A 4JXVA 3VP0A 2OSUA 2QMIA 1BTLA 4EETB 1F5MA 1X0OA 4K0XA 5DF9A 5CHMA 3I7JA 1V9ZA 3E4QA 1PWDA 5A92A 5A93A 3ULFA 3MJQA 2ACGA 4IUHA 1CQAA 1GSVA 2W3FA 2HP5A 2G2UA 4BBUA 4OOYA 3VV4A 1K56D 3UO9A 5M19A 1LI0A 5HPIA 1BZAA 5CGWA 4Y0UA 4OQHA 3MR0A 2XK1A 1NY0A 1BSGA 3HJKA 2B18A 2R9XA 3U2AA 4WZ5A 5M18A 2J8YA 4HHDA 1Q2QA 2R78A 1FIKA 1Y54A 1XGJA 4GS9A 5F68A 1FSWA 4HIAA 3QNCA 3KSGA 5F1FA 3FC7A 1FSYA 4YNRA 2OOLA 3CPTA 3Q82A 3T4JA 1YKDA 3E98A 2A24B 4LPZA 3IH8A 4EBPA 3Q81A 3NOTC 2XD5A 5AQBA 2X71A 4PMAA 3ZG0A 3N4IA 3IHAA 3IWOA 3CUEA 5IHVA 4KZBA 4N9KA 1ZC2A 3QP2A 4WF0A 2VGJA 4JLFA 4WEKA 3JVUA 3F1PB 1MKIA 1K54C 3OZHA 5EOOA 3E4PA 3VP3A 4OOMA 4LCLA 4IBXA
chains in the Genus database with same CATH topology
2QJ7A 4DMZA 4IUKA 4JGQA 5DJTA 4M4XA 3LIAA 3R7WA 1D7EA 1MZUA 3S7QA 4EEUA 4EW7A 3C8CA 2VZWA 4G3VA 2PYPA 2XA7S 4G3WA 3CAXA 3T4KA 2A2LA 4R6LA 2W3GA 3R4KA 4HQAA 3DBAA 5F6AA 2V1BA 2EWVA 4EEPA 1V9YA 3S7PA 4R3AA 4HJ3A 4BBTA 1OTDA 2Z6DA 1P9RA 3UB9A 2OAQ1 3G6OA 1TF1A 3S7NA 2A24A 3UMEA 5KSHA 2L4RA 4ME4A 2JKTM 2PDRA 4BBVA 3OBFA 4I39A 2VV8A 3E0YA 4II7A 2B02A 1BYWA 2OAP1 3D3OA 4B9OA 5KIZA 3V67A 4WEJA 4K08A 2EWWA 5F5YA 2JHEA 3CI6A 1XJ3A 2VX8A 3T4TA 2J3TC 2VEAA 4NXEA 5TBMB 3BQAA 1OTAA 4L9FA 3VE4A 2P04A 1H8MA 1G6OA 1TS6A 2PT7A 3BY9A 5HWVA 3NJAA 1WA9A 3NOUC 2JN7A 4QPRA 3K2NA 2LB5A 3F1PA 4H6JB 4NXBA 4MN5A 5HDSA 3MFXA 3PBTA 5HWWA 1XJ6A 4YOFA 3K3CA 5CX7A 3T4OA 4DN0A 4WLAA 4BJPA 2V1AA 5DFYA 1NWZA 4GHIB 3TJZC 2L0WA 1T18A 4O01A 4Y2FA 2XSSA 3LFVA 4OOLA 3PBSA 2ZOHA 2O99A 1T1BA 4F3LB 2JKRI 2W1RA 2ZBBA 3NHQA 3LIBA 1YSQA 5HDDA 1LSXA 3PBRA 4NXFA 1LT0A 3OOVA 3LR3A 3RFBA 2PHYA 1UWNX 3FG8A 4Q0HA 3UB7A 1TS7A 3BQ8A 2QYBA 3EEHA 3EWKA 3KSIA 3VE3A 2O0YA 2J80A 2PR5A 5A8BA 5HZHA 2VJWA 3C30A 1S1YA 1ZTUA 1OPXA 4PAUA 5IS1A 5HL6A 3H82B 3KSFA 1OTIA 4KUOA 5DKKA 3UB6A 4PKYA 3HCYA 4HI4A 1G28A 5TBMA 4ETXA 2D02A 3H7WB 2GZAA 2QHKA 1EW0A 4KUKA 4HP9A 4KQOA 5AVEA 4LRXC 1N9LA 3RTYA 3B33A 3PR6A 4ETZA 3ZYTA 4H6JA 4MN6A 1LSWA 4Q0JA 2V0UA 2K2NA 2V9AA 3T50A 4Y3IA 3LICA 3S7OA 4DJ2A 3BWLA 3EOIA 5HD3A 4GHIA 2FZ0A 5EFWA 2H28A 5HDCA 1S4SA 3LR0A 1N9NA 5J7EA 1T1CA 3IBRA 1DP9A 2HJ9C 4F3LA 1F9IA 4O0PA 2JKTI 2NUPC 3EQUA 2PD7A 4I38A 5HSQA 3FPVA 3PHYA 2O9BA 3BJNA 2Y79A 4WELA 4PHTA 1P0ZA 4R70A 3CLOA 4IJGA 1XFQA 2ZMVA 4ARZB 2PYRA 3KSHA 5HD5A 4HY8A 1TS8A 2ZOIA 2GJ3A 1OTBA 2KX6A 3PBOA 4AFIA 4B93A 4WUJA 3KX0X 1GSWA 2GX5A 1W63M 3JVVA 1P9WA 2QWSA 3A0RA 3H82A 4EERA 4WL9A 2VV6A 4FOFA 2WKPA 1IFQA 3H7WA 4I3AA 4JGRA 4NXGA 2K31A 3VOLA 4KQDA 5G4YA 2HV1A 1P97A 3OCNA 1OT9A 5IT5A 4CLCD 4EU0A 3F1OB 1KOUA 4LRZE 4CLCB 3CITA 3LIFA 4ZRRA 4LLOB 3PBNA 5L8MA 3LIEA 4HNBA 1LSVA 2KDKA 4GLQA 4YWZA 5IU1A 3UE3A 2OWJA 3KO6A 1TD5A 4HP4A 3A0SA 2G7UA 1OT6A 1S1ZA 1H3QA 3B47A 3LUQA 5J4EA 4G3KA 5DKLA 3C2WA 1VHMA 2HJEA 4GJ4A 4DJ3A 4MMNA 4E04A 4HH3A 3C38A 3MMHA 3EEAA 4HJ4A 2W3DA 1F98A 4I3IA 4EESA 2KOIA 4ARZA 1N9OA 3P7NA 1TS0A 2VLGA 2YKHA 3LIDA 5K5BA 4L9GA 1T1AA 3KYZA 2XROA 1XFNA 1GSXA 2IA2A 2JKRM 3ICYA 5DFXA 3LR4A 3E4OA 2M7VA 2EA9A 3EGDC 4RQ9A 3NOPC 2W3HA 2I9VA 3ZQ5A 3CUEC 1DP8A 4LRYC 1YAXA 2PR6A 3CWFA 2HGVA 4UEYA 2QKPA 4JGOA 3EQVA 2D01A 4R38A 2NUTC 3F1NB 3UE6A 3GECA 2WKRA 3LI9A 2P08A 4JGPA 4HOIA 3T4LA 3PBQA 2M7UA 2O9CA 3OC2A 2VGLM 3IS2B 1NLZA 1XJ4A 3MXQA 1STZA 4CLCC 3MQ0A 3F1OA 2INWA 4IHQA 4CLCA 1W63Q 2DMWA 2FH5A 3FPWA 3O5YA 2L1MA 2P7JA 3TRCA 3T4SA 4BWIA 5MC7A 3GDIA 3PYPA 3B42A 1Y28A 2VGLS 5HWTA 1S66L 2VA0A 4WN5A 3SW1A 4GS9B 2KLIA 2W1TB 1OJ5A 4XT2B 2K7SA 5I5LA 4UQIM 2O9AA 1VB6A 5C5KA 4EETB 1F5MA 1YSPA 3W2ZA 1LL8A 1X0OA 5DF9A 1DP6A 1V9ZA 3E4QA 4HJ6A 2CMNA 3D72A 3MQOA 1ZHHB 3ULFA 3MJQA 4IUHA 3MF0A 1GSVA 2VKSA 2W3FA 2VV7A 4BBUA 1DRMA 2J3WA 2QJ5A 3VV4A 4Z1WA 2M1CA 4UQIS 4FSFA 3A0VA 1ODVA 2LB9A 3OLOA 5AVFA 1JNUA 5AJGA 3TW8A 3F1NA 4CQHA 3BW6A 3KYQA 5HPIA 2V0WA 2BASA 2PD8A 2WKQA 3UMDA 1UGUA 1NRJA 4P6ZM 5LBRA 1UWPX 3OCLA 3IS2A 2W27A 1MC0A 3MR0A 4NEED 2OWHA 4MN7A 2W0NA 3LR5A 3HJKA 3PXPA 5TJJA 3BY8A 1IOUA 1NLYA 2B18A 3LYXA 3U2AA 3R7WB 5HPFA 5DJUA 3UB8A 3IBJA 4HHDA 4L9EA 2R78A 4P6ZS 1MKMA 4MDZA 1S4RA 4GS9A 5F68A 2MJ6A 2W1TA 3K3DA 4EXOA 4HIAA 4EUVA 3KSGA 1D06A 3FC7A 3HJIA 5J3WA 4XT2A 4YNRA 2OOLA 2ZMFA 3T4JA 1YKDA 3E98A 2A24B 4EQ1A 3T4QA 4LPZA 1OJGA 3NOTC 3LI8A 3P01A 4CLCE 3CUEA 1OTEA 1S67L 4I3JA 4NKPA 3H9WA 2J3TD 5G4ZA 2W3EA 4L0LA 4BMWA 3EGXC 3MQQA 2Y8HA 4MCWA 4I5SA 4WF0A 4HH2A 4GW9A 2HF6A 2GNXA 2XRNA 2YKFA 4Y5FA 4WEKA 1XJ2A 3JVUA 3TE8A 3F1PB 5FL3A 2XA7M 3E4PA 3RH8B 4O8GA 4OOMA 4Q0IA 5F69A 4PKYG 2Z6CA 1T19A 4GCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJ7 A;  4JGQ A;  5DJT A;  4M4X A;  3LIA A;  1D7E A;  1MZU A;  4EEU A;  4EW7 A;  3C8C A;  2PYP A;  3CAX A;  4R6L A;  4HQA A;  5F6A A;  2V1B A;  4EEP A;  1V9Y A;  4R3A A;  4HJ3 A;  4BBT A;  1OTD A;  2Z6D A;  3UB9 A;  3G6O A;  2A24 A;  3UME A;  2L4R A;  2PDR A;  4BBV A;  4I39 A;  2VV8 A;  2B02 A;  1BYW A;  5KIZ A;  4B9O A;  4K08 A;  5F5Y A;  2JHE A;  1XJ3 A;  2VEA A;  4NXE A;  5TBM B;  1OTA A;  4L9F A;  3VE4 A;  1TS6 A;  3BY9 A;  5HWV A;  3NJA A;  1WA9 A;  3NOU C;  2JN7 A;  3F1P A;  4H6J B;  4NXB A;  4MN5 A;  5HDS A;  3MFX A;  5HWW A;  1XJ6 A;  3K3C A;  4WLA A;  2V1A A;  1NWZ A;  4GHI B;  2L0W A;  1T18 A;  2ZOH A;  1T1B A;  4F3L B;  2ZBB A;  3NHQ A;  3LIB A;  5HDD A;  1LSX A;  4NXF A;  1LT0 A;  2PHY A;  1UWN X;  3FG8 A;  3UB7 A;  1TS7 A;  3EEH A;  3EWK A;  3VE3 A;  2J80 A;  2PR5 A;  5A8B A;  5HZH A;  1S1Y A;  5IS1 A;  3H82 B;  1OTI A;  4KUO A;  5DKK A;  3UB6 A;  4PKY A;  4HI4 A;  1G28 A;  5TBM A;  2D02 A;  3H7W B;  2QHK A;  1EW0 A;  4KUK A;  4HP9 A;  5AVE A;  4LRX C;  1N9L A;  3RTY A;  3B33 A;  4H6J A;  4MN6 A;  1LSW A;  2V0U A;  2V9A A;  3T50 A;  3LIC A;  4DJ2 A;  3BWL A;  5HD3 A;  4GHI A;  5EFW A;  2H28 A;  5HDC A;  1S4S A;  1N9N A;  5J7E A;  1T1C A;  3IBR A;  1DP9 A;  4F3L A;  1F9I A;  4I38 A;  2PD7 A;  5HSQ A;  3PHY A;  1P0Z A;  4R70 A;  3CLO A;  1XFQ A;  2PYR A;  5HD5 A;  4HY8 A;  1TS8 A;  2ZOI A;  2GJ3 A;  1OTB A;  2KX6 A;  4WUJ A;  3KX0 X;  1GSW A;  2QWS A;  3A0R A;  3H82 A;  4EER A;  4WL9 A;  2VV6 A;  4JGR A;  2WKP A;  3H7W A;  4I3A A;  4NXG A;  3VOL A;  4KQD A;  5G4Y A;  2HV1 A;  1P97 A;  1OT9 A;  3F1O B;  1KOU A;  4LRZ E;  3LIF A;  4LLO B;  3LIE A;  4HNB A;  1LSV A;  2KDK A;  4YWZ A;  5IU1 A;  2OWJ A;  4HP4 A;  3A0S A;  1OT6 A;  1S1Z A;  5J4E A;  3LUQ A;  5DKL A;  3C2W A;  4DJ3 A;  4E04 A;  4HH3 A;  4HJ4 A;  1F98 A;  4I3I A;  4EES A;  1N9O A;  3P7N A;  1TS0 A;  2VLG A;  2YKH A;  3LID A;  4L9G A;  1T1A A;  1XFN A;  1GSX A;  3ICY A;  3E4O A;  2EA9 A;  4RQ9 A;  3NOP C;  3ZQ5 A;  2I9V A;  1DP8 A;  4LRY C;  2PR6 A;  3CWF A;  2QKP A;  4JGO A;  2D01 A;  4R38 A;  3F1N B;  3UE6 A;  3GEC A;  2WKR A;  3LI9 A;  4JGP A;  4HOI A;  3IS2 B;  1XJ4 A;  3MXQ A;  3F1O A;  2INW A;  2L1M A;  2P7J A;  3GDI A;  3PYP A;  1Y28 A;  5HWT A;  1S66 L;  4WN5 A;  3SW1 A;  4GS9 B;  1OJ5 A;  4XT2 B;  2K7S A;  5I5L A;  1VB6 A;  4EET B;  1LL8 A;  1X0O A;  1DP6 A;  1V9Z A;  4HJ6 A;  3E4Q A;  2CMN A;  3D72 A;  3MQO A;  3ULF A;  3MJQ A;  1GSV A;  2VV7 A;  4BBU A;  1DRM A;  2QJ5 A;  2M1C A;  3A0V A;  1ODV A;  3OLO A;  5AVF A;  1JNU A;  3F1N A;  2V0W A;  2BAS A;  2PD8 A;  2WKQ A;  3UMD A;  1UGU A;  1UWP X;  3IS2 A;  2W27 A;  3MR0 A;  2OWH A;  2W0N A;  3HJK A;  3BY8 A;  3LYX A;  5DJU A;  3UB8 A;  4HHD A;  4L9E A;  2R78 A;  1S4R A;  4GS9 A;  5F68 A;  3K3D A;  4EXO A;  4HIA A;  1D06 A;  3FC7 A;  3HJI A;  5J3W A;  4XT2 A;  2OOL A;  2A24 B;  4EQ1 A;  4LPZ A;  1OJG A;  3NOT C;  3LI8 A;  1OTE A;  1S67 L;  4I3J A;  3H9W A;  5G4Z A;  3MQQ A;  4I5S A;  4WF0 A;  4HH2 A;  4GW9 A;  2YKF A;  1XJ2 A;  3F1P B;  3E4P A;  3RH8 B;  5F69 A;  4PKY G;  2Z6C A;  1T19 A;  4GCZ A; 
#chains in the Genus database with same CATH topology
 2QJ7 A;  4JGQ A;  5DJT A;  5J8X A;  1PZP A;  4LCM A;  4H8R A;  5E2H A;  4NK3 A;  3R7W A;  1I2W A;  3G2Z A;  4EEU A;  3LCE A;  4G3V A;  2BTF P;  2HDS A;  2W3G A;  2Y55 A;  4HQA A;  5F6A A;  1V9Y A;  3S7P A;  3B3X A;  4OQ0 A;  2EX6 A;  4BBT A;  3G31 A;  5DVA A;  1KE3 A;  3UB9 A;  2A49 A;  1IKG A;  3UME A;  5KSH A;  2L4R A;  3V5M A;  3OBF A;  1ESI A;  1JWP A;  3CJM A;  3HLG A;  4I39 A;  5E2F A;  4WM9 A;  4OQI A;  4B9O A;  1E25 A;  1NZU A;  1YLT A;  2JHE A;  3CI6 A;  2J3T C;  2B95 A;  1OTA A;  4L9F A;  1G5U A;  2PT7 A;  5HWV A;  5HAP A;  4S2N A;  5EM0 A;  3BFD A;  1CEG A;  3NOU C;  1SKF A;  2JN7 A;  3QNB A;  5FAT A;  3K2N A;  1QME A;  1H0M A;  2Y2Q A;  3MFX A;  4GD8 A;  4S2O A;  4E6W A;  3UN7 A;  4KZ6 A;  5CX7 A;  4DN0 A;  4DE2 A;  4X69 A;  1FCO A;  4O01 A;  3LFV A;  3ZG7 B;  4OOL A;  3PBS A;  3Q7Z A;  4F3L B;  3M2K A;  1TEM A;  3SH7 A;  3LIB A;  2JC7 A;  2P74 A;  4NXF A;  2PHY A;  1UWN X;  3FG8 A;  2QYB A;  2BLS A;  3V50 A;  4C75 A;  2EFU A;  2PR5 A;  1AWI A;  2Y91 A;  2CC1 A;  5AQ7 A;  4LEN A;  2V1Z A;  1DJB A;  1ONG A;  3IX8 A;  4PKY A;  1YQS A;  5FQQ A;  4KEN B;  1G28 A;  4KZ7 A;  5TBM A;  3UNW A;  3MS6 A;  1WYB A;  1EW0 A;  3UDI A;  3CHW P;  1YLJ A;  4ETZ A;  4UHU A;  3UE1 A;  4H6J A;  3ZG5 A;  2V0U A;  3L9K A;  4DRT A;  5EVI D;  4DJ2 A;  3ZNY A;  3EOI A;  3MKF A;  5HD3 A;  5EVI B;  4DKI A;  2FZ0 A;  1HVB A;  1I5Q A;  5KSC A;  1N9N A;  3SS5 A;  4RX3 A;  1SKO A;  1K25 A;  1EWZ A;  3EQU A;  4I38 A;  5TR7 A;  5FAS A;  3PHY A;  2Y79 A;  4WEL A;  3S1Y A;  4PM6 A;  2PYR A;  1BLP A;  3KSH A;  1HLU P;  4E6X A;  1OTB A;  3G35 A;  4AFI A;  1W8Q A;  1CF0 A;  3RXX A;  4WUJ A;  3KX0 X;  2BG1 A;  1GSW A;  1Z6F A;  3JVV A;  3HUN A;  3T1S A;  4WL9 A;  4ID4 A;  3O88 A;  1F2K A;  4E3K A;  4NXG A;  3IQA A;  3LY3 A;  2K31 A;  2ZM2 A;  5CEB A;  4KZ5 A;  4KQD A;  5G4Y A;  2HV1 A;  4X68 A;  5EVL A;  4JF4 A;  2Y2M A;  2Y2G A;  4F94 A;  1KOU A;  4LRZ E;  4IED A;  4GDN A;  1IYS A;  5EV0 A;  1FCN A;  3PBN A;  5CRF A;  4HNB A;  4YWZ A;  5IU1 A;  3KO6 A;  5EM1 A;  4OPZ A;  4HP4 A;  3S4X A;  3DAV A;  1OT6 A;  3LUQ A;  4G3K A;  3SH8 A;  1VHM A;  3IT9 A;  4QWO A;  3T1X A;  2JKF A;  2J9O A;  3C38 A;  4HJ4 A;  5G18 A;  3T12 B;  4GDB A;  1PZO A;  3LID A;  1T1A A;  4BLM A;  1GSX A;  2JKR M;  3UB5 P;  3NIA A;  4B4Z A;  1XX2 A;  5E2E A;  2EA9 A;  3EGD C;  4R4R A;  5BOH A;  4HBT A;  5D3O A;  2E8I A;  3CUE C;  5GLB A;  1YAX A;  4WZ4 A;  2QKP A;  3SS4 A;  3EQV A;  1KDS A;  3LI9 A;  4JGP A;  4R3B A;  2M7U A;  3MSH A;  1NLZ A;  3MQ0 A;  3HLW A;  1PNE A;  3C7U A;  4IHQ A;  2DMW A;  4OLG A;  1XPB A;  2L1M A;  3VOY A;  4ZJ2 A;  5FSR A;  3TRC A;  5CTN A;  3A3E A;  5TGF A;  2J7V A;  3SZT A;  4GS9 B;  5A91 A;  2OLV A;  5HAR A;  4WBG A;  3ZG8 B;  2X01 A;  2ZC5 B;  3CPT B;  4UQI M;  2O9A A;  3IXH A;  3W2Z A;  3MZD A;  2XQZ A;  3MFD A;  1ZHH B;  2VV7 A;  3BFE A;  3C7V A;  3TSG A;  2QZ6 A;  4Z1W A;  2M1C A;  1YPR A;  4FSF A;  2LB9 A;  3OLO A;  3OPR A;  5AJG A;  2Q9M A;  3KYQ A;  3M2J A;  2WKQ A;  1UGU A;  1CI9 A;  1NRJ A;  2VGK A;  2IWD A;  4LV2 A;  2W27 A;  4B4X A;  1O07 A;  1KDW A;  2OWH A;  3V3S A;  3HLF A;  3LR5 A;  5L09 A;  3VSL A;  5TJJ A;  3LYX A;  3QP5 A;  3R7W B;  3IXB A;  2DRW A;  4K91 A;  3UB8 A;  1PFL A;  4L9E A;  3MKE A;  4P6Z S;  1ES3 A;  5AQA A;  4ESP A;  4EXO A;  1LL9 A;  4EUV A;  2UV0 E;  4QY6 A;  3HJI A;  5J3W A;  4XT2 A;  3G4P A;  1MWS A;  5FAQ A;  1SDN A;  4BQM A;  4EQ1 A;  3T4Q A;  4FCF A;  3VP1 A;  3UDF A;  2ZLY A;  3BFC A;  1PWG A;  4C6Y A;  2HDR A;  3BM6 A;  4X56 A;  1ES5 A;  4CLC E;  3UY6 A;  2XLN A;  5EUA A;  4BL2 A;  4L0L A;  1ACF A;  3EGX C;  2Y8H A;  3N8L A;  4GW9 A;  5CXW A;  2GNX A;  2V8C A;  4D2O A;  5F83 A;  3GTC A;  3TE8 A;  3W4O A;  5FL3 A;  3FKW A;  1M6K A;  3MZE A;  1JVJ A;  2FFY A;  4PM9 A;  3DWK A;  3IXD A;  4GCZ A;  4DMZ A;  1NYY A;  4M4X A;  1YM1 A;  2V20 A;  3LIA A;  2PRF A;  1L3L A;  5L2F A;  1MZU A;  1H8Y A;  2VZW A;  2XA7 S;  4G3W A;  3CAX A;  3LEZ A;  3T4K A;  4R6L A;  3GSG A;  3IF6 A;  2EWV A;  2JBF A;  4EEP A;  1MY8 A;  4R3A A;  4UA7 A;  1K55 C;  5HX9 A;  4P85 A;  2XD1 A;  2OAQ 1;  1W79 A;  4FH2 A;  4JPM A;  4ME4 A;  1YLW A;  4DE1 A;  1BYW A;  3BEC A;  3JPU A;  2R9W A;  4GOG A;  3ZVW A;  4WEJ A;  4LV0 A;  4K08 A;  2EWW A;  1WE4 A;  4N1H A;  2VEA A;  5TBM B;  4HBU A;  1H5X A;  2PU2 A;  2ZQC A;  2XDM A;  3OPL A;  4QPR A;  4H6J B;  4NXB A;  4MN5 A;  1ERM A;  3KYE A;  3PBT A;  1W8Y A;  3K3C A;  4EBL A;  3AGD A;  4BJP A;  4MBK A;  2V1A A;  1ERO A;  5FI7 A;  1XKZ A;  2Y2I A;  1SKO B;  1T1B A;  2EXB A;  1D1J A;  4C3Q A;  1YSQ A;  5HDD A;  1LT0 A;  1MPL A;  1SDE A;  3LR3 A;  1ALQ A;  2PU4 A;  3O87 A;  5CEC A;  4Q0H A;  4JF5 A;  4Y17 A;  1YLZ A;  4E3I A;  1TS7 A;  3E2K A;  5CGX A;  3VE3 A;  5A8B A;  5HZH A;  2VJW A;  1S1Y A;  5IS1 A;  5HL6 A;  3V3R A;  3KSF A;  1OTI A;  3MZF A;  3WWX A;  5CHU A;  2D02 A;  3PAE A;  4HEF A;  1VQQ A;  4KUK A;  4KQO A;  5AVE A;  1N9L A;  3BEB A;  5FDS A;  2ZJ9 A;  3B33 A;  1Y4O A;  3ZYT A;  1LSW A;  5EVE A;  4Q0J A;  1BUL A;  4S2P A;  3LEQ A;  3T50 A;  1YMX A;  3NBL A;  4Y3I A;  5TFQ A;  1ZG6 A;  3LIC A;  3S7O A;  1CK3 A;  3HBR A;  2VK3 A;  3DW0 A;  5EFW A;  1JTD A;  5J7E A;  3FKV A;  3IBR A;  3CG5 A;  5GHX A;  1CI8 A;  3QP4 A;  2PD7 A;  5HSQ A;  3FPV A;  3C4O A;  3HLC A;  2EX9 A;  1P0Z A;  3GR2 A;  4R70 A;  1RP5 A;  1RGZ A;  1TS8 A;  2ZC7 A;  4GKU A;  4B93 A;  2GX5 A;  3ITB A;  1W63 M;  5KZH A;  3AGF A;  4YIN A;  2WKP A;  3H7W A;  4I3A A;  1EI5 A;  3HVF A;  1P97 A;  1OT9 A;  2J9P A;  5FEG A;  5IT5 A;  2OV5 A;  4EU0 A;  4ZJ3 A;  5DTK A;  5EE8 A;  5L8M A;  1KGF A;  2HDQ A;  5EVI C;  3HL9 A;  5HFO A;  1TD5 A;  3A0S A;  3FZC A;  2PBD P;  3D4F A;  1H3Q A;  1ONH A;  2V8F A;  2WAD A;  4S2J A;  3UDX A;  4LV3 A;  4EES A;  2KOI A;  2XRO A;  5FQI A;  2WK0 A;  3MXS A;  4M3K A;  1XFN A;  2IA2 A;  3ICY A;  5DFX A;  4EUZ A;  5KMW A;  4LFU A;  2JKG A;  2M7V A;  4QY5 A;  4NET A;  1GHP A;  1DP8 A;  3NUL A;  4LRY C;  2PR6 A;  2ZC4 B;  2HGV A;  3ZCZ A;  1BLH A;  2ZC3 B;  4Y13 A;  3GEC A;  4DE0 A;  4HOI A;  2ZQD A;  3WS5 A;  2O9C A;  4ZBE A;  1FOF A;  5GHZ A;  2Y2N A;  2Z2L B;  1STZ A;  5EPH A;  1IYO A;  4RVA A;  4LV1 A;  1L0G A;  2INW A;  4CLC A;  1C3B A;  1W63 Q;  4N1X A;  3O5Y A;  3HLD A;  2ZD8 A;  2EX8 A;  3MBZ A;  3BFF A;  5HWT A;  2VGL S;  2ZQ9 A;  2Y2K A;  2Z2M B;  3OPP A;  4LGW A;  5JYO A;  2AVX A;  1OJ5 A;  4S2L A;  4MLL A;  3G34 A;  4XT2 B;  5F1G A;  2RCX A;  4X25 A;  5C5K A;  2Q0O A;  1LL8 A;  2CMN A;  3D72 A;  3WS4 A;  3MQO A;  1N4O A;  2FFF B;  2VKS A;  2ZC6 B;  2ZM0 A;  1DRM A;  2J3W A;  4OVD A;  1JNU A;  1VET A;  1E3U A;  3T1Q B;  2OLU A;  5DF8 A;  2WAE A;  4CQH A;  1XA7 A;  3N8R A;  2WGI A;  1HZO A;  5LBR A;  1UWP X;  3IXG A;  4GZB A;  5GLA A;  3IS2 A;  1MC0 A;  4X6T A;  5CED A;  4MN7 A;  2W0N A;  4QU3 A;  3G32 A;  3WS2 A;  2ZL1 A;  4EBN A;  5FEF A;  2PBY A;  3FV7 A;  5FI6 A;  4WZ5 C;  1NLY A;  1CEF A;  1PW8 A;  2EX2 A;  4KQQ A;  4OP5 A;  5HPF A;  3IWQ A;  4S2K A;  5DJU A;  1GCE A;  5EOE A;  5GHY A;  1TVF A;  4MDZ A;  3A3F A;  3IF6 B;  2MJ6 A;  3K3D A;  4WMC D;  1QMF A;  3SH9 A;  2WGW A;  4OPR A;  2WKI A;  1OJG A;  1FCM A;  5CHJ A;  4JXW A;  1LL5 A;  2Y2O A;  3QP6 A;  2HP6 A;  4KG5 A;  3ZFZ A;  3GV9 A;  1LI9 A;  3O86 A;  1FIL A;  4I3J A;  2H5S A;  4NKP A;  3SS3 A;  4K0W A;  2W3E A;  4MCW A;  4NG2 A;  4Y5F A;  5A90 A;  4QJG A;  4EWF A;  5JYP A;  4UAA A;  3RH8 B;  4PKY G;  1T19 A;  2H0T A;  4IUK A;  3UPO A;  4Y15 A;  3G30 A;  1D7E A;  3S7Q A;  1VEU A;  3C8C A;  2GDN A;  4FD8 A;  2PYP A;  3HUM A;  5I94 A;  3DBA A;  2V1B A;  4R1G A;  3QP1 A;  2ZQ7 A;  1KGE A;  4HJ3 A;  1YLY A;  4E3M A;  4IBR A;  3G6O A;  3IH9 A;  1TF1 A;  4XXR A;  2JKT M;  4BBV A;  1LHY A;  3M6H A;  2VV8 A;  4HES A;  1OME A;  1XJ3 A;  2VX8 A;  3BQA A;  2P04 A;  4X1M A;  4S2N C;  1TS6 A;  4O7D A;  3BY9 A;  4MBF A;  4R0Q A;  4DF6 A;  5CGS A;  1XGI A;  1XJ6 A;  1KGG A;  3A3I A;  5DFY A;  1BLS A;  3TJZ C;  1YT4 A;  2P9V A;  2L0W A;  4EQI A;  1T18 A;  3NEC A;  2XSS A;  2WKE A;  3ISG A;  3A3J A;  3V39 A;  1NXY A;  5FQ9 A;  4DDS A;  3PBR A;  4XUX A;  3RFB A;  2IWB A;  4QD4 A;  3HLE A;  3BQ8 A;  3EWK A;  3DTM A;  2J80 A;  2C5W B;  1ZTU A;  1FR1 A;  3LO7 A;  2XGN A;  4XUZ A;  4KUO A;  5DKK A;  3UB6 A;  3W4P A;  4OON A;  3HCY A;  2E8J A;  4HI4 A;  4MBH A;  3H7W B;  2QHK A;  2IWC A;  1RCJ A;  4HP9 A;  2JE5 A;  3JYI A;  4CJN A;  5HW3 A;  4LRX C;  3RTY A;  4R23 A;  3PR6 A;  4OQG A;  1H8Z A;  4OKP A;  3RJU A;  3BFG A;  2V9A A;  2A3U A;  4KZA A;  1SCW A;  3T1R A;  1K6R A;  3UPP A;  1TDL A;  4GHI A;  4KZ4 A;  2H28 A;  5HDC A;  1S4S A;  3LR0 A;  1T1C A;  1DP9 A;  2XF3 A;  5DTS A;  4O0P A;  4WMC A;  4UA9 A;  2NUP C;  2O9B A;  4UA6 A;  4IJG A;  2ZMV A;  1AXB A;  1BLC A;  4HY8 A;  2ZOI A;  4JXG A;  4PM8 A;  2KX6 A;  3PBO A;  4KZ9 A;  3DWZ A;  1FQG A;  1P9W A;  3A0R A;  3H82 A;  3VP2 A;  1ZG4 A;  1K57 A;  2XFS A;  1PWC A;  3VOL A;  4Y0O A;  3S22 A;  1RGY A;  3OCN A;  3NDE A;  4P87 A;  1Q2P A;  4CLC D;  4ZAM A;  1GHI A;  5HL1 A;  1PI5 A;  4IVK A;  3LGO A;  1SHV A;  4CLC B;  3CIT A;  1Z09 A;  1M40 A;  3LIF A;  4FTX A;  2KDK A;  5DF7 A;  4RA7 A;  2V2F F;  1L0F A;  2XFT A;  3G2Y A;  2OWJ A;  3UE3 A;  3A3D A;  1G6A A;  5J4E A;  3B47 A;  5HAQ A;  5DKL A;  3C2W A;  2HJE A;  4GNU A;  4DJ3 A;  4MMN A;  3HRE A;  1VM1 A;  4E04 A;  4OPY A;  3AGE A;  4PM7 A;  1A0K A;  2W3D A;  5GL9 A;  4I3I A;  4ARZ A;  5K5B A;  1N9O A;  3P7N A;  1TS0 A;  2YKH A;  4L9G A;  2WZZ A;  4BD0 A;  3QHY A;  4OPQ A;  3LR4 A;  3E4O A;  1BUE A;  3C4P A;  2W3H A;  2I9V A;  5FDH A;  1MWU A;  3GMW A;  1E3U D;  4UEY A;  4JGO A;  1VET B;  2D01 A;  3N6I A;  3UE6 A;  2WKR A;  4Q8I A;  2P08 A;  1I2S A;  4S2M A;  3PBQ A;  5FQM A;  4S2I A;  3TOI A;  3IS2 B;  1KE4 A;  1IKI A;  3MXQ A;  1JWV A;  2ZL1 B;  1GHM A;  3F1O A;  4BD1 A;  3VSK A;  3LY4 A;  2FH5 A;  1KVM A;  1K6S A;  3GRJ A;  4EV4 A;  1G68 A;  2Y4A A;  4KG6 A;  4R3J A;  1Y28 A;  3DTI A;  2KLI A;  4KZ8 A;  5FQK A;  3UPN A;  2WGV A;  1DY6 A;  3DTE A;  4Z9Q A;  4N92 A;  2K7S A;  5I5L A;  2WGW B;  4KZ3 A;  2I72 A;  2Y2L A;  1VB6 A;  5E43 A;  1MBL A;  1YSP A;  5GLD A;  4KQR A;  1DP6 A;  4HJ6 A;  3VFH A;  3GVB A;  3MF0 A;  1YLP A;  3FYZ A;  4E3O A;  4MEZ A;  4OLD A;  1FR6 A;  2QJ5 A;  1KE0 A;  1WYC A;  5L10 A;  4UQI S;  4P6B A;  3A0V A;  1ES4 A;  1ODV A;  3QP8 A;  5AVF A;  3TW8 A;  3SOI A;  3PTE A;  3F1N A;  3BW6 A;  5E2G A;  2V0W A;  2BAS A;  3M6B A;  2PD8 A;  3UMD A;  3N8S A;  4YFM A;  1TDG A;  4P6Z M;  1PIO A;  3OCL A;  3ITA A;  4NEE D;  3CMZ A;  3HLB A;  5L07 A;  3E2L A;  3PXP A;  3BY8 A;  1IOU A;  1L2S A;  4P0M A;  1W7F A;  1NRF A;  1VEU B;  3IBJ A;  2C6W B;  1ERQ A;  1MKM A;  1S4R A;  5FA7 A;  4BL3 A;  1MXO A;  2W1T A;  1IEL A;  3Q7V A;  4Y7P A;  3NDG A;  1D06 A;  3ZGA B;  1NZO A;  4X53 A;  4B88 A;  2ZMF A;  5M1A A;  3CZD A;  3FWL A;  1U60 A;  1S0W A;  4JBF A;  4E3N A;  3LI8 A;  4E3J A;  3P01 A;  4DE3 A;  3ZHH A;  1OTE A;  1S67 L;  3H9W A;  1IEM A;  2J3T D;  5G4Z A;  2ZMA A;  4BMW A;  4X1L A;  3MQQ A;  4I5S A;  1NJ4 A;  4HH2 A;  2WKH A;  2HF6 A;  2YKF A;  2XRN A;  3VP4 A;  4PPR A;  2X02 A;  1K56 A;  1XJ2 A;  2XA7 M;  1DJC A;  1JTG A;  2JCH A;  3O3V A;  4E3L A;  1KVL A;  4O8G A;  3RXW A;  4Q0I A;  5F69 A;  2Z6C A;  3W8K A;  2ZQ8 A;  1J3W A;  2P9V B;  2QPN A;  4R4S A;  2WUQ A;  4EW7 A;  4JF6 A;  3IF6 C;  3ZVT A;  2A2L A;  2XR0 A;  3R4K A;  3IX3 A;  1SZV A;  1OTD A;  5U47 A;  3IF5 A;  2Z6D A;  2G2W A;  1P9R A;  3HUO A;  1LLB A;  2DNS A;  1K55 A;  5HAI A;  4JKT A;  2Y2P A;  3S7N A;  2A24 A;  3PAG A;  2PDR A;  2ZM8 A;  4N9L A;  1J9M A;  4DDY A;  5AQ9 A;  3E0Y A;  4II7 A;  2B02 A;  3ZG9 B;  2OAP 1;  3D3O A;  5KIZ A;  3OPH A;  4JXS A;  3V67 A;  3U4L P;  5F5Y A;  3T4T A;  3BLM A;  1YMS A;  4NXE A;  1K0K A;  3VE4 A;  1H8M A;  3VOZ A;  1K57 C;  1G6O A;  1ES2 A;  3NJA A;  1XA1 A;  4PM5 A;  1WA9 A;  4FH4 A;  4BEN A;  1K38 A;  2LB5 A;  4MNR A;  3F1P A;  1ZKJ A;  5HDS A;  4FUW A;  2HDU A;  1IYP A;  5HWW A;  3Q07 A;  4YOF A;  4Y0T A;  3T4O A;  5F82 A;  4WLA A;  4GN2 A;  4U0T A;  1NWZ A;  2WZX A;  4GHI B;  4KG2 A;  3Q1F A;  4D60 A;  4Y2F A;  4ZJ1 A;  2ZOH A;  2O99 A;  4X55 A;  2JKR I;  2W1R A;  2ZBB A;  2XEP A;  3NHQ A;  4RYE A;  1PI4 A;  4GD6 A;  1LSX A;  4QB8 A;  3OOV A;  3UB7 A;  2PAV P;  3NI9 A;  1PYY A;  5FI2 A;  3EEH A;  3UE0 A;  3KSI A;  4ZDX A;  2O0Y A;  1N9B A;  4PAU A;  3C30 A;  1OPX A;  3H82 B;  1XXM A;  2DCF A;  4ETX A;  3GQZ A;  2GZA A;  2H0Y A;  1HTZ A;  5DTT A;  2EXA A;  5FAP A;  1K54 A;  3MXR A;  4OH0 A;  4MN6 A;  1O7E A;  2B5R A;  3VMA A;  2XH9 A;  4OP8 A;  4RX2 A;  2K2N A;  1XP4 A;  2HZ5 A;  3WRT A;  3NC8 A;  2Y2J A;  2HPB A;  3BWL A;  3IWI A;  2Y59 A;  3W4Q A;  5GLC A;  1GA9 A;  3P09 A;  2HJ9 C;  4WYY A;  4F3L A;  1F9I A;  3TG9 A;  2JKT I;  3VFF A;  1CJF A;  3BJN A;  4PHT A;  3CLO A;  1XFQ A;  3NY4 A;  4ARZ B;  5HD5 A;  1HD8 A;  1ESU A;  2UWX A;  2WYX A;  1PW1 A;  2GJ3 A;  3BYD A;  1PRQ A;  2WAF A;  3NCK A;  2QWS A;  2EFX A;  3D9Y A;  4U0X A;  4EER A;  2VV6 A;  1L0E A;  1E4D A;  5CER A;  4FOF A;  4JGR A;  1IFQ A;  2H10 A;  1NYM A;  2RL3 A;  3DTK A;  3F1O B;  3WS1 A;  4ZRR A;  5FQJ A;  4LLO B;  4CPK A;  3LIE A;  5CTM A;  1LSV A;  1IYQ A;  4GLQ A;  3IX4 A;  5EVI A;  1GA0 A;  4QHC A;  2G7U A;  1S1Z A;  4GJ4 A;  1K4F A;  1K4E A;  4DXB A;  4HH3 A;  1BT5 A;  3MMH A;  3EEA A;  5EEC A;  3P98 A;  1F98 A;  1JWZ A;  4U3T A;  2VLG A;  3KYZ A;  3BRM A;  2Y2H A;  3ZDJ A;  1L0D A;  1S6R A;  4RQ9 A;  3C5A A;  3NOP C;  3BLS A;  3ZQ5 A;  3CWF A;  4IVI A;  4R38 A;  2NUT C;  3F1N B;  3IHB A;  1MWR A;  3T4L A;  5FAO A;  3OC2 A;  2VGL M;  1XJ4 A;  2Q9N A;  4CLC C;  3N7W A;  4DXC A;  1DJA A;  3WS0 A;  3FPW A;  2P7J A;  2ZQA A;  4ZTK A;  3T4S A;  4BWI A;  5MC7 A;  3GDI A;  3PYP A;  3B42 A;  1MWT A;  1S66 L;  2VA0 A;  3ZNT A;  4A5R A;  4WN5 A;  3SW1 A;  2W1T B;  1W5D A;  2HP9 A;  3L7H A;  3Q7V B;  3WRZ A;  4GB7 A;  4JXV A;  3VP0 A;  2OSU A;  2QMI A;  1BTL A;  4EET B;  1F5M A;  1X0O A;  4K0X A;  5DF9 A;  5CHM A;  3I7J A;  1V9Z A;  3E4Q A;  1PWD A;  5A92 A;  5A93 A;  3ULF A;  3MJQ A;  2ACG A;  4IUH A;  1CQA A;  1GSV A;  2W3F A;  2HP5 A;  2G2U A;  4BBU A;  4OOY A;  3VV4 A;  1K56 D;  3UO9 A;  5M19 A;  1LI0 A;  5HPI A;  1BZA A;  5CGW A;  4Y0U A;  4OQH A;  3MR0 A;  2XK1 A;  1NY0 A;  1BSG A;  3HJK A;  2B18 A;  2R9X A;  3U2A A;  4WZ5 A;  5M18 A;  2J8Y A;  4HHD A;  1Q2Q A;  2R78 A;  1FIK A;  1Y54 A;  1XGJ A;  4GS9 A;  5F68 A;  1FSW A;  4HIA A;  3QNC A;  3KSG A;  5F1F A;  3FC7 A;  1FSY A;  4YNR A;  2OOL A;  3CPT A;  3Q82 A;  3T4J A;  1YKD A;  3E98 A;  2A24 B;  4LPZ A;  3IH8 A;  4EBP A;  3Q81 A;  3NOT C;  2XD5 A;  5AQB A;  2X71 A;  4PMA A;  3ZG0 A;  3N4I A;  3IHA A;  3IWO A;  3CUE A;  5IHV A;  4KZB A;  4N9K A;  1ZC2 A;  3QP2 A;  4WF0 A;  2VGJ A;  4JLF A;  4WEK A;  3JVU A;  3F1P B;  1MKI A;  1K54 C;  3OZH A;  5EOO A;  3E4P A;  3VP3 A;  4OOM A;  4LCL A;  4IBX A; 
#chains in the Genus database with same CATH homology
 2QJ7 A;  4DMZ A;  4IUK A;  4JGQ A;  5DJT A;  4M4X A;  3LIA A;  3R7W A;  1D7E A;  1MZU A;  3S7Q A;  4EEU A;  4EW7 A;  3C8C A;  2VZW A;  4G3V A;  2PYP A;  2XA7 S;  4G3W A;  3CAX A;  3T4K A;  2A2L A;  4R6L A;  2W3G A;  3R4K A;  4HQA A;  3DBA A;  5F6A A;  2V1B A;  2EWV A;  4EEP A;  1V9Y A;  3S7P A;  4R3A A;  4HJ3 A;  4BBT A;  1OTD A;  2Z6D A;  1P9R A;  3UB9 A;  2OAQ 1;  3G6O A;  1TF1 A;  3S7N A;  2A24 A;  3UME A;  5KSH A;  2L4R A;  4ME4 A;  2JKT M;  2PDR A;  4BBV A;  3OBF A;  4I39 A;  2VV8 A;  3E0Y A;  4II7 A;  2B02 A;  1BYW A;  2OAP 1;  3D3O A;  4B9O A;  5KIZ A;  3V67 A;  4WEJ A;  4K08 A;  2EWW A;  5F5Y A;  2JHE A;  3CI6 A;  1XJ3 A;  2VX8 A;  3T4T A;  2J3T C;  2VEA A;  4NXE A;  5TBM B;  3BQA A;  1OTA A;  4L9F A;  3VE4 A;  2P04 A;  1H8M A;  1G6O A;  1TS6 A;  2PT7 A;  3BY9 A;  5HWV A;  3NJA A;  1WA9 A;  3NOU C;  2JN7 A;  4QPR A;  3K2N A;  2LB5 A;  3F1P A;  4H6J B;  4NXB A;  4MN5 A;  5HDS A;  3MFX A;  3PBT A;  5HWW A;  1XJ6 A;  4YOF A;  3K3C A;  5CX7 A;  3T4O A;  4DN0 A;  4WLA A;  4BJP A;  2V1A A;  5DFY A;  1NWZ A;  4GHI B;  3TJZ C;  2L0W A;  1T18 A;  4O01 A;  4Y2F A;  2XSS A;  3LFV A;  4OOL A;  3PBS A;  2ZOH A;  2O99 A;  1T1B A;  4F3L B;  2JKR I;  2W1R A;  2ZBB A;  3NHQ A;  3LIB A;  1YSQ A;  5HDD A;  1LSX A;  3PBR A;  4NXF A;  1LT0 A;  3OOV A;  3LR3 A;  3RFB A;  2PHY A;  1UWN X;  3FG8 A;  4Q0H A;  3UB7 A;  1TS7 A;  3BQ8 A;  2QYB A;  3EEH A;  3EWK A;  3KSI A;  3VE3 A;  2O0Y A;  2J80 A;  2PR5 A;  5A8B A;  5HZH A;  2VJW A;  3C30 A;  1S1Y A;  1ZTU A;  1OPX A;  4PAU A;  5IS1 A;  5HL6 A;  3H82 B;  3KSF A;  1OTI A;  4KUO A;  5DKK A;  3UB6 A;  4PKY A;  3HCY A;  4HI4 A;  1G28 A;  5TBM A;  4ETX A;  2D02 A;  3H7W B;  2GZA A;  2QHK A;  1EW0 A;  4KUK A;  4HP9 A;  4KQO A;  5AVE A;  4LRX C;  1N9L A;  3RTY A;  3B33 A;  3PR6 A;  4ETZ A;  3ZYT A;  4H6J A;  4MN6 A;  1LSW A;  4Q0J A;  2V0U A;  2K2N A;  2V9A A;  3T50 A;  4Y3I A;  3LIC A;  3S7O A;  4DJ2 A;  3BWL A;  3EOI A;  5HD3 A;  4GHI A;  2FZ0 A;  5EFW A;  2H28 A;  5HDC A;  1S4S A;  3LR0 A;  1N9N A;  5J7E A;  1T1C A;  3IBR A;  1DP9 A;  2HJ9 C;  4F3L A;  1F9I A;  4O0P A;  2JKT I;  2NUP C;  3EQU A;  2PD7 A;  4I38 A;  5HSQ A;  3FPV A;  3PHY A;  2O9B A;  3BJN A;  2Y79 A;  4WEL A;  4PHT A;  1P0Z A;  4R70 A;  3CLO A;  4IJG A;  1XFQ A;  2ZMV A;  4ARZ B;  2PYR A;  3KSH A;  5HD5 A;  4HY8 A;  1TS8 A;  2ZOI A;  2GJ3 A;  1OTB A;  2KX6 A;  3PBO A;  4AFI A;  4B93 A;  4WUJ A;  3KX0 X;  1GSW A;  2GX5 A;  1W63 M;  3JVV A;  1P9W A;  2QWS A;  3A0R A;  3H82 A;  4EER A;  4WL9 A;  2VV6 A;  4FOF A;  2WKP A;  1IFQ A;  3H7W A;  4I3A A;  4JGR A;  4NXG A;  2K31 A;  3VOL A;  4KQD A;  5G4Y A;  2HV1 A;  1P97 A;  3OCN A;  1OT9 A;  5IT5 A;  4CLC D;  4EU0 A;  3F1O B;  1KOU A;  4LRZ E;  4CLC B;  3CIT A;  3LIF A;  4ZRR A;  4LLO B;  3PBN A;  5L8M A;  3LIE A;  4HNB A;  1LSV A;  2KDK A;  4GLQ A;  4YWZ A;  5IU1 A;  3UE3 A;  2OWJ A;  3KO6 A;  1TD5 A;  4HP4 A;  3A0S A;  2G7U A;  1OT6 A;  1S1Z A;  1H3Q A;  3B47 A;  3LUQ A;  5J4E A;  4G3K A;  5DKL A;  3C2W A;  1VHM A;  2HJE A;  4GJ4 A;  4DJ3 A;  4MMN A;  4E04 A;  4HH3 A;  3C38 A;  3MMH A;  3EEA A;  4HJ4 A;  2W3D A;  1F98 A;  4I3I A;  4EES A;  2KOI A;  4ARZ A;  1N9O A;  3P7N A;  1TS0 A;  2VLG A;  2YKH A;  3LID A;  5K5B A;  4L9G A;  1T1A A;  3KYZ A;  2XRO A;  1XFN A;  1GSX A;  2IA2 A;  2JKR M;  3ICY A;  5DFX A;  3LR4 A;  3E4O A;  2M7V A;  2EA9 A;  3EGD C;  4RQ9 A;  3NOP C;  2W3H A;  2I9V A;  3ZQ5 A;  3CUE C;  1DP8 A;  4LRY C;  1YAX A;  2PR6 A;  3CWF A;  2HGV A;  4UEY A;  2QKP A;  4JGO A;  3EQV A;  2D01 A;  4R38 A;  2NUT C;  3F1N B;  3UE6 A;  3GEC A;  2WKR A;  3LI9 A;  2P08 A;  4JGP A;  4HOI A;  3T4L A;  3PBQ A;  2M7U A;  2O9C A;  3OC2 A;  2VGL M;  3IS2 B;  1NLZ A;  1XJ4 A;  3MXQ A;  1STZ A;  4CLC C;  3MQ0 A;  3F1O A;  2INW A;  4IHQ A;  4CLC A;  1W63 Q;  2DMW A;  2FH5 A;  3FPW A;  3O5Y A;  2L1M A;  2P7J A;  3TRC A;  3T4S A;  4BWI A;  5MC7 A;  3GDI A;  3PYP A;  3B42 A;  1Y28 A;  2VGL S;  5HWT A;  1S66 L;  2VA0 A;  4WN5 A;  3SW1 A;  4GS9 B;  2KLI A;  2W1T B;  1OJ5 A;  4XT2 B;  2K7S A;  5I5L A;  4UQI M;  2O9A A;  1VB6 A;  5C5K A;  4EET B;  1F5M A;  1YSP A;  3W2Z A;  1LL8 A;  1X0O A;  5DF9 A;  1DP6 A;  1V9Z A;  3E4Q A;  4HJ6 A;  2CMN A;  3D72 A;  3MQO A;  1ZHH B;  3ULF A;  3MJQ A;  4IUH A;  3MF0 A;  1GSV A;  2VKS A;  2W3F A;  2VV7 A;  4BBU A;  1DRM A;  2J3W A;  2QJ5 A;  3VV4 A;  4Z1W A;  2M1C A;  4UQI S;  4FSF A;  3A0V A;  1ODV A;  2LB9 A;  3OLO A;  5AVF A;  1JNU A;  5AJG A;  3TW8 A;  3F1N A;  4CQH A;  3BW6 A;  3KYQ A;  5HPI A;  2V0W A;  2BAS A;  2PD8 A;  2WKQ A;  3UMD A;  1UGU A;  1NRJ A;  4P6Z M;  5LBR A;  1UWP X;  3OCL A;  3IS2 A;  2W27 A;  1MC0 A;  3MR0 A;  4NEE D;  2OWH A;  4MN7 A;  2W0N A;  3LR5 A;  3HJK A;  3PXP A;  5TJJ A;  3BY8 A;  1IOU A;  1NLY A;  2B18 A;  3LYX A;  3U2A A;  3R7W B;  5HPF A;  5DJU A;  3UB8 A;  3IBJ A;  4HHD A;  4L9E A;  2R78 A;  4P6Z S;  1MKM A;  4MDZ A;  1S4R A;  4GS9 A;  5F68 A;  2MJ6 A;  2W1T A;  3K3D A;  4EXO A;  4HIA A;  4EUV A;  3KSG A;  1D06 A;  3FC7 A;  3HJI A;  5J3W A;  4XT2 A;  4YNR A;  2OOL A;  2ZMF A;  3T4J A;  1YKD A;  3E98 A;  2A24 B;  4EQ1 A;  3T4Q A;  4LPZ A;  1OJG A;  3NOT C;  3LI8 A;  3P01 A;  4CLC E;  3CUE A;  1OTE A;  1S67 L;  4I3J A;  4NKP A;  3H9W A;  2J3T D;  5G4Z A;  2W3E A;  4L0L A;  4BMW A;  3EGX C;  3MQQ A;  2Y8H A;  4MCW A;  4I5S A;  4WF0 A;  4HH2 A;  4GW9 A;  2HF6 A;  2GNX A;  2XRN A;  2YKF A;  4Y5F A;  4WEK A;  1XJ2 A;  3JVU A;  3TE8 A;  3F1P B;  5FL3 A;  2XA7 M;  3E4P A;  3RH8 B;  4O8G A;  4OOM A;  4Q0I A;  5F69 A;  4PKY G;  2Z6C A;  1T19 A;  4GCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...