4NXBA

Crystal structure of ilov-i486(2lt) at ph 7.0
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
108
Chain Sequence
KNFVITDPRLPDNPIIFASDGFLELTEYSREEILGRNARFLQGPETDQATVQKIRDAIRDQRETTVQLINYTKSGKKFWNLLHLQPVRDQKGELQYFGVQLDGSDHVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Flavoprotein, fluorescent protein
molecule keywords Phototropin-2
publication title Significant Expansion of Fluorescent Protein Sensing Ability through the Genetic Incorporation of Superior Photo-Induced Electron-Transfer Quenchers
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 30
structure length 108
sequence length 109
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4nxbA00
4DJ3A 1OJ5A 1S4RA 2A24A 3MQQA 1XFQA 2OOLA 4HY8A 1OTBA 4HJ4A 1P97A 1Y28A 4R38A 4JGPA 2WKRA 1OT9A 3LIBA 5HD3A 4PKYA 4EESA 3HJIA 3EEHA 4GHIA 2PHYA 3ZQ5A 5HSQA 5G4YA 3IS2A 4M4XA 1LSVA 1UWNX 2OWHA 1BYWA 3NOPC 1F9IA 2PR6A 2I9VA 2GJ3A 3K3CA 5AVFA 4WLAA 4R3AA 3VOLA 1OT6A 5TBMB 1XFNA 3A0RA 3UB8A 1LSWA 3NOTC 1S1YA 4EEPA 1P0ZA 3KX0X 2V1AA 4XT2B 1G28A 4WUJA 3F1PB 3NOUC 3CAXA 4BBVA 3A0SA 1F98A 3UMEA 3PYPA 4JGQA 3UB9A 1T19A 1DRMA 3A0VA 5HWWA 1T1AA 2JN7A 1DP8A 1UWPX 4NXEA 3MXQA 1VB6A 4HP9A 2VV7A 2YKHA 4DJ2A 1DP9A 4LLOB 4GCZA 3E4OA 5HDCA 2PD8A 3FC7A 5I5LA 1TS0A 3RTYA 1LSXA 2OWJA 2WKPA 3LUQA 1JNUA 1S66L 4HH3A 2Z6CA 3NJAA 2QJ7A 4GHIB 1DP6A 4LPZA 3IS2B 4PKYG 1KOUA 4HOIA 4GW9A 3BY9A 5HDDA 5KIZA 1LT0A 4JGOA 1ODVA 3K3DA 2D02A 4HIAA 4I5SA 4I39A 2QHKA 1EW0A 2L4RA 4KQDA 3VE3A 1XJ3A 4MN6A 3LIEA 3VE4A 2D01A 2V0UA 4EEUA 2YKFA 5F6AA 1TS7A 4L9FA 1T18A 3G6OA 1D7EA 3E4QA 4WL9A 3F1NA 4BBTA 5DKKA 1XJ2A 3OLOA 4KUKA 4L9GA 3P7NA 3ICYA 2ZOIA 5G4ZA 1GSVA 4L9EA 3HJKA 4YWZA 4EW7A 3LIFA 2H28A 5DJTA 3EWKA 2W27A 2R78A 1UGUA 1OTAA 2KDKA 2WKQA 1GSWA 3UB6A 3MFXA 1X0OA 2BASA 1XJ6A 5IS1A 3H7WB 2PYRA 2EA9A 4RQ9A 4EETB 1OTEA 3LIDA 2PDRA 1LL8A 2ZBBA 3PHYA 3MQOA 2VV6A 4MN5A 2VV8A 5DKLA 3LIAA 2W0NA 5HDSA 2CMNA 3H7WA 4HH2A 1GSXA 4R70A 3BWLA 4KUOA 3B33A 1N9NA 4NXFA 1S1ZA 5HWVA 2L1MA 4I3AA 5J3WA 3NHQA 4HNBA 3F1OA 4WN5A 4HJ3A 3LI8A 3FG8A 1WA9A 4NXGA 2JHEA 4HHDA 2Z6DA 5IU1A 2M1CA 2L0WA 3F1NB 3IBRA 1V9ZA 2V0WA 3H82B 4E04A 1TS8A 4EERA 3MR0A 1XJ4A 3H9WA 4HP4A 4I3JA 2J80A 3GDIA 2P7JA 4LRYC 1S4SA 2QWSA 2QJ5A 3H82A 3T50A 3UMDA 4EXOA 3C2WA 3UB7A 2V9AA 2HV1A 4H6JB 5HD5A 3RH8B 2VEAA 5DJUA 4B9OA 1S67L 2PD7A 1OTIA 5HWTA 4BBUA 3MJQA 4R6LA 3BY8A 2VLGA 1D06A 1V9YA 3SW1A 1NWZA 4JGRA 4NXBA 2PR5A 4I3IA 3ULFA 5F68A 4H6JA 5J4EA 3CWFA 1OTDA 5TBMA 3CLOA 3E4PA 5HZHA 4HQAA 1OJGA 4HJ6A 4I38A 2KX6A 5EFWA 5AVEA 4LRXC 3LICA 4F3LB 1T1BA 5A8BA 1N9LA 4GS9B 4XT2A 2V1BA 3F1PA 4WF0A 4EQ1A 2INWA 2PYPA 5F5YA 2A24B 3LI9A 2ZOHA 4LRZE 4HI4A 5J7EA 3UE6A 2QKPA 2K7SA 3F1OB 1T1CA 3D72A 1MZUA 3C8CA 4F3LA 4K08A 3GECA 5F69A 4GS9A 3LYXA 2B02A 1N9OA 1TS6A
chains in the Genus database with same CATH superfamily
2GX5A 1OJ5A 3MQQA 4FH2A 2QPNA 2OOLA 3BYDA 4JF4A 3IH8A 4QY5A 1OTBA 2G2UA 5FAPA 4LV1A 4ARZB 3HBRA 1BULA 1IOUA 5A93A 4Q8IA 1WYCA 4R4SA 3QP6A 3CPTB 1VM1A 4PKYA 4LCMA 3OZHA 1SZVA 3UNWA 3PXPA 4U0TA 5AQ9A 5K5BA 4L0LA 1K57C 1TEMA 2PU4A 2OWHA 1BYWA 5GHZA 3V50A 2PR6A 2I9VA 2GJ3A 3L7HA 4MBHA 3T1SA 5LBRA 5L8MA 1XGIA 3ZG9B 3VOLA 1MWTA 1OT6A 5E2HA 1M6KA 1LSWA 1S1YA 4E3KA 1W8QA 1XX2A 1S6RA 1P0ZA 3BLMA 1GHPA 1NXYA 5A91A 5TJJA 4XT2B 4EU0A 3BLSA 3CAXA 3FPWA 4NKPA 3ZGAB 3ZG5A 1DJCA 2J9OA 5HX9A 1JTDA 4MBKA 1MWUA 4KZAA 2PBYA 4IUKA 3QP8A 2JN7A 1DP8A 1UWPX 1TDGA 4XUZA 4HP9A 5CGWA 4S2KA 4DRTA 4P87A 3FYZA 2YKHA 4BL3A 1VEUA 1K55C 4KQOA 3QP2A 3KO6A 1ZKJA 5HDCA 3V5MA 4BD1A 4XXRA 4BWIA 3FC7A 5U47A 3W4QA 4JBFA 3WS4A 4E3NA 1LSXA 2WKPA 3Q07A 4JXGA 2Y2NA 4KZ4A 1RGYA 4DMZA 1IKIA 3O87A 4GHIB 4F94A 4CLCC 1K57A 3NBLA 1DP6A 4UA9A 4RYEA 2JKTM 2H10A 3BQAA 1PNEA 5TGFA 4BJPA 4PMAA 5KIZA 2Y4AA 3NULA 3KSHA 4ETXA 4D2OA 1YM1A 1PWGA 1VETB 4ZJ3A 3G35A 2QHKA 1EW0A 3WS2A 1JWPA 2L4RA 4BQMA 3ZHHA 2HZ5A 3IT9A 3LY4A 4CLCD 3WS5A 1QMEA 5M19A 2PRFA 3GV9A 3T4OA 5I94A 5F6AA 1ESIA 4FTXA 1T18A 3IXGA 2XSSA 1OPXA 3VP3A 2Y8HA 4KUKA 1D1JA 3GTCA 3NDGA 3TSGA 4IUHA 4IHQA 2WKHA 5DVAA 3MBZA 4B4ZA 4JKTA 2R78A 4S2JA 1W7FA 4Y17A 3TOIA 1UGUA 1OTAA 1PW1A 1BUEA 1YLPA 3PBRA 4R0QA 4NG2A 2ZC7A 1YLWA 2BASA 1GA0A 2Y59A 4G3KA 1K6RA 5FEGA 2IWCA 4QJGA 2Y55A 4WZ4A 5GLDA 5HL6A 1JTGA 4S2MA 4EETB 3VSLA 2Z2LB 2WAEA 3SH7A 2JE5A 2J3TC 3NCKA 4Y0TA 1TVFA 1LL8A 2WADA 1FSWA 2W0NA 4O01A 4C3QA 3MKFA 3BWLA 3ZG8B 3A3JA 3IXBA 3CUEC 3MSHA 4KUOA 1K4FA 3HUOA 3HVFA 2XDMA 1WYBA 4ZTKA 5EV0A 2FFFB 2UV0E 1IYQA 2L1MA 4MBFA 4KQRA 5FQMA 5FA7A 4P85A 3CJMA 4WN5A 4HJ3A 3LI8A 1FCNA 4GDNA 4ZAMA 2P74A 3GQZA 1EWZA 2FH5A 3IXDA 1ES4A 2J3TD 3F1NB 3IBRA 2ZMVA 3ZG7B 5L07A 1FCOA 2C6WB 1S0WA 3R4KA 2BLSA 1PFLA 5DF8A 1KE0A 4EERA 4QHCA 5FAQA 4N1HA 3GSGA 3G2ZA 2Y2HA 1GCEA 3GRJA 5CEDA 5J8XA 5HARA 4EXOA 4KZ3A 3C2WA 4X6TA 4IVIA 3C38A 2V9AA 5DTSA 1Y4OA 2LB9A 3HCYA 2EWVA 1YSPA 1VQQA 2HV1A 3O88A 3RH8B 3C30A 1S67L 2PD7A 1OTIA 3QP1A 2CC1A 1BT5A 4Z1WA 2Q9MA 2ZM2A 3T4SA 1HTZA 2ZMAA 4O0PA 2ZC4B 3TW8A 1D06A 3B42A 4JGRA 4NXBA 4I3IA 3MFDA 2ZM8A 3ULFA 5F68A 1MKMA 3Q1FA 2J3WA 3V39A 5J4EA 3VSKA 4E3IA 3G32A 2Y2OA 1FR1A 3UPOA 2H5SA 4HJ6A 5KZHA 4K91A 5AVEA 3CUEA 2EX6A 3ZG0A 1HZOA 3TG9A 1L0FA 4WF0A 4JPMA 2OLVA 4B88A 3LCEA 5AQAA 2QKPA 4JLFA 2W3FA 4MMNA 3D72A 4K08A 5E2GA 1CF0A 2XF3A 3HLDA 3IH9A 4OQGA 2H0TA 1KDWA 1HLUP 2A49A 1W5DA 5FI7A 1ALQA 5CEBA 1LI0A 3ZVTA 3T1RA 1MBLA 4HY8A 2M7VA 5AQBA 4ZJ2A 5L09A 1LL9A 1XKZA 4R38A 4Y13A 4E3LA 4JGPA 1MWRA 2WKRA 2DNSA 4EESA 2DCFA 1YPRA 3ZQ5A 5CGSA 5HSQA 2Y79A 4M4XA 1L3LA 4Z9QA 1XA7A 4R3JA 1LSVA 3IF6B 1UWNX 1L0EA 1BLCA 4GD6A 3D3OA 1PWDA 1F9IA 2EX2A 2ZL1A 3VP1A 4UEYA 4FSFA 1YAXA 4WLAA 4R3AA 3P01A 3TJZC 4OPQA 2Y2MA 3S7QA 3IF6A 3LR4A 2W3DA 2XFSA 3OBFA 5DTTA 1NY0A 1HVBA 2W3GA 3AGFA 4JF5A 3BQ8A 3LEQA 1RCJA 1G5UA 1YQSA 5GHXA 2WZZA 2XA7M 5GLAA 4GKUA 2JKTI 3ZCZA 2HPBA 2EFUA 4JGQA 3R7WB 3OPPA 2MJ6A 2WK0A 1Z6FA 4NXEA 4ZBEA 4WZ5C 1VB6A 3G31A 3MMHA 5D3OA 3SH8A 4KZ9A 1IYOA 1DP9A 4LLOB 4LV2A 4GCZA 3HLEA 3R7WA 3IHAA 1Y54A 2XR0A 2PD8A 4O8GA 5I5LA 1KGEA 1TS0A 1TD5A 2B5RA 3RTYA 2OWJA 3V3RA 4ZJ1A 2VGLM 1DY6A 1FQGA 4E3JA 1JNUA 3EGDC 1YMSA 3O3VA 3S7PA 1U60A 1YSQA 4DDYA 4HEFA 2Z6CA 3W8KA 4PKYG 1KOUA 5HFOA 3C7UA 2XD5A 3IWOA 3SS4A 1MPLA 5FQQA 4DXCA 1LT0A 4PM7A 1ODVA 4H8RA 4UHUA 2D02A 3N8SA 5E43A 3RJUA 2ZQ9A 1YMXA 4HIAA 1KVMA 3TRCA 2VA0A 4DE3A 1J9MA 2EXAA 3G2YA 3OCNA 2FFYA 1ACFA 3MXRA 5C5KA 1XXMA 3MF0A 4UQIS 4DDSA 2H0YA 5TR7A 3VOYA 1XJ3A 4MN6A 3SH9A 4IJGA 4EV4A 1YLTA 4ME4A 2JBFA 4L9FA 4EBLA 4JXSA 4BBTA 3NC8A 4P0MA 4FD8A 3OLOA 1NJ4A 2A2LA 3MXSA 4OQIA 2ZQCA 3N8RA 3ICYA 4X68A 3S4XA 5G4ZA 1GSVA 1PZPA 4L9EA 3HJKA 4YWZA 2KLIA 1FILA 3Q7VA 3IX8A 2JKFA 4DE0A 1VEUB 2Q9NA 5DJTA 3BFDA 4S2OA 1H8MA 4P6BA 2W27A 3O86A 5BOHA 4EUZA 3S7NA 1CQAA 3IX3A 2RL3A 1NYYA 3JYIA 4EQIA 1NZOA 4Y2FA 3QHYA 1GHIA 1ZTUA 3MFXA 4Q0HA 4CLCE 3ZDJA 3CITA 5EECA 1XJ6A 3VV4A 3A3EA 4EBNA 2PYRA 1FCMA 3HUMA 1NLYA 4RQ9A 3SZTA 3VP0A 3DAVA 2ACGA 3A3FA 1BTLA 3LEZA 2LB5A 2ZQ7A 3MKEA 3K2NA 3HL9A 2VV6A 3KYZA 4MN5A 5HAQA 3LIAA 4A5RA 1VHMA 2HJ9C 4HH2A 1GSXA 1XPBA 2O99A 1PW8A 5EM1A 2OAP1 1M40A 1BZAA 3B33A 4S2NC 3EQUA 2V8FA 1H5XA 2EWWA 2W1TB 5HWVA 3Q82A 5J3WA 4DKIA 5FQKA 4GDBA 3NI9A 1WE4A 1LI9A 3F1OA 3OOVA 4WMCD 4NXGA 4ETZA 2JHEA 3BFFA 3D9YA 4S2PA 2M1CA 2L0WA 2A3UA 1V9ZA 2OAQ1 2Y2KA 3H82B 3M6HA 1TDLA 2HDRA 5EPHA 2PT7A 1XGJA 2W1TA 2J8YA 3VP4A 3UY6A 3GDIA 5CHMA 5CERA 2IA2A 2P7JA 3RFBA 1S4SA 2QWSA 2ZMFA 2QJ5A 3H82A 4KQQA 3P98A 1YLZA 4YNRA 4WBGA 2Y2IA 3UB7A 4H6JB 1YLJA 4LV0A 1K55A 2G2WA 4CLCB 5HWTA 2HJEA 4BBUA 3PAEA 4R6LA 3JVVA 4X1LA 2ZM0A 3SS3A 4WMCA 3U4LP 2C5WB 3SW1A 1NWZA 5F1FA 2PR5A 3HLFA 1PI4A 4ZDXA 2ZJ9A 1MKIA 4H6JA 1ZG4A 4CLCA 3CWFA 1OTDA 5TBMA 3E4PA 3T4QA 4U0XA 4GNUA 1OJGA 1YLYA 1MC0A 3BFGA 1O7EA 1T1BA 4WEKA 5A8BA 3PTEA 5FDSA 3DTMA 3O5YA 2V1BA 5CTMA 4OH0A 3F1PA 3T4LA 4EQ1A 4KZ7A 5F5YA 5E2EA 2VX8A 3I7JA 4LRZE 4HI4A 5IT5A 4Y7PA 4R23A 4WYYA 4OOMA 1G6OA 3Q7ZA 1T1CA 1IKGA 4CPKA 3CZDA 3UO9A 3KSGA 4PM6A 2B02A 2QMIA 1N9OA 1W8YA 4HBTA 3PBSA 3G34A 1ES2A 2XEPA 1S4RA 3HLBA 3LR5A 2W3HA 3KSFA 1XFQA 1P9WA 5FATA 3IX4A 2R9WA 1ERQA 4FCFA 1P97A 3BM6A 1Y28A 2VK3A 1E25A 3FWLA 3HLWA 5FQJA 2HDUA 1QMFA 3HJIA 4DE1A 3WRTA 3LR0A 2PHYA 5HL1A 5CGXA 5G4YA 2W3EA 3OCLA 3IS2A 4S2LA 1TF1A 4MN7A 3ITBA 1HD8A 1BLSA 4LGWA 4B4XA 4Y15A 4QU3A 3K3CA 4QWOA 3N7WA 2IWBA 5AVFA 4E3OA 5KSCA 4K0WA 4X55A 2P9VB 4PM5A 4GB7A 2Y2LA 5FSRA 3A0RA 3N8LA 3KYEA 5A90A 3NOTC 4OPYA 1FIKA 2P08A 1SKOB 1XA1A 1W63Q 3P09A 1G28A 4OP8A 2B18A 4BBVA 4AFIA 2BG1A 3VOZA 3A0SA 1PWCA 2P9VA 4OOYA 5EVIC 2Y2JA 3PAGA 3UMEA 3PYPA 5DF7A 3UB9A 1H8YA 1SKOA 4OPZA 4R4RA 5M1AA 5F83A 1IFQA 3EOIA 3C4PA 3MXQA 1MY8A 3E2LA 4N9LA 2VV7A 5EOEA 4R1GA 5EVLA 3HREA 1PYYA 2M7UA 3T1QB 3BRMA 1K54C 4DJ2A 5AQ7A 3WS0A 3QNBA 3KSIA 1SCWA 1K4EA 5CHUA 4OVDA 2VGLS 2O0YA 4BD0A 5EVID 4X69A 4OLDA 4KG6A 3LUQA 4EWFA 1S66L 1XP4A 4HH3A 3NJAA 1OMEA 4GZBA 3BW6A 4LPZA 4WM9A 2HGVA 4HOIA 4GW9A 3BY9A 5HDDA 3EEAA 4JGOA 3W4OA 4S2IA 4U3TA 2ZL1B 2WKIA 5FDHA 3T12B 1NLZA 3GMWA 1IELA 1MWSA 4I39A 4D60A 1NYMA 2X71A 1DJBA 3UPNA 1PIOA 3G30A 4KQDA 4RA7A 3UDIA 5HPFA 1IEMA 3LIEA 3VE4A 4YINA 4OQ0A 2D01A 1TS7A 5EVIA 4QY6A 3VP2A 3UE0A 1D7EA 3TE8A 2E8IA 4GLQA 2B95A 4KZBA 1XJ2A 2V8CA 4L9GA 4RX3A 3ISGA 2ZOIA 3OPRA 4UA7A 2Y2PA 1G6AA 1K54A 3V3SA 1KGGA 3LIFA 1N9BA 2K31A 3MQ0A 3PBTA 3ZVWA 5CECA 4X53A 3KYQA 2ZQ8A 1JVJA 1G68A 5FAOA 5JYPA 5MC7A 1GSWA 2UWXA 2ZC6B 3BEBA 3ZNTA 2HP9A 5DTKA 1STZA 5IS1A 1J3WA 3H7WB 3T4KA 4OQHA 1OTEA 2VZWA 4IBRA 4C75A 3LIDA 2KOIA 3B47A 3MS6A 3FPVA 2ZBBA 3MQOA 5CRFA 1ES3A 4JXVA 4E6XA 4OONA 1BLPA 4NETA 3H7WA 2QZ6A 2JCHA 4GOGA 4R70A 3LFVA 3IHBA 1K6SA 2VJWA 4NXFA 2HP5A 1S1ZA 3S22A 4LENA 4I3AA 4WEJA 2ZC3B 4HNBA 3BJNA 1WA9A 2X02A 1ZHHB 3E2KA 1NZUA 3WS1A 3IWIA 4HESA 5IHVA 2V0WA 1JWZA 3LY3A 5L10A 5FASA 2EFXA 3NECA 4X25A 3OC2A 5HW3A 5EE8A 1TS8A 1BSGA 5AJGA 5GLCA 1AWIA 3AGEA 1XJ4A 3H9WA 4WELA 4PM8A 3BECA 4QB8A 3MZDA 2EX9A 4ARZA 3Q7VB 3C4OA 4LRYC 2VKSA 3UMDA 3CPTA 3QP5A 3EQVA 4JF6A 4WZ5A 4KZ5A 1ONHA 3JPUA 1SDEA 3IQAA 2PAVP 2P04A 5HD5A 3UDFA 2GNXA 2J9PA 1N4OA 2JKRM 5DJUA 5KMWA 4XUXA 4B9OA 3MJQA 3IBJA 3BY8A 4CQHA 2PU2A 2VLGA 1K56D 4E3MA 1V9YA 4LV3A 3V67A 5M18A 3E0YA 4OOLA 3UDXA 4MNRA 3C7VA 3CLOA 4IBXA 2QYBA 1SKFA 2HP6A 4HQAA 4FUWA 2GDNA 4C6YA 1Q2QA 3T4TA 3LICA 4PHTA 3LR3A 2XQZA 4XT2A 3UPPA 1IYSA 2INWA 2PYPA 2A24B 3LI9A 4ESPA 2ZOHA 3UE6A 1GHMA 1H0MA 2PBDP 1KDSA 2O9BA 2K7SA 3F1OB 4P6ZM 3LGOA 1MZUA 3C8CA 3GECA 5F69A 1RP5A 3LYXA 3OPHA 3DTKA 2WUQA 5FI6A 1Z09A 1K56A 3MZFA 4QPRA 4DJ3A 2A24A 4YFMA 4GJ4A 4MLLA 3GVBA 3JVUA 1L2SA 1A0KA 4HJ4A 3UB5P 2HF6A 5TFQA 3S1YA 3AGDA 3BFEA 3UN7A 2WGIA 1OT9A 3LIBA 4N1XA 5HD3A 4OPRA 3EEHA 4GHIA 4N9KA 3ZFZA 1L0DA 1ESUA 3RXXA 2EXBA 3G4PA 4UQIM 5E2FA 3ZNYA 1CI9A 3ITAA 4NK3A 4QD4A 3NOPC 5L2FA 2W1RA 2Y2QA 4PAUA 3FZCA 1SDNA 1VETA 4ZRRA 2RCXA 5TBMB 4B93A 1XFNA 3UB8A 3CMZA 4R3BA 4E6WA 5F1GA 4EEPA 3W2ZA 3N6IA 1I2WA 5F82A 3KX0X 2V1AA 1KE4A 1GA9A 3EGXC 4WUJA 3F1PB 3NOUC 1I5QA 4Y0OA 5CTNA 1F98A 2OLUA 2Y91A 1H8ZA 3UE1A 2ZC5B 1ZC2A 3GR2A 4JXWA 1T19A 3DTIA 1DRMA 1BLHA 3A0VA 5HWWA 1T1AA 3FKVA 4MEZA 2JKGA 2EX8A 1YKDA 4S2NA 2NUTC 5FI2A 2XFTA 2ZQDA 2IWDA 1EROA 2R9XA 3DWZA 4NEED 3E4OA 4Y5FA 1LLBA 3CG5A 3T1XA 4IEDA 4GD8A 4EUVA 3PR6A 5HAPA 4Y3IA 4Q0IA 5KSHA 2BTFP 2QJ7A 1W79A 5CX7A 1FOFA 3IS2B 5HPIA 2J7VA 5EOOA 1NRJA 1ONGA 4X1MA 3K3DA 4X56A 1JWVA 2X01A 3NIAA 2XH9A 4I5SA 3OPLA 3S7OA 5JYOA 3U2AA 3VFFA 2I72A 4OLGA 1SHVA 3VE3A 4MDZA 2OSUA 1P9RA 2V0UA 4OP5A 2YKFA 4EEUA 1NRFA 1PRQA 2ZLYA 3G6OA 1CEGA 4PPRA 2XROA 3E4QA 4WL9A 3F1NA 2WZXA 4GN2A 3L9KA 3N4IA 5DKKA 2V2FF 1K0KA 4RX2A 4OKPA 2ZD8A 4FH4A 3P7NA 4ID4A 1K25A 5FQ9A 3DWKA 3WRZA 4Y0UA 1ES5A 3A3DA 4CJNA 2XA7S 3VMAA 4UA6A 4EW7A 4G3WA 2HDQA 5FQIA 2H28A 2XK1A 4LCLA 5A92A 3EWKA 2WAFA 1K38A 1FR6A 2Z2MB 3NY4A 1ZG6A 2KDKA 2XD1A 5EVEA 3UE3A 2GZAA 2WKQA 2K2NA 3UB6A 3FV7A 3T4JA 1X0OA 2NUPC 1KE3A 5GL9A 2XRNA 3IF6C 1MXOA 2WKEA 2FZ0A 1FSYA 2EA9A 3Q81A 2WYXA 3B3XA 3PBOA 1PZOA 3QP4A 4DF6A 5GHYA 1CEFA 3MZEA 5FL3A 2PDRA 3VFHA 3PHYA 4YOFA 2DRWA 5DFYA 1EI5A 2VV8A 2XGNA 5DKLA 5HDSA 2CMNA 3D4FA 4DN0A 1PI5A 1DJAA 1CI8A 5EM0A 3W4PA 1C3BA 1N9NA 2Y2GA 2JC7A 4KG5A 1CJFA 2JKRI 4EBPA 3NHQA 5EUAA 3C5AA 4KG2A 3E98A 5EVIB 3FG8A 5CXWA 4HHDA 2Z6DA 4Q0JA 5IU1A 4UAAA 5CHJA 4G3VA 3SOIA 1RGZA 1F5MA 3PBNA 2WGVA 4DXBA 2AVXA 1AXBA 2XLNA 1KVLA 3HUNA 4E04A 4O7DA 3DTEA 3MR0A 2VGKA 1KGFA 2Q0OA 3DW0A 3QNCA 4HP4A 4I3JA 4MCWA 3A3IA 5DF9A 2E8JA 2J80A 3HLGA 3IXHA 3ZYTA 1F2KA 3PBQA 4N92A 4BENA 1E3UD 3RXWA 3T50A 2V20A 3WWXA 1LHYA 2DMWA 3BFCA 4KZ8A 1ERMA 2ZQAA 4KZ6A 4K0XA 3CI6A 5GLBA 5HAIA 5G18A 2VEAA 3M2JA 2WGWB 1Q2PA 3HLCA 3CHWP 1H3QA 1L0GA 2OV5A 4M3KA 2V1ZA 2G7UA 3DBAA 1CK3A 1W63M 5DFXA 4DE2A 4KENB 2WGWA 5FEFA 5HZHA 4FOFA 1IYPA 4HBUA 4RVAA 3IWQA 3M2KA 2KX6A 4I38A 5EFWA 4LFUA 4LRXC 4F3LB 3FKWA 2VGJA 2HDSA 1N9LA 4GS9B 1YT4A 4BL2A 1E3UA 5J7EA 4IVKA 4II7A 4BLMA 4P6ZS 3IF5A 3NDEA 3M6BA 4F3LA 2O9AA 4PM9A 4GS9A 3SS5A 4BMWA 1E4DA 1LL5A 1O07A 1I2SA 3LO7A 2O9CA 1TS6A
chains in the Genus database with same CATH topology
2GX5A 3PBSA 4QPRA 4DJ3A 1OJ5A 1S4RA 2A24A 3LR5A 3MQQA 4GJ4A 2W3HA 3KSFA 1XFQA 2OOLA 1P9WA 4HY8A 2M7VA 3JVUA 1OTBA 4HJ4A 1P97A 1Y28A 2HF6A 4ARZB 4R38A 1IOUA 4JGPA 2WKRA 1OT9A 3LIBA 5HD3A 4PKYA 4EESA 3HJIA 3EEHA 3LR0A 2PHYA 4GHIA 3ZQ5A 5HSQA 2Y79A 5G4YA 2W3EA 3PXPA 3OCLA 5K5BA 3IS2A 4L0LA 4M4XA 1TF1A 1LSVA 4MN7A 1UWNX 2OWHA 4UQIM 1BYWA 3NOPC 3D3OA 1F9IA 2PR6A 2I9VA 2GJ3A 3K3CA 4UEYA 2W1RA 4PAUA 5LBRA 5AVFA 4FSFA 4ZRRA 5L8MA 1YAXA 4WLAA 4R3AA 3VOLA 3P01A 3TJZC 1OT6A 5TBMB 4B93A 1XFNA 3A0RA 3UB8A 3S7QA 1LSWA 3LR4A 3NOTC 2W3DA 1S1YA 4EEPA 3OBFA 3W2ZA 2P08A 1P0ZA 2W3GA 3KX0X 1W63Q 3BQ8A 2V1AA 5TJJA 4XT2B 1G28A 4EU0A 3EGXC 4WUJA 2B18A 3F1PB 3NOUC 3FPWA 3CAXA 4NKPA 4BBVA 4AFIA 2XA7M 3A0SA 1F98A 2JKTI 3UMEA 3PYPA 4JGQA 3R7WB 3UB9A 1T19A 4IUKA 1DRMA 3A0VA 5HWWA 1T1AA 1IFQA 2JN7A 1DP8A 2MJ6A 1YKDA 1UWPX 3EOIA 2NUTC 4NXEA 3MXQA 1VB6A 4HP9A 2VV7A 2M7UA 2YKHA 3MMHA 4DJ2A 1DP9A 4LLOB 4KQOA 4NEED 4GCZA 3KO6A 3KSIA 3R7WA 3E4OA 5HDCA 4BWIA 4Y5FA 2PD8A 3FC7A 4O8GA 5I5LA 1TS0A 1TD5A 3RTYA 1LSXA 2OWJA 2VGLS 2O0YA 2WKPA 2VGLM 4EUVA 3PR6A 3LUQA 1JNUA 3EGDC 4Y3IA 4DMZA 1S66L 3S7PA 4Q0IA 1YSQA 4HH3A 2Z6CA 5KSHA 3NJAA 2QJ7A 4GHIB 4CLCC 5CX7A 1DP6A 3BW6A 4LPZA 3IS2B 4PKYG 2JKTM 3BQAA 1KOUA 5HPIA 2HGVA 4HOIA 4GW9A 3BY9A 1NRJA 4BJPA 5HDDA 3EEAA 5KIZA 1LT0A 4JGOA 1ODVA 3K3DA 2D02A 3KSHA 4ETXA 1NLZA 4HIAA 3TRCA 2VA0A 4I5SA 3OCNA 3S7OA 4I39A 2QHKA 1EW0A 3U2AA 5C5KA 2L4RA 4KQDA 3MF0A 4UQIS 3VE3A 4MDZA 4CLCD 5HPFA 1XJ3A 4MN6A 3LIEA 3VE4A 4IJGA 4ME4A 1P9RA 2D01A 3T4OA 2V0UA 4EEUA 2YKFA 5F6AA 1TS7A 4L9FA 1T18A 3G6OA 2XSSA 1OPXA 1D7EA 2XROA 3E4QA 4WL9A 3F1NA 3TE8A 4BBTA 4GLQA 5DKKA 1XJ2A 3OLOA 2A2LA 2Y8HA 4KUKA 4L9GA 3P7NA 3ICYA 2ZOIA 5G4ZA 1GSVA 4IUHA 4L9EA 3HJKA 2XA7S 4YWZA 4IHQA 2KLIA 4EW7A 4G3WA 3LIFA 2H28A 5DJTA 2K31A 3MQ0A 3EWKA 1H8MA 3PBTA 2W27A 2R78A 1UGUA 1OTAA 3KYQA 3S7NA 2KDKA 3UE3A 2GZAA 2WKQA 3PBRA 1GSWA 2K2NA 4Y2FA 5MC7A 3UB6A 1ZTUA 3MFXA 3T4JA 1X0OA 4Q0HA 2NUPC 2BASA 4CLCE 3CITA 2XRNA 4G3KA 1STZA 1XJ6A 3VV4A 5IS1A 3H7WB 3T4KA 2PYRA 2FZ0A 2EA9A 1NLYA 4RQ9A 5HL6A 4EETB 1OTEA 3PBOA 2VZWA 2LB5A 2J3TC 5FL3A 3LIDA 2KOIA 3B47A 2PDRA 3FPVA 3K2NA 1LL8A 2ZBBA 3PHYA 3MQOA 2VV6A 4YOFA 3KYZA 5DFYA 4MN5A 2VV8A 5DKLA 3LIAA 1VHMA 2W0NA 5HDSA 2CMNA 2HJ9C 3H7WA 4HH2A 1GSXA 4O01A 2O99A 4DN0A 4R70A 2OAP1 3LFVA 3BWLA 3CUEC 4KUOA 3B33A 1N9NA 2VJWA 3EQUA 4NXFA 2EWWA 2W1TB 1S1ZA 5HWVA 2L1MA 2JKRI 4I3AA 4WEJA 5J3WA 3NHQA 4HNBA 3F1OA 3BJNA 4WN5A 3E98A 3LI8A 3OOVA 4HJ3A 3FG8A 1WA9A 4NXGA 4ETZA 2JHEA 4HHDA 1ZHHB 2Z6DA 4Q0JA 5IU1A 2M1CA 2FH5A 2L0WA 4G3VA 3F1NB 2J3TD 3IBRA 1V9ZA 2V0WA 2OAQ1 3H82B 2ZMVA 1F5MA 3PBNA 3R4KA 3OC2A 2PT7A 2W1TA 4E04A 1TS8A 5AJGA 4EERA 3MR0A 1XJ4A 3H9WA 4HP4A 4I3JA 4WELA 4MCWA 5DF9A 2J80A 3GDIA 3ZYTA 2IA2A 4ARZA 2P7JA 3PBQA 4LRYC 3RFBA 1S4SA 2QWSA 2ZMFA 2QJ5A 2VKSA 3H82A 3T50A 3UMDA 4YNRA 4EXOA 2DMWA 3EQVA 3C2WA 3UB7A 3C38A 2V9AA 2LB9A 3HCYA 2EWVA 1YSPA 2HV1A 2P04A 3CI6A 4H6JB 5HD5A 2GNXA 4CLCB 3RH8B 2JKRM 2VEAA 5DJUA 3C30A 4B9OA 1S67L 2PD7A 1OTIA 5HWTA 2HJEA 4BBUA 3MJQA 4Z1WA 3IBJA 4R6LA 3BY8A 1H3QA 3JVVA 4CQHA 3T4SA 2VLGA 4O0PA 3TW8A 1D06A 1V9YA 3B42A 3SW1A 1NWZA 4JGRA 4NXBA 2G7UA 2PR5A 4I3IA 3ULFA 3V67A 3DBAA 1MKMA 3E0YA 5F68A 2J3WA 4H6JA 1W63M 4OOLA 5J4EA 4CLCA 5DFXA 3CWFA 1OTDA 5TBMA 3CLOA 3E4PA 2QYBA 5HZHA 4FOFA 3T4QA 4HQAA 1OJGA 1MC0A 4HJ6A 4I38A 2KX6A 5EFWA 3T4TA 5AVEA 4LRXC 3LICA 4F3LB 1T1BA 4WEKA 5A8BA 3CUEA 1N9LA 4GS9B 4PHTA 3LR3A 3O5YA 4XT2A 2V1BA 3F1PA 4WF0A 3T4LA 4EQ1A 2INWA 2PYPA 5F5YA 2A24B 3LI9A 2VX8A 2ZOHA 4LRZE 4HI4A 5J7EA 3UE6A 5IT5A 2QKPA 4OOMA 1G6OA 4II7A 4P6ZS 2O9BA 2K7SA 3F1OB 4P6ZM 2W3FA 4MMNA 1T1CA 3D72A 1MZUA 3C8CA 4F3LA 4K08A 2O9AA 3GECA 5F69A 4GS9A 3KSGA 3LYXA 2B02A 4BMWA 1N9OA 2O9CA 1TS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DJ3 A;  1OJ5 A;  1S4R A;  2A24 A;  3MQQ A;  1XFQ A;  2OOL A;  4HY8 A;  1OTB A;  4HJ4 A;  1P97 A;  1Y28 A;  4R38 A;  4JGP A;  2WKR A;  1OT9 A;  3LIB A;  5HD3 A;  4PKY A;  4EES A;  3HJI A;  3EEH A;  4GHI A;  2PHY A;  3ZQ5 A;  5HSQ A;  5G4Y A;  3IS2 A;  4M4X A;  1LSV A;  1UWN X;  2OWH A;  1BYW A;  3NOP C;  1F9I A;  2PR6 A;  2I9V A;  2GJ3 A;  3K3C A;  5AVF A;  4WLA A;  4R3A A;  3VOL A;  1OT6 A;  5TBM B;  1XFN A;  3A0R A;  3UB8 A;  1LSW A;  3NOT C;  1S1Y A;  4EEP A;  1P0Z A;  3KX0 X;  2V1A A;  4XT2 B;  1G28 A;  4WUJ A;  3F1P B;  3NOU C;  3CAX A;  4BBV A;  3A0S A;  1F98 A;  3UME A;  3PYP A;  4JGQ A;  3UB9 A;  1T19 A;  1DRM A;  3A0V A;  5HWW A;  1T1A A;  2JN7 A;  1DP8 A;  1UWP X;  4NXE A;  3MXQ A;  1VB6 A;  4HP9 A;  2VV7 A;  2YKH A;  4DJ2 A;  1DP9 A;  4LLO B;  4GCZ A;  3E4O A;  5HDC A;  2PD8 A;  3FC7 A;  5I5L A;  1TS0 A;  3RTY A;  1LSX A;  2OWJ A;  2WKP A;  3LUQ A;  1JNU A;  1S66 L;  4HH3 A;  2Z6C A;  3NJA A;  2QJ7 A;  4GHI B;  1DP6 A;  4LPZ A;  3IS2 B;  4PKY G;  1KOU A;  4HOI A;  4GW9 A;  3BY9 A;  5HDD A;  5KIZ A;  1LT0 A;  4JGO A;  1ODV A;  3K3D A;  2D02 A;  4HIA A;  4I5S A;  4I39 A;  2QHK A;  1EW0 A;  2L4R A;  4KQD A;  3VE3 A;  1XJ3 A;  4MN6 A;  3LIE A;  3VE4 A;  2D01 A;  2V0U A;  4EEU A;  2YKF A;  5F6A A;  1TS7 A;  4L9F A;  1T18 A;  3G6O A;  1D7E A;  3E4Q A;  4WL9 A;  3F1N A;  4BBT A;  5DKK A;  1XJ2 A;  3OLO A;  4KUK A;  4L9G A;  3P7N A;  3ICY A;  2ZOI A;  5G4Z A;  1GSV A;  4L9E A;  3HJK A;  4YWZ A;  4EW7 A;  3LIF A;  2H28 A;  5DJT A;  3EWK A;  2W27 A;  2R78 A;  1UGU A;  1OTA A;  2KDK A;  2WKQ A;  1GSW A;  3UB6 A;  3MFX A;  1X0O A;  2BAS A;  1XJ6 A;  5IS1 A;  3H7W B;  2PYR A;  2EA9 A;  4RQ9 A;  4EET B;  1OTE A;  3LID A;  2PDR A;  1LL8 A;  2ZBB A;  3PHY A;  3MQO A;  2VV6 A;  4MN5 A;  2VV8 A;  5DKL A;  3LIA A;  2W0N A;  5HDS A;  2CMN A;  3H7W A;  4HH2 A;  1GSX A;  4R70 A;  3BWL A;  4KUO A;  3B33 A;  1N9N A;  4NXF A;  1S1Z A;  5HWV A;  2L1M A;  4I3A A;  5J3W A;  3NHQ A;  4HNB A;  3F1O A;  4WN5 A;  4HJ3 A;  3LI8 A;  3FG8 A;  1WA9 A;  4NXG A;  2JHE A;  4HHD A;  2Z6D A;  5IU1 A;  2M1C A;  2L0W A;  3F1N B;  3IBR A;  1V9Z A;  2V0W A;  3H82 B;  4E04 A;  1TS8 A;  4EER A;  3MR0 A;  1XJ4 A;  3H9W A;  4HP4 A;  4I3J A;  2J80 A;  3GDI A;  2P7J A;  4LRY C;  1S4S A;  2QWS A;  2QJ5 A;  3H82 A;  3T50 A;  3UMD A;  4EXO A;  3C2W A;  3UB7 A;  2V9A A;  2HV1 A;  4H6J B;  5HD5 A;  3RH8 B;  2VEA A;  5DJU A;  4B9O A;  1S67 L;  2PD7 A;  1OTI A;  5HWT A;  4BBU A;  3MJQ A;  4R6L A;  3BY8 A;  2VLG A;  1D06 A;  1V9Y A;  3SW1 A;  1NWZ A;  4JGR A;  4NXB A;  2PR5 A;  4I3I A;  3ULF A;  5F68 A;  4H6J A;  5J4E A;  3CWF A;  1OTD A;  5TBM A;  3CLO A;  3E4P A;  5HZH A;  4HQA A;  1OJG A;  4HJ6 A;  4I38 A;  2KX6 A;  5EFW A;  5AVE A;  4LRX C;  3LIC A;  4F3L B;  1T1B A;  5A8B A;  1N9L A;  4GS9 B;  4XT2 A;  2V1B A;  3F1P A;  4WF0 A;  4EQ1 A;  2INW A;  2PYP A;  5F5Y A;  2A24 B;  3LI9 A;  2ZOH A;  4LRZ E;  4HI4 A;  5J7E A;  3UE6 A;  2QKP A;  2K7S A;  3F1O B;  1T1C A;  3D72 A;  1MZU A;  3C8C A;  4F3L A;  4K08 A;  3GEC A;  5F69 A;  4GS9 A;  3LYX A;  2B02 A;  1N9O A;  1TS6 A; 
#chains in the Genus database with same CATH topology
 2GX5 A;  1OJ5 A;  3MQQ A;  4FH2 A;  2QPN A;  2OOL A;  3BYD A;  4JF4 A;  3IH8 A;  4QY5 A;  1OTB A;  2G2U A;  5FAP A;  4LV1 A;  4ARZ B;  3HBR A;  1BUL A;  1IOU A;  5A93 A;  4Q8I A;  1WYC A;  4R4S A;  3QP6 A;  3CPT B;  1VM1 A;  4PKY A;  4LCM A;  3OZH A;  1SZV A;  3UNW A;  3PXP A;  4U0T A;  5AQ9 A;  5K5B A;  4L0L A;  1K57 C;  1TEM A;  2PU4 A;  2OWH A;  1BYW A;  5GHZ A;  3V50 A;  2PR6 A;  2I9V A;  2GJ3 A;  3L7H A;  4MBH A;  3T1S A;  5LBR A;  5L8M A;  1XGI A;  3ZG9 B;  3VOL A;  1MWT A;  1OT6 A;  5E2H A;  1M6K A;  1LSW A;  1S1Y A;  4E3K A;  1W8Q A;  1XX2 A;  1S6R A;  1P0Z A;  3BLM A;  1GHP A;  1NXY A;  5A91 A;  5TJJ A;  4XT2 B;  4EU0 A;  3BLS A;  3CAX A;  3FPW A;  4NKP A;  3ZGA B;  3ZG5 A;  1DJC A;  2J9O A;  5HX9 A;  1JTD A;  4MBK A;  1MWU A;  4KZA A;  2PBY A;  4IUK A;  3QP8 A;  2JN7 A;  1DP8 A;  1UWP X;  1TDG A;  4XUZ A;  4HP9 A;  5CGW A;  4S2K A;  4DRT A;  4P87 A;  3FYZ A;  2YKH A;  4BL3 A;  1VEU A;  1K55 C;  4KQO A;  3QP2 A;  3KO6 A;  1ZKJ A;  5HDC A;  3V5M A;  4BD1 A;  4XXR A;  4BWI A;  3FC7 A;  5U47 A;  3W4Q A;  4JBF A;  3WS4 A;  4E3N A;  1LSX A;  2WKP A;  3Q07 A;  4JXG A;  2Y2N A;  4KZ4 A;  1RGY A;  4DMZ A;  1IKI A;  3O87 A;  4GHI B;  4F94 A;  4CLC C;  1K57 A;  3NBL A;  1DP6 A;  4UA9 A;  4RYE A;  2JKT M;  2H10 A;  3BQA A;  1PNE A;  5TGF A;  4BJP A;  4PMA A;  5KIZ A;  2Y4A A;  3NUL A;  3KSH A;  4ETX A;  4D2O A;  1YM1 A;  1PWG A;  1VET B;  4ZJ3 A;  3G35 A;  2QHK A;  1EW0 A;  3WS2 A;  1JWP A;  2L4R A;  4BQM A;  3ZHH A;  2HZ5 A;  3IT9 A;  3LY4 A;  4CLC D;  3WS5 A;  1QME A;  5M19 A;  2PRF A;  3GV9 A;  3T4O A;  5I94 A;  5F6A A;  1ESI A;  4FTX A;  1T18 A;  3IXG A;  2XSS A;  1OPX A;  3VP3 A;  2Y8H A;  4KUK A;  1D1J A;  3GTC A;  3NDG A;  3TSG A;  4IUH A;  4IHQ A;  2WKH A;  5DVA A;  3MBZ A;  4B4Z A;  4JKT A;  2R78 A;  4S2J A;  1W7F A;  4Y17 A;  3TOI A;  1UGU A;  1OTA A;  1PW1 A;  1BUE A;  1YLP A;  3PBR A;  4R0Q A;  4NG2 A;  2ZC7 A;  1YLW A;  2BAS A;  1GA0 A;  2Y59 A;  4G3K A;  1K6R A;  5FEG A;  2IWC A;  4QJG A;  2Y55 A;  4WZ4 A;  5GLD A;  5HL6 A;  1JTG A;  4S2M A;  4EET B;  3VSL A;  2Z2L B;  2WAE A;  3SH7 A;  2JE5 A;  2J3T C;  3NCK A;  4Y0T A;  1TVF A;  1LL8 A;  2WAD A;  1FSW A;  2W0N A;  4O01 A;  4C3Q A;  3MKF A;  3BWL A;  3ZG8 B;  3A3J A;  3IXB A;  3CUE C;  3MSH A;  4KUO A;  1K4F A;  3HUO A;  3HVF A;  2XDM A;  1WYB A;  4ZTK A;  5EV0 A;  2FFF B;  2UV0 E;  1IYQ A;  2L1M A;  4MBF A;  4KQR A;  5FQM A;  5FA7 A;  4P85 A;  3CJM A;  4WN5 A;  4HJ3 A;  3LI8 A;  1FCN A;  4GDN A;  4ZAM A;  2P74 A;  3GQZ A;  1EWZ A;  2FH5 A;  3IXD A;  1ES4 A;  2J3T D;  3F1N B;  3IBR A;  2ZMV A;  3ZG7 B;  5L07 A;  1FCO A;  2C6W B;  1S0W A;  3R4K A;  2BLS A;  1PFL A;  5DF8 A;  1KE0 A;  4EER A;  4QHC A;  5FAQ A;  4N1H A;  3GSG A;  3G2Z A;  2Y2H A;  1GCE A;  3GRJ A;  5CED A;  5J8X A;  5HAR A;  4EXO A;  4KZ3 A;  3C2W A;  4X6T A;  4IVI A;  3C38 A;  2V9A A;  5DTS A;  1Y4O A;  2LB9 A;  3HCY A;  2EWV A;  1YSP A;  1VQQ A;  2HV1 A;  3O88 A;  3RH8 B;  3C30 A;  1S67 L;  2PD7 A;  1OTI A;  3QP1 A;  2CC1 A;  1BT5 A;  4Z1W A;  2Q9M A;  2ZM2 A;  3T4S A;  1HTZ A;  2ZMA A;  4O0P A;  2ZC4 B;  3TW8 A;  1D06 A;  3B42 A;  4JGR A;  4NXB A;  4I3I A;  3MFD A;  2ZM8 A;  3ULF A;  5F68 A;  1MKM A;  3Q1F A;  2J3W A;  3V39 A;  5J4E A;  3VSK A;  4E3I A;  3G32 A;  2Y2O A;  1FR1 A;  3UPO A;  2H5S A;  4HJ6 A;  5KZH A;  4K91 A;  5AVE A;  3CUE A;  2EX6 A;  3ZG0 A;  1HZO A;  3TG9 A;  1L0F A;  4WF0 A;  4JPM A;  2OLV A;  4B88 A;  3LCE A;  5AQA A;  2QKP A;  4JLF A;  2W3F A;  4MMN A;  3D72 A;  4K08 A;  5E2G A;  1CF0 A;  2XF3 A;  3HLD A;  3IH9 A;  4OQG A;  2H0T A;  1KDW A;  1HLU P;  2A49 A;  1W5D A;  5FI7 A;  1ALQ A;  5CEB A;  1LI0 A;  3ZVT A;  3T1R A;  1MBL A;  4HY8 A;  2M7V A;  5AQB A;  4ZJ2 A;  5L09 A;  1LL9 A;  1XKZ A;  4R38 A;  4Y13 A;  4E3L A;  4JGP A;  1MWR A;  2WKR A;  2DNS A;  4EES A;  2DCF A;  1YPR A;  3ZQ5 A;  5CGS A;  5HSQ A;  2Y79 A;  4M4X A;  1L3L A;  4Z9Q A;  1XA7 A;  4R3J A;  1LSV A;  3IF6 B;  1UWN X;  1L0E A;  1BLC A;  4GD6 A;  3D3O A;  1PWD A;  1F9I A;  2EX2 A;  2ZL1 A;  3VP1 A;  4UEY A;  4FSF A;  1YAX A;  4WLA A;  4R3A A;  3P01 A;  3TJZ C;  4OPQ A;  2Y2M A;  3S7Q A;  3IF6 A;  3LR4 A;  2W3D A;  2XFS A;  3OBF A;  5DTT A;  1NY0 A;  1HVB A;  2W3G A;  3AGF A;  4JF5 A;  3BQ8 A;  3LEQ A;  1RCJ A;  1G5U A;  1YQS A;  5GHX A;  2WZZ A;  2XA7 M;  5GLA A;  4GKU A;  2JKT I;  3ZCZ A;  2HPB A;  2EFU A;  4JGQ A;  3R7W B;  3OPP A;  2MJ6 A;  2WK0 A;  1Z6F A;  4NXE A;  4ZBE A;  4WZ5 C;  1VB6 A;  3G31 A;  3MMH A;  5D3O A;  3SH8 A;  4KZ9 A;  1IYO A;  1DP9 A;  4LLO B;  4LV2 A;  4GCZ A;  3HLE A;  3R7W A;  3IHA A;  1Y54 A;  2XR0 A;  2PD8 A;  4O8G A;  5I5L A;  1KGE A;  1TS0 A;  1TD5 A;  2B5R A;  3RTY A;  2OWJ A;  3V3R A;  4ZJ1 A;  2VGL M;  1DY6 A;  1FQG A;  4E3J A;  1JNU A;  3EGD C;  1YMS A;  3O3V A;  3S7P A;  1U60 A;  1YSQ A;  4DDY A;  4HEF A;  2Z6C A;  3W8K A;  4PKY G;  1KOU A;  5HFO A;  3C7U A;  2XD5 A;  3IWO A;  3SS4 A;  1MPL A;  5FQQ A;  4DXC A;  1LT0 A;  4PM7 A;  1ODV A;  4H8R A;  4UHU A;  2D02 A;  3N8S A;  5E43 A;  3RJU A;  2ZQ9 A;  1YMX A;  4HIA A;  1KVM A;  3TRC A;  2VA0 A;  4DE3 A;  1J9M A;  2EXA A;  3G2Y A;  3OCN A;  2FFY A;  1ACF A;  3MXR A;  5C5K A;  1XXM A;  3MF0 A;  4UQI S;  4DDS A;  2H0Y A;  5TR7 A;  3VOY A;  1XJ3 A;  4MN6 A;  3SH9 A;  4IJG A;  4EV4 A;  1YLT A;  4ME4 A;  2JBF A;  4L9F A;  4EBL A;  4JXS A;  4BBT A;  3NC8 A;  4P0M A;  4FD8 A;  3OLO A;  1NJ4 A;  2A2L A;  3MXS A;  4OQI A;  2ZQC A;  3N8R A;  3ICY A;  4X68 A;  3S4X A;  5G4Z A;  1GSV A;  1PZP A;  4L9E A;  3HJK A;  4YWZ A;  2KLI A;  1FIL A;  3Q7V A;  3IX8 A;  2JKF A;  4DE0 A;  1VEU B;  2Q9N A;  5DJT A;  3BFD A;  4S2O A;  1H8M A;  4P6B A;  2W27 A;  3O86 A;  5BOH A;  4EUZ A;  3S7N A;  1CQA A;  3IX3 A;  2RL3 A;  1NYY A;  3JYI A;  4EQI A;  1NZO A;  4Y2F A;  3QHY A;  1GHI A;  1ZTU A;  3MFX A;  4Q0H A;  4CLC E;  3ZDJ A;  3CIT A;  5EEC A;  1XJ6 A;  3VV4 A;  3A3E A;  4EBN A;  2PYR A;  1FCM A;  3HUM A;  1NLY A;  4RQ9 A;  3SZT A;  3VP0 A;  3DAV A;  2ACG A;  3A3F A;  1BTL A;  3LEZ A;  2LB5 A;  2ZQ7 A;  3MKE A;  3K2N A;  3HL9 A;  2VV6 A;  3KYZ A;  4MN5 A;  5HAQ A;  3LIA A;  4A5R A;  1VHM A;  2HJ9 C;  4HH2 A;  1GSX A;  1XPB A;  2O99 A;  1PW8 A;  5EM1 A;  2OAP 1;  1M40 A;  1BZA A;  3B33 A;  4S2N C;  3EQU A;  2V8F A;  1H5X A;  2EWW A;  2W1T B;  5HWV A;  3Q82 A;  5J3W A;  4DKI A;  5FQK A;  4GDB A;  3NI9 A;  1WE4 A;  1LI9 A;  3F1O A;  3OOV A;  4WMC D;  4NXG A;  4ETZ A;  2JHE A;  3BFF A;  3D9Y A;  4S2P A;  2M1C A;  2L0W A;  2A3U A;  1V9Z A;  2OAQ 1;  2Y2K A;  3H82 B;  3M6H A;  1TDL A;  2HDR A;  5EPH A;  2PT7 A;  1XGJ A;  2W1T A;  2J8Y A;  3VP4 A;  3UY6 A;  3GDI A;  5CHM A;  5CER A;  2IA2 A;  2P7J A;  3RFB A;  1S4S A;  2QWS A;  2ZMF A;  2QJ5 A;  3H82 A;  4KQQ A;  3P98 A;  1YLZ A;  4YNR A;  4WBG A;  2Y2I A;  3UB7 A;  4H6J B;  1YLJ A;  4LV0 A;  1K55 A;  2G2W A;  4CLC B;  5HWT A;  2HJE A;  4BBU A;  3PAE A;  4R6L A;  3JVV A;  4X1L A;  2ZM0 A;  3SS3 A;  4WMC A;  3U4L P;  2C5W B;  3SW1 A;  1NWZ A;  5F1F A;  2PR5 A;  3HLF A;  1PI4 A;  4ZDX A;  2ZJ9 A;  1MKI A;  4H6J A;  1ZG4 A;  4CLC A;  3CWF A;  1OTD A;  5TBM A;  3E4P A;  3T4Q A;  4U0X A;  4GNU A;  1OJG A;  1YLY A;  1MC0 A;  3BFG A;  1O7E A;  1T1B A;  4WEK A;  5A8B A;  3PTE A;  5FDS A;  3DTM A;  3O5Y A;  2V1B A;  5CTM A;  4OH0 A;  3F1P A;  3T4L A;  4EQ1 A;  4KZ7 A;  5F5Y A;  5E2E A;  2VX8 A;  3I7J A;  4LRZ E;  4HI4 A;  5IT5 A;  4Y7P A;  4R23 A;  4WYY A;  4OOM A;  1G6O A;  3Q7Z A;  1T1C A;  1IKG A;  4CPK A;  3CZD A;  3UO9 A;  3KSG A;  4PM6 A;  2B02 A;  2QMI A;  1N9O A;  1W8Y A;  4HBT A;  3PBS A;  3G34 A;  1ES2 A;  2XEP A;  1S4R A;  3HLB A;  3LR5 A;  2W3H A;  3KSF A;  1XFQ A;  1P9W A;  5FAT A;  3IX4 A;  2R9W A;  1ERQ A;  4FCF A;  1P97 A;  3BM6 A;  1Y28 A;  2VK3 A;  1E25 A;  3FWL A;  3HLW A;  5FQJ A;  2HDU A;  1QMF A;  3HJI A;  4DE1 A;  3WRT A;  3LR0 A;  2PHY A;  5HL1 A;  5CGX A;  5G4Y A;  2W3E A;  3OCL A;  3IS2 A;  4S2L A;  1TF1 A;  4MN7 A;  3ITB A;  1HD8 A;  1BLS A;  4LGW A;  4B4X A;  4Y15 A;  4QU3 A;  3K3C A;  4QWO A;  3N7W A;  2IWB A;  5AVF A;  4E3O A;  5KSC A;  4K0W A;  4X55 A;  2P9V B;  4PM5 A;  4GB7 A;  2Y2L A;  5FSR A;  3A0R A;  3N8L A;  3KYE A;  5A90 A;  3NOT C;  4OPY A;  1FIK A;  2P08 A;  1SKO B;  1XA1 A;  1W63 Q;  3P09 A;  1G28 A;  4OP8 A;  2B18 A;  4BBV A;  4AFI A;  2BG1 A;  3VOZ A;  3A0S A;  1PWC A;  2P9V A;  4OOY A;  5EVI C;  2Y2J A;  3PAG A;  3UME A;  3PYP A;  5DF7 A;  3UB9 A;  1H8Y A;  1SKO A;  4OPZ A;  4R4R A;  5M1A A;  5F83 A;  1IFQ A;  3EOI A;  3C4P A;  3MXQ A;  1MY8 A;  3E2L A;  4N9L A;  2VV7 A;  5EOE A;  4R1G A;  5EVL A;  3HRE A;  1PYY A;  2M7U A;  3T1Q B;  3BRM A;  1K54 C;  4DJ2 A;  5AQ7 A;  3WS0 A;  3QNB A;  3KSI A;  1SCW A;  1K4E A;  5CHU A;  4OVD A;  2VGL S;  2O0Y A;  4BD0 A;  5EVI D;  4X69 A;  4OLD A;  4KG6 A;  3LUQ A;  4EWF A;  1S66 L;  1XP4 A;  4HH3 A;  3NJA A;  1OME A;  4GZB A;  3BW6 A;  4LPZ A;  4WM9 A;  2HGV A;  4HOI A;  4GW9 A;  3BY9 A;  5HDD A;  3EEA A;  4JGO A;  3W4O A;  4S2I A;  4U3T A;  2ZL1 B;  2WKI A;  5FDH A;  3T12 B;  1NLZ A;  3GMW A;  1IEL A;  1MWS A;  4I39 A;  4D60 A;  1NYM A;  2X71 A;  1DJB A;  3UPN A;  1PIO A;  3G30 A;  4KQD A;  4RA7 A;  3UDI A;  5HPF A;  1IEM A;  3LIE A;  3VE4 A;  4YIN A;  4OQ0 A;  2D01 A;  1TS7 A;  5EVI A;  4QY6 A;  3VP2 A;  3UE0 A;  1D7E A;  3TE8 A;  2E8I A;  4GLQ A;  2B95 A;  4KZB A;  1XJ2 A;  2V8C A;  4L9G A;  4RX3 A;  3ISG A;  2ZOI A;  3OPR A;  4UA7 A;  2Y2P A;  1G6A A;  1K54 A;  3V3S A;  1KGG A;  3LIF A;  1N9B A;  2K31 A;  3MQ0 A;  3PBT A;  3ZVW A;  5CEC A;  4X53 A;  3KYQ A;  2ZQ8 A;  1JVJ A;  1G68 A;  5FAO A;  5JYP A;  5MC7 A;  1GSW A;  2UWX A;  2ZC6 B;  3BEB A;  3ZNT A;  2HP9 A;  5DTK A;  1STZ A;  5IS1 A;  1J3W A;  3H7W B;  3T4K A;  4OQH A;  1OTE A;  2VZW A;  4IBR A;  4C75 A;  3LID A;  2KOI A;  3B47 A;  3MS6 A;  3FPV A;  2ZBB A;  3MQO A;  5CRF A;  1ES3 A;  4JXV A;  4E6X A;  4OON A;  1BLP A;  4NET A;  3H7W A;  2QZ6 A;  2JCH A;  4GOG A;  4R70 A;  3LFV A;  3IHB A;  1K6S A;  2VJW A;  4NXF A;  2HP5 A;  1S1Z A;  3S22 A;  4LEN A;  4I3A A;  4WEJ A;  2ZC3 B;  4HNB A;  3BJN A;  1WA9 A;  2X02 A;  1ZHH B;  3E2K A;  1NZU A;  3WS1 A;  3IWI A;  4HES A;  5IHV A;  2V0W A;  1JWZ A;  3LY3 A;  5L10 A;  5FAS A;  2EFX A;  3NEC A;  4X25 A;  3OC2 A;  5HW3 A;  5EE8 A;  1TS8 A;  1BSG A;  5AJG A;  5GLC A;  1AWI A;  3AGE A;  1XJ4 A;  3H9W A;  4WEL A;  4PM8 A;  3BEC A;  4QB8 A;  3MZD A;  2EX9 A;  4ARZ A;  3Q7V B;  3C4O A;  4LRY C;  2VKS A;  3UMD A;  3CPT A;  3QP5 A;  3EQV A;  4JF6 A;  4WZ5 A;  4KZ5 A;  1ONH A;  3JPU A;  1SDE A;  3IQA A;  2PAV P;  2P04 A;  5HD5 A;  3UDF A;  2GNX A;  2J9P A;  1N4O A;  2JKR M;  5DJU A;  5KMW A;  4XUX A;  4B9O A;  3MJQ A;  3IBJ A;  3BY8 A;  4CQH A;  2PU2 A;  2VLG A;  1K56 D;  4E3M A;  1V9Y A;  4LV3 A;  3V67 A;  5M18 A;  3E0Y A;  4OOL A;  3UDX A;  4MNR A;  3C7V A;  3CLO A;  4IBX A;  2QYB A;  1SKF A;  2HP6 A;  4HQA A;  4FUW A;  2GDN A;  4C6Y A;  1Q2Q A;  3T4T A;  3LIC A;  4PHT A;  3LR3 A;  2XQZ A;  4XT2 A;  3UPP A;  1IYS A;  2INW A;  2PYP A;  2A24 B;  3LI9 A;  4ESP A;  2ZOH A;  3UE6 A;  1GHM A;  1H0M A;  2PBD P;  1KDS A;  2O9B A;  2K7S A;  3F1O B;  4P6Z M;  3LGO A;  1MZU A;  3C8C A;  3GEC A;  5F69 A;  1RP5 A;  3LYX A;  3OPH A;  3DTK A;  2WUQ A;  5FI6 A;  1Z09 A;  1K56 A;  3MZF A;  4QPR A;  4DJ3 A;  2A24 A;  4YFM A;  4GJ4 A;  4MLL A;  3GVB A;  3JVU A;  1L2S A;  1A0K A;  4HJ4 A;  3UB5 P;  2HF6 A;  5TFQ A;  3S1Y A;  3AGD A;  3BFE A;  3UN7 A;  2WGI A;  1OT9 A;  3LIB A;  4N1X A;  5HD3 A;  4OPR A;  3EEH A;  4GHI A;  4N9K A;  3ZFZ A;  1L0D A;  1ESU A;  3RXX A;  2EXB A;  3G4P A;  4UQI M;  5E2F A;  3ZNY A;  1CI9 A;  3ITA A;  4NK3 A;  4QD4 A;  3NOP C;  5L2F A;  2W1R A;  2Y2Q A;  4PAU A;  3FZC A;  1SDN A;  1VET A;  4ZRR A;  2RCX A;  5TBM B;  4B93 A;  1XFN A;  3UB8 A;  3CMZ A;  4R3B A;  4E6W A;  5F1G A;  4EEP A;  3W2Z A;  3N6I A;  1I2W A;  5F82 A;  3KX0 X;  2V1A A;  1KE4 A;  1GA9 A;  3EGX C;  4WUJ A;  3F1P B;  3NOU C;  1I5Q A;  4Y0O A;  5CTN A;  1F98 A;  2OLU A;  2Y91 A;  1H8Z A;  3UE1 A;  2ZC5 B;  1ZC2 A;  3GR2 A;  4JXW A;  1T19 A;  3DTI A;  1DRM A;  1BLH A;  3A0V A;  5HWW A;  1T1A A;  3FKV A;  4MEZ A;  2JKG A;  2EX8 A;  1YKD A;  4S2N A;  2NUT C;  5FI2 A;  2XFT A;  2ZQD A;  2IWD A;  1ERO A;  2R9X A;  3DWZ A;  4NEE D;  3E4O A;  4Y5F A;  1LLB A;  3CG5 A;  3T1X A;  4IED A;  4GD8 A;  4EUV A;  3PR6 A;  5HAP A;  4Y3I A;  4Q0I A;  5KSH A;  2BTF P;  2QJ7 A;  1W79 A;  5CX7 A;  1FOF A;  3IS2 B;  5HPI A;  2J7V A;  5EOO A;  1NRJ A;  1ONG A;  4X1M A;  3K3D A;  4X56 A;  1JWV A;  2X01 A;  3NIA A;  2XH9 A;  4I5S A;  3OPL A;  3S7O A;  5JYO A;  3U2A A;  3VFF A;  2I72 A;  4OLG A;  1SHV A;  3VE3 A;  4MDZ A;  2OSU A;  1P9R A;  2V0U A;  4OP5 A;  2YKF A;  4EEU A;  1NRF A;  1PRQ A;  2ZLY A;  3G6O A;  1CEG A;  4PPR A;  2XRO A;  3E4Q A;  4WL9 A;  3F1N A;  2WZX A;  4GN2 A;  3L9K A;  3N4I A;  5DKK A;  2V2F F;  1K0K A;  4RX2 A;  4OKP A;  2ZD8 A;  4FH4 A;  3P7N A;  4ID4 A;  1K25 A;  5FQ9 A;  3DWK A;  3WRZ A;  4Y0U A;  1ES5 A;  3A3D A;  4CJN A;  2XA7 S;  3VMA A;  4UA6 A;  4EW7 A;  4G3W A;  2HDQ A;  5FQI A;  2H28 A;  2XK1 A;  4LCL A;  5A92 A;  3EWK A;  2WAF A;  1K38 A;  1FR6 A;  2Z2M B;  3NY4 A;  1ZG6 A;  2KDK A;  2XD1 A;  5EVE A;  3UE3 A;  2GZA A;  2WKQ A;  2K2N A;  3UB6 A;  3FV7 A;  3T4J A;  1X0O A;  2NUP C;  1KE3 A;  5GL9 A;  2XRN A;  3IF6 C;  1MXO A;  2WKE A;  2FZ0 A;  1FSY A;  2EA9 A;  3Q81 A;  2WYX A;  3B3X A;  3PBO A;  1PZO A;  3QP4 A;  4DF6 A;  5GHY A;  1CEF A;  3MZE A;  5FL3 A;  2PDR A;  3VFH A;  3PHY A;  4YOF A;  2DRW A;  5DFY A;  1EI5 A;  2VV8 A;  2XGN A;  5DKL A;  5HDS A;  2CMN A;  3D4F A;  4DN0 A;  1PI5 A;  1DJA A;  1CI8 A;  5EM0 A;  3W4P A;  1C3B A;  1N9N A;  2Y2G A;  2JC7 A;  4KG5 A;  1CJF A;  2JKR I;  4EBP A;  3NHQ A;  5EUA A;  3C5A A;  4KG2 A;  3E98 A;  5EVI B;  3FG8 A;  5CXW A;  4HHD A;  2Z6D A;  4Q0J A;  5IU1 A;  4UAA A;  5CHJ A;  4G3V A;  3SOI A;  1RGZ A;  1F5M A;  3PBN A;  2WGV A;  4DXB A;  2AVX A;  1AXB A;  2XLN A;  1KVL A;  3HUN A;  4E04 A;  4O7D A;  3DTE A;  3MR0 A;  2VGK A;  1KGF A;  2Q0O A;  3DW0 A;  3QNC A;  4HP4 A;  4I3J A;  4MCW A;  3A3I A;  5DF9 A;  2E8J A;  2J80 A;  3HLG A;  3IXH A;  3ZYT A;  1F2K A;  3PBQ A;  4N92 A;  4BEN A;  1E3U D;  3RXW A;  3T50 A;  2V20 A;  3WWX A;  1LHY A;  2DMW A;  3BFC A;  4KZ8 A;  1ERM A;  2ZQA A;  4KZ6 A;  4K0X A;  3CI6 A;  5GLB A;  5HAI A;  5G18 A;  2VEA A;  3M2J A;  2WGW B;  1Q2P A;  3HLC A;  3CHW P;  1H3Q A;  1L0G A;  2OV5 A;  4M3K A;  2V1Z A;  2G7U A;  3DBA A;  1CK3 A;  1W63 M;  5DFX A;  4DE2 A;  4KEN B;  2WGW A;  5FEF A;  5HZH A;  4FOF A;  1IYP A;  4HBU A;  4RVA A;  3IWQ A;  3M2K A;  2KX6 A;  4I38 A;  5EFW A;  4LFU A;  4LRX C;  4F3L B;  3FKW A;  2VGJ A;  2HDS A;  1N9L A;  4GS9 B;  1YT4 A;  4BL2 A;  1E3U A;  5J7E A;  4IVK A;  4II7 A;  4BLM A;  4P6Z S;  3IF5 A;  3NDE A;  3M6B A;  4F3L A;  2O9A A;  4PM9 A;  4GS9 A;  3SS5 A;  4BMW A;  1E4D A;  1LL5 A;  1O07 A;  1I2S A;  3LO7 A;  2O9C A;  1TS6 A; 
#chains in the Genus database with same CATH homology
 2GX5 A;  3PBS A;  4QPR A;  4DJ3 A;  1OJ5 A;  1S4R A;  2A24 A;  3LR5 A;  3MQQ A;  4GJ4 A;  2W3H A;  3KSF A;  1XFQ A;  2OOL A;  1P9W A;  4HY8 A;  2M7V A;  3JVU A;  1OTB A;  4HJ4 A;  1P97 A;  1Y28 A;  2HF6 A;  4ARZ B;  4R38 A;  1IOU A;  4JGP A;  2WKR A;  1OT9 A;  3LIB A;  5HD3 A;  4PKY A;  4EES A;  3HJI A;  3EEH A;  3LR0 A;  2PHY A;  4GHI A;  3ZQ5 A;  5HSQ A;  2Y79 A;  5G4Y A;  2W3E A;  3PXP A;  3OCL A;  5K5B A;  3IS2 A;  4L0L A;  4M4X A;  1TF1 A;  1LSV A;  4MN7 A;  1UWN X;  2OWH A;  4UQI M;  1BYW A;  3NOP C;  3D3O A;  1F9I A;  2PR6 A;  2I9V A;  2GJ3 A;  3K3C A;  4UEY A;  2W1R A;  4PAU A;  5LBR A;  5AVF A;  4FSF A;  4ZRR A;  5L8M A;  1YAX A;  4WLA A;  4R3A A;  3VOL A;  3P01 A;  3TJZ C;  1OT6 A;  5TBM B;  4B93 A;  1XFN A;  3A0R A;  3UB8 A;  3S7Q A;  1LSW A;  3LR4 A;  3NOT C;  2W3D A;  1S1Y A;  4EEP A;  3OBF A;  3W2Z A;  2P08 A;  1P0Z A;  2W3G A;  3KX0 X;  1W63 Q;  3BQ8 A;  2V1A A;  5TJJ A;  4XT2 B;  1G28 A;  4EU0 A;  3EGX C;  4WUJ A;  2B18 A;  3F1P B;  3NOU C;  3FPW A;  3CAX A;  4NKP A;  4BBV A;  4AFI A;  2XA7 M;  3A0S A;  1F98 A;  2JKT I;  3UME A;  3PYP A;  4JGQ A;  3R7W B;  3UB9 A;  1T19 A;  4IUK A;  1DRM A;  3A0V A;  5HWW A;  1T1A A;  1IFQ A;  2JN7 A;  1DP8 A;  2MJ6 A;  1YKD A;  1UWP X;  3EOI A;  2NUT C;  4NXE A;  3MXQ A;  1VB6 A;  4HP9 A;  2VV7 A;  2M7U A;  2YKH A;  3MMH A;  4DJ2 A;  1DP9 A;  4LLO B;  4KQO A;  4NEE D;  4GCZ A;  3KO6 A;  3KSI A;  3R7W A;  3E4O A;  5HDC A;  4BWI A;  4Y5F A;  2PD8 A;  3FC7 A;  4O8G A;  5I5L A;  1TS0 A;  1TD5 A;  3RTY A;  1LSX A;  2OWJ A;  2VGL S;  2O0Y A;  2WKP A;  2VGL M;  4EUV A;  3PR6 A;  3LUQ A;  1JNU A;  3EGD C;  4Y3I A;  4DMZ A;  1S66 L;  3S7P A;  4Q0I A;  1YSQ A;  4HH3 A;  2Z6C A;  5KSH A;  3NJA A;  2QJ7 A;  4GHI B;  4CLC C;  5CX7 A;  1DP6 A;  3BW6 A;  4LPZ A;  3IS2 B;  4PKY G;  2JKT M;  3BQA A;  1KOU A;  5HPI A;  2HGV A;  4HOI A;  4GW9 A;  3BY9 A;  1NRJ A;  4BJP A;  5HDD A;  3EEA A;  5KIZ A;  1LT0 A;  4JGO A;  1ODV A;  3K3D A;  2D02 A;  3KSH A;  4ETX A;  1NLZ A;  4HIA A;  3TRC A;  2VA0 A;  4I5S A;  3OCN A;  3S7O A;  4I39 A;  2QHK A;  1EW0 A;  3U2A A;  5C5K A;  2L4R A;  4KQD A;  3MF0 A;  4UQI S;  3VE3 A;  4MDZ A;  4CLC D;  5HPF A;  1XJ3 A;  4MN6 A;  3LIE A;  3VE4 A;  4IJG A;  4ME4 A;  1P9R A;  2D01 A;  3T4O A;  2V0U A;  4EEU A;  2YKF A;  5F6A A;  1TS7 A;  4L9F A;  1T18 A;  3G6O A;  2XSS A;  1OPX A;  1D7E A;  2XRO A;  3E4Q A;  4WL9 A;  3F1N A;  3TE8 A;  4BBT A;  4GLQ A;  5DKK A;  1XJ2 A;  3OLO A;  2A2L A;  2Y8H A;  4KUK A;  4L9G A;  3P7N A;  3ICY A;  2ZOI A;  5G4Z A;  1GSV A;  4IUH A;  4L9E A;  3HJK A;  2XA7 S;  4YWZ A;  4IHQ A;  2KLI A;  4EW7 A;  4G3W A;  3LIF A;  2H28 A;  5DJT A;  2K31 A;  3MQ0 A;  3EWK A;  1H8M A;  3PBT A;  2W27 A;  2R78 A;  1UGU A;  1OTA A;  3KYQ A;  3S7N A;  2KDK A;  3UE3 A;  2GZA A;  2WKQ A;  3PBR A;  1GSW A;  2K2N A;  4Y2F A;  5MC7 A;  3UB6 A;  1ZTU A;  3MFX A;  3T4J A;  1X0O A;  4Q0H A;  2NUP C;  2BAS A;  4CLC E;  3CIT A;  2XRN A;  4G3K A;  1STZ A;  1XJ6 A;  3VV4 A;  5IS1 A;  3H7W B;  3T4K A;  2PYR A;  2FZ0 A;  2EA9 A;  1NLY A;  4RQ9 A;  5HL6 A;  4EET B;  1OTE A;  3PBO A;  2VZW A;  2LB5 A;  2J3T C;  5FL3 A;  3LID A;  2KOI A;  3B47 A;  2PDR A;  3FPV A;  3K2N A;  1LL8 A;  2ZBB A;  3PHY A;  3MQO A;  2VV6 A;  4YOF A;  3KYZ A;  5DFY A;  4MN5 A;  2VV8 A;  5DKL A;  3LIA A;  1VHM A;  2W0N A;  5HDS A;  2CMN A;  2HJ9 C;  3H7W A;  4HH2 A;  1GSX A;  4O01 A;  2O99 A;  4DN0 A;  4R70 A;  2OAP 1;  3LFV A;  3BWL A;  3CUE C;  4KUO A;  3B33 A;  1N9N A;  2VJW A;  3EQU A;  4NXF A;  2EWW A;  2W1T B;  1S1Z A;  5HWV A;  2L1M A;  2JKR I;  4I3A A;  4WEJ A;  5J3W A;  3NHQ A;  4HNB A;  3F1O A;  3BJN A;  4WN5 A;  3E98 A;  3LI8 A;  3OOV A;  4HJ3 A;  3FG8 A;  1WA9 A;  4NXG A;  4ETZ A;  2JHE A;  4HHD A;  1ZHH B;  2Z6D A;  4Q0J A;  5IU1 A;  2M1C A;  2FH5 A;  2L0W A;  4G3V A;  3F1N B;  2J3T D;  3IBR A;  1V9Z A;  2V0W A;  2OAQ 1;  3H82 B;  2ZMV A;  1F5M A;  3PBN A;  3R4K A;  3OC2 A;  2PT7 A;  2W1T A;  4E04 A;  1TS8 A;  5AJG A;  4EER A;  3MR0 A;  1XJ4 A;  3H9W A;  4HP4 A;  4I3J A;  4WEL A;  4MCW A;  5DF9 A;  2J80 A;  3GDI A;  3ZYT A;  2IA2 A;  4ARZ A;  2P7J A;  3PBQ A;  4LRY C;  3RFB A;  1S4S A;  2QWS A;  2ZMF A;  2QJ5 A;  2VKS A;  3H82 A;  3T50 A;  3UMD A;  4YNR A;  4EXO A;  2DMW A;  3EQV A;  3C2W A;  3UB7 A;  3C38 A;  2V9A A;  2LB9 A;  3HCY A;  2EWV A;  1YSP A;  2HV1 A;  2P04 A;  3CI6 A;  4H6J B;  5HD5 A;  2GNX A;  4CLC B;  3RH8 B;  2JKR M;  2VEA A;  5DJU A;  3C30 A;  4B9O A;  1S67 L;  2PD7 A;  1OTI A;  5HWT A;  2HJE A;  4BBU A;  3MJQ A;  4Z1W A;  3IBJ A;  4R6L A;  3BY8 A;  1H3Q A;  3JVV A;  4CQH A;  3T4S A;  2VLG A;  4O0P A;  3TW8 A;  1D06 A;  1V9Y A;  3B42 A;  3SW1 A;  1NWZ A;  4JGR A;  4NXB A;  2G7U A;  2PR5 A;  4I3I A;  3ULF A;  3V67 A;  3DBA A;  1MKM A;  3E0Y A;  5F68 A;  2J3W A;  4H6J A;  1W63 M;  4OOL A;  5J4E A;  4CLC A;  5DFX A;  3CWF A;  1OTD A;  5TBM A;  3CLO A;  3E4P A;  2QYB A;  5HZH A;  4FOF A;  3T4Q A;  4HQA A;  1OJG A;  1MC0 A;  4HJ6 A;  4I38 A;  2KX6 A;  5EFW A;  3T4T A;  5AVE A;  4LRX C;  3LIC A;  4F3L B;  1T1B A;  4WEK A;  5A8B A;  3CUE A;  1N9L A;  4GS9 B;  4PHT A;  3LR3 A;  3O5Y A;  4XT2 A;  2V1B A;  3F1P A;  4WF0 A;  3T4L A;  4EQ1 A;  2INW A;  2PYP A;  5F5Y A;  2A24 B;  3LI9 A;  2VX8 A;  2ZOH A;  4LRZ E;  4HI4 A;  5J7E A;  3UE6 A;  5IT5 A;  2QKP A;  4OOM A;  1G6O A;  4II7 A;  4P6Z S;  2O9B A;  2K7S A;  3F1O B;  4P6Z M;  2W3F A;  4MMN A;  1T1C A;  3D72 A;  1MZU A;  3C8C A;  4F3L A;  4K08 A;  2O9A A;  3GEC A;  5F69 A;  4GS9 A;  3KSG A;  3LYX A;  2B02 A;  4BMW A;  1N9O A;  2O9C A;  1TS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...