3IF6B

Crystal structure of oxa-46 beta-lactamase from p. aeruginosa
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
242
structure length
242
Chain Sequence
VVIRSDWKKFFSDLQAEGAIVIADERQAKHTLSVFDQERAAKRYSPASTFKIPHTLFALDADAVRDEFQVFRWDGVNRSFAGHNQDQDLRSAMRNSTVWVYELFAKDIGEDKARRYLKQIDYGNVDPSTIKGDYWIDGNLKISAHEQILFLRKLYRNQLPFKVEHQRLVKDLMITEAGRSWILRAKTGWEGRFGWWVGWIEWPTGPVFFALNIDTPNRTDDLFKREAIARAILRSIDALPPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords OXA-46 oxacillinase
publication title Crystal structure of the narrow-spectrum OXA-46 class D beta-lactamase: relationship between active-site lysine carbamylation and inhibition by polycarboxylates
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 70
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3if6B00
2HDQA 4KZ4A 1NZUA 3MZDA 5EOOA 3ZCZA 4K0WA 5CTMA 3FZCA 3G35A 5U47A 1K56D 5HX9A 4OPYA 3FKVA 3NBLA 1HTZA 2ZJ9A 3VP4A 1K57A 3BFFA 4LENA 5EVIB 3BECA 1K4FA 1ALQA 1PW8A 1XPBA 3C5AA 4JXGA 4OOLA 4FD8A 3UDFA 2WGWA 4ZJ1A 1BUEA 4PM7A 1LL5A 1XGIA 3P09A 3WS1A 2C6WB 2P9VB 2J7VA 4NK3A 2WKHA 4CJNA 1C3BA 2C5WB 3OPLA 4LCLA 1L0GA 1CI8A 5HFOA 1E25A 2JBFA 4QY6A 4Y7PA 2VGKA 1YLTA 4S2KA 4N9LA 2A3UA 2WAFA 4MLLA 5FI2A 3MKFA 2WYXA 2V1ZA 3IT9A 4UA9A 2HP5A 2BLSA 3VOZA 4BLMA 1ERMA 5CRFA 4HESA 1EI5A 1MBLA 4N9KA 3LY3A 1IYOA 3A3EA 3BFDA 3LCEA 1NRFA 3BYDA 5EOEA 3MXRA 4Y0OA 3B3XA 4DE1A 4PM6A 1K4EA 3ZVWA 4L0LA 1RGZA 2ZQ9A 4HEFA 5DTKA 3IF6B 3D4FA 4GD6A 1CEFA 1XKZA 1GHPA 5J8XA 3BFCA 3MKEA 3MXSA 3MBZA 5KZHA 4IBRA 2HP9A 5EE8A 1GA0A 4KQQA 5A90A 2Y2JA 3QNBA 2H0YA 5CEBA 4PM8A 1MY8A 5GLDA 1LI9A 1XA7A 3ZG7B 1S6RA 4OQGA 4WMCA 3I7JA 1SHVA 1W5DA 1LI0A 4KZ3A 5EECA 3G32A 3UPNA 4DDYA 5L2FA 1Q2QA 2Q9NA 4ZDXA 1KVLA 2ZQ7A 1SCWA 3BM6A 5JYOA 4OQ0A 1M6KA 1VQQA 3AGDA 3S1YA 5DTTA 3N8RA 2Y55A 4S2OA 1JWPA 2CC1A 4WZ5A 2I72A 4WBGA 3UY6A 2EFXA 2EXAA 4R0QA 4OKPA 5TFQA 3GVBA 1YMSA 1PWGA 2ZLYA 3C4OA 4RX3A 4IBXA 4X56A 4ZJ2A 4WZ4A 2WZZA 1K55A 1EROA 2XD5A 3NC8A 3O87A 3ZNYA 4KZ9A 1GHIA 1IKGA 1W7FA 3ZG5A 5DF7A 1KDSA 2WADA 1YM1A 2RCXA 4K91A 1FR6A 3O3VA 1I2SA 1EWZA 3BEBA 4Y0TA 2XH9A 4N92A 4OH0A 4PMAA 4P6BA 3IWQA 4S2NC 4MBFA 1K6RA 2PBYA 1M40A 3G4PA 3OZHA 2R9WA 2ZC4B 2ZMAA 4KQRA 5TGFA 4JXWA 4RA7A 4S2JA 3DW0A 2H5SA 3A3IA 3HL9A 4B4XA 1ESUA 3E2LA 2Y2HA 1ESIA 3Q7VA 1YLWA 4DF6A 4KZAA 5AQBA 4X6TA 3NCKA 4E3JA 1IEMA 3SS5A 1NYMA 1ZG6A 3O88A 2ZM2A 3BFGA 2DNSA 3G2YA 2XEPA 2IWBA 1SDEA 2Z2MB 3PBOA 5HAIA 5CEDA 1NXYA 3GMWA 4ZBEA 1FQGA 1KE4A 4EV4A 1LL9A 3IXDA 3DWKA 1HVBA 4DXBA 2H0TA 4S2LA 1YMXA 2Y59A 2X71A 4QU3A 4QY5A 1W79A 5FATA 5GHXA 4KG5A 5EPHA 3HLFA 4IVKA 3EQVA 4MEZA 4KZBA 4C6YA 1QMEA 1O07A 2ZD8A 5KMWA 3MFDA 4E6XA 3E2KA 5KSHA 3O86A 4QD4A 5FQKA 5F1FA 4U0XA 1MKIA 4OP8A 3UN7A 3N7WA 2IWDA 4UA7A 4JXVA 4GD8A 1KE3A 1Z6FA 3FYZA 3IXBA 4X68A 2QMIA 3G30A 5DTSA 4DDSA 3IXGA 4JF4A 2H10A 3A3FA 3WS4A 1MWRA 1DJBA 4KZ7A 4BL2A 5EVIC 2HP6A 3VP3A 2V2FF 1YLJA 4LCMA 5I94A 3AGFA 3FKWA 1XA1A 4QHCA 3HUMA 1CEGA 3IF5A 3JYIA 2XFSA 4IEDA 4GZBA 5FQ9A 5M19A 1SDNA 1IELA 3Q81A 3CMZA 5CHMA 1K54C 5HL1A 5E43A 2Y2LA 4CPKA 3PBTA 1H8ZA 2Y2QA 5BOHA 3WS5A 1LLBA 1TDGA 2EX9A 1NZOA 4WYYA 5FQIA 1K6SA 3PBSA 3M2KA 4MBKA 5A93A 4UAAA 3A3JA 4OOMA 4KG2A 2Y2NA 3UE0A 1FSYA 1G68A 2XQZA 3NDGA 3OPRA 3WWXA 4OPZA 3IWOA 5CGXA 1ES4A 5A92A 2J9PA 4U0TA 4WMCD 1KGGA 1OMEA 3IWIA 2WGWB 4ZAMA 4BQMA 5F1GA 4WELA 4UA6A 3OCNA 4OVDA 1NJ4A 3V39A 1BT5A 3UPOA 4YFMA 3RXXA 3Q82A 4UHUA 1K57C 1Y54A 4DRTA 2OSUA 4DE3A 1K25A 2X02A 2DCFA 2Y91A 3OCLA 4OP5A 1GCEA 3IF6C 2X01A 3HLWA 4R1GA 3PTEA 5CXWA 4XUZA 1JVJA 4OPQA 1KGFA 5CECA 3ITBA 5AQAA 3VOYA 2ZQDA 3SH9A 1HD8A 1WYBA 2FFFB 3W4QA 3C4PA 4OLDA 4S2PA 4E3IA 1FCMA 4ZTKA 3ZHHA 4WM9A 1GA9A 3BFEA 3FV7A 4S2IA 5JYPA 3WRZA 1RGYA 1BULA 2HDSA 4PPRA 1I2WA 4S2NA 3Q1FA 3N4IA 3GR2A 5CHUA 2ZQ8A 1ZKJA 5EVLA 3SS4A 3ZG9B 3UPPA 4KENB 1BZAA 3FWLA 4BJPA 5FQJA 1ERQA 2UWXA 2ZM8A 5FI7A 3WS2A 3BRMA 4S2MA 4BD0A 3CJMA 3V50A 4LV1A 1YLPA 1H8YA 3ISGA 3CZDA 4P85A 1ES3A 1JWVA 3BLSA 3SH8A 2Y2MA 4FH2A 3N6IA 3VP0A 5TR7A 1FCNA 5AQ7A 1H5XA 4M3KA 1YQSA 2G2UA 3V3SA 1YLYA 3TG9A 1BSGA 2WGIA 4H8RA 3PBRA 5FASA 4HBTA 1TEMA 2XK1A 3G31A 3IHAA 4KG6A 1DJAA 4X55A 5FDHA 5HW3A 3A3DA 3G34A 5CGSA 2FFYA 4R3BA 1PWDA 1PZPA 1W8QA 4E6WA 5M18A 2WZXA 3M2JA 5CGWA 5M1AA 1TDLA 4DKIA 3W4OA 4O7DA 2J9OA 2PU2A 3HLBA 3LY4A 2WUQA 5G18A 1CK3A 2OLUA 1IYSA 4JF6A 1BLPA 1MWSA 3UDIA 1KGEA 3BLMA 5E2FA 5GL9A 4E3LA 4WZ5C 1DY6A 1ES2A 5IHVA 4OQHA 4RVAA 2Y2IA 1KDWA 3OPHA 4OLGA 5DF8A 4KQOA 2DRWA 5EVIA 5FAQA 3NI9A 1FR1A 2XD1A 3C7VA 1L2SA 1LHYA 2V20A 2ZM0A 4D2OA 3S22A 5GLAA 3ZNTA 3PAGA 4QB8A 1MWUA 2E8IA 4FSFA 5HAPA 4B88A 4OQIA 3UE3A 4JXSA 1K54A 3UNWA 4OPRA 1HZOA 1RP5A 2ZQCA 3LO7A 5DF9A 1PYYA 3NY4A 5F82A 3Q7ZA 5FQQA 1U60A 5GLCA 4C75A 1IYPA 3Q7VB 4JLFA 4RYEA 4R3JA 2BG1A 5CHJA 3W4PA 1BTLA 2R9XA 3ITAA 1IKIA 4R4SA 3SS3A 2WKIA 4Z9QA 3HUNA 4ZJ3A 3M6HA 1XGJA 4EQIA 4FH4A 2ZC5B 2EX8A 2IWCA 2Q9MA 1E3UA 5GHYA 3ZFZA 2XFTA 5F83A 4JBFA 1AXBA 1L0DA 1SKFA 4FCFA 3CG5A 1VM1A 4HBUA 3HVFA 3ZVTA 1ZG4A 2WK0A 3IF6A 1XX2A 2G2WA 4N1XA 4WEKA 3IXHA 5CERA 3HLGA 1FSWA 2XF3A 3P98A 4ID4A 3PBQA 2Z2LB 4DXCA 1N9BA 3HLDA 5E2EA 1K56A 3IH9A 1IYQA 3HLCA 4Y0UA 4A5RA 1FOFA 3HBRA 1PZOA 5GLBA 1FCOA 4WEJA 3ZG0A 1PW1A 2WKEA 2QZ6A 3RJUA 4MBHA 3GV9A 1KE0A 3DTMA 4GOGA 4U3TA 4X69A 5E2HA 2ZC6B 5FAOA 1NYYA 1L0EA 3QNCA 4JPMA 2OV5A 1CI9A 2Y2OA 2ZQAA 4P0MA 1G6AA 1W8YA 3LEZA 3V5MA 3NDEA 2ZC7A 1N4OA 1PWCA 5EUAA 4Q8IA 3DWZA 3N8LA 4QJGA 4DE0A 2HPBA 2EX2A 1MXOA 3G2ZA 5FI6A 4N1HA 4E3KA 1KVMA 4YINA 1ONHA 2VGJA 4XXRA 1BLCA 1J9MA 3UO9A 3WRTA 3VMAA 2JCHA 3MZFA 1Q2PA 2A49A 3C7UA 4GKUA 3IHBA 3GRJA 4OOYA 3IQAA 5KSCA 5AQ9A 1ES5A 4MNRA 3VFFA 3SOIA 3VP1A 4PM5A 4EWFA 3SH7A 4BL3A 4P87A 3WS0A 2Y2GA 4LV2A 3VFHA 3VP2A 5HAQA 2Y4AA 2WGVA 5FQMA 4X53A 1QMFA 3OPPA 3PAEA 4XUXA 4BENA 5FAPA 2ZC3B 4GB7A 2EFUA 2EX6A 3N8SA 3AGEA 1K38A 4KZ8A 1PI4A 5FSRA 1MPLA 1E4DA 4C3QA 3GQZA 3IH8A 1BLSA 2EXBA 4R4RA 5FA7A 4JF5A 2OLVA 3S4XA 3Q07A 1JTGA 3EQUA 3GTCA 2RL3A 2P74A 3RXWA 2JE5A 4JKTA 2Y2KA 5EVID 3UDXA 3ZDJA 3GSGA 4GN2A 1I5QA 1WYCA 4LV3A 4E3OA 3M6BA 3TSGA 5GHZA 3ZG8B 2XGNA 3PBNA 4IVIA 4K0XA 3VSKA 3W8KA 2QPNA 3TOIA 1O7EA 3HLEA 4LV0A 4NETA 4EUZA 4PM9A 1GHMA 1RCJA 2Y2PA 1S0WA 1YLZA 1L0FA 1NY0A 1YT4A 2B5RA 4F94A 3MZEA 4GDBA 3UE1A 1TVFA 4OONA 1K55C 2WAEA 4GDNA 5A91A 2PU4A 1JWZA 1PI5A 4R23A 1PIOA 5HARA 4DE2A 4EBLA 1BLHA 4BD1A 1WE4A 4RX2A 1XP4A 2P9VA 4EBPA 1ONGA 1MWTA 2XLNA 2HDUA 3QHYA 5CTNA 1E3UD 1XXMA 2XDMA 3V3RA 3NIAA 4E3NA 4E3MA 4KZ5A 1JTDA 2J8YA 3OC2A 5D3OA 3ZGAB 1DJCA 2XR0A 5E2GA 4EBNA 4B4ZA 3HREA 2HDRA 2GDNA 5DVAA 1ZC2A 3HUOA 4KZ6A 4GNUA 3VSLA 2JC7A
chains in the Genus database with same CATH superfamily
3W2ZA 5CTMA 3FZCA 3NBLA 2ZJ9A 1VETB 3BFFA 4CQHA 4JXGA 5F6AA 3NOUC 4ZJ1A 4PM7A 2BTFP 3E4PA 3P09A 3WS1A 2C6WB 3RTYA 2WKHA 1SZVA 4HOIA 1C3BA 4LCLA 1L0GA 2JBFA 4Y13A 2HJ9C 4Y7PA 2VGKA 3DTKA 4N9LA 2ZL1B 5LBRA 3IT9A 1VB6A 1MBLA 3LY3A 3A3EA 1NRFA 3MXRA 1G5UA 4DE1A 2QWSA 5HWVA 4L0LA 3F1NB 1RGZA 3IF6B 1XKZA 4Y3IA 3MKEA 3MXSA 4F3LB 4IBRA 5EE8A 3F1PA 4PM8A 1LI9A 4MDZA 1S6RA 4OQGA 5HD5A 1SHVA 3QP1A 3SW1A 2Q9NA 1SCWA 5DTTA 1HLUP 2KOIA 3H82B 5J7EA 4WBGA 2EXAA 4X56A 5L10A 3T1XA 5AVFA 3O87A 3ZNYA 5G4YA 1GHIA 1IKGA 1W7FA 5DF7A 2KX6A 3IX4A 5HDSA 4Q0IA 5AJGA 4Y0TA 4N92A 2QJ5A 4MBFA 4HP9A 3OZHA 4X1MA 4RA7A 4S2JA 3DW0A 2H5SA 4GHIA 4LRZE 4X6TA 3FC7A 3NCKA 1IEMA 3SS5A 3O88A 3SZTA 4K08A 2ZM2A 2DNSA 1SDEA 1NXYA 3GMWA 1KE4A 1P9WA 4EV4A 3IXDA 4QU3A 5GHXA 5FATA 3EOIA 4MEZA 4C6YA 5KSHA 1O07A 4QPRA 3E2KA 5FQKA 1DP9A 4U0XA 3VE3A 4UA7A 3D3OA 3MXQA 3FYZA 3G6OA 1IOUA 5HPIA 1MWRA 1DJBA 3DAVA 2V2FF 4I3IA 5EFWA 3JYIA 5DKKA 2XFSA 4GZBA 1SDNA 3Q81A 3CMZA 5HL1A 4WN5A 5MC7A 5BOHA 4FOFA 2EX9A 5FQIA 3PBSA 4OOMA 4KG2A 2Y2NA 3MF0A 1NLZA 3OPRA 1CJFA 2WGWB 4BQMA 5F1GA 4OVDA 3Q82A 1Y54A 2DCFA 4GLQA 4UEYA 3HLWA 4R1GA 3PTEA 4I5SA 3MMHA 1S4RA 5CECA 3CITA 3CPTB 4NXBA 1WYBA 2G7UA 2ZOIA 5DJUA 2EWVA 3MQ0A 4S2PA 3ZHHA 4EQ1A 1GA9A 3BFEA 3C38A 3FV7A 4EUVA 1ZTUA 5TJJA 3R7WA 4ARZB 4S2NA 3N4IA 1OTIA 1ZKJA 4HH2A 4KENB 3P7NA 3H7WA 3WS2A 4MN5A 3NULA 4Y17A 1H8MA 1W63M 3VP0A 5TR7A 2GNXA 1D06A 2Y79A 3CWFA 4HBTA 3G31A 2W3HA 3T4KA 3G34A 5CGSA 4R3BA 2QYBA 5M18A 1OTEA 1TDLA 4DKIA 3BWLA 1LSXA 5J4EA 4O8GA 4D60A 1KGEA 2W3DA 1DY6A 4OQHA 2Y2IA 4KQOA 3NI9A 2XD1A 3O5YA 3MR0A 4D2OA 3ZNTA 3PAGA 1MWUA 5HAPA 1UWNX 1K54A 3UB7A 4OPRA 1HZOA 4DMZA 2ZQCA 5F82A 2XSSA 5GLCA 3A0RA 3TE8A 3Q7VB 3EEAA 3QP4A 2R9XA 3ITAA 3SS3A 2WKIA 4FH4A 2ZC5B 1P9RA 4EEPA 2IWCA 3ZFZA 4EU0A 1L0DA 3DTEA 1SKFA 2J80A 1ZG4A 2WK0A 2G2WA 4N1XA 4WEKA 1FSWA 2XF3A 1ODVA 4DXCA 5F69A 4A5RA 3DTMA 1YSPA 1S66L 4U3TA 5FAOA 1NYYA 1L0EA 1YPRA 3QNCA 1CI9A 3FG8A 4MN6A 4MN7A 1G6AA 2QHKA 2NUTC 3V5MA 1PWCA 3BW6A 4DE0A 2EX2A 2L1MA 3B47A 2ACGA 3VMAA 3MZFA 1Q2PA 2A49A 4GKUA 4OOYA 3D9YA 1ES5A 3VFFA 3UB9A 1VHMA 5FEGA 2WGVA 3PAEA 2L0WA 4XUXA 3VE4A 2ZC3B 3N8SA 2KLIA 3S7OA 3AGEA 3C30A 5HDCA 4L9GA 4Y2FA 5FSRA 3MSHA 3IH8A 1BLSA 1OJ5A 2EXBA 4R4RA 5FA7A 4Q0HA 5F5YA 5C5KA 5G4ZA 3BQAA 2W0NA 4GN2A 5KIZA 1LT0A 4LV3A 4E3OA 3M6BA 1S1ZA 5TBMA 3TOIA 3HLEA 2W3EA 4IJGA 4PM9A 2VK3A 3EWKA 1GHMA 5J3WA 1P97A 1TVFA 5HARA 4DE2A 3LI9A 4EBLA 4RX2A 1MWTA 1E3UD 2XDMA 2O9BA 2XA7S 3NIAA 4KZ5A 5D3OA 4YWZA 1K0KA 1DJCA 2XR0A 4II7A 1L3LA 4EBNA 3LIAA 2HDRA 4S2MA 2HDQA 1NZUA 3B33A 5HWTA 3ZCZA 5U47A 1K56D 4H6JB 1HTZA 4R6LA 4OOLA 3UDFA 4ME4A 3QP6A 1BUEA 2JKRI 2P9VB 2J7VA 2B18A 4Z1WA 4QY6A 4DJ2A 3K2NA 2A3UA 2WAFA 2V1ZA 2HP5A 3VOZA 2OAQ1 5CRFA 4HESA 1EI5A 3BY9A 3HJKA 4N9KA 1IYOA 1PFLA 4DN0A 4Y0OA 3L9KA 2J3TC 4HEFA 3S7QA 3T4TA 5DTKA 3D4FA 1CEFA 5KZHA 2K31A 4KQQA 3QNBA 1MY8A 1XA7A 3DBAA 3ICYA 3ZG7B 4BBVA 5HD3A 5F68A 2PT7A 3MQOA 2M7UA 5L2FA 3LR4A 3IBJA 4WF0A 2ZQ7A 1VQQA 5DKLA 3JVUA 1JWPA 2CC1A 3FPVA 2D02A 5TFQA 1D7EA 1TS7A 3GVBA 1YMSA 3OOVA 2VGLM 1UGUA 1YAXA 3MFXA 1EROA 1N9NA 3CAXA 2RCXA 4K91A 1FR6A 1EWZA 2GX5A 2XH9A 1XJ2A 5IT5A 4P6BA 3IWQA 1Y4OA 4E04A 2ZC4B 4KQRA 4JXWA 3KYQA 3A3IA 1ESIA 3UB8A 1TD5A 4E3JA 1XFNA 1ZG6A 5HZHA 2UV0E 2XEPA 5CEDA 2Z2MB 3PBOA 2HV1A 3LIEA 2K7SA 4BWIA 1LL9A 2Y59A 3HLFA 4KZBA 4HJ3A 5KMWA 5F1FA 4OP8A 3UN7A 2IWDA 4LFUA 4JXVA 1Z6FA 4X68A 3IXGA 1V9YA 2H10A 3A3FA 3TRCA 3WS4A 2VKSA 4KZ7A 5EVIC 3HJIA 3AGFA 3IS2A 3FKWA 3HUMA 1CEGA 2B95A 5AVEA 3CI6A 4CPKA 2PRFA 3WS5A 3UMDA 3ZQ5A 2Y8HA 4MBKA 4HQAA 4UAAA 3T12B 1FILA 5CX7A 1G68A 2XQZA 3NDGA 4OPZA 3IWOA 1ES4A 2VX8A 2XRNA 2DMWA 2J9PA 4U0TA 4WMCD 4XT2A 3IWIA 4ZAMA 4X25A 4HP4A 3OCNA 1NJ4A 1BT5A 4HH3A 4YFMA 2ZBBA 4DE3A 1K25A 3PR6A 4OP5A 1GCEA 1PRQA 5CXWA 4XUZA 1KGFA 3LR3A 2PHYA 5AQAA 2ZQDA 2D01A 1HD8A 4P6ZM 3W4QA 1FCMA 4WM9A 2PR6A 2VV7A 1RGYA 5DFXA 3S7NA 4PPRA 4QWOA 5CHUA 2ZQ8A 5FL3A 3UPPA 4CLCA 1OT6A 4BJPA 2UWXA 4O01A 5K5BA 3A0SA 1NRJA 3CJMA 1OJGA 3ISGA 1H8YA 5DFYA 3BLSA 3UB5P 3SH8A 2Y2MA 1YKDA 2PAVP 1YQSA 1YLYA 3TG9A 1BSGA 2HF6A 2WGIA 5FASA 4GW9A 3NHQA 4WL9A 2A24A 4I3AA 1XJ3A 1TEMA 2XK1A 3IHAA 4KG6A 3A3DA 1PWDA 3R7WB 1PZPA 4E6WA 4KQDA 3M2JA 2J9OA 3HLBA 3LY4A 2BASA 2OLUA 2VJWA 4JF6A 3T1SA 4EERA 1SKOA 5IHVA 1GSVA 1VETA 1XJ6A 1L2SA 2E8IA 4FSFA 2LB5A 3UE3A 4JGPA 3UNWA 3NY4A 4I39A 3Q7ZA 1U60A 4C75A 4JLFA 2BG1A 1BTLA 4R4SA 3LUQA 4Z9QA 4ZJ3A 3EEHA 3M6HA 1XGJA 2CMNA 4EQIA 5GHYA 5F83A 3F1NA 4FCFA 3CG5A 2HJEA 2V1AA 3IF6A 3E4QA 4F3LA 3P98A 4ID4A 2Z2LB 3LR0A 5E2EA 3IH9A 1IYQA 1NLYA 4Y0UA 3LGOA 2P7JA 1PZOA 2JHEA 1FCOA 1PW1A 4R38A 2WKEA 3RJUA 4GOGA 4X69A 2ZC6B 4JPMA 1CQAA 1EW0A 2Y2OA 2WKRA 3BJNA 3NDEA 4Q8IA 3N8LA 4ETXA 2HPBA 1MXOA 4N1HA 4E3KA 1KVMA 3IHBA 3GRJA 4MNRA 3VP1A 4PM5A 4EWFA 3SH7A 4HJ4A 4BL3A 4P87A 4MCWA 3WS0A 5IU1A 4Q0JA 2Y4AA 5FQMA 4X53A 3LR5A 3OPPA 2EFUA 2PBDP 1VEUB 1K38A 3UMEA 4KZ8A 1E4DA 2JN7A 3S4XA 3Q07A 1JTGA 5EVID 4JKTA 3LIBA 3UDXA 3V67A 1N9OA 3PBNA 4EUZA 1OPXA 1MZUA 1YLZA 1NY0A 1YT4A 2B5RA 2K2NA 4OONA 4HJ6A 4GJ4A 1PI5A 1PIOA 4HNBA 3PYPA 1T18A 2XLNA 2OWJA 3QHYA 3V3RA 3PXPA 4E3MA 3ZGAB 5E2GA 3MQQA 3VOLA 5DVAA 2GDNA 4I38A 3CUEA 1S1YA 1ZC2A 3HUOA 4KZ6A 4GNUA 3VSLA 3W4PA 4KZ4A 3MZDA 4K0WA 4NKPA 4O0PA 5HX9A 1K57A 4LENA 5EVIB 2PD8A 3BECA 1K4FA 1ALQA 1PW8A 1XPBA 2WKQA 3H9WA 2H28A 2WGWA 1LL5A 2W27A 4BBTA 1Y28A 4YOFA 4NK3A 4CJNA 4GS9B 4YNRA 3OPLA 1CI8A 4HIAA 1E25A 4X1LA 3RFBA 1YLTA 2NUPC 2V8FA 2AVXA 4BLMA 1ERMA 3CPTA 3GECA 3BFDA 3LCEA 3OBFA 3B3XA 4ARZA 4PM6A 1K4EA 2VV8A 2ZQ9A 3C8CA 4UQIM 1Z09A 3K3DA 1GHPA 5J8XA 3MBZA 5A90A 2HP9A 1GA0A 2Y2JA 3BY8A 2H0YA 1DP6A 3DTIA 5GLDA 3ULFA 3G32A 3UPNA 4DDYA 1Q2QA 4ZDXA 1KVLA 4L9FA 1M6KA 3AGDA 1MC0A 4OKPA 3C4OA 1PWGA 2ZLYA 1UWPX 4RX3A 2VGLS 4ZJ2A 2WZZA 1K55A 2XD5A 4KZ9A 5EM1A 4ESPA 1KDSA 3T1QB 3BEBA 4PMAA 5DJTA 4S2NC 2PBYA 3G4PA 3F1OB 3UB6A 4B4XA 3E2LA 3Q7VA 1YLWA 1MKMA 4KZAA 5AQBA 2V0UA 1NYMA 3BFGA 2I9VA 2QKPA 2IWBA 1W63Q 2W1TB 1TS6A 5HAIA 1T1BA 2ZOHA 2VLGA 4ZBEA 1FQGA 4IHQA 1HVBA 3MS6A 1T1CA 4S2LA 4QY5A 1W79A 5EPHA 4IVKA 3EQVA 2ZD8A 3MFDA 3O86A 4QD4A 1S67L 4MMNA 3RH8B 1MKIA 4LRYC 4B93A 1KE3A 3G30A 3KSIA 5DTSA 4JF4A 2P08A 4Y5FA 1S4SA 3LEQA 1YLJA 2YKHA 1XA1A 2EWWA 2PR5A 5FQ9A 5CHMA 4EETB 1K54C 5E43A 2V8CA 2Y2LA 1H8ZA 1LLBA 1TDGA 3KSFA 4WYYA 3LICA 1K6SA 3M2KA 3A3JA 3UE0A 3WWXA 2W1RA 3KYEA 1FIKA 1KGGA 4NXFA 3LI8A 4UA6A 3P01A 3V39A 3UPOA 3RXXA 4UHUA 1K57C 4CLCE 5HDDA 4DRTA 3IS2B 3S7PA 2Y91A 3T4QA 1JVJA 4OPQA 3VOYA 3SH9A 2FFFB 3C4PA 4FUWA 4OLDA 2XROA 3T1RA 3Q1FA 3GR2A 3ZG9B 5EVLA 3SS4A 1BZAA 3FWLA 1STZA 5FI7A 4BD0A 1ZHHB 3BRMA 1CF0A 1TS0A 3V50A 1YLPA 3D72A 3KSHA 3CZDA 3F1PB 1JWVA 2LB9A 4FH2A 3N6IA 2GJ3A 1FCNA 1H5XA 4M3KA 2G2UA 3PBRA 4X55A 5FDHA 5HW3A 4HI4A 1KOUA 1OTAA 2WZXA 3W4OA 1DRMA 1TF1A 5G18A 1CK3A 2JKGA 1IYSA 5GL9A 1ES2A 4H6JA 4RVAA 3OPHA 4R70A 2O0YA 1FR1A 1LHYA 2V20A 2ZM0A 3S22A 4QB8A 3KX0X 2VEAA 1RP5A 3LO7A 4FTXA 5DF9A 2XA7M 3E98A 1GSWA 4GHIB 5FEFA 1IKIA 4BBUA 2QJ7A 1SKOB 3NOTC 1E3UA 3IBRA 1BYWA 1G28A 3ZVTA 3LFVA 1XX2A 3HLGA 1N9BA 3HLDA 4JGOA 1K56A 3L7HA 1FOFA 5GLBA 2O9AA 3ZG0A 4EEUA 2FZ0A 2QZ6A 4MBHA 3K3CA 5E2HA 1OT9A 1GSXA 2ZQAA 2B02A 2P04A 4JGQA 4P0MA 1W8YA 2ZC7A 5EUAA 2V0WA 4QJGA 1OTBA 4YINA 1ONHA 2MJ6A 2JCHA 3T4JA 3C7UA 1V9ZA 4I3JA 4JGRA 3SOIA 4LV2A 3VFHA 5HAQA 1XFQA 1DP8A 4GB7A 4WUJA 4AFIA 2PDRA 1PI4A 4C3QA 4JF5A 2OLVA 2ZMVA 3EQUA 2RL3A 2P74A 3RXWA 3TW8A 2JE5A 3GDIA 1I5QA 1WYCA 3MJQA 5GHZA 3H7WB 2XGNA 4IVIA 3W8KA 1O7EA 4G3KA 2Q0OA 4KUKA 2Y2PA 1S0WA 1PNEA 4F94A 4M4XA 4GDBA 2WAEA 4GDNA 2J3TD 4R23A 4BD1A 3T4LA 3NOPC 1ACFA 1ONGA 5CTNA 1JNUA 1XXMA 2R78A 3ZYTA 2ZL1A 2PD7A 5EOOA 3G35A 2EA9A 4OPYA 3FKVA 3VP4A 2YKFA 4Y15A 3C5AA 4FD8A 3LYXA 3C2WA 1XGIA 1IFQA 2C5WB 4BMWA 5HFOA 3A0VA 2M7VA 4S2KA 3EGDC 4MLLA 5FI2A 3MKFA 2WYXA 4UA9A 2BLSA 4GCZA 3BYDA 5EOEA 3H82A 3ZVWA 1AWIA 3E0YA 4UQIS 1F98A 4GD6A 2M1CA 3BFCA 4LGWA 5CEBA 1H3QA 3QP2A 4WMCA 3I7JA 1W5DA 1LI0A 4KZ3A 5EECA 4ETZA 1YSQA 3BM6A 3LIDA 5JYOA 4OQ0A 2OAP1 3CLOA 3S1YA 3N8RA 2Y55A 4S2OA 4WZ5A 2I72A 3UY6A 2EFXA 4R0QA 2V1BA 4IBXA 4HHDA 4WZ4A 4NXGA 3NC8A 3ZG5A 2WADA 2J3WA 1YM1A 3O3VA 1I2SA 4OH0A 1K6RA 1M40A 2R9WA 2ZMAA 2PYRA 4CLCC 5TGFA 3HL9A 1ESUA 1T1AA 2Y2HA 4B9OA 4DF6A 4RQ9A 4R3AA 2WKPA 3G2YA 3CHWP 2FH5A 3DWKA 2PYPA 4DXBA 2H0TA 5TBMB 1YMXA 2X71A 4KG5A 1QMEA 1OTDA 4E6XA 3N7WA 4GD8A 3IXBA 2QMIA 4DDSA 2W3FA 4BL2A 2HP6A 3VP3A 4LPZA 4LCMA 5I94A 2L4RA 4QHCA 3IF5A 3EGXC 4IEDA 2GZAA 5M19A 4EESA 1IELA 5HWWA 5HL6A 3IX3A 3PBTA 1A0KA 2Z6CA 2Y2QA 3T50A 1NZOA 1G6OA 3OLOA 4NG2A 5A93A 4PHTA 5EVEA 1FSYA 5CGXA 5A92A 1OMEA 3KO6A 4G3VA 4WELA 1WA9A 2VZWA 3BQ8A 2OSUA 2X02A 2Z6DA 4PAUA 3OCLA 1VEUA 3IF6C 2X01A 2A2LA 1F9IA 3ITBA 3VV4A 4E3IA 4ZTKA 5JYPA 4S2IA 3PHYA 3UE6A 3WRZA 1BULA 2HDSA 1I2WA 5FQJA 1ERQA 2ZM8A 2O99A 4LV1A 4PKYG 4P85A 5HSQA 4LRXC 1ES3A 1LL8A 5AQ7A 3U4LP 2OWHA 3V3SA 4H8RA 3QP5A 1DJAA 3B42A 4G3WA 2FFYA 1W8QA 5L09A 2E8JA 5CGWA 5M1AA 1X0OA 4O7DA 2PU2A 2WUQA 2VV6A 4IUHA 1BLPA 1MWSA 1XJ4A 3UDIA 3BLMA 5E2FA 4E3LA 4WZ5C 4EW7A 4OLGA 1KDWA 5DF8A 2DRWA 5EVIA 5FAQA 3C7VA 1NWZA 5GLAA 2OOLA 4PKYA 4B88A 5IS1A 4OQIA 4JXSA 2JKRM 5L8MA 1H0MA 1PYYA 4GS9A 5FQQA 3R4KA 1IYPA 5HPFA 4RYEA 4R3JA 5CHJA 5A8BA 4KUOA 3HUNA 2EX8A 2HGVA 2Q9MA 2V9AA 2XFTA 4JBFA 1AXBA 1VM1A 4HBUA 3HVFA 3LIFA 3QP8A 5EV0A 5CERA 3IXHA 3PBQA 3KYZA 3CUEC 3HLCA 3HBRA 3NJAA 4NXEA 4WEJA 2JKTM 2HZ5A 1P0ZA 1F2KA 3GV9A 1KE0A 3JPUA 2OV5A 5FDSA 1F5MA 3TJZC 3LEZA 1N4OA 4CLCD 2ZMFA 3DWZA 1J3WA 4DJ3A 3G2ZA 3E4OA 4P6ZS 5FI6A 2JKFA 2VA0A 1LSWA 2IA2A 2VGJA 4XXRA 1BLCA 1J9MA 3UO9A 3WRTA 3HCYA 4HY8A 3IQAA 4ZRRA 5KSCA 4XT2B 5AQ9A 2JKTI 3IX8A 2Y2GA 3VP2A 2INWA 4L9EA 1QMFA 4BENA 3F1OA 5FAPA 2EX6A 3JVVA 5L07A 2W3GA 1MPLA 3KSGA 3GQZA 1N9LA 3T4OA 4LLOB 4EXOA 3T4SA 3U2AA 3GTCA 2KDKA 2Y2KA 2W1TA 3ZDJA 1LSVA 3GSGA 5EM0A 4NEED 4CLCB 3TSGA 3ZG8B 2O9CA 1TS8A 4K0XA 3VSKA 4IUKA 2QPNA 4NETA 4LV0A 1RCJA 1L0FA 1D1JA 3MZEA 3UE1A 5I5LA 1K55C 5A91A 2PU4A 1JWZA 1T19A 1BLHA 1WE4A 2A24B 1XP4A 2P9VA 3NECA 4EBPA 4WLAA 2HDUA 4E3NA 1JTDA 2J8YA 3OC2A 4B4ZA 3HREA 3FPWA 2JC7A
chains in the Genus database with same CATH topology
2HDQA 4KZ4A 1NZUA 3MZDA 5EOOA 3ZCZA 4K0WA 5CTMA 3FZCA 3G35A 5U47A 1K56D 5HX9A 4OPYA 3FKVA 3NBLA 1HTZA 2ZJ9A 3VP4A 1K57A 3BFFA 4LENA 5EVIB 3BECA 1K4FA 1ALQA 1PW8A 1XPBA 3C5AA 4JXGA 4OOLA 4FD8A 3UDFA 2WGWA 4ZJ1A 1BUEA 4PM7A 1LL5A 1XGIA 3P09A 3WS1A 2C6WB 2P9VB 2J7VA 4NK3A 2WKHA 4CJNA 1C3BA 2C5WB 3OPLA 4LCLA 1L0GA 1CI8A 5HFOA 1E25A 2JBFA 4QY6A 4Y7PA 2VGKA 1YLTA 4S2KA 4N9LA 2A3UA 2WAFA 4MLLA 5FI2A 3MKFA 2WYXA 2V1ZA 3IT9A 4UA9A 2HP5A 2BLSA 3VOZA 4BLMA 1ERMA 5CRFA 4HESA 1EI5A 1MBLA 4N9KA 3LY3A 1IYOA 3A3EA 3BFDA 3LCEA 1NRFA 3BYDA 5EOEA 3MXRA 4Y0OA 3B3XA 4DE1A 4PM6A 1K4EA 3ZVWA 4L0LA 1RGZA 2ZQ9A 4HEFA 5DTKA 3IF6B 3D4FA 4GD6A 1CEFA 1XKZA 1GHPA 5J8XA 3BFCA 3MKEA 3MXSA 3MBZA 5KZHA 4IBRA 2HP9A 5EE8A 1GA0A 4KQQA 5A90A 2Y2JA 3QNBA 2H0YA 5CEBA 4PM8A 1MY8A 5GLDA 1LI9A 1XA7A 3ZG7B 1S6RA 4OQGA 4WMCA 3I7JA 1SHVA 1W5DA 1LI0A 4KZ3A 5EECA 3G32A 3UPNA 4DDYA 5L2FA 1Q2QA 2Q9NA 4ZDXA 1KVLA 2ZQ7A 1SCWA 3BM6A 5JYOA 4OQ0A 1M6KA 1VQQA 3AGDA 3S1YA 5DTTA 3N8RA 2Y55A 4S2OA 1JWPA 2CC1A 4WZ5A 2I72A 4WBGA 3UY6A 2EFXA 2EXAA 4R0QA 4OKPA 5TFQA 3GVBA 1YMSA 1PWGA 2ZLYA 3C4OA 4RX3A 4IBXA 4X56A 4ZJ2A 4WZ4A 2WZZA 1K55A 1EROA 2XD5A 3NC8A 3O87A 3ZNYA 4KZ9A 1GHIA 1IKGA 1W7FA 3ZG5A 5DF7A 1KDSA 2WADA 1YM1A 2RCXA 4K91A 1FR6A 3O3VA 1I2SA 1EWZA 3BEBA 4Y0TA 2XH9A 4N92A 4OH0A 4PMAA 4P6BA 3IWQA 4S2NC 4MBFA 1K6RA 2PBYA 1M40A 3G4PA 3OZHA 2R9WA 2ZC4B 2ZMAA 4KQRA 5TGFA 4JXWA 4RA7A 4S2JA 3DW0A 2H5SA 3A3IA 3HL9A 4B4XA 1ESUA 3E2LA 2Y2HA 1ESIA 3Q7VA 1YLWA 4DF6A 4KZAA 5AQBA 4X6TA 3NCKA 4E3JA 1IEMA 3SS5A 1NYMA 1ZG6A 3O88A 2ZM2A 3BFGA 2DNSA 3G2YA 2XEPA 2IWBA 1SDEA 2Z2MB 3PBOA 5HAIA 5CEDA 1NXYA 3GMWA 4ZBEA 1FQGA 1KE4A 4EV4A 1LL9A 3IXDA 3DWKA 1HVBA 4DXBA 2H0TA 4S2LA 1YMXA 2Y59A 2X71A 4QU3A 4QY5A 1W79A 5FATA 5GHXA 4KG5A 5EPHA 3HLFA 4IVKA 3EQVA 4MEZA 4KZBA 4C6YA 1QMEA 1O07A 2ZD8A 5KMWA 3MFDA 4E6XA 3E2KA 5KSHA 3O86A 4QD4A 5FQKA 5F1FA 4U0XA 1MKIA 4OP8A 3UN7A 3N7WA 2IWDA 4UA7A 4JXVA 4GD8A 1KE3A 1Z6FA 3FYZA 3IXBA 4X68A 2QMIA 3G30A 5DTSA 4DDSA 3IXGA 4JF4A 2H10A 3A3FA 3WS4A 1MWRA 1DJBA 4KZ7A 4BL2A 5EVIC 2HP6A 3VP3A 2V2FF 1YLJA 4LCMA 5I94A 3AGFA 3FKWA 1XA1A 4QHCA 3HUMA 1CEGA 3IF5A 3JYIA 2XFSA 4IEDA 4GZBA 5FQ9A 5M19A 1SDNA 1IELA 3Q81A 3CMZA 5CHMA 1K54C 5HL1A 5E43A 2Y2LA 4CPKA 3PBTA 1H8ZA 2Y2QA 5BOHA 3WS5A 1LLBA 1TDGA 2EX9A 1NZOA 4WYYA 5FQIA 1K6SA 3PBSA 3M2KA 4MBKA 5A93A 4UAAA 3A3JA 4OOMA 4KG2A 2Y2NA 3UE0A 1FSYA 1G68A 2XQZA 3NDGA 3OPRA 3WWXA 4OPZA 3IWOA 5CGXA 1ES4A 5A92A 2J9PA 4U0TA 4WMCD 1KGGA 1OMEA 3IWIA 2WGWB 4ZAMA 4BQMA 5F1GA 4WELA 4UA6A 3OCNA 4OVDA 1NJ4A 3V39A 1BT5A 3UPOA 4YFMA 3RXXA 3Q82A 4UHUA 1K57C 1Y54A 4DRTA 2OSUA 4DE3A 1K25A 2X02A 2DCFA 2Y91A 3OCLA 4OP5A 1GCEA 3IF6C 2X01A 3HLWA 4R1GA 3PTEA 5CXWA 4XUZA 1JVJA 4OPQA 1KGFA 5CECA 3ITBA 5AQAA 3VOYA 2ZQDA 3SH9A 1HD8A 1WYBA 2FFFB 3W4QA 3C4PA 4OLDA 4S2PA 4E3IA 1FCMA 4ZTKA 3ZHHA 4WM9A 1GA9A 3BFEA 3FV7A 4S2IA 5JYPA 3WRZA 1RGYA 1BULA 2HDSA 4PPRA 1I2WA 4S2NA 3Q1FA 3N4IA 3GR2A 5CHUA 2ZQ8A 1ZKJA 5EVLA 3SS4A 3ZG9B 3UPPA 4KENB 1BZAA 3FWLA 4BJPA 5FQJA 1ERQA 2UWXA 2ZM8A 5FI7A 3WS2A 3BRMA 4S2MA 4BD0A 3CJMA 3V50A 4LV1A 1YLPA 1H8YA 3ISGA 3CZDA 4P85A 1ES3A 1JWVA 3BLSA 3SH8A 2Y2MA 4FH2A 3N6IA 3VP0A 5TR7A 1FCNA 5AQ7A 1H5XA 4M3KA 1YQSA 2G2UA 3V3SA 1YLYA 3TG9A 1BSGA 2WGIA 4H8RA 3PBRA 5FASA 4HBTA 1TEMA 2XK1A 3G31A 3IHAA 4KG6A 1DJAA 4X55A 5FDHA 5HW3A 3A3DA 3G34A 5CGSA 2FFYA 4R3BA 1PWDA 1PZPA 1W8QA 4E6WA 5M18A 2WZXA 3M2JA 5CGWA 5M1AA 1TDLA 4DKIA 3W4OA 4O7DA 2J9OA 2PU2A 3HLBA 3LY4A 2WUQA 5G18A 1CK3A 2OLUA 1IYSA 4JF6A 1BLPA 1MWSA 3UDIA 1KGEA 3BLMA 5E2FA 5GL9A 4E3LA 4WZ5C 1DY6A 1ES2A 5IHVA 4OQHA 4RVAA 2Y2IA 1KDWA 3OPHA 4OLGA 5DF8A 4KQOA 2DRWA 5EVIA 5FAQA 3NI9A 1FR1A 2XD1A 3C7VA 1L2SA 1LHYA 2V20A 2ZM0A 4D2OA 3S22A 5GLAA 3ZNTA 3PAGA 4QB8A 1MWUA 2E8IA 4FSFA 5HAPA 4B88A 4OQIA 3UE3A 4JXSA 1K54A 3UNWA 4OPRA 1HZOA 1RP5A 2ZQCA 3LO7A 5DF9A 1PYYA 3NY4A 5F82A 3Q7ZA 5FQQA 1U60A 5GLCA 4C75A 1IYPA 3Q7VB 4JLFA 4RYEA 4R3JA 2BG1A 5CHJA 3W4PA 1BTLA 2R9XA 3ITAA 1IKIA 4R4SA 3SS3A 2WKIA 4Z9QA 3HUNA 4ZJ3A 3M6HA 1XGJA 4EQIA 4FH4A 2ZC5B 2EX8A 2IWCA 2Q9MA 1E3UA 5GHYA 3ZFZA 2XFTA 5F83A 4JBFA 1AXBA 1L0DA 1SKFA 4FCFA 3CG5A 1VM1A 4HBUA 3HVFA 3ZVTA 1ZG4A 2WK0A 3IF6A 1XX2A 2G2WA 4N1XA 4WEKA 3IXHA 5CERA 3HLGA 1FSWA 2XF3A 3P98A 4ID4A 3PBQA 2Z2LB 4DXCA 1N9BA 3HLDA 5E2EA 1K56A 3IH9A 1IYQA 3HLCA 4Y0UA 4A5RA 1FOFA 3HBRA 1PZOA 5GLBA 1FCOA 4WEJA 3ZG0A 1PW1A 2WKEA 2QZ6A 3RJUA 4MBHA 3GV9A 1KE0A 3DTMA 4GOGA 4U3TA 4X69A 5E2HA 2ZC6B 5FAOA 1NYYA 1L0EA 3QNCA 4JPMA 2OV5A 1CI9A 2Y2OA 2ZQAA 4P0MA 1G6AA 1W8YA 3LEZA 3V5MA 3NDEA 2ZC7A 1N4OA 1PWCA 5EUAA 4Q8IA 3DWZA 3N8LA 4QJGA 4DE0A 2HPBA 2EX2A 1MXOA 3G2ZA 5FI6A 4N1HA 4E3KA 1KVMA 4YINA 1ONHA 2VGJA 4XXRA 1BLCA 1J9MA 3UO9A 3WRTA 3VMAA 2JCHA 3MZFA 1Q2PA 2A49A 3C7UA 4GKUA 3IHBA 3GRJA 4OOYA 3IQAA 5KSCA 5AQ9A 1ES5A 4MNRA 3VFFA 3SOIA 3VP1A 4PM5A 4EWFA 3SH7A 4BL3A 4P87A 3WS0A 2Y2GA 4LV2A 3VFHA 3VP2A 5HAQA 2Y4AA 2WGVA 5FQMA 4X53A 1QMFA 3OPPA 3PAEA 4XUXA 4BENA 5FAPA 2ZC3B 4GB7A 2EFUA 2EX6A 3N8SA 3AGEA 1K38A 4KZ8A 1PI4A 5FSRA 1MPLA 1E4DA 4C3QA 3GQZA 3IH8A 1BLSA 2EXBA 4R4RA 5FA7A 4JF5A 2OLVA 3S4XA 3Q07A 1JTGA 3EQUA 3GTCA 2RL3A 2P74A 3RXWA 2JE5A 4JKTA 2Y2KA 5EVID 3UDXA 3ZDJA 3GSGA 4GN2A 1I5QA 1WYCA 4LV3A 4E3OA 3M6BA 3TSGA 5GHZA 3ZG8B 2XGNA 3PBNA 4IVIA 4K0XA 3VSKA 3W8KA 2QPNA 3TOIA 1O7EA 3HLEA 4LV0A 4NETA 4EUZA 4PM9A 1GHMA 1RCJA 2Y2PA 1S0WA 1YLZA 1L0FA 1NY0A 1YT4A 2B5RA 4F94A 3MZEA 4GDBA 3UE1A 1TVFA 4OONA 1K55C 2WAEA 4GDNA 5A91A 2PU4A 1JWZA 1PI5A 4R23A 1PIOA 5HARA 4DE2A 4EBLA 1BLHA 4BD1A 1WE4A 4RX2A 1XP4A 2P9VA 4EBPA 1ONGA 1MWTA 2XLNA 2HDUA 3QHYA 5CTNA 1E3UD 1XXMA 2XDMA 3V3RA 3NIAA 4E3NA 4E3MA 4KZ5A 1JTDA 2J8YA 3OC2A 5D3OA 3ZGAB 1DJCA 2XR0A 5E2GA 4EBNA 4B4ZA 3HREA 2HDRA 2GDNA 5DVAA 1ZC2A 3HUOA 4KZ6A 4GNUA 3VSLA 2JC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HDQ A;  4KZ4 A;  1NZU A;  3MZD A;  5EOO A;  3ZCZ A;  4K0W A;  5CTM A;  3FZC A;  3G35 A;  5U47 A;  1K56 D;  5HX9 A;  4OPY A;  3FKV A;  3NBL A;  1HTZ A;  2ZJ9 A;  3VP4 A;  1K57 A;  3BFF A;  4LEN A;  5EVI B;  3BEC A;  1K4F A;  1ALQ A;  1PW8 A;  1XPB A;  3C5A A;  4JXG A;  4OOL A;  4FD8 A;  3UDF A;  2WGW A;  4ZJ1 A;  1BUE A;  4PM7 A;  1LL5 A;  1XGI A;  3P09 A;  3WS1 A;  2C6W B;  2P9V B;  2J7V A;  4NK3 A;  2WKH A;  4CJN A;  1C3B A;  2C5W B;  3OPL A;  4LCL A;  1L0G A;  1CI8 A;  5HFO A;  1E25 A;  2JBF A;  4QY6 A;  4Y7P A;  2VGK A;  1YLT A;  4S2K A;  4N9L A;  2A3U A;  2WAF A;  4MLL A;  5FI2 A;  3MKF A;  2WYX A;  2V1Z A;  3IT9 A;  4UA9 A;  2HP5 A;  2BLS A;  3VOZ A;  4BLM A;  1ERM A;  5CRF A;  4HES A;  1EI5 A;  1MBL A;  4N9K A;  3LY3 A;  1IYO A;  3A3E A;  3BFD A;  3LCE A;  1NRF A;  3BYD A;  5EOE A;  3MXR A;  4Y0O A;  3B3X A;  4DE1 A;  4PM6 A;  1K4E A;  3ZVW A;  4L0L A;  1RGZ A;  2ZQ9 A;  4HEF A;  5DTK A;  3IF6 B;  3D4F A;  4GD6 A;  1CEF A;  1XKZ A;  1GHP A;  5J8X A;  3BFC A;  3MKE A;  3MXS A;  3MBZ A;  5KZH A;  4IBR A;  2HP9 A;  5EE8 A;  1GA0 A;  4KQQ A;  5A90 A;  2Y2J A;  3QNB A;  2H0Y A;  5CEB A;  4PM8 A;  1MY8 A;  5GLD A;  1LI9 A;  1XA7 A;  3ZG7 B;  1S6R A;  4OQG A;  4WMC A;  3I7J A;  1SHV A;  1W5D A;  1LI0 A;  4KZ3 A;  5EEC A;  3G32 A;  3UPN A;  4DDY A;  5L2F A;  1Q2Q A;  2Q9N A;  4ZDX A;  1KVL A;  2ZQ7 A;  1SCW A;  3BM6 A;  5JYO A;  4OQ0 A;  1M6K A;  1VQQ A;  3AGD A;  3S1Y A;  5DTT A;  3N8R A;  2Y55 A;  4S2O A;  1JWP A;  2CC1 A;  4WZ5 A;  2I72 A;  4WBG A;  3UY6 A;  2EFX A;  2EXA A;  4R0Q A;  4OKP A;  5TFQ A;  3GVB A;  1YMS A;  1PWG A;  2ZLY A;  3C4O A;  4RX3 A;  4IBX A;  4X56 A;  4ZJ2 A;  4WZ4 A;  2WZZ A;  1K55 A;  1ERO A;  2XD5 A;  3NC8 A;  3O87 A;  3ZNY A;  4KZ9 A;  1GHI A;  1IKG A;  1W7F A;  3ZG5 A;  5DF7 A;  1KDS A;  2WAD A;  1YM1 A;  2RCX A;  4K91 A;  1FR6 A;  3O3V A;  1I2S A;  1EWZ A;  3BEB A;  4Y0T A;  2XH9 A;  4N92 A;  4OH0 A;  4PMA A;  4P6B A;  3IWQ A;  4S2N C;  4MBF A;  1K6R A;  2PBY A;  1M40 A;  3G4P A;  3OZH A;  2R9W A;  2ZC4 B;  2ZMA A;  4KQR A;  5TGF A;  4JXW A;  4RA7 A;  4S2J A;  3DW0 A;  2H5S A;  3A3I A;  3HL9 A;  4B4X A;  1ESU A;  3E2L A;  2Y2H A;  1ESI A;  3Q7V A;  1YLW A;  4DF6 A;  4KZA A;  5AQB A;  4X6T A;  3NCK A;  4E3J A;  1IEM A;  3SS5 A;  1NYM A;  1ZG6 A;  3O88 A;  2ZM2 A;  3BFG A;  2DNS A;  3G2Y A;  2XEP A;  2IWB A;  1SDE A;  2Z2M B;  3PBO A;  5HAI A;  5CED A;  1NXY A;  3GMW A;  4ZBE A;  1FQG A;  1KE4 A;  4EV4 A;  1LL9 A;  3IXD A;  3DWK A;  1HVB A;  4DXB A;  2H0T A;  4S2L A;  1YMX A;  2Y59 A;  2X71 A;  4QU3 A;  4QY5 A;  1W79 A;  5FAT A;  5GHX A;  4KG5 A;  5EPH A;  3HLF A;  4IVK A;  3EQV A;  4MEZ A;  4KZB A;  4C6Y A;  1QME A;  1O07 A;  2ZD8 A;  5KMW A;  3MFD A;  4E6X A;  3E2K A;  5KSH A;  3O86 A;  4QD4 A;  5FQK A;  5F1F A;  4U0X A;  1MKI A;  4OP8 A;  3UN7 A;  3N7W A;  2IWD A;  4UA7 A;  4JXV A;  4GD8 A;  1KE3 A;  1Z6F A;  3FYZ A;  3IXB A;  4X68 A;  2QMI A;  3G30 A;  5DTS A;  4DDS A;  3IXG A;  4JF4 A;  2H10 A;  3A3F A;  3WS4 A;  1MWR A;  1DJB A;  4KZ7 A;  4BL2 A;  5EVI C;  2HP6 A;  3VP3 A;  2V2F F;  1YLJ A;  4LCM A;  5I94 A;  3AGF A;  3FKW A;  1XA1 A;  4QHC A;  3HUM A;  1CEG A;  3IF5 A;  3JYI A;  2XFS A;  4IED A;  4GZB A;  5FQ9 A;  5M19 A;  1SDN A;  1IEL A;  3Q81 A;  3CMZ A;  5CHM A;  1K54 C;  5HL1 A;  5E43 A;  2Y2L A;  4CPK A;  3PBT A;  1H8Z A;  2Y2Q A;  5BOH A;  3WS5 A;  1LLB A;  1TDG A;  2EX9 A;  1NZO A;  4WYY A;  5FQI A;  1K6S A;  3PBS A;  3M2K A;  4MBK A;  5A93 A;  4UAA A;  3A3J A;  4OOM A;  4KG2 A;  2Y2N A;  3UE0 A;  1FSY A;  1G68 A;  2XQZ A;  3NDG A;  3OPR A;  3WWX A;  4OPZ A;  3IWO A;  5CGX A;  1ES4 A;  5A92 A;  2J9P A;  4U0T A;  4WMC D;  1KGG A;  1OME A;  3IWI A;  2WGW B;  4ZAM A;  4BQM A;  5F1G A;  4WEL A;  4UA6 A;  3OCN A;  4OVD A;  1NJ4 A;  3V39 A;  1BT5 A;  3UPO A;  4YFM A;  3RXX A;  3Q82 A;  4UHU A;  1K57 C;  1Y54 A;  4DRT A;  2OSU A;  4DE3 A;  1K25 A;  2X02 A;  2DCF A;  2Y91 A;  3OCL A;  4OP5 A;  1GCE A;  3IF6 C;  2X01 A;  3HLW A;  4R1G A;  3PTE A;  5CXW A;  4XUZ A;  1JVJ A;  4OPQ A;  1KGF A;  5CEC A;  3ITB A;  5AQA A;  3VOY A;  2ZQD A;  3SH9 A;  1HD8 A;  1WYB A;  2FFF B;  3W4Q A;  3C4P A;  4OLD A;  4S2P A;  4E3I A;  1FCM A;  4ZTK A;  3ZHH A;  4WM9 A;  1GA9 A;  3BFE A;  3FV7 A;  4S2I A;  5JYP A;  3WRZ A;  1RGY A;  1BUL A;  2HDS A;  4PPR A;  1I2W A;  4S2N A;  3Q1F A;  3N4I A;  3GR2 A;  5CHU A;  2ZQ8 A;  1ZKJ A;  5EVL A;  3SS4 A;  3ZG9 B;  3UPP A;  4KEN B;  1BZA A;  3FWL A;  4BJP A;  5FQJ A;  1ERQ A;  2UWX A;  2ZM8 A;  5FI7 A;  3WS2 A;  3BRM A;  4S2M A;  4BD0 A;  3CJM A;  3V50 A;  4LV1 A;  1YLP A;  1H8Y A;  3ISG A;  3CZD A;  4P85 A;  1ES3 A;  1JWV A;  3BLS A;  3SH8 A;  2Y2M A;  4FH2 A;  3N6I A;  3VP0 A;  5TR7 A;  1FCN A;  5AQ7 A;  1H5X A;  4M3K A;  1YQS A;  2G2U A;  3V3S A;  1YLY A;  3TG9 A;  1BSG A;  2WGI A;  4H8R A;  3PBR A;  5FAS A;  4HBT A;  1TEM A;  2XK1 A;  3G31 A;  3IHA A;  4KG6 A;  1DJA A;  4X55 A;  5FDH A;  5HW3 A;  3A3D A;  3G34 A;  5CGS A;  2FFY A;  4R3B A;  1PWD A;  1PZP A;  1W8Q A;  4E6W A;  5M18 A;  2WZX A;  3M2J A;  5CGW A;  5M1A A;  1TDL A;  4DKI A;  3W4O A;  4O7D A;  2J9O A;  2PU2 A;  3HLB A;  3LY4 A;  2WUQ A;  5G18 A;  1CK3 A;  2OLU A;  1IYS A;  4JF6 A;  1BLP A;  1MWS A;  3UDI A;  1KGE A;  3BLM A;  5E2F A;  5GL9 A;  4E3L A;  4WZ5 C;  1DY6 A;  1ES2 A;  5IHV A;  4OQH A;  4RVA A;  2Y2I A;  1KDW A;  3OPH A;  4OLG A;  5DF8 A;  4KQO A;  2DRW A;  5EVI A;  5FAQ A;  3NI9 A;  1FR1 A;  2XD1 A;  3C7V A;  1L2S A;  1LHY A;  2V20 A;  2ZM0 A;  4D2O A;  3S22 A;  5GLA A;  3ZNT A;  3PAG A;  4QB8 A;  1MWU A;  2E8I A;  4FSF A;  5HAP A;  4B88 A;  4OQI A;  3UE3 A;  4JXS A;  1K54 A;  3UNW A;  4OPR A;  1HZO A;  1RP5 A;  2ZQC A;  3LO7 A;  5DF9 A;  1PYY A;  3NY4 A;  5F82 A;  3Q7Z A;  5FQQ A;  1U60 A;  5GLC A;  4C75 A;  1IYP A;  3Q7V B;  4JLF A;  4RYE A;  4R3J A;  2BG1 A;  5CHJ A;  3W4P A;  1BTL A;  2R9X A;  3ITA A;  1IKI A;  4R4S A;  3SS3 A;  2WKI A;  4Z9Q A;  3HUN A;  4ZJ3 A;  3M6H A;  1XGJ A;  4EQI A;  4FH4 A;  2ZC5 B;  2EX8 A;  2IWC A;  2Q9M A;  1E3U A;  5GHY A;  3ZFZ A;  2XFT A;  5F83 A;  4JBF A;  1AXB A;  1L0D A;  1SKF A;  4FCF A;  3CG5 A;  1VM1 A;  4HBU A;  3HVF A;  3ZVT A;  1ZG4 A;  2WK0 A;  3IF6 A;  1XX2 A;  2G2W A;  4N1X A;  4WEK A;  3IXH A;  5CER A;  3HLG A;  1FSW A;  2XF3 A;  3P98 A;  4ID4 A;  3PBQ A;  2Z2L B;  4DXC A;  1N9B A;  3HLD A;  5E2E A;  1K56 A;  3IH9 A;  1IYQ A;  3HLC A;  4Y0U A;  4A5R A;  1FOF A;  3HBR A;  1PZO A;  5GLB A;  1FCO A;  4WEJ A;  3ZG0 A;  1PW1 A;  2WKE A;  2QZ6 A;  3RJU A;  4MBH A;  3GV9 A;  1KE0 A;  3DTM A;  4GOG A;  4U3T A;  4X69 A;  5E2H A;  2ZC6 B;  5FAO A;  1NYY A;  1L0E A;  3QNC A;  4JPM A;  2OV5 A;  1CI9 A;  2Y2O A;  2ZQA A;  4P0M A;  1G6A A;  1W8Y A;  3LEZ A;  3V5M A;  3NDE A;  2ZC7 A;  1N4O A;  1PWC A;  5EUA A;  4Q8I A;  3DWZ A;  3N8L A;  4QJG A;  4DE0 A;  2HPB A;  2EX2 A;  1MXO A;  3G2Z A;  5FI6 A;  4N1H A;  4E3K A;  1KVM A;  4YIN A;  1ONH A;  2VGJ A;  4XXR A;  1BLC A;  1J9M A;  3UO9 A;  3WRT A;  3VMA A;  2JCH A;  3MZF A;  1Q2P A;  2A49 A;  3C7U A;  4GKU A;  3IHB A;  3GRJ A;  4OOY A;  3IQA A;  5KSC A;  5AQ9 A;  1ES5 A;  4MNR A;  3VFF A;  3SOI A;  3VP1 A;  4PM5 A;  4EWF A;  3SH7 A;  4BL3 A;  4P87 A;  3WS0 A;  2Y2G A;  4LV2 A;  3VFH A;  3VP2 A;  5HAQ A;  2Y4A A;  2WGV A;  5FQM A;  4X53 A;  1QMF A;  3OPP A;  3PAE A;  4XUX A;  4BEN A;  5FAP A;  2ZC3 B;  4GB7 A;  2EFU A;  2EX6 A;  3N8S A;  3AGE A;  1K38 A;  4KZ8 A;  1PI4 A;  5FSR A;  1MPL A;  1E4D A;  4C3Q A;  3GQZ A;  3IH8 A;  1BLS A;  2EXB A;  4R4R A;  5FA7 A;  4JF5 A;  2OLV A;  3S4X A;  3Q07 A;  1JTG A;  3EQU A;  3GTC A;  2RL3 A;  2P74 A;  3RXW A;  2JE5 A;  4JKT A;  2Y2K A;  5EVI D;  3UDX A;  3ZDJ A;  3GSG A;  4GN2 A;  1I5Q A;  1WYC A;  4LV3 A;  4E3O A;  3M6B A;  3TSG A;  5GHZ A;  3ZG8 B;  2XGN A;  3PBN A;  4IVI A;  4K0X A;  3VSK A;  3W8K A;  2QPN A;  3TOI A;  1O7E A;  3HLE A;  4LV0 A;  4NET A;  4EUZ A;  4PM9 A;  1GHM A;  1RCJ A;  2Y2P A;  1S0W A;  1YLZ A;  1L0F A;  1NY0 A;  1YT4 A;  2B5R A;  4F94 A;  3MZE A;  4GDB A;  3UE1 A;  1TVF A;  4OON A;  1K55 C;  2WAE A;  4GDN A;  5A91 A;  2PU4 A;  1JWZ A;  1PI5 A;  4R23 A;  1PIO A;  5HAR A;  4DE2 A;  4EBL A;  1BLH A;  4BD1 A;  1WE4 A;  4RX2 A;  1XP4 A;  2P9V A;  4EBP A;  1ONG A;  1MWT A;  2XLN A;  2HDU A;  3QHY A;  5CTN A;  1E3U D;  1XXM A;  2XDM A;  3V3R A;  3NIA A;  4E3N A;  4E3M A;  4KZ5 A;  1JTD A;  2J8Y A;  3OC2 A;  5D3O A;  3ZGA B;  1DJC A;  2XR0 A;  5E2G A;  4EBN A;  4B4Z A;  3HRE A;  2HDR A;  2GDN A;  5DVA A;  1ZC2 A;  3HUO A;  4KZ6 A;  4GNU A;  3VSL A;  2JC7 A; 
#chains in the Genus database with same CATH topology
 3W2Z A;  5CTM A;  3FZC A;  3NBL A;  2ZJ9 A;  1VET B;  3BFF A;  4CQH A;  4JXG A;  5F6A A;  3NOU C;  4ZJ1 A;  4PM7 A;  2BTF P;  3E4P A;  3P09 A;  3WS1 A;  2C6W B;  3RTY A;  2WKH A;  1SZV A;  4HOI A;  1C3B A;  4LCL A;  1L0G A;  2JBF A;  4Y13 A;  2HJ9 C;  4Y7P A;  2VGK A;  3DTK A;  4N9L A;  2ZL1 B;  5LBR A;  3IT9 A;  1VB6 A;  1MBL A;  3LY3 A;  3A3E A;  1NRF A;  3MXR A;  1G5U A;  4DE1 A;  2QWS A;  5HWV A;  4L0L A;  3F1N B;  1RGZ A;  3IF6 B;  1XKZ A;  4Y3I A;  3MKE A;  3MXS A;  4F3L B;  4IBR A;  5EE8 A;  3F1P A;  4PM8 A;  1LI9 A;  4MDZ A;  1S6R A;  4OQG A;  5HD5 A;  1SHV A;  3QP1 A;  3SW1 A;  2Q9N A;  1SCW A;  5DTT A;  1HLU P;  2KOI A;  3H82 B;  5J7E A;  4WBG A;  2EXA A;  4X56 A;  5L10 A;  3T1X A;  5AVF A;  3O87 A;  3ZNY A;  5G4Y A;  1GHI A;  1IKG A;  1W7F A;  5DF7 A;  2KX6 A;  3IX4 A;  5HDS A;  4Q0I A;  5AJG A;  4Y0T A;  4N92 A;  2QJ5 A;  4MBF A;  4HP9 A;  3OZH A;  4X1M A;  4RA7 A;  4S2J A;  3DW0 A;  2H5S A;  4GHI A;  4LRZ E;  4X6T A;  3FC7 A;  3NCK A;  1IEM A;  3SS5 A;  3O88 A;  3SZT A;  4K08 A;  2ZM2 A;  2DNS A;  1SDE A;  1NXY A;  3GMW A;  1KE4 A;  1P9W A;  4EV4 A;  3IXD A;  4QU3 A;  5GHX A;  5FAT A;  3EOI A;  4MEZ A;  4C6Y A;  5KSH A;  1O07 A;  4QPR A;  3E2K A;  5FQK A;  1DP9 A;  4U0X A;  3VE3 A;  4UA7 A;  3D3O A;  3MXQ A;  3FYZ A;  3G6O A;  1IOU A;  5HPI A;  1MWR A;  1DJB A;  3DAV A;  2V2F F;  4I3I A;  5EFW A;  3JYI A;  5DKK A;  2XFS A;  4GZB A;  1SDN A;  3Q81 A;  3CMZ A;  5HL1 A;  4WN5 A;  5MC7 A;  5BOH A;  4FOF A;  2EX9 A;  5FQI A;  3PBS A;  4OOM A;  4KG2 A;  2Y2N A;  3MF0 A;  1NLZ A;  3OPR A;  1CJF A;  2WGW B;  4BQM A;  5F1G A;  4OVD A;  3Q82 A;  1Y54 A;  2DCF A;  4GLQ A;  4UEY A;  3HLW A;  4R1G A;  3PTE A;  4I5S A;  3MMH A;  1S4R A;  5CEC A;  3CIT A;  3CPT B;  4NXB A;  1WYB A;  2G7U A;  2ZOI A;  5DJU A;  2EWV A;  3MQ0 A;  4S2P A;  3ZHH A;  4EQ1 A;  1GA9 A;  3BFE A;  3C38 A;  3FV7 A;  4EUV A;  1ZTU A;  5TJJ A;  3R7W A;  4ARZ B;  4S2N A;  3N4I A;  1OTI A;  1ZKJ A;  4HH2 A;  4KEN B;  3P7N A;  3H7W A;  3WS2 A;  4MN5 A;  3NUL A;  4Y17 A;  1H8M A;  1W63 M;  3VP0 A;  5TR7 A;  2GNX A;  1D06 A;  2Y79 A;  3CWF A;  4HBT A;  3G31 A;  2W3H A;  3T4K A;  3G34 A;  5CGS A;  4R3B A;  2QYB A;  5M18 A;  1OTE A;  1TDL A;  4DKI A;  3BWL A;  1LSX A;  5J4E A;  4O8G A;  4D60 A;  1KGE A;  2W3D A;  1DY6 A;  4OQH A;  2Y2I A;  4KQO A;  3NI9 A;  2XD1 A;  3O5Y A;  3MR0 A;  4D2O A;  3ZNT A;  3PAG A;  1MWU A;  5HAP A;  1UWN X;  1K54 A;  3UB7 A;  4OPR A;  1HZO A;  4DMZ A;  2ZQC A;  5F82 A;  2XSS A;  5GLC A;  3A0R A;  3TE8 A;  3Q7V B;  3EEA A;  3QP4 A;  2R9X A;  3ITA A;  3SS3 A;  2WKI A;  4FH4 A;  2ZC5 B;  1P9R A;  4EEP A;  2IWC A;  3ZFZ A;  4EU0 A;  1L0D A;  3DTE A;  1SKF A;  2J80 A;  1ZG4 A;  2WK0 A;  2G2W A;  4N1X A;  4WEK A;  1FSW A;  2XF3 A;  1ODV A;  4DXC A;  5F69 A;  4A5R A;  3DTM A;  1YSP A;  1S66 L;  4U3T A;  5FAO A;  1NYY A;  1L0E A;  1YPR A;  3QNC A;  1CI9 A;  3FG8 A;  4MN6 A;  4MN7 A;  1G6A A;  2QHK A;  2NUT C;  3V5M A;  1PWC A;  3BW6 A;  4DE0 A;  2EX2 A;  2L1M A;  3B47 A;  2ACG A;  3VMA A;  3MZF A;  1Q2P A;  2A49 A;  4GKU A;  4OOY A;  3D9Y A;  1ES5 A;  3VFF A;  3UB9 A;  1VHM A;  5FEG A;  2WGV A;  3PAE A;  2L0W A;  4XUX A;  3VE4 A;  2ZC3 B;  3N8S A;  2KLI A;  3S7O A;  3AGE A;  3C30 A;  5HDC A;  4L9G A;  4Y2F A;  5FSR A;  3MSH A;  3IH8 A;  1BLS A;  1OJ5 A;  2EXB A;  4R4R A;  5FA7 A;  4Q0H A;  5F5Y A;  5C5K A;  5G4Z A;  3BQA A;  2W0N A;  4GN2 A;  5KIZ A;  1LT0 A;  4LV3 A;  4E3O A;  3M6B A;  1S1Z A;  5TBM A;  3TOI A;  3HLE A;  2W3E A;  4IJG A;  4PM9 A;  2VK3 A;  3EWK A;  1GHM A;  5J3W A;  1P97 A;  1TVF A;  5HAR A;  4DE2 A;  3LI9 A;  4EBL A;  4RX2 A;  1MWT A;  1E3U D;  2XDM A;  2O9B A;  2XA7 S;  3NIA A;  4KZ5 A;  5D3O A;  4YWZ A;  1K0K A;  1DJC A;  2XR0 A;  4II7 A;  1L3L A;  4EBN A;  3LIA A;  2HDR A;  4S2M A;  2HDQ A;  1NZU A;  3B33 A;  5HWT A;  3ZCZ A;  5U47 A;  1K56 D;  4H6J B;  1HTZ A;  4R6L A;  4OOL A;  3UDF A;  4ME4 A;  3QP6 A;  1BUE A;  2JKR I;  2P9V B;  2J7V A;  2B18 A;  4Z1W A;  4QY6 A;  4DJ2 A;  3K2N A;  2A3U A;  2WAF A;  2V1Z A;  2HP5 A;  3VOZ A;  2OAQ 1;  5CRF A;  4HES A;  1EI5 A;  3BY9 A;  3HJK A;  4N9K A;  1IYO A;  1PFL A;  4DN0 A;  4Y0O A;  3L9K A;  2J3T C;  4HEF A;  3S7Q A;  3T4T A;  5DTK A;  3D4F A;  1CEF A;  5KZH A;  2K31 A;  4KQQ A;  3QNB A;  1MY8 A;  1XA7 A;  3DBA A;  3ICY A;  3ZG7 B;  4BBV A;  5HD3 A;  5F68 A;  2PT7 A;  3MQO A;  2M7U A;  5L2F A;  3LR4 A;  3IBJ A;  4WF0 A;  2ZQ7 A;  1VQQ A;  5DKL A;  3JVU A;  1JWP A;  2CC1 A;  3FPV A;  2D02 A;  5TFQ A;  1D7E A;  1TS7 A;  3GVB A;  1YMS A;  3OOV A;  2VGL M;  1UGU A;  1YAX A;  3MFX A;  1ERO A;  1N9N A;  3CAX A;  2RCX A;  4K91 A;  1FR6 A;  1EWZ A;  2GX5 A;  2XH9 A;  1XJ2 A;  5IT5 A;  4P6B A;  3IWQ A;  1Y4O A;  4E04 A;  2ZC4 B;  4KQR A;  4JXW A;  3KYQ A;  3A3I A;  1ESI A;  3UB8 A;  1TD5 A;  4E3J A;  1XFN A;  1ZG6 A;  5HZH A;  2UV0 E;  2XEP A;  5CED A;  2Z2M B;  3PBO A;  2HV1 A;  3LIE A;  2K7S A;  4BWI A;  1LL9 A;  2Y59 A;  3HLF A;  4KZB A;  4HJ3 A;  5KMW A;  5F1F A;  4OP8 A;  3UN7 A;  2IWD A;  4LFU A;  4JXV A;  1Z6F A;  4X68 A;  3IXG A;  1V9Y A;  2H10 A;  3A3F A;  3TRC A;  3WS4 A;  2VKS A;  4KZ7 A;  5EVI C;  3HJI A;  3AGF A;  3IS2 A;  3FKW A;  3HUM A;  1CEG A;  2B95 A;  5AVE A;  3CI6 A;  4CPK A;  2PRF A;  3WS5 A;  3UMD A;  3ZQ5 A;  2Y8H A;  4MBK A;  4HQA A;  4UAA A;  3T12 B;  1FIL A;  5CX7 A;  1G68 A;  2XQZ A;  3NDG A;  4OPZ A;  3IWO A;  1ES4 A;  2VX8 A;  2XRN A;  2DMW A;  2J9P A;  4U0T A;  4WMC D;  4XT2 A;  3IWI A;  4ZAM A;  4X25 A;  4HP4 A;  3OCN A;  1NJ4 A;  1BT5 A;  4HH3 A;  4YFM A;  2ZBB A;  4DE3 A;  1K25 A;  3PR6 A;  4OP5 A;  1GCE A;  1PRQ A;  5CXW A;  4XUZ A;  1KGF A;  3LR3 A;  2PHY A;  5AQA A;  2ZQD A;  2D01 A;  1HD8 A;  4P6Z M;  3W4Q A;  1FCM A;  4WM9 A;  2PR6 A;  2VV7 A;  1RGY A;  5DFX A;  3S7N A;  4PPR A;  4QWO A;  5CHU A;  2ZQ8 A;  5FL3 A;  3UPP A;  4CLC A;  1OT6 A;  4BJP A;  2UWX A;  4O01 A;  5K5B A;  3A0S A;  1NRJ A;  3CJM A;  1OJG A;  3ISG A;  1H8Y A;  5DFY A;  3BLS A;  3UB5 P;  3SH8 A;  2Y2M A;  1YKD A;  2PAV P;  1YQS A;  1YLY A;  3TG9 A;  1BSG A;  2HF6 A;  2WGI A;  5FAS A;  4GW9 A;  3NHQ A;  4WL9 A;  2A24 A;  4I3A A;  1XJ3 A;  1TEM A;  2XK1 A;  3IHA A;  4KG6 A;  3A3D A;  1PWD A;  3R7W B;  1PZP A;  4E6W A;  4KQD A;  3M2J A;  2J9O A;  3HLB A;  3LY4 A;  2BAS A;  2OLU A;  2VJW A;  4JF6 A;  3T1S A;  4EER A;  1SKO A;  5IHV A;  1GSV A;  1VET A;  1XJ6 A;  1L2S A;  2E8I A;  4FSF A;  2LB5 A;  3UE3 A;  4JGP A;  3UNW A;  3NY4 A;  4I39 A;  3Q7Z A;  1U60 A;  4C75 A;  4JLF A;  2BG1 A;  1BTL A;  4R4S A;  3LUQ A;  4Z9Q A;  4ZJ3 A;  3EEH A;  3M6H A;  1XGJ A;  2CMN A;  4EQI A;  5GHY A;  5F83 A;  3F1N A;  4FCF A;  3CG5 A;  2HJE A;  2V1A A;  3IF6 A;  3E4Q A;  4F3L A;  3P98 A;  4ID4 A;  2Z2L B;  3LR0 A;  5E2E A;  3IH9 A;  1IYQ A;  1NLY A;  4Y0U A;  3LGO A;  2P7J A;  1PZO A;  2JHE A;  1FCO A;  1PW1 A;  4R38 A;  2WKE A;  3RJU A;  4GOG A;  4X69 A;  2ZC6 B;  4JPM A;  1CQA A;  1EW0 A;  2Y2O A;  2WKR A;  3BJN A;  3NDE A;  4Q8I A;  3N8L A;  4ETX A;  2HPB A;  1MXO A;  4N1H A;  4E3K A;  1KVM A;  3IHB A;  3GRJ A;  4MNR A;  3VP1 A;  4PM5 A;  4EWF A;  3SH7 A;  4HJ4 A;  4BL3 A;  4P87 A;  4MCW A;  3WS0 A;  5IU1 A;  4Q0J A;  2Y4A A;  5FQM A;  4X53 A;  3LR5 A;  3OPP A;  2EFU A;  2PBD P;  1VEU B;  1K38 A;  3UME A;  4KZ8 A;  1E4D A;  2JN7 A;  3S4X A;  3Q07 A;  1JTG A;  5EVI D;  4JKT A;  3LIB A;  3UDX A;  3V67 A;  1N9O A;  3PBN A;  4EUZ A;  1OPX A;  1MZU A;  1YLZ A;  1NY0 A;  1YT4 A;  2B5R A;  2K2N A;  4OON A;  4HJ6 A;  4GJ4 A;  1PI5 A;  1PIO A;  4HNB A;  3PYP A;  1T18 A;  2XLN A;  2OWJ A;  3QHY A;  3V3R A;  3PXP A;  4E3M A;  3ZGA B;  5E2G A;  3MQQ A;  3VOL A;  5DVA A;  2GDN A;  4I38 A;  3CUE A;  1S1Y A;  1ZC2 A;  3HUO A;  4KZ6 A;  4GNU A;  3VSL A;  3W4P A;  4KZ4 A;  3MZD A;  4K0W A;  4NKP A;  4O0P A;  5HX9 A;  1K57 A;  4LEN A;  5EVI B;  2PD8 A;  3BEC A;  1K4F A;  1ALQ A;  1PW8 A;  1XPB A;  2WKQ A;  3H9W A;  2H28 A;  2WGW A;  1LL5 A;  2W27 A;  4BBT A;  1Y28 A;  4YOF A;  4NK3 A;  4CJN A;  4GS9 B;  4YNR A;  3OPL A;  1CI8 A;  4HIA A;  1E25 A;  4X1L A;  3RFB A;  1YLT A;  2NUP C;  2V8F A;  2AVX A;  4BLM A;  1ERM A;  3CPT A;  3GEC A;  3BFD A;  3LCE A;  3OBF A;  3B3X A;  4ARZ A;  4PM6 A;  1K4E A;  2VV8 A;  2ZQ9 A;  3C8C A;  4UQI M;  1Z09 A;  3K3D A;  1GHP A;  5J8X A;  3MBZ A;  5A90 A;  2HP9 A;  1GA0 A;  2Y2J A;  3BY8 A;  2H0Y A;  1DP6 A;  3DTI A;  5GLD A;  3ULF A;  3G32 A;  3UPN A;  4DDY A;  1Q2Q A;  4ZDX A;  1KVL A;  4L9F A;  1M6K A;  3AGD A;  1MC0 A;  4OKP A;  3C4O A;  1PWG A;  2ZLY A;  1UWP X;  4RX3 A;  2VGL S;  4ZJ2 A;  2WZZ A;  1K55 A;  2XD5 A;  4KZ9 A;  5EM1 A;  4ESP A;  1KDS A;  3T1Q B;  3BEB A;  4PMA A;  5DJT A;  4S2N C;  2PBY A;  3G4P A;  3F1O B;  3UB6 A;  4B4X A;  3E2L A;  3Q7V A;  1YLW A;  1MKM A;  4KZA A;  5AQB A;  2V0U A;  1NYM A;  3BFG A;  2I9V A;  2QKP A;  2IWB A;  1W63 Q;  2W1T B;  1TS6 A;  5HAI A;  1T1B A;  2ZOH A;  2VLG A;  4ZBE A;  1FQG A;  4IHQ A;  1HVB A;  3MS6 A;  1T1C A;  4S2L A;  4QY5 A;  1W79 A;  5EPH A;  4IVK A;  3EQV A;  2ZD8 A;  3MFD A;  3O86 A;  4QD4 A;  1S67 L;  4MMN A;  3RH8 B;  1MKI A;  4LRY C;  4B93 A;  1KE3 A;  3G30 A;  3KSI A;  5DTS A;  4JF4 A;  2P08 A;  4Y5F A;  1S4S A;  3LEQ A;  1YLJ A;  2YKH A;  1XA1 A;  2EWW A;  2PR5 A;  5FQ9 A;  5CHM A;  4EET B;  1K54 C;  5E43 A;  2V8C A;  2Y2L A;  1H8Z A;  1LLB A;  1TDG A;  3KSF A;  4WYY A;  3LIC A;  1K6S A;  3M2K A;  3A3J A;  3UE0 A;  3WWX A;  2W1R A;  3KYE A;  1FIK A;  1KGG A;  4NXF A;  3LI8 A;  4UA6 A;  3P01 A;  3V39 A;  3UPO A;  3RXX A;  4UHU A;  1K57 C;  4CLC E;  5HDD A;  4DRT A;  3IS2 B;  3S7P A;  2Y91 A;  3T4Q A;  1JVJ A;  4OPQ A;  3VOY A;  3SH9 A;  2FFF B;  3C4P A;  4FUW A;  4OLD A;  2XRO A;  3T1R A;  3Q1F A;  3GR2 A;  3ZG9 B;  5EVL A;  3SS4 A;  1BZA A;  3FWL A;  1STZ A;  5FI7 A;  4BD0 A;  1ZHH B;  3BRM A;  1CF0 A;  1TS0 A;  3V50 A;  1YLP A;  3D72 A;  3KSH A;  3CZD A;  3F1P B;  1JWV A;  2LB9 A;  4FH2 A;  3N6I A;  2GJ3 A;  1FCN A;  1H5X A;  4M3K A;  2G2U A;  3PBR A;  4X55 A;  5FDH A;  5HW3 A;  4HI4 A;  1KOU A;  1OTA A;  2WZX A;  3W4O A;  1DRM A;  1TF1 A;  5G18 A;  1CK3 A;  2JKG A;  1IYS A;  5GL9 A;  1ES2 A;  4H6J A;  4RVA A;  3OPH A;  4R70 A;  2O0Y A;  1FR1 A;  1LHY A;  2V20 A;  2ZM0 A;  3S22 A;  4QB8 A;  3KX0 X;  2VEA A;  1RP5 A;  3LO7 A;  4FTX A;  5DF9 A;  2XA7 M;  3E98 A;  1GSW A;  4GHI B;  5FEF A;  1IKI A;  4BBU A;  2QJ7 A;  1SKO B;  3NOT C;  1E3U A;  3IBR A;  1BYW A;  1G28 A;  3ZVT A;  3LFV A;  1XX2 A;  3HLG A;  1N9B A;  3HLD A;  4JGO A;  1K56 A;  3L7H A;  1FOF A;  5GLB A;  2O9A A;  3ZG0 A;  4EEU A;  2FZ0 A;  2QZ6 A;  4MBH A;  3K3C A;  5E2H A;  1OT9 A;  1GSX A;  2ZQA A;  2B02 A;  2P04 A;  4JGQ A;  4P0M A;  1W8Y A;  2ZC7 A;  5EUA A;  2V0W A;  4QJG A;  1OTB A;  4YIN A;  1ONH A;  2MJ6 A;  2JCH A;  3T4J A;  3C7U A;  1V9Z A;  4I3J A;  4JGR A;  3SOI A;  4LV2 A;  3VFH A;  5HAQ A;  1XFQ A;  1DP8 A;  4GB7 A;  4WUJ A;  4AFI A;  2PDR A;  1PI4 A;  4C3Q A;  4JF5 A;  2OLV A;  2ZMV A;  3EQU A;  2RL3 A;  2P74 A;  3RXW A;  3TW8 A;  2JE5 A;  3GDI A;  1I5Q A;  1WYC A;  3MJQ A;  5GHZ A;  3H7W B;  2XGN A;  4IVI A;  3W8K A;  1O7E A;  4G3K A;  2Q0O A;  4KUK A;  2Y2P A;  1S0W A;  1PNE A;  4F94 A;  4M4X A;  4GDB A;  2WAE A;  4GDN A;  2J3T D;  4R23 A;  4BD1 A;  3T4L A;  3NOP C;  1ACF A;  1ONG A;  5CTN A;  1JNU A;  1XXM A;  2R78 A;  3ZYT A;  2ZL1 A;  2PD7 A;  5EOO A;  3G35 A;  2EA9 A;  4OPY A;  3FKV A;  3VP4 A;  2YKF A;  4Y15 A;  3C5A A;  4FD8 A;  3LYX A;  3C2W A;  1XGI A;  1IFQ A;  2C5W B;  4BMW A;  5HFO A;  3A0V A;  2M7V A;  4S2K A;  3EGD C;  4MLL A;  5FI2 A;  3MKF A;  2WYX A;  4UA9 A;  2BLS A;  4GCZ A;  3BYD A;  5EOE A;  3H82 A;  3ZVW A;  1AWI A;  3E0Y A;  4UQI S;  1F98 A;  4GD6 A;  2M1C A;  3BFC A;  4LGW A;  5CEB A;  1H3Q A;  3QP2 A;  4WMC A;  3I7J A;  1W5D A;  1LI0 A;  4KZ3 A;  5EEC A;  4ETZ A;  1YSQ A;  3BM6 A;  3LID A;  5JYO A;  4OQ0 A;  2OAP 1;  3CLO A;  3S1Y A;  3N8R A;  2Y55 A;  4S2O A;  4WZ5 A;  2I72 A;  3UY6 A;  2EFX A;  4R0Q A;  2V1B A;  4IBX A;  4HHD A;  4WZ4 A;  4NXG A;  3NC8 A;  3ZG5 A;  2WAD A;  2J3W A;  1YM1 A;  3O3V A;  1I2S A;  4OH0 A;  1K6R A;  1M40 A;  2R9W A;  2ZMA A;  2PYR A;  4CLC C;  5TGF A;  3HL9 A;  1ESU A;  1T1A A;  2Y2H A;  4B9O A;  4DF6 A;  4RQ9 A;  4R3A A;  2WKP A;  3G2Y A;  3CHW P;  2FH5 A;  3DWK A;  2PYP A;  4DXB A;  2H0T A;  5TBM B;  1YMX A;  2X71 A;  4KG5 A;  1QME A;  1OTD A;  4E6X A;  3N7W A;  4GD8 A;  3IXB A;  2QMI A;  4DDS A;  2W3F A;  4BL2 A;  2HP6 A;  3VP3 A;  4LPZ A;  4LCM A;  5I94 A;  2L4R A;  4QHC A;  3IF5 A;  3EGX C;  4IED A;  2GZA A;  5M19 A;  4EES A;  1IEL A;  5HWW A;  5HL6 A;  3IX3 A;  3PBT A;  1A0K A;  2Z6C A;  2Y2Q A;  3T50 A;  1NZO A;  1G6O A;  3OLO A;  4NG2 A;  5A93 A;  4PHT A;  5EVE A;  1FSY A;  5CGX A;  5A92 A;  1OME A;  3KO6 A;  4G3V A;  4WEL A;  1WA9 A;  2VZW A;  3BQ8 A;  2OSU A;  2X02 A;  2Z6D A;  4PAU A;  3OCL A;  1VEU A;  3IF6 C;  2X01 A;  2A2L A;  1F9I A;  3ITB A;  3VV4 A;  4E3I A;  4ZTK A;  5JYP A;  4S2I A;  3PHY A;  3UE6 A;  3WRZ A;  1BUL A;  2HDS A;  1I2W A;  5FQJ A;  1ERQ A;  2ZM8 A;  2O99 A;  4LV1 A;  4PKY G;  4P85 A;  5HSQ A;  4LRX C;  1ES3 A;  1LL8 A;  5AQ7 A;  3U4L P;  2OWH A;  3V3S A;  4H8R A;  3QP5 A;  1DJA A;  3B42 A;  4G3W A;  2FFY A;  1W8Q A;  5L09 A;  2E8J A;  5CGW A;  5M1A A;  1X0O A;  4O7D A;  2PU2 A;  2WUQ A;  2VV6 A;  4IUH A;  1BLP A;  1MWS A;  1XJ4 A;  3UDI A;  3BLM A;  5E2F A;  4E3L A;  4WZ5 C;  4EW7 A;  4OLG A;  1KDW A;  5DF8 A;  2DRW A;  5EVI A;  5FAQ A;  3C7V A;  1NWZ A;  5GLA A;  2OOL A;  4PKY A;  4B88 A;  5IS1 A;  4OQI A;  4JXS A;  2JKR M;  5L8M A;  1H0M A;  1PYY A;  4GS9 A;  5FQQ A;  3R4K A;  1IYP A;  5HPF A;  4RYE A;  4R3J A;  5CHJ A;  5A8B A;  4KUO A;  3HUN A;  2EX8 A;  2HGV A;  2Q9M A;  2V9A A;  2XFT A;  4JBF A;  1AXB A;  1VM1 A;  4HBU A;  3HVF A;  3LIF A;  3QP8 A;  5EV0 A;  5CER A;  3IXH A;  3PBQ A;  3KYZ A;  3CUE C;  3HLC A;  3HBR A;  3NJA A;  4NXE A;  4WEJ A;  2JKT M;  2HZ5 A;  1P0Z A;  1F2K A;  3GV9 A;  1KE0 A;  3JPU A;  2OV5 A;  5FDS A;  1F5M A;  3TJZ C;  3LEZ A;  1N4O A;  4CLC D;  2ZMF A;  3DWZ A;  1J3W A;  4DJ3 A;  3G2Z A;  3E4O A;  4P6Z S;  5FI6 A;  2JKF A;  2VA0 A;  1LSW A;  2IA2 A;  2VGJ A;  4XXR A;  1BLC A;  1J9M A;  3UO9 A;  3WRT A;  3HCY A;  4HY8 A;  3IQA A;  4ZRR A;  5KSC A;  4XT2 B;  5AQ9 A;  2JKT I;  3IX8 A;  2Y2G A;  3VP2 A;  2INW A;  4L9E A;  1QMF A;  4BEN A;  3F1O A;  5FAP A;  2EX6 A;  3JVV A;  5L07 A;  2W3G A;  1MPL A;  3KSG A;  3GQZ A;  1N9L A;  3T4O A;  4LLO B;  4EXO A;  3T4S A;  3U2A A;  3GTC A;  2KDK A;  2Y2K A;  2W1T A;  3ZDJ A;  1LSV A;  3GSG A;  5EM0 A;  4NEE D;  4CLC B;  3TSG A;  3ZG8 B;  2O9C A;  1TS8 A;  4K0X A;  3VSK A;  4IUK A;  2QPN A;  4NET A;  4LV0 A;  1RCJ A;  1L0F A;  1D1J A;  3MZE A;  3UE1 A;  5I5L A;  1K55 C;  5A91 A;  2PU4 A;  1JWZ A;  1T19 A;  1BLH A;  1WE4 A;  2A24 B;  1XP4 A;  2P9V A;  3NEC A;  4EBP A;  4WLA A;  2HDU A;  4E3N A;  1JTD A;  2J8Y A;  3OC2 A;  4B4Z A;  3HRE A;  3FPW A;  2JC7 A; 
#chains in the Genus database with same CATH homology
 2HDQ A;  4KZ4 A;  1NZU A;  3MZD A;  5EOO A;  3ZCZ A;  4K0W A;  5CTM A;  3FZC A;  3G35 A;  5U47 A;  1K56 D;  5HX9 A;  4OPY A;  3FKV A;  3NBL A;  1HTZ A;  2ZJ9 A;  3VP4 A;  1K57 A;  3BFF A;  4LEN A;  5EVI B;  3BEC A;  1K4F A;  1ALQ A;  1PW8 A;  1XPB A;  3C5A A;  4JXG A;  4OOL A;  4FD8 A;  3UDF A;  2WGW A;  4ZJ1 A;  1BUE A;  4PM7 A;  1LL5 A;  1XGI A;  3P09 A;  3WS1 A;  2C6W B;  2P9V B;  2J7V A;  4NK3 A;  2WKH A;  4CJN A;  1C3B A;  2C5W B;  3OPL A;  4LCL A;  1L0G A;  1CI8 A;  5HFO A;  1E25 A;  2JBF A;  4QY6 A;  4Y7P A;  2VGK A;  1YLT A;  4S2K A;  4N9L A;  2A3U A;  2WAF A;  4MLL A;  5FI2 A;  3MKF A;  2WYX A;  2V1Z A;  3IT9 A;  4UA9 A;  2HP5 A;  2BLS A;  3VOZ A;  4BLM A;  1ERM A;  5CRF A;  4HES A;  1EI5 A;  1MBL A;  4N9K A;  3LY3 A;  1IYO A;  3A3E A;  3BFD A;  3LCE A;  1NRF A;  3BYD A;  5EOE A;  3MXR A;  4Y0O A;  3B3X A;  4DE1 A;  4PM6 A;  1K4E A;  3ZVW A;  4L0L A;  1RGZ A;  2ZQ9 A;  4HEF A;  5DTK A;  3IF6 B;  3D4F A;  4GD6 A;  1CEF A;  1XKZ A;  1GHP A;  5J8X A;  3BFC A;  3MKE A;  3MXS A;  3MBZ A;  5KZH A;  4IBR A;  2HP9 A;  5EE8 A;  1GA0 A;  4KQQ A;  5A90 A;  2Y2J A;  3QNB A;  2H0Y A;  5CEB A;  4PM8 A;  1MY8 A;  5GLD A;  1LI9 A;  1XA7 A;  3ZG7 B;  1S6R A;  4OQG A;  4WMC A;  3I7J A;  1SHV A;  1W5D A;  1LI0 A;  4KZ3 A;  5EEC A;  3G32 A;  3UPN A;  4DDY A;  5L2F A;  1Q2Q A;  2Q9N A;  4ZDX A;  1KVL A;  2ZQ7 A;  1SCW A;  3BM6 A;  5JYO A;  4OQ0 A;  1M6K A;  1VQQ A;  3AGD A;  3S1Y A;  5DTT A;  3N8R A;  2Y55 A;  4S2O A;  1JWP A;  2CC1 A;  4WZ5 A;  2I72 A;  4WBG A;  3UY6 A;  2EFX A;  2EXA A;  4R0Q A;  4OKP A;  5TFQ A;  3GVB A;  1YMS A;  1PWG A;  2ZLY A;  3C4O A;  4RX3 A;  4IBX A;  4X56 A;  4ZJ2 A;  4WZ4 A;  2WZZ A;  1K55 A;  1ERO A;  2XD5 A;  3NC8 A;  3O87 A;  3ZNY A;  4KZ9 A;  1GHI A;  1IKG A;  1W7F A;  3ZG5 A;  5DF7 A;  1KDS A;  2WAD A;  1YM1 A;  2RCX A;  4K91 A;  1FR6 A;  3O3V A;  1I2S A;  1EWZ A;  3BEB A;  4Y0T A;  2XH9 A;  4N92 A;  4OH0 A;  4PMA A;  4P6B A;  3IWQ A;  4S2N C;  4MBF A;  1K6R A;  2PBY A;  1M40 A;  3G4P A;  3OZH A;  2R9W A;  2ZC4 B;  2ZMA A;  4KQR A;  5TGF A;  4JXW A;  4RA7 A;  4S2J A;  3DW0 A;  2H5S A;  3A3I A;  3HL9 A;  4B4X A;  1ESU A;  3E2L A;  2Y2H A;  1ESI A;  3Q7V A;  1YLW A;  4DF6 A;  4KZA A;  5AQB A;  4X6T A;  3NCK A;  4E3J A;  1IEM A;  3SS5 A;  1NYM A;  1ZG6 A;  3O88 A;  2ZM2 A;  3BFG A;  2DNS A;  3G2Y A;  2XEP A;  2IWB A;  1SDE A;  2Z2M B;  3PBO A;  5HAI A;  5CED A;  1NXY A;  3GMW A;  4ZBE A;  1FQG A;  1KE4 A;  4EV4 A;  1LL9 A;  3IXD A;  3DWK A;  1HVB A;  4DXB A;  2H0T A;  4S2L A;  1YMX A;  2Y59 A;  2X71 A;  4QU3 A;  4QY5 A;  1W79 A;  5FAT A;  5GHX A;  4KG5 A;  5EPH A;  3HLF A;  4IVK A;  3EQV A;  4MEZ A;  4KZB A;  4C6Y A;  1QME A;  1O07 A;  2ZD8 A;  5KMW A;  3MFD A;  4E6X A;  3E2K A;  5KSH A;  3O86 A;  4QD4 A;  5FQK A;  5F1F A;  4U0X A;  1MKI A;  4OP8 A;  3UN7 A;  3N7W A;  2IWD A;  4UA7 A;  4JXV A;  4GD8 A;  1KE3 A;  1Z6F A;  3FYZ A;  3IXB A;  4X68 A;  2QMI A;  3G30 A;  5DTS A;  4DDS A;  3IXG A;  4JF4 A;  2H10 A;  3A3F A;  3WS4 A;  1MWR A;  1DJB A;  4KZ7 A;  4BL2 A;  5EVI C;  2HP6 A;  3VP3 A;  2V2F F;  1YLJ A;  4LCM A;  5I94 A;  3AGF A;  3FKW A;  1XA1 A;  4QHC A;  3HUM A;  1CEG A;  3IF5 A;  3JYI A;  2XFS A;  4IED A;  4GZB A;  5FQ9 A;  5M19 A;  1SDN A;  1IEL A;  3Q81 A;  3CMZ A;  5CHM A;  1K54 C;  5HL1 A;  5E43 A;  2Y2L A;  4CPK A;  3PBT A;  1H8Z A;  2Y2Q A;  5BOH A;  3WS5 A;  1LLB A;  1TDG A;  2EX9 A;  1NZO A;  4WYY A;  5FQI A;  1K6S A;  3PBS A;  3M2K A;  4MBK A;  5A93 A;  4UAA A;  3A3J A;  4OOM A;  4KG2 A;  2Y2N A;  3UE0 A;  1FSY A;  1G68 A;  2XQZ A;  3NDG A;  3OPR A;  3WWX A;  4OPZ A;  3IWO A;  5CGX A;  1ES4 A;  5A92 A;  2J9P A;  4U0T A;  4WMC D;  1KGG A;  1OME A;  3IWI A;  2WGW B;  4ZAM A;  4BQM A;  5F1G A;  4WEL A;  4UA6 A;  3OCN A;  4OVD A;  1NJ4 A;  3V39 A;  1BT5 A;  3UPO A;  4YFM A;  3RXX A;  3Q82 A;  4UHU A;  1K57 C;  1Y54 A;  4DRT A;  2OSU A;  4DE3 A;  1K25 A;  2X02 A;  2DCF A;  2Y91 A;  3OCL A;  4OP5 A;  1GCE A;  3IF6 C;  2X01 A;  3HLW A;  4R1G A;  3PTE A;  5CXW A;  4XUZ A;  1JVJ A;  4OPQ A;  1KGF A;  5CEC A;  3ITB A;  5AQA A;  3VOY A;  2ZQD A;  3SH9 A;  1HD8 A;  1WYB A;  2FFF B;  3W4Q A;  3C4P A;  4OLD A;  4S2P A;  4E3I A;  1FCM A;  4ZTK A;  3ZHH A;  4WM9 A;  1GA9 A;  3BFE A;  3FV7 A;  4S2I A;  5JYP A;  3WRZ A;  1RGY A;  1BUL A;  2HDS A;  4PPR A;  1I2W A;  4S2N A;  3Q1F A;  3N4I A;  3GR2 A;  5CHU A;  2ZQ8 A;  1ZKJ A;  5EVL A;  3SS4 A;  3ZG9 B;  3UPP A;  4KEN B;  1BZA A;  3FWL A;  4BJP A;  5FQJ A;  1ERQ A;  2UWX A;  2ZM8 A;  5FI7 A;  3WS2 A;  3BRM A;  4S2M A;  4BD0 A;  3CJM A;  3V50 A;  4LV1 A;  1YLP A;  1H8Y A;  3ISG A;  3CZD A;  4P85 A;  1ES3 A;  1JWV A;  3BLS A;  3SH8 A;  2Y2M A;  4FH2 A;  3N6I A;  3VP0 A;  5TR7 A;  1FCN A;  5AQ7 A;  1H5X A;  4M3K A;  1YQS A;  2G2U A;  3V3S A;  1YLY A;  3TG9 A;  1BSG A;  2WGI A;  4H8R A;  3PBR A;  5FAS A;  4HBT A;  1TEM A;  2XK1 A;  3G31 A;  3IHA A;  4KG6 A;  1DJA A;  4X55 A;  5FDH A;  5HW3 A;  3A3D A;  3G34 A;  5CGS A;  2FFY A;  4R3B A;  1PWD A;  1PZP A;  1W8Q A;  4E6W A;  5M18 A;  2WZX A;  3M2J A;  5CGW A;  5M1A A;  1TDL A;  4DKI A;  3W4O A;  4O7D A;  2J9O A;  2PU2 A;  3HLB A;  3LY4 A;  2WUQ A;  5G18 A;  1CK3 A;  2OLU A;  1IYS A;  4JF6 A;  1BLP A;  1MWS A;  3UDI A;  1KGE A;  3BLM A;  5E2F A;  5GL9 A;  4E3L A;  4WZ5 C;  1DY6 A;  1ES2 A;  5IHV A;  4OQH A;  4RVA A;  2Y2I A;  1KDW A;  3OPH A;  4OLG A;  5DF8 A;  4KQO A;  2DRW A;  5EVI A;  5FAQ A;  3NI9 A;  1FR1 A;  2XD1 A;  3C7V A;  1L2S A;  1LHY A;  2V20 A;  2ZM0 A;  4D2O A;  3S22 A;  5GLA A;  3ZNT A;  3PAG A;  4QB8 A;  1MWU A;  2E8I A;  4FSF A;  5HAP A;  4B88 A;  4OQI A;  3UE3 A;  4JXS A;  1K54 A;  3UNW A;  4OPR A;  1HZO A;  1RP5 A;  2ZQC A;  3LO7 A;  5DF9 A;  1PYY A;  3NY4 A;  5F82 A;  3Q7Z A;  5FQQ A;  1U60 A;  5GLC A;  4C75 A;  1IYP A;  3Q7V B;  4JLF A;  4RYE A;  4R3J A;  2BG1 A;  5CHJ A;  3W4P A;  1BTL A;  2R9X A;  3ITA A;  1IKI A;  4R4S A;  3SS3 A;  2WKI A;  4Z9Q A;  3HUN A;  4ZJ3 A;  3M6H A;  1XGJ A;  4EQI A;  4FH4 A;  2ZC5 B;  2EX8 A;  2IWC A;  2Q9M A;  1E3U A;  5GHY A;  3ZFZ A;  2XFT A;  5F83 A;  4JBF A;  1AXB A;  1L0D A;  1SKF A;  4FCF A;  3CG5 A;  1VM1 A;  4HBU A;  3HVF A;  3ZVT A;  1ZG4 A;  2WK0 A;  3IF6 A;  1XX2 A;  2G2W A;  4N1X A;  4WEK A;  3IXH A;  5CER A;  3HLG A;  1FSW A;  2XF3 A;  3P98 A;  4ID4 A;  3PBQ A;  2Z2L B;  4DXC A;  1N9B A;  3HLD A;  5E2E A;  1K56 A;  3IH9 A;  1IYQ A;  3HLC A;  4Y0U A;  4A5R A;  1FOF A;  3HBR A;  1PZO A;  5GLB A;  1FCO A;  4WEJ A;  3ZG0 A;  1PW1 A;  2WKE A;  2QZ6 A;  3RJU A;  4MBH A;  3GV9 A;  1KE0 A;  3DTM A;  4GOG A;  4U3T A;  4X69 A;  5E2H A;  2ZC6 B;  5FAO A;  1NYY A;  1L0E A;  3QNC A;  4JPM A;  2OV5 A;  1CI9 A;  2Y2O A;  2ZQA A;  4P0M A;  1G6A A;  1W8Y A;  3LEZ A;  3V5M A;  3NDE A;  2ZC7 A;  1N4O A;  1PWC A;  5EUA A;  4Q8I A;  3DWZ A;  3N8L A;  4QJG A;  4DE0 A;  2HPB A;  2EX2 A;  1MXO A;  3G2Z A;  5FI6 A;  4N1H A;  4E3K A;  1KVM A;  4YIN A;  1ONH A;  2VGJ A;  4XXR A;  1BLC A;  1J9M A;  3UO9 A;  3WRT A;  3VMA A;  2JCH A;  3MZF A;  1Q2P A;  2A49 A;  3C7U A;  4GKU A;  3IHB A;  3GRJ A;  4OOY A;  3IQA A;  5KSC A;  5AQ9 A;  1ES5 A;  4MNR A;  3VFF A;  3SOI A;  3VP1 A;  4PM5 A;  4EWF A;  3SH7 A;  4BL3 A;  4P87 A;  3WS0 A;  2Y2G A;  4LV2 A;  3VFH A;  3VP2 A;  5HAQ A;  2Y4A A;  2WGV A;  5FQM A;  4X53 A;  1QMF A;  3OPP A;  3PAE A;  4XUX A;  4BEN A;  5FAP A;  2ZC3 B;  4GB7 A;  2EFU A;  2EX6 A;  3N8S A;  3AGE A;  1K38 A;  4KZ8 A;  1PI4 A;  5FSR A;  1MPL A;  1E4D A;  4C3Q A;  3GQZ A;  3IH8 A;  1BLS A;  2EXB A;  4R4R A;  5FA7 A;  4JF5 A;  2OLV A;  3S4X A;  3Q07 A;  1JTG A;  3EQU A;  3GTC A;  2RL3 A;  2P74 A;  3RXW A;  2JE5 A;  4JKT A;  2Y2K A;  5EVI D;  3UDX A;  3ZDJ A;  3GSG A;  4GN2 A;  1I5Q A;  1WYC A;  4LV3 A;  4E3O A;  3M6B A;  3TSG A;  5GHZ A;  3ZG8 B;  2XGN A;  3PBN A;  4IVI A;  4K0X A;  3VSK A;  3W8K A;  2QPN A;  3TOI A;  1O7E A;  3HLE A;  4LV0 A;  4NET A;  4EUZ A;  4PM9 A;  1GHM A;  1RCJ A;  2Y2P A;  1S0W A;  1YLZ A;  1L0F A;  1NY0 A;  1YT4 A;  2B5R A;  4F94 A;  3MZE A;  4GDB A;  3UE1 A;  1TVF A;  4OON A;  1K55 C;  2WAE A;  4GDN A;  5A91 A;  2PU4 A;  1JWZ A;  1PI5 A;  4R23 A;  1PIO A;  5HAR A;  4DE2 A;  4EBL A;  1BLH A;  4BD1 A;  1WE4 A;  4RX2 A;  1XP4 A;  2P9V A;  4EBP A;  1ONG A;  1MWT A;  2XLN A;  2HDU A;  3QHY A;  5CTN A;  1E3U D;  1XXM A;  2XDM A;  3V3R A;  3NIA A;  4E3N A;  4E3M A;  4KZ5 A;  1JTD A;  2J8Y A;  3OC2 A;  5D3O A;  3ZGA B;  1DJC A;  2XR0 A;  5E2G A;  4EBN A;  4B4Z A;  3HRE A;  2HDR A;  2GDN A;  5DVA A;  1ZC2 A;  3HUO A;  4KZ6 A;  4GNU A;  3VSL A;  2JC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...