3IF6B

Crystal structure of oxa-46 beta-lactamase from p. aeruginosa
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
242
structure length
242
Chain Sequence
b'VVIRSDWKKFFSDLQAEGAIVIADERQAKHTLSVFDQERAAKRYSPASTFKIPHTLFALDADAVRDEFQVFRWDGVNRSFAGHNQDQDLRSAMRNSTVWVYELFAKDIGEDKARRYLKQIDYGNVDPSTIKGDYWIDGNLKISAHEQILFLRKLYRNQLPFKVEHQRLVKDLMITEAGRSWILRAKTGWEGRFGWWVGWIEWPTGPVFFALNIDTPNRTDDLFKREAIARAILRSIDALPPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OXA-46 oxacillinase
publication title Crystal structure of the narrow-spectrum OXA-46 class D beta-lactamase: relationship between active-site lysine carbamylation and inhibition by polycarboxylates
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 70
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3if6B00
1FR1A 3UPOA 2JBFA 4MBHA 4IVKA 3HLFA 3BFDA 4OKPA 1L0DA 3Q1FA 3OPHA 1O7EA 1FOFA 1J9MA 2WGVA 1MBLA 2R9XA 5BOHA 2ZC3B 3ZGAB 3C7VA 5TR7A 1K55C 1KE3A 2I72A 4IVIA 1N4OA 5GHXA 4BJPA 3GVBA 5CGXA 4DE0A 2EX9A 1XA7A 2XFSA 1XPBA 3WWXA 3WRTA 4LCMA 3G2ZA 3LY3A 2E8IA 1SKFA 5A93A 3TG9A 5HAQA 4ZJ1A 4U0XA 4N1XA 4S2OA 5KMWA 5DTKA 3BECA 3FV7A 4DDYA 1LI9A 2ZQ9A 1BLHA 1XXMA 1MWRA 4R4SA 4KQRA 3IQAA 2ZQDA 3GMWA 3NY4A 4IBXA 5HARA 2JCHA 4BLMA 4LV3A 3ZVWA 5JYOA 5EUAA 2R9WA 1IYPA 3LO7A 3IXDA 1E3UA 1VM1A 3PBOA 1HZOA 2V20A 4OPQA 4QU3A 5EECA 5GLCA 1LL5A 2IWCA 1ES2A 1MXOA 4GN2A 3FKVA 2RCXA 5CEBA 1VQQA 2G2UA 5HAIA 3WS0A 5CRFA 5AQ9A 3ZNYA 1NYMA 1PWCA 3W4OA 5FI2A 3UPNA 5FQ9A 4S2MA 1N9BA 2Y2JA 3BM6A 2OSUA 1L0FA 3CMZA 4JXSA 4WZ5C 4X69A 3BLMA 4R23A 3V5MA 4WEKA 2EX8A 4EQIA 1GHPA 3DWKA 4HBUA 3Q7VB 5J8XA 1JVJA 1EWZA 4E3LA 5EOEA 1KGGA 4KQOA 3VFFA 5L2FA 5FAPA 2V2FF 4QY5A 3SS4A 1YLZA 1KVMA 4S2NC 4OP8A 3ZG8B 4U0TA 5AQAA 1NJ4A 4CPKA 3SS3A 1NXYA 4DKIA 1FQGA 1ERMA 1PW8A 1C3BA 1FCOA 2QPNA 2V1ZA 5F83A 3HUOA 1BLSA 3BFEA 2ZM8A 3C5AA 3HLCA 3S22A 3PAGA 3S4XA 4JBFA 4OQ0A 3OPRA 4KZ5A 4XUXA 3DWZA 3ZG5A 1LLBA 3V39A 4DE3A 2A3UA 3VMAA 1CK3A 3N7WA 4GDNA 2EX2A 3IT9A 3VP4A 3G30A 4H8RA 4JF6A 5EOOA 2JE5A 4OOMA 3PBRA 4S2IA 5EVIA 2B5RA 4KG2A 2JC7A 5GLBA 4QJGA 4OLGA 4EBPA 4GD6A 5DTSA 1KVLA 3ZHHA 3N4IA 4DXCA 4KZAA 1AXBA 4B4XA 4ID4A 4OPZA 5E2EA 1E4DA 3IHBA 1L0EA 3SH7A 4PM6A 4XUZA 3ZFZA 4GD8A 1SDNA 2X02A 3VSLA 3MKEA 1BT5A 3WS1A 3IF6A 1S0WA 4FH2A 4UA7A 1IEMA 2XH9A 3NI9A 4E3OA 1NZOA 3VP0A 3E2LA 3D4FA 2Z2LB 3O88A 2Q9MA 3IH8A 5M18A 1XGJA 3AGFA 3OPLA 3M6BA 1YMSA 4ZTKA 4D2OA 5FQQA 3BFCA 3Q81A 4LCLA 2J9PA 4BD0A 1EI5A 2XEPA 3VOYA 1XGIA 4EWFA 2P74A 1ALQA 4B4ZA 3HVFA 1M40A 1E3UD 4LV2A 4N9LA 3SH9A 1ES4A 4WMCA 3WRZA 1FSYA 3LY4A 3OCLA 3UO9A 2VGKA 1G68A 1YMXA 5AQ7A 4R4RA 3MBZA 2WAFA 3UY6A 4ZJ3A 4RA7A 1NY0A 4KZ8A 4Y7PA 3UDFA 2ZC5B 3IXBA 1S6RA 4R0QA 3HUNA 2WGWB 3IWIA 3HLWA 1BTLA 2Y2HA 3A3EA 2ZLYA 5CHMA 4EUZA 2Z2MB 1DJBA 4Y0UA 1MPLA 1K57C 3GRJA 4X68A 1QMEA 5FDHA 4E6WA 4N9KA 1MWSA 1L0GA 1PI5A 4DE1A 5FAQA 4FH4A 5I94A 3HLBA 4LV0A 3BYDA 3N8LA 3E2KA 2WYXA 1YLTA 3DW0A 4EV4A 4WZ5A 4O7DA 4LENA 4BL2A 1YLJA 2H10A 5CXWA 4YFMA 3GV9A 1IYSA 2J9OA 2Y2QA 3BEBA 3FYZA 4GOGA 2FFYA 4P85A 4B88A 4DDSA 3Q82A 1ERQA 3G34A 2ZD8A 4X53A 2QZ6A 4E3IA 3AGEA 1NZUA 1IYQA 1SHVA 3Q7VA 3RXWA 3VP3A 4WELA 5FI6A 2OLVA 4KENB 4S2NA 1WE4A 2UWXA 4MLLA 3ITAA 2CC1A 4OPRA 4Y0OA 3SS5A 1CEGA 4C3QA 4DXBA 3UE0A 4KZ7A 3BFGA 4S2PA 1WYBA 2Y2NA 4QB8A 4RX2A 2WKEA 3NDEA 4HESA 3V50A 2WK0A 2ZQ8A 3UDXA 5CTMA 3B3XA 1DJAA 1KDSA 4YINA 1BZAA 4S2JA 4C6YA 2A49A 4QD4A 1FCMA 4JF5A 5HAPA 4PM8A 3O3VA 4IBRA 2C5WB 1DJCA 1CI9A 3CZDA 2HDRA 2Y2MA 5DF9A 5DTTA 5GHZA 1QMFA 1HTZA 1MKIA 1PW1A 4P6BA 3MXSA 5CTNA 4JPMA 4ZDXA 5FASA 3ZDJA 3G4PA 1MWUA 4Q8IA 1ZKJA 1TDGA 2ZMAA 4P87A 3DTMA 2QMIA 4ZBEA 1K4FA 1ESIA 5CGWA 4KZBA 1RGYA 1OMEA 3EQVA 3ZNTA 4K0WA 1GHMA 3RJUA 3P09A 2VGJA 3PBSA 3VP2A 2Y4AA 4MBFA 4WMCD 5FAOA 2X01A 1IKIA 3IXHA 2ZC4B 1BUEA 1PWGA 2P9VB 4PM9A 3S1YA 5FI7A 2BG1A 4WBGA 5F1FA 2HDQA 4M3KA 5M1AA 2EXAA 2ZQCA 2HP9A 3BRMA 4XXRA 4X56A 2Y55A 1CEFA 2J7VA 1ZC2A 2FFFB 3OPPA 4K0XA 5F82A 4KG5A 3V3SA 2XGNA 5E2GA 4DE2A 1E25A 1RCJA 4ZAMA 4N1HA 1JTGA 3Q07A 2ZJ9A 5A91A 2J8YA 1YLWA 2HP5A 1W8QA 1XP4A 2PU4A 3BFFA 3HLGA 4OVDA 2Y2GA 1ESUA 4FCFA 4X6TA 3HLEA 4MBKA 2Y2OA 3HLDA 5CGSA 2X71A 2WGIA 4Z9QA 1Q2QA 2H5SA 5CERA 4OH0A 1TDLA 4BD1A 3LEZA 4JF4A 1W7FA 3MZDA 3PBNA 2WKIA 1CI8A 4EBNA 4F94A 1G6AA 1K57A 4HBTA 1K55A 5FQIA 4RX3A 1PYYA 3HBRA 3EQUA 3MFDA 3NCKA 5IHVA 3W4QA 1IELA 1BSGA 3GQZA 5EPHA 1EROA 3JYIA 3A3IA 3UE3A 2EFXA 5KSCA 3HREA 4OQIA 3UE1A 3O87A 5FQMA 4UAAA 1K6SA 1W8YA 4OPYA 1GCEA 1XX2A 4BL3A 4E3NA 2WZXA 3IWQA 1HVBA 5TFQA 4JXVA 2WADA 3N8RA 4KZ6A 4Y0TA 4X55A 1FSWA 4R3JA 5A92A 3IH9A 4DRTA 2G2WA 4GKUA 4NETA 5FA7A 5CECA 1YT4A 4DF6A 4UA9A 4WYYA 4P0MA 2ZM0A 1PWDA 4JXWA 2Y2KA 2XFTA 4E3KA 3A3DA 1ONHA 2HDUA 2Y2IA 3GSGA 3NBLA 4OP5A 4BENA 5E2HA 5HL1A 2XDMA 1KDWA 1Q2PA 1Y54A 1KGEA 2IWDA 3OC2A 1MY8A 5F1GA 2Y2PA 5CEDA 4OONA 1MWTA 1PZOA 4KZ9A 3FKWA 3M2KA 1K56A 4OOLA 1IKGA 1TVFA 4QHCA 1U60A 1W79A 4QY6A 1WYCA 1JWPA 1PIOA 1I2SA 2EX6A 2GDNA 4PMAA 3MZEA 2XQZA 1I2WA 2XD1A 2XK1A 3ISGA 3NIAA 5GLDA 5TGFA 2EFUA 3MZFA 3WS4A 1K54C 4GZBA 5EVID 4A5RA 3MKFA 4OQGA 4KZ3A 4E3MA 3HL9A 3QHYA 3VP1A 1JWZA 1K6RA 1PI4A 3ZG7B 3G31A 1IYOA 3Q7ZA 4JLFA 1H5XA 1KE4A 1BLPA 2ZC6B 3FZCA 3PAEA 5A90A 1ZG4A 3OCNA 3ITBA 3QNCA 1YLYA 2WAEA 5G18A 3I7JA 5DVAA 3UN7A 1LI0A 3N6IA 4R1GA 1PZPA 4N92A 5E43A 2EXBA 3G35A 1BLCA 2PU2A 4JXGA 1L2SA 2P9VA 3G32A 5GLAA 3TSGA 4HEFA 5HW3A 5CHJA 3NC8A 2WKHA 1YLPA 2ZM2A 3PTEA 4LV1A 5FQKA 3AGDA 4PM7A 2XR0A 1ES3A 1XA1A 3C7UA 4E6XA 2BLSA 4S2LA 3VSKA 5DF7A 2H0YA 5EE8A 5HX9A 3C4OA 3UNWA 4JKTA 5E2FA 2DNSA 5AQBA 2WUQA 3OZHA 2RL3A 1RGZA 5KZHA 4R3BA 4PM5A 1YQSA 1GA0A 1NRFA 1K4EA 2OLUA 3HUMA 1TEMA 3ZCZA 4PPRA 2C6WB 2DRWA 2IWBA 4UA6A 4BQMA 3NDGA 2XLNA 1LHYA 3SH8A 2Y91A 1H8YA 1H8ZA 1LL9A 3M6HA 2HP6A 1BULA 2Y2LA 5CHUA 1NYYA 4ZJ2A 1RP5A 1XKZA 4GNUA 3LCEA 3RXXA 3G2YA 4RVAA 1O07A 3PBQA 1HD8A 1I5QA 3IF5A 3TOIA 1JTDA 2WZZA 5FSRA 1W5DA 3ZG0A 4KG6A 1SDEA 3WS5A 1K25A 1GA9A 1Z6FA 4FSFA 4K91A 4NK3A 1FCNA 1YM1A 3C4PA 3W4PA 1JWVA 5KSHA 5M19A 5EVLA 3PBTA 1K56D 2DCFA 2WGWA 2Y59A 3UPPA 3IWOA 4UHUA 3P98A 5GL9A 3VFHA 1GHIA 3BLSA 5HFOA 4GB7A 1DY6A 4C75A 2XF3A 5EVIB 4L0LA 5FATA 2ZC7A 2ZQ7A 2HDSA 3IXGA 3ZVTA 1KE0A 1ONGA 2PBYA 2ZQAA 4E3JA 1FR6A 3VOZA 4KZ4A 3QNBA 4OOYA 5GHYA 1KGFA 1M6KA 5EVIC 1SCWA 4WM9A 4MNRA 5U47A 4EBLA 4OQHA 2Q9NA 3W8KA 3CJMA 2XD5A 3UDIA 3IHAA 1ZG6A 1K38A 5JYPA 4IEDA 3GR2A 5DF8A 3WS2A 3GTCA 3SOIA 4RYEA 4CJNA 2H0TA 3N8SA 3MXRA 4OLDA 5D3OA 4KQQA 3O86A 3IF6B 4WZ4A 4U3TA 4FD8A 3A3FA 1K54A 3CG5A 3M2JA 3A3JA 5FQJA 2OV5A 3V3RA 4WEJA 3IF6C 4MEZA 1ES5A 3FWLA 2HPBA 4S2KA 3ZG9B 4GDBA
chains in the Genus database with same CATH superfamily
4IVKA 3BFDA 1T19A 1WA9A 4X1MA 2WGVA 3VV4A 2ZC3B 2GJ3A 1OJGA 1S1YA 1K55C 1KE3A 2VA0A 3F1NA 3GVBA 1XA7A 4LCMA 3G2ZA 5A93A 5KMWA 4WN5A 1LI9A 1BLHA 1LT0A 1JNUA 2J3TD 3BJNA 3GMWA 1TD5A 1VEUA 5DKLA 3ZVWA 5JYOA 2R9WA 1IYPA 4WLAA 1E3UA 3PBOA 1HZOA 2V1BA 5GLCA 1LL5A 3W4OA 5FI2A 4AFIA 3KO6A 4JXSA 2OSUA 2VV8A 4EETB 1ZHHB 1VETA 2EX8A 1GHPA 5L09A 4I38A 3CLOA 5G4YA 5EOEA 4XT2B 5FAPA 1YLZA 2EWVA 4R38A 4B93A 4O8GA 3ZG8B 1D06A 1HLUP 5AQAA 4CPKA 4DKIA 1PW8A 1FCOA 5F83A 3BFEA 3HLCA 3S4XA 5AVEA 1GSXA 3FC7A 1XFQA 4OQ0A 1NLZA 4HIAA 2XA7M 3IT9A 3VP4A 5EM1A 1A0KA 3MFXA 2KLIA 2JE5A 3PBRA 2PYPA 4CLCA 5DTSA 1AXBA 5HWTA 4B4XA 4GD8A 2P08A 1L3LA 3WS1A 1SKOB 1S0WA 4FH2A 1IEMA 3NI9A 5M18A 3IH8A 3AGFA 3S7NA 3LIEA 1EI5A 1ALQA 4ME4A 4B4ZA 2ZOIA 4N9LA 1ES4A 3WRZA 5HDCA 2VGKA 4HI4A 3O5YA 3RTYA 5AQ7A 4R4RA 3UDFA 3IWIA 1BTLA 3NULA 4Y0UA 1DJBA 2V8CA 4E6WA 1QMEA 5FDHA 2VLGA 1L0GA 4DE1A 4FH4A 2NUPC 5IS1A 3EGXC 2QHKA 1J3WA 1Z09A 4FTXA 1LL8A 2WYXA 3E2KA 2VV7A 2O9BA 4BL2A 2QYBA 2J9OA 3BEBA 1ERQA 2QZ6A 4E3IA 4UQIS 1SHVA 3RXWA 2OLVA 4S2NA 3T4JA 4XT2A 1H0MA 1T1AA 4KZ7A 3UE0A 1WYBA 3NDEA 3V50A 3BY8A 4EW7A 1DJAA 4C6YA 4JF5A 5HAPA 1TS0A 3S7OA 2Y2MA 3OLOA 1EW0A 3PYPA 3GDIA 4LRXC 3DTMA 2QMIA 4ZBEA 1K4FA 3K3DA 3DAVA 5CGWA 1RGYA 3CUEC 4NKPA 1OT6A 3ZNTA 3E4OA 4Y2FA 2Y4AA 4WMCD 5DFXA 4PM9A 3S1YA 2VZWA 2HDQA 1MKMA 3LR4A 4MN6A 2EXAA 2HP9A 4XXRA 3ZHHA 1CEFA 3OPPA 2FFFB 4DE2A 2BASA 3Q07A 1W8QA 5CGSA 2QJ7A 2X71A 4BBUA 2WGIA 5FDSA 5CERA 4OH0A 1TDLA 4BD1A 1NLYA 4YNRA 1OTAA 3BQAA 1K57A 4LRZE 3HBRA 3MFDA 4GHIB 3A0SA 5EPHA 1T1BA 3A3IA 3B42A 4UAAA 2YKHA 1GCEA 1XX2A 4E3NA 5HSQA 4CLCC 5HZHA 3N8RA 4KZ6A 4X55A 1FSWA 4R3JA 5A92A 4DRTA 3T1QB 4UA9A 3L7HA 3UB5P 2YKFA 4JXWA 2XFTA 3A3DA 2Y2IA 5E2HA 5HL1A 1Y54A 1KDWA 1Q2PA 1ODVA 1MY8A 5AVFA 4OONA 1MWTA 1PZOA 3FKWA 3M2KA 4PKYG 2XSSA 4QHCA 3KX0X 4QY6A 1I2SA 3NOUC 2XQZA 5GLDA 2A24B 3HCYA 5EVID 3IBJA 3HL9A 3VP1A 1PI4A 4HJ6A 1IYOA 5A90A 4EXOA 3OCNA 2M7VA 3I7JA 2W3GA 5E43A 2PU2A 4JXGA 1L2SA 4DJ3A 3T4OA 3PTEA 1YLPA 2J3WA 1K0KA 3AGDA 4DN0A 1ES3A 1XA1A 3C7UA 3D9YA 4JGOA 4S2LA 1H8MA 1Y28A 3VSKA 2H0YA 3D3OA 3EOIA 3H7WA 5AQBA 4HOIA 5KZHA 3P01A 3TW8A 4G3VA 3HUMA 1YKDA 3ZCZA 2DRWA 1H8YA 2HP6A 1XKZA 4GNUA 3RXXA 4RVAA 4GHIA 3FG8A 1HD8A 3TJZC 3T1RA 1Z6FA 4FSFA 4NK3A 1K56D 2DCFA 2WGWA 3UPPA 3P98A 4RQ9A 1GHIA 1DY6A 4C75A 4L0LA 2INWA 5FATA 2V0WA 4LLOB 2PBDP 3VOZA 5GHYA 3QNBA 1SCWA 4WM9A 4BBTA 2ZOHA 4EBLA 3IX4A 3CPTB 2DMWA 3F1OB 1K38A 3IS2B 3S7QA 5D3OA 3IF6B 4FD8A 3A3FA 2OV5A 3V3RA 3A0RA 4WEJA 4S2KA 3LUQA 2A24A 3FWLA 4IUKA 4GDBA 1FR1A 2PAVP 2PD7A 5TR7A 5GHXA 2O9AA 2HJ9C 5CGXA 2EX9A 3LY3A 4ZJ1A 4U0XA 4S2OA 5DTKA 3FV7A 4QWOA 2E8JA 2K7SA 3NY4A 5HARA 3T50A 2JCHA 4BLMA 3LO7A 3UMDA 4QU3A 3LGOA 3KSGA 2IWCA 1MXOA 3FKVA 1T1CA 2I9VA 1VQQA 2G2UA 5HAIA 3WS0A 4R6LA 5CRFA 5AQ9A 3ZNYA 1NYMA 3UPNA 4CQHA 5FQ9A 3BLMA 3DWKA 3U4LP 4EEUA 4I39A 1JVJA 5L2FA 3SS4A 4HJ3A 4OP8A 4U0TA 3NOTC 1NXYA 3MJQA 1ERMA 3HUOA 3C5AA 3S22A 3PAGA 4EESA 3ZG5A 1LLBA 2A3UA 1CK3A 4GDNA 3G30A 4H8RA 4JF6A 5EOOA 4OOMA 3QP5A 1XJ2A 4KZAA 3LR5A 4UEYA 4OPZA 3IHBA 1L0EA 3KSFA 3IS2A 4Y13A 5TBMB 5HWWA 4EU0A 3LYXA 4HJ4A 3IF6A 2XH9A 1NZOA 3VP0A 4BMWA 4Y15A 2Q9MA 3VOLA 4GLQA 3OPLA 3M6BA 4ZTKA 4D2OA 1LSWA 2XEPA 2KX6A 1XGIA 4EWFA 3QP8A 1M40A 1E3UD 3OCLA 1S67L 4L9GA 1YMXA 4HY8A 3UY6A 1NY0A 3IXBA 4R0QA 3HUNA 1OPXA 4EUZA 3E4QA 3JVUA 1MPLA 3N8LA 4BWIA 4EV4A 4WZ5A 3EGDC 2H10A 1IYSA 2H28A 1FIKA 3FYZA 4GOGA 4P85A 4B88A 3E98A 3G34A 3ZYTA 2CMNA 3AGEA 2W1RA 1IYQA 3VP3A 5FI6A 3SW1A 3ITAA 4GJ4A 3SS5A 4DXBA 4EUVA 4S2PA 2Y2NA 3LI8A 2W1TB 4KQDA 4RX2A 3QP4A 4CLCD 4HESA 5HD3A 4NXBA 5CTMA 3CHWP 3LEQA 1BYWA 2A49A 4QD4A 3LIAA 1Y4OA 5C5KA 3O3VA 5F6AA 2C5WB 5DTTA 1MKIA 5CTNA 4HH2A 4JPMA 5FASA 4KUOA 1IOUA 3ZDJA 1ZKJA 3VE3A 4KZBA 1TS8A 3VE4A 4K0WA 3VP2A 5FAOA 4MBFA 1BUEA 1PWGA 5FI7A 1TF1A 3BRMA 4X56A 2Y55A 4K0XA 1ZC2A 3V3SA 4KG5A 2XGNA 1F2KA 1RCJA 3UMEA 4ZAMA 2FZ0A 4HP9A 2ZJ9A 2J8YA 1YLWA 2HP5A 4FCFA 4Y17A 4P6ZM 2Y2OA 4Z9QA 2WKPA 5EFWA 3LEZA 3RFBA 1XJ6A 2WKIA 4HHDA 4NXEA 2ZMVA 1G6AA 2VGLS 4HBTA 2KDKA 3OBFA 5DJTA 2PT7A 3NCKA 1IELA 2VKSA 1EROA 2BTFP 3JYIA 5EM0A 1K6SA 3W2ZA 4OPYA 5FEFA 3T4SA 4BL3A 2WZXA 3IWQA 1HVBA 2WADA 3EWKA 5L07A 4Y0TA 5FA7A 4DF6A 2WKQA 1F98A 4WYYA 3ULFA 2Y2KA 2HDUA 4ETXA 1N9NA 3DBAA 2XDMA 5F68A 1KGEA 2Y2PA 1OTEA 3V67A 2W1TA 4LFUA 4Q0HA 1U60A 1WYCA 3T12B 3ISGA 3MZFA 1K54C 4GZBA 4GS9B 4OQGA 4KZ3A 4IHQA 3C2WA 3QHYA 1K6RA 1PRQA 3Q7ZA 1H5XA 1BLPA 3PAEA 1YLYA 2WAEA 3DTEA 5DVAA 3UN7A 5DJUA 4N92A 1BLCA 2J80A 3TSGA 5HW3A 5CHJA 4LV1A 4Y5FA 2XR0A 1TS7A 2VX8A 2BLSA 5J4EA 3LFVA 5DF7A 5EE8A 2WUQA 1SKOA 2RL3A 4R3BA 3K2NA 4PM5A 1YQSA 1NRFA 5EV0A 1K4EA 2C6WB 5DKKA 3T4TA 2XLNA 1LHYA 1LL9A 4ZJ2A 3LCEA 4G3WA 1O07A 1I5QA 3IF5A 3NOPC 2A2LA 2WZZA 3WS5A 4K91A 4IUHA 1FCNA 1YM1A 3W4PA 5M19A 5EVEA 2Y59A 3IWOA 4UHUA 5HFOA 3PR6A 5EVIB 3IXGA 3ZVTA 1ONGA 5A8BA 2JHEA 1S1ZA 2PBYA 2V0UA 2Q9NA 3W8KA 2W3HA 2LB9A 5JYPA 4IEDA 1P9RA 2ZBBA 4OLDA 3MXRA 4MN5A 4L9EA 3B47A 3PHYA 4MEZA 4MCWA 3LIBA 2QJ5A 4OKPA 1L0DA 4GS9A 3Q1FA 3OPHA 3BQ8A 1FOFA 1NRJA 1MBLA 2NUTC 2R9XA 4WUJA 3T4KA 4IVIA 2I72A 3JVVA 1N4OA 5K5BA 3E0YA 4UQIM 2XFSA 1XPBA 3WWXA 2JKTI 3WRTA 2E8IA 1SKFA 3TG9A 4N1XA 3LICA 4DDYA 1OTIA 1V9ZA 2JKRM 3ZQ5A 2L0WA 3IQAA 2ZQDA 3L9KA 2PYRA 1VM1A 3LIFA 4OPQA 4MDZA 1LSXA 5CEBA 4HH3A 1PWCA 4FUWA 1H3QA 4S2MA 3BM6A 1L0FA 3NECA 4HNBA 5TJJA 4HBUA 1EWZA 1DP9A 1KGGA 4KQOA 4JGPA 3VFFA 2OWHA 4QY5A 4S2NC 1NJ4A 3SS3A 4LGWA 3F1PB 2OWJA 2G7UA 4XUXA 3DWZA 3V39A 2HF6A 2EX2A 2M7UA 2AVXA 5HWVA 4F3LB 5IT5A 4S2IA 5EVIA 2B5RA 4QJGA 4OLGA 2JKGA 4GD6A 3C8CA 3CI6A 1OTBA 1KVLA 3SZTA 3N4IA 5LBRA 4I3JA 1S4SA 3EEHA 3SH7A 4XUZA 4KUKA 3ZFZA 2X02A 3R7WB 4II7A 4UA7A 1F9IA 1D1JA 3MQOA 3O88A 1UWPX 3CITA 1NWZA 1YMSA 3BFCA 3Q81A 4HP4A 3VOYA 2P74A 2L4RA 1DP6A 3BWLA 4LV2A 4YOFA 1X0OA 1FSYA 3LY4A 1G68A 3MQ0A 5KIZA 3NHQA 3MBZA 4ZJ3A 4X25A 5G4ZA 5MC7A 3A3EA 2ZLYA 4JGRA 1K57C 4X68A 4R70A 4N9KA 1MWSA 1PI5A 5I94A 2O9CA 1F5MA 3BYDA 1YLTA 3DW0A 1ZTUA 4O7DA 4LENA 1YLJA 5CXWA 3GV9A 1DRMA 2FFYA 4X53A 2ZD8A 4PAUA 4K08A 4WL9A 5I5LA 2GX5A 1ACFA 4O01A 4WELA 1WE4A 2CC1A 3UB8A 4Y0OA 1CEGA 4C3QA 2WKEA 3F1PA 3QP6A 3MF0A 2WK0A 1XFNA 5HL6A 3H9WA 3IX8A 4FOFA 2O99A 4LPZA 3B3XA 1KDSA 3F1NB 4S2JA 1FCMA 4PM8A 4MMNA 4IBRA 1P97A 3MXQA 3CZDA 2HDRA 5AJGA 1QMFA 4ETZA 1HTZA 3HJIA 4P6BA 3MXSA 3D72A 2P04A 1VEUB 3G4PA 1MWUA 4Q8IA 5F69A 2ZMAA 1ESIA 2B02A 2OAQ1 2ZMFA 3FPWA 3R7WA 1GHMA 3RJUA 3P09A 2VGJA 2X01A 3R4KA 1IKIA 3IXHA 2ZC4B 2P9VB 3A0VA 4Z1WA 5J3WA 3CPTA 3TE8A 3F1OA 2ZQCA 5F82A 3C38A 2XA7S 4N1HA 5A91A 2PU4A 1XP4A 4OVDA 3HLGA 2Y2GA 4X6TA 1ESUA 1GSWA 3HLEA 5IU1A 3T1SA 4Y3IA 2HV1A 3MZDA 3PBNA 1CI8A 4EBNA 1YPRA 1PYYA 3GQZA 2KOIA 3KYEA 3UE1A 3O87A 4CLCB 2W3DA 5L10A 4JXVA 1FILA 4GKUA 4NETA 3E4PA 1YT4A 4H6JB 3OOVA 4P0MA 3T4QA 2PR5A 1OT9A 4E3KA 3GSGA 4OP5A 4BENA 3OC2A 2VV6A 5CEDA 1XJ3A 4OOLA 5CX7A 4DMZA 1JWPA 2EX6A 3MZEA 4EEPA 1I2WA 2XD1A 2XK1A 3NIAA 5TGFA 2PRFA 4A5RA 1P9WA 3MKFA 5FEGA 2HZ5A 4D60A 4E3MA 1JWZA 3G31A 1CF0A 1KE4A 3FZCA 1ZG4A 2Z6DA 3CUEA 4Q0JA 3ITBA 4Q0IA 3QNCA 2GNXA 3N6IA 1PZPA 3G35A 1STZA 2P9VA 3G32A 5GLAA 2D01A 4PM7A 4E6XA 2ZL1B 3FPVA 1CJFA 5TBMA 3C4OA 3OZHA 2O0YA 2QWSA 4L9FA 2OLUA 1TEMA 4PPRA 3T1XA 1OTDA 2IWBA 4BQMA 3CWFA 2Y91A 2Y8HA 3QP2A 1BULA 5CHUA 1NYYA 1RP5A 3G2YA 3PBQA 3TOIA 1JTDA 1W5DA 3QP1A 3ZG0A 4KG6A 1G5UA 3ICYA 1K25A 2V9AA 3C4PA 1N9OA 1XJ4A 4YWZA 3PXPA 5GL9A 3BLSA 2OOLA 4H6JA 2EA9A 2XF3A 5DFYA 2ZC7A 4E3JA 1FR6A 3MQQA 4GW9A 1M6KA 3LIDA 2K2NA 4MNRA 4QPRA 3CJMA 3UDIA 2PHYA 5J7EA 3NJAA 5DF8A 4RYEA 1SZVA 3N8SA 3DTIA 4KQQA 4WZ4A 2JKRI 1G28A 3CG5A 4O0PA 2VJWA 3M2JA 3A3JA 2ACGA 5FQJA 2PDRA 3IF6C 1ES5A 1V9YA 3UPOA 2JBFA 4MBHA 1LSVA 3HLFA 1W63M 1O7EA 1J9MA 5BOHA 3ZGAB 2Q0OA 3C7VA 4BJPA 4I5SA 2PD8A 4DE0A 2XRNA 1VB6A 2M1CA 5HAQA 3BECA 3MR0A 2ZQ9A 1XXMA 1MWRA 4R4SA 4KQRA 4IBXA 4LV3A 5EUAA 3IXDA 2JKFA 2V20A 2FH5A 5EECA 2JN7A 1ES2A 2ZL1A 2WKRA 4GN2A 2RCXA 4HQAA 3C30A 4X1LA 3B33A 1YSPA 1N9BA 4WZ5C 2Y2JA 3CMZA 4X69A 3HJKA 4R23A 3V5MA 4WEKA 4EQIA 3Q7VB 3BY9A 5J8XA 5HPFA 4E3LA 4ESPA 3UB9A 3LI9A 1TS6A 3H82B 2V2FF 1KVMA 4ARZB 1FQGA 1C3BA 3UB7A 2QPNA 2V1ZA 1S66L 1BLSA 2ZM8A 2D02A 4JBFA 3OPRA 4KZ5A 3U2AA 3VMAA 4DE3A 2GZAA 3N7WA 2V1AA 4R3AA 2OAP1 5GLBA 4KG2A 2JC7A 4WF0A 5HPIA 4EBPA 3P7NA 4DXCA 3K3CA 4ID4A 2EWWA 5E2EA 1E4DA 4NXFA 2Y79A 2VGLM 5F5YA 4PM6A 4JGQA 4DJ2A 4M4XA 1SDNA 2HJEA 3VSLA 3MKEA 1BT5A 3H7WB 2QKPA 4E3OA 3MSHA 3E2LA 4MN7A 2W0NA 3D4FA 2Z2LB 3S7PA 1XGJA 3KYZA 5FQQA 3JPUA 4LCLA 4NXGA 2J9PA 2J3TC 4BD0A 1UGUA 2B18A 3HVFA 3SH9A 4WMCA 3UO9A 2W27A 1DP8A 2WAFA 4RA7A 4KZ8A 4Y7PA 2ZC5B 1S6RA 2UV0E 1MZUA 2WGWB 3HLWA 2Y2HA 5CHMA 2Z2MB 5HD5A 3GRJA 1T18A 5FAQA 3KSHA 3HLBA 4LV0A 5HDDA 3EEAA 4YFMA 2Y2QA 4DDSA 3Q82A 3RH8B 1NZUA 3MMHA 1OJ5A 3Q7VA 4KENB 2UWXA 4MLLA 4OPRA 4B9OA 3H82A 5L8MA 3BFGA 4QB8A 4ARZA 1W63Q 3MS6A 1N9LA 2ZQ8A 3UDXA 4YINA 1BZAA 2K31A 3G6OA 1DJCA 1CI9A 5DF9A 5GHZA 4IJGA 1PW1A 4ZDXA 4G3KA 1TDGA 4P87A 1KOUA 4I3IA 2V8FA 4PHTA 1OMEA 3EQVA 3GECA 3PBSA 1UWNX 2BG1A 4WBGA 5F1FA 1G6OA 4M3KA 5M1AA 1P0ZA 2J7VA 5E2GA 1E25A 4GCZA 1JTGA 3BFFA 4MBKA 3HLDA 1Q2QA 2H5SA 3TRCA 1PFLA 4JF4A 1W7FA 4F94A 5HDSA 1K55A 5FQIA 4RX3A 2P7JA 3EQUA 3W4QA 5IHVA 1BSGA 3UE3A 2EFXA 5KSCA 3HREA 4OQIA 5FQMA 4CLCE 1W8YA 2VK3A 2PR6A 5TFQA 3IH9A 2G2WA 5CECA 2ZM0A 1PWDA 1ONHA 3NBLA 2IWDA 4I3AA 4NG2A 5F1GA 4KZ9A 1K56A 1IKGA 1TVFA 1W79A 4E04A 1PIOA 5FL3A 2GDNA 4PMAA 2LB5A 2EFUA 3WS4A 1D7EA 1PNEA 3ZG7B 4JLFA 2ZC6B 4EQ1A 2R78A 2W3EA 1MC0A 5G18A 2MJ6A 4ZRRA 2W3FA 4F3LA 2Z6CA 1LI0A 1S4RA 4R1GA 2EXBA 2VEAA 4HEFA 3NC8A 2WKHA 2ZM2A 2JKTM 5FQKA 3CAXA 3BW6A 2HGVA 1VHMA 1YAXA 5HX9A 3UNWA 4JKTA 5E2FA 2DNSA 1IFQA 1RGZA 3IBRA 1GA0A 3T4LA 3UE6A 3IX3A 3LR3A 1CQAA 1VETB 3UB6A 4UA6A 3NDGA 3SH8A 1H8ZA 3LR0A 3M6HA 2Y2LA 4NEED 2XROA 3KYQA 5FSRA 1AWIA 1SDEA 2L1MA 1GA9A 2B95A 4BBVA 5KSHA 1JWVA 5EVLA 3PBTA 4P6ZS 3VFHA 4GB7A 2ZQ7A 2HDSA 1KE0A 2ZQAA 4KZ4A 4OOYA 1KGFA 5EVIC 5U47A 4OQHA 4LRYC 2XD5A 4EERA 3IHAA 1ZG6A 1GSVA 1YSQA 3GR2A 3WS2A 3DTKA 3GTCA 3SOIA 2IA2A 4CJNA 2H0TA 3O86A 3KSIA 4U3TA 4PKYA 1K54A 2HPBA 3ZG9B
chains in the Genus database with same CATH topology
1FR1A 3UPOA 2JBFA 4MBHA 4IVKA 3HLFA 3BFDA 4OKPA 1L0DA 3Q1FA 3OPHA 1O7EA 1FOFA 1J9MA 2WGVA 1MBLA 2R9XA 5BOHA 2ZC3B 3ZGAB 3C7VA 5TR7A 1K55C 1KE3A 2I72A 4IVIA 1N4OA 5GHXA 4BJPA 3GVBA 5CGXA 4DE0A 2EX9A 1XA7A 2XFSA 1XPBA 3WWXA 3WRTA 4LCMA 3G2ZA 3LY3A 2E8IA 1SKFA 5A93A 3TG9A 5HAQA 4ZJ1A 4U0XA 4N1XA 4S2OA 5KMWA 5DTKA 3BECA 3FV7A 4DDYA 1LI9A 2ZQ9A 1BLHA 1XXMA 1MWRA 4R4SA 4KQRA 3IQAA 2ZQDA 3GMWA 3NY4A 4IBXA 5HARA 2JCHA 4BLMA 4LV3A 3ZVWA 5JYOA 5EUAA 2R9WA 1IYPA 3LO7A 3IXDA 1E3UA 1VM1A 3PBOA 1HZOA 2V20A 4OPQA 4QU3A 5EECA 5GLCA 1LL5A 2IWCA 1ES2A 1MXOA 4GN2A 3FKVA 2RCXA 5CEBA 1VQQA 2G2UA 5HAIA 3WS0A 5CRFA 5AQ9A 3ZNYA 1NYMA 1PWCA 3W4OA 5FI2A 3UPNA 5FQ9A 4S2MA 1N9BA 2Y2JA 3BM6A 2OSUA 1L0FA 3CMZA 4JXSA 4WZ5C 4X69A 3BLMA 4R23A 3V5MA 4WEKA 2EX8A 4EQIA 1GHPA 3DWKA 4HBUA 3Q7VB 5J8XA 1JVJA 1EWZA 4E3LA 5EOEA 1KGGA 4KQOA 3VFFA 5L2FA 5FAPA 2V2FF 4QY5A 3SS4A 1YLZA 1KVMA 4S2NC 4OP8A 3ZG8B 4U0TA 5AQAA 1NJ4A 4CPKA 3SS3A 1NXYA 4DKIA 1FQGA 1ERMA 1PW8A 1C3BA 1FCOA 2QPNA 2V1ZA 5F83A 3HUOA 1BLSA 3BFEA 2ZM8A 3C5AA 3HLCA 3S22A 3PAGA 3S4XA 4JBFA 4OQ0A 3OPRA 4KZ5A 4XUXA 3DWZA 3ZG5A 1LLBA 3V39A 4DE3A 2A3UA 3VMAA 1CK3A 3N7WA 4GDNA 2EX2A 3IT9A 3VP4A 3G30A 4H8RA 4JF6A 5EOOA 2JE5A 4OOMA 3PBRA 4S2IA 5EVIA 2B5RA 4KG2A 2JC7A 5GLBA 4QJGA 4OLGA 4EBPA 4GD6A 5DTSA 1KVLA 3ZHHA 3N4IA 4DXCA 4KZAA 1AXBA 4B4XA 4ID4A 4OPZA 5E2EA 1E4DA 3IHBA 1L0EA 3SH7A 4PM6A 4XUZA 3ZFZA 4GD8A 1SDNA 2X02A 3VSLA 3MKEA 1BT5A 3WS1A 3IF6A 1S0WA 4FH2A 4UA7A 1IEMA 2XH9A 3NI9A 4E3OA 1NZOA 3VP0A 3E2LA 3D4FA 2Z2LB 3O88A 2Q9MA 3IH8A 5M18A 1XGJA 3AGFA 3OPLA 3M6BA 1YMSA 4ZTKA 4D2OA 5FQQA 3BFCA 3Q81A 4LCLA 2J9PA 4BD0A 1EI5A 2XEPA 3VOYA 1XGIA 4EWFA 2P74A 1ALQA 4B4ZA 3HVFA 1M40A 1E3UD 4LV2A 4N9LA 3SH9A 1ES4A 4WMCA 3WRZA 1FSYA 3LY4A 3OCLA 3UO9A 2VGKA 1G68A 1YMXA 5AQ7A 4R4RA 3MBZA 2WAFA 3UY6A 4ZJ3A 4RA7A 1NY0A 4KZ8A 4Y7PA 3UDFA 2ZC5B 3IXBA 1S6RA 4R0QA 3HUNA 2WGWB 3IWIA 3HLWA 1BTLA 2Y2HA 3A3EA 2ZLYA 5CHMA 4EUZA 2Z2MB 1DJBA 4Y0UA 1MPLA 1K57C 3GRJA 4X68A 1QMEA 5FDHA 4E6WA 4N9KA 1MWSA 1L0GA 1PI5A 4DE1A 5FAQA 4FH4A 5I94A 3HLBA 4LV0A 3BYDA 3N8LA 3E2KA 2WYXA 1YLTA 3DW0A 4EV4A 4WZ5A 4O7DA 4LENA 4BL2A 1YLJA 2H10A 5CXWA 4YFMA 3GV9A 1IYSA 2J9OA 2Y2QA 3BEBA 3FYZA 4GOGA 2FFYA 4P85A 4B88A 4DDSA 3Q82A 1ERQA 3G34A 2ZD8A 4X53A 2QZ6A 4E3IA 3AGEA 1NZUA 1IYQA 1SHVA 3Q7VA 3RXWA 3VP3A 4WELA 5FI6A 2OLVA 4KENB 4S2NA 1WE4A 2UWXA 4MLLA 3ITAA 2CC1A 4OPRA 4Y0OA 3SS5A 1CEGA 4C3QA 4DXBA 3UE0A 4KZ7A 3BFGA 4S2PA 1WYBA 2Y2NA 4QB8A 4RX2A 2WKEA 3NDEA 4HESA 3V50A 2WK0A 2ZQ8A 3UDXA 5CTMA 3B3XA 1DJAA 1KDSA 4YINA 1BZAA 4S2JA 4C6YA 2A49A 4QD4A 1FCMA 4JF5A 5HAPA 4PM8A 3O3VA 4IBRA 2C5WB 1DJCA 1CI9A 3CZDA 2HDRA 2Y2MA 5DF9A 5DTTA 5GHZA 1QMFA 1HTZA 1MKIA 1PW1A 4P6BA 3MXSA 5CTNA 4JPMA 4ZDXA 5FASA 3ZDJA 3G4PA 1MWUA 4Q8IA 1ZKJA 1TDGA 2ZMAA 4P87A 3DTMA 2QMIA 4ZBEA 1K4FA 1ESIA 5CGWA 4KZBA 1RGYA 1OMEA 3EQVA 3ZNTA 4K0WA 1GHMA 3RJUA 3P09A 2VGJA 3PBSA 3VP2A 2Y4AA 4MBFA 4WMCD 5FAOA 2X01A 1IKIA 3IXHA 2ZC4B 1BUEA 1PWGA 2P9VB 4PM9A 3S1YA 5FI7A 2BG1A 4WBGA 5F1FA 2HDQA 4M3KA 5M1AA 2EXAA 2ZQCA 2HP9A 3BRMA 4XXRA 4X56A 2Y55A 1CEFA 2J7VA 1ZC2A 2FFFB 3OPPA 4K0XA 5F82A 4KG5A 3V3SA 2XGNA 5E2GA 4DE2A 1E25A 1RCJA 4ZAMA 4N1HA 1JTGA 3Q07A 2ZJ9A 5A91A 2J8YA 1YLWA 2HP5A 1W8QA 1XP4A 2PU4A 3BFFA 3HLGA 4OVDA 2Y2GA 1ESUA 4FCFA 4X6TA 3HLEA 4MBKA 2Y2OA 3HLDA 5CGSA 2X71A 2WGIA 4Z9QA 1Q2QA 2H5SA 5CERA 4OH0A 1TDLA 4BD1A 3LEZA 4JF4A 1W7FA 3MZDA 3PBNA 2WKIA 1CI8A 4EBNA 4F94A 1G6AA 1K57A 4HBTA 1K55A 5FQIA 4RX3A 1PYYA 3HBRA 3EQUA 3MFDA 3NCKA 5IHVA 3W4QA 1IELA 1BSGA 3GQZA 5EPHA 1EROA 3JYIA 3A3IA 3UE3A 2EFXA 5KSCA 3HREA 4OQIA 3UE1A 3O87A 5FQMA 4UAAA 1K6SA 1W8YA 4OPYA 1GCEA 1XX2A 4BL3A 4E3NA 2WZXA 3IWQA 1HVBA 5TFQA 4JXVA 2WADA 3N8RA 4KZ6A 4Y0TA 4X55A 1FSWA 4R3JA 5A92A 3IH9A 4DRTA 2G2WA 4GKUA 4NETA 5FA7A 5CECA 1YT4A 4DF6A 4UA9A 4WYYA 4P0MA 2ZM0A 1PWDA 4JXWA 2Y2KA 2XFTA 4E3KA 3A3DA 1ONHA 2HDUA 2Y2IA 3GSGA 3NBLA 4OP5A 4BENA 5E2HA 5HL1A 2XDMA 1KDWA 1Q2PA 1Y54A 1KGEA 2IWDA 3OC2A 1MY8A 5F1GA 2Y2PA 5CEDA 4OONA 1MWTA 1PZOA 4KZ9A 3FKWA 3M2KA 1K56A 4OOLA 1IKGA 1TVFA 4QHCA 1U60A 1W79A 4QY6A 1WYCA 1JWPA 1PIOA 1I2SA 2EX6A 2GDNA 4PMAA 3MZEA 2XQZA 1I2WA 2XD1A 2XK1A 3ISGA 3NIAA 5GLDA 5TGFA 2EFUA 3MZFA 3WS4A 1K54C 4GZBA 5EVID 4A5RA 3MKFA 4OQGA 4KZ3A 4E3MA 3HL9A 3QHYA 3VP1A 1JWZA 1K6RA 1PI4A 3ZG7B 3G31A 1IYOA 3Q7ZA 4JLFA 1H5XA 1KE4A 1BLPA 2ZC6B 3FZCA 3PAEA 5A90A 1ZG4A 3OCNA 3ITBA 3QNCA 1YLYA 2WAEA 5G18A 3I7JA 5DVAA 3UN7A 1LI0A 3N6IA 4R1GA 1PZPA 4N92A 5E43A 2EXBA 3G35A 1BLCA 2PU2A 4JXGA 1L2SA 2P9VA 3G32A 5GLAA 3TSGA 4HEFA 5HW3A 5CHJA 3NC8A 2WKHA 1YLPA 2ZM2A 3PTEA 4LV1A 5FQKA 3AGDA 4PM7A 2XR0A 1ES3A 1XA1A 3C7UA 4E6XA 2BLSA 4S2LA 3VSKA 5DF7A 2H0YA 5EE8A 5HX9A 3C4OA 3UNWA 4JKTA 5E2FA 2DNSA 5AQBA 2WUQA 3OZHA 2RL3A 1RGZA 5KZHA 4R3BA 4PM5A 1YQSA 1GA0A 1NRFA 1K4EA 2OLUA 3HUMA 1TEMA 3ZCZA 4PPRA 2C6WB 2DRWA 2IWBA 4UA6A 4BQMA 3NDGA 2XLNA 1LHYA 3SH8A 2Y91A 1H8YA 1H8ZA 1LL9A 3M6HA 2HP6A 1BULA 2Y2LA 5CHUA 1NYYA 4ZJ2A 1RP5A 1XKZA 4GNUA 3LCEA 3RXXA 3G2YA 4RVAA 1O07A 3PBQA 1HD8A 1I5QA 3IF5A 3TOIA 1JTDA 2WZZA 5FSRA 1W5DA 3ZG0A 4KG6A 1SDEA 3WS5A 1K25A 1GA9A 1Z6FA 4FSFA 4K91A 4NK3A 1FCNA 1YM1A 3C4PA 3W4PA 1JWVA 5KSHA 5M19A 5EVLA 3PBTA 1K56D 2DCFA 2WGWA 2Y59A 3UPPA 3IWOA 4UHUA 3P98A 5GL9A 3VFHA 1GHIA 3BLSA 5HFOA 4GB7A 1DY6A 4C75A 2XF3A 5EVIB 4L0LA 5FATA 2ZC7A 2ZQ7A 2HDSA 3IXGA 3ZVTA 1KE0A 1ONGA 2PBYA 2ZQAA 4E3JA 1FR6A 3VOZA 4KZ4A 3QNBA 4OOYA 5GHYA 1KGFA 1M6KA 5EVIC 1SCWA 4WM9A 4MNRA 5U47A 4EBLA 4OQHA 2Q9NA 3W8KA 3CJMA 2XD5A 3UDIA 3IHAA 1ZG6A 1K38A 5JYPA 4IEDA 3GR2A 5DF8A 3WS2A 3GTCA 3SOIA 4RYEA 4CJNA 2H0TA 3N8SA 3MXRA 4OLDA 5D3OA 4KQQA 3O86A 3IF6B 4WZ4A 4U3TA 4FD8A 3A3FA 1K54A 3CG5A 3M2JA 3A3JA 5FQJA 2OV5A 3V3RA 4WEJA 3IF6C 4MEZA 1ES5A 3FWLA 2HPBA 4S2KA 3ZG9B 4GDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FR1 A;  3UPO A;  2JBF A;  4MBH A;  4IVK A;  3HLF A;  3BFD A;  4OKP A;  1L0D A;  3Q1F A;  3OPH A;  1O7E A;  1FOF A;  1J9M A;  2WGV A;  1MBL A;  2R9X A;  5BOH A;  2ZC3 B;  3ZGA B;  3C7V A;  5TR7 A;  1K55 C;  1KE3 A;  2I72 A;  4IVI A;  1N4O A;  5GHX A;  4BJP A;  3GVB A;  5CGX A;  4DE0 A;  2EX9 A;  1XA7 A;  2XFS A;  1XPB A;  3WWX A;  3WRT A;  4LCM A;  3G2Z A;  3LY3 A;  2E8I A;  1SKF A;  5A93 A;  3TG9 A;  5HAQ A;  4ZJ1 A;  4U0X A;  4N1X A;  4S2O A;  5KMW A;  5DTK A;  3BEC A;  3FV7 A;  4DDY A;  1LI9 A;  2ZQ9 A;  1BLH A;  1XXM A;  1MWR A;  4R4S A;  4KQR A;  3IQA A;  2ZQD A;  3GMW A;  3NY4 A;  4IBX A;  5HAR A;  2JCH A;  4BLM A;  4LV3 A;  3ZVW A;  5JYO A;  5EUA A;  2R9W A;  1IYP A;  3LO7 A;  3IXD A;  1E3U A;  1VM1 A;  3PBO A;  1HZO A;  2V20 A;  4OPQ A;  4QU3 A;  5EEC A;  5GLC A;  1LL5 A;  2IWC A;  1ES2 A;  1MXO A;  4GN2 A;  3FKV A;  2RCX A;  5CEB A;  1VQQ A;  2G2U A;  5HAI A;  3WS0 A;  5CRF A;  5AQ9 A;  3ZNY A;  1NYM A;  1PWC A;  3W4O A;  5FI2 A;  3UPN A;  5FQ9 A;  4S2M A;  1N9B A;  2Y2J A;  3BM6 A;  2OSU A;  1L0F A;  3CMZ A;  4JXS A;  4WZ5 C;  4X69 A;  3BLM A;  4R23 A;  3V5M A;  4WEK A;  2EX8 A;  4EQI A;  1GHP A;  3DWK A;  4HBU A;  3Q7V B;  5J8X A;  1JVJ A;  1EWZ A;  4E3L A;  5EOE A;  1KGG A;  4KQO A;  3VFF A;  5L2F A;  5FAP A;  2V2F F;  4QY5 A;  3SS4 A;  1YLZ A;  1KVM A;  4S2N C;  4OP8 A;  3ZG8 B;  4U0T A;  5AQA A;  1NJ4 A;  4CPK A;  3SS3 A;  1NXY A;  4DKI A;  1FQG A;  1ERM A;  1PW8 A;  1C3B A;  1FCO A;  2QPN A;  2V1Z A;  5F83 A;  3HUO A;  1BLS A;  3BFE A;  2ZM8 A;  3C5A A;  3HLC A;  3S22 A;  3PAG A;  3S4X A;  4JBF A;  4OQ0 A;  3OPR A;  4KZ5 A;  4XUX A;  3DWZ A;  3ZG5 A;  1LLB A;  3V39 A;  4DE3 A;  2A3U A;  3VMA A;  1CK3 A;  3N7W A;  4GDN A;  2EX2 A;  3IT9 A;  3VP4 A;  3G30 A;  4H8R A;  4JF6 A;  5EOO A;  2JE5 A;  4OOM A;  3PBR A;  4S2I A;  5EVI A;  2B5R A;  4KG2 A;  2JC7 A;  5GLB A;  4QJG A;  4OLG A;  4EBP A;  4GD6 A;  5DTS A;  1KVL A;  3ZHH A;  3N4I A;  4DXC A;  4KZA A;  1AXB A;  4B4X A;  4ID4 A;  4OPZ A;  5E2E A;  1E4D A;  3IHB A;  1L0E A;  3SH7 A;  4PM6 A;  4XUZ A;  3ZFZ A;  4GD8 A;  1SDN A;  2X02 A;  3VSL A;  3MKE A;  1BT5 A;  3WS1 A;  3IF6 A;  1S0W A;  4FH2 A;  4UA7 A;  1IEM A;  2XH9 A;  3NI9 A;  4E3O A;  1NZO A;  3VP0 A;  3E2L A;  3D4F A;  2Z2L B;  3O88 A;  2Q9M A;  3IH8 A;  5M18 A;  1XGJ A;  3AGF A;  3OPL A;  3M6B A;  1YMS A;  4ZTK A;  4D2O A;  5FQQ A;  3BFC A;  3Q81 A;  4LCL A;  2J9P A;  4BD0 A;  1EI5 A;  2XEP A;  3VOY A;  1XGI A;  4EWF A;  2P74 A;  1ALQ A;  4B4Z A;  3HVF A;  1M40 A;  1E3U D;  4LV2 A;  4N9L A;  3SH9 A;  1ES4 A;  4WMC A;  3WRZ A;  1FSY A;  3LY4 A;  3OCL A;  3UO9 A;  2VGK A;  1G68 A;  1YMX A;  5AQ7 A;  4R4R A;  3MBZ A;  2WAF A;  3UY6 A;  4ZJ3 A;  4RA7 A;  1NY0 A;  4KZ8 A;  4Y7P A;  3UDF A;  2ZC5 B;  3IXB A;  1S6R A;  4R0Q A;  3HUN A;  2WGW B;  3IWI A;  3HLW A;  1BTL A;  2Y2H A;  3A3E A;  2ZLY A;  5CHM A;  4EUZ A;  2Z2M B;  1DJB A;  4Y0U A;  1MPL A;  1K57 C;  3GRJ A;  4X68 A;  1QME A;  5FDH A;  4E6W A;  4N9K A;  1MWS A;  1L0G A;  1PI5 A;  4DE1 A;  5FAQ A;  4FH4 A;  5I94 A;  3HLB A;  4LV0 A;  3BYD A;  3N8L A;  3E2K A;  2WYX A;  1YLT A;  3DW0 A;  4EV4 A;  4WZ5 A;  4O7D A;  4LEN A;  4BL2 A;  1YLJ A;  2H10 A;  5CXW A;  4YFM A;  3GV9 A;  1IYS A;  2J9O A;  2Y2Q A;  3BEB A;  3FYZ A;  4GOG A;  2FFY A;  4P85 A;  4B88 A;  4DDS A;  3Q82 A;  1ERQ A;  3G34 A;  2ZD8 A;  4X53 A;  2QZ6 A;  4E3I A;  3AGE A;  1NZU A;  1IYQ A;  1SHV A;  3Q7V A;  3RXW A;  3VP3 A;  4WEL A;  5FI6 A;  2OLV A;  4KEN B;  4S2N A;  1WE4 A;  2UWX A;  4MLL A;  3ITA A;  2CC1 A;  4OPR A;  4Y0O A;  3SS5 A;  1CEG A;  4C3Q A;  4DXB A;  3UE0 A;  4KZ7 A;  3BFG A;  4S2P A;  1WYB A;  2Y2N A;  4QB8 A;  4RX2 A;  2WKE A;  3NDE A;  4HES A;  3V50 A;  2WK0 A;  2ZQ8 A;  3UDX A;  5CTM A;  3B3X A;  1DJA A;  1KDS A;  4YIN A;  1BZA A;  4S2J A;  4C6Y A;  2A49 A;  4QD4 A;  1FCM A;  4JF5 A;  5HAP A;  4PM8 A;  3O3V A;  4IBR A;  2C5W B;  1DJC A;  1CI9 A;  3CZD A;  2HDR A;  2Y2M A;  5DF9 A;  5DTT A;  5GHZ A;  1QMF A;  1HTZ A;  1MKI A;  1PW1 A;  4P6B A;  3MXS A;  5CTN A;  4JPM A;  4ZDX A;  5FAS A;  3ZDJ A;  3G4P A;  1MWU A;  4Q8I A;  1ZKJ A;  1TDG A;  2ZMA A;  4P87 A;  3DTM A;  2QMI A;  4ZBE A;  1K4F A;  1ESI A;  5CGW A;  4KZB A;  1RGY A;  1OME A;  3EQV A;  3ZNT A;  4K0W A;  1GHM A;  3RJU A;  3P09 A;  2VGJ A;  3PBS A;  3VP2 A;  2Y4A A;  4MBF A;  4WMC D;  5FAO A;  2X01 A;  1IKI A;  3IXH A;  2ZC4 B;  1BUE A;  1PWG A;  2P9V B;  4PM9 A;  3S1Y A;  5FI7 A;  2BG1 A;  4WBG A;  5F1F A;  2HDQ A;  4M3K A;  5M1A A;  2EXA A;  2ZQC A;  2HP9 A;  3BRM A;  4XXR A;  4X56 A;  2Y55 A;  1CEF A;  2J7V A;  1ZC2 A;  2FFF B;  3OPP A;  4K0X A;  5F82 A;  4KG5 A;  3V3S A;  2XGN A;  5E2G A;  4DE2 A;  1E25 A;  1RCJ A;  4ZAM A;  4N1H A;  1JTG A;  3Q07 A;  2ZJ9 A;  5A91 A;  2J8Y A;  1YLW A;  2HP5 A;  1W8Q A;  1XP4 A;  2PU4 A;  3BFF A;  3HLG A;  4OVD A;  2Y2G A;  1ESU A;  4FCF A;  4X6T A;  3HLE A;  4MBK A;  2Y2O A;  3HLD A;  5CGS A;  2X71 A;  2WGI A;  4Z9Q A;  1Q2Q A;  2H5S A;  5CER A;  4OH0 A;  1TDL A;  4BD1 A;  3LEZ A;  4JF4 A;  1W7F A;  3MZD A;  3PBN A;  2WKI A;  1CI8 A;  4EBN A;  4F94 A;  1G6A A;  1K57 A;  4HBT A;  1K55 A;  5FQI A;  4RX3 A;  1PYY A;  3HBR A;  3EQU A;  3MFD A;  3NCK A;  5IHV A;  3W4Q A;  1IEL A;  1BSG A;  3GQZ A;  5EPH A;  1ERO A;  3JYI A;  3A3I A;  3UE3 A;  2EFX A;  5KSC A;  3HRE A;  4OQI A;  3UE1 A;  3O87 A;  5FQM A;  4UAA A;  1K6S A;  1W8Y A;  4OPY A;  1GCE A;  1XX2 A;  4BL3 A;  4E3N A;  2WZX A;  3IWQ A;  1HVB A;  5TFQ A;  4JXV A;  2WAD A;  3N8R A;  4KZ6 A;  4Y0T A;  4X55 A;  1FSW A;  4R3J A;  5A92 A;  3IH9 A;  4DRT A;  2G2W A;  4GKU A;  4NET A;  5FA7 A;  5CEC A;  1YT4 A;  4DF6 A;  4UA9 A;  4WYY A;  4P0M A;  2ZM0 A;  1PWD A;  4JXW A;  2Y2K A;  2XFT A;  4E3K A;  3A3D A;  1ONH A;  2HDU A;  2Y2I A;  3GSG A;  3NBL A;  4OP5 A;  4BEN A;  5E2H A;  5HL1 A;  2XDM A;  1KDW A;  1Q2P A;  1Y54 A;  1KGE A;  2IWD A;  3OC2 A;  1MY8 A;  5F1G A;  2Y2P A;  5CED A;  4OON A;  1MWT A;  1PZO A;  4KZ9 A;  3FKW A;  3M2K A;  1K56 A;  4OOL A;  1IKG A;  1TVF A;  4QHC A;  1U60 A;  1W79 A;  4QY6 A;  1WYC A;  1JWP A;  1PIO A;  1I2S A;  2EX6 A;  2GDN A;  4PMA A;  3MZE A;  2XQZ A;  1I2W A;  2XD1 A;  2XK1 A;  3ISG A;  3NIA A;  5GLD A;  5TGF A;  2EFU A;  3MZF A;  3WS4 A;  1K54 C;  4GZB A;  5EVI D;  4A5R A;  3MKF A;  4OQG A;  4KZ3 A;  4E3M A;  3HL9 A;  3QHY A;  3VP1 A;  1JWZ A;  1K6R A;  1PI4 A;  3ZG7 B;  3G31 A;  1IYO A;  3Q7Z A;  4JLF A;  1H5X A;  1KE4 A;  1BLP A;  2ZC6 B;  3FZC A;  3PAE A;  5A90 A;  1ZG4 A;  3OCN A;  3ITB A;  3QNC A;  1YLY A;  2WAE A;  5G18 A;  3I7J A;  5DVA A;  3UN7 A;  1LI0 A;  3N6I A;  4R1G A;  1PZP A;  4N92 A;  5E43 A;  2EXB A;  3G35 A;  1BLC A;  2PU2 A;  4JXG A;  1L2S A;  2P9V A;  3G32 A;  5GLA A;  3TSG A;  4HEF A;  5HW3 A;  5CHJ A;  3NC8 A;  2WKH A;  1YLP A;  2ZM2 A;  3PTE A;  4LV1 A;  5FQK A;  3AGD A;  4PM7 A;  2XR0 A;  1ES3 A;  1XA1 A;  3C7U A;  4E6X A;  2BLS A;  4S2L A;  3VSK A;  5DF7 A;  2H0Y A;  5EE8 A;  5HX9 A;  3C4O A;  3UNW A;  4JKT A;  5E2F A;  2DNS A;  5AQB A;  2WUQ A;  3OZH A;  2RL3 A;  1RGZ A;  5KZH A;  4R3B A;  4PM5 A;  1YQS A;  1GA0 A;  1NRF A;  1K4E A;  2OLU A;  3HUM A;  1TEM A;  3ZCZ A;  4PPR A;  2C6W B;  2DRW A;  2IWB A;  4UA6 A;  4BQM A;  3NDG A;  2XLN A;  1LHY A;  3SH8 A;  2Y91 A;  1H8Y A;  1H8Z A;  1LL9 A;  3M6H A;  2HP6 A;  1BUL A;  2Y2L A;  5CHU A;  1NYY A;  4ZJ2 A;  1RP5 A;  1XKZ A;  4GNU A;  3LCE A;  3RXX A;  3G2Y A;  4RVA A;  1O07 A;  3PBQ A;  1HD8 A;  1I5Q A;  3IF5 A;  3TOI A;  1JTD A;  2WZZ A;  5FSR A;  1W5D A;  3ZG0 A;  4KG6 A;  1SDE A;  3WS5 A;  1K25 A;  1GA9 A;  1Z6F A;  4FSF A;  4K91 A;  4NK3 A;  1FCN A;  1YM1 A;  3C4P A;  3W4P A;  1JWV A;  5KSH A;  5M19 A;  5EVL A;  3PBT A;  1K56 D;  2DCF A;  2WGW A;  2Y59 A;  3UPP A;  3IWO A;  4UHU A;  3P98 A;  5GL9 A;  3VFH A;  1GHI A;  3BLS A;  5HFO A;  4GB7 A;  1DY6 A;  4C75 A;  2XF3 A;  5EVI B;  4L0L A;  5FAT A;  2ZC7 A;  2ZQ7 A;  2HDS A;  3IXG A;  3ZVT A;  1KE0 A;  1ONG A;  2PBY A;  2ZQA A;  4E3J A;  1FR6 A;  3VOZ A;  4KZ4 A;  3QNB A;  4OOY A;  5GHY A;  1KGF A;  1M6K A;  5EVI C;  1SCW A;  4WM9 A;  4MNR A;  5U47 A;  4EBL A;  4OQH A;  2Q9N A;  3W8K A;  3CJM A;  2XD5 A;  3UDI A;  3IHA A;  1ZG6 A;  1K38 A;  5JYP A;  4IED A;  3GR2 A;  5DF8 A;  3WS2 A;  3GTC A;  3SOI A;  4RYE A;  4CJN A;  2H0T A;  3N8S A;  3MXR A;  4OLD A;  5D3O A;  4KQQ A;  3O86 A;  3IF6 B;  4WZ4 A;  4U3T A;  4FD8 A;  3A3F A;  1K54 A;  3CG5 A;  3M2J A;  3A3J A;  5FQJ A;  2OV5 A;  3V3R A;  4WEJ A;  3IF6 C;  4MEZ A;  1ES5 A;  3FWL A;  2HPB A;  4S2K A;  3ZG9 B;  4GDB A; 
#chains in the Genus database with same CATH topology
 4IVK A;  3BFD A;  1T19 A;  1WA9 A;  4X1M A;  2WGV A;  3VV4 A;  2ZC3 B;  2GJ3 A;  1OJG A;  1S1Y A;  1K55 C;  1KE3 A;  2VA0 A;  3F1N A;  3GVB A;  1XA7 A;  4LCM A;  3G2Z A;  5A93 A;  5KMW A;  4WN5 A;  1LI9 A;  1BLH A;  1LT0 A;  1JNU A;  2J3T D;  3BJN A;  3GMW A;  1TD5 A;  1VEU A;  5DKL A;  3ZVW A;  5JYO A;  2R9W A;  1IYP A;  4WLA A;  1E3U A;  3PBO A;  1HZO A;  2V1B A;  5GLC A;  1LL5 A;  3W4O A;  5FI2 A;  4AFI A;  3KO6 A;  4JXS A;  2OSU A;  2VV8 A;  4EET B;  1ZHH B;  1VET A;  2EX8 A;  1GHP A;  5L09 A;  4I38 A;  3CLO A;  5G4Y A;  5EOE A;  4XT2 B;  5FAP A;  1YLZ A;  2EWV A;  4R38 A;  4B93 A;  4O8G A;  3ZG8 B;  1D06 A;  1HLU P;  5AQA A;  4CPK A;  4DKI A;  1PW8 A;  1FCO A;  5F83 A;  3BFE A;  3HLC A;  3S4X A;  5AVE A;  1GSX A;  3FC7 A;  1XFQ A;  4OQ0 A;  1NLZ A;  4HIA A;  2XA7 M;  3IT9 A;  3VP4 A;  5EM1 A;  1A0K A;  3MFX A;  2KLI A;  2JE5 A;  3PBR A;  2PYP A;  4CLC A;  5DTS A;  1AXB A;  5HWT A;  4B4X A;  4GD8 A;  2P08 A;  1L3L A;  3WS1 A;  1SKO B;  1S0W A;  4FH2 A;  1IEM A;  3NI9 A;  5M18 A;  3IH8 A;  3AGF A;  3S7N A;  3LIE A;  1EI5 A;  1ALQ A;  4ME4 A;  4B4Z A;  2ZOI A;  4N9L A;  1ES4 A;  3WRZ A;  5HDC A;  2VGK A;  4HI4 A;  3O5Y A;  3RTY A;  5AQ7 A;  4R4R A;  3UDF A;  3IWI A;  1BTL A;  3NUL A;  4Y0U A;  1DJB A;  2V8C A;  4E6W A;  1QME A;  5FDH A;  2VLG A;  1L0G A;  4DE1 A;  4FH4 A;  2NUP C;  5IS1 A;  3EGX C;  2QHK A;  1J3W A;  1Z09 A;  4FTX A;  1LL8 A;  2WYX A;  3E2K A;  2VV7 A;  2O9B A;  4BL2 A;  2QYB A;  2J9O A;  3BEB A;  1ERQ A;  2QZ6 A;  4E3I A;  4UQI S;  1SHV A;  3RXW A;  2OLV A;  4S2N A;  3T4J A;  4XT2 A;  1H0M A;  1T1A A;  4KZ7 A;  3UE0 A;  1WYB A;  3NDE A;  3V50 A;  3BY8 A;  4EW7 A;  1DJA A;  4C6Y A;  4JF5 A;  5HAP A;  1TS0 A;  3S7O A;  2Y2M A;  3OLO A;  1EW0 A;  3PYP A;  3GDI A;  4LRX C;  3DTM A;  2QMI A;  4ZBE A;  1K4F A;  3K3D A;  3DAV A;  5CGW A;  1RGY A;  3CUE C;  4NKP A;  1OT6 A;  3ZNT A;  3E4O A;  4Y2F A;  2Y4A A;  4WMC D;  5DFX A;  4PM9 A;  3S1Y A;  2VZW A;  2HDQ A;  1MKM A;  3LR4 A;  4MN6 A;  2EXA A;  2HP9 A;  4XXR A;  3ZHH A;  1CEF A;  3OPP A;  2FFF B;  4DE2 A;  2BAS A;  3Q07 A;  1W8Q A;  5CGS A;  2QJ7 A;  2X71 A;  4BBU A;  2WGI A;  5FDS A;  5CER A;  4OH0 A;  1TDL A;  4BD1 A;  1NLY A;  4YNR A;  1OTA A;  3BQA A;  1K57 A;  4LRZ E;  3HBR A;  3MFD A;  4GHI B;  3A0S A;  5EPH A;  1T1B A;  3A3I A;  3B42 A;  4UAA A;  2YKH A;  1GCE A;  1XX2 A;  4E3N A;  5HSQ A;  4CLC C;  5HZH A;  3N8R A;  4KZ6 A;  4X55 A;  1FSW A;  4R3J A;  5A92 A;  4DRT A;  3T1Q B;  4UA9 A;  3L7H A;  3UB5 P;  2YKF A;  4JXW A;  2XFT A;  3A3D A;  2Y2I A;  5E2H A;  5HL1 A;  1Y54 A;  1KDW A;  1Q2P A;  1ODV A;  1MY8 A;  5AVF A;  4OON A;  1MWT A;  1PZO A;  3FKW A;  3M2K A;  4PKY G;  2XSS A;  4QHC A;  3KX0 X;  4QY6 A;  1I2S A;  3NOU C;  2XQZ A;  5GLD A;  2A24 B;  3HCY A;  5EVI D;  3IBJ A;  3HL9 A;  3VP1 A;  1PI4 A;  4HJ6 A;  1IYO A;  5A90 A;  4EXO A;  3OCN A;  2M7V A;  3I7J A;  2W3G A;  5E43 A;  2PU2 A;  4JXG A;  1L2S A;  4DJ3 A;  3T4O A;  3PTE A;  1YLP A;  2J3W A;  1K0K A;  3AGD A;  4DN0 A;  1ES3 A;  1XA1 A;  3C7U A;  3D9Y A;  4JGO A;  4S2L A;  1H8M A;  1Y28 A;  3VSK A;  2H0Y A;  3D3O A;  3EOI A;  3H7W A;  5AQB A;  4HOI A;  5KZH A;  3P01 A;  3TW8 A;  4G3V A;  3HUM A;  1YKD A;  3ZCZ A;  2DRW A;  1H8Y A;  2HP6 A;  1XKZ A;  4GNU A;  3RXX A;  4RVA A;  4GHI A;  3FG8 A;  1HD8 A;  3TJZ C;  3T1R A;  1Z6F A;  4FSF A;  4NK3 A;  1K56 D;  2DCF A;  2WGW A;  3UPP A;  3P98 A;  4RQ9 A;  1GHI A;  1DY6 A;  4C75 A;  4L0L A;  2INW A;  5FAT A;  2V0W A;  4LLO B;  2PBD P;  3VOZ A;  5GHY A;  3QNB A;  1SCW A;  4WM9 A;  4BBT A;  2ZOH A;  4EBL A;  3IX4 A;  3CPT B;  2DMW A;  3F1O B;  1K38 A;  3IS2 B;  3S7Q A;  5D3O A;  3IF6 B;  4FD8 A;  3A3F A;  2OV5 A;  3V3R A;  3A0R A;  4WEJ A;  4S2K A;  3LUQ A;  2A24 A;  3FWL A;  4IUK A;  4GDB A;  1FR1 A;  2PAV P;  2PD7 A;  5TR7 A;  5GHX A;  2O9A A;  2HJ9 C;  5CGX A;  2EX9 A;  3LY3 A;  4ZJ1 A;  4U0X A;  4S2O A;  5DTK A;  3FV7 A;  4QWO A;  2E8J A;  2K7S A;  3NY4 A;  5HAR A;  3T50 A;  2JCH A;  4BLM A;  3LO7 A;  3UMD A;  4QU3 A;  3LGO A;  3KSG A;  2IWC A;  1MXO A;  3FKV A;  1T1C A;  2I9V A;  1VQQ A;  2G2U A;  5HAI A;  3WS0 A;  4R6L A;  5CRF A;  5AQ9 A;  3ZNY A;  1NYM A;  3UPN A;  4CQH A;  5FQ9 A;  3BLM A;  3DWK A;  3U4L P;  4EEU A;  4I39 A;  1JVJ A;  5L2F A;  3SS4 A;  4HJ3 A;  4OP8 A;  4U0T A;  3NOT C;  1NXY A;  3MJQ A;  1ERM A;  3HUO A;  3C5A A;  3S22 A;  3PAG A;  4EES A;  3ZG5 A;  1LLB A;  2A3U A;  1CK3 A;  4GDN A;  3G30 A;  4H8R A;  4JF6 A;  5EOO A;  4OOM A;  3QP5 A;  1XJ2 A;  4KZA A;  3LR5 A;  4UEY A;  4OPZ A;  3IHB A;  1L0E A;  3KSF A;  3IS2 A;  4Y13 A;  5TBM B;  5HWW A;  4EU0 A;  3LYX A;  4HJ4 A;  3IF6 A;  2XH9 A;  1NZO A;  3VP0 A;  4BMW A;  4Y15 A;  2Q9M A;  3VOL A;  4GLQ A;  3OPL A;  3M6B A;  4ZTK A;  4D2O A;  1LSW A;  2XEP A;  2KX6 A;  1XGI A;  4EWF A;  3QP8 A;  1M40 A;  1E3U D;  3OCL A;  1S67 L;  4L9G A;  1YMX A;  4HY8 A;  3UY6 A;  1NY0 A;  3IXB A;  4R0Q A;  3HUN A;  1OPX A;  4EUZ A;  3E4Q A;  3JVU A;  1MPL A;  3N8L A;  4BWI A;  4EV4 A;  4WZ5 A;  3EGD C;  2H10 A;  1IYS A;  2H28 A;  1FIK A;  3FYZ A;  4GOG A;  4P85 A;  4B88 A;  3E98 A;  3G34 A;  3ZYT A;  2CMN A;  3AGE A;  2W1R A;  1IYQ A;  3VP3 A;  5FI6 A;  3SW1 A;  3ITA A;  4GJ4 A;  3SS5 A;  4DXB A;  4EUV A;  4S2P A;  2Y2N A;  3LI8 A;  2W1T B;  4KQD A;  4RX2 A;  3QP4 A;  4CLC D;  4HES A;  5HD3 A;  4NXB A;  5CTM A;  3CHW P;  3LEQ A;  1BYW A;  2A49 A;  4QD4 A;  3LIA A;  1Y4O A;  5C5K A;  3O3V A;  5F6A A;  2C5W B;  5DTT A;  1MKI A;  5CTN A;  4HH2 A;  4JPM A;  5FAS A;  4KUO A;  1IOU A;  3ZDJ A;  1ZKJ A;  3VE3 A;  4KZB A;  1TS8 A;  3VE4 A;  4K0W A;  3VP2 A;  5FAO A;  4MBF A;  1BUE A;  1PWG A;  5FI7 A;  1TF1 A;  3BRM A;  4X56 A;  2Y55 A;  4K0X A;  1ZC2 A;  3V3S A;  4KG5 A;  2XGN A;  1F2K A;  1RCJ A;  3UME A;  4ZAM A;  2FZ0 A;  4HP9 A;  2ZJ9 A;  2J8Y A;  1YLW A;  2HP5 A;  4FCF A;  4Y17 A;  4P6Z M;  2Y2O A;  4Z9Q A;  2WKP A;  5EFW A;  3LEZ A;  3RFB A;  1XJ6 A;  2WKI A;  4HHD A;  4NXE A;  2ZMV A;  1G6A A;  2VGL S;  4HBT A;  2KDK A;  3OBF A;  5DJT A;  2PT7 A;  3NCK A;  1IEL A;  2VKS A;  1ERO A;  2BTF P;  3JYI A;  5EM0 A;  1K6S A;  3W2Z A;  4OPY A;  5FEF A;  3T4S A;  4BL3 A;  2WZX A;  3IWQ A;  1HVB A;  2WAD A;  3EWK A;  5L07 A;  4Y0T A;  5FA7 A;  4DF6 A;  2WKQ A;  1F98 A;  4WYY A;  3ULF A;  2Y2K A;  2HDU A;  4ETX A;  1N9N A;  3DBA A;  2XDM A;  5F68 A;  1KGE A;  2Y2P A;  1OTE A;  3V67 A;  2W1T A;  4LFU A;  4Q0H A;  1U60 A;  1WYC A;  3T12 B;  3ISG A;  3MZF A;  1K54 C;  4GZB A;  4GS9 B;  4OQG A;  4KZ3 A;  4IHQ A;  3C2W A;  3QHY A;  1K6R A;  1PRQ A;  3Q7Z A;  1H5X A;  1BLP A;  3PAE A;  1YLY A;  2WAE A;  3DTE A;  5DVA A;  3UN7 A;  5DJU A;  4N92 A;  1BLC A;  2J80 A;  3TSG A;  5HW3 A;  5CHJ A;  4LV1 A;  4Y5F A;  2XR0 A;  1TS7 A;  2VX8 A;  2BLS A;  5J4E A;  3LFV A;  5DF7 A;  5EE8 A;  2WUQ A;  1SKO A;  2RL3 A;  4R3B A;  3K2N A;  4PM5 A;  1YQS A;  1NRF A;  5EV0 A;  1K4E A;  2C6W B;  5DKK A;  3T4T A;  2XLN A;  1LHY A;  1LL9 A;  4ZJ2 A;  3LCE A;  4G3W A;  1O07 A;  1I5Q A;  3IF5 A;  3NOP C;  2A2L A;  2WZZ A;  3WS5 A;  4K91 A;  4IUH A;  1FCN A;  1YM1 A;  3W4P A;  5M19 A;  5EVE A;  2Y59 A;  3IWO A;  4UHU A;  5HFO A;  3PR6 A;  5EVI B;  3IXG A;  3ZVT A;  1ONG A;  5A8B A;  2JHE A;  1S1Z A;  2PBY A;  2V0U A;  2Q9N A;  3W8K A;  2W3H A;  2LB9 A;  5JYP A;  4IED A;  1P9R A;  2ZBB A;  4OLD A;  3MXR A;  4MN5 A;  4L9E A;  3B47 A;  3PHY A;  4MEZ A;  4MCW A;  3LIB A;  2QJ5 A;  4OKP A;  1L0D A;  4GS9 A;  3Q1F A;  3OPH A;  3BQ8 A;  1FOF A;  1NRJ A;  1MBL A;  2NUT C;  2R9X A;  4WUJ A;  3T4K A;  4IVI A;  2I72 A;  3JVV A;  1N4O A;  5K5B A;  3E0Y A;  4UQI M;  2XFS A;  1XPB A;  3WWX A;  2JKT I;  3WRT A;  2E8I A;  1SKF A;  3TG9 A;  4N1X A;  3LIC A;  4DDY A;  1OTI A;  1V9Z A;  2JKR M;  3ZQ5 A;  2L0W A;  3IQA A;  2ZQD A;  3L9K A;  2PYR A;  1VM1 A;  3LIF A;  4OPQ A;  4MDZ A;  1LSX A;  5CEB A;  4HH3 A;  1PWC A;  4FUW A;  1H3Q A;  4S2M A;  3BM6 A;  1L0F A;  3NEC A;  4HNB A;  5TJJ A;  4HBU A;  1EWZ A;  1DP9 A;  1KGG A;  4KQO A;  4JGP A;  3VFF A;  2OWH A;  4QY5 A;  4S2N C;  1NJ4 A;  3SS3 A;  4LGW A;  3F1P B;  2OWJ A;  2G7U A;  4XUX A;  3DWZ A;  3V39 A;  2HF6 A;  2EX2 A;  2M7U A;  2AVX A;  5HWV A;  4F3L B;  5IT5 A;  4S2I A;  5EVI A;  2B5R A;  4QJG A;  4OLG A;  2JKG A;  4GD6 A;  3C8C A;  3CI6 A;  1OTB A;  1KVL A;  3SZT A;  3N4I A;  5LBR A;  4I3J A;  1S4S A;  3EEH A;  3SH7 A;  4XUZ A;  4KUK A;  3ZFZ A;  2X02 A;  3R7W B;  4II7 A;  4UA7 A;  1F9I A;  1D1J A;  3MQO A;  3O88 A;  1UWP X;  3CIT A;  1NWZ A;  1YMS A;  3BFC A;  3Q81 A;  4HP4 A;  3VOY A;  2P74 A;  2L4R A;  1DP6 A;  3BWL A;  4LV2 A;  4YOF A;  1X0O A;  1FSY A;  3LY4 A;  1G68 A;  3MQ0 A;  5KIZ A;  3NHQ A;  3MBZ A;  4ZJ3 A;  4X25 A;  5G4Z A;  5MC7 A;  3A3E A;  2ZLY A;  4JGR A;  1K57 C;  4X68 A;  4R70 A;  4N9K A;  1MWS A;  1PI5 A;  5I94 A;  2O9C A;  1F5M A;  3BYD A;  1YLT A;  3DW0 A;  1ZTU A;  4O7D A;  4LEN A;  1YLJ A;  5CXW A;  3GV9 A;  1DRM A;  2FFY A;  4X53 A;  2ZD8 A;  4PAU A;  4K08 A;  4WL9 A;  5I5L A;  2GX5 A;  1ACF A;  4O01 A;  4WEL A;  1WE4 A;  2CC1 A;  3UB8 A;  4Y0O A;  1CEG A;  4C3Q A;  2WKE A;  3F1P A;  3QP6 A;  3MF0 A;  2WK0 A;  1XFN A;  5HL6 A;  3H9W A;  3IX8 A;  4FOF A;  2O99 A;  4LPZ A;  3B3X A;  1KDS A;  3F1N B;  4S2J A;  1FCM A;  4PM8 A;  4MMN A;  4IBR A;  1P97 A;  3MXQ A;  3CZD A;  2HDR A;  5AJG A;  1QMF A;  4ETZ A;  1HTZ A;  3HJI A;  4P6B A;  3MXS A;  3D72 A;  2P04 A;  1VEU B;  3G4P A;  1MWU A;  4Q8I A;  5F69 A;  2ZMA A;  1ESI A;  2B02 A;  2OAQ 1;  2ZMF A;  3FPW A;  3R7W A;  1GHM A;  3RJU A;  3P09 A;  2VGJ A;  2X01 A;  3R4K A;  1IKI A;  3IXH A;  2ZC4 B;  2P9V B;  3A0V A;  4Z1W A;  5J3W A;  3CPT A;  3TE8 A;  3F1O A;  2ZQC A;  5F82 A;  3C38 A;  2XA7 S;  4N1H A;  5A91 A;  2PU4 A;  1XP4 A;  4OVD A;  3HLG A;  2Y2G A;  4X6T A;  1ESU A;  1GSW A;  3HLE A;  5IU1 A;  3T1S A;  4Y3I A;  2HV1 A;  3MZD A;  3PBN A;  1CI8 A;  4EBN A;  1YPR A;  1PYY A;  3GQZ A;  2KOI A;  3KYE A;  3UE1 A;  3O87 A;  4CLC B;  2W3D A;  5L10 A;  4JXV A;  1FIL A;  4GKU A;  4NET A;  3E4P A;  1YT4 A;  4H6J B;  3OOV A;  4P0M A;  3T4Q A;  2PR5 A;  1OT9 A;  4E3K A;  3GSG A;  4OP5 A;  4BEN A;  3OC2 A;  2VV6 A;  5CED A;  1XJ3 A;  4OOL A;  5CX7 A;  4DMZ A;  1JWP A;  2EX6 A;  3MZE A;  4EEP A;  1I2W A;  2XD1 A;  2XK1 A;  3NIA A;  5TGF A;  2PRF A;  4A5R A;  1P9W A;  3MKF A;  5FEG A;  2HZ5 A;  4D60 A;  4E3M A;  1JWZ A;  3G31 A;  1CF0 A;  1KE4 A;  3FZC A;  1ZG4 A;  2Z6D A;  3CUE A;  4Q0J A;  3ITB A;  4Q0I A;  3QNC A;  2GNX A;  3N6I A;  1PZP A;  3G35 A;  1STZ A;  2P9V A;  3G32 A;  5GLA A;  2D01 A;  4PM7 A;  4E6X A;  2ZL1 B;  3FPV A;  1CJF A;  5TBM A;  3C4O A;  3OZH A;  2O0Y A;  2QWS A;  4L9F A;  2OLU A;  1TEM A;  4PPR A;  3T1X A;  1OTD A;  2IWB A;  4BQM A;  3CWF A;  2Y91 A;  2Y8H A;  3QP2 A;  1BUL A;  5CHU A;  1NYY A;  1RP5 A;  3G2Y A;  3PBQ A;  3TOI A;  1JTD A;  1W5D A;  3QP1 A;  3ZG0 A;  4KG6 A;  1G5U A;  3ICY A;  1K25 A;  2V9A A;  3C4P A;  1N9O A;  1XJ4 A;  4YWZ A;  3PXP A;  5GL9 A;  3BLS A;  2OOL A;  4H6J A;  2EA9 A;  2XF3 A;  5DFY A;  2ZC7 A;  4E3J A;  1FR6 A;  3MQQ A;  4GW9 A;  1M6K A;  3LID A;  2K2N A;  4MNR A;  4QPR A;  3CJM A;  3UDI A;  2PHY A;  5J7E A;  3NJA A;  5DF8 A;  4RYE A;  1SZV A;  3N8S A;  3DTI A;  4KQQ A;  4WZ4 A;  2JKR I;  1G28 A;  3CG5 A;  4O0P A;  2VJW A;  3M2J A;  3A3J A;  2ACG A;  5FQJ A;  2PDR A;  3IF6 C;  1ES5 A;  1V9Y A;  3UPO A;  2JBF A;  4MBH A;  1LSV A;  3HLF A;  1W63 M;  1O7E A;  1J9M A;  5BOH A;  3ZGA B;  2Q0O A;  3C7V A;  4BJP A;  4I5S A;  2PD8 A;  4DE0 A;  2XRN A;  1VB6 A;  2M1C A;  5HAQ A;  3BEC A;  3MR0 A;  2ZQ9 A;  1XXM A;  1MWR A;  4R4S A;  4KQR A;  4IBX A;  4LV3 A;  5EUA A;  3IXD A;  2JKF A;  2V20 A;  2FH5 A;  5EEC A;  2JN7 A;  1ES2 A;  2ZL1 A;  2WKR A;  4GN2 A;  2RCX A;  4HQA A;  3C30 A;  4X1L A;  3B33 A;  1YSP A;  1N9B A;  4WZ5 C;  2Y2J A;  3CMZ A;  4X69 A;  3HJK A;  4R23 A;  3V5M A;  4WEK A;  4EQI A;  3Q7V B;  3BY9 A;  5J8X A;  5HPF A;  4E3L A;  4ESP A;  3UB9 A;  3LI9 A;  1TS6 A;  3H82 B;  2V2F F;  1KVM A;  4ARZ B;  1FQG A;  1C3B A;  3UB7 A;  2QPN A;  2V1Z A;  1S66 L;  1BLS A;  2ZM8 A;  2D02 A;  4JBF A;  3OPR A;  4KZ5 A;  3U2A A;  3VMA A;  4DE3 A;  2GZA A;  3N7W A;  2V1A A;  4R3A A;  2OAP 1;  5GLB A;  4KG2 A;  2JC7 A;  4WF0 A;  5HPI A;  4EBP A;  3P7N A;  4DXC A;  3K3C A;  4ID4 A;  2EWW A;  5E2E A;  1E4D A;  4NXF A;  2Y79 A;  2VGL M;  5F5Y A;  4PM6 A;  4JGQ A;  4DJ2 A;  4M4X A;  1SDN A;  2HJE A;  3VSL A;  3MKE A;  1BT5 A;  3H7W B;  2QKP A;  4E3O A;  3MSH A;  3E2L A;  4MN7 A;  2W0N A;  3D4F A;  2Z2L B;  3S7P A;  1XGJ A;  3KYZ A;  5FQQ A;  3JPU A;  4LCL A;  4NXG A;  2J9P A;  2J3T C;  4BD0 A;  1UGU A;  2B18 A;  3HVF A;  3SH9 A;  4WMC A;  3UO9 A;  2W27 A;  1DP8 A;  2WAF A;  4RA7 A;  4KZ8 A;  4Y7P A;  2ZC5 B;  1S6R A;  2UV0 E;  1MZU A;  2WGW B;  3HLW A;  2Y2H A;  5CHM A;  2Z2M B;  5HD5 A;  3GRJ A;  1T18 A;  5FAQ A;  3KSH A;  3HLB A;  4LV0 A;  5HDD A;  3EEA A;  4YFM A;  2Y2Q A;  4DDS A;  3Q82 A;  3RH8 B;  1NZU A;  3MMH A;  1OJ5 A;  3Q7V A;  4KEN B;  2UWX A;  4MLL A;  4OPR A;  4B9O A;  3H82 A;  5L8M A;  3BFG A;  4QB8 A;  4ARZ A;  1W63 Q;  3MS6 A;  1N9L A;  2ZQ8 A;  3UDX A;  4YIN A;  1BZA A;  2K31 A;  3G6O A;  1DJC A;  1CI9 A;  5DF9 A;  5GHZ A;  4IJG A;  1PW1 A;  4ZDX A;  4G3K A;  1TDG A;  4P87 A;  1KOU A;  4I3I A;  2V8F A;  4PHT A;  1OME A;  3EQV A;  3GEC A;  3PBS A;  1UWN X;  2BG1 A;  4WBG A;  5F1F A;  1G6O A;  4M3K A;  5M1A A;  1P0Z A;  2J7V A;  5E2G A;  1E25 A;  4GCZ A;  1JTG A;  3BFF A;  4MBK A;  3HLD A;  1Q2Q A;  2H5S A;  3TRC A;  1PFL A;  4JF4 A;  1W7F A;  4F94 A;  5HDS A;  1K55 A;  5FQI A;  4RX3 A;  2P7J A;  3EQU A;  3W4Q A;  5IHV A;  1BSG A;  3UE3 A;  2EFX A;  5KSC A;  3HRE A;  4OQI A;  5FQM A;  4CLC E;  1W8Y A;  2VK3 A;  2PR6 A;  5TFQ A;  3IH9 A;  2G2W A;  5CEC A;  2ZM0 A;  1PWD A;  1ONH A;  3NBL A;  2IWD A;  4I3A A;  4NG2 A;  5F1G A;  4KZ9 A;  1K56 A;  1IKG A;  1TVF A;  1W79 A;  4E04 A;  1PIO A;  5FL3 A;  2GDN A;  4PMA A;  2LB5 A;  2EFU A;  3WS4 A;  1D7E A;  1PNE A;  3ZG7 B;  4JLF A;  2ZC6 B;  4EQ1 A;  2R78 A;  2W3E A;  1MC0 A;  5G18 A;  2MJ6 A;  4ZRR A;  2W3F A;  4F3L A;  2Z6C A;  1LI0 A;  1S4R A;  4R1G A;  2EXB A;  2VEA A;  4HEF A;  3NC8 A;  2WKH A;  2ZM2 A;  2JKT M;  5FQK A;  3CAX A;  3BW6 A;  2HGV A;  1VHM A;  1YAX A;  5HX9 A;  3UNW A;  4JKT A;  5E2F A;  2DNS A;  1IFQ A;  1RGZ A;  3IBR A;  1GA0 A;  3T4L A;  3UE6 A;  3IX3 A;  3LR3 A;  1CQA A;  1VET B;  3UB6 A;  4UA6 A;  3NDG A;  3SH8 A;  1H8Z A;  3LR0 A;  3M6H A;  2Y2L A;  4NEE D;  2XRO A;  3KYQ A;  5FSR A;  1AWI A;  1SDE A;  2L1M A;  1GA9 A;  2B95 A;  4BBV A;  5KSH A;  1JWV A;  5EVL A;  3PBT A;  4P6Z S;  3VFH A;  4GB7 A;  2ZQ7 A;  2HDS A;  1KE0 A;  2ZQA A;  4KZ4 A;  4OOY A;  1KGF A;  5EVI C;  5U47 A;  4OQH A;  4LRY C;  2XD5 A;  4EER A;  3IHA A;  1ZG6 A;  1GSV A;  1YSQ A;  3GR2 A;  3WS2 A;  3DTK A;  3GTC A;  3SOI A;  2IA2 A;  4CJN A;  2H0T A;  3O86 A;  3KSI A;  4U3T A;  4PKY A;  1K54 A;  2HPB A;  3ZG9 B; 
#chains in the Genus database with same CATH homology
 1FR1 A;  3UPO A;  2JBF A;  4MBH A;  4IVK A;  3HLF A;  3BFD A;  4OKP A;  1L0D A;  3Q1F A;  3OPH A;  1O7E A;  1FOF A;  1J9M A;  2WGV A;  1MBL A;  2R9X A;  5BOH A;  2ZC3 B;  3ZGA B;  3C7V A;  5TR7 A;  1K55 C;  1KE3 A;  2I72 A;  4IVI A;  1N4O A;  5GHX A;  4BJP A;  3GVB A;  5CGX A;  4DE0 A;  2EX9 A;  1XA7 A;  2XFS A;  1XPB A;  3WWX A;  3WRT A;  4LCM A;  3G2Z A;  3LY3 A;  2E8I A;  1SKF A;  5A93 A;  3TG9 A;  5HAQ A;  4ZJ1 A;  4U0X A;  4N1X A;  4S2O A;  5KMW A;  5DTK A;  3BEC A;  3FV7 A;  4DDY A;  1LI9 A;  2ZQ9 A;  1BLH A;  1XXM A;  1MWR A;  4R4S A;  4KQR A;  3IQA A;  2ZQD A;  3GMW A;  3NY4 A;  4IBX A;  5HAR A;  2JCH A;  4BLM A;  4LV3 A;  3ZVW A;  5JYO A;  5EUA A;  2R9W A;  1IYP A;  3LO7 A;  3IXD A;  1E3U A;  1VM1 A;  3PBO A;  1HZO A;  2V20 A;  4OPQ A;  4QU3 A;  5EEC A;  5GLC A;  1LL5 A;  2IWC A;  1ES2 A;  1MXO A;  4GN2 A;  3FKV A;  2RCX A;  5CEB A;  1VQQ A;  2G2U A;  5HAI A;  3WS0 A;  5CRF A;  5AQ9 A;  3ZNY A;  1NYM A;  1PWC A;  3W4O A;  5FI2 A;  3UPN A;  5FQ9 A;  4S2M A;  1N9B A;  2Y2J A;  3BM6 A;  2OSU A;  1L0F A;  3CMZ A;  4JXS A;  4WZ5 C;  4X69 A;  3BLM A;  4R23 A;  3V5M A;  4WEK A;  2EX8 A;  4EQI A;  1GHP A;  3DWK A;  4HBU A;  3Q7V B;  5J8X A;  1JVJ A;  1EWZ A;  4E3L A;  5EOE A;  1KGG A;  4KQO A;  3VFF A;  5L2F A;  5FAP A;  2V2F F;  4QY5 A;  3SS4 A;  1YLZ A;  1KVM A;  4S2N C;  4OP8 A;  3ZG8 B;  4U0T A;  5AQA A;  1NJ4 A;  4CPK A;  3SS3 A;  1NXY A;  4DKI A;  1FQG A;  1ERM A;  1PW8 A;  1C3B A;  1FCO A;  2QPN A;  2V1Z A;  5F83 A;  3HUO A;  1BLS A;  3BFE A;  2ZM8 A;  3C5A A;  3HLC A;  3S22 A;  3PAG A;  3S4X A;  4JBF A;  4OQ0 A;  3OPR A;  4KZ5 A;  4XUX A;  3DWZ A;  3ZG5 A;  1LLB A;  3V39 A;  4DE3 A;  2A3U A;  3VMA A;  1CK3 A;  3N7W A;  4GDN A;  2EX2 A;  3IT9 A;  3VP4 A;  3G30 A;  4H8R A;  4JF6 A;  5EOO A;  2JE5 A;  4OOM A;  3PBR A;  4S2I A;  5EVI A;  2B5R A;  4KG2 A;  2JC7 A;  5GLB A;  4QJG A;  4OLG A;  4EBP A;  4GD6 A;  5DTS A;  1KVL A;  3ZHH A;  3N4I A;  4DXC A;  4KZA A;  1AXB A;  4B4X A;  4ID4 A;  4OPZ A;  5E2E A;  1E4D A;  3IHB A;  1L0E A;  3SH7 A;  4PM6 A;  4XUZ A;  3ZFZ A;  4GD8 A;  1SDN A;  2X02 A;  3VSL A;  3MKE A;  1BT5 A;  3WS1 A;  3IF6 A;  1S0W A;  4FH2 A;  4UA7 A;  1IEM A;  2XH9 A;  3NI9 A;  4E3O A;  1NZO A;  3VP0 A;  3E2L A;  3D4F A;  2Z2L B;  3O88 A;  2Q9M A;  3IH8 A;  5M18 A;  1XGJ A;  3AGF A;  3OPL A;  3M6B A;  1YMS A;  4ZTK A;  4D2O A;  5FQQ A;  3BFC A;  3Q81 A;  4LCL A;  2J9P A;  4BD0 A;  1EI5 A;  2XEP A;  3VOY A;  1XGI A;  4EWF A;  2P74 A;  1ALQ A;  4B4Z A;  3HVF A;  1M40 A;  1E3U D;  4LV2 A;  4N9L A;  3SH9 A;  1ES4 A;  4WMC A;  3WRZ A;  1FSY A;  3LY4 A;  3OCL A;  3UO9 A;  2VGK A;  1G68 A;  1YMX A;  5AQ7 A;  4R4R A;  3MBZ A;  2WAF A;  3UY6 A;  4ZJ3 A;  4RA7 A;  1NY0 A;  4KZ8 A;  4Y7P A;  3UDF A;  2ZC5 B;  3IXB A;  1S6R A;  4R0Q A;  3HUN A;  2WGW B;  3IWI A;  3HLW A;  1BTL A;  2Y2H A;  3A3E A;  2ZLY A;  5CHM A;  4EUZ A;  2Z2M B;  1DJB A;  4Y0U A;  1MPL A;  1K57 C;  3GRJ A;  4X68 A;  1QME A;  5FDH A;  4E6W A;  4N9K A;  1MWS A;  1L0G A;  1PI5 A;  4DE1 A;  5FAQ A;  4FH4 A;  5I94 A;  3HLB A;  4LV0 A;  3BYD A;  3N8L A;  3E2K A;  2WYX A;  1YLT A;  3DW0 A;  4EV4 A;  4WZ5 A;  4O7D A;  4LEN A;  4BL2 A;  1YLJ A;  2H10 A;  5CXW A;  4YFM A;  3GV9 A;  1IYS A;  2J9O A;  2Y2Q A;  3BEB A;  3FYZ A;  4GOG A;  2FFY A;  4P85 A;  4B88 A;  4DDS A;  3Q82 A;  1ERQ A;  3G34 A;  2ZD8 A;  4X53 A;  2QZ6 A;  4E3I A;  3AGE A;  1NZU A;  1IYQ A;  1SHV A;  3Q7V A;  3RXW A;  3VP3 A;  4WEL A;  5FI6 A;  2OLV A;  4KEN B;  4S2N A;  1WE4 A;  2UWX A;  4MLL A;  3ITA A;  2CC1 A;  4OPR A;  4Y0O A;  3SS5 A;  1CEG A;  4C3Q A;  4DXB A;  3UE0 A;  4KZ7 A;  3BFG A;  4S2P A;  1WYB A;  2Y2N A;  4QB8 A;  4RX2 A;  2WKE A;  3NDE A;  4HES A;  3V50 A;  2WK0 A;  2ZQ8 A;  3UDX A;  5CTM A;  3B3X A;  1DJA A;  1KDS A;  4YIN A;  1BZA A;  4S2J A;  4C6Y A;  2A49 A;  4QD4 A;  1FCM A;  4JF5 A;  5HAP A;  4PM8 A;  3O3V A;  4IBR A;  2C5W B;  1DJC A;  1CI9 A;  3CZD A;  2HDR A;  2Y2M A;  5DF9 A;  5DTT A;  5GHZ A;  1QMF A;  1HTZ A;  1MKI A;  1PW1 A;  4P6B A;  3MXS A;  5CTN A;  4JPM A;  4ZDX A;  5FAS A;  3ZDJ A;  3G4P A;  1MWU A;  4Q8I A;  1ZKJ A;  1TDG A;  2ZMA A;  4P87 A;  3DTM A;  2QMI A;  4ZBE A;  1K4F A;  1ESI A;  5CGW A;  4KZB A;  1RGY A;  1OME A;  3EQV A;  3ZNT A;  4K0W A;  1GHM A;  3RJU A;  3P09 A;  2VGJ A;  3PBS A;  3VP2 A;  2Y4A A;  4MBF A;  4WMC D;  5FAO A;  2X01 A;  1IKI A;  3IXH A;  2ZC4 B;  1BUE A;  1PWG A;  2P9V B;  4PM9 A;  3S1Y A;  5FI7 A;  2BG1 A;  4WBG A;  5F1F A;  2HDQ A;  4M3K A;  5M1A A;  2EXA A;  2ZQC A;  2HP9 A;  3BRM A;  4XXR A;  4X56 A;  2Y55 A;  1CEF A;  2J7V A;  1ZC2 A;  2FFF B;  3OPP A;  4K0X A;  5F82 A;  4KG5 A;  3V3S A;  2XGN A;  5E2G A;  4DE2 A;  1E25 A;  1RCJ A;  4ZAM A;  4N1H A;  1JTG A;  3Q07 A;  2ZJ9 A;  5A91 A;  2J8Y A;  1YLW A;  2HP5 A;  1W8Q A;  1XP4 A;  2PU4 A;  3BFF A;  3HLG A;  4OVD A;  2Y2G A;  1ESU A;  4FCF A;  4X6T A;  3HLE A;  4MBK A;  2Y2O A;  3HLD A;  5CGS A;  2X71 A;  2WGI A;  4Z9Q A;  1Q2Q A;  2H5S A;  5CER A;  4OH0 A;  1TDL A;  4BD1 A;  3LEZ A;  4JF4 A;  1W7F A;  3MZD A;  3PBN A;  2WKI A;  1CI8 A;  4EBN A;  4F94 A;  1G6A A;  1K57 A;  4HBT A;  1K55 A;  5FQI A;  4RX3 A;  1PYY A;  3HBR A;  3EQU A;  3MFD A;  3NCK A;  5IHV A;  3W4Q A;  1IEL A;  1BSG A;  3GQZ A;  5EPH A;  1ERO A;  3JYI A;  3A3I A;  3UE3 A;  2EFX A;  5KSC A;  3HRE A;  4OQI A;  3UE1 A;  3O87 A;  5FQM A;  4UAA A;  1K6S A;  1W8Y A;  4OPY A;  1GCE A;  1XX2 A;  4BL3 A;  4E3N A;  2WZX A;  3IWQ A;  1HVB A;  5TFQ A;  4JXV A;  2WAD A;  3N8R A;  4KZ6 A;  4Y0T A;  4X55 A;  1FSW A;  4R3J A;  5A92 A;  3IH9 A;  4DRT A;  2G2W A;  4GKU A;  4NET A;  5FA7 A;  5CEC A;  1YT4 A;  4DF6 A;  4UA9 A;  4WYY A;  4P0M A;  2ZM0 A;  1PWD A;  4JXW A;  2Y2K A;  2XFT A;  4E3K A;  3A3D A;  1ONH A;  2HDU A;  2Y2I A;  3GSG A;  3NBL A;  4OP5 A;  4BEN A;  5E2H A;  5HL1 A;  2XDM A;  1KDW A;  1Q2P A;  1Y54 A;  1KGE A;  2IWD A;  3OC2 A;  1MY8 A;  5F1G A;  2Y2P A;  5CED A;  4OON A;  1MWT A;  1PZO A;  4KZ9 A;  3FKW A;  3M2K A;  1K56 A;  4OOL A;  1IKG A;  1TVF A;  4QHC A;  1U60 A;  1W79 A;  4QY6 A;  1WYC A;  1JWP A;  1PIO A;  1I2S A;  2EX6 A;  2GDN A;  4PMA A;  3MZE A;  2XQZ A;  1I2W A;  2XD1 A;  2XK1 A;  3ISG A;  3NIA A;  5GLD A;  5TGF A;  2EFU A;  3MZF A;  3WS4 A;  1K54 C;  4GZB A;  5EVI D;  4A5R A;  3MKF A;  4OQG A;  4KZ3 A;  4E3M A;  3HL9 A;  3QHY A;  3VP1 A;  1JWZ A;  1K6R A;  1PI4 A;  3ZG7 B;  3G31 A;  1IYO A;  3Q7Z A;  4JLF A;  1H5X A;  1KE4 A;  1BLP A;  2ZC6 B;  3FZC A;  3PAE A;  5A90 A;  1ZG4 A;  3OCN A;  3ITB A;  3QNC A;  1YLY A;  2WAE A;  5G18 A;  3I7J A;  5DVA A;  3UN7 A;  1LI0 A;  3N6I A;  4R1G A;  1PZP A;  4N92 A;  5E43 A;  2EXB A;  3G35 A;  1BLC A;  2PU2 A;  4JXG A;  1L2S A;  2P9V A;  3G32 A;  5GLA A;  3TSG A;  4HEF A;  5HW3 A;  5CHJ A;  3NC8 A;  2WKH A;  1YLP A;  2ZM2 A;  3PTE A;  4LV1 A;  5FQK A;  3AGD A;  4PM7 A;  2XR0 A;  1ES3 A;  1XA1 A;  3C7U A;  4E6X A;  2BLS A;  4S2L A;  3VSK A;  5DF7 A;  2H0Y A;  5EE8 A;  5HX9 A;  3C4O A;  3UNW A;  4JKT A;  5E2F A;  2DNS A;  5AQB A;  2WUQ A;  3OZH A;  2RL3 A;  1RGZ A;  5KZH A;  4R3B A;  4PM5 A;  1YQS A;  1GA0 A;  1NRF A;  1K4E A;  2OLU A;  3HUM A;  1TEM A;  3ZCZ A;  4PPR A;  2C6W B;  2DRW A;  2IWB A;  4UA6 A;  4BQM A;  3NDG A;  2XLN A;  1LHY A;  3SH8 A;  2Y91 A;  1H8Y A;  1H8Z A;  1LL9 A;  3M6H A;  2HP6 A;  1BUL A;  2Y2L A;  5CHU A;  1NYY A;  4ZJ2 A;  1RP5 A;  1XKZ A;  4GNU A;  3LCE A;  3RXX A;  3G2Y A;  4RVA A;  1O07 A;  3PBQ A;  1HD8 A;  1I5Q A;  3IF5 A;  3TOI A;  1JTD A;  2WZZ A;  5FSR A;  1W5D A;  3ZG0 A;  4KG6 A;  1SDE A;  3WS5 A;  1K25 A;  1GA9 A;  1Z6F A;  4FSF A;  4K91 A;  4NK3 A;  1FCN A;  1YM1 A;  3C4P A;  3W4P A;  1JWV A;  5KSH A;  5M19 A;  5EVL A;  3PBT A;  1K56 D;  2DCF A;  2WGW A;  2Y59 A;  3UPP A;  3IWO A;  4UHU A;  3P98 A;  5GL9 A;  3VFH A;  1GHI A;  3BLS A;  5HFO A;  4GB7 A;  1DY6 A;  4C75 A;  2XF3 A;  5EVI B;  4L0L A;  5FAT A;  2ZC7 A;  2ZQ7 A;  2HDS A;  3IXG A;  3ZVT A;  1KE0 A;  1ONG A;  2PBY A;  2ZQA A;  4E3J A;  1FR6 A;  3VOZ A;  4KZ4 A;  3QNB A;  4OOY A;  5GHY A;  1KGF A;  1M6K A;  5EVI C;  1SCW A;  4WM9 A;  4MNR A;  5U47 A;  4EBL A;  4OQH A;  2Q9N A;  3W8K A;  3CJM A;  2XD5 A;  3UDI A;  3IHA A;  1ZG6 A;  1K38 A;  5JYP A;  4IED A;  3GR2 A;  5DF8 A;  3WS2 A;  3GTC A;  3SOI A;  4RYE A;  4CJN A;  2H0T A;  3N8S A;  3MXR A;  4OLD A;  5D3O A;  4KQQ A;  3O86 A;  3IF6 B;  4WZ4 A;  4U3T A;  4FD8 A;  3A3F A;  1K54 A;  3CG5 A;  3M2J A;  3A3J A;  5FQJ A;  2OV5 A;  3V3R A;  4WEJ A;  3IF6 C;  4MEZ A;  1ES5 A;  3FWL A;  2HPB A;  4S2K A;  3ZG9 B;  4GDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...