3IF6B

Crystal structure of oxa-46 beta-lactamase from p. aeruginosa
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
242
structure length
242
Chain Sequence
VVIRSDWKKFFSDLQAEGAIVIADERQAKHTLSVFDQERAAKRYSPASTFKIPHTLFALDADAVRDEFQVFRWDGVNRSFAGHNQDQDLRSAMRNSTVWVYELFAKDIGEDKARRYLKQIDYGNVDPSTIKGDYWIDGNLKISAHEQILFLRKLYRNQLPFKVEHQRLVKDLMITEAGRSWILRAKTGWEGRFGWWVGWIEWPTGPVFFALNIDTPNRTDDLFKREAIARAILRSIDALPPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OXA-46 oxacillinase
publication title Crystal structure of the narrow-spectrum OXA-46 class D beta-lactamase: relationship between active-site lysine carbamylation and inhibition by polycarboxylates
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 70
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3if6B00
1GHIA 4JXWA 4Q8IA 3N7WA 5CHJA 1RGYA 4PM5A 3UPOA 5FQJA 1G6AA 4EBLA 4QY5A 2Y2QA 2ZC6B 1IYQA 1HZOA 1YLYA 4ZTKA 1HD8A 2Y2MA 4XUXA 4E3LA 2P9VB 3HREA 3GQZA 4MLLA 4DE2A 5FI6A 2VGJA 1EWZA 1XKZA 2WAEA 1K55A 3S22A 3Q81A 1PWCA 3BEBA 4WBGA 1BLHA 3ITBA 3OC2A 2ZMAA 3Q7ZA 2EXAA 4OKPA 3DTMA 3IXHA 4WMCA 5GHXA 3G2ZA 3PBNA 4OP5A 3C5AA 4DKIA 2E8IA 2WKIA 4S2NA 4UHUA 3W8KA 1K25A 1NY0A 1TDGA 4N9KA 5GLDA 1K4FA 1BULA 1KGFA 4WYYA 3UDFA 3RXWA 4JPMA 1N4OA 5I94A 3BFFA 1OMEA 1RGZA 2ZM0A 4KZ9A 2HDUA 2EFUA 5FSRA 3WRTA 4E3NA 2Z2MB 3BM6A 3UE0A 5L2FA 3A3FA 4GDBA 1SKFA 1JVJA 5TR7A 2DRWA 1NJ4A 2WYXA 4JXSA 4OPQA 2X02A 4R3JA 3RXXA 3G32A 2PU4A 3VOYA 4DF6A 1ESUA 2XR0A 3HUMA 1PI5A 2QPNA 3FWLA 4WELA 4KZ4A 4OVDA 5KSHA 3SS4A 1W7FA 4C75A 3NY4A 1ZKJA 3PBQA 2WGIA 3GVBA 4M3KA 3IH8A 3NDGA 4BJPA 1BUEA 4JKTA 5M1AA 4KZ5A 4QHCA 5GHZA 5TFQA 3Q7VB 4OOLA 1HVBA 3S1YA 5FQQA 3VFFA 3ZG5A 2WGWB 3OCLA 2HP9A 4K0XA 2WAFA 4PMAA 3N4IA 3IHBA 5CTMA 2ZJ9A 1LLBA 4BD0A 1YMXA 4Y0TA 1PWDA 4PM6A 5EVLA 4U3TA 4IVKA 1LI9A 4GDNA 1MWTA 4YINA 3GTCA 1L0EA 3IF5A 2WKEA 2Y55A 4ZAMA 3P98A 3OPPA 3VMAA 3CJMA 4OOYA 4A5RA 1O7EA 3O86A 3LCEA 1KGEA 1FOFA 3HUOA 3BECA 3P09A 5DTTA 4OQGA 5A91A 4X53A 2HP6A 1L0FA 2A3UA 4LENA 1KVLA 1K56A 1JTDA 1M40A 5CXWA 3VFHA 5FAOA 2GDNA 2ZQAA 4RVAA 5BOHA 4NK3A 1GA9A 2JE5A 5CGSA 5KMWA 1RP5A 1EROA 1HTZA 4OP8A 1YLZA 3FZCA 1K54A 4OLGA 3MXRA 3SS3A 3VP1A 1U60A 1NZUA 4WMCD 2WZXA 3MBZA 5CHUA 3MKFA 1IYSA 4UA6A 1ERMA 3BLSA 4JXGA 5DTKA 2WKHA 4KQOA 1KDSA 1K6SA 2OLUA 1YLWA 4ID4A 4S2LA 5J8XA 4N9LA 1PYYA 2V1ZA 3S4XA 5E2GA 2ZM8A 4N1XA 5CGWA 5GHYA 1GHMA 4JF6A 1WYBA 1BLSA 3A3IA 4KQRA 1VM1A 4RA7A 2J8YA 1LI0A 1ZG4A 4WEJA 1KE3A 3A3EA 2QZ6A 2XEPA 1FQGA 2HDQA 2RCXA 4KG6A 5FDHA 1YLPA 1GA0A 1BLCA 4IBRA 5CHMA 3GSGA 5FQIA 4EWFA 1S0WA 2Q9NA 3ZG0A 1XX2A 2Y2JA 3HLCA 2CC1A 3WS1A 3HLEA 2G2WA 2Y2PA 4GB7A 2IWDA 2V2FF 2JC7A 5EECA 1ES3A 3VP3A 4GNUA 1PZOA 3NIAA 4S2KA 2ZQ8A 2ZQDA 3V39A 1BTLA 4P6BA 4QU3A 4HBUA 5GLCA 1ES5A 3VSLA 5AQAA 2V20A 4E3KA 4OH0A 1YMSA 4XXRA 5EVIB 5FASA 4UA9A 5D3OA 4X56A 3G34A 4OONA 3UDIA 1CI8A 1JWZA 4P87A 5HX9A 5TGFA 3G2YA 3WS4A 1SCWA 1H5XA 5HW3A 4ZJ3A 1L0GA 2HDRA 4DXCA 2X71A 3VP0A 2EX8A 2PBYA 1IYPA 2C5WB 5FQKA 4ZJ1A 5F1FA 1MKIA 3UY6A 3G4PA 1XA1A 3IQAA 3LEZA 1YLJA 1DJAA 4OQIA 4DE0A 2P9VA 2HP5A 2OLVA 2IWBA 3NBLA 4LCMA 4S2PA 4DDYA 4LV0A 1H8ZA 2FFYA 2Y2KA 5EOOA 3M2KA 4JBFA 4B88A 1C3BA 5EVIC 1SHVA 1K56D 3HL9A 5EPHA 1ERQA 3AGEA 3E2KA 4PPRA 4PM9A 3ZG9B 3GMWA 4XUZA 3IWQA 3PAEA 1PI4A 2JCHA 3AGDA 4QB8A 4R4RA 2Y4AA 3ZVWA 1SDNA 4MNRA 4D2OA 2Y2GA 4DDSA 1SDEA 2WUQA 3M2JA 2I72A 3NC8A 5F82A 3IH9A 4B4ZA 2Y2OA 2DCFA 3N6IA 4KZ7A 1MPLA 1FCMA 2XD5A 5FAQA 5U47A 3IWIA 3SS5A 1DY6A 5FQ9A 2PU2A 1N9BA 4U0XA 2VGKA 3FYZA 5FI7A 5FATA 4FH4A 4CPKA 3ZNTA 3N8RA 4LCLA 1ONHA 4E3OA 4IEDA 3ITAA 3O3VA 3Q82A 2ZC4B 2OSUA 5DF8A 4KENB 1BT5A 2ZC3B 1IELA 3CG5A 5EOEA 3PBRA 4X55A 5GL9A 1BSGA 3MFDA 4X68A 4E3JA 3OCNA 5HAPA 1IYOA 2XK1A 3CZDA 3QHYA 4QD4A 4S2IA 4EUZA 4KQQA 3Q7VA 3WRZA 4OQ0A 1W79A 1XA7A 2H0TA 1KGGA 5DVAA 1VQQA 2X01A 2EFXA 2WGWA 3SH9A 3WS0A 4RYEA 4X69A 4KZ3A 3D4FA 2Z2LB 4DXBA 1NZOA 3BRMA 3CMZA 5A93A 3IHAA 2ZQCA 3NDEA 5GLAA 3GRJA 5CGXA 5M19A 4BQMA 4GOGA 3W4QA 1Q2PA 4GKUA 3RJUA 4MEZA 3C4OA 3UN7A 4JLFA 5CTNA 5FA7A 1ZG6A 1JTGA 4F94A 1M6KA 1MY8A 4BLMA 5HFOA 3IWOA 1G68A 2C6WB 1Y54A 3OPRA 1KDWA 3FKVA 3ZNYA 3QNBA 2XFTA 5EUAA 3WS2A 2JBFA 3DWZA 3HBRA 1LL5A 2Y2IA 4KZ6A 3UDXA 3MZEA 1ES2A 2HDSA 3C7UA 2ZC5B 2XDMA 1AXBA 2BLSA 4KZAA 3UNWA 4IBXA 5FQMA 2WZZA 5DTSA 3PBSA 4IVIA 4DE1A 1XP4A 1NYYA 2XD1A 4YFMA 2BG1A 3BYDA 3UE1A 3HLBA 3BLMA 3G30A 4HEFA 4KZBA 3V50A 3WWXA 5A90A 3IF6B 2H10A 1RCJA 3GR2A 3ZG7B 2J9OA 4EBNA 1EI5A 1YLTA 2B5RA 4E3IA 3HUNA 4OPYA 1IKGA 1K57C 4EBPA 5E2FA 3ZVTA 5E43A 4Y7PA 2R9XA 5CEBA 1MWRA 3PTEA 1K38A 3C4PA 4BD1A 2A49A 3MZFA 4KG5A 3JYIA 1FSWA 3BFGA 3MKEA 3ZGAB 1CK3A 4OPZA 3LO7A 1H8YA 2J7VA 4MBHA 3Q1FA 3ZHHA 1WE4A 1FCOA 3IT9A 4LV2A 1ZC2A 5HARA 3SOIA 4CJNA 4DRTA 5JYOA 4WZ5C 5EVIA 2Y91A 2ZM2A 1FSYA 1I5QA 3A3DA 3PBOA 3IF6C 4JXVA 4OQHA 2R9WA 4B4XA 2Y2HA 1LHYA 4WM9A 4PM8A 4GD6A 4UAAA 5AQ9A 1GHPA 1YQSA 5F1GA 3G31A 3I7JA 1FR6A 4MBKA 3OZHA 1E3UA 2RL3A 1W5DA 5KSCA 4N92A 4HESA 1NYMA 3UPNA 1MXOA 4GD8A 1K55C 3BFEA 3IXBA 3NI9A 3M6HA 1IEMA 3QNCA 4K0WA 4E6XA 4ZDXA 4S2MA 4E6WA 2DNSA 1E25A 4L0LA 2P74A 1W8YA 1CEFA 1PW1A 4QJGA 4ZBEA 1ONGA 4S2NC 3Q07A 3ZG8B 4BL3A 4FCFA 4FD8A 2XH9A 4KZ8A 3V5MA 3ISGA 5CEDA 4R3BA 3SH8A 1TDLA 2H5SA 3O87A 2ZC7A 1CEGA 4OLDA 1BLPA 4KG2A 2WK0A 3C7VA 1MWUA 2QMIA 3DWKA 4P85A 5A92A 4LV1A 3E2LA 5GLBA 3VOZA 1WYCA 3W4PA 3PBTA 1O07A 3M6BA 4RX3A 5M18A 2ZD8A 3IXDA 2EX6A 1IKIA 3V3SA 1NXYA 1S6RA 2Y2LA 3EQVA 3LY4A 4R23A 5AQ7A 3HLWA 5IHVA 3TSGA 5HL1A 3VSKA 5FI2A 4P0MA 1MBLA 2WADA 1I2SA 1L2SA 3FV7A 4U0TA 3SH7A 3UPPA 5CERA 3N8SA 2H0YA 2WGVA 3N8LA 2G2UA 4ZJ2A 3EQUA 2OV5A 5JYPA 1DJCA 1QMFA 1PWGA 3W4OA 2IWCA 1ESIA 1XPBA 4E3MA 3ZCZA 1KVMA 1Z6FA 2EX9A 2Q9MA 1JWPA 5EE8A 1XGJA 2J9PA 1YT4A 2FFFB 5HAQA 1MWSA 4UA7A 4O7DA 3HLGA 3FKWA 4WZ4A 5DF9A 4BL2A 1J9MA 4H8RA 4NETA 4JF5A 5KZHA 5E2HA 4PM7A 1JWVA 3PAGA 3IXGA 5EVID 4R0QA 3ZDJA 4RX2A 4S2JA 2XFSA 4OOMA 4BENA 3HLDA 1KE4A 3GV9A 5AQBA 3TG9A 4N1HA 4C6YA 2XQZA 4R1GA 2ZQ9A 2XLNA 2EX2A 5HAIA 3BFCA 5CECA 2HPBA 4WEKA 5G18A 3TOIA 3UE3A 1DJBA 4C3QA 4QY6A 5F83A 1E3UD 1TVFA 1QMEA 4OPRA 1KE0A 1ES4A 4GZBA 4R4SA 1TEMA 4DE3A 3G35A 1L0DA 3HVFA 3O88A 5E2EA 1LL9A 4GN2A 1I2WA 1K54C 3DW0A 4FSFA 1ALQA 1XXMA 3V3RA 1K4EA 2ZQ7A 1K57A 1GCEA 1CI9A 2XF3A 3B3XA 1PW8A 4K91A 4Y0UA 5FAPA 4Z9QA 2ZLYA 3HLFA 4EV4A 3VP4A 1E4DA 2Y59A 2Y2NA 4S2OA 3OPLA 3MXSA 4Y0OA 1PZPA 2UWXA 1FR1A 3UO9A 2XGNA 3OPHA 3NCKA 4JF4A 5CRFA 1W8QA 4FH2A 5DF7A 4MBFA 3WS5A 3MZDA 4EQIA 4X6TA 3VP2A 3BFDA 1YM1A 3A3JA 1NRFA 3LY3A 1Q2QA 4LV3A 4WZ5A 1BZAA 2EXBA 1K6RA 3IF6A 3AGFA 3ZFZA 1FCNA 1XGIA 1PIOA 4HBTA
chains in the Genus database with same CATH superfamily
1WA9A 1GHIA 4EW7A 3N7WA 4PM5A 1RGYA 1P9RA 4ZTKA 1N9LA 5FI6A 2WAEA 3Q81A 4WBGA 3UE6A 4UEYA 3OC2A 2ZMAA 4WMCA 3DTMA 2L4RA 3IXHA 5GHXA 3G2ZA 4UHUA 1K25A 1NY0A 4N9KA 5GLDA 4JPMA 5I94A 3BFFA 1OMEA 4KZ9A 2HDUA 2EFUA 2Z2MB 3BM6A 3UE0A 4NXGA 1JVJA 3PHYA 1NJ4A 4JXSA 4OPQA 3NHQA 1H0MA 1T18A 3G32A 3LIFA 2EWWA 2XR0A 3HUMA 1PI5A 4DMZA 5KSHA 4C75A 1W7FA 2R78A 3NY4A 1ZKJA 3GVBA 2ZL1A 3IH8A 4BJPA 4QHCA 5TFQA 4OOLA 4H6JA 1L3LA 5FQQA 2WGWB 2J3WA 3A0VA 1PWDA 3JPUA 1X0OA 2WKEA 1UWPX 4NG2A 3O86A 2V1AA 4OQGA 1S1ZA 4X53A 1KVLA 1Y4OA 3QP1A 5CXWA 3VFHA 2GDNA 2ZQAA 1F9IA 4HH3A 5KMWA 2P7JA 3R4KA 1RP5A 4OP8A 3FZCA 3T12B 4MCWA 1U60A 1NZUA 4BMWA 1CQAA 3ULFA 2WKHA 4ID4A 3B42A 5DKKA 4HOIA 4N9LA 3S4XA 4HJ3A 4N1XA 1WYBA 4KQRA 4RA7A 1ZG4A 3F1OB 2QZ6A 5FDHA 1P97A 5HD5A 1GA0A 4IBRA 3GSGA 1MC0A 4EWFA 3ZG0A 3HLCA 3BWLA 3K3CA 5EECA 4Y2FA 1MZUA 2ZQ8A 4LGWA 5GLCA 2V20A 4OH0A 2HGVA 4HH2A 5FASA 4OONA 3WS4A 1SCWA 5HW3A 4ZJ3A 2EX8A 2PBYA 3LR4A 3T1SA 4UQIM 5FQKA 5F1FA 3UY6A 5AJGA 1XA1A 3LEZA 1DJAA 2VV6A 3L9KA 2OLVA 3BQAA 4LV0A 1SZVA 5EPHA 3T1RA 1ERQA 1TD5A 4PPRA 1OJ5A 3GMWA 3NOPC 3UB8A 4R4RA 1SDNA 4D2OA 1LSVA 2Y2GA 1SDEA 2WUQA 4B4ZA 2I72A 3IH9A 2Y2OA 2WKPA 1FCMA 5FAQA 5U47A 4R3AA 4NXBA 2VGKA 3FYZA 4FH4A 1ONHA 4IEDA 3ITAA 3Q82A 2ZC4B 1BT5A 2ZC3B 5EOEA 3PBRA 4X55A 5K5BA 1BSGA 4E3JA 4X68A 4KQQA 4PAUA 1XA7A 5DVAA 3SH9A 2WGWA 4RYEA 3CHWP 4KZ3A 4ETZA 2VX8A 4FTXA 5CGXA 2GX5A 4GKUA 1S1YA 3IS2B 5F6AA 1MY8A 4BLMA 3IWOA 2JKTM 4HQAA 4LLOB 3H82B 3FG8A 3DAVA 4LRZE 4HHDA 3WS2A 3DWZA 3HBRA 2XROA 4IBXA 1OJGA 2A24B 1XP4A 4MMNA 2O0YA 2XD1A 4YFMA 3C2WA 2BG1A 4EU0A 3BLMA 3CPTA 3G30A 3WWXA 4EBNA 1YLTA 4RQ9A 4EBPA 4JGOA 1K38A 3MZFA 3BFGA 5HDSA 1H8YA 4MBHA 4MDZA 1Y28A 1WE4A 3BW6A 2PYRA 3IT9A 5HARA 4CJNA 5JYOA 2ZM2A 1I5QA 4JXVA 4B4XA 4PM8A 4UAAA 2O9AA 4XT2A 1FR6A 4HY8A 4MBKA 2RL3A 2Q0OA 4GD8A 1K55C 4E6XA 4L0LA 4QJGA 1CEFA 4S2NC 1ONGA 3Q07A 4BL3A 1DP6A 2B95A 5HWVA 4FD8A 3LI9A 4ZRRA 1NLZA 1CEGA 1T1AA 2DMWA 4KG2A 3IBRA 2VV7A 1WYCA 3W4PA 3PBTA 3FC7A 3HJKA 2EX6A 1IKIA 5F68A 5AQ7A 5FI2A 2W3DA 2WADA 3N8SA 2H0YA 3N8LA 2G2UA 2OV5A 1QMFA 4E3MA 4L9EA 1KVMA 2EX9A 1XGJA 2FFFB 2V9AA 2M7UA 2D01A 2PAVP 4L9GA 4UA7A 4WZ4A 5DF9A 3PAGA 3IXGA 3ZDJA 4MN5A 4C6YA 3LYXA 2W1TA 2XQZA 1OT6A 2VJWA 2XLNA 5HAIA 3TOIA 3IS2A 4PKYA 1QMEA 1KE0A 4GZBA 3E0YA 4R4SA 1L0DA 4FSFA 1K54C 3H82A 2HF6A 2OAQ1 2ZQ7A 1PW8A 1E4DA 2Y2NA 4G3VA 3OPLA 3F1PB 5KIZA 4ARZA 5J3WA 2A24A 5DF7A 4X6TA 1NRFA 2IA2A 1BZAA 3LUQA 5C5KA 2VZWA 3AGFA 1PIOA 5CHJA 4EBLA 4QY5A 2Y2QA 2ZC6B 1IYQA 2Y2MA 4XUXA 1A0KA 3E98A 5AVFA 4WL9A 4DE2A 3T4TA 3S22A 1K55A 2MJ6A 2XRNA 3ITBA 2EXAA 3PBNA 3OBFA 3IX8A 2FH5A 3C5AA 2E8IA 4S2NA 1TDGA 1BULA 1KGFA 4WYYA 3RXWA 2L1MA 1N4OA 1RGZA 5FSRA 4LRYC 5TR7A 2LB5A 2WYXA 4PHTA 5DJUA 2X02A 1ZTUA 2QJ7A 2QPNA 1OTBA 4WELA 4KZ4A 3QP5A 2O9CA 3TW8A 1LSWA 1BUEA 4DJ2A 5GHZA 3CWFA 4EXOA 1HVBA 3VFFA 3OCLA 1EW0A 2HP9A 4K0XA 4GS9B 1LLBA 4BD0A 2ZOIA 3UB5P 4Y5FA 1T1CA 4U3TA 2QWSA 4YINA 3GTCA 1L0EA 3IF5A 4G3KA 2Y55A 1O7EA 2HJEA 5DTTA 3BECA 2A3UA 3P01A 5FAOA 4RVAA 5BOHA 3KSHA 1GA9A 2JE5A 3LFVA 1HTZA 4F3LB 1K54A 1VB6A 4UA6A 1ERMA 2OLUA 3T1XA 5J8XA 1PYYA 5E2GA 3JVVA 5GHYA 1GHMA 4JF6A 3MJQA 2J8YA 4WEJA 3A3EA 4WN5A 2RCXA 5CHMA 5FQIA 4LPZA 1S0WA 3WS1A 4GHIB 2Y2PA 4GB7A 2JC7A 4GNUA 1PZOA 3NIAA 3V39A 4P6BA 3F1PA 4HBUA 3VSLA 5AQAA 3KYZA 1YMSA 1XJ2A 1JWZA 1S4SA 2HDRA 4DXCA 2X71A 3VP0A 1TS6A 2VGLM 1YLJA 4BBUA 2HP5A 2CMNA 2K31A 2IWBA 4LCMA 5HWWA 1H8ZA 2A2LA 3M2KA 5EOOA 4JBFA 1SHVA 1K56D 4HP4A 4XUZA 3IWQA 1PI4A 2JCHA 1CF0A 3M2JA 5F82A 4KZ7A 2J3TC 3IWIA 3SS5A 4CPKA 5F5YA 4R38A 2OSUA 2HJ9C 5GL9A 2QHKA 4QD4A 4S2IA 4EUZA 1W79A 2H0TA 1KGGA 4X69A 1V9ZA 3D4FA 4GS9A 3F1NB 1NZOA 5A93A 3LR3A 3IHAA 4O01A 5GLAA 3GRJA 1S66L 4BQMA 1YSQA 4GOGA 3O5YA 1H8MA 4NXEA 3PR6A 1DP9A 3KYEA 4FUWA 4F94A 1M6KA 5HFOA 3S7NA 3OPRA 4L9FA 3FKVA 4JGQA 3CPTB 2XFTA 3H7WB 5EUAA 4F3LA 4HI4A 4KZ6A 1ES2A 2HDSA 3LR5A 2XDMA 5EM0A 4I3IA 3PBSA 1AWIA 3UE1A 1P0ZA 4KZBA 3V50A 5A90A 5G4YA 4HIAA 3GR2A 3ZG7B 4MN7A 3MQ0A 2B5RA 3HUNA 4OPYA 1K57C 1OTAA 3ZVTA 5CEBA 4NEED 1MWRA 4GHIA 4QPRA 1XFQA 3D72A 4XT2B 1CJFA 3LIAA 2J7VA 1D06A 2PBDP 3HCYA 4WZ5C 2Y91A 1XJ6A 5EFWA 5I5LA 4OQHA 4II7A 2R9WA 1LHYA 4WM9A 2K7SA 2Z6DA 4QWOA 3OZHA 1W5DA 1NYMA 2XSSA 3UPNA 1MXOA 4I3AA 3BFEA 5L10A 1IEMA 4E6WA 2DNSA 5EM1A 3EGXC 2P74A 1W8YA 1PW1A 1VETB 3ZG8B 5G4ZA 5HWTA 3V5MA 4YNRA 3ISGA 5CEDA 4R3BA 2H5SA 4EUVA 3O87A 2ZC7A 4OLDA 4EQ1A 1MWUA 3DWKA 3E2LA 4RX3A 1O07A 3M6BA 2KDKA 1NXYA 2Y2LA 3EQVA 3RTYA 3VSKA 3D9YA 4P0MA 5IS1A 2H28A 3SH7A 1KOUA 2W3HA 3LIDA 1H3QA 1Z6FA 1NWZA 4G3WA 2Q9MA 1JWPA 1MWSA 2W1TB 4WF0A 3EGDC 3FKWA 3F1NA 3VE3A 3LGOA 4PM7A 2GNXA 2O99A 3UMEA 1ODVA 3TG9A 4BWIA 4R1GA 2ZQ9A 2EX2A 3BFCA 5G18A 1DJBA 1E3UD 1TVFA 4ARZB 2VGLS 1ES4A 4R6LA 1TEMA 1XJ3A 2JKRI 2OWHA 3O88A 3HJIA 1LL8A 3DW0A 1K4EA 3B47A 1K57A 3H7WA 2XF3A 3B3XA 4B9OA 4EV4A 2Y59A 4S2OA 3EEHA 4JGPA 3T4QA 4Y0OA 3OPHA 3KSFA 4JF4A 5CRFA 1W8QA 3RH8B 3MZDA 4EQIA 2W27A 1YM1A 4LV3A 4WZ5A 2AVXA 5IT5A 3JVUA 1K6RA 2V8CA 1XGIA 2V0WA 3UPOA 4JXWA 4Q8IA 3B33A 5FQJA 5DKLA 1G6AA 1HZOA 1YLYA 4E3LA 3DTEA 3GQZA 4MLLA 1EWZA 2VLGA 1PWCA 3BEBA 1BLHA 4DJ3A 4OP5A 1P9WA 4I5SA 3W8KA 4X25A 1STZA 1DRMA 3U4LP 2ZM0A 3WRTA 1PRQA 3A3FA 1G5UA 1SKFA 1FILA 4R3JA 3FPVA 3RXXA 3VOYA 1ESUA 2HZ5A 3FWLA 1OTEA 4OVDA 3A0SA 3CI6A 3SS4A 1VETA 2WGIA 3EEAA 3DTKA 3NDGA 3QP4A 4KZ5A 3Q7VB 3S1YA 1FIKA 3ZG5A 3GECA 3UMDA 2WAFA 3N4IA 5FEFA 4Y0TA 4IUKA 4MN6A 4PM6A 4IVKA 2KOIA 3VE4A 3OPPA 3MSHA 2QYBA 3CJMA 4OOYA 2LB9A 3VMAA 4A5RA 1KGEA 1FOFA 3HUOA 3UB7A 2HP6A 5J4EA 1K56A 1M40A 5FL3A 5CGSA 1NLYA 2VKSA 1YLZA 4OLGA 3S7PA 3SS3A 3VP1A 5CHUA 2WZXA 3MBZA 2J3TD 1IYSA 5DTKA 4EESA 4KQOA 3MXQA 3K2NA 1KDSA 1YLWA 4S2LA 2G7UA 2ZM8A 4ESPA 1BLSA 1VM1A 2XEPA 1LT0A 4EETB 2Q9NA 1XX2A 1OTDA 2CC1A 2G2WA 2YKHA 5HZHA 1ES3A 2ZQDA 1BTLA 1ES5A 4XXRA 4WUJA 4UA9A 5HDDA 3UDIA 3LIEA 4P87A 1F5MA 5L8MA 5TGFA 5HPIA 4Y15A 1L0GA 2I9VA 1UGUA 1MKIA 3NBLA 4S2PA 4DDYA 3NULA 2FFYA 2Y2KA 4B88A 1C3BA 5EVEA 1DP8A 3E2KA 5FDSA 5MC7A 3AGDA 2Y4AA 3SW1A 3ZVWA 4MNRA 4DDSA 2DCFA 1Z09A 3T1QB 1OTIA 4U0XA 1N9BA 4CLCD 5FATA 3N8RA 3C8CA 5TJJA 4LCLA 4HJ4A 5L09A 3MFXA 1IELA 2PR6A 3T4SA 4GJ4A 3MFDA 5LBRA 1IFQA 3OCNA 1IYOA 5HAPA 3QHYA 3Q7VA 3WRZA 4CQHA 3P7NA 2EFXA 2PYPA 1T19A 2Z2LB 4DXBA 3T50A 3NDEA 5M19A 2OOLA 3EOIA 4O0PA 1Q2PA 4MEZA 3C4OA 2JKRM 5CTNA 1ZG6A 1PNEA 1D1JA 1GSVA 1JTGA 3FPWA 3GDIA 2HV1A 3PXPA 4GLQA 1KDWA 3ZNYA 4NKPA 2JBFA 3UDXA 3MZEA 1AXBA 2BLSA 4KZAA 3S7OA 3UNWA 5FQMA 3LR0A 3T4KA 4DE1A 2B02A 4KUKA 3IF6B 2H10A 1RCJA 3PYPA 4CLCE 1EI5A 2E8JA 5E2FA 4Y7PA 3EWKA 3VV4A 3PTEA 3C4PA 4KG5A 2J80A 3JYIA 1FSWA 3MKEA 4OPZA 2V0UA 3ZHHA 1ZHHB 3Q1FA 1FCOA 3CITA 1FSYA 3PBOA 3IF6C 1F2KA 3G31A 4LRXC 2VA0A 1VHMA 1E3UA 1YKDA 4HESA 1HLUP 4IJGA 3IXBA 3NI9A 3QNCA 4ZDXA 2INWA 4S2MA 4YWZA 2W3GA 2W0NA 4FCFA 2V1BA 3SH8A 1TDLA 1YPRA 2JKGA 2Y79A 3BJNA 1BLPA 2WK0A 4R70A 5A92A 4LV1A 2WKQA 3MMHA 3CUEC 3R7WB 2QJ5A 2ZD8A 3V3SA 3LEQA 1S6RA 4R23A 5HL1A 5IHVA 3C30A 3FV7A 4Q0JA 5CERA 4ZJ2A 3EQUA 2ACGA 5JYPA 1DJCA 1PWGA 2BASA 5DFYA 3W4OA 4HJ6A 3W2ZA 4Y13A 3A0RA 5FEGA 4I3JA 3VOLA 5EE8A 2J9PA 1YT4A 4EERA 4O7DA 4BL2A 4NETA 2QKPA 4JF5A 1IOUA 5KZHA 5E2HA 2ZMVA 1JWVA 4CLCB 5EVID 2ZBBA 2XA7S 4S2JA 4OOMA 3HLDA 5AQBA 3GV9A 3QP6A 5IU1A 2GJ3A 5E2EA 2V8FA 3HVFA 4GN2A 3V3RA 3ICYA 1GCEA 1CI9A 3LICA 3D3OA 2W3EA 5HL6A 2ZLYA 4CLCC 3VP4A 3MXSA 1PZPA 3UO9A 2XGNA 3NCKA 4FH2A 4MBFA 3KSIA 3NJAA 3E4PA 3LY3A 3IF6A 1FCNA 2JKFA 1YAXA 4HBTA 5HSQA 2M7VA 1J3WA 1YSPA 4GW9A 3KSGA 1HD8A 2P9VB 2Z6CA 3HREA 2VGJA 1XKZA 3NOTC 2BTFP 1JNUA 3Q7ZA 4OKPA 4LFUA 4DKIA 2WKIA 3QP2A 3ZQ5A 2PHYA 2KX6A 3UDFA 1K4FA 4E04A 3LIBA 4E3NA 5L2FA 4P6ZM 4GDBA 5EV0A 2DRWA 3CUEA 2Y8HA 4X1LA 2PU4A 4DF6A 3MS6A 5HPFA 1G28A 5CX7A 4BBVA 3PBQA 2VEAA 4M3KA 2PR5A 4JKTA 2EA9A 5M1AA 3KX0X 1XJ4A 4PMAA 3IHBA 5CTMA 2ZJ9A 1YMXA 3R7WA 4FOFA 4DN0A 5EVLA 1VEUB 1GSXA 1LI9A 4GDNA 1MWTA 1XFNA 2OWJA 4ZAMA 3P98A 3LCEA 5A91A 3P09A 1PFLA 1L0FA 3V67A 4LENA 3T4OA 1JTDA 2O9BA 3TE8A 4NK3A 2M1CA 1GSWA 2ZOHA 1S67L 1EROA 3MXRA 4WMCD 3IBJA 3MKFA 3BLSA 4JXGA 4ME4A 4CLCA 1K6SA 4I39A 4O8GA 3E4QA 2V1ZA 5CGWA 2EWVA 3A3IA 3BY9A 1LI0A 4X1MA 2ZMFA 1KE3A 3RFBA 4KG6A 1G6OA 1FQGA 2HDQA 1YLPA 1TS8A 1BLCA 2Y2JA 3IX4A 3HLEA 4AFIA 2IWDA 2V2FF 5DFXA 3VP3A 3OLOA 4Y3IA 4S2KA 2PDRA 3F1OA 4QU3A 4E3KA 5EVIB 5D3OA 4X56A 2JHEA 3G34A 1CI8A 5HX9A 3G2YA 5L07A 1H5XA 1IYPA 3MF0A 2C5WB 4ZJ1A 3G4PA 3IQAA 4DE0A 4OQIA 4I38A 2P9VA 1BYWA 4M4XA 2K2NA 3NOUC 5EVIC 3HL9A 3AGEA 1TS0A 2NUTC 4PM9A 3ZG9B 1W63M 3PAEA 4QB8A 3NC8A 4EEUA 2PD7A 3N6IA 1MPLA 2XD5A 3CLOA 1DY6A 5FQ9A 2PU2A 5FI7A 4HP9A 2WKRA 3IX3A 3ZNTA 1MKMA 3E4OA 5HD3A 4E3OA 1UWNX 1TF1A 3O3VA 3T4JA 5DF8A 4KENB 3T4LA 2PRFA 3CG5A 2VV8A 3MQOA 4ETXA 2XK1A 3CZDA 4OQ0A 2X01A 1VQQA 3U2AA 3WS0A 5TBMB 3BRMA 3CMZA 1VEUA 2ZQCA 5DJTA 3W4QA 4EEPA 3RJUA 3UN7A 4JLFA 5AVEA 5FA7A 2GZAA 5J7EA 2W1RA 4IHQA 2YKFA 1G68A 1SKOB 2C6WB 1Y54A 1S4RA 2W3FA 3KO6A 3QNBA 4Y17A 1LL5A 2Y2IA 3C7UA 2ZC5B 4UQIS 4B93A 2WZZA 5DTSA 4WLAA 3TRCA 2D02A 4IVIA 4KUOA 1NYYA 3UB9A 3BYDA 3QP8A 3HLBA 4HEFA 4P6ZS 1D7EA 2J9OA 3MQQA 4E3IA 3TJZC 1IKGA 3H9WA 5E43A 2R9XA 2XA7M 4BD1A 2A49A 3BQ8A 3ZGAB 1CK3A 3LO7A 4PKYG 4GCZA 5A8BA 4LV2A 1ZC2A 4Z1WA 3SOIA 4DRTA 5EVIA 2VK3A 3UB6A 3A3DA 1T1BA 2P04A 2Y2HA 4GD6A 5AQ9A 1GHPA 1YQSA 5F1GA 3I7JA 1NRJA 4YOFA 2P08A 3S7QA 5KSCA 1K0KA 4N92A 2PT7A 4K08A 3M6HA 4K0WA 4HNBA 1E25A 1N9NA 3OOVA 3ZYTA 4ZBEA 4KQDA 1TS7A 3K3DA 2XH9A 4KZ8A 2ZL1B 1LSXA 3L7HA 2KLIA 4H6JB 2B18A 3CAXA 3C7VA 4P85A 2QMIA 3DBAA 5GLBA 3VOZA 2OAP1 5M18A 3IXDA 1W63Q 3LY4A 3HLWA 3TSGA 1MBLA 1I2SA 1L2SA 4U0TA 4JGRA 4NXFA 3UPPA 3KYQA 2WGVA 2UV0E 2IWCA 1ESIA 1XPBA 3ZCZA 1OPXA 1V9YA 5HAQA 3HLGA 1J9MA 4H8RA 5TBMA 3MR0A 3SZTA 4R0QA 4RX2A 2XFSA 1ACFA 3DTIA 4BENA 1KE4A 4D60A 4N1HA 2NUPC 3BY8A 4Q0IA 5F69A 5CECA 3C38A 2HPBA 4WEKA 3UE3A 4C3QA 4QY6A 5F83A 4OPRA 4DE3A 1SKOA 3G35A 4IUHA 1LL9A 2PD8A 1I2WA 1ALQA 1XXMA 2JKTI 4K91A 4Y0UA 2L0WA 5FAPA 5HDCA 3LI8A 4Z9QA 3G6OA 3HLFA 4Q0HA 1N9OA 2UWXA 1FR1A 1OT9A 3NECA 3WS5A 3VP2A 3BFDA 3A3JA 1F98A 1Q2QA 2EXBA 3ZFZA 4BBTA 2FZ0A 2JN7A
chains in the Genus database with same CATH topology
1GHIA 4JXWA 4Q8IA 3N7WA 5CHJA 1RGYA 4PM5A 3UPOA 5FQJA 1G6AA 4EBLA 4QY5A 2Y2QA 2ZC6B 1IYQA 1HZOA 1YLYA 4ZTKA 1HD8A 2Y2MA 4XUXA 4E3LA 2P9VB 3HREA 3GQZA 4MLLA 4DE2A 5FI6A 2VGJA 1EWZA 1XKZA 2WAEA 1K55A 3S22A 3Q81A 1PWCA 3BEBA 4WBGA 1BLHA 3ITBA 3OC2A 2ZMAA 3Q7ZA 2EXAA 4OKPA 3DTMA 3IXHA 4WMCA 5GHXA 3G2ZA 3PBNA 4OP5A 3C5AA 4DKIA 2E8IA 2WKIA 4S2NA 4UHUA 3W8KA 1K25A 1NY0A 1TDGA 4N9KA 5GLDA 1K4FA 1BULA 1KGFA 4WYYA 3UDFA 3RXWA 4JPMA 1N4OA 5I94A 3BFFA 1OMEA 1RGZA 2ZM0A 4KZ9A 2HDUA 2EFUA 5FSRA 3WRTA 4E3NA 2Z2MB 3BM6A 3UE0A 5L2FA 3A3FA 4GDBA 1SKFA 1JVJA 5TR7A 2DRWA 1NJ4A 2WYXA 4JXSA 4OPQA 2X02A 4R3JA 3RXXA 3G32A 2PU4A 3VOYA 4DF6A 1ESUA 2XR0A 3HUMA 1PI5A 2QPNA 3FWLA 4WELA 4KZ4A 4OVDA 5KSHA 3SS4A 1W7FA 4C75A 3NY4A 1ZKJA 3PBQA 2WGIA 3GVBA 4M3KA 3IH8A 3NDGA 4BJPA 1BUEA 4JKTA 5M1AA 4KZ5A 4QHCA 5GHZA 5TFQA 3Q7VB 4OOLA 1HVBA 3S1YA 5FQQA 3VFFA 3ZG5A 2WGWB 3OCLA 2HP9A 4K0XA 2WAFA 4PMAA 3N4IA 3IHBA 5CTMA 2ZJ9A 1LLBA 4BD0A 1YMXA 4Y0TA 1PWDA 4PM6A 5EVLA 4U3TA 4IVKA 1LI9A 4GDNA 1MWTA 4YINA 3GTCA 1L0EA 3IF5A 2WKEA 2Y55A 4ZAMA 3P98A 3OPPA 3VMAA 3CJMA 4OOYA 4A5RA 1O7EA 3O86A 3LCEA 1KGEA 1FOFA 3HUOA 3BECA 3P09A 5DTTA 4OQGA 5A91A 4X53A 2HP6A 1L0FA 2A3UA 4LENA 1KVLA 1K56A 1JTDA 1M40A 5CXWA 3VFHA 5FAOA 2GDNA 2ZQAA 4RVAA 5BOHA 4NK3A 1GA9A 2JE5A 5CGSA 5KMWA 1RP5A 1EROA 1HTZA 4OP8A 1YLZA 3FZCA 1K54A 4OLGA 3MXRA 3SS3A 3VP1A 1U60A 1NZUA 4WMCD 2WZXA 3MBZA 5CHUA 3MKFA 1IYSA 4UA6A 1ERMA 3BLSA 4JXGA 5DTKA 2WKHA 4KQOA 1KDSA 1K6SA 2OLUA 1YLWA 4ID4A 4S2LA 5J8XA 4N9LA 1PYYA 2V1ZA 3S4XA 5E2GA 2ZM8A 4N1XA 5CGWA 5GHYA 1GHMA 4JF6A 1WYBA 1BLSA 3A3IA 4KQRA 1VM1A 4RA7A 2J8YA 1LI0A 1ZG4A 4WEJA 1KE3A 3A3EA 2QZ6A 2XEPA 1FQGA 2HDQA 2RCXA 4KG6A 5FDHA 1YLPA 1GA0A 1BLCA 4IBRA 5CHMA 3GSGA 5FQIA 4EWFA 1S0WA 2Q9NA 3ZG0A 1XX2A 2Y2JA 3HLCA 2CC1A 3WS1A 3HLEA 2G2WA 2Y2PA 4GB7A 2IWDA 2V2FF 2JC7A 5EECA 1ES3A 3VP3A 4GNUA 1PZOA 3NIAA 4S2KA 2ZQ8A 2ZQDA 3V39A 1BTLA 4P6BA 4QU3A 4HBUA 5GLCA 1ES5A 3VSLA 5AQAA 2V20A 4E3KA 4OH0A 1YMSA 4XXRA 5EVIB 5FASA 4UA9A 5D3OA 4X56A 3G34A 4OONA 3UDIA 1CI8A 1JWZA 4P87A 5HX9A 5TGFA 3G2YA 3WS4A 1SCWA 1H5XA 5HW3A 4ZJ3A 1L0GA 2HDRA 4DXCA 2X71A 3VP0A 2EX8A 2PBYA 1IYPA 2C5WB 5FQKA 4ZJ1A 5F1FA 1MKIA 3UY6A 3G4PA 1XA1A 3IQAA 3LEZA 1YLJA 1DJAA 4OQIA 4DE0A 2P9VA 2HP5A 2OLVA 2IWBA 3NBLA 4LCMA 4S2PA 4DDYA 4LV0A 1H8ZA 2FFYA 2Y2KA 5EOOA 3M2KA 4JBFA 4B88A 1C3BA 5EVIC 1SHVA 1K56D 3HL9A 5EPHA 1ERQA 3AGEA 3E2KA 4PPRA 4PM9A 3ZG9B 3GMWA 4XUZA 3IWQA 3PAEA 1PI4A 2JCHA 3AGDA 4QB8A 4R4RA 2Y4AA 3ZVWA 1SDNA 4MNRA 4D2OA 2Y2GA 4DDSA 1SDEA 2WUQA 3M2JA 2I72A 3NC8A 5F82A 3IH9A 4B4ZA 2Y2OA 2DCFA 3N6IA 4KZ7A 1MPLA 1FCMA 2XD5A 5FAQA 5U47A 3IWIA 3SS5A 1DY6A 5FQ9A 2PU2A 1N9BA 4U0XA 2VGKA 3FYZA 5FI7A 5FATA 4FH4A 4CPKA 3ZNTA 3N8RA 4LCLA 1ONHA 4E3OA 4IEDA 3ITAA 3O3VA 3Q82A 2ZC4B 2OSUA 5DF8A 4KENB 1BT5A 2ZC3B 1IELA 3CG5A 5EOEA 3PBRA 4X55A 5GL9A 1BSGA 3MFDA 4X68A 4E3JA 3OCNA 5HAPA 1IYOA 2XK1A 3CZDA 3QHYA 4QD4A 4S2IA 4EUZA 4KQQA 3Q7VA 3WRZA 4OQ0A 1W79A 1XA7A 2H0TA 1KGGA 5DVAA 1VQQA 2X01A 2EFXA 2WGWA 3SH9A 3WS0A 4RYEA 4X69A 4KZ3A 3D4FA 2Z2LB 4DXBA 1NZOA 3BRMA 3CMZA 5A93A 3IHAA 2ZQCA 3NDEA 5GLAA 3GRJA 5CGXA 5M19A 4BQMA 4GOGA 3W4QA 1Q2PA 4GKUA 3RJUA 4MEZA 3C4OA 3UN7A 4JLFA 5CTNA 5FA7A 1ZG6A 1JTGA 4F94A 1M6KA 1MY8A 4BLMA 5HFOA 3IWOA 1G68A 2C6WB 1Y54A 3OPRA 1KDWA 3FKVA 3ZNYA 3QNBA 2XFTA 5EUAA 3WS2A 2JBFA 3DWZA 3HBRA 1LL5A 2Y2IA 4KZ6A 3UDXA 3MZEA 1ES2A 2HDSA 3C7UA 2ZC5B 2XDMA 1AXBA 2BLSA 4KZAA 3UNWA 4IBXA 5FQMA 2WZZA 5DTSA 3PBSA 4IVIA 4DE1A 1XP4A 1NYYA 2XD1A 4YFMA 2BG1A 3BYDA 3UE1A 3HLBA 3BLMA 3G30A 4HEFA 4KZBA 3V50A 3WWXA 5A90A 3IF6B 2H10A 1RCJA 3GR2A 3ZG7B 2J9OA 4EBNA 1EI5A 1YLTA 2B5RA 4E3IA 3HUNA 4OPYA 1IKGA 1K57C 4EBPA 5E2FA 3ZVTA 5E43A 4Y7PA 2R9XA 5CEBA 1MWRA 3PTEA 1K38A 3C4PA 4BD1A 2A49A 3MZFA 4KG5A 3JYIA 1FSWA 3BFGA 3MKEA 3ZGAB 1CK3A 4OPZA 3LO7A 1H8YA 2J7VA 4MBHA 3Q1FA 3ZHHA 1WE4A 1FCOA 3IT9A 4LV2A 1ZC2A 5HARA 3SOIA 4CJNA 4DRTA 5JYOA 4WZ5C 5EVIA 2Y91A 2ZM2A 1FSYA 1I5QA 3A3DA 3PBOA 3IF6C 4JXVA 4OQHA 2R9WA 4B4XA 2Y2HA 1LHYA 4WM9A 4PM8A 4GD6A 4UAAA 5AQ9A 1GHPA 1YQSA 5F1GA 3G31A 3I7JA 1FR6A 4MBKA 3OZHA 1E3UA 2RL3A 1W5DA 5KSCA 4N92A 4HESA 1NYMA 3UPNA 1MXOA 4GD8A 1K55C 3BFEA 3IXBA 3NI9A 3M6HA 1IEMA 3QNCA 4K0WA 4E6XA 4ZDXA 4S2MA 4E6WA 2DNSA 1E25A 4L0LA 2P74A 1W8YA 1CEFA 1PW1A 4QJGA 4ZBEA 1ONGA 4S2NC 3Q07A 3ZG8B 4BL3A 4FCFA 4FD8A 2XH9A 4KZ8A 3V5MA 3ISGA 5CEDA 4R3BA 3SH8A 1TDLA 2H5SA 3O87A 2ZC7A 1CEGA 4OLDA 1BLPA 4KG2A 2WK0A 3C7VA 1MWUA 2QMIA 3DWKA 4P85A 5A92A 4LV1A 3E2LA 5GLBA 3VOZA 1WYCA 3W4PA 3PBTA 1O07A 3M6BA 4RX3A 5M18A 2ZD8A 3IXDA 2EX6A 1IKIA 3V3SA 1NXYA 1S6RA 2Y2LA 3EQVA 3LY4A 4R23A 5AQ7A 3HLWA 5IHVA 3TSGA 5HL1A 3VSKA 5FI2A 4P0MA 1MBLA 2WADA 1I2SA 1L2SA 3FV7A 4U0TA 3SH7A 3UPPA 5CERA 3N8SA 2H0YA 2WGVA 3N8LA 2G2UA 4ZJ2A 3EQUA 2OV5A 5JYPA 1DJCA 1QMFA 1PWGA 3W4OA 2IWCA 1ESIA 1XPBA 4E3MA 3ZCZA 1KVMA 1Z6FA 2EX9A 2Q9MA 1JWPA 5EE8A 1XGJA 2J9PA 1YT4A 2FFFB 5HAQA 1MWSA 4UA7A 4O7DA 3HLGA 3FKWA 4WZ4A 5DF9A 4BL2A 1J9MA 4H8RA 4NETA 4JF5A 5KZHA 5E2HA 4PM7A 1JWVA 3PAGA 3IXGA 5EVID 4R0QA 3ZDJA 4RX2A 4S2JA 2XFSA 4OOMA 4BENA 3HLDA 1KE4A 3GV9A 5AQBA 3TG9A 4N1HA 4C6YA 2XQZA 4R1GA 2ZQ9A 2XLNA 2EX2A 5HAIA 3BFCA 5CECA 2HPBA 4WEKA 5G18A 3TOIA 3UE3A 1DJBA 4C3QA 4QY6A 5F83A 1E3UD 1TVFA 1QMEA 4OPRA 1KE0A 1ES4A 4GZBA 4R4SA 1TEMA 4DE3A 3G35A 1L0DA 3HVFA 3O88A 5E2EA 1LL9A 4GN2A 1I2WA 1K54C 3DW0A 4FSFA 1ALQA 1XXMA 3V3RA 1K4EA 2ZQ7A 1K57A 1GCEA 1CI9A 2XF3A 3B3XA 1PW8A 4K91A 4Y0UA 5FAPA 4Z9QA 2ZLYA 3HLFA 4EV4A 3VP4A 1E4DA 2Y59A 2Y2NA 4S2OA 3OPLA 3MXSA 4Y0OA 1PZPA 2UWXA 1FR1A 3UO9A 2XGNA 3OPHA 3NCKA 4JF4A 5CRFA 1W8QA 4FH2A 5DF7A 4MBFA 3WS5A 3MZDA 4EQIA 4X6TA 3VP2A 3BFDA 1YM1A 3A3JA 1NRFA 3LY3A 1Q2QA 4LV3A 4WZ5A 1BZAA 2EXBA 1K6RA 3IF6A 3AGFA 3ZFZA 1FCNA 1XGIA 1PIOA 4HBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GHI A;  4JXW A;  4Q8I A;  3N7W A;  5CHJ A;  1RGY A;  4PM5 A;  3UPO A;  5FQJ A;  1G6A A;  4EBL A;  4QY5 A;  2Y2Q A;  2ZC6 B;  1IYQ A;  1HZO A;  1YLY A;  4ZTK A;  1HD8 A;  2Y2M A;  4XUX A;  4E3L A;  2P9V B;  3HRE A;  3GQZ A;  4MLL A;  4DE2 A;  5FI6 A;  2VGJ A;  1EWZ A;  1XKZ A;  2WAE A;  1K55 A;  3S22 A;  3Q81 A;  1PWC A;  3BEB A;  4WBG A;  1BLH A;  3ITB A;  3OC2 A;  2ZMA A;  3Q7Z A;  2EXA A;  4OKP A;  3DTM A;  3IXH A;  4WMC A;  5GHX A;  3G2Z A;  3PBN A;  4OP5 A;  3C5A A;  4DKI A;  2E8I A;  2WKI A;  4S2N A;  4UHU A;  3W8K A;  1K25 A;  1NY0 A;  1TDG A;  4N9K A;  5GLD A;  1K4F A;  1BUL A;  1KGF A;  4WYY A;  3UDF A;  3RXW A;  4JPM A;  1N4O A;  5I94 A;  3BFF A;  1OME A;  1RGZ A;  2ZM0 A;  4KZ9 A;  2HDU A;  2EFU A;  5FSR A;  3WRT A;  4E3N A;  2Z2M B;  3BM6 A;  3UE0 A;  5L2F A;  3A3F A;  4GDB A;  1SKF A;  1JVJ A;  5TR7 A;  2DRW A;  1NJ4 A;  2WYX A;  4JXS A;  4OPQ A;  2X02 A;  4R3J A;  3RXX A;  3G32 A;  2PU4 A;  3VOY A;  4DF6 A;  1ESU A;  2XR0 A;  3HUM A;  1PI5 A;  2QPN A;  3FWL A;  4WEL A;  4KZ4 A;  4OVD A;  5KSH A;  3SS4 A;  1W7F A;  4C75 A;  3NY4 A;  1ZKJ A;  3PBQ A;  2WGI A;  3GVB A;  4M3K A;  3IH8 A;  3NDG A;  4BJP A;  1BUE A;  4JKT A;  5M1A A;  4KZ5 A;  4QHC A;  5GHZ A;  5TFQ A;  3Q7V B;  4OOL A;  1HVB A;  3S1Y A;  5FQQ A;  3VFF A;  3ZG5 A;  2WGW B;  3OCL A;  2HP9 A;  4K0X A;  2WAF A;  4PMA A;  3N4I A;  3IHB A;  5CTM A;  2ZJ9 A;  1LLB A;  4BD0 A;  1YMX A;  4Y0T A;  1PWD A;  4PM6 A;  5EVL A;  4U3T A;  4IVK A;  1LI9 A;  4GDN A;  1MWT A;  4YIN A;  3GTC A;  1L0E A;  3IF5 A;  2WKE A;  2Y55 A;  4ZAM A;  3P98 A;  3OPP A;  3VMA A;  3CJM A;  4OOY A;  4A5R A;  1O7E A;  3O86 A;  3LCE A;  1KGE A;  1FOF A;  3HUO A;  3BEC A;  3P09 A;  5DTT A;  4OQG A;  5A91 A;  4X53 A;  2HP6 A;  1L0F A;  2A3U A;  4LEN A;  1KVL A;  1K56 A;  1JTD A;  1M40 A;  5CXW A;  3VFH A;  5FAO A;  2GDN A;  2ZQA A;  4RVA A;  5BOH A;  4NK3 A;  1GA9 A;  2JE5 A;  5CGS A;  5KMW A;  1RP5 A;  1ERO A;  1HTZ A;  4OP8 A;  1YLZ A;  3FZC A;  1K54 A;  4OLG A;  3MXR A;  3SS3 A;  3VP1 A;  1U60 A;  1NZU A;  4WMC D;  2WZX A;  3MBZ A;  5CHU A;  3MKF A;  1IYS A;  4UA6 A;  1ERM A;  3BLS A;  4JXG A;  5DTK A;  2WKH A;  4KQO A;  1KDS A;  1K6S A;  2OLU A;  1YLW A;  4ID4 A;  4S2L A;  5J8X A;  4N9L A;  1PYY A;  2V1Z A;  3S4X A;  5E2G A;  2ZM8 A;  4N1X A;  5CGW A;  5GHY A;  1GHM A;  4JF6 A;  1WYB A;  1BLS A;  3A3I A;  4KQR A;  1VM1 A;  4RA7 A;  2J8Y A;  1LI0 A;  1ZG4 A;  4WEJ A;  1KE3 A;  3A3E A;  2QZ6 A;  2XEP A;  1FQG A;  2HDQ A;  2RCX A;  4KG6 A;  5FDH A;  1YLP A;  1GA0 A;  1BLC A;  4IBR A;  5CHM A;  3GSG A;  5FQI A;  4EWF A;  1S0W A;  2Q9N A;  3ZG0 A;  1XX2 A;  2Y2J A;  3HLC A;  2CC1 A;  3WS1 A;  3HLE A;  2G2W A;  2Y2P A;  4GB7 A;  2IWD A;  2V2F F;  2JC7 A;  5EEC A;  1ES3 A;  3VP3 A;  4GNU A;  1PZO A;  3NIA A;  4S2K A;  2ZQ8 A;  2ZQD A;  3V39 A;  1BTL A;  4P6B A;  4QU3 A;  4HBU A;  5GLC A;  1ES5 A;  3VSL A;  5AQA A;  2V20 A;  4E3K A;  4OH0 A;  1YMS A;  4XXR A;  5EVI B;  5FAS A;  4UA9 A;  5D3O A;  4X56 A;  3G34 A;  4OON A;  3UDI A;  1CI8 A;  1JWZ A;  4P87 A;  5HX9 A;  5TGF A;  3G2Y A;  3WS4 A;  1SCW A;  1H5X A;  5HW3 A;  4ZJ3 A;  1L0G A;  2HDR A;  4DXC A;  2X71 A;  3VP0 A;  2EX8 A;  2PBY A;  1IYP A;  2C5W B;  5FQK A;  4ZJ1 A;  5F1F A;  1MKI A;  3UY6 A;  3G4P A;  1XA1 A;  3IQA A;  3LEZ A;  1YLJ A;  1DJA A;  4OQI A;  4DE0 A;  2P9V A;  2HP5 A;  2OLV A;  2IWB A;  3NBL A;  4LCM A;  4S2P A;  4DDY A;  4LV0 A;  1H8Z A;  2FFY A;  2Y2K A;  5EOO A;  3M2K A;  4JBF A;  4B88 A;  1C3B A;  5EVI C;  1SHV A;  1K56 D;  3HL9 A;  5EPH A;  1ERQ A;  3AGE A;  3E2K A;  4PPR A;  4PM9 A;  3ZG9 B;  3GMW A;  4XUZ A;  3IWQ A;  3PAE A;  1PI4 A;  2JCH A;  3AGD A;  4QB8 A;  4R4R A;  2Y4A A;  3ZVW A;  1SDN A;  4MNR A;  4D2O A;  2Y2G A;  4DDS A;  1SDE A;  2WUQ A;  3M2J A;  2I72 A;  3NC8 A;  5F82 A;  3IH9 A;  4B4Z A;  2Y2O A;  2DCF A;  3N6I A;  4KZ7 A;  1MPL A;  1FCM A;  2XD5 A;  5FAQ A;  5U47 A;  3IWI A;  3SS5 A;  1DY6 A;  5FQ9 A;  2PU2 A;  1N9B A;  4U0X A;  2VGK A;  3FYZ A;  5FI7 A;  5FAT A;  4FH4 A;  4CPK A;  3ZNT A;  3N8R A;  4LCL A;  1ONH A;  4E3O A;  4IED A;  3ITA A;  3O3V A;  3Q82 A;  2ZC4 B;  2OSU A;  5DF8 A;  4KEN B;  1BT5 A;  2ZC3 B;  1IEL A;  3CG5 A;  5EOE A;  3PBR A;  4X55 A;  5GL9 A;  1BSG A;  3MFD A;  4X68 A;  4E3J A;  3OCN A;  5HAP A;  1IYO A;  2XK1 A;  3CZD A;  3QHY A;  4QD4 A;  4S2I A;  4EUZ A;  4KQQ A;  3Q7V A;  3WRZ A;  4OQ0 A;  1W79 A;  1XA7 A;  2H0T A;  1KGG A;  5DVA A;  1VQQ A;  2X01 A;  2EFX A;  2WGW A;  3SH9 A;  3WS0 A;  4RYE A;  4X69 A;  4KZ3 A;  3D4F A;  2Z2L B;  4DXB A;  1NZO A;  3BRM A;  3CMZ A;  5A93 A;  3IHA A;  2ZQC A;  3NDE A;  5GLA A;  3GRJ A;  5CGX A;  5M19 A;  4BQM A;  4GOG A;  3W4Q A;  1Q2P A;  4GKU A;  3RJU A;  4MEZ A;  3C4O A;  3UN7 A;  4JLF A;  5CTN A;  5FA7 A;  1ZG6 A;  1JTG A;  4F94 A;  1M6K A;  1MY8 A;  4BLM A;  5HFO A;  3IWO A;  1G68 A;  2C6W B;  1Y54 A;  3OPR A;  1KDW A;  3FKV A;  3ZNY A;  3QNB A;  2XFT A;  5EUA A;  3WS2 A;  2JBF A;  3DWZ A;  3HBR A;  1LL5 A;  2Y2I A;  4KZ6 A;  3UDX A;  3MZE A;  1ES2 A;  2HDS A;  3C7U A;  2ZC5 B;  2XDM A;  1AXB A;  2BLS A;  4KZA A;  3UNW A;  4IBX A;  5FQM A;  2WZZ A;  5DTS A;  3PBS A;  4IVI A;  4DE1 A;  1XP4 A;  1NYY A;  2XD1 A;  4YFM A;  2BG1 A;  3BYD A;  3UE1 A;  3HLB A;  3BLM A;  3G30 A;  4HEF A;  4KZB A;  3V50 A;  3WWX A;  5A90 A;  3IF6 B;  2H10 A;  1RCJ A;  3GR2 A;  3ZG7 B;  2J9O A;  4EBN A;  1EI5 A;  1YLT A;  2B5R A;  4E3I A;  3HUN A;  4OPY A;  1IKG A;  1K57 C;  4EBP A;  5E2F A;  3ZVT A;  5E43 A;  4Y7P A;  2R9X A;  5CEB A;  1MWR A;  3PTE A;  1K38 A;  3C4P A;  4BD1 A;  2A49 A;  3MZF A;  4KG5 A;  3JYI A;  1FSW A;  3BFG A;  3MKE A;  3ZGA B;  1CK3 A;  4OPZ A;  3LO7 A;  1H8Y A;  2J7V A;  4MBH A;  3Q1F A;  3ZHH A;  1WE4 A;  1FCO A;  3IT9 A;  4LV2 A;  1ZC2 A;  5HAR A;  3SOI A;  4CJN A;  4DRT A;  5JYO A;  4WZ5 C;  5EVI A;  2Y91 A;  2ZM2 A;  1FSY A;  1I5Q A;  3A3D A;  3PBO A;  3IF6 C;  4JXV A;  4OQH A;  2R9W A;  4B4X A;  2Y2H A;  1LHY A;  4WM9 A;  4PM8 A;  4GD6 A;  4UAA A;  5AQ9 A;  1GHP A;  1YQS A;  5F1G A;  3G31 A;  3I7J A;  1FR6 A;  4MBK A;  3OZH A;  1E3U A;  2RL3 A;  1W5D A;  5KSC A;  4N92 A;  4HES A;  1NYM A;  3UPN A;  1MXO A;  4GD8 A;  1K55 C;  3BFE A;  3IXB A;  3NI9 A;  3M6H A;  1IEM A;  3QNC A;  4K0W A;  4E6X A;  4ZDX A;  4S2M A;  4E6W A;  2DNS A;  1E25 A;  4L0L A;  2P74 A;  1W8Y A;  1CEF A;  1PW1 A;  4QJG A;  4ZBE A;  1ONG A;  4S2N C;  3Q07 A;  3ZG8 B;  4BL3 A;  4FCF A;  4FD8 A;  2XH9 A;  4KZ8 A;  3V5M A;  3ISG A;  5CED A;  4R3B A;  3SH8 A;  1TDL A;  2H5S A;  3O87 A;  2ZC7 A;  1CEG A;  4OLD A;  1BLP A;  4KG2 A;  2WK0 A;  3C7V A;  1MWU A;  2QMI A;  3DWK A;  4P85 A;  5A92 A;  4LV1 A;  3E2L A;  5GLB A;  3VOZ A;  1WYC A;  3W4P A;  3PBT A;  1O07 A;  3M6B A;  4RX3 A;  5M18 A;  2ZD8 A;  3IXD A;  2EX6 A;  1IKI A;  3V3S A;  1NXY A;  1S6R A;  2Y2L A;  3EQV A;  3LY4 A;  4R23 A;  5AQ7 A;  3HLW A;  5IHV A;  3TSG A;  5HL1 A;  3VSK A;  5FI2 A;  4P0M A;  1MBL A;  2WAD A;  1I2S A;  1L2S A;  3FV7 A;  4U0T A;  3SH7 A;  3UPP A;  5CER A;  3N8S A;  2H0Y A;  2WGV A;  3N8L A;  2G2U A;  4ZJ2 A;  3EQU A;  2OV5 A;  5JYP A;  1DJC A;  1QMF A;  1PWG A;  3W4O A;  2IWC A;  1ESI A;  1XPB A;  4E3M A;  3ZCZ A;  1KVM A;  1Z6F A;  2EX9 A;  2Q9M A;  1JWP A;  5EE8 A;  1XGJ A;  2J9P A;  1YT4 A;  2FFF B;  5HAQ A;  1MWS A;  4UA7 A;  4O7D A;  3HLG A;  3FKW A;  4WZ4 A;  5DF9 A;  4BL2 A;  1J9M A;  4H8R A;  4NET A;  4JF5 A;  5KZH A;  5E2H A;  4PM7 A;  1JWV A;  3PAG A;  3IXG A;  5EVI D;  4R0Q A;  3ZDJ A;  4RX2 A;  4S2J A;  2XFS A;  4OOM A;  4BEN A;  3HLD A;  1KE4 A;  3GV9 A;  5AQB A;  3TG9 A;  4N1H A;  4C6Y A;  2XQZ A;  4R1G A;  2ZQ9 A;  2XLN A;  2EX2 A;  5HAI A;  3BFC A;  5CEC A;  2HPB A;  4WEK A;  5G18 A;  3TOI A;  3UE3 A;  1DJB A;  4C3Q A;  4QY6 A;  5F83 A;  1E3U D;  1TVF A;  1QME A;  4OPR A;  1KE0 A;  1ES4 A;  4GZB A;  4R4S A;  1TEM A;  4DE3 A;  3G35 A;  1L0D A;  3HVF A;  3O88 A;  5E2E A;  1LL9 A;  4GN2 A;  1I2W A;  1K54 C;  3DW0 A;  4FSF A;  1ALQ A;  1XXM A;  3V3R A;  1K4E A;  2ZQ7 A;  1K57 A;  1GCE A;  1CI9 A;  2XF3 A;  3B3X A;  1PW8 A;  4K91 A;  4Y0U A;  5FAP A;  4Z9Q A;  2ZLY A;  3HLF A;  4EV4 A;  3VP4 A;  1E4D A;  2Y59 A;  2Y2N A;  4S2O A;  3OPL A;  3MXS A;  4Y0O A;  1PZP A;  2UWX A;  1FR1 A;  3UO9 A;  2XGN A;  3OPH A;  3NCK A;  4JF4 A;  5CRF A;  1W8Q A;  4FH2 A;  5DF7 A;  4MBF A;  3WS5 A;  3MZD A;  4EQI A;  4X6T A;  3VP2 A;  3BFD A;  1YM1 A;  3A3J A;  1NRF A;  3LY3 A;  1Q2Q A;  4LV3 A;  4WZ5 A;  1BZA A;  2EXB A;  1K6R A;  3IF6 A;  3AGF A;  3ZFZ A;  1FCN A;  1XGI A;  1PIO A;  4HBT A; 
#chains in the Genus database with same CATH topology
 1WA9 A;  1GHI A;  4EW7 A;  3N7W A;  4PM5 A;  1RGY A;  1P9R A;  4ZTK A;  1N9L A;  5FI6 A;  2WAE A;  3Q81 A;  4WBG A;  3UE6 A;  4UEY A;  3OC2 A;  2ZMA A;  4WMC A;  3DTM A;  2L4R A;  3IXH A;  5GHX A;  3G2Z A;  4UHU A;  1K25 A;  1NY0 A;  4N9K A;  5GLD A;  4JPM A;  5I94 A;  3BFF A;  1OME A;  4KZ9 A;  2HDU A;  2EFU A;  2Z2M B;  3BM6 A;  3UE0 A;  4NXG A;  1JVJ A;  3PHY A;  1NJ4 A;  4JXS A;  4OPQ A;  3NHQ A;  1H0M A;  1T18 A;  3G32 A;  3LIF A;  2EWW A;  2XR0 A;  3HUM A;  1PI5 A;  4DMZ A;  5KSH A;  4C75 A;  1W7F A;  2R78 A;  3NY4 A;  1ZKJ A;  3GVB A;  2ZL1 A;  3IH8 A;  4BJP A;  4QHC A;  5TFQ A;  4OOL A;  4H6J A;  1L3L A;  5FQQ A;  2WGW B;  2J3W A;  3A0V A;  1PWD A;  3JPU A;  1X0O A;  2WKE A;  1UWP X;  4NG2 A;  3O86 A;  2V1A A;  4OQG A;  1S1Z A;  4X53 A;  1KVL A;  1Y4O A;  3QP1 A;  5CXW A;  3VFH A;  2GDN A;  2ZQA A;  1F9I A;  4HH3 A;  5KMW A;  2P7J A;  3R4K A;  1RP5 A;  4OP8 A;  3FZC A;  3T12 B;  4MCW A;  1U60 A;  1NZU A;  4BMW A;  1CQA A;  3ULF A;  2WKH A;  4ID4 A;  3B42 A;  5DKK A;  4HOI A;  4N9L A;  3S4X A;  4HJ3 A;  4N1X A;  1WYB A;  4KQR A;  4RA7 A;  1ZG4 A;  3F1O B;  2QZ6 A;  5FDH A;  1P97 A;  5HD5 A;  1GA0 A;  4IBR A;  3GSG A;  1MC0 A;  4EWF A;  3ZG0 A;  3HLC A;  3BWL A;  3K3C A;  5EEC A;  4Y2F A;  1MZU A;  2ZQ8 A;  4LGW A;  5GLC A;  2V20 A;  4OH0 A;  2HGV A;  4HH2 A;  5FAS A;  4OON A;  3WS4 A;  1SCW A;  5HW3 A;  4ZJ3 A;  2EX8 A;  2PBY A;  3LR4 A;  3T1S A;  4UQI M;  5FQK A;  5F1F A;  3UY6 A;  5AJG A;  1XA1 A;  3LEZ A;  1DJA A;  2VV6 A;  3L9K A;  2OLV A;  3BQA A;  4LV0 A;  1SZV A;  5EPH A;  3T1R A;  1ERQ A;  1TD5 A;  4PPR A;  1OJ5 A;  3GMW A;  3NOP C;  3UB8 A;  4R4R A;  1SDN A;  4D2O A;  1LSV A;  2Y2G A;  1SDE A;  2WUQ A;  4B4Z A;  2I72 A;  3IH9 A;  2Y2O A;  2WKP A;  1FCM A;  5FAQ A;  5U47 A;  4R3A A;  4NXB A;  2VGK A;  3FYZ A;  4FH4 A;  1ONH A;  4IED A;  3ITA A;  3Q82 A;  2ZC4 B;  1BT5 A;  2ZC3 B;  5EOE A;  3PBR A;  4X55 A;  5K5B A;  1BSG A;  4E3J A;  4X68 A;  4KQQ A;  4PAU A;  1XA7 A;  5DVA A;  3SH9 A;  2WGW A;  4RYE A;  3CHW P;  4KZ3 A;  4ETZ A;  2VX8 A;  4FTX A;  5CGX A;  2GX5 A;  4GKU A;  1S1Y A;  3IS2 B;  5F6A A;  1MY8 A;  4BLM A;  3IWO A;  2JKT M;  4HQA A;  4LLO B;  3H82 B;  3FG8 A;  3DAV A;  4LRZ E;  4HHD A;  3WS2 A;  3DWZ A;  3HBR A;  2XRO A;  4IBX A;  1OJG A;  2A24 B;  1XP4 A;  4MMN A;  2O0Y A;  2XD1 A;  4YFM A;  3C2W A;  2BG1 A;  4EU0 A;  3BLM A;  3CPT A;  3G30 A;  3WWX A;  4EBN A;  1YLT A;  4RQ9 A;  4EBP A;  4JGO A;  1K38 A;  3MZF A;  3BFG A;  5HDS A;  1H8Y A;  4MBH A;  4MDZ A;  1Y28 A;  1WE4 A;  3BW6 A;  2PYR A;  3IT9 A;  5HAR A;  4CJN A;  5JYO A;  2ZM2 A;  1I5Q A;  4JXV A;  4B4X A;  4PM8 A;  4UAA A;  2O9A A;  4XT2 A;  1FR6 A;  4HY8 A;  4MBK A;  2RL3 A;  2Q0O A;  4GD8 A;  1K55 C;  4E6X A;  4L0L A;  4QJG A;  1CEF A;  4S2N C;  1ONG A;  3Q07 A;  4BL3 A;  1DP6 A;  2B95 A;  5HWV A;  4FD8 A;  3LI9 A;  4ZRR A;  1NLZ A;  1CEG A;  1T1A A;  2DMW A;  4KG2 A;  3IBR A;  2VV7 A;  1WYC A;  3W4P A;  3PBT A;  3FC7 A;  3HJK A;  2EX6 A;  1IKI A;  5F68 A;  5AQ7 A;  5FI2 A;  2W3D A;  2WAD A;  3N8S A;  2H0Y A;  3N8L A;  2G2U A;  2OV5 A;  1QMF A;  4E3M A;  4L9E A;  1KVM A;  2EX9 A;  1XGJ A;  2FFF B;  2V9A A;  2M7U A;  2D01 A;  2PAV P;  4L9G A;  4UA7 A;  4WZ4 A;  5DF9 A;  3PAG A;  3IXG A;  3ZDJ A;  4MN5 A;  4C6Y A;  3LYX A;  2W1T A;  2XQZ A;  1OT6 A;  2VJW A;  2XLN A;  5HAI A;  3TOI A;  3IS2 A;  4PKY A;  1QME A;  1KE0 A;  4GZB A;  3E0Y A;  4R4S A;  1L0D A;  4FSF A;  1K54 C;  3H82 A;  2HF6 A;  2OAQ 1;  2ZQ7 A;  1PW8 A;  1E4D A;  2Y2N A;  4G3V A;  3OPL A;  3F1P B;  5KIZ A;  4ARZ A;  5J3W A;  2A24 A;  5DF7 A;  4X6T A;  1NRF A;  2IA2 A;  1BZA A;  3LUQ A;  5C5K A;  2VZW A;  3AGF A;  1PIO A;  5CHJ A;  4EBL A;  4QY5 A;  2Y2Q A;  2ZC6 B;  1IYQ A;  2Y2M A;  4XUX A;  1A0K A;  3E98 A;  5AVF A;  4WL9 A;  4DE2 A;  3T4T A;  3S22 A;  1K55 A;  2MJ6 A;  2XRN A;  3ITB A;  2EXA A;  3PBN A;  3OBF A;  3IX8 A;  2FH5 A;  3C5A A;  2E8I A;  4S2N A;  1TDG A;  1BUL A;  1KGF A;  4WYY A;  3RXW A;  2L1M A;  1N4O A;  1RGZ A;  5FSR A;  4LRY C;  5TR7 A;  2LB5 A;  2WYX A;  4PHT A;  5DJU A;  2X02 A;  1ZTU A;  2QJ7 A;  2QPN A;  1OTB A;  4WEL A;  4KZ4 A;  3QP5 A;  2O9C A;  3TW8 A;  1LSW A;  1BUE A;  4DJ2 A;  5GHZ A;  3CWF A;  4EXO A;  1HVB A;  3VFF A;  3OCL A;  1EW0 A;  2HP9 A;  4K0X A;  4GS9 B;  1LLB A;  4BD0 A;  2ZOI A;  3UB5 P;  4Y5F A;  1T1C A;  4U3T A;  2QWS A;  4YIN A;  3GTC A;  1L0E A;  3IF5 A;  4G3K A;  2Y55 A;  1O7E A;  2HJE A;  5DTT A;  3BEC A;  2A3U A;  3P01 A;  5FAO A;  4RVA A;  5BOH A;  3KSH A;  1GA9 A;  2JE5 A;  3LFV A;  1HTZ A;  4F3L B;  1K54 A;  1VB6 A;  4UA6 A;  1ERM A;  2OLU A;  3T1X A;  5J8X A;  1PYY A;  5E2G A;  3JVV A;  5GHY A;  1GHM A;  4JF6 A;  3MJQ A;  2J8Y A;  4WEJ A;  3A3E A;  4WN5 A;  2RCX A;  5CHM A;  5FQI A;  4LPZ A;  1S0W A;  3WS1 A;  4GHI B;  2Y2P A;  4GB7 A;  2JC7 A;  4GNU A;  1PZO A;  3NIA A;  3V39 A;  4P6B A;  3F1P A;  4HBU A;  3VSL A;  5AQA A;  3KYZ A;  1YMS A;  1XJ2 A;  1JWZ A;  1S4S A;  2HDR A;  4DXC A;  2X71 A;  3VP0 A;  1TS6 A;  2VGL M;  1YLJ A;  4BBU A;  2HP5 A;  2CMN A;  2K31 A;  2IWB A;  4LCM A;  5HWW A;  1H8Z A;  2A2L A;  3M2K A;  5EOO A;  4JBF A;  1SHV A;  1K56 D;  4HP4 A;  4XUZ A;  3IWQ A;  1PI4 A;  2JCH A;  1CF0 A;  3M2J A;  5F82 A;  4KZ7 A;  2J3T C;  3IWI A;  3SS5 A;  4CPK A;  5F5Y A;  4R38 A;  2OSU A;  2HJ9 C;  5GL9 A;  2QHK A;  4QD4 A;  4S2I A;  4EUZ A;  1W79 A;  2H0T A;  1KGG A;  4X69 A;  1V9Z A;  3D4F A;  4GS9 A;  3F1N B;  1NZO A;  5A93 A;  3LR3 A;  3IHA A;  4O01 A;  5GLA A;  3GRJ A;  1S66 L;  4BQM A;  1YSQ A;  4GOG A;  3O5Y A;  1H8M A;  4NXE A;  3PR6 A;  1DP9 A;  3KYE A;  4FUW A;  4F94 A;  1M6K A;  5HFO A;  3S7N A;  3OPR A;  4L9F A;  3FKV A;  4JGQ A;  3CPT B;  2XFT A;  3H7W B;  5EUA A;  4F3L A;  4HI4 A;  4KZ6 A;  1ES2 A;  2HDS A;  3LR5 A;  2XDM A;  5EM0 A;  4I3I A;  3PBS A;  1AWI A;  3UE1 A;  1P0Z A;  4KZB A;  3V50 A;  5A90 A;  5G4Y A;  4HIA A;  3GR2 A;  3ZG7 B;  4MN7 A;  3MQ0 A;  2B5R A;  3HUN A;  4OPY A;  1K57 C;  1OTA A;  3ZVT A;  5CEB A;  4NEE D;  1MWR A;  4GHI A;  4QPR A;  1XFQ A;  3D72 A;  4XT2 B;  1CJF A;  3LIA A;  2J7V A;  1D06 A;  2PBD P;  3HCY A;  4WZ5 C;  2Y91 A;  1XJ6 A;  5EFW A;  5I5L A;  4OQH A;  4II7 A;  2R9W A;  1LHY A;  4WM9 A;  2K7S A;  2Z6D A;  4QWO A;  3OZH A;  1W5D A;  1NYM A;  2XSS A;  3UPN A;  1MXO A;  4I3A A;  3BFE A;  5L10 A;  1IEM A;  4E6W A;  2DNS A;  5EM1 A;  3EGX C;  2P74 A;  1W8Y A;  1PW1 A;  1VET B;  3ZG8 B;  5G4Z A;  5HWT A;  3V5M A;  4YNR A;  3ISG A;  5CED A;  4R3B A;  2H5S A;  4EUV A;  3O87 A;  2ZC7 A;  4OLD A;  4EQ1 A;  1MWU A;  3DWK A;  3E2L A;  4RX3 A;  1O07 A;  3M6B A;  2KDK A;  1NXY A;  2Y2L A;  3EQV A;  3RTY A;  3VSK A;  3D9Y A;  4P0M A;  5IS1 A;  2H28 A;  3SH7 A;  1KOU A;  2W3H A;  3LID A;  1H3Q A;  1Z6F A;  1NWZ A;  4G3W A;  2Q9M A;  1JWP A;  1MWS A;  2W1T B;  4WF0 A;  3EGD C;  3FKW A;  3F1N A;  3VE3 A;  3LGO A;  4PM7 A;  2GNX A;  2O99 A;  3UME A;  1ODV A;  3TG9 A;  4BWI A;  4R1G A;  2ZQ9 A;  2EX2 A;  3BFC A;  5G18 A;  1DJB A;  1E3U D;  1TVF A;  4ARZ B;  2VGL S;  1ES4 A;  4R6L A;  1TEM A;  1XJ3 A;  2JKR I;  2OWH A;  3O88 A;  3HJI A;  1LL8 A;  3DW0 A;  1K4E A;  3B47 A;  1K57 A;  3H7W A;  2XF3 A;  3B3X A;  4B9O A;  4EV4 A;  2Y59 A;  4S2O A;  3EEH A;  4JGP A;  3T4Q A;  4Y0O A;  3OPH A;  3KSF A;  4JF4 A;  5CRF A;  1W8Q A;  3RH8 B;  3MZD A;  4EQI A;  2W27 A;  1YM1 A;  4LV3 A;  4WZ5 A;  2AVX A;  5IT5 A;  3JVU A;  1K6R A;  2V8C A;  1XGI A;  2V0W A;  3UPO A;  4JXW A;  4Q8I A;  3B33 A;  5FQJ A;  5DKL A;  1G6A A;  1HZO A;  1YLY A;  4E3L A;  3DTE A;  3GQZ A;  4MLL A;  1EWZ A;  2VLG A;  1PWC A;  3BEB A;  1BLH A;  4DJ3 A;  4OP5 A;  1P9W A;  4I5S A;  3W8K A;  4X25 A;  1STZ A;  1DRM A;  3U4L P;  2ZM0 A;  3WRT A;  1PRQ A;  3A3F A;  1G5U A;  1SKF A;  1FIL A;  4R3J A;  3FPV A;  3RXX A;  3VOY A;  1ESU A;  2HZ5 A;  3FWL A;  1OTE A;  4OVD A;  3A0S A;  3CI6 A;  3SS4 A;  1VET A;  2WGI A;  3EEA A;  3DTK A;  3NDG A;  3QP4 A;  4KZ5 A;  3Q7V B;  3S1Y A;  1FIK A;  3ZG5 A;  3GEC A;  3UMD A;  2WAF A;  3N4I A;  5FEF A;  4Y0T A;  4IUK A;  4MN6 A;  4PM6 A;  4IVK A;  2KOI A;  3VE4 A;  3OPP A;  3MSH A;  2QYB A;  3CJM A;  4OOY A;  2LB9 A;  3VMA A;  4A5R A;  1KGE A;  1FOF A;  3HUO A;  3UB7 A;  2HP6 A;  5J4E A;  1K56 A;  1M40 A;  5FL3 A;  5CGS A;  1NLY A;  2VKS A;  1YLZ A;  4OLG A;  3S7P A;  3SS3 A;  3VP1 A;  5CHU A;  2WZX A;  3MBZ A;  2J3T D;  1IYS A;  5DTK A;  4EES A;  4KQO A;  3MXQ A;  3K2N A;  1KDS A;  1YLW A;  4S2L A;  2G7U A;  2ZM8 A;  4ESP A;  1BLS A;  1VM1 A;  2XEP A;  1LT0 A;  4EET B;  2Q9N A;  1XX2 A;  1OTD A;  2CC1 A;  2G2W A;  2YKH A;  5HZH A;  1ES3 A;  2ZQD A;  1BTL A;  1ES5 A;  4XXR A;  4WUJ A;  4UA9 A;  5HDD A;  3UDI A;  3LIE A;  4P87 A;  1F5M A;  5L8M A;  5TGF A;  5HPI A;  4Y15 A;  1L0G A;  2I9V A;  1UGU A;  1MKI A;  3NBL A;  4S2P A;  4DDY A;  3NUL A;  2FFY A;  2Y2K A;  4B88 A;  1C3B A;  5EVE A;  1DP8 A;  3E2K A;  5FDS A;  5MC7 A;  3AGD A;  2Y4A A;  3SW1 A;  3ZVW A;  4MNR A;  4DDS A;  2DCF A;  1Z09 A;  3T1Q B;  1OTI A;  4U0X A;  1N9B A;  4CLC D;  5FAT A;  3N8R A;  3C8C A;  5TJJ A;  4LCL A;  4HJ4 A;  5L09 A;  3MFX A;  1IEL A;  2PR6 A;  3T4S A;  4GJ4 A;  3MFD A;  5LBR A;  1IFQ A;  3OCN A;  1IYO A;  5HAP A;  3QHY A;  3Q7V A;  3WRZ A;  4CQH A;  3P7N A;  2EFX A;  2PYP A;  1T19 A;  2Z2L B;  4DXB A;  3T50 A;  3NDE A;  5M19 A;  2OOL A;  3EOI A;  4O0P A;  1Q2P A;  4MEZ A;  3C4O A;  2JKR M;  5CTN A;  1ZG6 A;  1PNE A;  1D1J A;  1GSV A;  1JTG A;  3FPW A;  3GDI A;  2HV1 A;  3PXP A;  4GLQ A;  1KDW A;  3ZNY A;  4NKP A;  2JBF A;  3UDX A;  3MZE A;  1AXB A;  2BLS A;  4KZA A;  3S7O A;  3UNW A;  5FQM A;  3LR0 A;  3T4K A;  4DE1 A;  2B02 A;  4KUK A;  3IF6 B;  2H10 A;  1RCJ A;  3PYP A;  4CLC E;  1EI5 A;  2E8J A;  5E2F A;  4Y7P A;  3EWK A;  3VV4 A;  3PTE A;  3C4P A;  4KG5 A;  2J80 A;  3JYI A;  1FSW A;  3MKE A;  4OPZ A;  2V0U A;  3ZHH A;  1ZHH B;  3Q1F A;  1FCO A;  3CIT A;  1FSY A;  3PBO A;  3IF6 C;  1F2K A;  3G31 A;  4LRX C;  2VA0 A;  1VHM A;  1E3U A;  1YKD A;  4HES A;  1HLU P;  4IJG A;  3IXB A;  3NI9 A;  3QNC A;  4ZDX A;  2INW A;  4S2M A;  4YWZ A;  2W3G A;  2W0N A;  4FCF A;  2V1B A;  3SH8 A;  1TDL A;  1YPR A;  2JKG A;  2Y79 A;  3BJN A;  1BLP A;  2WK0 A;  4R70 A;  5A92 A;  4LV1 A;  2WKQ A;  3MMH A;  3CUE C;  3R7W B;  2QJ5 A;  2ZD8 A;  3V3S A;  3LEQ A;  1S6R A;  4R23 A;  5HL1 A;  5IHV A;  3C30 A;  3FV7 A;  4Q0J A;  5CER A;  4ZJ2 A;  3EQU A;  2ACG A;  5JYP A;  1DJC A;  1PWG A;  2BAS A;  5DFY A;  3W4O A;  4HJ6 A;  3W2Z A;  4Y13 A;  3A0R A;  5FEG A;  4I3J A;  3VOL A;  5EE8 A;  2J9P A;  1YT4 A;  4EER A;  4O7D A;  4BL2 A;  4NET A;  2QKP A;  4JF5 A;  1IOU A;  5KZH A;  5E2H A;  2ZMV A;  1JWV A;  4CLC B;  5EVI D;  2ZBB A;  2XA7 S;  4S2J A;  4OOM A;  3HLD A;  5AQB A;  3GV9 A;  3QP6 A;  5IU1 A;  2GJ3 A;  5E2E A;  2V8F A;  3HVF A;  4GN2 A;  3V3R A;  3ICY A;  1GCE A;  1CI9 A;  3LIC A;  3D3O A;  2W3E A;  5HL6 A;  2ZLY A;  4CLC C;  3VP4 A;  3MXS A;  1PZP A;  3UO9 A;  2XGN A;  3NCK A;  4FH2 A;  4MBF A;  3KSI A;  3NJA A;  3E4P A;  3LY3 A;  3IF6 A;  1FCN A;  2JKF A;  1YAX A;  4HBT A;  5HSQ A;  2M7V A;  1J3W A;  1YSP A;  4GW9 A;  3KSG A;  1HD8 A;  2P9V B;  2Z6C A;  3HRE A;  2VGJ A;  1XKZ A;  3NOT C;  2BTF P;  1JNU A;  3Q7Z A;  4OKP A;  4LFU A;  4DKI A;  2WKI A;  3QP2 A;  3ZQ5 A;  2PHY A;  2KX6 A;  3UDF A;  1K4F A;  4E04 A;  3LIB A;  4E3N A;  5L2F A;  4P6Z M;  4GDB A;  5EV0 A;  2DRW A;  3CUE A;  2Y8H A;  4X1L A;  2PU4 A;  4DF6 A;  3MS6 A;  5HPF A;  1G28 A;  5CX7 A;  4BBV A;  3PBQ A;  2VEA A;  4M3K A;  2PR5 A;  4JKT A;  2EA9 A;  5M1A A;  3KX0 X;  1XJ4 A;  4PMA A;  3IHB A;  5CTM A;  2ZJ9 A;  1YMX A;  3R7W A;  4FOF A;  4DN0 A;  5EVL A;  1VEU B;  1GSX A;  1LI9 A;  4GDN A;  1MWT A;  1XFN A;  2OWJ A;  4ZAM A;  3P98 A;  3LCE A;  5A91 A;  3P09 A;  1PFL A;  1L0F A;  3V67 A;  4LEN A;  3T4O A;  1JTD A;  2O9B A;  3TE8 A;  4NK3 A;  2M1C A;  1GSW A;  2ZOH A;  1S67 L;  1ERO A;  3MXR A;  4WMC D;  3IBJ A;  3MKF A;  3BLS A;  4JXG A;  4ME4 A;  4CLC A;  1K6S A;  4I39 A;  4O8G A;  3E4Q A;  2V1Z A;  5CGW A;  2EWV A;  3A3I A;  3BY9 A;  1LI0 A;  4X1M A;  2ZMF A;  1KE3 A;  3RFB A;  4KG6 A;  1G6O A;  1FQG A;  2HDQ A;  1YLP A;  1TS8 A;  1BLC A;  2Y2J A;  3IX4 A;  3HLE A;  4AFI A;  2IWD A;  2V2F F;  5DFX A;  3VP3 A;  3OLO A;  4Y3I A;  4S2K A;  2PDR A;  3F1O A;  4QU3 A;  4E3K A;  5EVI B;  5D3O A;  4X56 A;  2JHE A;  3G34 A;  1CI8 A;  5HX9 A;  3G2Y A;  5L07 A;  1H5X A;  1IYP A;  3MF0 A;  2C5W B;  4ZJ1 A;  3G4P A;  3IQA A;  4DE0 A;  4OQI A;  4I38 A;  2P9V A;  1BYW A;  4M4X A;  2K2N A;  3NOU C;  5EVI C;  3HL9 A;  3AGE A;  1TS0 A;  2NUT C;  4PM9 A;  3ZG9 B;  1W63 M;  3PAE A;  4QB8 A;  3NC8 A;  4EEU A;  2PD7 A;  3N6I A;  1MPL A;  2XD5 A;  3CLO A;  1DY6 A;  5FQ9 A;  2PU2 A;  5FI7 A;  4HP9 A;  2WKR A;  3IX3 A;  3ZNT A;  1MKM A;  3E4O A;  5HD3 A;  4E3O A;  1UWN X;  1TF1 A;  3O3V A;  3T4J A;  5DF8 A;  4KEN B;  3T4L A;  2PRF A;  3CG5 A;  2VV8 A;  3MQO A;  4ETX A;  2XK1 A;  3CZD A;  4OQ0 A;  2X01 A;  1VQQ A;  3U2A A;  3WS0 A;  5TBM B;  3BRM A;  3CMZ A;  1VEU A;  2ZQC A;  5DJT A;  3W4Q A;  4EEP A;  3RJU A;  3UN7 A;  4JLF A;  5AVE A;  5FA7 A;  2GZA A;  5J7E A;  2W1R A;  4IHQ A;  2YKF A;  1G68 A;  1SKO B;  2C6W B;  1Y54 A;  1S4R A;  2W3F A;  3KO6 A;  3QNB A;  4Y17 A;  1LL5 A;  2Y2I A;  3C7U A;  2ZC5 B;  4UQI S;  4B93 A;  2WZZ A;  5DTS A;  4WLA A;  3TRC A;  2D02 A;  4IVI A;  4KUO A;  1NYY A;  3UB9 A;  3BYD A;  3QP8 A;  3HLB A;  4HEF A;  4P6Z S;  1D7E A;  2J9O A;  3MQQ A;  4E3I A;  3TJZ C;  1IKG A;  3H9W A;  5E43 A;  2R9X A;  2XA7 M;  4BD1 A;  2A49 A;  3BQ8 A;  3ZGA B;  1CK3 A;  3LO7 A;  4PKY G;  4GCZ A;  5A8B A;  4LV2 A;  1ZC2 A;  4Z1W A;  3SOI A;  4DRT A;  5EVI A;  2VK3 A;  3UB6 A;  3A3D A;  1T1B A;  2P04 A;  2Y2H A;  4GD6 A;  5AQ9 A;  1GHP A;  1YQS A;  5F1G A;  3I7J A;  1NRJ A;  4YOF A;  2P08 A;  3S7Q A;  5KSC A;  1K0K A;  4N92 A;  2PT7 A;  4K08 A;  3M6H A;  4K0W A;  4HNB A;  1E25 A;  1N9N A;  3OOV A;  3ZYT A;  4ZBE A;  4KQD A;  1TS7 A;  3K3D A;  2XH9 A;  4KZ8 A;  2ZL1 B;  1LSX A;  3L7H A;  2KLI A;  4H6J B;  2B18 A;  3CAX A;  3C7V A;  4P85 A;  2QMI A;  3DBA A;  5GLB A;  3VOZ A;  2OAP 1;  5M18 A;  3IXD A;  1W63 Q;  3LY4 A;  3HLW A;  3TSG A;  1MBL A;  1I2S A;  1L2S A;  4U0T A;  4JGR A;  4NXF A;  3UPP A;  3KYQ A;  2WGV A;  2UV0 E;  2IWC A;  1ESI A;  1XPB A;  3ZCZ A;  1OPX A;  1V9Y A;  5HAQ A;  3HLG A;  1J9M A;  4H8R A;  5TBM A;  3MR0 A;  3SZT A;  4R0Q A;  4RX2 A;  2XFS A;  1ACF A;  3DTI A;  4BEN A;  1KE4 A;  4D60 A;  4N1H A;  2NUP C;  3BY8 A;  4Q0I A;  5F69 A;  5CEC A;  3C38 A;  2HPB A;  4WEK A;  3UE3 A;  4C3Q A;  4QY6 A;  5F83 A;  4OPR A;  4DE3 A;  1SKO A;  3G35 A;  4IUH A;  1LL9 A;  2PD8 A;  1I2W A;  1ALQ A;  1XXM A;  2JKT I;  4K91 A;  4Y0U A;  2L0W A;  5FAP A;  5HDC A;  3LI8 A;  4Z9Q A;  3G6O A;  3HLF A;  4Q0H A;  1N9O A;  2UWX A;  1FR1 A;  1OT9 A;  3NEC A;  3WS5 A;  3VP2 A;  3BFD A;  3A3J A;  1F98 A;  1Q2Q A;  2EXB A;  3ZFZ A;  4BBT A;  2FZ0 A;  2JN7 A; 
#chains in the Genus database with same CATH homology
 1GHI A;  4JXW A;  4Q8I A;  3N7W A;  5CHJ A;  1RGY A;  4PM5 A;  3UPO A;  5FQJ A;  1G6A A;  4EBL A;  4QY5 A;  2Y2Q A;  2ZC6 B;  1IYQ A;  1HZO A;  1YLY A;  4ZTK A;  1HD8 A;  2Y2M A;  4XUX A;  4E3L A;  2P9V B;  3HRE A;  3GQZ A;  4MLL A;  4DE2 A;  5FI6 A;  2VGJ A;  1EWZ A;  1XKZ A;  2WAE A;  1K55 A;  3S22 A;  3Q81 A;  1PWC A;  3BEB A;  4WBG A;  1BLH A;  3ITB A;  3OC2 A;  2ZMA A;  3Q7Z A;  2EXA A;  4OKP A;  3DTM A;  3IXH A;  4WMC A;  5GHX A;  3G2Z A;  3PBN A;  4OP5 A;  3C5A A;  4DKI A;  2E8I A;  2WKI A;  4S2N A;  4UHU A;  3W8K A;  1K25 A;  1NY0 A;  1TDG A;  4N9K A;  5GLD A;  1K4F A;  1BUL A;  1KGF A;  4WYY A;  3UDF A;  3RXW A;  4JPM A;  1N4O A;  5I94 A;  3BFF A;  1OME A;  1RGZ A;  2ZM0 A;  4KZ9 A;  2HDU A;  2EFU A;  5FSR A;  3WRT A;  4E3N A;  2Z2M B;  3BM6 A;  3UE0 A;  5L2F A;  3A3F A;  4GDB A;  1SKF A;  1JVJ A;  5TR7 A;  2DRW A;  1NJ4 A;  2WYX A;  4JXS A;  4OPQ A;  2X02 A;  4R3J A;  3RXX A;  3G32 A;  2PU4 A;  3VOY A;  4DF6 A;  1ESU A;  2XR0 A;  3HUM A;  1PI5 A;  2QPN A;  3FWL A;  4WEL A;  4KZ4 A;  4OVD A;  5KSH A;  3SS4 A;  1W7F A;  4C75 A;  3NY4 A;  1ZKJ A;  3PBQ A;  2WGI A;  3GVB A;  4M3K A;  3IH8 A;  3NDG A;  4BJP A;  1BUE A;  4JKT A;  5M1A A;  4KZ5 A;  4QHC A;  5GHZ A;  5TFQ A;  3Q7V B;  4OOL A;  1HVB A;  3S1Y A;  5FQQ A;  3VFF A;  3ZG5 A;  2WGW B;  3OCL A;  2HP9 A;  4K0X A;  2WAF A;  4PMA A;  3N4I A;  3IHB A;  5CTM A;  2ZJ9 A;  1LLB A;  4BD0 A;  1YMX A;  4Y0T A;  1PWD A;  4PM6 A;  5EVL A;  4U3T A;  4IVK A;  1LI9 A;  4GDN A;  1MWT A;  4YIN A;  3GTC A;  1L0E A;  3IF5 A;  2WKE A;  2Y55 A;  4ZAM A;  3P98 A;  3OPP A;  3VMA A;  3CJM A;  4OOY A;  4A5R A;  1O7E A;  3O86 A;  3LCE A;  1KGE A;  1FOF A;  3HUO A;  3BEC A;  3P09 A;  5DTT A;  4OQG A;  5A91 A;  4X53 A;  2HP6 A;  1L0F A;  2A3U A;  4LEN A;  1KVL A;  1K56 A;  1JTD A;  1M40 A;  5CXW A;  3VFH A;  5FAO A;  2GDN A;  2ZQA A;  4RVA A;  5BOH A;  4NK3 A;  1GA9 A;  2JE5 A;  5CGS A;  5KMW A;  1RP5 A;  1ERO A;  1HTZ A;  4OP8 A;  1YLZ A;  3FZC A;  1K54 A;  4OLG A;  3MXR A;  3SS3 A;  3VP1 A;  1U60 A;  1NZU A;  4WMC D;  2WZX A;  3MBZ A;  5CHU A;  3MKF A;  1IYS A;  4UA6 A;  1ERM A;  3BLS A;  4JXG A;  5DTK A;  2WKH A;  4KQO A;  1KDS A;  1K6S A;  2OLU A;  1YLW A;  4ID4 A;  4S2L A;  5J8X A;  4N9L A;  1PYY A;  2V1Z A;  3S4X A;  5E2G A;  2ZM8 A;  4N1X A;  5CGW A;  5GHY A;  1GHM A;  4JF6 A;  1WYB A;  1BLS A;  3A3I A;  4KQR A;  1VM1 A;  4RA7 A;  2J8Y A;  1LI0 A;  1ZG4 A;  4WEJ A;  1KE3 A;  3A3E A;  2QZ6 A;  2XEP A;  1FQG A;  2HDQ A;  2RCX A;  4KG6 A;  5FDH A;  1YLP A;  1GA0 A;  1BLC A;  4IBR A;  5CHM A;  3GSG A;  5FQI A;  4EWF A;  1S0W A;  2Q9N A;  3ZG0 A;  1XX2 A;  2Y2J A;  3HLC A;  2CC1 A;  3WS1 A;  3HLE A;  2G2W A;  2Y2P A;  4GB7 A;  2IWD A;  2V2F F;  2JC7 A;  5EEC A;  1ES3 A;  3VP3 A;  4GNU A;  1PZO A;  3NIA A;  4S2K A;  2ZQ8 A;  2ZQD A;  3V39 A;  1BTL A;  4P6B A;  4QU3 A;  4HBU A;  5GLC A;  1ES5 A;  3VSL A;  5AQA A;  2V20 A;  4E3K A;  4OH0 A;  1YMS A;  4XXR A;  5EVI B;  5FAS A;  4UA9 A;  5D3O A;  4X56 A;  3G34 A;  4OON A;  3UDI A;  1CI8 A;  1JWZ A;  4P87 A;  5HX9 A;  5TGF A;  3G2Y A;  3WS4 A;  1SCW A;  1H5X A;  5HW3 A;  4ZJ3 A;  1L0G A;  2HDR A;  4DXC A;  2X71 A;  3VP0 A;  2EX8 A;  2PBY A;  1IYP A;  2C5W B;  5FQK A;  4ZJ1 A;  5F1F A;  1MKI A;  3UY6 A;  3G4P A;  1XA1 A;  3IQA A;  3LEZ A;  1YLJ A;  1DJA A;  4OQI A;  4DE0 A;  2P9V A;  2HP5 A;  2OLV A;  2IWB A;  3NBL A;  4LCM A;  4S2P A;  4DDY A;  4LV0 A;  1H8Z A;  2FFY A;  2Y2K A;  5EOO A;  3M2K A;  4JBF A;  4B88 A;  1C3B A;  5EVI C;  1SHV A;  1K56 D;  3HL9 A;  5EPH A;  1ERQ A;  3AGE A;  3E2K A;  4PPR A;  4PM9 A;  3ZG9 B;  3GMW A;  4XUZ A;  3IWQ A;  3PAE A;  1PI4 A;  2JCH A;  3AGD A;  4QB8 A;  4R4R A;  2Y4A A;  3ZVW A;  1SDN A;  4MNR A;  4D2O A;  2Y2G A;  4DDS A;  1SDE A;  2WUQ A;  3M2J A;  2I72 A;  3NC8 A;  5F82 A;  3IH9 A;  4B4Z A;  2Y2O A;  2DCF A;  3N6I A;  4KZ7 A;  1MPL A;  1FCM A;  2XD5 A;  5FAQ A;  5U47 A;  3IWI A;  3SS5 A;  1DY6 A;  5FQ9 A;  2PU2 A;  1N9B A;  4U0X A;  2VGK A;  3FYZ A;  5FI7 A;  5FAT A;  4FH4 A;  4CPK A;  3ZNT A;  3N8R A;  4LCL A;  1ONH A;  4E3O A;  4IED A;  3ITA A;  3O3V A;  3Q82 A;  2ZC4 B;  2OSU A;  5DF8 A;  4KEN B;  1BT5 A;  2ZC3 B;  1IEL A;  3CG5 A;  5EOE A;  3PBR A;  4X55 A;  5GL9 A;  1BSG A;  3MFD A;  4X68 A;  4E3J A;  3OCN A;  5HAP A;  1IYO A;  2XK1 A;  3CZD A;  3QHY A;  4QD4 A;  4S2I A;  4EUZ A;  4KQQ A;  3Q7V A;  3WRZ A;  4OQ0 A;  1W79 A;  1XA7 A;  2H0T A;  1KGG A;  5DVA A;  1VQQ A;  2X01 A;  2EFX A;  2WGW A;  3SH9 A;  3WS0 A;  4RYE A;  4X69 A;  4KZ3 A;  3D4F A;  2Z2L B;  4DXB A;  1NZO A;  3BRM A;  3CMZ A;  5A93 A;  3IHA A;  2ZQC A;  3NDE A;  5GLA A;  3GRJ A;  5CGX A;  5M19 A;  4BQM A;  4GOG A;  3W4Q A;  1Q2P A;  4GKU A;  3RJU A;  4MEZ A;  3C4O A;  3UN7 A;  4JLF A;  5CTN A;  5FA7 A;  1ZG6 A;  1JTG A;  4F94 A;  1M6K A;  1MY8 A;  4BLM A;  5HFO A;  3IWO A;  1G68 A;  2C6W B;  1Y54 A;  3OPR A;  1KDW A;  3FKV A;  3ZNY A;  3QNB A;  2XFT A;  5EUA A;  3WS2 A;  2JBF A;  3DWZ A;  3HBR A;  1LL5 A;  2Y2I A;  4KZ6 A;  3UDX A;  3MZE A;  1ES2 A;  2HDS A;  3C7U A;  2ZC5 B;  2XDM A;  1AXB A;  2BLS A;  4KZA A;  3UNW A;  4IBX A;  5FQM A;  2WZZ A;  5DTS A;  3PBS A;  4IVI A;  4DE1 A;  1XP4 A;  1NYY A;  2XD1 A;  4YFM A;  2BG1 A;  3BYD A;  3UE1 A;  3HLB A;  3BLM A;  3G30 A;  4HEF A;  4KZB A;  3V50 A;  3WWX A;  5A90 A;  3IF6 B;  2H10 A;  1RCJ A;  3GR2 A;  3ZG7 B;  2J9O A;  4EBN A;  1EI5 A;  1YLT A;  2B5R A;  4E3I A;  3HUN A;  4OPY A;  1IKG A;  1K57 C;  4EBP A;  5E2F A;  3ZVT A;  5E43 A;  4Y7P A;  2R9X A;  5CEB A;  1MWR A;  3PTE A;  1K38 A;  3C4P A;  4BD1 A;  2A49 A;  3MZF A;  4KG5 A;  3JYI A;  1FSW A;  3BFG A;  3MKE A;  3ZGA B;  1CK3 A;  4OPZ A;  3LO7 A;  1H8Y A;  2J7V A;  4MBH A;  3Q1F A;  3ZHH A;  1WE4 A;  1FCO A;  3IT9 A;  4LV2 A;  1ZC2 A;  5HAR A;  3SOI A;  4CJN A;  4DRT A;  5JYO A;  4WZ5 C;  5EVI A;  2Y91 A;  2ZM2 A;  1FSY A;  1I5Q A;  3A3D A;  3PBO A;  3IF6 C;  4JXV A;  4OQH A;  2R9W A;  4B4X A;  2Y2H A;  1LHY A;  4WM9 A;  4PM8 A;  4GD6 A;  4UAA A;  5AQ9 A;  1GHP A;  1YQS A;  5F1G A;  3G31 A;  3I7J A;  1FR6 A;  4MBK A;  3OZH A;  1E3U A;  2RL3 A;  1W5D A;  5KSC A;  4N92 A;  4HES A;  1NYM A;  3UPN A;  1MXO A;  4GD8 A;  1K55 C;  3BFE A;  3IXB A;  3NI9 A;  3M6H A;  1IEM A;  3QNC A;  4K0W A;  4E6X A;  4ZDX A;  4S2M A;  4E6W A;  2DNS A;  1E25 A;  4L0L A;  2P74 A;  1W8Y A;  1CEF A;  1PW1 A;  4QJG A;  4ZBE A;  1ONG A;  4S2N C;  3Q07 A;  3ZG8 B;  4BL3 A;  4FCF A;  4FD8 A;  2XH9 A;  4KZ8 A;  3V5M A;  3ISG A;  5CED A;  4R3B A;  3SH8 A;  1TDL A;  2H5S A;  3O87 A;  2ZC7 A;  1CEG A;  4OLD A;  1BLP A;  4KG2 A;  2WK0 A;  3C7V A;  1MWU A;  2QMI A;  3DWK A;  4P85 A;  5A92 A;  4LV1 A;  3E2L A;  5GLB A;  3VOZ A;  1WYC A;  3W4P A;  3PBT A;  1O07 A;  3M6B A;  4RX3 A;  5M18 A;  2ZD8 A;  3IXD A;  2EX6 A;  1IKI A;  3V3S A;  1NXY A;  1S6R A;  2Y2L A;  3EQV A;  3LY4 A;  4R23 A;  5AQ7 A;  3HLW A;  5IHV A;  3TSG A;  5HL1 A;  3VSK A;  5FI2 A;  4P0M A;  1MBL A;  2WAD A;  1I2S A;  1L2S A;  3FV7 A;  4U0T A;  3SH7 A;  3UPP A;  5CER A;  3N8S A;  2H0Y A;  2WGV A;  3N8L A;  2G2U A;  4ZJ2 A;  3EQU A;  2OV5 A;  5JYP A;  1DJC A;  1QMF A;  1PWG A;  3W4O A;  2IWC A;  1ESI A;  1XPB A;  4E3M A;  3ZCZ A;  1KVM A;  1Z6F A;  2EX9 A;  2Q9M A;  1JWP A;  5EE8 A;  1XGJ A;  2J9P A;  1YT4 A;  2FFF B;  5HAQ A;  1MWS A;  4UA7 A;  4O7D A;  3HLG A;  3FKW A;  4WZ4 A;  5DF9 A;  4BL2 A;  1J9M A;  4H8R A;  4NET A;  4JF5 A;  5KZH A;  5E2H A;  4PM7 A;  1JWV A;  3PAG A;  3IXG A;  5EVI D;  4R0Q A;  3ZDJ A;  4RX2 A;  4S2J A;  2XFS A;  4OOM A;  4BEN A;  3HLD A;  1KE4 A;  3GV9 A;  5AQB A;  3TG9 A;  4N1H A;  4C6Y A;  2XQZ A;  4R1G A;  2ZQ9 A;  2XLN A;  2EX2 A;  5HAI A;  3BFC A;  5CEC A;  2HPB A;  4WEK A;  5G18 A;  3TOI A;  3UE3 A;  1DJB A;  4C3Q A;  4QY6 A;  5F83 A;  1E3U D;  1TVF A;  1QME A;  4OPR A;  1KE0 A;  1ES4 A;  4GZB A;  4R4S A;  1TEM A;  4DE3 A;  3G35 A;  1L0D A;  3HVF A;  3O88 A;  5E2E A;  1LL9 A;  4GN2 A;  1I2W A;  1K54 C;  3DW0 A;  4FSF A;  1ALQ A;  1XXM A;  3V3R A;  1K4E A;  2ZQ7 A;  1K57 A;  1GCE A;  1CI9 A;  2XF3 A;  3B3X A;  1PW8 A;  4K91 A;  4Y0U A;  5FAP A;  4Z9Q A;  2ZLY A;  3HLF A;  4EV4 A;  3VP4 A;  1E4D A;  2Y59 A;  2Y2N A;  4S2O A;  3OPL A;  3MXS A;  4Y0O A;  1PZP A;  2UWX A;  1FR1 A;  3UO9 A;  2XGN A;  3OPH A;  3NCK A;  4JF4 A;  5CRF A;  1W8Q A;  4FH2 A;  5DF7 A;  4MBF A;  3WS5 A;  3MZD A;  4EQI A;  4X6T A;  3VP2 A;  3BFD A;  1YM1 A;  3A3J A;  1NRF A;  3LY3 A;  1Q2Q A;  4LV3 A;  4WZ5 A;  1BZA A;  2EXB A;  1K6R A;  3IF6 A;  3AGF A;  3ZFZ A;  1FCN A;  1XGI A;  1PIO A;  4HBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...