3IF6B

Crystal structure of oxa-46 beta-lactamase from p. aeruginosa
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
242
structure length
242
Chain Sequence
VVIRSDWKKFFSDLQAEGAIVIADERQAKHTLSVFDQERAAKRYSPASTFKIPHTLFALDADAVRDEFQVFRWDGVNRSFAGHNQDQDLRSAMRNSTVWVYELFAKDIGEDKARRYLKQIDYGNVDPSTIKGDYWIDGNLKISAHEQILFLRKLYRNQLPFKVEHQRLVKDLMITEAGRSWILRAKTGWEGRFGWWVGWIEWPTGPVFFALNIDTPNRTDDLFKREAIARAILRSIDALPPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the narrow-spectrum OXA-46 class D beta-lactamase: relationship between active-site lysine carbamylation and inhibition by polycarboxylates
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords OXA-46 oxacillinase
total genus 70
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3if6B00
2OLVA 3HUOA 1J9MA 2HDRA 2Y4AA 4U0XA 1RP5A 1IYOA 2EX2A 2JC7A 1EWZA 1L0FA 4HBUA 3TSGA 3ISGA 1XP4A 5GHZA 3M2JA 1XA1A 2ZM2A 2DCFA 2OLUA 2WKHA 3O88A 4LENA 4ZJ3A 3VP3A 3IF6B 4DE3A 2ZC7A 1M40A 1TVFA 2R9WA 3PAEA 2H0TA 3SS3A 2WKIA 4ZDXA 2WZZA 3S4XA 2G2UA 3QNCA 3HUNA 2GDNA 3BFCA 3VP0A 1MY8A 1MKIA 1XGIA 1YLTA 2IWDA 3UNWA 2PU4A 4OP8A 3HLCA 3NCKA 4P87A 5DTTA 3GMWA 3O86A 4JLFA 4PM6A 1EI5A 5EUAA 3VP4A 5CTMA 5GLCA 3SS4A 3NC8A 1PI4A 3FV7A 1Z6FA 3PAGA 1BLHA 1O07A 4HEFA 2HDSA 5FQIA 4IEDA 4KZAA 4S2PA 4Y0UA 1L0EA 5CGSA 2EX8A 1PWGA 4JF6A 2RCXA 5CHMA 4EBNA 5KMWA 4B4ZA 1QMFA 1GHPA 4E3NA 2JCHA 4MNRA 1IEMA 3ZFZA 1NXYA 1SHVA 3GTCA 3G4PA 4Y0TA 5FQ9A 3IWIA 3O3VA 3PBNA 5JYOA 4F94A 4GOGA 1KE3A 1K38A 1W7FA 2Q9NA 2XD5A 1I2WA 3G35A 3OC2A 4UA9A 5EOEA 5EECA 4QJGA 4D2OA 1AXBA 2UWXA 3BFFA 5FA7A 1W79A 4CJNA 2I72A 3OCNA 3DTMA 3EQUA 3NI9A 2XD1A 4R0QA 5D3OA 5M19A 4OOYA 1I5QA 3Q7ZA 2WGWB 5CHJA 5HAPA 1YM1A 1IELA 2XF3A 5HAIA 3S22A 1TEMA 4S2MA 1MPLA 3CJMA 4GN2A 2ZMAA 3VFFA 3ITBA 3ZG5A 5DTSA 2XQZA 3C4PA 2WGVA 3OPPA 3C5AA 3TG9A 2EX9A 2H0YA 2A49A 1L0GA 5CGWA 2B5RA 4EUZA 1MWUA 1PIOA 3WS4A 4OPQA 3IH8A 4R4SA 4E3JA 1K57C 1HTZA 1YLWA 2Y59A 3WWXA 4QY6A 4XUXA 5FQQA 4DDSA 1XX2A 4YINA 5TFQA 1CEGA 1LL5A 2ZC5B 3Q7VB 5A90A 1MXOA 2P9VB 3MXRA 3ZVTA 1U60A 1MWRA 4MBKA 4HESA 3MZDA 1HVBA 4OOLA 3OCLA 1H5XA 2EFXA 3NDGA 2FFYA 3GV9A 2ZQ9A 3Q81A 2OV5A 5FI7A 1W8QA 1KDSA 1YMXA 3GR2A 5DF7A 3VSKA 2DRWA 1K25A 3DW0A 2JBFA 3LEZA 4R23A 1K4FA 4OPRA 3IXGA 4BD0A 3O87A 3V50A 1W8YA 1N4OA 1FSYA 3C7UA 1WYBA 3ZNYA 1HD8A 2DNSA 1VQQA 2HPBA 4PMAA 4S2NA 1K55A 1ZG6A 3BFDA 1BSGA 5FI6A 2XH9A 3HL9A 5FI2A 3Q1FA 3A3FA 1RGYA 3G2ZA 4QD4A 4BD1A 4JXSA 5FQJA 3HVFA 3NBLA 1ZG4A 3W8KA 2Y2NA 3AGDA 2X02A 3PBQA 1SKFA 4FSFA 4JXVA 2Q9MA 1RCJA 3V39A 4DE2A 4KZBA 4X55A 4P0MA 4EV4A 3V5MA 3N8SA 4QY5A 3GSGA 4DDYA 5FASA 4BENA 1KE4A 1KGFA 3MBZA 4RVAA 3WS1A 3N7WA 5EE8A 3IWOA 4QB8A 1E4DA 2Y2KA 2WK0A 5M18A 4KZ5A 3BEBA 3IT9A 4KENB 3CG5A 5HARA 4WBGA 2V2FF 2ZD8A 1CK3A 1PI5A 1XXMA 1G6AA 3UPNA 1N9BA 5EVIB 2WKEA 3HLBA 5BOHA 4OH0A 1PW1A 2QMIA 3VP1A 2Y2HA 4NK3A 1K54A 3RJUA 3QNBA 2Y2QA 2QZ6A 2PU2A 2P9VA 3B3XA 4LCMA 3ZVWA 3UDFA 1PWDA 4XXRA 2BG1A 3N8RA 4OOMA 4WZ5A 2Z2MB 2H10A 1GHIA 4X69A 3VOZA 3IXHA 4WEKA 4QHCA 5HX9A 1IKIA 2WZXA 4X53A 3ZG7B 3HLDA 1KVMA 4P6BA 1EROA 4S2IA 3W4QA 1K56D 3PTEA 2HDUA 1K54C 1KDWA 1O7EA 5GL9A 2ZM8A 1BTLA 4XUZA 1WE4A 3W4OA 4FD8A 5DVAA 5HAQA 4ZJ2A 4E3IA 4EQIA 4E6XA 1PW8A 1JTDA 3BYDA 1MBLA 1RGZA 3ZNTA 3C7VA 2Y2OA 1K6SA 2A3UA 1S6RA 2E8IA 2VGJA 2Y2PA 4IBRA 4OQHA 1NRFA 3FWLA 3UDIA 2BLSA 5HW3A 4L0LA 4KZ9A 2ZM0A 2ZC4B 1H8YA 2WGWA 5CRFA 3BFEA 3FKWA 1IKGA 2IWBA 4R4RA 3BLSA 3HLEA 4WYYA 3GVBA 3OPHA 3AGFA 5J8XA 4X6TA 1K56A 4UAAA 4OPYA 2XFSA 3NIAA 4WZ5C 1CI9A 5G18A 3WRTA 5AQAA 3A3DA 4E3LA 5KSCA 1YLZA 4PM9A 1IYQA 1ZC2A 4LCLA 1E25A 4E3KA 4OQIA 3UE0A 2XGNA 4OQGA 1ERMA 2Z2LB 5CGXA 5CEBA 4PM8A 3HLGA 4BJPA 5EOOA 5KZHA 4S2LA 4UA7A 4RYEA 5A91A 4JPMA 4RX3A 1FOFA 1JWVA 4U3TA 3UPOA 2JE5A 4R1GA 3MXSA 4KQRA 4PPRA 3UO9A 1NZOA 1Q2PA 5E2EA 3OPRA 4WMCA 5CERA 3SOIA 3FKVA 4PM5A 4U0TA 4H8RA 1NYMA 5FQMA 5EVLA 3DWZA 1BLCA 5A93A 3GQZA 2X01A 4R3JA 2X71A 4OLDA 4OPZA 5FSRA 4ZBEA 1XA7A 3SH8A 3P98A 4B4XA 3IWQA 4Y7PA 3OZHA 5GLDA 3Q07A 3UE1A 2WYXA 2XK1A 3ZG9B 4YFMA 4MBHA 1BLPA 5FDHA 3A3IA 4EWFA 2P74A 3BFGA 1JTGA 1LL9A 5TR7A 4WZ4A 1JWZA 3NDEA 5GLBA 3Q82A 4ID4A 2ZQDA 3HLFA 5M1AA 1BT5A 4K0XA 1CEFA 1DJCA 1I2SA 5CHUA 5AQBA 4JXGA 4P85A 4JF4A 5CEDA 4OONA 1E3UA 3V3RA 4KZ4A 1HZOA 1G68A 2ZQ8A 4JF5A 2WUQA 4C3QA 5F1FA 3MFDA 1ESUA 3VFHA 3PBOA 4Q8IA 2XLNA 2ZQ7A 1IYPA 1H8ZA 4NETA 3IXBA 1WYCA 5AQ9A 2V1ZA 4N9KA 1PWCA 4DXBA 1MWSA 2Y2JA 1FR6A 4OLGA 2Y2MA 2WAFA 3GRJA 4IVKA 4FCFA 4EBPA 2H5SA 2J9OA 1M6KA 4K91A 4MBFA 5EPHA 1LI0A 2EXAA 3C4OA 4FH4A 4BLMA 2ZJ9A 5I94A 4KG2A 1K55C 1IYSA 4BL2A 1ZKJA 2XR0A 4KZ3A 4N9LA 4DRTA 3FZCA 1GA0A 1Q2QA 3I7JA 4LV2A 4X56A 5E2FA 5AQ7A 3SS5A 2EFUA 1LI9A 5F1GA 1JVJA 5HFOA 4DXCA 2HP6A 5FAOA 1GA9A 4MLLA 1E3UD 3N8LA 4Z9QA 4KG6A 5E2HA 4OQ0A 3N6IA 4DF6A 3A3JA 4GZBA 4WEJA 3ZCZA 3DWKA 4WELA 4PM7A 1QMEA 3ZHHA 4JXWA 1ESIA 3E2LA 4S2KA 1BUEA 3P09A 3VMAA 5HL1A 1XPBA 1XKZA 1KGGA 3Q7VA 3G32A 5CTNA 5TGFA 1KVLA 3IXDA 1YT4A 5EVIA 4GNUA 1BLSA 4IBXA 3NY4A 3HLWA 3VSLA 2Y2LA 1NY0A 1FCMA 3QHYA 4Y0OA 5CECA 2HDQA 3MZEA 2G2WA 1K57A 3RXXA 2C5WB 1ERQA 4GD6A 4EBLA 5EVID 2WAEA 5GHXA 3UPPA 1DJBA 5F82A 3EQVA 3G2YA 1C3BA 5IHVA 1CI8A 3V3SA 1TDGA 3E2KA 1S0WA 2J8YA 2CC1A 4OVDA 3MZFA 4KQOA 3SH9A 3UDXA 4GB7A 1FQGA 4R3BA 3PBSA 3VP2A 2V20A 1ES4A 3LCEA 1NYYA 4KQQA 5CXWA 2XDMA 3IHAA 1L0DA 2EXBA 4UHUA 1YQSA 4ZTKA 4GKUA 3MKEA 1FCOA 3WS0A 1ES2A 3IF6A 1SDNA 1NJ4A 3MKFA 3OPLA 1PZPA 4X68A 4ZAMA 1FCNA 4LV1A 4N1XA 2ZLYA 4JBFA 4UA6A 4S2JA 3WS5A 5F83A 5JYPA 4DKIA 3JYIA 4N1HA 4WM9A 5L2FA 1FSWA 5DF8A 1W5DA 5DF9A 4RA7A 3HREA 1BZAA 4OP5A 3PBRA 4KZ7A 3LY4A 4QU3A 3S1YA 4MEZA 2ZC3B 3UE3A 3ZGAB 1SDEA 2ZQAA 1YLYA 3BLMA 3ZDJA 3M2KA 3CMZA 2RL3A 2IWCA 3N4IA 4LV0A 2OSUA 5FAPA 3UN7A 2ZC6B 4BQMA 1BULA 4IVIA 1MWTA 3SH7A 3M6HA 2PBYA 5FAQA 2FFFB 1Y54A 1XGJA 2Y91A 3VOYA 4GDNA 2VGKA 5GHYA 2Y2IA 5U47A 4JKTA 1ALQA 5KSHA 4C75A 2WADA 2XEPA 1JWPA 2Y2GA 2XFTA 1GHMA 2QPNA 4GDBA 2J9PA 4M3KA 5DTKA 4K0WA 1YLJA 4E3OA 4KZ6A 3BECA 1TDLA 4S2OA 1SCWA 3D4FA 4O7DA 1DJAA 1NZUA 3HUMA 3IHBA 1KE0A 1K6RA 3M6BA 3IF6C 4C6YA 4N92A 2EX6A 3UY6A 1PYYA 3BRMA 4BL3A 5A92A 5FQKA 3PBTA 4HBTA 5GLAA 4LV3A 3IH9A 4RX2A 3RXWA 1LHYA 1YLPA 1L2SA 3LY3A 2ZQCA 1VM1A 4E3MA 4FH2A 4ZJ1A 3FYZA 4WMCD 3G30A 3W4PA 4GD8A 1ONHA 3A3EA 3IF5A 4A5RA 1ES5A 3AGEA 2C6WB 4DE0A 3TOIA 3BM6A 1LLBA 2J7VA 3HBRA 5E2GA 3CZDA 5FATA 1GCEA 4CPKA 1K4EA 3LO7A 3IQAA 2HP5A 4B88A 4KZ8A 4DE1A 1ES3A 1PZOA 1KGEA 4OKPA 1DY6A 5E43A 4S2NC 3ZG0A 4E6WA 4KG5A 1ONGA 2HP9A 2Y55A 1OMEA 3ZG8B 2R9XA 3G31A 3WRZA 1FR1A 3WS2A 3G34A 3ITAA 1YMSA 5EVIC 2WGIA
chains in the Genus database with same CATH superfamily
1GSVA 2Y4AA 2QWSA 1IYOA 2EX2A 2JC7A 3ISGA 2WKHA 2DCFA 2OLUA 3QP2A 2V1AA 1TS8A 1TVFA 2R9WA 2WKIA 1P9RA 2GDNA 3VP0A 3B47A 1YLTA 4E04A 4EEUA 2PU4A 4OP8A 3O86A 4EW7A 1EI5A 5EUAA 5GLCA 1PI4A 1T18A 2I9VA 2HDSA 4IEDA 4KZAA 4S2PA 4Y0UA 4PAUA 1VB6A 4EU0A 5CGSA 3T4JA 4EBNA 3K3DA 4Q0IA 3ULFA 3UMEA 3KO6A 3GTCA 4JGOA 3G4PA 4Y0TA 5JYOA 2Z6DA 1SKOA 1W7FA 3G35A 5EOEA 4Y15A 1AXBA 5FA7A 1W79A 2P08A 5D3OA 5M19A 3NI9A 2WGWB 5HAPA 1YM1A 2XF3A 3PR6A 3G6OA 2NUTC 2ZMAA 1OJ5A 2XQZA 2WGVA 3OPPA 2B18A 3TG9A 4O01A 5TBMA 2B5RA 2E8JA 2GJ3A 3IH8A 2Y59A 4G3KA 3K3CA 2ZC5B 1MXOA 2P9VB 4BBTA 3MZDA 1T1BA 1LSXA 1HVBA 4OOLA 3LI9A 2VJWA 4UEYA 2ZQ9A 5FI7A 1W8QA 1KDSA 2KX6A 3DW0A 4R23A 1D1JA 3EEHA 3IXGA 3V50A 1W8YA 3ZNYA 4MN7A 1VQQA 3F1PB 4S2NA 5FI6A 2XH9A 4YWZA 1RGYA 4Y2FA 5FQJA 2A24A 2X02A 2Q9MA 3V39A 4X55A 2O9AA 3N8SA 1MZUA 1KE4A 4XT2B 3N7WA 3IWOA 2Y2KA 2WK0A 5M18A 3IT9A 3CG5A 3FPWA 5K5BA 4BMWA 1VEUB 2HZ5A 1PW1A 2J80A 3ZVWA 4XXRA 4OOMA 2H10A 3IXHA 4QHCA 2WZXA 3HLDA 1EROA 4S2IA 2Q0OA 3W4QA 1Y4OA 1BYWA 5GL9A 4G3VA 1OTBA 4UQIS 5F6AA 3ZYTA 3BYDA 3EEAA 1RGZA 5MC7A 3JVUA 2ZM0A 5KIZA 1H8YA 3BFEA 1IKGA 2ZMVA 3C2WA 4WYYA 4K08A 1TS7A 1D7EA 1S4SA 3D3OA 5AJGA 5G18A 1YAXA 3A3DA 4E3LA 4PM9A 4LCLA 3CITA 4E3KA 3UE0A 4IHQA 2XGNA 4WL9A 5FDSA 2GX5A 4S2LA 4RYEA 5A91A 5C5KA 4JPMA 4KQRA 1NZOA 5E2EA 3OPRA 4MMNA 3FKVA 4PM5A 3F1OA 5J7EA 1PNEA 1NYMA 3TJZC 1BLCA 5A93A 3GQZA 3H82B 2MJ6A 2XRNA 2PRFA 3Q07A 4NXFA 3U4LP 3ZG9B 1FIKA 1PRQA 2KDKA 4EWFA 3KSHA 2P74A 2QHKA 1JTGA 2ZQDA 5M1AA 1DJCA 5CHUA 4YOFA 4P85A 1LT0A 4JF5A 2WUQA 2W1TA 2O9CA 2ZQ7A 2VV8A 4NETA 5HDDA 1W63M 2V1ZA 4DXBA 3R4KA 1CQAA 2Y2MA 1OTAA 4FCFA 2J9OA 3GECA 3LIFA 4MBFA 2EXAA 3T4SA 3MR0A 3LIBA 5AQ7A 1Q2QA 4LV2A 3R7WB 4NXEA 1LI9A 5F1GA 2W3HA 1YSPA 4DXCA 5L07A 4Z9QA 1UGUA 1V9ZA 4GZBA 3DWKA 4PM7A 4LFUA 1ESIA 4GHIB 4S2KA 1XKZA 3Q7VA 5CTNA 3IXDA 5EVIA 1BLSA 4HIAA 2Y2LA 3QHYA 1FCMA 3K2NA 1K57A 2OWHA 4IUKA 4G3WA 3MFXA 3UPPA 5IHVA 3V3SA 1S0WA 2CC1A 4DJ3A 1L3LA 4KQDA 3UDXA 5L8MA 4R3BA 2V20A 3LCEA 5CXWA 1L0DA 2EXBA 1YQSA 2G7UA 1SDNA 3OPLA 4ZAMA 3NOUC 2ZLYA 4ME4A 4UA6A 5F5YA 3JYIA 4N1HA 3IBJA 3HREA 2W27A 3PBRA 3LY4A 2ZQAA 3ZDJA 3CMZA 2RL3A 4ARZA 2IWCA 1OJGA 4EEPA 3UN7A 2ZC6B 1BULA 3C38A 5FAQA 1XFQA 2L1MA 4YNRA 1Y54A 3BJNA 4GDNA 2Y2IA 5U47A 2PR5A 1GHMA 3BECA 5HL6A 1G5UA 1NZUA 2KOIA 2Y79A 1K6RA 4PHTA 4HH2A 4HBTA 1JNUA 1CF0A 3CWFA 4LV3A 3W2ZA 1LHYA 2ZOHA 1VM1A 4E3MA 2J3TC 4ZJ1A 4WMCD 1OPXA 3G30A 1OT9A 1ONHA 3A3EA 3AGEA 5HWTA 3BM6A 2J7VA 5FATA 1K4EA 5J4EA 3IQAA 4DE1A 1KGEA 5DJTA 5E43A 5J3WA 3F1NB 2HP9A 4H6JB 3G31A 3E4OA 4HBUA 5EVIC 4HHDA 3GRJA 2OLVA 1YPRA 2GZAA 2HDRA 2W3FA 1RP5A 5L10A 5TBMB 4Y3IA 3VE3A 3VP3A 2ZC7A 1M40A 5TJJA 3JVVA 5G4ZA 3PAEA 3SS3A 4ZDXA 2D02A 2G2UA 3QNCA 1IFQA 2IWDA 3NCKA 3MMHA 2M7UA 3VP4A 4Z1WA 3SS4A 4IUHA 3FC7A 3ICYA 1KOUA 5FQIA 1L0EA 2EX8A 5KMWA 4B4ZA 4MNRA 1NXYA 4BWIA 4O8GA 4MN6A 4RQ9A 3BW6A 1TS0A 2Q9NA 2XD5A 1I2WA 3MSHA 3OC2A 5HD5A 4I3JA 2UWXA 4R3AA 3BFFA 2P7JA 3OCNA 4OOYA 1I5QA 3Q7ZA 5CHJA 3MQQA 1IELA 3VFFA 3L9KA 2H0YA 1L0GA 3UB8A 3NULA 4EUZA 1MWUA 3WS4A 2O99A 1YLWA 3WWXA 4QY6A 4XUXA 3RH8B 5TFQA 3EGXC 4BBUA 1MWRA 2FZ0A 1S66L 2WKPA 4HP9A 1H5XA 4GCZA 2FFYA 1NLYA 3Q81A 1OT6A 2OV5A 2LB5A 5DF7A 2JBFA 3T4KA 1HD8A 1K55A 3Q1FA 3G2ZA 4JXSA 3HVFA 3NBLA 4EESA 4JXVA 1SKFA 1RCJA 4EV4A 3PYPA 3GSGA 3H7WA 1F2KA 1H3QA 4RVAA 3CAXA 5EE8A 2VGLS 4QB8A 3L7HA 4KZ5A 2V2FF 1CK3A 1G6AA 3UPNA 1LL8A 3T1RA 2R78A 4OH0A 3VP1A 2INWA 4NK3A 3OLOA 1K54A 4WF0A 3RJUA 3TW8A 2PU2A 4LCMA 3TRCA 4Q0HA 1UWNX 5FEGA 1IKIA 5IU1A 1K56D 4GJ4A 3NOPC 3W4OA 5HWVA 4FD8A 5DVAA 4GS9B 2Y2OA 2A3UA 2E8IA 2Y2PA 4OQHA 2WKQA 3IX8A 4L0LA 4NG2A 3E98A 2VEAA 2ZC4B 5CRFA 3FKWA 1ODVA 3BY9A 3HLEA 2AVXA 3GVBA 3OPHA 3AGFA 1K56A 2XROA 2PAVP 2V0UA 3QP6A 4JGQA 1CI9A 3WRTA 4I3AA 1YLZA 1ZC2A 1E25A 4OQIA 4CLCD 2Z2LB 5CEBA 3HLGA 4BJPA 3QP8A 5EOOA 1FOFA 4U3TA 3IS2B 5FQMA 3DWZA 2X01A 3CI6A 5FSRA 4B4XA 4Y7PA 3OZHA 5GLDA 3UE1A 2XK1A 4YFMA 1HLUP 5GLBA 3Q82A 4X25A 4K0XA 5HD3A 3FG8A 3CUEC 2V8CA 2JN7A 1DP6A 1E3UA 2W1TB 1HZOA 2DMWA 5F1FA 1ESUA 1Z09A 2W3EA 1WYCA 2VK3A 4N9KA 4Y13A 1PWCA 2Y2JA 1FR6A 4OLGA 3LR3A 2BTFP 4EBPA 2L0WA 2VKSA 3LIAA 4FH4A 1YKDA 2ZJ9A 4CLCC 5I94A 1K55C 1H0MA 1IYSA 4N9LA 1UWPX 1GSXA 4AFIA 3CPTB 3FZCA 2PDRA 1JVJA 4LLOB 5FAOA 1GA9A 4MLLA 3N8LA 2J3TD 4KG6A 2OAQ1 5E2HA 4OQ0A 4DF6A 4WEJA 3ZCZA 4WELA 1NLZA 3NECA 3E2LA 3LGOA 1TD5A 3IS2A 3VMAA 3S7NA 5HL1A 5HPFA 3G32A 1KVLA 1YT4A 2J3WA 3LIDA 2EWWA 3KYQA 3RXXA 3KSIA 1ERQA 4EBLA 5EVID 2WAEA 3G2YA 2J8YA 4KQOA 4GB7A 1FQGA 1ES4A 1NYYA 4JGPA 2XDMA 3IHAA 4EUVA 3WS0A 2W0NA 3MKFA 4LV1A 1DRMA 4S2JA 3WS5A 4DKIA 2H28A 4L9EA 4OP5A 3LEQA 2ZC3B 3F1OB 3ZGAB 1SDEA 4ESPA 3M2KA 4P6ZM 4BQMA 3M6HA 1XGJA 2Y91A 2VGKA 5GHYA 2A24B 1P0ZA 3T12B 2XFTA 1VHMA 4K0WA 4KZ6A 1XJ2A 3IHBA 3VV4A 3IF6C 1TF1A 1PYYA 3LR0A 4BL3A 3MS6A 3IH9A 4Y5FA 1YLPA 4CLCA 3LY3A 3FYZA 3W4PA 1ES5A 2C6WB 3MJQA 4FOFA 3HBRA 4QPRA 1GCEA 2HP5A 1S1ZA 3DBAA 1PZOA 4OKPA 1DY6A 4KG5A 5AVFA 2QJ7A 5EV0A 5IT5A 1YMSA 5I5LA 2WGIA 3E0YA 1EWZA 1L0FA 1XP4A 5GHZA 3M2JA 1XA1A 2ZM2A 4ZJ3A 3O88A 4LENA 3PHYA 3LI8A 4DE3A 2H0TA 2P04A 3DAVA 4B93A 2HF6A 2WZZA 3HJIA 2XA7S 3BFCA 4X1MA 3LIEA 3T4TA 1MKIA 1XGIA 4I3IA 3UNWA 5HDCA 3HLCA 5EM1A 4P87A 5DTTA 3GMWA 3MF0A 3E4QA 5CTMA 3QP5A 3DTKA 3NC8A 1Z6FA 3IX3A 1O07A 4HEFA 4I39A 1PWGA 5CHMA 2JHEA 5FEFA 3MQOA 3OBFA 1SHVA 3IWIA 3O3VA 4QWOA 5F69A 4F94A 4GOGA 4HQAA 4UA9A 1XJ3A 4QJGA 1W63Q 3B42A 4D2OA 4CJNA 4JGRA 4R0QA 2PR6A 4PKYG 5HAIA 1TEMA 2HJEA 4XT2A 1MPLA 4GN2A 3ZG5A 3VE4A 1CJFA 3C4PA 3C5AA 2A49A 1ZTUA 1PIOA 4OPQA 4R4SA 4E3JA 1HTZA 4DDSA 4YINA 2V1BA 1CEGA 1LL5A 3Q7VB 2PYPA 5A90A 4GLQA 4MBKA 3O5YA 4D60A 3LICA 3OCLA 2EFXA 3NDGA 3GV9A 1YMXA 3VSKA 2DRWA 1K25A 3LEZA 3O87A 1N4OA 1WYBA 2HPBA 4PMAA 2W3DA 1D06A 1BSGA 5FI2A 3A3FA 4QD4A 4I38A 3W8KA 2Y2NA 3PBQA 4DE2A 4KZBA 4P0MA 1N9LA 4BENA 4KUKA 1KGFA 3MBZA 1A0KA 1VETB 1E4DA 5HARA 4KENB 2ZD8A 5EFWA 1PI5A 3NHQA 4ARZB 5EVIB 3CLOA 2WKEA 3HLBA 5BOHA 2OOLA 2QMIA 5A8BA 2JKFA 2PD7A 2P9VA 3UDFA 1PWDA 1F98A 2BG1A 3N8RA 1GHIA 3VOZA 2JKRM 4LRYC 5HSQA 2M7VA 5HX9A 4X53A 3ZG7B 4P6BA 1KVMA 4F3LA 1H8MA 3PTEA 2HDUA 2PD8A 3VOLA 2ZM8A 1WE4A 1EW0A 4ZJ2A 4EQIA 1JTDA 4NXBA 2BASA 3ZNTA 1S6RA 4IBRA 3FWLA 3UB5P 5HW3A 3IX4A 3V67A 3BLSA 2B95A 4X6TA 2LB9A 2PYRA 2XFSA 3NIAA 4O0PA 4WZ5C 5HPIA 5KSCA 1IYQA 2QYBA 2ZOIA 4OQGA 5CGXA 4PM8A 5KZHA 2OWJA 4RX3A 1JWVA 5DFYA 2JE5A 4R1GA 3UPOA 4WMCA 5CERA 2HGVA 3P01A 5EVLA 2X71A 4EETB 4OLDA 3BY8A 2ZMFA 3SH8A 3IWQA 1OTEA 4MBHA 3BFGA 3UB6A 2Z6CA 1LL9A 1JWZA 1SZVA 2K2NA 4ID4A 2OAP1 3HLFA 3SW1A 3LYXA 1I2SA 2YKFA 5CEDA 2PT7A 4IJGA 1G68A 2ZQ8A 4HNBA 4C3QA 4I5SA 4Q8IA 3IXBA 5LBRA 1G6OA 5AQ9A 4NXGA 4PKYA 1MWSA 2QKPA 4CQHA 1STZA 4DJ2A 4K91A 1LI0A 2VZWA 3C4OA 1P97A 3FPVA 3CPTA 1ZKJA 2XR0A 4KZ3A 3LUQA 2XA7M 1PFLA 5E2FA 1GA0A 3SS5A 2EFUA 2EWVA 2HP6A 4LRZE 1E3UD 3N6IA 2O9BA 2VX8A 3A3JA 2K31A 1T1AA 3A0SA 1QMEA 3ZHHA 3UB9A 1BUEA 2JKRI 2JKTM 1KGGA 4DMZA 4ETZA 3LR5A 4GNUA 3NY4A 3HLWA 3VSLA 1NY0A 5CECA 3T4OA 3MXQA 3MZEA 3HJKA 2C5WB 1VETA 4Y17A 5GHXA 2B02A 2PBDP 2JKTI 5F82A 3EQVA 1C3BA 1CI8A 1TDGA 1T19A 4OVDA 4KQQA 4FTXA 4ZTKA 1LSVA 1ES2A 3IF6A 1NJ4A 4HH3A 2V9AA 1FCNA 3BWLA 4WM9A 2PHYA 1K0KA 5DF8A 3T1SA 1W5DA 1BZAA 4KZ7A 4QU3A 3S1YA 4MEZA 4F3LB 1YLYA 3N4IA 2OSUA 3H9WA 3T4QA 4IVIA 1MWTA 2PBYA 2FFFB 3VOYA 5KSHA 2WADA 2XEPA 2Y2GA 2ZL1B 4X1LA 2J9PA 4LGWA 5DTKA 4E3OA 2FH5A 3PXPA 1TDLA 4S2OA 1SCWA 3D4FA 2JKGA 1DJAA 2VGLM 4GS9A 4EERA 1KE0A 3M6BA 4N92A 3UY6A 5A92A 2L4RA 4RX2A 1L2SA 5HWWA 2ZQCA 1AWIA 3C30A 4GD8A 4Q0JA 3IF5A 3SZTA 3TOIA 1LLBA 2EA9A 5E2GA 4HJ6A 4MN5A 4B88A 1MKMA 2W3GA 1ES3A 4S2NC 3ZG0A 2VLGA 2R9XA 4L9FA 3ITAA 3HUOA 1J9MA 4U0XA 3KYZA 1WA9A 3TSGA 5L09A 3IF6B 4HP4A 4R70A 3S4XA 3HUNA 3TE8A 1Y28A 1MY8A 3T1QB 4PM6A 3OOVA 4JLFA 3FV7A 3GDIA 3PAGA 3UMDA 1BLHA 4II7A 3DTEA 4JF6A 2RCXA 1MC0A 1QMFA 1GHPA 4E3NA 2JCHA 3ZFZA 1IEMA 2ZBBA 1DP8A 4BBVA 5FQ9A 3D72A 3NOTC 3PBNA 3U2AA 3C8CA 3F1NA 1KE3A 1K38A 5FL3A 4L9GA 1J3WA 5EECA 3EWKA 4DN0A 2I72A 3DTMA 3EQUA 2XD1A 2K7SA 3S22A 4S2MA 3CJMA 3ITBA 3KX0X 5DTSA 1F5MA 1YSQA 2EX9A 5CGWA 4GW9A 1K57C 4LPZA 3RTYA 3E4PA 5FQQA 3S7PA 1XX2A 4CLCE 3ZVTA 3MXRA 3B33A 1U60A 4HESA 3LR4A 4R6LA 5DJUA 3GR2A 4LRXC 2M1CA 4HJ4A 4BD0A 1K4FA 4OPRA 1FSYA 3C7UA 2DNSA 1ZG6A 3BFDA 3HL9A 3H7WB 5F68A 4BD1A 1ZG4A 1LSWA 3DTIA 3AGDA 4FSFA 3EOIA 3KSGA 3V5MA 4QY5A 2IA2A 4DDYA 5FASA 1XJ4A 3WS1A 5HZHA 1OTIA 3BEBA 4WBGA 1XJ6A 3T4LA 5IS1A 3BQ8A 3T1XA 1XXMA 3MQ0A 1N9BA 1GSWA 3LFVA 2Y2HA 1V9YA 5DKLA 2NUPC 3QNBA 2Y2QA 2QZ6A 3B3XA 3CHWP 3D9YA 4WZ5A 4X69A 2Z2MB 1NWZA 4WEKA 3S7QA 1VEUA 3KYEA 1K54C 1KDWA 1O7EA 2V0WA 1BTLA 4XUZA 4R38A 3BQAA 3KSFA 5HAQA 4E3IA 4E6XA 1PW8A 1MBLA 3C7VA 1K6SA 1TS6A 5AVEA 2VGJA 1NRFA 3UDIA 4FUWA 2BLSA 3R7WA 4HJ3A 2UV0E 4KZ9A 1ACFA 2VV7A 2WGWA 2IWBA 4R4RA 5J8XA 2A2LA 4UAAA 4OPYA 4WUJA 5AQAA 1IOUA 5CX7A 3HCYA 1F9IA 2XSSA 1ERMA 4UA7A 2WKRA 3MXSA 4PPRA 3UO9A 1Q2PA 2CMNA 3SOIA 4U0TA 4H8RA 1FILA 4R3JA 4WLAA 4OPZA 4ZBEA 1XA7A 1XFNA 3P98A 2YKHA 3F1PA 2WYXA 5EM0A 1BLPA 5FDHA 3A3IA 2ACGA 4KUOA 5TR7A 4WZ4A 3NDEA 1BT5A 1CEFA 1X0OA 2KLIA 5AQBA 4JXGA 4JF4A 4MDZA 4OONA 2GNXA 3V3RA 5EVEA 4KZ4A 4H6JA 2Y8HA 3MFDA 2W1RA 3PBOA 3VFHA 2XLNA 5HDSA 1IYPA 1H8ZA 2HJ9C 4MCWA 2WAFA 4IVKA 5DKKA 3CUEA 2H5SA 4ETXA 1M6KA 5EPHA 1P9WA 1T1CA 4BLMA 4KG2A 4BL2A 4DRTA 3I7JA 4X56A 2QJ5A 5HFOA 4P6ZS 4NEED 3A0VA 3ZQ5A 4ZRRA 4EQ1A 3JPUA 1S67L 4JXWA 3P09A 1XPBA 4NKPA 5TGFA 1S1YA 4IBXA 4HI4A 4Y0OA 2HDQA 2G2WA 1N9OA 4GD6A 3QP4A 2V8FA 3RFBA 1DJBA 3T50A 4EXOA 3E2KA 3MZFA 3SH9A 3VP2A 3PBSA 4M4XA 4UHUA 4GKUA 3MKEA 1FCOA 4WN5A 1PZPA 4X68A 3QP1A 4N1XA 1DP9A 2O0YA 4JBFA 5F83A 5JYPA 2VA0A 5L2FA 2ZL1A 1FSWA 3H82A 5DF9A 4RA7A 3EGDC 3UE3A 3BLMA 4LV0A 5FAPA 3A0RA 3UE6A 3NJAA 4UQIM 3SH7A 3S7OA 2HV1A 1N9NA 2VV6A 3UB7A 4JKTA 1ALQA 4C75A 2D01A 1JWPA 2QPNA 4GDBA 4M3KA 1OTDA 1YLJA 1ZHHB 4GHIA 4O7DA 4B9OA 3HUMA 4HOIA 4C6YA 2EX6A 3BRMA 5DFXA 5FQKA 5GLAA 3PBTA 3RXWA 1NRJA 1G28A 4FH2A 3IBRA 4A5RA 4DE0A 4CLCB 3CZDA 1S4RA 4CPKA 1SKOB 5G4YA 3LO7A 4KZ8A 4E6WA 4HY8A 1ONGA 2Y55A 1OMEA 3ZG8B 3WRZA 1FR1A 3WS2A 3G34A 3P7NA
chains in the Genus database with same CATH topology
2OLVA 3HUOA 1J9MA 2HDRA 2Y4AA 4U0XA 1RP5A 1IYOA 2EX2A 2JC7A 1EWZA 1L0FA 4HBUA 3TSGA 3ISGA 1XP4A 5GHZA 3M2JA 1XA1A 2ZM2A 2DCFA 2OLUA 2WKHA 3O88A 4LENA 4ZJ3A 3VP3A 3IF6B 4DE3A 2ZC7A 1M40A 1TVFA 2R9WA 3PAEA 2H0TA 3SS3A 2WKIA 4ZDXA 2WZZA 3S4XA 2G2UA 3QNCA 3HUNA 2GDNA 3BFCA 3VP0A 1MY8A 1MKIA 1XGIA 1YLTA 2IWDA 3UNWA 2PU4A 4OP8A 3HLCA 3NCKA 4P87A 5DTTA 3GMWA 3O86A 4JLFA 4PM6A 1EI5A 5EUAA 3VP4A 5CTMA 5GLCA 3SS4A 3NC8A 1PI4A 3FV7A 1Z6FA 3PAGA 1BLHA 1O07A 4HEFA 2HDSA 5FQIA 4IEDA 4KZAA 4S2PA 4Y0UA 1L0EA 5CGSA 2EX8A 1PWGA 4JF6A 2RCXA 5CHMA 4EBNA 5KMWA 4B4ZA 1QMFA 1GHPA 4E3NA 2JCHA 4MNRA 1IEMA 3ZFZA 1NXYA 1SHVA 3GTCA 3G4PA 4Y0TA 5FQ9A 3IWIA 3O3VA 3PBNA 5JYOA 4F94A 4GOGA 1KE3A 1K38A 1W7FA 2Q9NA 2XD5A 1I2WA 3G35A 3OC2A 4UA9A 5EOEA 5EECA 4QJGA 4D2OA 1AXBA 2UWXA 3BFFA 5FA7A 1W79A 4CJNA 2I72A 3OCNA 3DTMA 3EQUA 3NI9A 2XD1A 4R0QA 5D3OA 5M19A 4OOYA 1I5QA 3Q7ZA 2WGWB 5CHJA 5HAPA 1YM1A 1IELA 2XF3A 5HAIA 3S22A 1TEMA 4S2MA 1MPLA 3CJMA 4GN2A 2ZMAA 3VFFA 3ITBA 3ZG5A 5DTSA 2XQZA 3C4PA 2WGVA 3OPPA 3C5AA 3TG9A 2EX9A 2H0YA 2A49A 1L0GA 5CGWA 2B5RA 4EUZA 1MWUA 1PIOA 3WS4A 4OPQA 3IH8A 4R4SA 4E3JA 1K57C 1HTZA 1YLWA 2Y59A 3WWXA 4QY6A 4XUXA 5FQQA 4DDSA 1XX2A 4YINA 5TFQA 1CEGA 1LL5A 2ZC5B 3Q7VB 5A90A 1MXOA 2P9VB 3MXRA 3ZVTA 1U60A 1MWRA 4MBKA 4HESA 3MZDA 1HVBA 4OOLA 3OCLA 1H5XA 2EFXA 3NDGA 2FFYA 3GV9A 2ZQ9A 3Q81A 2OV5A 5FI7A 1W8QA 1KDSA 1YMXA 3GR2A 5DF7A 3VSKA 2DRWA 1K25A 3DW0A 2JBFA 3LEZA 4R23A 1K4FA 4OPRA 3IXGA 4BD0A 3O87A 3V50A 1W8YA 1N4OA 1FSYA 3C7UA 1WYBA 3ZNYA 1HD8A 2DNSA 1VQQA 2HPBA 4PMAA 4S2NA 1K55A 1ZG6A 3BFDA 1BSGA 5FI6A 2XH9A 3HL9A 5FI2A 3Q1FA 3A3FA 1RGYA 3G2ZA 4QD4A 4BD1A 4JXSA 5FQJA 3HVFA 3NBLA 1ZG4A 3W8KA 2Y2NA 3AGDA 2X02A 3PBQA 1SKFA 4FSFA 4JXVA 2Q9MA 1RCJA 3V39A 4DE2A 4KZBA 4X55A 4P0MA 4EV4A 3V5MA 3N8SA 4QY5A 3GSGA 4DDYA 5FASA 4BENA 1KE4A 1KGFA 3MBZA 4RVAA 3WS1A 3N7WA 5EE8A 3IWOA 4QB8A 1E4DA 2Y2KA 2WK0A 5M18A 4KZ5A 3BEBA 3IT9A 4KENB 3CG5A 5HARA 4WBGA 2V2FF 2ZD8A 1CK3A 1PI5A 1XXMA 1G6AA 3UPNA 1N9BA 5EVIB 2WKEA 3HLBA 5BOHA 4OH0A 1PW1A 2QMIA 3VP1A 2Y2HA 4NK3A 1K54A 3RJUA 3QNBA 2Y2QA 2QZ6A 2PU2A 2P9VA 3B3XA 4LCMA 3ZVWA 3UDFA 1PWDA 4XXRA 2BG1A 3N8RA 4OOMA 4WZ5A 2Z2MB 2H10A 1GHIA 4X69A 3VOZA 3IXHA 4WEKA 4QHCA 5HX9A 1IKIA 2WZXA 4X53A 3ZG7B 3HLDA 1KVMA 4P6BA 1EROA 4S2IA 3W4QA 1K56D 3PTEA 2HDUA 1K54C 1KDWA 1O7EA 5GL9A 2ZM8A 1BTLA 4XUZA 1WE4A 3W4OA 4FD8A 5DVAA 5HAQA 4ZJ2A 4E3IA 4EQIA 4E6XA 1PW8A 1JTDA 3BYDA 1MBLA 1RGZA 3ZNTA 3C7VA 2Y2OA 1K6SA 2A3UA 1S6RA 2E8IA 2VGJA 2Y2PA 4IBRA 4OQHA 1NRFA 3FWLA 3UDIA 2BLSA 5HW3A 4L0LA 4KZ9A 2ZM0A 2ZC4B 1H8YA 2WGWA 5CRFA 3BFEA 3FKWA 1IKGA 2IWBA 4R4RA 3BLSA 3HLEA 4WYYA 3GVBA 3OPHA 3AGFA 5J8XA 4X6TA 1K56A 4UAAA 4OPYA 2XFSA 3NIAA 4WZ5C 1CI9A 5G18A 3WRTA 5AQAA 3A3DA 4E3LA 5KSCA 1YLZA 4PM9A 1IYQA 1ZC2A 4LCLA 1E25A 4E3KA 4OQIA 3UE0A 2XGNA 4OQGA 1ERMA 2Z2LB 5CGXA 5CEBA 4PM8A 3HLGA 4BJPA 5EOOA 5KZHA 4S2LA 4UA7A 4RYEA 5A91A 4JPMA 4RX3A 1FOFA 1JWVA 4U3TA 3UPOA 2JE5A 4R1GA 3MXSA 4KQRA 4PPRA 3UO9A 1NZOA 1Q2PA 5E2EA 3OPRA 4WMCA 5CERA 3SOIA 3FKVA 4PM5A 4U0TA 4H8RA 1NYMA 5FQMA 5EVLA 3DWZA 1BLCA 5A93A 3GQZA 2X01A 4R3JA 2X71A 4OLDA 4OPZA 5FSRA 4ZBEA 1XA7A 3SH8A 3P98A 4B4XA 3IWQA 4Y7PA 3OZHA 5GLDA 3Q07A 3UE1A 2WYXA 2XK1A 3ZG9B 4YFMA 4MBHA 1BLPA 5FDHA 3A3IA 4EWFA 2P74A 3BFGA 1JTGA 1LL9A 5TR7A 4WZ4A 1JWZA 3NDEA 5GLBA 3Q82A 4ID4A 2ZQDA 3HLFA 5M1AA 1BT5A 4K0XA 1CEFA 1DJCA 1I2SA 5CHUA 5AQBA 4JXGA 4P85A 4JF4A 5CEDA 4OONA 1E3UA 3V3RA 4KZ4A 1HZOA 1G68A 2ZQ8A 4JF5A 2WUQA 4C3QA 5F1FA 3MFDA 1ESUA 3VFHA 3PBOA 4Q8IA 2XLNA 2ZQ7A 1IYPA 1H8ZA 4NETA 3IXBA 1WYCA 5AQ9A 2V1ZA 4N9KA 1PWCA 4DXBA 1MWSA 2Y2JA 1FR6A 4OLGA 2Y2MA 2WAFA 3GRJA 4IVKA 4FCFA 4EBPA 2H5SA 2J9OA 1M6KA 4K91A 4MBFA 5EPHA 1LI0A 2EXAA 3C4OA 4FH4A 4BLMA 2ZJ9A 5I94A 4KG2A 1K55C 1IYSA 4BL2A 1ZKJA 2XR0A 4KZ3A 4N9LA 4DRTA 3FZCA 1GA0A 1Q2QA 3I7JA 4LV2A 4X56A 5E2FA 5AQ7A 3SS5A 2EFUA 1LI9A 5F1GA 1JVJA 5HFOA 4DXCA 2HP6A 5FAOA 1GA9A 4MLLA 1E3UD 3N8LA 4Z9QA 4KG6A 5E2HA 4OQ0A 3N6IA 4DF6A 3A3JA 4GZBA 4WEJA 3ZCZA 3DWKA 4WELA 4PM7A 1QMEA 3ZHHA 4JXWA 1ESIA 3E2LA 4S2KA 1BUEA 3P09A 3VMAA 5HL1A 1XPBA 1XKZA 1KGGA 3Q7VA 3G32A 5CTNA 5TGFA 1KVLA 3IXDA 1YT4A 5EVIA 4GNUA 1BLSA 4IBXA 3NY4A 3HLWA 3VSLA 2Y2LA 1NY0A 1FCMA 3QHYA 4Y0OA 5CECA 2HDQA 3MZEA 2G2WA 1K57A 3RXXA 2C5WB 1ERQA 4GD6A 4EBLA 5EVID 2WAEA 5GHXA 3UPPA 1DJBA 5F82A 3EQVA 3G2YA 1C3BA 5IHVA 1CI8A 3V3SA 1TDGA 3E2KA 1S0WA 2J8YA 2CC1A 4OVDA 3MZFA 4KQOA 3SH9A 3UDXA 4GB7A 1FQGA 4R3BA 3PBSA 3VP2A 2V20A 1ES4A 3LCEA 1NYYA 4KQQA 5CXWA 2XDMA 3IHAA 1L0DA 2EXBA 4UHUA 1YQSA 4ZTKA 4GKUA 3MKEA 1FCOA 3WS0A 1ES2A 3IF6A 1SDNA 1NJ4A 3MKFA 3OPLA 1PZPA 4X68A 4ZAMA 1FCNA 4LV1A 4N1XA 2ZLYA 4JBFA 4UA6A 4S2JA 3WS5A 5F83A 5JYPA 4DKIA 3JYIA 4N1HA 4WM9A 5L2FA 1FSWA 5DF8A 1W5DA 5DF9A 4RA7A 3HREA 1BZAA 4OP5A 3PBRA 4KZ7A 3LY4A 4QU3A 3S1YA 4MEZA 2ZC3B 3UE3A 3ZGAB 1SDEA 2ZQAA 1YLYA 3BLMA 3ZDJA 3M2KA 3CMZA 2RL3A 2IWCA 3N4IA 4LV0A 2OSUA 5FAPA 3UN7A 2ZC6B 4BQMA 1BULA 4IVIA 1MWTA 3SH7A 3M6HA 2PBYA 5FAQA 2FFFB 1Y54A 1XGJA 2Y91A 3VOYA 4GDNA 2VGKA 5GHYA 2Y2IA 5U47A 4JKTA 1ALQA 5KSHA 4C75A 2WADA 2XEPA 1JWPA 2Y2GA 2XFTA 1GHMA 2QPNA 4GDBA 2J9PA 4M3KA 5DTKA 4K0WA 1YLJA 4E3OA 4KZ6A 3BECA 1TDLA 4S2OA 1SCWA 3D4FA 4O7DA 1DJAA 1NZUA 3HUMA 3IHBA 1KE0A 1K6RA 3M6BA 3IF6C 4C6YA 4N92A 2EX6A 3UY6A 1PYYA 3BRMA 4BL3A 5A92A 5FQKA 3PBTA 4HBTA 5GLAA 4LV3A 3IH9A 4RX2A 3RXWA 1LHYA 1YLPA 1L2SA 3LY3A 2ZQCA 1VM1A 4E3MA 4FH2A 4ZJ1A 3FYZA 4WMCD 3G30A 3W4PA 4GD8A 1ONHA 3A3EA 3IF5A 4A5RA 1ES5A 3AGEA 2C6WB 4DE0A 3TOIA 3BM6A 1LLBA 2J7VA 3HBRA 5E2GA 3CZDA 5FATA 1GCEA 4CPKA 1K4EA 3LO7A 3IQAA 2HP5A 4B88A 4KZ8A 4DE1A 1ES3A 1PZOA 1KGEA 4OKPA 1DY6A 5E43A 4S2NC 3ZG0A 4E6WA 4KG5A 1ONGA 2HP9A 2Y55A 1OMEA 3ZG8B 2R9XA 3G31A 3WRZA 1FR1A 3WS2A 3G34A 3ITAA 1YMSA 5EVIC 2WGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OLV A;  3HUO A;  1J9M A;  2HDR A;  2Y4A A;  4U0X A;  1RP5 A;  1IYO A;  2EX2 A;  2JC7 A;  1EWZ A;  1L0F A;  4HBU A;  3TSG A;  3ISG A;  1XP4 A;  5GHZ A;  3M2J A;  1XA1 A;  2ZM2 A;  2DCF A;  2OLU A;  2WKH A;  3O88 A;  4LEN A;  4ZJ3 A;  3VP3 A;  3IF6 B;  4DE3 A;  2ZC7 A;  1M40 A;  1TVF A;  2R9W A;  3PAE A;  2H0T A;  3SS3 A;  2WKI A;  4ZDX A;  2WZZ A;  3S4X A;  2G2U A;  3QNC A;  3HUN A;  2GDN A;  3BFC A;  3VP0 A;  1MY8 A;  1MKI A;  1XGI A;  1YLT A;  2IWD A;  3UNW A;  2PU4 A;  4OP8 A;  3HLC A;  3NCK A;  4P87 A;  5DTT A;  3GMW A;  3O86 A;  4JLF A;  4PM6 A;  1EI5 A;  5EUA A;  3VP4 A;  5CTM A;  5GLC A;  3SS4 A;  3NC8 A;  1PI4 A;  3FV7 A;  1Z6F A;  3PAG A;  1BLH A;  1O07 A;  4HEF A;  2HDS A;  5FQI A;  4IED A;  4KZA A;  4S2P A;  4Y0U A;  1L0E A;  5CGS A;  2EX8 A;  1PWG A;  4JF6 A;  2RCX A;  5CHM A;  4EBN A;  5KMW A;  4B4Z A;  1QMF A;  1GHP A;  4E3N A;  2JCH A;  4MNR A;  1IEM A;  3ZFZ A;  1NXY A;  1SHV A;  3GTC A;  3G4P A;  4Y0T A;  5FQ9 A;  3IWI A;  3O3V A;  3PBN A;  5JYO A;  4F94 A;  4GOG A;  1KE3 A;  1K38 A;  1W7F A;  2Q9N A;  2XD5 A;  1I2W A;  3G35 A;  3OC2 A;  4UA9 A;  5EOE A;  5EEC A;  4QJG A;  4D2O A;  1AXB A;  2UWX A;  3BFF A;  5FA7 A;  1W79 A;  4CJN A;  2I72 A;  3OCN A;  3DTM A;  3EQU A;  3NI9 A;  2XD1 A;  4R0Q A;  5D3O A;  5M19 A;  4OOY A;  1I5Q A;  3Q7Z A;  2WGW B;  5CHJ A;  5HAP A;  1YM1 A;  1IEL A;  2XF3 A;  5HAI A;  3S22 A;  1TEM A;  4S2M A;  1MPL A;  3CJM A;  4GN2 A;  2ZMA A;  3VFF A;  3ITB A;  3ZG5 A;  5DTS A;  2XQZ A;  3C4P A;  2WGV A;  3OPP A;  3C5A A;  3TG9 A;  2EX9 A;  2H0Y A;  2A49 A;  1L0G A;  5CGW A;  2B5R A;  4EUZ A;  1MWU A;  1PIO A;  3WS4 A;  4OPQ A;  3IH8 A;  4R4S A;  4E3J A;  1K57 C;  1HTZ A;  1YLW A;  2Y59 A;  3WWX A;  4QY6 A;  4XUX A;  5FQQ A;  4DDS A;  1XX2 A;  4YIN A;  5TFQ A;  1CEG A;  1LL5 A;  2ZC5 B;  3Q7V B;  5A90 A;  1MXO A;  2P9V B;  3MXR A;  3ZVT A;  1U60 A;  1MWR A;  4MBK A;  4HES A;  3MZD A;  1HVB A;  4OOL A;  3OCL A;  1H5X A;  2EFX A;  3NDG A;  2FFY A;  3GV9 A;  2ZQ9 A;  3Q81 A;  2OV5 A;  5FI7 A;  1W8Q A;  1KDS A;  1YMX A;  3GR2 A;  5DF7 A;  3VSK A;  2DRW A;  1K25 A;  3DW0 A;  2JBF A;  3LEZ A;  4R23 A;  1K4F A;  4OPR A;  3IXG A;  4BD0 A;  3O87 A;  3V50 A;  1W8Y A;  1N4O A;  1FSY A;  3C7U A;  1WYB A;  3ZNY A;  1HD8 A;  2DNS A;  1VQQ A;  2HPB A;  4PMA A;  4S2N A;  1K55 A;  1ZG6 A;  3BFD A;  1BSG A;  5FI6 A;  2XH9 A;  3HL9 A;  5FI2 A;  3Q1F A;  3A3F A;  1RGY A;  3G2Z A;  4QD4 A;  4BD1 A;  4JXS A;  5FQJ A;  3HVF A;  3NBL A;  1ZG4 A;  3W8K A;  2Y2N A;  3AGD A;  2X02 A;  3PBQ A;  1SKF A;  4FSF A;  4JXV A;  2Q9M A;  1RCJ A;  3V39 A;  4DE2 A;  4KZB A;  4X55 A;  4P0M A;  4EV4 A;  3V5M A;  3N8S A;  4QY5 A;  3GSG A;  4DDY A;  5FAS A;  4BEN A;  1KE4 A;  1KGF A;  3MBZ A;  4RVA A;  3WS1 A;  3N7W A;  5EE8 A;  3IWO A;  4QB8 A;  1E4D A;  2Y2K A;  2WK0 A;  5M18 A;  4KZ5 A;  3BEB A;  3IT9 A;  4KEN B;  3CG5 A;  5HAR A;  4WBG A;  2V2F F;  2ZD8 A;  1CK3 A;  1PI5 A;  1XXM A;  1G6A A;  3UPN A;  1N9B A;  5EVI B;  2WKE A;  3HLB A;  5BOH A;  4OH0 A;  1PW1 A;  2QMI A;  3VP1 A;  2Y2H A;  4NK3 A;  1K54 A;  3RJU A;  3QNB A;  2Y2Q A;  2QZ6 A;  2PU2 A;  2P9V A;  3B3X A;  4LCM A;  3ZVW A;  3UDF A;  1PWD A;  4XXR A;  2BG1 A;  3N8R A;  4OOM A;  4WZ5 A;  2Z2M B;  2H10 A;  1GHI A;  4X69 A;  3VOZ A;  3IXH A;  4WEK A;  4QHC A;  5HX9 A;  1IKI A;  2WZX A;  4X53 A;  3ZG7 B;  3HLD A;  1KVM A;  4P6B A;  1ERO A;  4S2I A;  3W4Q A;  1K56 D;  3PTE A;  2HDU A;  1K54 C;  1KDW A;  1O7E A;  5GL9 A;  2ZM8 A;  1BTL A;  4XUZ A;  1WE4 A;  3W4O A;  4FD8 A;  5DVA A;  5HAQ A;  4ZJ2 A;  4E3I A;  4EQI A;  4E6X A;  1PW8 A;  1JTD A;  3BYD A;  1MBL A;  1RGZ A;  3ZNT A;  3C7V A;  2Y2O A;  1K6S A;  2A3U A;  1S6R A;  2E8I A;  2VGJ A;  2Y2P A;  4IBR A;  4OQH A;  1NRF A;  3FWL A;  3UDI A;  2BLS A;  5HW3 A;  4L0L A;  4KZ9 A;  2ZM0 A;  2ZC4 B;  1H8Y A;  2WGW A;  5CRF A;  3BFE A;  3FKW A;  1IKG A;  2IWB A;  4R4R A;  3BLS A;  3HLE A;  4WYY A;  3GVB A;  3OPH A;  3AGF A;  5J8X A;  4X6T A;  1K56 A;  4UAA A;  4OPY A;  2XFS A;  3NIA A;  4WZ5 C;  1CI9 A;  5G18 A;  3WRT A;  5AQA A;  3A3D A;  4E3L A;  5KSC A;  1YLZ A;  4PM9 A;  1IYQ A;  1ZC2 A;  4LCL A;  1E25 A;  4E3K A;  4OQI A;  3UE0 A;  2XGN A;  4OQG A;  1ERM A;  2Z2L B;  5CGX A;  5CEB A;  4PM8 A;  3HLG A;  4BJP A;  5EOO A;  5KZH A;  4S2L A;  4UA7 A;  4RYE A;  5A91 A;  4JPM A;  4RX3 A;  1FOF A;  1JWV A;  4U3T A;  3UPO A;  2JE5 A;  4R1G A;  3MXS A;  4KQR A;  4PPR A;  3UO9 A;  1NZO A;  1Q2P A;  5E2E A;  3OPR A;  4WMC A;  5CER A;  3SOI A;  3FKV A;  4PM5 A;  4U0T A;  4H8R A;  1NYM A;  5FQM A;  5EVL A;  3DWZ A;  1BLC A;  5A93 A;  3GQZ A;  2X01 A;  4R3J A;  2X71 A;  4OLD A;  4OPZ A;  5FSR A;  4ZBE A;  1XA7 A;  3SH8 A;  3P98 A;  4B4X A;  3IWQ A;  4Y7P A;  3OZH A;  5GLD A;  3Q07 A;  3UE1 A;  2WYX A;  2XK1 A;  3ZG9 B;  4YFM A;  4MBH A;  1BLP A;  5FDH A;  3A3I A;  4EWF A;  2P74 A;  3BFG A;  1JTG A;  1LL9 A;  5TR7 A;  4WZ4 A;  1JWZ A;  3NDE A;  5GLB A;  3Q82 A;  4ID4 A;  2ZQD A;  3HLF A;  5M1A A;  1BT5 A;  4K0X A;  1CEF A;  1DJC A;  1I2S A;  5CHU A;  5AQB A;  4JXG A;  4P85 A;  4JF4 A;  5CED A;  4OON A;  1E3U A;  3V3R A;  4KZ4 A;  1HZO A;  1G68 A;  2ZQ8 A;  4JF5 A;  2WUQ A;  4C3Q A;  5F1F A;  3MFD A;  1ESU A;  3VFH A;  3PBO A;  4Q8I A;  2XLN A;  2ZQ7 A;  1IYP A;  1H8Z A;  4NET A;  3IXB A;  1WYC A;  5AQ9 A;  2V1Z A;  4N9K A;  1PWC A;  4DXB A;  1MWS A;  2Y2J A;  1FR6 A;  4OLG A;  2Y2M A;  2WAF A;  3GRJ A;  4IVK A;  4FCF A;  4EBP A;  2H5S A;  2J9O A;  1M6K A;  4K91 A;  4MBF A;  5EPH A;  1LI0 A;  2EXA A;  3C4O A;  4FH4 A;  4BLM A;  2ZJ9 A;  5I94 A;  4KG2 A;  1K55 C;  1IYS A;  4BL2 A;  1ZKJ A;  2XR0 A;  4KZ3 A;  4N9L A;  4DRT A;  3FZC A;  1GA0 A;  1Q2Q A;  3I7J A;  4LV2 A;  4X56 A;  5E2F A;  5AQ7 A;  3SS5 A;  2EFU A;  1LI9 A;  5F1G A;  1JVJ A;  5HFO A;  4DXC A;  2HP6 A;  5FAO A;  1GA9 A;  4MLL A;  1E3U D;  3N8L A;  4Z9Q A;  4KG6 A;  5E2H A;  4OQ0 A;  3N6I A;  4DF6 A;  3A3J A;  4GZB A;  4WEJ A;  3ZCZ A;  3DWK A;  4WEL A;  4PM7 A;  1QME A;  3ZHH A;  4JXW A;  1ESI A;  3E2L A;  4S2K A;  1BUE A;  3P09 A;  3VMA A;  5HL1 A;  1XPB A;  1XKZ A;  1KGG A;  3Q7V A;  3G32 A;  5CTN A;  5TGF A;  1KVL A;  3IXD A;  1YT4 A;  5EVI A;  4GNU A;  1BLS A;  4IBX A;  3NY4 A;  3HLW A;  3VSL A;  2Y2L A;  1NY0 A;  1FCM A;  3QHY A;  4Y0O A;  5CEC A;  2HDQ A;  3MZE A;  2G2W A;  1K57 A;  3RXX A;  2C5W B;  1ERQ A;  4GD6 A;  4EBL A;  5EVI D;  2WAE A;  5GHX A;  3UPP A;  1DJB A;  5F82 A;  3EQV A;  3G2Y A;  1C3B A;  5IHV A;  1CI8 A;  3V3S A;  1TDG A;  3E2K A;  1S0W A;  2J8Y A;  2CC1 A;  4OVD A;  3MZF A;  4KQO A;  3SH9 A;  3UDX A;  4GB7 A;  1FQG A;  4R3B A;  3PBS A;  3VP2 A;  2V20 A;  1ES4 A;  3LCE A;  1NYY A;  4KQQ A;  5CXW A;  2XDM A;  3IHA A;  1L0D A;  2EXB A;  4UHU A;  1YQS A;  4ZTK A;  4GKU A;  3MKE A;  1FCO A;  3WS0 A;  1ES2 A;  3IF6 A;  1SDN A;  1NJ4 A;  3MKF A;  3OPL A;  1PZP A;  4X68 A;  4ZAM A;  1FCN A;  4LV1 A;  4N1X A;  2ZLY A;  4JBF A;  4UA6 A;  4S2J A;  3WS5 A;  5F83 A;  5JYP A;  4DKI A;  3JYI A;  4N1H A;  4WM9 A;  5L2F A;  1FSW A;  5DF8 A;  1W5D A;  5DF9 A;  4RA7 A;  3HRE A;  1BZA A;  4OP5 A;  3PBR A;  4KZ7 A;  3LY4 A;  4QU3 A;  3S1Y A;  4MEZ A;  2ZC3 B;  3UE3 A;  3ZGA B;  1SDE A;  2ZQA A;  1YLY A;  3BLM A;  3ZDJ A;  3M2K A;  3CMZ A;  2RL3 A;  2IWC A;  3N4I A;  4LV0 A;  2OSU A;  5FAP A;  3UN7 A;  2ZC6 B;  4BQM A;  1BUL A;  4IVI A;  1MWT A;  3SH7 A;  3M6H A;  2PBY A;  5FAQ A;  2FFF B;  1Y54 A;  1XGJ A;  2Y91 A;  3VOY A;  4GDN A;  2VGK A;  5GHY A;  2Y2I A;  5U47 A;  4JKT A;  1ALQ A;  5KSH A;  4C75 A;  2WAD A;  2XEP A;  1JWP A;  2Y2G A;  2XFT A;  1GHM A;  2QPN A;  4GDB A;  2J9P A;  4M3K A;  5DTK A;  4K0W A;  1YLJ A;  4E3O A;  4KZ6 A;  3BEC A;  1TDL A;  4S2O A;  1SCW A;  3D4F A;  4O7D A;  1DJA A;  1NZU A;  3HUM A;  3IHB A;  1KE0 A;  1K6R A;  3M6B A;  3IF6 C;  4C6Y A;  4N92 A;  2EX6 A;  3UY6 A;  1PYY A;  3BRM A;  4BL3 A;  5A92 A;  5FQK A;  3PBT A;  4HBT A;  5GLA A;  4LV3 A;  3IH9 A;  4RX2 A;  3RXW A;  1LHY A;  1YLP A;  1L2S A;  3LY3 A;  2ZQC A;  1VM1 A;  4E3M A;  4FH2 A;  4ZJ1 A;  3FYZ A;  4WMC D;  3G30 A;  3W4P A;  4GD8 A;  1ONH A;  3A3E A;  3IF5 A;  4A5R A;  1ES5 A;  3AGE A;  2C6W B;  4DE0 A;  3TOI A;  3BM6 A;  1LLB A;  2J7V A;  3HBR A;  5E2G A;  3CZD A;  5FAT A;  1GCE A;  4CPK A;  1K4E A;  3LO7 A;  3IQA A;  2HP5 A;  4B88 A;  4KZ8 A;  4DE1 A;  1ES3 A;  1PZO A;  1KGE A;  4OKP A;  1DY6 A;  5E43 A;  4S2N C;  3ZG0 A;  4E6W A;  4KG5 A;  1ONG A;  2HP9 A;  2Y55 A;  1OME A;  3ZG8 B;  2R9X A;  3G31 A;  3WRZ A;  1FR1 A;  3WS2 A;  3G34 A;  3ITA A;  1YMS A;  5EVI C;  2WGI A; 
#chains in the Genus database with same CATH topology
 1GSV A;  2Y4A A;  2QWS A;  1IYO A;  2EX2 A;  2JC7 A;  3ISG A;  2WKH A;  2DCF A;  2OLU A;  3QP2 A;  2V1A A;  1TS8 A;  1TVF A;  2R9W A;  2WKI A;  1P9R A;  2GDN A;  3VP0 A;  3B47 A;  1YLT A;  4E04 A;  4EEU A;  2PU4 A;  4OP8 A;  3O86 A;  4EW7 A;  1EI5 A;  5EUA A;  5GLC A;  1PI4 A;  1T18 A;  2I9V A;  2HDS A;  4IED A;  4KZA A;  4S2P A;  4Y0U A;  4PAU A;  1VB6 A;  4EU0 A;  5CGS A;  3T4J A;  4EBN A;  3K3D A;  4Q0I A;  3ULF A;  3UME A;  3KO6 A;  3GTC A;  4JGO A;  3G4P A;  4Y0T A;  5JYO A;  2Z6D A;  1SKO A;  1W7F A;  3G35 A;  5EOE A;  4Y15 A;  1AXB A;  5FA7 A;  1W79 A;  2P08 A;  5D3O A;  5M19 A;  3NI9 A;  2WGW B;  5HAP A;  1YM1 A;  2XF3 A;  3PR6 A;  3G6O A;  2NUT C;  2ZMA A;  1OJ5 A;  2XQZ A;  2WGV A;  3OPP A;  2B18 A;  3TG9 A;  4O01 A;  5TBM A;  2B5R A;  2E8J A;  2GJ3 A;  3IH8 A;  2Y59 A;  4G3K A;  3K3C A;  2ZC5 B;  1MXO A;  2P9V B;  4BBT A;  3MZD A;  1T1B A;  1LSX A;  1HVB A;  4OOL A;  3LI9 A;  2VJW A;  4UEY A;  2ZQ9 A;  5FI7 A;  1W8Q A;  1KDS A;  2KX6 A;  3DW0 A;  4R23 A;  1D1J A;  3EEH A;  3IXG A;  3V50 A;  1W8Y A;  3ZNY A;  4MN7 A;  1VQQ A;  3F1P B;  4S2N A;  5FI6 A;  2XH9 A;  4YWZ A;  1RGY A;  4Y2F A;  5FQJ A;  2A24 A;  2X02 A;  2Q9M A;  3V39 A;  4X55 A;  2O9A A;  3N8S A;  1MZU A;  1KE4 A;  4XT2 B;  3N7W A;  3IWO A;  2Y2K A;  2WK0 A;  5M18 A;  3IT9 A;  3CG5 A;  3FPW A;  5K5B A;  4BMW A;  1VEU B;  2HZ5 A;  1PW1 A;  2J80 A;  3ZVW A;  4XXR A;  4OOM A;  2H10 A;  3IXH A;  4QHC A;  2WZX A;  3HLD A;  1ERO A;  4S2I A;  2Q0O A;  3W4Q A;  1Y4O A;  1BYW A;  5GL9 A;  4G3V A;  1OTB A;  4UQI S;  5F6A A;  3ZYT A;  3BYD A;  3EEA A;  1RGZ A;  5MC7 A;  3JVU A;  2ZM0 A;  5KIZ A;  1H8Y A;  3BFE A;  1IKG A;  2ZMV A;  3C2W A;  4WYY A;  4K08 A;  1TS7 A;  1D7E A;  1S4S A;  3D3O A;  5AJG A;  5G18 A;  1YAX A;  3A3D A;  4E3L A;  4PM9 A;  4LCL A;  3CIT A;  4E3K A;  3UE0 A;  4IHQ A;  2XGN A;  4WL9 A;  5FDS A;  2GX5 A;  4S2L A;  4RYE A;  5A91 A;  5C5K A;  4JPM A;  4KQR A;  1NZO A;  5E2E A;  3OPR A;  4MMN A;  3FKV A;  4PM5 A;  3F1O A;  5J7E A;  1PNE A;  1NYM A;  3TJZ C;  1BLC A;  5A93 A;  3GQZ A;  3H82 B;  2MJ6 A;  2XRN A;  2PRF A;  3Q07 A;  4NXF A;  3U4L P;  3ZG9 B;  1FIK A;  1PRQ A;  2KDK A;  4EWF A;  3KSH A;  2P74 A;  2QHK A;  1JTG A;  2ZQD A;  5M1A A;  1DJC A;  5CHU A;  4YOF A;  4P85 A;  1LT0 A;  4JF5 A;  2WUQ A;  2W1T A;  2O9C A;  2ZQ7 A;  2VV8 A;  4NET A;  5HDD A;  1W63 M;  2V1Z A;  4DXB A;  3R4K A;  1CQA A;  2Y2M A;  1OTA A;  4FCF A;  2J9O A;  3GEC A;  3LIF A;  4MBF A;  2EXA A;  3T4S A;  3MR0 A;  3LIB A;  5AQ7 A;  1Q2Q A;  4LV2 A;  3R7W B;  4NXE A;  1LI9 A;  5F1G A;  2W3H A;  1YSP A;  4DXC A;  5L07 A;  4Z9Q A;  1UGU A;  1V9Z A;  4GZB A;  3DWK A;  4PM7 A;  4LFU A;  1ESI A;  4GHI B;  4S2K A;  1XKZ A;  3Q7V A;  5CTN A;  3IXD A;  5EVI A;  1BLS A;  4HIA A;  2Y2L A;  3QHY A;  1FCM A;  3K2N A;  1K57 A;  2OWH A;  4IUK A;  4G3W A;  3MFX A;  3UPP A;  5IHV A;  3V3S A;  1S0W A;  2CC1 A;  4DJ3 A;  1L3L A;  4KQD A;  3UDX A;  5L8M A;  4R3B A;  2V20 A;  3LCE A;  5CXW A;  1L0D A;  2EXB A;  1YQS A;  2G7U A;  1SDN A;  3OPL A;  4ZAM A;  3NOU C;  2ZLY A;  4ME4 A;  4UA6 A;  5F5Y A;  3JYI A;  4N1H A;  3IBJ A;  3HRE A;  2W27 A;  3PBR A;  3LY4 A;  2ZQA A;  3ZDJ A;  3CMZ A;  2RL3 A;  4ARZ A;  2IWC A;  1OJG A;  4EEP A;  3UN7 A;  2ZC6 B;  1BUL A;  3C38 A;  5FAQ A;  1XFQ A;  2L1M A;  4YNR A;  1Y54 A;  3BJN A;  4GDN A;  2Y2I A;  5U47 A;  2PR5 A;  1GHM A;  3BEC A;  5HL6 A;  1G5U A;  1NZU A;  2KOI A;  2Y79 A;  1K6R A;  4PHT A;  4HH2 A;  4HBT A;  1JNU A;  1CF0 A;  3CWF A;  4LV3 A;  3W2Z A;  1LHY A;  2ZOH A;  1VM1 A;  4E3M A;  2J3T C;  4ZJ1 A;  4WMC D;  1OPX A;  3G30 A;  1OT9 A;  1ONH A;  3A3E A;  3AGE A;  5HWT A;  3BM6 A;  2J7V A;  5FAT A;  1K4E A;  5J4E A;  3IQA A;  4DE1 A;  1KGE A;  5DJT A;  5E43 A;  5J3W A;  3F1N B;  2HP9 A;  4H6J B;  3G31 A;  3E4O A;  4HBU A;  5EVI C;  4HHD A;  3GRJ A;  2OLV A;  1YPR A;  2GZA A;  2HDR A;  2W3F A;  1RP5 A;  5L10 A;  5TBM B;  4Y3I A;  3VE3 A;  3VP3 A;  2ZC7 A;  1M40 A;  5TJJ A;  3JVV A;  5G4Z A;  3PAE A;  3SS3 A;  4ZDX A;  2D02 A;  2G2U A;  3QNC A;  1IFQ A;  2IWD A;  3NCK A;  3MMH A;  2M7U A;  3VP4 A;  4Z1W A;  3SS4 A;  4IUH A;  3FC7 A;  3ICY A;  1KOU A;  5FQI A;  1L0E A;  2EX8 A;  5KMW A;  4B4Z A;  4MNR A;  1NXY A;  4BWI A;  4O8G A;  4MN6 A;  4RQ9 A;  3BW6 A;  1TS0 A;  2Q9N A;  2XD5 A;  1I2W A;  3MSH A;  3OC2 A;  5HD5 A;  4I3J A;  2UWX A;  4R3A A;  3BFF A;  2P7J A;  3OCN A;  4OOY A;  1I5Q A;  3Q7Z A;  5CHJ A;  3MQQ A;  1IEL A;  3VFF A;  3L9K A;  2H0Y A;  1L0G A;  3UB8 A;  3NUL A;  4EUZ A;  1MWU A;  3WS4 A;  2O99 A;  1YLW A;  3WWX A;  4QY6 A;  4XUX A;  3RH8 B;  5TFQ A;  3EGX C;  4BBU A;  1MWR A;  2FZ0 A;  1S66 L;  2WKP A;  4HP9 A;  1H5X A;  4GCZ A;  2FFY A;  1NLY A;  3Q81 A;  1OT6 A;  2OV5 A;  2LB5 A;  5DF7 A;  2JBF A;  3T4K A;  1HD8 A;  1K55 A;  3Q1F A;  3G2Z A;  4JXS A;  3HVF A;  3NBL A;  4EES A;  4JXV A;  1SKF A;  1RCJ A;  4EV4 A;  3PYP A;  3GSG A;  3H7W A;  1F2K A;  1H3Q A;  4RVA A;  3CAX A;  5EE8 A;  2VGL S;  4QB8 A;  3L7H A;  4KZ5 A;  2V2F F;  1CK3 A;  1G6A A;  3UPN A;  1LL8 A;  3T1R A;  2R78 A;  4OH0 A;  3VP1 A;  2INW A;  4NK3 A;  3OLO A;  1K54 A;  4WF0 A;  3RJU A;  3TW8 A;  2PU2 A;  4LCM A;  3TRC A;  4Q0H A;  1UWN X;  5FEG A;  1IKI A;  5IU1 A;  1K56 D;  4GJ4 A;  3NOP C;  3W4O A;  5HWV A;  4FD8 A;  5DVA A;  4GS9 B;  2Y2O A;  2A3U A;  2E8I A;  2Y2P A;  4OQH A;  2WKQ A;  3IX8 A;  4L0L A;  4NG2 A;  3E98 A;  2VEA A;  2ZC4 B;  5CRF A;  3FKW A;  1ODV A;  3BY9 A;  3HLE A;  2AVX A;  3GVB A;  3OPH A;  3AGF A;  1K56 A;  2XRO A;  2PAV P;  2V0U A;  3QP6 A;  4JGQ A;  1CI9 A;  3WRT A;  4I3A A;  1YLZ A;  1ZC2 A;  1E25 A;  4OQI A;  4CLC D;  2Z2L B;  5CEB A;  3HLG A;  4BJP A;  3QP8 A;  5EOO A;  1FOF A;  4U3T A;  3IS2 B;  5FQM A;  3DWZ A;  2X01 A;  3CI6 A;  5FSR A;  4B4X A;  4Y7P A;  3OZH A;  5GLD A;  3UE1 A;  2XK1 A;  4YFM A;  1HLU P;  5GLB A;  3Q82 A;  4X25 A;  4K0X A;  5HD3 A;  3FG8 A;  3CUE C;  2V8C A;  2JN7 A;  1DP6 A;  1E3U A;  2W1T B;  1HZO A;  2DMW A;  5F1F A;  1ESU A;  1Z09 A;  2W3E A;  1WYC A;  2VK3 A;  4N9K A;  4Y13 A;  1PWC A;  2Y2J A;  1FR6 A;  4OLG A;  3LR3 A;  2BTF P;  4EBP A;  2L0W A;  2VKS A;  3LIA A;  4FH4 A;  1YKD A;  2ZJ9 A;  4CLC C;  5I94 A;  1K55 C;  1H0M A;  1IYS A;  4N9L A;  1UWP X;  1GSX A;  4AFI A;  3CPT B;  3FZC A;  2PDR A;  1JVJ A;  4LLO B;  5FAO A;  1GA9 A;  4MLL A;  3N8L A;  2J3T D;  4KG6 A;  2OAQ 1;  5E2H A;  4OQ0 A;  4DF6 A;  4WEJ A;  3ZCZ A;  4WEL A;  1NLZ A;  3NEC A;  3E2L A;  3LGO A;  1TD5 A;  3IS2 A;  3VMA A;  3S7N A;  5HL1 A;  5HPF A;  3G32 A;  1KVL A;  1YT4 A;  2J3W A;  3LID A;  2EWW A;  3KYQ A;  3RXX A;  3KSI A;  1ERQ A;  4EBL A;  5EVI D;  2WAE A;  3G2Y A;  2J8Y A;  4KQO A;  4GB7 A;  1FQG A;  1ES4 A;  1NYY A;  4JGP A;  2XDM A;  3IHA A;  4EUV A;  3WS0 A;  2W0N A;  3MKF A;  4LV1 A;  1DRM A;  4S2J A;  3WS5 A;  4DKI A;  2H28 A;  4L9E A;  4OP5 A;  3LEQ A;  2ZC3 B;  3F1O B;  3ZGA B;  1SDE A;  4ESP A;  3M2K A;  4P6Z M;  4BQM A;  3M6H A;  1XGJ A;  2Y91 A;  2VGK A;  5GHY A;  2A24 B;  1P0Z A;  3T12 B;  2XFT A;  1VHM A;  4K0W A;  4KZ6 A;  1XJ2 A;  3IHB A;  3VV4 A;  3IF6 C;  1TF1 A;  1PYY A;  3LR0 A;  4BL3 A;  3MS6 A;  3IH9 A;  4Y5F A;  1YLP A;  4CLC A;  3LY3 A;  3FYZ A;  3W4P A;  1ES5 A;  2C6W B;  3MJQ A;  4FOF A;  3HBR A;  4QPR A;  1GCE A;  2HP5 A;  1S1Z A;  3DBA A;  1PZO A;  4OKP A;  1DY6 A;  4KG5 A;  5AVF A;  2QJ7 A;  5EV0 A;  5IT5 A;  1YMS A;  5I5L A;  2WGI A;  3E0Y A;  1EWZ A;  1L0F A;  1XP4 A;  5GHZ A;  3M2J A;  1XA1 A;  2ZM2 A;  4ZJ3 A;  3O88 A;  4LEN A;  3PHY A;  3LI8 A;  4DE3 A;  2H0T A;  2P04 A;  3DAV A;  4B93 A;  2HF6 A;  2WZZ A;  3HJI A;  2XA7 S;  3BFC A;  4X1M A;  3LIE A;  3T4T A;  1MKI A;  1XGI A;  4I3I A;  3UNW A;  5HDC A;  3HLC A;  5EM1 A;  4P87 A;  5DTT A;  3GMW A;  3MF0 A;  3E4Q A;  5CTM A;  3QP5 A;  3DTK A;  3NC8 A;  1Z6F A;  3IX3 A;  1O07 A;  4HEF A;  4I39 A;  1PWG A;  5CHM A;  2JHE A;  5FEF A;  3MQO A;  3OBF A;  1SHV A;  3IWI A;  3O3V A;  4QWO A;  5F69 A;  4F94 A;  4GOG A;  4HQA A;  4UA9 A;  1XJ3 A;  4QJG A;  1W63 Q;  3B42 A;  4D2O A;  4CJN A;  4JGR A;  4R0Q A;  2PR6 A;  4PKY G;  5HAI A;  1TEM A;  2HJE A;  4XT2 A;  1MPL A;  4GN2 A;  3ZG5 A;  3VE4 A;  1CJF A;  3C4P A;  3C5A A;  2A49 A;  1ZTU A;  1PIO A;  4OPQ A;  4R4S A;  4E3J A;  1HTZ A;  4DDS A;  4YIN A;  2V1B A;  1CEG A;  1LL5 A;  3Q7V B;  2PYP A;  5A90 A;  4GLQ A;  4MBK A;  3O5Y A;  4D60 A;  3LIC A;  3OCL A;  2EFX A;  3NDG A;  3GV9 A;  1YMX A;  3VSK A;  2DRW A;  1K25 A;  3LEZ A;  3O87 A;  1N4O A;  1WYB A;  2HPB A;  4PMA A;  2W3D A;  1D06 A;  1BSG A;  5FI2 A;  3A3F A;  4QD4 A;  4I38 A;  3W8K A;  2Y2N A;  3PBQ A;  4DE2 A;  4KZB A;  4P0M A;  1N9L A;  4BEN A;  4KUK A;  1KGF A;  3MBZ A;  1A0K A;  1VET B;  1E4D A;  5HAR A;  4KEN B;  2ZD8 A;  5EFW A;  1PI5 A;  3NHQ A;  4ARZ B;  5EVI B;  3CLO A;  2WKE A;  3HLB A;  5BOH A;  2OOL A;  2QMI A;  5A8B A;  2JKF A;  2PD7 A;  2P9V A;  3UDF A;  1PWD A;  1F98 A;  2BG1 A;  3N8R A;  1GHI A;  3VOZ A;  2JKR M;  4LRY C;  5HSQ A;  2M7V A;  5HX9 A;  4X53 A;  3ZG7 B;  4P6B A;  1KVM A;  4F3L A;  1H8M A;  3PTE A;  2HDU A;  2PD8 A;  3VOL A;  2ZM8 A;  1WE4 A;  1EW0 A;  4ZJ2 A;  4EQI A;  1JTD A;  4NXB A;  2BAS A;  3ZNT A;  1S6R A;  4IBR A;  3FWL A;  3UB5 P;  5HW3 A;  3IX4 A;  3V67 A;  3BLS A;  2B95 A;  4X6T A;  2LB9 A;  2PYR A;  2XFS A;  3NIA A;  4O0P A;  4WZ5 C;  5HPI A;  5KSC A;  1IYQ A;  2QYB A;  2ZOI A;  4OQG A;  5CGX A;  4PM8 A;  5KZH A;  2OWJ A;  4RX3 A;  1JWV A;  5DFY A;  2JE5 A;  4R1G A;  3UPO A;  4WMC A;  5CER A;  2HGV A;  3P01 A;  5EVL A;  2X71 A;  4EET B;  4OLD A;  3BY8 A;  2ZMF A;  3SH8 A;  3IWQ A;  1OTE A;  4MBH A;  3BFG A;  3UB6 A;  2Z6C A;  1LL9 A;  1JWZ A;  1SZV A;  2K2N A;  4ID4 A;  2OAP 1;  3HLF A;  3SW1 A;  3LYX A;  1I2S A;  2YKF A;  5CED A;  2PT7 A;  4IJG A;  1G68 A;  2ZQ8 A;  4HNB A;  4C3Q A;  4I5S A;  4Q8I A;  3IXB A;  5LBR A;  1G6O A;  5AQ9 A;  4NXG A;  4PKY A;  1MWS A;  2QKP A;  4CQH A;  1STZ A;  4DJ2 A;  4K91 A;  1LI0 A;  2VZW A;  3C4O A;  1P97 A;  3FPV A;  3CPT A;  1ZKJ A;  2XR0 A;  4KZ3 A;  3LUQ A;  2XA7 M;  1PFL A;  5E2F A;  1GA0 A;  3SS5 A;  2EFU A;  2EWV A;  2HP6 A;  4LRZ E;  1E3U D;  3N6I A;  2O9B A;  2VX8 A;  3A3J A;  2K31 A;  1T1A A;  3A0S A;  1QME A;  3ZHH A;  3UB9 A;  1BUE A;  2JKR I;  2JKT M;  1KGG A;  4DMZ A;  4ETZ A;  3LR5 A;  4GNU A;  3NY4 A;  3HLW A;  3VSL A;  1NY0 A;  5CEC A;  3T4O A;  3MXQ A;  3MZE A;  3HJK A;  2C5W B;  1VET A;  4Y17 A;  5GHX A;  2B02 A;  2PBD P;  2JKT I;  5F82 A;  3EQV A;  1C3B A;  1CI8 A;  1TDG A;  1T19 A;  4OVD A;  4KQQ A;  4FTX A;  4ZTK A;  1LSV A;  1ES2 A;  3IF6 A;  1NJ4 A;  4HH3 A;  2V9A A;  1FCN A;  3BWL A;  4WM9 A;  2PHY A;  1K0K A;  5DF8 A;  3T1S A;  1W5D A;  1BZA A;  4KZ7 A;  4QU3 A;  3S1Y A;  4MEZ A;  4F3L B;  1YLY A;  3N4I A;  2OSU A;  3H9W A;  3T4Q A;  4IVI A;  1MWT A;  2PBY A;  2FFF B;  3VOY A;  5KSH A;  2WAD A;  2XEP A;  2Y2G A;  2ZL1 B;  4X1L A;  2J9P A;  4LGW A;  5DTK A;  4E3O A;  2FH5 A;  3PXP A;  1TDL A;  4S2O A;  1SCW A;  3D4F A;  2JKG A;  1DJA A;  2VGL M;  4GS9 A;  4EER A;  1KE0 A;  3M6B A;  4N92 A;  3UY6 A;  5A92 A;  2L4R A;  4RX2 A;  1L2S A;  5HWW A;  2ZQC A;  1AWI A;  3C30 A;  4GD8 A;  4Q0J A;  3IF5 A;  3SZT A;  3TOI A;  1LLB A;  2EA9 A;  5E2G A;  4HJ6 A;  4MN5 A;  4B88 A;  1MKM A;  2W3G A;  1ES3 A;  4S2N C;  3ZG0 A;  2VLG A;  2R9X A;  4L9F A;  3ITA A;  3HUO A;  1J9M A;  4U0X A;  3KYZ A;  1WA9 A;  3TSG A;  5L09 A;  3IF6 B;  4HP4 A;  4R70 A;  3S4X A;  3HUN A;  3TE8 A;  1Y28 A;  1MY8 A;  3T1Q B;  4PM6 A;  3OOV A;  4JLF A;  3FV7 A;  3GDI A;  3PAG A;  3UMD A;  1BLH A;  4II7 A;  3DTE A;  4JF6 A;  2RCX A;  1MC0 A;  1QMF A;  1GHP A;  4E3N A;  2JCH A;  3ZFZ A;  1IEM A;  2ZBB A;  1DP8 A;  4BBV A;  5FQ9 A;  3D72 A;  3NOT C;  3PBN A;  3U2A A;  3C8C A;  3F1N A;  1KE3 A;  1K38 A;  5FL3 A;  4L9G A;  1J3W A;  5EEC A;  3EWK A;  4DN0 A;  2I72 A;  3DTM A;  3EQU A;  2XD1 A;  2K7S A;  3S22 A;  4S2M A;  3CJM A;  3ITB A;  3KX0 X;  5DTS A;  1F5M A;  1YSQ A;  2EX9 A;  5CGW A;  4GW9 A;  1K57 C;  4LPZ A;  3RTY A;  3E4P A;  5FQQ A;  3S7P A;  1XX2 A;  4CLC E;  3ZVT A;  3MXR A;  3B33 A;  1U60 A;  4HES A;  3LR4 A;  4R6L A;  5DJU A;  3GR2 A;  4LRX C;  2M1C A;  4HJ4 A;  4BD0 A;  1K4F A;  4OPR A;  1FSY A;  3C7U A;  2DNS A;  1ZG6 A;  3BFD A;  3HL9 A;  3H7W B;  5F68 A;  4BD1 A;  1ZG4 A;  1LSW A;  3DTI A;  3AGD A;  4FSF A;  3EOI A;  3KSG A;  3V5M A;  4QY5 A;  2IA2 A;  4DDY A;  5FAS A;  1XJ4 A;  3WS1 A;  5HZH A;  1OTI A;  3BEB A;  4WBG A;  1XJ6 A;  3T4L A;  5IS1 A;  3BQ8 A;  3T1X A;  1XXM A;  3MQ0 A;  1N9B A;  1GSW A;  3LFV A;  2Y2H A;  1V9Y A;  5DKL A;  2NUP C;  3QNB A;  2Y2Q A;  2QZ6 A;  3B3X A;  3CHW P;  3D9Y A;  4WZ5 A;  4X69 A;  2Z2M B;  1NWZ A;  4WEK A;  3S7Q A;  1VEU A;  3KYE A;  1K54 C;  1KDW A;  1O7E A;  2V0W A;  1BTL A;  4XUZ A;  4R38 A;  3BQA A;  3KSF A;  5HAQ A;  4E3I A;  4E6X A;  1PW8 A;  1MBL A;  3C7V A;  1K6S A;  1TS6 A;  5AVE A;  2VGJ A;  1NRF A;  3UDI A;  4FUW A;  2BLS A;  3R7W A;  4HJ3 A;  2UV0 E;  4KZ9 A;  1ACF A;  2VV7 A;  2WGW A;  2IWB A;  4R4R A;  5J8X A;  2A2L A;  4UAA A;  4OPY A;  4WUJ A;  5AQA A;  1IOU A;  5CX7 A;  3HCY A;  1F9I A;  2XSS A;  1ERM A;  4UA7 A;  2WKR A;  3MXS A;  4PPR A;  3UO9 A;  1Q2P A;  2CMN A;  3SOI A;  4U0T A;  4H8R A;  1FIL A;  4R3J A;  4WLA A;  4OPZ A;  4ZBE A;  1XA7 A;  1XFN A;  3P98 A;  2YKH A;  3F1P A;  2WYX A;  5EM0 A;  1BLP A;  5FDH A;  3A3I A;  2ACG A;  4KUO A;  5TR7 A;  4WZ4 A;  3NDE A;  1BT5 A;  1CEF A;  1X0O A;  2KLI A;  5AQB A;  4JXG A;  4JF4 A;  4MDZ A;  4OON A;  2GNX A;  3V3R A;  5EVE A;  4KZ4 A;  4H6J A;  2Y8H A;  3MFD A;  2W1R A;  3PBO A;  3VFH A;  2XLN A;  5HDS A;  1IYP A;  1H8Z A;  2HJ9 C;  4MCW A;  2WAF A;  4IVK A;  5DKK A;  3CUE A;  2H5S A;  4ETX A;  1M6K A;  5EPH A;  1P9W A;  1T1C A;  4BLM A;  4KG2 A;  4BL2 A;  4DRT A;  3I7J A;  4X56 A;  2QJ5 A;  5HFO A;  4P6Z S;  4NEE D;  3A0V A;  3ZQ5 A;  4ZRR A;  4EQ1 A;  3JPU A;  1S67 L;  4JXW A;  3P09 A;  1XPB A;  4NKP A;  5TGF A;  1S1Y A;  4IBX A;  4HI4 A;  4Y0O A;  2HDQ A;  2G2W A;  1N9O A;  4GD6 A;  3QP4 A;  2V8F A;  3RFB A;  1DJB A;  3T50 A;  4EXO A;  3E2K A;  3MZF A;  3SH9 A;  3VP2 A;  3PBS A;  4M4X A;  4UHU A;  4GKU A;  3MKE A;  1FCO A;  4WN5 A;  1PZP A;  4X68 A;  3QP1 A;  4N1X A;  1DP9 A;  2O0Y A;  4JBF A;  5F83 A;  5JYP A;  2VA0 A;  5L2F A;  2ZL1 A;  1FSW A;  3H82 A;  5DF9 A;  4RA7 A;  3EGD C;  3UE3 A;  3BLM A;  4LV0 A;  5FAP A;  3A0R A;  3UE6 A;  3NJA A;  4UQI M;  3SH7 A;  3S7O A;  2HV1 A;  1N9N A;  2VV6 A;  3UB7 A;  4JKT A;  1ALQ A;  4C75 A;  2D01 A;  1JWP A;  2QPN A;  4GDB A;  4M3K A;  1OTD A;  1YLJ A;  1ZHH B;  4GHI A;  4O7D A;  4B9O A;  3HUM A;  4HOI A;  4C6Y A;  2EX6 A;  3BRM A;  5DFX A;  5FQK A;  5GLA A;  3PBT A;  3RXW A;  1NRJ A;  1G28 A;  4FH2 A;  3IBR A;  4A5R A;  4DE0 A;  4CLC B;  3CZD A;  1S4R A;  4CPK A;  1SKO B;  5G4Y A;  3LO7 A;  4KZ8 A;  4E6W A;  4HY8 A;  1ONG A;  2Y55 A;  1OME A;  3ZG8 B;  3WRZ A;  1FR1 A;  3WS2 A;  3G34 A;  3P7N A; 
#chains in the Genus database with same CATH homology
 2OLV A;  3HUO A;  1J9M A;  2HDR A;  2Y4A A;  4U0X A;  1RP5 A;  1IYO A;  2EX2 A;  2JC7 A;  1EWZ A;  1L0F A;  4HBU A;  3TSG A;  3ISG A;  1XP4 A;  5GHZ A;  3M2J A;  1XA1 A;  2ZM2 A;  2DCF A;  2OLU A;  2WKH A;  3O88 A;  4LEN A;  4ZJ3 A;  3VP3 A;  3IF6 B;  4DE3 A;  2ZC7 A;  1M40 A;  1TVF A;  2R9W A;  3PAE A;  2H0T A;  3SS3 A;  2WKI A;  4ZDX A;  2WZZ A;  3S4X A;  2G2U A;  3QNC A;  3HUN A;  2GDN A;  3BFC A;  3VP0 A;  1MY8 A;  1MKI A;  1XGI A;  1YLT A;  2IWD A;  3UNW A;  2PU4 A;  4OP8 A;  3HLC A;  3NCK A;  4P87 A;  5DTT A;  3GMW A;  3O86 A;  4JLF A;  4PM6 A;  1EI5 A;  5EUA A;  3VP4 A;  5CTM A;  5GLC A;  3SS4 A;  3NC8 A;  1PI4 A;  3FV7 A;  1Z6F A;  3PAG A;  1BLH A;  1O07 A;  4HEF A;  2HDS A;  5FQI A;  4IED A;  4KZA A;  4S2P A;  4Y0U A;  1L0E A;  5CGS A;  2EX8 A;  1PWG A;  4JF6 A;  2RCX A;  5CHM A;  4EBN A;  5KMW A;  4B4Z A;  1QMF A;  1GHP A;  4E3N A;  2JCH A;  4MNR A;  1IEM A;  3ZFZ A;  1NXY A;  1SHV A;  3GTC A;  3G4P A;  4Y0T A;  5FQ9 A;  3IWI A;  3O3V A;  3PBN A;  5JYO A;  4F94 A;  4GOG A;  1KE3 A;  1K38 A;  1W7F A;  2Q9N A;  2XD5 A;  1I2W A;  3G35 A;  3OC2 A;  4UA9 A;  5EOE A;  5EEC A;  4QJG A;  4D2O A;  1AXB A;  2UWX A;  3BFF A;  5FA7 A;  1W79 A;  4CJN A;  2I72 A;  3OCN A;  3DTM A;  3EQU A;  3NI9 A;  2XD1 A;  4R0Q A;  5D3O A;  5M19 A;  4OOY A;  1I5Q A;  3Q7Z A;  2WGW B;  5CHJ A;  5HAP A;  1YM1 A;  1IEL A;  2XF3 A;  5HAI A;  3S22 A;  1TEM A;  4S2M A;  1MPL A;  3CJM A;  4GN2 A;  2ZMA A;  3VFF A;  3ITB A;  3ZG5 A;  5DTS A;  2XQZ A;  3C4P A;  2WGV A;  3OPP A;  3C5A A;  3TG9 A;  2EX9 A;  2H0Y A;  2A49 A;  1L0G A;  5CGW A;  2B5R A;  4EUZ A;  1MWU A;  1PIO A;  3WS4 A;  4OPQ A;  3IH8 A;  4R4S A;  4E3J A;  1K57 C;  1HTZ A;  1YLW A;  2Y59 A;  3WWX A;  4QY6 A;  4XUX A;  5FQQ A;  4DDS A;  1XX2 A;  4YIN A;  5TFQ A;  1CEG A;  1LL5 A;  2ZC5 B;  3Q7V B;  5A90 A;  1MXO A;  2P9V B;  3MXR A;  3ZVT A;  1U60 A;  1MWR A;  4MBK A;  4HES A;  3MZD A;  1HVB A;  4OOL A;  3OCL A;  1H5X A;  2EFX A;  3NDG A;  2FFY A;  3GV9 A;  2ZQ9 A;  3Q81 A;  2OV5 A;  5FI7 A;  1W8Q A;  1KDS A;  1YMX A;  3GR2 A;  5DF7 A;  3VSK A;  2DRW A;  1K25 A;  3DW0 A;  2JBF A;  3LEZ A;  4R23 A;  1K4F A;  4OPR A;  3IXG A;  4BD0 A;  3O87 A;  3V50 A;  1W8Y A;  1N4O A;  1FSY A;  3C7U A;  1WYB A;  3ZNY A;  1HD8 A;  2DNS A;  1VQQ A;  2HPB A;  4PMA A;  4S2N A;  1K55 A;  1ZG6 A;  3BFD A;  1BSG A;  5FI6 A;  2XH9 A;  3HL9 A;  5FI2 A;  3Q1F A;  3A3F A;  1RGY A;  3G2Z A;  4QD4 A;  4BD1 A;  4JXS A;  5FQJ A;  3HVF A;  3NBL A;  1ZG4 A;  3W8K A;  2Y2N A;  3AGD A;  2X02 A;  3PBQ A;  1SKF A;  4FSF A;  4JXV A;  2Q9M A;  1RCJ A;  3V39 A;  4DE2 A;  4KZB A;  4X55 A;  4P0M A;  4EV4 A;  3V5M A;  3N8S A;  4QY5 A;  3GSG A;  4DDY A;  5FAS A;  4BEN A;  1KE4 A;  1KGF A;  3MBZ A;  4RVA A;  3WS1 A;  3N7W A;  5EE8 A;  3IWO A;  4QB8 A;  1E4D A;  2Y2K A;  2WK0 A;  5M18 A;  4KZ5 A;  3BEB A;  3IT9 A;  4KEN B;  3CG5 A;  5HAR A;  4WBG A;  2V2F F;  2ZD8 A;  1CK3 A;  1PI5 A;  1XXM A;  1G6A A;  3UPN A;  1N9B A;  5EVI B;  2WKE A;  3HLB A;  5BOH A;  4OH0 A;  1PW1 A;  2QMI A;  3VP1 A;  2Y2H A;  4NK3 A;  1K54 A;  3RJU A;  3QNB A;  2Y2Q A;  2QZ6 A;  2PU2 A;  2P9V A;  3B3X A;  4LCM A;  3ZVW A;  3UDF A;  1PWD A;  4XXR A;  2BG1 A;  3N8R A;  4OOM A;  4WZ5 A;  2Z2M B;  2H10 A;  1GHI A;  4X69 A;  3VOZ A;  3IXH A;  4WEK A;  4QHC A;  5HX9 A;  1IKI A;  2WZX A;  4X53 A;  3ZG7 B;  3HLD A;  1KVM A;  4P6B A;  1ERO A;  4S2I A;  3W4Q A;  1K56 D;  3PTE A;  2HDU A;  1K54 C;  1KDW A;  1O7E A;  5GL9 A;  2ZM8 A;  1BTL A;  4XUZ A;  1WE4 A;  3W4O A;  4FD8 A;  5DVA A;  5HAQ A;  4ZJ2 A;  4E3I A;  4EQI A;  4E6X A;  1PW8 A;  1JTD A;  3BYD A;  1MBL A;  1RGZ A;  3ZNT A;  3C7V A;  2Y2O A;  1K6S A;  2A3U A;  1S6R A;  2E8I A;  2VGJ A;  2Y2P A;  4IBR A;  4OQH A;  1NRF A;  3FWL A;  3UDI A;  2BLS A;  5HW3 A;  4L0L A;  4KZ9 A;  2ZM0 A;  2ZC4 B;  1H8Y A;  2WGW A;  5CRF A;  3BFE A;  3FKW A;  1IKG A;  2IWB A;  4R4R A;  3BLS A;  3HLE A;  4WYY A;  3GVB A;  3OPH A;  3AGF A;  5J8X A;  4X6T A;  1K56 A;  4UAA A;  4OPY A;  2XFS A;  3NIA A;  4WZ5 C;  1CI9 A;  5G18 A;  3WRT A;  5AQA A;  3A3D A;  4E3L A;  5KSC A;  1YLZ A;  4PM9 A;  1IYQ A;  1ZC2 A;  4LCL A;  1E25 A;  4E3K A;  4OQI A;  3UE0 A;  2XGN A;  4OQG A;  1ERM A;  2Z2L B;  5CGX A;  5CEB A;  4PM8 A;  3HLG A;  4BJP A;  5EOO A;  5KZH A;  4S2L A;  4UA7 A;  4RYE A;  5A91 A;  4JPM A;  4RX3 A;  1FOF A;  1JWV A;  4U3T A;  3UPO A;  2JE5 A;  4R1G A;  3MXS A;  4KQR A;  4PPR A;  3UO9 A;  1NZO A;  1Q2P A;  5E2E A;  3OPR A;  4WMC A;  5CER A;  3SOI A;  3FKV A;  4PM5 A;  4U0T A;  4H8R A;  1NYM A;  5FQM A;  5EVL A;  3DWZ A;  1BLC A;  5A93 A;  3GQZ A;  2X01 A;  4R3J A;  2X71 A;  4OLD A;  4OPZ A;  5FSR A;  4ZBE A;  1XA7 A;  3SH8 A;  3P98 A;  4B4X A;  3IWQ A;  4Y7P A;  3OZH A;  5GLD A;  3Q07 A;  3UE1 A;  2WYX A;  2XK1 A;  3ZG9 B;  4YFM A;  4MBH A;  1BLP A;  5FDH A;  3A3I A;  4EWF A;  2P74 A;  3BFG A;  1JTG A;  1LL9 A;  5TR7 A;  4WZ4 A;  1JWZ A;  3NDE A;  5GLB A;  3Q82 A;  4ID4 A;  2ZQD A;  3HLF A;  5M1A A;  1BT5 A;  4K0X A;  1CEF A;  1DJC A;  1I2S A;  5CHU A;  5AQB A;  4JXG A;  4P85 A;  4JF4 A;  5CED A;  4OON A;  1E3U A;  3V3R A;  4KZ4 A;  1HZO A;  1G68 A;  2ZQ8 A;  4JF5 A;  2WUQ A;  4C3Q A;  5F1F A;  3MFD A;  1ESU A;  3VFH A;  3PBO A;  4Q8I A;  2XLN A;  2ZQ7 A;  1IYP A;  1H8Z A;  4NET A;  3IXB A;  1WYC A;  5AQ9 A;  2V1Z A;  4N9K A;  1PWC A;  4DXB A;  1MWS A;  2Y2J A;  1FR6 A;  4OLG A;  2Y2M A;  2WAF A;  3GRJ A;  4IVK A;  4FCF A;  4EBP A;  2H5S A;  2J9O A;  1M6K A;  4K91 A;  4MBF A;  5EPH A;  1LI0 A;  2EXA A;  3C4O A;  4FH4 A;  4BLM A;  2ZJ9 A;  5I94 A;  4KG2 A;  1K55 C;  1IYS A;  4BL2 A;  1ZKJ A;  2XR0 A;  4KZ3 A;  4N9L A;  4DRT A;  3FZC A;  1GA0 A;  1Q2Q A;  3I7J A;  4LV2 A;  4X56 A;  5E2F A;  5AQ7 A;  3SS5 A;  2EFU A;  1LI9 A;  5F1G A;  1JVJ A;  5HFO A;  4DXC A;  2HP6 A;  5FAO A;  1GA9 A;  4MLL A;  1E3U D;  3N8L A;  4Z9Q A;  4KG6 A;  5E2H A;  4OQ0 A;  3N6I A;  4DF6 A;  3A3J A;  4GZB A;  4WEJ A;  3ZCZ A;  3DWK A;  4WEL A;  4PM7 A;  1QME A;  3ZHH A;  4JXW A;  1ESI A;  3E2L A;  4S2K A;  1BUE A;  3P09 A;  3VMA A;  5HL1 A;  1XPB A;  1XKZ A;  1KGG A;  3Q7V A;  3G32 A;  5CTN A;  5TGF A;  1KVL A;  3IXD A;  1YT4 A;  5EVI A;  4GNU A;  1BLS A;  4IBX A;  3NY4 A;  3HLW A;  3VSL A;  2Y2L A;  1NY0 A;  1FCM A;  3QHY A;  4Y0O A;  5CEC A;  2HDQ A;  3MZE A;  2G2W A;  1K57 A;  3RXX A;  2C5W B;  1ERQ A;  4GD6 A;  4EBL A;  5EVI D;  2WAE A;  5GHX A;  3UPP A;  1DJB A;  5F82 A;  3EQV A;  3G2Y A;  1C3B A;  5IHV A;  1CI8 A;  3V3S A;  1TDG A;  3E2K A;  1S0W A;  2J8Y A;  2CC1 A;  4OVD A;  3MZF A;  4KQO A;  3SH9 A;  3UDX A;  4GB7 A;  1FQG A;  4R3B A;  3PBS A;  3VP2 A;  2V20 A;  1ES4 A;  3LCE A;  1NYY A;  4KQQ A;  5CXW A;  2XDM A;  3IHA A;  1L0D A;  2EXB A;  4UHU A;  1YQS A;  4ZTK A;  4GKU A;  3MKE A;  1FCO A;  3WS0 A;  1ES2 A;  3IF6 A;  1SDN A;  1NJ4 A;  3MKF A;  3OPL A;  1PZP A;  4X68 A;  4ZAM A;  1FCN A;  4LV1 A;  4N1X A;  2ZLY A;  4JBF A;  4UA6 A;  4S2J A;  3WS5 A;  5F83 A;  5JYP A;  4DKI A;  3JYI A;  4N1H A;  4WM9 A;  5L2F A;  1FSW A;  5DF8 A;  1W5D A;  5DF9 A;  4RA7 A;  3HRE A;  1BZA A;  4OP5 A;  3PBR A;  4KZ7 A;  3LY4 A;  4QU3 A;  3S1Y A;  4MEZ A;  2ZC3 B;  3UE3 A;  3ZGA B;  1SDE A;  2ZQA A;  1YLY A;  3BLM A;  3ZDJ A;  3M2K A;  3CMZ A;  2RL3 A;  2IWC A;  3N4I A;  4LV0 A;  2OSU A;  5FAP A;  3UN7 A;  2ZC6 B;  4BQM A;  1BUL A;  4IVI A;  1MWT A;  3SH7 A;  3M6H A;  2PBY A;  5FAQ A;  2FFF B;  1Y54 A;  1XGJ A;  2Y91 A;  3VOY A;  4GDN A;  2VGK A;  5GHY A;  2Y2I A;  5U47 A;  4JKT A;  1ALQ A;  5KSH A;  4C75 A;  2WAD A;  2XEP A;  1JWP A;  2Y2G A;  2XFT A;  1GHM A;  2QPN A;  4GDB A;  2J9P A;  4M3K A;  5DTK A;  4K0W A;  1YLJ A;  4E3O A;  4KZ6 A;  3BEC A;  1TDL A;  4S2O A;  1SCW A;  3D4F A;  4O7D A;  1DJA A;  1NZU A;  3HUM A;  3IHB A;  1KE0 A;  1K6R A;  3M6B A;  3IF6 C;  4C6Y A;  4N92 A;  2EX6 A;  3UY6 A;  1PYY A;  3BRM A;  4BL3 A;  5A92 A;  5FQK A;  3PBT A;  4HBT A;  5GLA A;  4LV3 A;  3IH9 A;  4RX2 A;  3RXW A;  1LHY A;  1YLP A;  1L2S A;  3LY3 A;  2ZQC A;  1VM1 A;  4E3M A;  4FH2 A;  4ZJ1 A;  3FYZ A;  4WMC D;  3G30 A;  3W4P A;  4GD8 A;  1ONH A;  3A3E A;  3IF5 A;  4A5R A;  1ES5 A;  3AGE A;  2C6W B;  4DE0 A;  3TOI A;  3BM6 A;  1LLB A;  2J7V A;  3HBR A;  5E2G A;  3CZD A;  5FAT A;  1GCE A;  4CPK A;  1K4E A;  3LO7 A;  3IQA A;  2HP5 A;  4B88 A;  4KZ8 A;  4DE1 A;  1ES3 A;  1PZO A;  1KGE A;  4OKP A;  1DY6 A;  5E43 A;  4S2N C;  3ZG0 A;  4E6W A;  4KG5 A;  1ONG A;  2HP9 A;  2Y55 A;  1OME A;  3ZG8 B;  2R9X A;  3G31 A;  3WRZ A;  1FR1 A;  3WS2 A;  3G34 A;  3ITA A;  1YMS A;  5EVI C;  2WGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...