3IXBA

X-ray crystal structure of the extended-spectrum ampc e219k mutant beta-lactamase complexed with benzo(b)thiophene-2-boronic acid (bzb) at 1.63 angstrom resolution
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
358
structure length
352
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAKAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Structural bases for stability-function tradeoffs in antibiotic resistance.
pubmed doi rcsb
source organism Escherichia coli
total genus 113
structure length 352
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3ixbA00
1MBLA 3Q7VB 3IH9A 4M3KA 2EFUA 2FFFB 4JF5A 4S2MA 5CHMA 1SKFA 3HLEA 2Y2LA 4JXSA 3S22A 3MXSA 4BL2A 4DKIA 1FCOA 1RP5A 1XA7A 2Y2GA 2EX2A 3ZVWA 5DVAA 1RGZA 1CEFA 3N6IA 4R4RA 1N9BA 1SHVA 4C6YA 3GR2A 3VP1A 3IHBA 1LI0A 3G4PA 3UPNA 5CTMA 1IYQA 5CGSA 3IWOA 5EVLA 3HLFA 2HDUA 3SS3A 1HD8A 2HP5A 5E2FA 4P85A 3GV9A 4BD1A 3AGDA 4E6WA 1NYYA 3E2KA 5L2FA 1BLSA 1Q2PA 3UY6A 1PZPA 2VGKA 4ZJ2A 1YQSA 4XUXA 3UE0A 5TR7A 3ZCZA 4LCMA 3HLDA 1E25A 1YM1A 3GSGA 4N1XA 4QJGA 4WBGA 2P9VB 4HESA 1W8YA 3NIAA 4UA6A 3NDEA 4UAAA 4WMCD 4X55A 3WS5A 5EVID 1XX2A 3UE3A 1ALQA 2Y2QA 3NC8A 3N7WA 2A3UA 2Y2KA 2ZM0A 4MNRA 1BTLA 3E2LA 4LV0A 4N1HA 5JYPA 2ZJ9A 5CTNA 3M2KA 3MBZA 4WZ4A 1K6SA 1YMXA 4P0MA 4DE3A 3BFCA 5F82A 3BM6A 5FI6A 3SH9A 1W79A 1DJCA 3UO9A 3BRMA 1K54A 5JYOA 1K57C 3CJMA 3WWXA 3S1YA 1L0DA 3SOIA 1YMSA 2J9PA 3NI9A 3DTMA 5HAQA 1K56D 2JC7A 5EVIA 3HUNA 4WEKA 2Q9NA 3Q7VA 1PW8A 2HDRA 4DRTA 1GHPA 3V5MA 3WS1A 2ZC3B 3CMZA 1DJAA 3C4PA 2P74A 5CECA 1IYOA 1S0WA 2I72A 4NK3A 1YLYA 4X56A 5FDHA 4NETA 1NZOA 3BFEA 1YLZA 3RXXA 4HBUA 3NBLA 1FSYA 4S2NC 2OLUA 3RXWA 1ONGA 4OQ0A 4OVDA 3LO7A 1HZOA 3VSKA 1WYCA 2EXBA 2EFXA 3QNCA 4GB7A 4WM9A 4MBKA 4S2KA 3UDXA 4OLGA 1PYYA 4ZDXA 4Z9QA 4DDYA 3WS4A 4OPYA 4GNUA 1MPLA 2P9VA 4KZ6A 5BOHA 3WS2A 3NCKA 2C6WB 2VGJA 5FQJA 2R9WA 3EQUA 4OQHA 3DW0A 1KVMA 3M2JA 2XGNA 4RX2A 5M1AA 3G32A 2EX9A 3PTEA 3DWKA 2V1ZA 2PBYA 2XF3A 2Y2HA 4N9KA 1ESIA 2ZM2A 3S4XA 3IWIA 4R3BA 2B5RA 1PWCA 3GTCA 5GHYA 5M19A 4N9LA 5GHXA 2XK1A 4KZ7A 1ZKJA 3ZGAB 1M6KA 3BLSA 4R23A 2Y2OA 1TDGA 5CRFA 3V39A 4S2IA 5FQ9A 4U0XA 2RCXA 3VP0A 2Q9MA 3VMAA 3IWQA 2WGIA 5CGWA 3WRTA 4KG2A 4PM8A 4IBXA 5HFOA 4KG5A 3BLMA 5CHJA 5EECA 3SS5A 3TSGA 4K91A 3IF5A 4BJPA 4ZBEA 4IBRA 4X68A 3OCNA 1H5XA 3TOIA 4OOMA 4KG6A 3QNBA 4FCFA 4F94A 3O88A 4DXCA 4IVKA 4RX3A 2IWCA 4B4XA 1HTZA 3BEBA 3ISGA 4DE0A 1DY6A 1NZUA 1NXYA 1KDSA 3N8RA 3PBQA 3UN7A 4OP5A 1FR1A 4B88A 4EUZA 4KZ3A 5EE8A 5KMWA 4X69A 4E3LA 4Y0TA 1K54C 1RCJA 2H10A 5HAIA 3M6HA 5F83A 4KZ4A 1K55A 1G6AA 2WKEA 5AQAA 1EI5A 3IT9A 3GRJA 1MWTA 4Y0OA 2EXAA 5EVIC 4E6XA 3VFFA 4FSFA 4JF4A 4QD4A 2Z2LB 4ZTKA 2JE5A 2ZC6B 4OKPA 4R0QA 1ZC2A 4KENB 3JYIA 4DF6A 1H8YA 4N92A 3QHYA 2V2FF 4OONA 3GMWA 3MZFA 3EQVA 3NY4A 3IF6B 5HW3A 1L2SA 5IHVA 4OPRA 4H8RA 5AQ7A 5CERA 3Q82A 3Q81A 3NDGA 2J7VA 4KQRA 1BT5A 2BLSA 4BL3A 4PMAA 2X02A 3O87A 5F1GA 3G31A 2BG1A 2G2UA 3A3FA 4KQOA 4YINA 5KSCA 4PPRA 3DWZA 2QMIA 3UPOA 3V3SA 2J8YA 5EPHA 2ZQAA 3VP4A 3HREA 3UDFA 3PBSA 3Q7ZA 3O86A 4O7DA 2WZZA 1L0FA 3W4PA 4GN2A 1XXMA 5A93A 1W5DA 5CEDA 3FZCA 5GLBA 4GD8A 1GA9A 3A3EA 3G2YA 4ZJ1A 1IKIA 4S2OA 1MWRA 1QMFA 4MEZA 1JVJA 1G68A 1O07A 5CGXA 3VOYA 1XP4A 4R4SA 5A92A 1S6RA 1Q2QA 3HVFA 2Y2PA 1W7FA 1BSGA 1IKGA 1GHMA 2HDSA 1Y54A 5GLDA 4YFMA 5KZHA 2ZC7A 4E3NA 4PM6A 4U0TA 5FQKA 5KSHA 2OSUA 3MFDA 2Y55A 2ZC4B 2JBFA 3OPPA 5A91A 3IH8A 3ZDJA 4LV3A 2XD5A 1JTDA 4EBPA 4KQQA 4X6TA 2WGVA 4EQIA 3LY3A 4JBFA 5AQBA 2X01A 1L0EA 2ZQ8A 5GLAA 4EV4A 5HX9A 5F1FA 2XH9A 2WZXA 1PI4A 4GOGA 2FFYA 5DTTA 1PWGA 2C5WB 1Z6FA 3BFGA 3MKFA 1SDNA 4Y7PA 3ZFZA 1XA1A 3C4OA 3G35A 4ID4A 1GHIA 4GKUA 4RYEA 3HL9A 3IF6A 1HVBA 3Q07A 1JWPA 4JLFA 4ZAMA 5GHZA 1XGIA 1GA0A 1TDLA 3G2ZA 4QHCA 2IWBA 3OCLA 4GD6A 3UNWA 1ES2A 2XFSA 2WKHA 5HAPA 3IHAA 3SH8A 4A5RA 2A49A 1ZG6A 4LV1A 4EWFA 5FA7A 1M40A 2DNSA 2UWXA 4P6BA 1KDWA 2Z2MB 4QY6A 5E2EA 1K55C 2XDMA 3UDIA 3MXRA 1PIOA 4B4ZA 5CEBA 3IXGA 1BZAA 1H8ZA 3Q1FA 5GL9A 3ITBA 3VFHA 4JXWA 4HEFA 1NYMA 1WYBA 5G18A 1XKZA 2G2WA 1YLJA 2ZD8A 5FASA 2WUQA 1NJ4A 2Y2NA 1LL5A 3A3IA 1LHYA 1ES5A 3CZDA 5FI7A 3PBRA 5FSRA 1N4OA 1YT4A 2WAEA 1K4EA 3BFFA 3FKWA 3PBOA 4UA9A 1EWZA 2WK0A 5FAPA 4BD0A 3HLBA 4FH2A 4PM9A 4C3QA 5HARA 4U3TA 1PZOA 1XGJA 3LEZA 2R9XA 1TVFA 2V20A 3G30A 4EBNA 3MKEA 4QY5A 4JXGA 1KVLA 4UHUA 3C7UA 1FCMA 1E3UA 4IEDA 4LENA 3HLWA 3HBRA 4OQIA 3N8LA 3GQZA 4DXBA 3FWLA 3ZG9B 3OC2A 4WEJA 4D2OA 3ITAA 1JWVA 3G34A 3IXHA 3VOZA 2Y59A 3O3VA 2ZM8A 2OV5A 2XEPA 1MXOA 3PAGA 2ZQCA 2Y2MA 2XLNA 2HP6A 4XUZA 1BUEA 4BLMA 1BLPA 4OOLA 3CG5A 4KZAA 3P09A 1WE4A 2ZQ7A 3SS4A 4FD8A 3A3DA 3HLGA 4WELA 1ES4A 2XR0A 4MBHA 2Y2IA 5DF9A 1PW1A 2CC1A 3HLCA 4DDSA 4E3KA 1LI9A 5U47A 4JPMA 4OOYA 1ERQA 1GCEA 4LV2A 4S2LA 5DF8A 3ZG5A 5FQQA 4E3OA 3V50A 4MLLA 1E4DA 2OLVA 2XD1A 1NY0A 3ZNTA 4CPKA 1ZG4A 5FQMA 1FR6A 3PBNA 5A90A 4WZ5A 1ONHA 1MY8A 5CXWA 2H5SA 4Q8IA 3PAEA 3OPRA 1C3BA 5DF7A 5FI2A 2WADA 4KZ9A 3ZG8B 3I7JA 4KZBA 3HUMA 2Y91A 3IF6C 1YLWA 4KZ5A 3RJUA 4K0XA 1K38A 3ZG7B 3WRZA 3MZDA 4OP8A 3VP2A 5E2GA 1ESUA 4LCLA 4ZJ3A 1K6RA 1KE4A 1RGYA 4OPQA 2WGWB 5I94A 3IXBA 2WAFA 2EX8A 1I2WA 2HPBA 3W4QA 2XQZA 1SCWA 4QB8A 3VP3A 3AGFA 5J8XA 1CI9A 1L0GA 5FATA 2WYXA 1PI5A 1VQQA 2RL3A 3GVBA 5CHUA 1FCNA 1KGFA 3UPPA 3WS0A 3A3JA 1IYSA 4QU3A 3LCEA 1U60A 4WMCA 1KE0A 5EOEA 2QZ6A 4GZBA 4HBTA 3LY4A 1O7EA 4X53A 3TG9A 2Y4AA 1BULA 1K4FA 3N8SA 2H0TA 4JF6A 5HL1A 2ZMAA 5FQIA 5FAOA 5TFQA 3P98A 1J9MA 4FH4A 4OQGA 1BLHA 3MZEA 3OPHA 3BECA 1K25A 2H0YA 4BQMA 1MKIA 1YLTA 4E3IA 1DJBA 3AGEA 4S2JA 2DRWA 3M6BA 2J9OA 5EUAA 5E2HA 2PU2A 3FV7A 3V3RA 4GDBA 1ERMA 1YLPA 2X71A 4K0WA 5AQ9A 4E3MA 1SDEA 3FKVA 2ZC5B 1K56A 4R3JA 3N4IA 5GLCA 2Y2JA 3ZG0A 3FYZA 3ZVTA 3ZNYA 3C7VA 4MBFA 1LL9A 3OPLA 5D3OA 1I2SA 1FQGA 2DCFA 1K57A 3SH7A 1AXBA 4JKTA 2ZQDA 1BLCA 3W8KA 3OZHA 1IELA 4JXVA 4DE2A 5EOOA 4EBLA 2JCHA 4Y0UA 1CI8A 1E3UD 1TEMA 4BENA 2HDQA 2WKIA 2XFTA 1CK3A 3ZHHA 4IVIA 4OPZA 2ZLYA 3VSLA 1VM1A 4KZ8A 1IYPA 1FOFA 2EX6A 3D4FA 1MWSA 1CEGA 1LLBA 4RVAA 5TGFA 4C75A 1PWDA 1ES3A 1FSWA 4OLDA 3UE1A 5M18A 2WGWA 3BFDA 3W4OA 3IXDA 2QPNA 4PM5A 4GDNA 5DTSA 1I5QA 1KGGA 4RA7A 4PM7A 4OH0A 4R1GA 3C5AA 3BYDA 1OMEA 2PU4A 3IQAA 3B3XA 4P87A 1EROA 4S2PA 4S2NA 2GDNA 3PBTA 4L0LA 1JTGA 1XPBA 4DE1A 1QMEA 1KE3A 1KGEA 1W8QA 4WZ5C 5DTKA 4E3JA 2HP9A 4WYYA 1MWUA 4XXRA 2ZQ9A 4CJNA 1JWZA 1NRFA 2E8IA 5E43A 3HUOA 5FAQA 1IEMA 2IWDA 4UA7A 5EVIB
chains in the Genus database with same CATH superfamily
4KQDA 3Q7VB 2EFUA 5CHMA 5EV0A 3HLEA 1RP5A 5FEGA 2EX2A 3ZVWA 3N6IA 3GR2A 2OWHA 5CTMA 1ACFA 2GNXA 5EVLA 4NXFA 3T1XA 5E2FA 4YNRA 4L9FA 1PZPA 4ZJ2A 5L10A 1HLUP 2O9CA 4UQIM 3ZCZA 3HLDA 1YM1A 2P9VB 1W8YA 4UA6A 3F1NB 2J3WA 3WS5A 1XX2A 3UE3A 1SZVA 1ALQA 3NC8A 2A3UA 2FZ0A 2Y2KA 1BTLA 4LV0A 5A8BA 2QYBA 1Z09A 5JYPA 5CTNA 3MBZA 4DE3A 1K6SA 1YMXA 3BFCA 3BM6A 1A0KA 2EWWA 1SKOB 2J3TD 5JYOA 4HQAA 3IS2A 1YMSA 3NI9A 1K56D 2XA7M 2JC7A 4LRXC 1GHPA 1BYWA 3CMZA 2PYPA 1DJAA 2VZWA 3QP2A 5L09A 3EEHA 2BTFP 5CECA 1IYOA 4Q0JA 2KDKA 4NETA 1NZOA 3RH8B 1FSYA 2LB5A 2VA0A 4OQ0A 1Y28A 2EXBA 3QNCA 4GB7A 3C8CA 1PYYA 3E4PA 1W63Q 4KZ6A 5BOHA 3WS2A 2VGJA 2R9WA 4OQHA 4JGRA 1KVMA 5M1AA 3CLOA 3U2AA 1ESIA 3CPTB 1PWCA 5M19A 3MQOA 5GHXA 2XK1A 4KZ7A 4BBTA 5AVFA 4PM8A 4IBXA 4HP4A 5HFOA 4UQIS 5EECA 3TSGA 4K91A 4L9EA 4X68A 3OCNA 2PD7A 4I3IA 4RX3A 2ZMVA 5LBRA 1HTZA 3ISGA 3PBQA 4OP5A 1FR1A 4CLCD 5HD5A 5F68A 1K54C 5HAIA 2PD8A 4KZ4A 5AQAA 3IT9A 3GRJA 2EXAA 2I9VA 4LRZE 4E6XA 3VFFA 4QD4A 2Z2LB 2ZC6B 4OKPA 2XROA 4DF6A 1LSXA 2V2FF 4H8RA 5AQ7A 5CERA 3Q81A 5TBMB 4KQRA 1BT5A 4PKYG 2BLSA 5FEFA 3G31A 3UPOA 3V3SA 2J8YA 5EPHA 2ZQAA 3HREA 2V0UA 4F3LA 4GN2A 5A93A 3LEQA 3FZCA 1GA9A 3G2YA 4ZJ1A 4S2OA 1T1CA 1G68A 1O07A 2P7JA 4E04A 5K5BA 1IKGA 4DN0A 1Y54A 5KZHA 2ZC7A 4HIAA 4E3NA 4U0TA 2OSUA 3MFDA 2Y55A 1GSVA 4I3AA 5A91A 3IH8A 3ZDJA 3C38A 1JTDA 4KQQA 4G3WA 4XT2A 4Y17A 5AVEA 1X0OA 1L0EA 2ZQ8A 4HNBA 4EV4A 5HX9A 2XH9A 3MXQA 2FFYA 2VLGA 3BFGA 4BBUA 2K31A 1SDNA 1OT9A 5DKLA 4ID4A 1GHIA 5L07A 4GKUA 3KSGA 1S4RA 1NLYA 3PR6A 3S7PA 2WKHA 5HAPA 3UB6A 5HDDA 1M40A 4GCZA 4HH2A 1KDWA 5E2EA 4QY6A 3UB9A 4Y13A 2FH5A 1PNEA 4B4ZA 5GL9A 1BZAA 3ITBA 1WYBA 5G18A 2G2WA 1P97A 2ZD8A 5FASA 1NJ4A 2Y2NA 1LL5A 2WAEA 3FKWA 3P7NA 1G6OA 1FILA 2WK0A 2Z6DA 5FAPA 1TF1A 3HLBA 3C30A 4FH2A 4PM9A 4BD0A 3BWLA 5FL3A 1L3LA 2JKRI 3LEZA 3B47A 2HZ5A 5HSQA 4BMWA 4LRYC 3CWFA 3ZG9B 4D2OA 2ZM8A 4X1LA 2XEPA 3UMDA 4ARZB 1P9WA 2HF6A 2XLNA 1TS0A 3CG5A 3D9YA 3HLGA 4WELA 1KOUA 3S7OA 3SZTA 4OOYA 5F69A 2ZOIA 3V50A 5F5YA 1E4DA 2V1BA 2G7UA 3E0YA 2W1TA 1MY8A 4LPZA 3PAEA 3OPRA 3CUEA 2WADA 4KZ9A 3ZG8B 3I7JA 3IF6C 3ZQ5A 1YLWA 3IX8A 1T1BA 3IX4A 4K0XA 3EOIA 3WRZA 4G3KA 3T1RA 3KX0X 3F1OB 3RTYA 2BASA 1RGYA 5I94A 3W2ZA 1SCWA 3VP3A 3AGFA 5EM1A 2PBDP 1PI5A 1VB6A 3GVBA 5CHUA 1IOUA 4MN7A 3UPPA 3LCEA 5EOEA 4GZBA 3FPWA 4X53A 1K4FA 5HPIA 2W3DA 3P98A 1J9MA 2PDRA 4EW7A 1K25A 1YLTA 1DJBA 5E2HA 4K0WA 2HV1A 1K56A 3D3OA 2KOIA 1VEUA 3C7VA 1LL9A 4RQ9A 2DCFA 3W8KA 4JXVA 4EBLA 1E3UD 4R6LA 4PAUA 3UMEA 4OPZA 3LI8A 3VSLA 3LYXA 1NRJA 3R7WA 1MWSA 4RVAA 1PWDA 4EESA 5M18A 3W4OA 4GDNA 5DTSA 3C5AA 1H8MA 3BYDA 2PU4A 3IQAA 4P87A 3B3XA 2GDNA 1XPBA 3CITA 1S66L 3VE3A 1MC0A 3IS2B 1NRFA 2OWJA 3F1PA 3LR4A 1IEMA 4JF5A 1DP9A 3S22A 3MXSA 4BL2A 4DKIA 4M4XA 5DVAA 4R4RA 4GW9A 1SHVA 4C6YA 1LI0A 1IYQA 3UB5P 3IWOA 3HLFA 1OTBA 3GV9A 5L2FA 1Q2PA 2VX8A 4CLCE 4XUXA 4HJ3A 4QJGA 3T12B 4HY8A 4X55A 5EVID 2PR5A 2Y2QA 4HH3A 3CI6A 1F9IA 2W1RA 2ZMFA 4P0MA 5F82A 1OTEA 1F2KA 3UO9A 1K54A 4Y2FA 1MZUA 1OT6A 3NOTC 3WWXA 3S1YA 3LGOA 3SOIA 3DTMA 1G28A 5HPFA 2PR6A 2PAVP 5IS1A 3C4PA 4KUKA 4X56A 5FDHA 4Y15A 3RXWA 4OVDA 2ZL1A 4WM9A 4DDYA 4NG2A 3DW0A 2EX9A 2XF3A 2Y2HA 4N9KA 2JKGA 4R3BA 5GHYA 1JNUA 2MJ6A 3ZGAB 3BLSA 3V39A 5FQ9A 4U0XA 2RCXA 2W3HA 4F3LB 3IWQA 4KG2A 2D01A 3IF5A 1H5XA 3TOIA 3A0SA 3O88A 1NXYA 3N8RA 3UN7A 4XT2B 4EUZA 5KMWA 4X69A 2WKPA 1CJFA 1RCJA 4HP9A 3M6HA 3T4SA 1G6AA 3KSIA 4JF4A 4ZTKA 2JE5A 4KENB 2P08A 4OONA 1XJ2A 3GMWA 1LL8A 3MZFA 3NY4A 1L2SA 4OPRA 2B02A 3BJNA 1N9OA 2J3TC 4PMAA 1DP6A 3A3FA 4KQOA 4YINA 2QMIA 2D02A 2GZAA 3Q7ZA 4O7DA 3TW8A 1IKIA 1D06A 4MEZA 1XP4A 2DMWA 2M7UA 1Q2QA 1W7FA 1BSGA 2HDSA 1GHMA 4PM6A 5FQKA 2JBFA 1FIKA 2NUPC 4MN5A 4LV3A 2WGVA 4EQIA 5HWWA 2X01A 4UEYA 2M7VA 4WUJA 5GLAA 5F1FA 3R4KA 5HDSA 2W3GA 3C4OA 3G35A 3OLOA 3HL9A 3IF6A 2K7SA 2L4RA 4BBVA 5C5KA 1TDLA 2IWBA 1ES2A 3IHAA 4A5RA 1TD5A 4ZRRA 4EWFA 5FA7A 2Z6CA 4ETZA 1K55C 1PIOA 4LFUA 3IXGA 2W1TB 1AWIA 1OPXA 2WUQA 3BFFA 4Q0IA 3QP1A 4CLCC 3ZYTA 5HDCA 2V20A 3JVUA 4QY5A 4JXGA 1FCMA 1E3UA 4LENA 3HLWA 3N8LA 3KO6A 3GQZA 4DJ3A 4CQHA 4DXBA 3FWLA 4WEJA 1S1ZA 1D1JA 4HI4A 1JWVA 4GLQA 3G34A 2OV5A 1YSPA 2Y2MA 1TS6A 1BUEA 1S67L 5DJTA 2V9AA 5HD3A 2XR0A 2Y2IA 3LR0A 3NECA 1PW1A 2CC1A 4E3KA 1ZTUA 1ERQA 5FQQA 2JKRM 2XD1A 3CHWP 3ZNTA 5FQMA 1FR6A 3PBNA 4R38A 1C3BA 5DF7A 5FI2A 3QP8A 3MMHA 2O9AA 4KZ5A 1K38A 3T4TA 3MZDA 4OP8A 5G4YA 4ZJ3A 3R7WB 4OPQA 2OOLA 3HJKA 2EX8A 2HPBA 2XQZA 4NEED 1L0GA 5J8XA 2RL3A 3B42A 1FCNA 1KGFA 1IYSA 1KE0A 3JVVA 3OOVA 4HBTA 3LY4A 2Y4AA 2OAP1 5HL1A 3F1PB 5FAOA 4FUWA 4YWZA 4OQGA 5I5LA 2W27A 3RFBA 1OTIA 4S2JA 3M6BA 2J9OA 3MS6A 4GDBA 3VV4A 3FKVA 2KX6A 4R3JA 3N4IA 1T19A 3FYZA 3ZVTA 3O5YA 3T4LA 3OPLA 1AXBA 3OZHA 5HWVA 4P6ZS 1TEMA 3F1NA 2HDQA 4IVIA 3D4FA 1CEGA 1ES3A 4OLDA 4Z1WA 1I5QA 1KGGA 4PM7A 1OMEA 4DMZA 1EROA 4L0LA 5EFWA 1EW0A 1KGEA 4WZ5C 5DTKA 4E3JA 2A2LA 4B9OA 4I39A 5FAQA 3T50A 4UA7A 1MBLA 3IH9A 4M3KA 4GS9A 2FFFB 4S2MA 3NOPC 2Y2GA 2QWSA 1N9LA 3VP1A 3IHBA 2GJ3A 1MKMA 3G4PA 3UPNA 2INWA 3MFXA 2HDUA 3H7WA 2HP5A 2EA9A 2ZL1B 4BD1A 3AGDA 4E6WA 1NYYA 3E2KA 1BLSA 3UY6A 2VGKA 3UE0A 2VV7A 3GSGA 4WBGA 1PRQA 3NDEA 4Y5FA 2VJWA 2ZM0A 4II7A 3E2LA 4N1HA 3T4JA 3M2KA 4WZ4A 1DJCA 3BRMA 1D7EA 3CJMA 4WL9A 2KLIA 5DKKA 2J9PA 3HUNA 2Q9NA 3TE8A 5CX7A 3WS1A 2ZC3B 2GX5A 3V67A 1LSWA 2P74A 4GHIA 1S0WA 2I72A 4R3AA 1YLYA 3T1QB 3BFEA 3IX3A 1YLZA 2O0YA 4HBUA 3NBLA 2OLUA 1ONGA 3LO7A 3T4QA 3VSKA 4O0PA 4B93A 1WYCA 2EFXA 3SW1A 3KYZA 5DFXA 3UDXA 4OLGA 4Z9QA 4OPYA 3H9WA 1MPLA 3NCKA 2C6WB 4RX2A 3M2JA 3G32A 3PTEA 2V1ZA 3LIFA 1IFQA 2ZM2A 3S4XA 3IWIA 4Q0HA 3UE6A 2B5RA 3GTCA 4N9LA 1P0ZA 1M6KA 5FDSA 2O99A 4R23A 5CRFA 2Q9MA 4ME4A 4LGWA 4KG5A 3BLMA 5CHJA 4NXBA 2A24A 4IBRA 2ZBBA 5TJJA 3QNBA 4DXCA 3BW6A 4IVKA 2IWCA 4B4XA 4ESPA 3PYPA 5EE8A 4Y0TA 4LLOB 3NOUC 2O9BA 2H10A 1K55A 1MWTA 4Y0OA 5EVIC 4FSFA 4R0QA 1ZC2A 2VK3A 1H8YA 4N92A 3IF6B 3BY9A 1OJGA 2HJEA 3Q82A 1NLZA 4CLCA 3NDGA 4BL3A 5F1GA 3O87A 2BG1A 2G2UA 5KSCA 1XFQA 2PT7A 3VP4A 3L7HA 4EXOA 5J7EA 3O86A 2WZZA 1L0FA 1XXMA 1W5DA 2OAQ1 4GD8A 3A3EA 5CGXA 1JVJA 3MJQA 3VOYA 3HVFA 1G5UA 2Y2PA 1CQAA 2ZC4B 3OBFA 3OPPA 1T1AA 4EBPA 4X6TA 5AQBA 2WZXA 1OTDA 3MF0A 5DTTA 1PWGA 3HCYA 2B95A 2C5WB 2VV8A 1Z6FA 4Y7PA 3LICA 1XA1A 3DAVA 2P04A 4RYEA 1YAXA 3Q07A 1JWPA 3U4LP 4JLFA 4ZAMA 5GHZA 1XGIA 3LFVA 1GA0A 4QHCA 3EGDC 3OCLA 4JGOA 2W0NA 4EETB 3UNWA 3SH8A 2A49A 3QP5A 4LV1A 1V9YA 2DNSA 4P6BA 3DTKA 2Z2MB 4JGQA 1GSWA 3MXRA 5CEBA 1H8ZA 1F98A 1NYMA 4HEFA 1XKZA 1YLJA 2K2NA 3A3IA 1LHYA 1ES5A 3CZDA 5FI7A 1YT4A 3PBOA 1XJ4A 4KUOA 2HGVA 4C3QA 5HARA 4U3TA 1XGJA 1TVFA 1Y4OA 3MKEA 2XRNA 1KVLA 4UHUA 5G4ZA 2JKTI 3HBRA 3FC7A 2M1CA 4FTXA 2V8CA 1XJ3A 4DJ2A 2WKRA 4PHTA 3HJIA 3IXHA 1MXOA 1DRMA 4IUHA 2QJ7A 1BLPA 4O8GA 3BQAA 3IBRA 3SS4A 3A3DA 5KIZA 1ES4A 4MBHA 4EUVA 4GJ4A 3HLCA 1LI9A 4JPMA 1V9ZA 1GCEA 5DF8A 5HWTA 2QHKA 3S7QA 3DTEA 4CPKA 3A0VA 1PFLA 5A90A 4WZ5A 2H5SA 4Q8IA 3TJZC 2VV6A 2ACGA 2Y91A 3RJUA 3LIDA 3VP2A 3IBJA 3ULFA 3IXBA 2WAFA 1I2WA 2H28A 2WYXA 3WS0A 1UGUA 3A3JA 3VE4A 4HJ6A 1U60A 3KSHA 1O7EA 3TG9A 4JF6A 3N8SA 2H0TA 1VETA 5FQIA 5TFQA 1BLHA 4NKPA 3MZEA 4GS9B 3K2NA 3BECA 4BQMA 1MKIA 4E3IA 2DRWA 1P9RA 4QWOA 3T1SA 3FV7A 3V3RA 2WKQA 2X71A 5AQ9A 5EM0A 1SDEA 2JKFA 2ZC5B 2W3FA 3NULA 3H7WB 3H82A 5D3OA 3SH7A 1FQGA 4JKTA 1S1YA 1BLCA 2EWVA 2ZQDA 1IELA 2CMNA 4DE2A 5EOOA 2JCHA 1OJ5A 4Y0UA 1CI8A 3LIEA 1LSVA 1CK3A 3ZHHA 1VM1A 1LLBA 2PYRA 2WGWA 3IXDA 2AVXA 2QPNA 4RA7A 4R1GA 4OH0A 4I38A 4EQ1A 4S2PA 1JTGA 1KE3A 1W8QA 2L1MA 4XXRA 2ZQ9A 4CJNA 1JWZA 1UWPX 4UAAA 1LT0A 1WA9A 4P6ZM 2ZOHA 4H6JA 3GECA 1SKFA 4JXSA 2Y2LA 5F6AA 1TS8A 3TRCA 1FCOA 4GHIB 3EEAA 1F5MA 1XA7A 4HHDA 1RGZA 1CEFA 1N9BA 5MC7A 4WF0A 5CGSA 3CAXA 3PXPA 3SS3A 1HD8A 3GDIA 4P85A 4O01A 1VEUB 2XA7S 1YQSA 2VEAA 1VHMA 5TR7A 4LCMA 1E25A 3FPVA 4N1XA 4HESA 4WMCD 3NIAA 3BY8A 3MSHA 3N7WA 4MNRA 2XSSA 2ZJ9A 5FI6A 3SH9A 1W79A 1K57C 3NHQA 3E4QA 1L0DA 4EERA 2W3EA 5HAQA 4G3VA 5EVIA 4WEKA 3Q7VA 1PW8A 2HDRA 4DRTA 1N9NA 3V5MA 2A24B 1XFNA 1YKDA 3FG8A 1TS7A 3QP6A 4NK3A 5IT5A 4L9GA 2QJ5A 3RXXA 4S2NC 1HZOA 4ETXA 4MBKA 4S2KA 4ZDXA 1W63M 3WS4A 4GNUA 2P9VA 4MN6A 5FQJA 3EQUA 2VGLM 4NXGA 2XGNA 4MCWA 3DWKA 4CLCB 2PBYA 1ZKJA 1SKOA 3LUQA 2Y2OA 1TDGA 3K3CA 3VP0A 4S2IA 3VMAA 2NUTC 2WGIA 5CGWA 1YSQA 3LR5A 3WRTA 2V1AA 3SS5A 4X25A 5L8MA 4BJPA 4ZBEA 4OOMA 4KG6A 4FCFA 4F94A 4JGPA 4MDZA 4DE0A 3BEBA 5EVEA 1DY6A 1NZUA 1KDSA 4B88A 4KZ3A 3LIAA 4E3LA 4K08A 1K0KA 5F83A 2WKEA 4QPRA 2L0WA 1EI5A 1DP8A 3NJAA 3QP4A 2VKSA 3JYIA 3QHYA 3EQVA 5HW3A 5IHVA 2J7VA 3CPTA 5IU1A 2X02A 4PPRA 3DWZA 2YKFA 4EEUA 2Q0OA 2Y8HA 3T4OA 3E4OA 3UDFA 3PBSA 2HJ9C 2IA2A 3W4PA 5CEDA 5GLBA 3L9KA 3BQ8A 1MWRA 1QMFA 1UWNX 4R4SA 5A92A 1S6RA 2YKHA 2R78A 5GLDA 4YFMA 2VGLS 5AJGA 5KSHA 3JPUA 3MQQA 3ICYA 3MQ0A 2PRFA 2QKPA 2XD5A 3LY3A 4JBFA 4I3JA 3B33A 1PI4A 3KYEA 4GOGA 1J3WA 4X1MA 4D60A 2LB9A 3UB7A 3T4KA 3KSFA 3MKFA 3ZFZA 4IJGA 1STZA 3PHYA 2JN7A 1HVBA 4EEPA 5TBMA 3G2ZA 4GD6A 4HOIA 3E98A 2XFSA 1ZG6A 2UWXA 4EU0A 2XDMA 3UDIA 3DTIA 3VOLA 3Q1FA 4Y3IA 3VFHA 4JXWA 2B18A 1T18A 1NWZA 3PBRA 5FSRA 1N4OA 4UA9A 1K4EA 1OTAA 1EWZA 1CF0A 4R70A 1PZOA 2R9XA 3G30A 4EBNA 2JHEA 3C7UA 4IEDA 3LIBA 4OQIA 3S7NA 3MR0A 1ODVA 3OC2A 3ITAA 1XJ6A 1VETB 3VOZA 2Y59A 3O3VA 4PKYA 3PAGA 3UB8A 2ZQCA 4XUZA 2HP6A 4BLMA 3EWKA 4OOLA 4KZAA 3P09A 1WE4A 2ZQ7A 1YPRA 4FD8A 1H0MA 5DF9A 1ZHHB 4DDSA 4HJ4A 5U47A 5DJUA 4S2LA 4LV2A 3ZG5A 4E3OA 4MLLA 2Y79A 2OLVA 1NY0A 3H82B 1ZG4A 1ONHA 5CXWA 2JKTM 3C2WA 4KZBA 5J3WA 3HUMA 3ZG7B 3G6OA 5E2GA 1ESUA 4LCLA 4YOFA 1K6RA 1KE4A 2UV0E 4AFIA 2WGWB 3W4QA 4QB8A 1CI9A 5FATA 5HZHA 4I5SA 1VQQA 4QU3A 5DFYA 2J80A 3KYQA 4WMCA 1H3QA 3DBAA 2QZ6A 1BULA 2ZMAA 5J4EA 4FH4A 4ARZA 3OPHA 4H6JB 2H0YA 3AGEA 5EUAA 2PU2A 3EGXC 3LR3A 1ERMA 1YLPA 4E3MA 1S4SA 2E8JA 5GLCA 3ZG0A 2Y2JA 2V8FA 3ZNYA 4MBFA 1I2SA 3A0RA 5HL6A 1K57A 2PHYA 1GSXA 3P01A 4BENA 2WKIA 4FOFA 2XFTA 2ZLYA 4WLAA 4KZ8A 4NXEA 1IYPA 1FOFA 2EX6A 3LI9A 3F1OA 4MMNA 5TGFA 3K3DA 4C75A 1FSWA 3UE1A 4IHQA 3BFDA 4BWIA 4PM5A 3D72A 4IUKA 4S2NA 4WN5A 3PBTA 4DE1A 1QMEA 2HP9A 4WYYA 2V0WA 1MWUA 5E43A 2E8IA 3CUEC 3HUOA 2IWDA 5EVIB
chains in the Genus database with same CATH topology
1MBLA 3Q7VB 3IH9A 4M3KA 2EFUA 2FFFB 4JF5A 4S2MA 5CHMA 1SKFA 3HLEA 2Y2LA 4JXSA 3S22A 3MXSA 4BL2A 4DKIA 1FCOA 1RP5A 1XA7A 2Y2GA 2EX2A 3ZVWA 5DVAA 1RGZA 1CEFA 3N6IA 4R4RA 1N9BA 1SHVA 4C6YA 3GR2A 3VP1A 3IHBA 1LI0A 3G4PA 3UPNA 5CTMA 1IYQA 5CGSA 3IWOA 5EVLA 3HLFA 2HDUA 3SS3A 1HD8A 2HP5A 5E2FA 4P85A 3GV9A 4BD1A 3AGDA 4E6WA 1NYYA 3E2KA 5L2FA 1BLSA 1Q2PA 3UY6A 1PZPA 2VGKA 4ZJ2A 1YQSA 4XUXA 3UE0A 5TR7A 3ZCZA 4LCMA 3HLDA 1E25A 1YM1A 3GSGA 4N1XA 4QJGA 4WBGA 2P9VB 4HESA 1W8YA 3NIAA 4UA6A 3NDEA 4UAAA 4WMCD 4X55A 3WS5A 5EVID 1XX2A 3UE3A 1ALQA 2Y2QA 3NC8A 3N7WA 2A3UA 2Y2KA 2ZM0A 4MNRA 1BTLA 3E2LA 4LV0A 4N1HA 5JYPA 2ZJ9A 5CTNA 3M2KA 3MBZA 4WZ4A 1K6SA 1YMXA 4P0MA 4DE3A 3BFCA 5F82A 3BM6A 5FI6A 3SH9A 1W79A 1DJCA 3UO9A 3BRMA 1K54A 5JYOA 1K57C 3CJMA 3WWXA 3S1YA 1L0DA 3SOIA 1YMSA 2J9PA 3NI9A 3DTMA 5HAQA 1K56D 2JC7A 5EVIA 3HUNA 4WEKA 2Q9NA 3Q7VA 1PW8A 2HDRA 4DRTA 1GHPA 3V5MA 3WS1A 2ZC3B 3CMZA 1DJAA 3C4PA 2P74A 5CECA 1IYOA 1S0WA 2I72A 4NK3A 1YLYA 4X56A 5FDHA 4NETA 1NZOA 3BFEA 1YLZA 3RXXA 4HBUA 3NBLA 1FSYA 4S2NC 2OLUA 3RXWA 1ONGA 4OQ0A 4OVDA 3LO7A 1HZOA 3VSKA 1WYCA 2EXBA 2EFXA 3QNCA 4GB7A 4WM9A 4MBKA 4S2KA 3UDXA 4OLGA 1PYYA 4ZDXA 4Z9QA 4DDYA 3WS4A 4OPYA 4GNUA 1MPLA 2P9VA 4KZ6A 5BOHA 3WS2A 3NCKA 2C6WB 2VGJA 5FQJA 2R9WA 3EQUA 4OQHA 3DW0A 1KVMA 3M2JA 2XGNA 4RX2A 5M1AA 3G32A 2EX9A 3PTEA 3DWKA 2V1ZA 2PBYA 2XF3A 2Y2HA 4N9KA 1ESIA 2ZM2A 3S4XA 3IWIA 4R3BA 2B5RA 1PWCA 3GTCA 5GHYA 5M19A 4N9LA 5GHXA 2XK1A 4KZ7A 1ZKJA 3ZGAB 1M6KA 3BLSA 4R23A 2Y2OA 1TDGA 5CRFA 3V39A 4S2IA 5FQ9A 4U0XA 2RCXA 3VP0A 2Q9MA 3VMAA 3IWQA 2WGIA 5CGWA 3WRTA 4KG2A 4PM8A 4IBXA 5HFOA 4KG5A 3BLMA 5CHJA 5EECA 3SS5A 3TSGA 4K91A 3IF5A 4BJPA 4ZBEA 4IBRA 4X68A 3OCNA 1H5XA 3TOIA 4OOMA 4KG6A 3QNBA 4FCFA 4F94A 3O88A 4DXCA 4IVKA 4RX3A 2IWCA 4B4XA 1HTZA 3BEBA 3ISGA 4DE0A 1DY6A 1NZUA 1NXYA 1KDSA 3N8RA 3PBQA 3UN7A 4OP5A 1FR1A 4B88A 4EUZA 4KZ3A 5EE8A 5KMWA 4X69A 4E3LA 4Y0TA 1K54C 1RCJA 2H10A 5HAIA 3M6HA 5F83A 4KZ4A 1K55A 1G6AA 2WKEA 5AQAA 1EI5A 3IT9A 3GRJA 1MWTA 4Y0OA 2EXAA 5EVIC 4E6XA 3VFFA 4FSFA 4JF4A 4QD4A 2Z2LB 4ZTKA 2JE5A 2ZC6B 4OKPA 4R0QA 1ZC2A 4KENB 3JYIA 4DF6A 1H8YA 4N92A 3QHYA 2V2FF 4OONA 3GMWA 3MZFA 3EQVA 3NY4A 3IF6B 5HW3A 1L2SA 5IHVA 4OPRA 4H8RA 5AQ7A 5CERA 3Q82A 3Q81A 3NDGA 2J7VA 4KQRA 1BT5A 2BLSA 4BL3A 4PMAA 2X02A 3O87A 5F1GA 3G31A 2BG1A 2G2UA 3A3FA 4KQOA 4YINA 5KSCA 4PPRA 3DWZA 2QMIA 3UPOA 3V3SA 2J8YA 5EPHA 2ZQAA 3VP4A 3HREA 3UDFA 3PBSA 3Q7ZA 3O86A 4O7DA 2WZZA 1L0FA 3W4PA 4GN2A 1XXMA 5A93A 1W5DA 5CEDA 3FZCA 5GLBA 4GD8A 1GA9A 3A3EA 3G2YA 4ZJ1A 1IKIA 4S2OA 1MWRA 1QMFA 4MEZA 1JVJA 1G68A 1O07A 5CGXA 3VOYA 1XP4A 4R4SA 5A92A 1S6RA 1Q2QA 3HVFA 2Y2PA 1W7FA 1BSGA 1IKGA 1GHMA 2HDSA 1Y54A 5GLDA 4YFMA 5KZHA 2ZC7A 4E3NA 4PM6A 4U0TA 5FQKA 5KSHA 2OSUA 3MFDA 2Y55A 2ZC4B 2JBFA 3OPPA 5A91A 3IH8A 3ZDJA 4LV3A 2XD5A 1JTDA 4EBPA 4KQQA 4X6TA 2WGVA 4EQIA 3LY3A 4JBFA 5AQBA 2X01A 1L0EA 2ZQ8A 5GLAA 4EV4A 5HX9A 5F1FA 2XH9A 2WZXA 1PI4A 4GOGA 2FFYA 5DTTA 1PWGA 2C5WB 1Z6FA 3BFGA 3MKFA 1SDNA 4Y7PA 3ZFZA 1XA1A 3C4OA 3G35A 4ID4A 1GHIA 4GKUA 4RYEA 3HL9A 3IF6A 1HVBA 3Q07A 1JWPA 4JLFA 4ZAMA 5GHZA 1XGIA 1GA0A 1TDLA 3G2ZA 4QHCA 2IWBA 3OCLA 4GD6A 3UNWA 1ES2A 2XFSA 2WKHA 5HAPA 3IHAA 3SH8A 4A5RA 2A49A 1ZG6A 4LV1A 4EWFA 5FA7A 1M40A 2DNSA 2UWXA 4P6BA 1KDWA 2Z2MB 4QY6A 5E2EA 1K55C 2XDMA 3UDIA 3MXRA 1PIOA 4B4ZA 5CEBA 3IXGA 1BZAA 1H8ZA 3Q1FA 5GL9A 3ITBA 3VFHA 4JXWA 4HEFA 1NYMA 1WYBA 5G18A 1XKZA 2G2WA 1YLJA 2ZD8A 5FASA 2WUQA 1NJ4A 2Y2NA 1LL5A 3A3IA 1LHYA 1ES5A 3CZDA 5FI7A 3PBRA 5FSRA 1N4OA 1YT4A 2WAEA 1K4EA 3BFFA 3FKWA 3PBOA 4UA9A 1EWZA 2WK0A 5FAPA 4BD0A 3HLBA 4FH2A 4PM9A 4C3QA 5HARA 4U3TA 1PZOA 1XGJA 3LEZA 2R9XA 1TVFA 2V20A 3G30A 4EBNA 3MKEA 4QY5A 4JXGA 1KVLA 4UHUA 3C7UA 1FCMA 1E3UA 4IEDA 4LENA 3HLWA 3HBRA 4OQIA 3N8LA 3GQZA 4DXBA 3FWLA 3ZG9B 3OC2A 4WEJA 4D2OA 3ITAA 1JWVA 3G34A 3IXHA 3VOZA 2Y59A 3O3VA 2ZM8A 2OV5A 2XEPA 1MXOA 3PAGA 2ZQCA 2Y2MA 2XLNA 2HP6A 4XUZA 1BUEA 4BLMA 1BLPA 4OOLA 3CG5A 4KZAA 3P09A 1WE4A 2ZQ7A 3SS4A 4FD8A 3A3DA 3HLGA 4WELA 1ES4A 2XR0A 4MBHA 2Y2IA 5DF9A 1PW1A 2CC1A 3HLCA 4DDSA 4E3KA 1LI9A 5U47A 4JPMA 4OOYA 1ERQA 1GCEA 4LV2A 4S2LA 5DF8A 3ZG5A 5FQQA 4E3OA 3V50A 4MLLA 1E4DA 2OLVA 2XD1A 1NY0A 3ZNTA 4CPKA 1ZG4A 5FQMA 1FR6A 3PBNA 5A90A 4WZ5A 1ONHA 1MY8A 5CXWA 2H5SA 4Q8IA 3PAEA 3OPRA 1C3BA 5DF7A 5FI2A 2WADA 4KZ9A 3ZG8B 3I7JA 4KZBA 3HUMA 2Y91A 3IF6C 1YLWA 4KZ5A 3RJUA 4K0XA 1K38A 3ZG7B 3WRZA 3MZDA 4OP8A 3VP2A 5E2GA 1ESUA 4LCLA 4ZJ3A 1K6RA 1KE4A 1RGYA 4OPQA 2WGWB 5I94A 3IXBA 2WAFA 2EX8A 1I2WA 2HPBA 3W4QA 2XQZA 1SCWA 4QB8A 3VP3A 3AGFA 5J8XA 1CI9A 1L0GA 5FATA 2WYXA 1PI5A 1VQQA 2RL3A 3GVBA 5CHUA 1FCNA 1KGFA 3UPPA 3WS0A 3A3JA 1IYSA 4QU3A 3LCEA 1U60A 4WMCA 1KE0A 5EOEA 2QZ6A 4GZBA 4HBTA 3LY4A 1O7EA 4X53A 3TG9A 2Y4AA 1BULA 1K4FA 3N8SA 2H0TA 4JF6A 5HL1A 2ZMAA 5FQIA 5FAOA 5TFQA 3P98A 1J9MA 4FH4A 4OQGA 1BLHA 3MZEA 3OPHA 3BECA 1K25A 2H0YA 4BQMA 1MKIA 1YLTA 4E3IA 1DJBA 3AGEA 4S2JA 2DRWA 3M6BA 2J9OA 5EUAA 5E2HA 2PU2A 3FV7A 3V3RA 4GDBA 1ERMA 1YLPA 2X71A 4K0WA 5AQ9A 4E3MA 1SDEA 3FKVA 2ZC5B 1K56A 4R3JA 3N4IA 5GLCA 2Y2JA 3ZG0A 3FYZA 3ZVTA 3ZNYA 3C7VA 4MBFA 1LL9A 3OPLA 5D3OA 1I2SA 1FQGA 2DCFA 1K57A 3SH7A 1AXBA 4JKTA 2ZQDA 1BLCA 3W8KA 3OZHA 1IELA 4JXVA 4DE2A 5EOOA 4EBLA 2JCHA 4Y0UA 1CI8A 1E3UD 1TEMA 4BENA 2HDQA 2WKIA 2XFTA 1CK3A 3ZHHA 4IVIA 4OPZA 2ZLYA 3VSLA 1VM1A 4KZ8A 1IYPA 1FOFA 2EX6A 3D4FA 1MWSA 1CEGA 1LLBA 4RVAA 5TGFA 4C75A 1PWDA 1ES3A 1FSWA 4OLDA 3UE1A 5M18A 2WGWA 3BFDA 3W4OA 3IXDA 2QPNA 4PM5A 4GDNA 5DTSA 1I5QA 1KGGA 4RA7A 4PM7A 4OH0A 4R1GA 3C5AA 3BYDA 1OMEA 2PU4A 3IQAA 3B3XA 4P87A 1EROA 4S2PA 4S2NA 2GDNA 3PBTA 4L0LA 1JTGA 1XPBA 4DE1A 1QMEA 1KE3A 1KGEA 1W8QA 4WZ5C 5DTKA 4E3JA 2HP9A 4WYYA 1MWUA 4XXRA 2ZQ9A 4CJNA 1JWZA 1NRFA 2E8IA 5E43A 3HUOA 5FAQA 1IEMA 2IWDA 4UA7A 5EVIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MBL A;  3Q7V B;  3IH9 A;  4M3K A;  2EFU A;  2FFF B;  4JF5 A;  4S2M A;  5CHM A;  1SKF A;  3HLE A;  2Y2L A;  4JXS A;  3S22 A;  3MXS A;  4BL2 A;  4DKI A;  1FCO A;  1RP5 A;  1XA7 A;  2Y2G A;  2EX2 A;  3ZVW A;  5DVA A;  1RGZ A;  1CEF A;  3N6I A;  4R4R A;  1N9B A;  1SHV A;  4C6Y A;  3GR2 A;  3VP1 A;  3IHB A;  1LI0 A;  3G4P A;  3UPN A;  5CTM A;  1IYQ A;  5CGS A;  3IWO A;  5EVL A;  3HLF A;  2HDU A;  3SS3 A;  1HD8 A;  2HP5 A;  5E2F A;  4P85 A;  3GV9 A;  4BD1 A;  3AGD A;  4E6W A;  1NYY A;  3E2K A;  5L2F A;  1BLS A;  1Q2P A;  3UY6 A;  1PZP A;  2VGK A;  4ZJ2 A;  1YQS A;  4XUX A;  3UE0 A;  5TR7 A;  3ZCZ A;  4LCM A;  3HLD A;  1E25 A;  1YM1 A;  3GSG A;  4N1X A;  4QJG A;  4WBG A;  2P9V B;  4HES A;  1W8Y A;  3NIA A;  4UA6 A;  3NDE A;  4UAA A;  4WMC D;  4X55 A;  3WS5 A;  5EVI D;  1XX2 A;  3UE3 A;  1ALQ A;  2Y2Q A;  3NC8 A;  3N7W A;  2A3U A;  2Y2K A;  2ZM0 A;  4MNR A;  1BTL A;  3E2L A;  4LV0 A;  4N1H A;  5JYP A;  2ZJ9 A;  5CTN A;  3M2K A;  3MBZ A;  4WZ4 A;  1K6S A;  1YMX A;  4P0M A;  4DE3 A;  3BFC A;  5F82 A;  3BM6 A;  5FI6 A;  3SH9 A;  1W79 A;  1DJC A;  3UO9 A;  3BRM A;  1K54 A;  5JYO A;  1K57 C;  3CJM A;  3WWX A;  3S1Y A;  1L0D A;  3SOI A;  1YMS A;  2J9P A;  3NI9 A;  3DTM A;  5HAQ A;  1K56 D;  2JC7 A;  5EVI A;  3HUN A;  4WEK A;  2Q9N A;  3Q7V A;  1PW8 A;  2HDR A;  4DRT A;  1GHP A;  3V5M A;  3WS1 A;  2ZC3 B;  3CMZ A;  1DJA A;  3C4P A;  2P74 A;  5CEC A;  1IYO A;  1S0W A;  2I72 A;  4NK3 A;  1YLY A;  4X56 A;  5FDH A;  4NET A;  1NZO A;  3BFE A;  1YLZ A;  3RXX A;  4HBU A;  3NBL A;  1FSY A;  4S2N C;  2OLU A;  3RXW A;  1ONG A;  4OQ0 A;  4OVD A;  3LO7 A;  1HZO A;  3VSK A;  1WYC A;  2EXB A;  2EFX A;  3QNC A;  4GB7 A;  4WM9 A;  4MBK A;  4S2K A;  3UDX A;  4OLG A;  1PYY A;  4ZDX A;  4Z9Q A;  4DDY A;  3WS4 A;  4OPY A;  4GNU A;  1MPL A;  2P9V A;  4KZ6 A;  5BOH A;  3WS2 A;  3NCK A;  2C6W B;  2VGJ A;  5FQJ A;  2R9W A;  3EQU A;  4OQH A;  3DW0 A;  1KVM A;  3M2J A;  2XGN A;  4RX2 A;  5M1A A;  3G32 A;  2EX9 A;  3PTE A;  3DWK A;  2V1Z A;  2PBY A;  2XF3 A;  2Y2H A;  4N9K A;  1ESI A;  2ZM2 A;  3S4X A;  3IWI A;  4R3B A;  2B5R A;  1PWC A;  3GTC A;  5GHY A;  5M19 A;  4N9L A;  5GHX A;  2XK1 A;  4KZ7 A;  1ZKJ A;  3ZGA B;  1M6K A;  3BLS A;  4R23 A;  2Y2O A;  1TDG A;  5CRF A;  3V39 A;  4S2I A;  5FQ9 A;  4U0X A;  2RCX A;  3VP0 A;  2Q9M A;  3VMA A;  3IWQ A;  2WGI A;  5CGW A;  3WRT A;  4KG2 A;  4PM8 A;  4IBX A;  5HFO A;  4KG5 A;  3BLM A;  5CHJ A;  5EEC A;  3SS5 A;  3TSG A;  4K91 A;  3IF5 A;  4BJP A;  4ZBE A;  4IBR A;  4X68 A;  3OCN A;  1H5X A;  3TOI A;  4OOM A;  4KG6 A;  3QNB A;  4FCF A;  4F94 A;  3O88 A;  4DXC A;  4IVK A;  4RX3 A;  2IWC A;  4B4X A;  1HTZ A;  3BEB A;  3ISG A;  4DE0 A;  1DY6 A;  1NZU A;  1NXY A;  1KDS A;  3N8R A;  3PBQ A;  3UN7 A;  4OP5 A;  1FR1 A;  4B88 A;  4EUZ A;  4KZ3 A;  5EE8 A;  5KMW A;  4X69 A;  4E3L A;  4Y0T A;  1K54 C;  1RCJ A;  2H10 A;  5HAI A;  3M6H A;  5F83 A;  4KZ4 A;  1K55 A;  1G6A A;  2WKE A;  5AQA A;  1EI5 A;  3IT9 A;  3GRJ A;  1MWT A;  4Y0O A;  2EXA A;  5EVI C;  4E6X A;  3VFF A;  4FSF A;  4JF4 A;  4QD4 A;  2Z2L B;  4ZTK A;  2JE5 A;  2ZC6 B;  4OKP A;  4R0Q A;  1ZC2 A;  4KEN B;  3JYI A;  4DF6 A;  1H8Y A;  4N92 A;  3QHY A;  2V2F F;  4OON A;  3GMW A;  3MZF A;  3EQV A;  3NY4 A;  3IF6 B;  5HW3 A;  1L2S A;  5IHV A;  4OPR A;  4H8R A;  5AQ7 A;  5CER A;  3Q82 A;  3Q81 A;  3NDG A;  2J7V A;  4KQR A;  1BT5 A;  2BLS A;  4BL3 A;  4PMA A;  2X02 A;  3O87 A;  5F1G A;  3G31 A;  2BG1 A;  2G2U A;  3A3F A;  4KQO A;  4YIN A;  5KSC A;  4PPR A;  3DWZ A;  2QMI A;  3UPO A;  3V3S A;  2J8Y A;  5EPH A;  2ZQA A;  3VP4 A;  3HRE A;  3UDF A;  3PBS A;  3Q7Z A;  3O86 A;  4O7D A;  2WZZ A;  1L0F A;  3W4P A;  4GN2 A;  1XXM A;  5A93 A;  1W5D A;  5CED A;  3FZC A;  5GLB A;  4GD8 A;  1GA9 A;  3A3E A;  3G2Y A;  4ZJ1 A;  1IKI A;  4S2O A;  1MWR A;  1QMF A;  4MEZ A;  1JVJ A;  1G68 A;  1O07 A;  5CGX A;  3VOY A;  1XP4 A;  4R4S A;  5A92 A;  1S6R A;  1Q2Q A;  3HVF A;  2Y2P A;  1W7F A;  1BSG A;  1IKG A;  1GHM A;  2HDS A;  1Y54 A;  5GLD A;  4YFM A;  5KZH A;  2ZC7 A;  4E3N A;  4PM6 A;  4U0T A;  5FQK A;  5KSH A;  2OSU A;  3MFD A;  2Y55 A;  2ZC4 B;  2JBF A;  3OPP A;  5A91 A;  3IH8 A;  3ZDJ A;  4LV3 A;  2XD5 A;  1JTD A;  4EBP A;  4KQQ A;  4X6T A;  2WGV A;  4EQI A;  3LY3 A;  4JBF A;  5AQB A;  2X01 A;  1L0E A;  2ZQ8 A;  5GLA A;  4EV4 A;  5HX9 A;  5F1F A;  2XH9 A;  2WZX A;  1PI4 A;  4GOG A;  2FFY A;  5DTT A;  1PWG A;  2C5W B;  1Z6F A;  3BFG A;  3MKF A;  1SDN A;  4Y7P A;  3ZFZ A;  1XA1 A;  3C4O A;  3G35 A;  4ID4 A;  1GHI A;  4GKU A;  4RYE A;  3HL9 A;  3IF6 A;  1HVB A;  3Q07 A;  1JWP A;  4JLF A;  4ZAM A;  5GHZ A;  1XGI A;  1GA0 A;  1TDL A;  3G2Z A;  4QHC A;  2IWB A;  3OCL A;  4GD6 A;  3UNW A;  1ES2 A;  2XFS A;  2WKH A;  5HAP A;  3IHA A;  3SH8 A;  4A5R A;  2A49 A;  1ZG6 A;  4LV1 A;  4EWF A;  5FA7 A;  1M40 A;  2DNS A;  2UWX A;  4P6B A;  1KDW A;  2Z2M B;  4QY6 A;  5E2E A;  1K55 C;  2XDM A;  3UDI A;  3MXR A;  1PIO A;  4B4Z A;  5CEB A;  3IXG A;  1BZA A;  1H8Z A;  3Q1F A;  5GL9 A;  3ITB A;  3VFH A;  4JXW A;  4HEF A;  1NYM A;  1WYB A;  5G18 A;  1XKZ A;  2G2W A;  1YLJ A;  2ZD8 A;  5FAS A;  2WUQ A;  1NJ4 A;  2Y2N A;  1LL5 A;  3A3I A;  1LHY A;  1ES5 A;  3CZD A;  5FI7 A;  3PBR A;  5FSR A;  1N4O A;  1YT4 A;  2WAE A;  1K4E A;  3BFF A;  3FKW A;  3PBO A;  4UA9 A;  1EWZ A;  2WK0 A;  5FAP A;  4BD0 A;  3HLB A;  4FH2 A;  4PM9 A;  4C3Q A;  5HAR A;  4U3T A;  1PZO A;  1XGJ A;  3LEZ A;  2R9X A;  1TVF A;  2V20 A;  3G30 A;  4EBN A;  3MKE A;  4QY5 A;  4JXG A;  1KVL A;  4UHU A;  3C7U A;  1FCM A;  1E3U A;  4IED A;  4LEN A;  3HLW A;  3HBR A;  4OQI A;  3N8L A;  3GQZ A;  4DXB A;  3FWL A;  3ZG9 B;  3OC2 A;  4WEJ A;  4D2O A;  3ITA A;  1JWV A;  3G34 A;  3IXH A;  3VOZ A;  2Y59 A;  3O3V A;  2ZM8 A;  2OV5 A;  2XEP A;  1MXO A;  3PAG A;  2ZQC A;  2Y2M A;  2XLN A;  2HP6 A;  4XUZ A;  1BUE A;  4BLM A;  1BLP A;  4OOL A;  3CG5 A;  4KZA A;  3P09 A;  1WE4 A;  2ZQ7 A;  3SS4 A;  4FD8 A;  3A3D A;  3HLG A;  4WEL A;  1ES4 A;  2XR0 A;  4MBH A;  2Y2I A;  5DF9 A;  1PW1 A;  2CC1 A;  3HLC A;  4DDS A;  4E3K A;  1LI9 A;  5U47 A;  4JPM A;  4OOY A;  1ERQ A;  1GCE A;  4LV2 A;  4S2L A;  5DF8 A;  3ZG5 A;  5FQQ A;  4E3O A;  3V50 A;  4MLL A;  1E4D A;  2OLV A;  2XD1 A;  1NY0 A;  3ZNT A;  4CPK A;  1ZG4 A;  5FQM A;  1FR6 A;  3PBN A;  5A90 A;  4WZ5 A;  1ONH A;  1MY8 A;  5CXW A;  2H5S A;  4Q8I A;  3PAE A;  3OPR A;  1C3B A;  5DF7 A;  5FI2 A;  2WAD A;  4KZ9 A;  3ZG8 B;  3I7J A;  4KZB A;  3HUM A;  2Y91 A;  3IF6 C;  1YLW A;  4KZ5 A;  3RJU A;  4K0X A;  1K38 A;  3ZG7 B;  3WRZ A;  3MZD A;  4OP8 A;  3VP2 A;  5E2G A;  1ESU A;  4LCL A;  4ZJ3 A;  1K6R A;  1KE4 A;  1RGY A;  4OPQ A;  2WGW B;  5I94 A;  3IXB A;  2WAF A;  2EX8 A;  1I2W A;  2HPB A;  3W4Q A;  2XQZ A;  1SCW A;  4QB8 A;  3VP3 A;  3AGF A;  5J8X A;  1CI9 A;  1L0G A;  5FAT A;  2WYX A;  1PI5 A;  1VQQ A;  2RL3 A;  3GVB A;  5CHU A;  1FCN A;  1KGF A;  3UPP A;  3WS0 A;  3A3J A;  1IYS A;  4QU3 A;  3LCE A;  1U60 A;  4WMC A;  1KE0 A;  5EOE A;  2QZ6 A;  4GZB A;  4HBT A;  3LY4 A;  1O7E A;  4X53 A;  3TG9 A;  2Y4A A;  1BUL A;  1K4F A;  3N8S A;  2H0T A;  4JF6 A;  5HL1 A;  2ZMA A;  5FQI A;  5FAO A;  5TFQ A;  3P98 A;  1J9M A;  4FH4 A;  4OQG A;  1BLH A;  3MZE A;  3OPH A;  3BEC A;  1K25 A;  2H0Y A;  4BQM A;  1MKI A;  1YLT A;  4E3I A;  1DJB A;  3AGE A;  4S2J A;  2DRW A;  3M6B A;  2J9O A;  5EUA A;  5E2H A;  2PU2 A;  3FV7 A;  3V3R A;  4GDB A;  1ERM A;  1YLP A;  2X71 A;  4K0W A;  5AQ9 A;  4E3M A;  1SDE A;  3FKV A;  2ZC5 B;  1K56 A;  4R3J A;  3N4I A;  5GLC A;  2Y2J A;  3ZG0 A;  3FYZ A;  3ZVT A;  3ZNY A;  3C7V A;  4MBF A;  1LL9 A;  3OPL A;  5D3O A;  1I2S A;  1FQG A;  2DCF A;  1K57 A;  3SH7 A;  1AXB A;  4JKT A;  2ZQD A;  1BLC A;  3W8K A;  3OZH A;  1IEL A;  4JXV A;  4DE2 A;  5EOO A;  4EBL A;  2JCH A;  4Y0U A;  1CI8 A;  1E3U D;  1TEM A;  4BEN A;  2HDQ A;  2WKI A;  2XFT A;  1CK3 A;  3ZHH A;  4IVI A;  4OPZ A;  2ZLY A;  3VSL A;  1VM1 A;  4KZ8 A;  1IYP A;  1FOF A;  2EX6 A;  3D4F A;  1MWS A;  1CEG A;  1LLB A;  4RVA A;  5TGF A;  4C75 A;  1PWD A;  1ES3 A;  1FSW A;  4OLD A;  3UE1 A;  5M18 A;  2WGW A;  3BFD A;  3W4O A;  3IXD A;  2QPN A;  4PM5 A;  4GDN A;  5DTS A;  1I5Q A;  1KGG A;  4RA7 A;  4PM7 A;  4OH0 A;  4R1G A;  3C5A A;  3BYD A;  1OME A;  2PU4 A;  3IQA A;  3B3X A;  4P87 A;  1ERO A;  4S2P A;  4S2N A;  2GDN A;  3PBT A;  4L0L A;  1JTG A;  1XPB A;  4DE1 A;  1QME A;  1KE3 A;  1KGE A;  1W8Q A;  4WZ5 C;  5DTK A;  4E3J A;  2HP9 A;  4WYY A;  1MWU A;  4XXR A;  2ZQ9 A;  4CJN A;  1JWZ A;  1NRF A;  2E8I A;  5E43 A;  3HUO A;  5FAQ A;  1IEM A;  2IWD A;  4UA7 A;  5EVI B; 
#chains in the Genus database with same CATH topology
 4KQD A;  3Q7V B;  2EFU A;  5CHM A;  5EV0 A;  3HLE A;  1RP5 A;  5FEG A;  2EX2 A;  3ZVW A;  3N6I A;  3GR2 A;  2OWH A;  5CTM A;  1ACF A;  2GNX A;  5EVL A;  4NXF A;  3T1X A;  5E2F A;  4YNR A;  4L9F A;  1PZP A;  4ZJ2 A;  5L10 A;  1HLU P;  2O9C A;  4UQI M;  3ZCZ A;  3HLD A;  1YM1 A;  2P9V B;  1W8Y A;  4UA6 A;  3F1N B;  2J3W A;  3WS5 A;  1XX2 A;  3UE3 A;  1SZV A;  1ALQ A;  3NC8 A;  2A3U A;  2FZ0 A;  2Y2K A;  1BTL A;  4LV0 A;  5A8B A;  2QYB A;  1Z09 A;  5JYP A;  5CTN A;  3MBZ A;  4DE3 A;  1K6S A;  1YMX A;  3BFC A;  3BM6 A;  1A0K A;  2EWW A;  1SKO B;  2J3T D;  5JYO A;  4HQA A;  3IS2 A;  1YMS A;  3NI9 A;  1K56 D;  2XA7 M;  2JC7 A;  4LRX C;  1GHP A;  1BYW A;  3CMZ A;  2PYP A;  1DJA A;  2VZW A;  3QP2 A;  5L09 A;  3EEH A;  2BTF P;  5CEC A;  1IYO A;  4Q0J A;  2KDK A;  4NET A;  1NZO A;  3RH8 B;  1FSY A;  2LB5 A;  2VA0 A;  4OQ0 A;  1Y28 A;  2EXB A;  3QNC A;  4GB7 A;  3C8C A;  1PYY A;  3E4P A;  1W63 Q;  4KZ6 A;  5BOH A;  3WS2 A;  2VGJ A;  2R9W A;  4OQH A;  4JGR A;  1KVM A;  5M1A A;  3CLO A;  3U2A A;  1ESI A;  3CPT B;  1PWC A;  5M19 A;  3MQO A;  5GHX A;  2XK1 A;  4KZ7 A;  4BBT A;  5AVF A;  4PM8 A;  4IBX A;  4HP4 A;  5HFO A;  4UQI S;  5EEC A;  3TSG A;  4K91 A;  4L9E A;  4X68 A;  3OCN A;  2PD7 A;  4I3I A;  4RX3 A;  2ZMV A;  5LBR A;  1HTZ A;  3ISG A;  3PBQ A;  4OP5 A;  1FR1 A;  4CLC D;  5HD5 A;  5F68 A;  1K54 C;  5HAI A;  2PD8 A;  4KZ4 A;  5AQA A;  3IT9 A;  3GRJ A;  2EXA A;  2I9V A;  4LRZ E;  4E6X A;  3VFF A;  4QD4 A;  2Z2L B;  2ZC6 B;  4OKP A;  2XRO A;  4DF6 A;  1LSX A;  2V2F F;  4H8R A;  5AQ7 A;  5CER A;  3Q81 A;  5TBM B;  4KQR A;  1BT5 A;  4PKY G;  2BLS A;  5FEF A;  3G31 A;  3UPO A;  3V3S A;  2J8Y A;  5EPH A;  2ZQA A;  3HRE A;  2V0U A;  4F3L A;  4GN2 A;  5A93 A;  3LEQ A;  3FZC A;  1GA9 A;  3G2Y A;  4ZJ1 A;  4S2O A;  1T1C A;  1G68 A;  1O07 A;  2P7J A;  4E04 A;  5K5B A;  1IKG A;  4DN0 A;  1Y54 A;  5KZH A;  2ZC7 A;  4HIA A;  4E3N A;  4U0T A;  2OSU A;  3MFD A;  2Y55 A;  1GSV A;  4I3A A;  5A91 A;  3IH8 A;  3ZDJ A;  3C38 A;  1JTD A;  4KQQ A;  4G3W A;  4XT2 A;  4Y17 A;  5AVE A;  1X0O A;  1L0E A;  2ZQ8 A;  4HNB A;  4EV4 A;  5HX9 A;  2XH9 A;  3MXQ A;  2FFY A;  2VLG A;  3BFG A;  4BBU A;  2K31 A;  1SDN A;  1OT9 A;  5DKL A;  4ID4 A;  1GHI A;  5L07 A;  4GKU A;  3KSG A;  1S4R A;  1NLY A;  3PR6 A;  3S7P A;  2WKH A;  5HAP A;  3UB6 A;  5HDD A;  1M40 A;  4GCZ A;  4HH2 A;  1KDW A;  5E2E A;  4QY6 A;  3UB9 A;  4Y13 A;  2FH5 A;  1PNE A;  4B4Z A;  5GL9 A;  1BZA A;  3ITB A;  1WYB A;  5G18 A;  2G2W A;  1P97 A;  2ZD8 A;  5FAS A;  1NJ4 A;  2Y2N A;  1LL5 A;  2WAE A;  3FKW A;  3P7N A;  1G6O A;  1FIL A;  2WK0 A;  2Z6D A;  5FAP A;  1TF1 A;  3HLB A;  3C30 A;  4FH2 A;  4PM9 A;  4BD0 A;  3BWL A;  5FL3 A;  1L3L A;  2JKR I;  3LEZ A;  3B47 A;  2HZ5 A;  5HSQ A;  4BMW A;  4LRY C;  3CWF A;  3ZG9 B;  4D2O A;  2ZM8 A;  4X1L A;  2XEP A;  3UMD A;  4ARZ B;  1P9W A;  2HF6 A;  2XLN A;  1TS0 A;  3CG5 A;  3D9Y A;  3HLG A;  4WEL A;  1KOU A;  3S7O A;  3SZT A;  4OOY A;  5F69 A;  2ZOI A;  3V50 A;  5F5Y A;  1E4D A;  2V1B A;  2G7U A;  3E0Y A;  2W1T A;  1MY8 A;  4LPZ A;  3PAE A;  3OPR A;  3CUE A;  2WAD A;  4KZ9 A;  3ZG8 B;  3I7J A;  3IF6 C;  3ZQ5 A;  1YLW A;  3IX8 A;  1T1B A;  3IX4 A;  4K0X A;  3EOI A;  3WRZ A;  4G3K A;  3T1R A;  3KX0 X;  3F1O B;  3RTY A;  2BAS A;  1RGY A;  5I94 A;  3W2Z A;  1SCW A;  3VP3 A;  3AGF A;  5EM1 A;  2PBD P;  1PI5 A;  1VB6 A;  3GVB A;  5CHU A;  1IOU A;  4MN7 A;  3UPP A;  3LCE A;  5EOE A;  4GZB A;  3FPW A;  4X53 A;  1K4F A;  5HPI A;  2W3D A;  3P98 A;  1J9M A;  2PDR A;  4EW7 A;  1K25 A;  1YLT A;  1DJB A;  5E2H A;  4K0W A;  2HV1 A;  1K56 A;  3D3O A;  2KOI A;  1VEU A;  3C7V A;  1LL9 A;  4RQ9 A;  2DCF A;  3W8K A;  4JXV A;  4EBL A;  1E3U D;  4R6L A;  4PAU A;  3UME A;  4OPZ A;  3LI8 A;  3VSL A;  3LYX A;  1NRJ A;  3R7W A;  1MWS A;  4RVA A;  1PWD A;  4EES A;  5M18 A;  3W4O A;  4GDN A;  5DTS A;  3C5A A;  1H8M A;  3BYD A;  2PU4 A;  3IQA A;  4P87 A;  3B3X A;  2GDN A;  1XPB A;  3CIT A;  1S66 L;  3VE3 A;  1MC0 A;  3IS2 B;  1NRF A;  2OWJ A;  3F1P A;  3LR4 A;  1IEM A;  4JF5 A;  1DP9 A;  3S22 A;  3MXS A;  4BL2 A;  4DKI A;  4M4X A;  5DVA A;  4R4R A;  4GW9 A;  1SHV A;  4C6Y A;  1LI0 A;  1IYQ A;  3UB5 P;  3IWO A;  3HLF A;  1OTB A;  3GV9 A;  5L2F A;  1Q2P A;  2VX8 A;  4CLC E;  4XUX A;  4HJ3 A;  4QJG A;  3T12 B;  4HY8 A;  4X55 A;  5EVI D;  2PR5 A;  2Y2Q A;  4HH3 A;  3CI6 A;  1F9I A;  2W1R A;  2ZMF A;  4P0M A;  5F82 A;  1OTE A;  1F2K A;  3UO9 A;  1K54 A;  4Y2F A;  1MZU A;  1OT6 A;  3NOT C;  3WWX A;  3S1Y A;  3LGO A;  3SOI A;  3DTM A;  1G28 A;  5HPF A;  2PR6 A;  2PAV P;  5IS1 A;  3C4P A;  4KUK A;  4X56 A;  5FDH A;  4Y15 A;  3RXW A;  4OVD A;  2ZL1 A;  4WM9 A;  4DDY A;  4NG2 A;  3DW0 A;  2EX9 A;  2XF3 A;  2Y2H A;  4N9K A;  2JKG A;  4R3B A;  5GHY A;  1JNU A;  2MJ6 A;  3ZGA B;  3BLS A;  3V39 A;  5FQ9 A;  4U0X A;  2RCX A;  2W3H A;  4F3L B;  3IWQ A;  4KG2 A;  2D01 A;  3IF5 A;  1H5X A;  3TOI A;  3A0S A;  3O88 A;  1NXY A;  3N8R A;  3UN7 A;  4XT2 B;  4EUZ A;  5KMW A;  4X69 A;  2WKP A;  1CJF A;  1RCJ A;  4HP9 A;  3M6H A;  3T4S A;  1G6A A;  3KSI A;  4JF4 A;  4ZTK A;  2JE5 A;  4KEN B;  2P08 A;  4OON A;  1XJ2 A;  3GMW A;  1LL8 A;  3MZF A;  3NY4 A;  1L2S A;  4OPR A;  2B02 A;  3BJN A;  1N9O A;  2J3T C;  4PMA A;  1DP6 A;  3A3F A;  4KQO A;  4YIN A;  2QMI A;  2D02 A;  2GZA A;  3Q7Z A;  4O7D A;  3TW8 A;  1IKI A;  1D06 A;  4MEZ A;  1XP4 A;  2DMW A;  2M7U A;  1Q2Q A;  1W7F A;  1BSG A;  2HDS A;  1GHM A;  4PM6 A;  5FQK A;  2JBF A;  1FIK A;  2NUP C;  4MN5 A;  4LV3 A;  2WGV A;  4EQI A;  5HWW A;  2X01 A;  4UEY A;  2M7V A;  4WUJ A;  5GLA A;  5F1F A;  3R4K A;  5HDS A;  2W3G A;  3C4O A;  3G35 A;  3OLO A;  3HL9 A;  3IF6 A;  2K7S A;  2L4R A;  4BBV A;  5C5K A;  1TDL A;  2IWB A;  1ES2 A;  3IHA A;  4A5R A;  1TD5 A;  4ZRR A;  4EWF A;  5FA7 A;  2Z6C A;  4ETZ A;  1K55 C;  1PIO A;  4LFU A;  3IXG A;  2W1T B;  1AWI A;  1OPX A;  2WUQ A;  3BFF A;  4Q0I A;  3QP1 A;  4CLC C;  3ZYT A;  5HDC A;  2V20 A;  3JVU A;  4QY5 A;  4JXG A;  1FCM A;  1E3U A;  4LEN A;  3HLW A;  3N8L A;  3KO6 A;  3GQZ A;  4DJ3 A;  4CQH A;  4DXB A;  3FWL A;  4WEJ A;  1S1Z A;  1D1J A;  4HI4 A;  1JWV A;  4GLQ A;  3G34 A;  2OV5 A;  1YSP A;  2Y2M A;  1TS6 A;  1BUE A;  1S67 L;  5DJT A;  2V9A A;  5HD3 A;  2XR0 A;  2Y2I A;  3LR0 A;  3NEC A;  1PW1 A;  2CC1 A;  4E3K A;  1ZTU A;  1ERQ A;  5FQQ A;  2JKR M;  2XD1 A;  3CHW P;  3ZNT A;  5FQM A;  1FR6 A;  3PBN A;  4R38 A;  1C3B A;  5DF7 A;  5FI2 A;  3QP8 A;  3MMH A;  2O9A A;  4KZ5 A;  1K38 A;  3T4T A;  3MZD A;  4OP8 A;  5G4Y A;  4ZJ3 A;  3R7W B;  4OPQ A;  2OOL A;  3HJK A;  2EX8 A;  2HPB A;  2XQZ A;  4NEE D;  1L0G A;  5J8X A;  2RL3 A;  3B42 A;  1FCN A;  1KGF A;  1IYS A;  1KE0 A;  3JVV A;  3OOV A;  4HBT A;  3LY4 A;  2Y4A A;  2OAP 1;  5HL1 A;  3F1P B;  5FAO A;  4FUW A;  4YWZ A;  4OQG A;  5I5L A;  2W27 A;  3RFB A;  1OTI A;  4S2J A;  3M6B A;  2J9O A;  3MS6 A;  4GDB A;  3VV4 A;  3FKV A;  2KX6 A;  4R3J A;  3N4I A;  1T19 A;  3FYZ A;  3ZVT A;  3O5Y A;  3T4L A;  3OPL A;  1AXB A;  3OZH A;  5HWV A;  4P6Z S;  1TEM A;  3F1N A;  2HDQ A;  4IVI A;  3D4F A;  1CEG A;  1ES3 A;  4OLD A;  4Z1W A;  1I5Q A;  1KGG A;  4PM7 A;  1OME A;  4DMZ A;  1ERO A;  4L0L A;  5EFW A;  1EW0 A;  1KGE A;  4WZ5 C;  5DTK A;  4E3J A;  2A2L A;  4B9O A;  4I39 A;  5FAQ A;  3T50 A;  4UA7 A;  1MBL A;  3IH9 A;  4M3K A;  4GS9 A;  2FFF B;  4S2M A;  3NOP C;  2Y2G A;  2QWS A;  1N9L A;  3VP1 A;  3IHB A;  2GJ3 A;  1MKM A;  3G4P A;  3UPN A;  2INW A;  3MFX A;  2HDU A;  3H7W A;  2HP5 A;  2EA9 A;  2ZL1 B;  4BD1 A;  3AGD A;  4E6W A;  1NYY A;  3E2K A;  1BLS A;  3UY6 A;  2VGK A;  3UE0 A;  2VV7 A;  3GSG A;  4WBG A;  1PRQ A;  3NDE A;  4Y5F A;  2VJW A;  2ZM0 A;  4II7 A;  3E2L A;  4N1H A;  3T4J A;  3M2K A;  4WZ4 A;  1DJC A;  3BRM A;  1D7E A;  3CJM A;  4WL9 A;  2KLI A;  5DKK A;  2J9P A;  3HUN A;  2Q9N A;  3TE8 A;  5CX7 A;  3WS1 A;  2ZC3 B;  2GX5 A;  3V67 A;  1LSW A;  2P74 A;  4GHI A;  1S0W A;  2I72 A;  4R3A A;  1YLY A;  3T1Q B;  3BFE A;  3IX3 A;  1YLZ A;  2O0Y A;  4HBU A;  3NBL A;  2OLU A;  1ONG A;  3LO7 A;  3T4Q A;  3VSK A;  4O0P A;  4B93 A;  1WYC A;  2EFX A;  3SW1 A;  3KYZ A;  5DFX A;  3UDX A;  4OLG A;  4Z9Q A;  4OPY A;  3H9W A;  1MPL A;  3NCK A;  2C6W B;  4RX2 A;  3M2J A;  3G32 A;  3PTE A;  2V1Z A;  3LIF A;  1IFQ A;  2ZM2 A;  3S4X A;  3IWI A;  4Q0H A;  3UE6 A;  2B5R A;  3GTC A;  4N9L A;  1P0Z A;  1M6K A;  5FDS A;  2O99 A;  4R23 A;  5CRF A;  2Q9M A;  4ME4 A;  4LGW A;  4KG5 A;  3BLM A;  5CHJ A;  4NXB A;  2A24 A;  4IBR A;  2ZBB A;  5TJJ A;  3QNB A;  4DXC A;  3BW6 A;  4IVK A;  2IWC A;  4B4X A;  4ESP A;  3PYP A;  5EE8 A;  4Y0T A;  4LLO B;  3NOU C;  2O9B A;  2H10 A;  1K55 A;  1MWT A;  4Y0O A;  5EVI C;  4FSF A;  4R0Q A;  1ZC2 A;  2VK3 A;  1H8Y A;  4N92 A;  3IF6 B;  3BY9 A;  1OJG A;  2HJE A;  3Q82 A;  1NLZ A;  4CLC A;  3NDG A;  4BL3 A;  5F1G A;  3O87 A;  2BG1 A;  2G2U A;  5KSC A;  1XFQ A;  2PT7 A;  3VP4 A;  3L7H A;  4EXO A;  5J7E A;  3O86 A;  2WZZ A;  1L0F A;  1XXM A;  1W5D A;  2OAQ 1;  4GD8 A;  3A3E A;  5CGX A;  1JVJ A;  3MJQ A;  3VOY A;  3HVF A;  1G5U A;  2Y2P A;  1CQA A;  2ZC4 B;  3OBF A;  3OPP A;  1T1A A;  4EBP A;  4X6T A;  5AQB A;  2WZX A;  1OTD A;  3MF0 A;  5DTT A;  1PWG A;  3HCY A;  2B95 A;  2C5W B;  2VV8 A;  1Z6F A;  4Y7P A;  3LIC A;  1XA1 A;  3DAV A;  2P04 A;  4RYE A;  1YAX A;  3Q07 A;  1JWP A;  3U4L P;  4JLF A;  4ZAM A;  5GHZ A;  1XGI A;  3LFV A;  1GA0 A;  4QHC A;  3EGD C;  3OCL A;  4JGO A;  2W0N A;  4EET B;  3UNW A;  3SH8 A;  2A49 A;  3QP5 A;  4LV1 A;  1V9Y A;  2DNS A;  4P6B A;  3DTK A;  2Z2M B;  4JGQ A;  1GSW A;  3MXR A;  5CEB A;  1H8Z A;  1F98 A;  1NYM A;  4HEF A;  1XKZ A;  1YLJ A;  2K2N A;  3A3I A;  1LHY A;  1ES5 A;  3CZD A;  5FI7 A;  1YT4 A;  3PBO A;  1XJ4 A;  4KUO A;  2HGV A;  4C3Q A;  5HAR A;  4U3T A;  1XGJ A;  1TVF A;  1Y4O A;  3MKE A;  2XRN A;  1KVL A;  4UHU A;  5G4Z A;  2JKT I;  3HBR A;  3FC7 A;  2M1C A;  4FTX A;  2V8C A;  1XJ3 A;  4DJ2 A;  2WKR A;  4PHT A;  3HJI A;  3IXH A;  1MXO A;  1DRM A;  4IUH A;  2QJ7 A;  1BLP A;  4O8G A;  3BQA A;  3IBR A;  3SS4 A;  3A3D A;  5KIZ A;  1ES4 A;  4MBH A;  4EUV A;  4GJ4 A;  3HLC A;  1LI9 A;  4JPM A;  1V9Z A;  1GCE A;  5DF8 A;  5HWT A;  2QHK A;  3S7Q A;  3DTE A;  4CPK A;  3A0V A;  1PFL A;  5A90 A;  4WZ5 A;  2H5S A;  4Q8I A;  3TJZ C;  2VV6 A;  2ACG A;  2Y91 A;  3RJU A;  3LID A;  3VP2 A;  3IBJ A;  3ULF A;  3IXB A;  2WAF A;  1I2W A;  2H28 A;  2WYX A;  3WS0 A;  1UGU A;  3A3J A;  3VE4 A;  4HJ6 A;  1U60 A;  3KSH A;  1O7E A;  3TG9 A;  4JF6 A;  3N8S A;  2H0T A;  1VET A;  5FQI A;  5TFQ A;  1BLH A;  4NKP A;  3MZE A;  4GS9 B;  3K2N A;  3BEC A;  4BQM A;  1MKI A;  4E3I A;  2DRW A;  1P9R A;  4QWO A;  3T1S A;  3FV7 A;  3V3R A;  2WKQ A;  2X71 A;  5AQ9 A;  5EM0 A;  1SDE A;  2JKF A;  2ZC5 B;  2W3F A;  3NUL A;  3H7W B;  3H82 A;  5D3O A;  3SH7 A;  1FQG A;  4JKT A;  1S1Y A;  1BLC A;  2EWV A;  2ZQD A;  1IEL A;  2CMN A;  4DE2 A;  5EOO A;  2JCH A;  1OJ5 A;  4Y0U A;  1CI8 A;  3LIE A;  1LSV A;  1CK3 A;  3ZHH A;  1VM1 A;  1LLB A;  2PYR A;  2WGW A;  3IXD A;  2AVX A;  2QPN A;  4RA7 A;  4R1G A;  4OH0 A;  4I38 A;  4EQ1 A;  4S2P A;  1JTG A;  1KE3 A;  1W8Q A;  2L1M A;  4XXR A;  2ZQ9 A;  4CJN A;  1JWZ A;  1UWP X;  4UAA A;  1LT0 A;  1WA9 A;  4P6Z M;  2ZOH A;  4H6J A;  3GEC A;  1SKF A;  4JXS A;  2Y2L A;  5F6A A;  1TS8 A;  3TRC A;  1FCO A;  4GHI B;  3EEA A;  1F5M A;  1XA7 A;  4HHD A;  1RGZ A;  1CEF A;  1N9B A;  5MC7 A;  4WF0 A;  5CGS A;  3CAX A;  3PXP A;  3SS3 A;  1HD8 A;  3GDI A;  4P85 A;  4O01 A;  1VEU B;  2XA7 S;  1YQS A;  2VEA A;  1VHM A;  5TR7 A;  4LCM A;  1E25 A;  3FPV A;  4N1X A;  4HES A;  4WMC D;  3NIA A;  3BY8 A;  3MSH A;  3N7W A;  4MNR A;  2XSS A;  2ZJ9 A;  5FI6 A;  3SH9 A;  1W79 A;  1K57 C;  3NHQ A;  3E4Q A;  1L0D A;  4EER A;  2W3E A;  5HAQ A;  4G3V A;  5EVI A;  4WEK A;  3Q7V A;  1PW8 A;  2HDR A;  4DRT A;  1N9N A;  3V5M A;  2A24 B;  1XFN A;  1YKD A;  3FG8 A;  1TS7 A;  3QP6 A;  4NK3 A;  5IT5 A;  4L9G A;  2QJ5 A;  3RXX A;  4S2N C;  1HZO A;  4ETX A;  4MBK A;  4S2K A;  4ZDX A;  1W63 M;  3WS4 A;  4GNU A;  2P9V A;  4MN6 A;  5FQJ A;  3EQU A;  2VGL M;  4NXG A;  2XGN A;  4MCW A;  3DWK A;  4CLC B;  2PBY A;  1ZKJ A;  1SKO A;  3LUQ A;  2Y2O A;  1TDG A;  3K3C A;  3VP0 A;  4S2I A;  3VMA A;  2NUT C;  2WGI A;  5CGW A;  1YSQ A;  3LR5 A;  3WRT A;  2V1A A;  3SS5 A;  4X25 A;  5L8M A;  4BJP A;  4ZBE A;  4OOM A;  4KG6 A;  4FCF A;  4F94 A;  4JGP A;  4MDZ A;  4DE0 A;  3BEB A;  5EVE A;  1DY6 A;  1NZU A;  1KDS A;  4B88 A;  4KZ3 A;  3LIA A;  4E3L A;  4K08 A;  1K0K A;  5F83 A;  2WKE A;  4QPR A;  2L0W A;  1EI5 A;  1DP8 A;  3NJA A;  3QP4 A;  2VKS A;  3JYI A;  3QHY A;  3EQV A;  5HW3 A;  5IHV A;  2J7V A;  3CPT A;  5IU1 A;  2X02 A;  4PPR A;  3DWZ A;  2YKF A;  4EEU A;  2Q0O A;  2Y8H A;  3T4O A;  3E4O A;  3UDF A;  3PBS A;  2HJ9 C;  2IA2 A;  3W4P A;  5CED A;  5GLB A;  3L9K A;  3BQ8 A;  1MWR A;  1QMF A;  1UWN X;  4R4S A;  5A92 A;  1S6R A;  2YKH A;  2R78 A;  5GLD A;  4YFM A;  2VGL S;  5AJG A;  5KSH A;  3JPU A;  3MQQ A;  3ICY A;  3MQ0 A;  2PRF A;  2QKP A;  2XD5 A;  3LY3 A;  4JBF A;  4I3J A;  3B33 A;  1PI4 A;  3KYE A;  4GOG A;  1J3W A;  4X1M A;  4D60 A;  2LB9 A;  3UB7 A;  3T4K A;  3KSF A;  3MKF A;  3ZFZ A;  4IJG A;  1STZ A;  3PHY A;  2JN7 A;  1HVB A;  4EEP A;  5TBM A;  3G2Z A;  4GD6 A;  4HOI A;  3E98 A;  2XFS A;  1ZG6 A;  2UWX A;  4EU0 A;  2XDM A;  3UDI A;  3DTI A;  3VOL A;  3Q1F A;  4Y3I A;  3VFH A;  4JXW A;  2B18 A;  1T18 A;  1NWZ A;  3PBR A;  5FSR A;  1N4O A;  4UA9 A;  1K4E A;  1OTA A;  1EWZ A;  1CF0 A;  4R70 A;  1PZO A;  2R9X A;  3G30 A;  4EBN A;  2JHE A;  3C7U A;  4IED A;  3LIB A;  4OQI A;  3S7N A;  3MR0 A;  1ODV A;  3OC2 A;  3ITA A;  1XJ6 A;  1VET B;  3VOZ A;  2Y59 A;  3O3V A;  4PKY A;  3PAG A;  3UB8 A;  2ZQC A;  4XUZ A;  2HP6 A;  4BLM A;  3EWK A;  4OOL A;  4KZA A;  3P09 A;  1WE4 A;  2ZQ7 A;  1YPR A;  4FD8 A;  1H0M A;  5DF9 A;  1ZHH B;  4DDS A;  4HJ4 A;  5U47 A;  5DJU A;  4S2L A;  4LV2 A;  3ZG5 A;  4E3O A;  4MLL A;  2Y79 A;  2OLV A;  1NY0 A;  3H82 B;  1ZG4 A;  1ONH A;  5CXW A;  2JKT M;  3C2W A;  4KZB A;  5J3W A;  3HUM A;  3ZG7 B;  3G6O A;  5E2G A;  1ESU A;  4LCL A;  4YOF A;  1K6R A;  1KE4 A;  2UV0 E;  4AFI A;  2WGW B;  3W4Q A;  4QB8 A;  1CI9 A;  5FAT A;  5HZH A;  4I5S A;  1VQQ A;  4QU3 A;  5DFY A;  2J80 A;  3KYQ A;  4WMC A;  1H3Q A;  3DBA A;  2QZ6 A;  1BUL A;  2ZMA A;  5J4E A;  4FH4 A;  4ARZ A;  3OPH A;  4H6J B;  2H0Y A;  3AGE A;  5EUA A;  2PU2 A;  3EGX C;  3LR3 A;  1ERM A;  1YLP A;  4E3M A;  1S4S A;  2E8J A;  5GLC A;  3ZG0 A;  2Y2J A;  2V8F A;  3ZNY A;  4MBF A;  1I2S A;  3A0R A;  5HL6 A;  1K57 A;  2PHY A;  1GSX A;  3P01 A;  4BEN A;  2WKI A;  4FOF A;  2XFT A;  2ZLY A;  4WLA A;  4KZ8 A;  4NXE A;  1IYP A;  1FOF A;  2EX6 A;  3LI9 A;  3F1O A;  4MMN A;  5TGF A;  3K3D A;  4C75 A;  1FSW A;  3UE1 A;  4IHQ A;  3BFD A;  4BWI A;  4PM5 A;  3D72 A;  4IUK A;  4S2N A;  4WN5 A;  3PBT A;  4DE1 A;  1QME A;  2HP9 A;  4WYY A;  2V0W A;  1MWU A;  5E43 A;  2E8I A;  3CUE C;  3HUO A;  2IWD A;  5EVI B; 
#chains in the Genus database with same CATH homology
 1MBL A;  3Q7V B;  3IH9 A;  4M3K A;  2EFU A;  2FFF B;  4JF5 A;  4S2M A;  5CHM A;  1SKF A;  3HLE A;  2Y2L A;  4JXS A;  3S22 A;  3MXS A;  4BL2 A;  4DKI A;  1FCO A;  1RP5 A;  1XA7 A;  2Y2G A;  2EX2 A;  3ZVW A;  5DVA A;  1RGZ A;  1CEF A;  3N6I A;  4R4R A;  1N9B A;  1SHV A;  4C6Y A;  3GR2 A;  3VP1 A;  3IHB A;  1LI0 A;  3G4P A;  3UPN A;  5CTM A;  1IYQ A;  5CGS A;  3IWO A;  5EVL A;  3HLF A;  2HDU A;  3SS3 A;  1HD8 A;  2HP5 A;  5E2F A;  4P85 A;  3GV9 A;  4BD1 A;  3AGD A;  4E6W A;  1NYY A;  3E2K A;  5L2F A;  1BLS A;  1Q2P A;  3UY6 A;  1PZP A;  2VGK A;  4ZJ2 A;  1YQS A;  4XUX A;  3UE0 A;  5TR7 A;  3ZCZ A;  4LCM A;  3HLD A;  1E25 A;  1YM1 A;  3GSG A;  4N1X A;  4QJG A;  4WBG A;  2P9V B;  4HES A;  1W8Y A;  3NIA A;  4UA6 A;  3NDE A;  4UAA A;  4WMC D;  4X55 A;  3WS5 A;  5EVI D;  1XX2 A;  3UE3 A;  1ALQ A;  2Y2Q A;  3NC8 A;  3N7W A;  2A3U A;  2Y2K A;  2ZM0 A;  4MNR A;  1BTL A;  3E2L A;  4LV0 A;  4N1H A;  5JYP A;  2ZJ9 A;  5CTN A;  3M2K A;  3MBZ A;  4WZ4 A;  1K6S A;  1YMX A;  4P0M A;  4DE3 A;  3BFC A;  5F82 A;  3BM6 A;  5FI6 A;  3SH9 A;  1W79 A;  1DJC A;  3UO9 A;  3BRM A;  1K54 A;  5JYO A;  1K57 C;  3CJM A;  3WWX A;  3S1Y A;  1L0D A;  3SOI A;  1YMS A;  2J9P A;  3NI9 A;  3DTM A;  5HAQ A;  1K56 D;  2JC7 A;  5EVI A;  3HUN A;  4WEK A;  2Q9N A;  3Q7V A;  1PW8 A;  2HDR A;  4DRT A;  1GHP A;  3V5M A;  3WS1 A;  2ZC3 B;  3CMZ A;  1DJA A;  3C4P A;  2P74 A;  5CEC A;  1IYO A;  1S0W A;  2I72 A;  4NK3 A;  1YLY A;  4X56 A;  5FDH A;  4NET A;  1NZO A;  3BFE A;  1YLZ A;  3RXX A;  4HBU A;  3NBL A;  1FSY A;  4S2N C;  2OLU A;  3RXW A;  1ONG A;  4OQ0 A;  4OVD A;  3LO7 A;  1HZO A;  3VSK A;  1WYC A;  2EXB A;  2EFX A;  3QNC A;  4GB7 A;  4WM9 A;  4MBK A;  4S2K A;  3UDX A;  4OLG A;  1PYY A;  4ZDX A;  4Z9Q A;  4DDY A;  3WS4 A;  4OPY A;  4GNU A;  1MPL A;  2P9V A;  4KZ6 A;  5BOH A;  3WS2 A;  3NCK A;  2C6W B;  2VGJ A;  5FQJ A;  2R9W A;  3EQU A;  4OQH A;  3DW0 A;  1KVM A;  3M2J A;  2XGN A;  4RX2 A;  5M1A A;  3G32 A;  2EX9 A;  3PTE A;  3DWK A;  2V1Z A;  2PBY A;  2XF3 A;  2Y2H A;  4N9K A;  1ESI A;  2ZM2 A;  3S4X A;  3IWI A;  4R3B A;  2B5R A;  1PWC A;  3GTC A;  5GHY A;  5M19 A;  4N9L A;  5GHX A;  2XK1 A;  4KZ7 A;  1ZKJ A;  3ZGA B;  1M6K A;  3BLS A;  4R23 A;  2Y2O A;  1TDG A;  5CRF A;  3V39 A;  4S2I A;  5FQ9 A;  4U0X A;  2RCX A;  3VP0 A;  2Q9M A;  3VMA A;  3IWQ A;  2WGI A;  5CGW A;  3WRT A;  4KG2 A;  4PM8 A;  4IBX A;  5HFO A;  4KG5 A;  3BLM A;  5CHJ A;  5EEC A;  3SS5 A;  3TSG A;  4K91 A;  3IF5 A;  4BJP A;  4ZBE A;  4IBR A;  4X68 A;  3OCN A;  1H5X A;  3TOI A;  4OOM A;  4KG6 A;  3QNB A;  4FCF A;  4F94 A;  3O88 A;  4DXC A;  4IVK A;  4RX3 A;  2IWC A;  4B4X A;  1HTZ A;  3BEB A;  3ISG A;  4DE0 A;  1DY6 A;  1NZU A;  1NXY A;  1KDS A;  3N8R A;  3PBQ A;  3UN7 A;  4OP5 A;  1FR1 A;  4B88 A;  4EUZ A;  4KZ3 A;  5EE8 A;  5KMW A;  4X69 A;  4E3L A;  4Y0T A;  1K54 C;  1RCJ A;  2H10 A;  5HAI A;  3M6H A;  5F83 A;  4KZ4 A;  1K55 A;  1G6A A;  2WKE A;  5AQA A;  1EI5 A;  3IT9 A;  3GRJ A;  1MWT A;  4Y0O A;  2EXA A;  5EVI C;  4E6X A;  3VFF A;  4FSF A;  4JF4 A;  4QD4 A;  2Z2L B;  4ZTK A;  2JE5 A;  2ZC6 B;  4OKP A;  4R0Q A;  1ZC2 A;  4KEN B;  3JYI A;  4DF6 A;  1H8Y A;  4N92 A;  3QHY A;  2V2F F;  4OON A;  3GMW A;  3MZF A;  3EQV A;  3NY4 A;  3IF6 B;  5HW3 A;  1L2S A;  5IHV A;  4OPR A;  4H8R A;  5AQ7 A;  5CER A;  3Q82 A;  3Q81 A;  3NDG A;  2J7V A;  4KQR A;  1BT5 A;  2BLS A;  4BL3 A;  4PMA A;  2X02 A;  3O87 A;  5F1G A;  3G31 A;  2BG1 A;  2G2U A;  3A3F A;  4KQO A;  4YIN A;  5KSC A;  4PPR A;  3DWZ A;  2QMI A;  3UPO A;  3V3S A;  2J8Y A;  5EPH A;  2ZQA A;  3VP4 A;  3HRE A;  3UDF A;  3PBS A;  3Q7Z A;  3O86 A;  4O7D A;  2WZZ A;  1L0F A;  3W4P A;  4GN2 A;  1XXM A;  5A93 A;  1W5D A;  5CED A;  3FZC A;  5GLB A;  4GD8 A;  1GA9 A;  3A3E A;  3G2Y A;  4ZJ1 A;  1IKI A;  4S2O A;  1MWR A;  1QMF A;  4MEZ A;  1JVJ A;  1G68 A;  1O07 A;  5CGX A;  3VOY A;  1XP4 A;  4R4S A;  5A92 A;  1S6R A;  1Q2Q A;  3HVF A;  2Y2P A;  1W7F A;  1BSG A;  1IKG A;  1GHM A;  2HDS A;  1Y54 A;  5GLD A;  4YFM A;  5KZH A;  2ZC7 A;  4E3N A;  4PM6 A;  4U0T A;  5FQK A;  5KSH A;  2OSU A;  3MFD A;  2Y55 A;  2ZC4 B;  2JBF A;  3OPP A;  5A91 A;  3IH8 A;  3ZDJ A;  4LV3 A;  2XD5 A;  1JTD A;  4EBP A;  4KQQ A;  4X6T A;  2WGV A;  4EQI A;  3LY3 A;  4JBF A;  5AQB A;  2X01 A;  1L0E A;  2ZQ8 A;  5GLA A;  4EV4 A;  5HX9 A;  5F1F A;  2XH9 A;  2WZX A;  1PI4 A;  4GOG A;  2FFY A;  5DTT A;  1PWG A;  2C5W B;  1Z6F A;  3BFG A;  3MKF A;  1SDN A;  4Y7P A;  3ZFZ A;  1XA1 A;  3C4O A;  3G35 A;  4ID4 A;  1GHI A;  4GKU A;  4RYE A;  3HL9 A;  3IF6 A;  1HVB A;  3Q07 A;  1JWP A;  4JLF A;  4ZAM A;  5GHZ A;  1XGI A;  1GA0 A;  1TDL A;  3G2Z A;  4QHC A;  2IWB A;  3OCL A;  4GD6 A;  3UNW A;  1ES2 A;  2XFS A;  2WKH A;  5HAP A;  3IHA A;  3SH8 A;  4A5R A;  2A49 A;  1ZG6 A;  4LV1 A;  4EWF A;  5FA7 A;  1M40 A;  2DNS A;  2UWX A;  4P6B A;  1KDW A;  2Z2M B;  4QY6 A;  5E2E A;  1K55 C;  2XDM A;  3UDI A;  3MXR A;  1PIO A;  4B4Z A;  5CEB A;  3IXG A;  1BZA A;  1H8Z A;  3Q1F A;  5GL9 A;  3ITB A;  3VFH A;  4JXW A;  4HEF A;  1NYM A;  1WYB A;  5G18 A;  1XKZ A;  2G2W A;  1YLJ A;  2ZD8 A;  5FAS A;  2WUQ A;  1NJ4 A;  2Y2N A;  1LL5 A;  3A3I A;  1LHY A;  1ES5 A;  3CZD A;  5FI7 A;  3PBR A;  5FSR A;  1N4O A;  1YT4 A;  2WAE A;  1K4E A;  3BFF A;  3FKW A;  3PBO A;  4UA9 A;  1EWZ A;  2WK0 A;  5FAP A;  4BD0 A;  3HLB A;  4FH2 A;  4PM9 A;  4C3Q A;  5HAR A;  4U3T A;  1PZO A;  1XGJ A;  3LEZ A;  2R9X A;  1TVF A;  2V20 A;  3G30 A;  4EBN A;  3MKE A;  4QY5 A;  4JXG A;  1KVL A;  4UHU A;  3C7U A;  1FCM A;  1E3U A;  4IED A;  4LEN A;  3HLW A;  3HBR A;  4OQI A;  3N8L A;  3GQZ A;  4DXB A;  3FWL A;  3ZG9 B;  3OC2 A;  4WEJ A;  4D2O A;  3ITA A;  1JWV A;  3G34 A;  3IXH A;  3VOZ A;  2Y59 A;  3O3V A;  2ZM8 A;  2OV5 A;  2XEP A;  1MXO A;  3PAG A;  2ZQC A;  2Y2M A;  2XLN A;  2HP6 A;  4XUZ A;  1BUE A;  4BLM A;  1BLP A;  4OOL A;  3CG5 A;  4KZA A;  3P09 A;  1WE4 A;  2ZQ7 A;  3SS4 A;  4FD8 A;  3A3D A;  3HLG A;  4WEL A;  1ES4 A;  2XR0 A;  4MBH A;  2Y2I A;  5DF9 A;  1PW1 A;  2CC1 A;  3HLC A;  4DDS A;  4E3K A;  1LI9 A;  5U47 A;  4JPM A;  4OOY A;  1ERQ A;  1GCE A;  4LV2 A;  4S2L A;  5DF8 A;  3ZG5 A;  5FQQ A;  4E3O A;  3V50 A;  4MLL A;  1E4D A;  2OLV A;  2XD1 A;  1NY0 A;  3ZNT A;  4CPK A;  1ZG4 A;  5FQM A;  1FR6 A;  3PBN A;  5A90 A;  4WZ5 A;  1ONH A;  1MY8 A;  5CXW A;  2H5S A;  4Q8I A;  3PAE A;  3OPR A;  1C3B A;  5DF7 A;  5FI2 A;  2WAD A;  4KZ9 A;  3ZG8 B;  3I7J A;  4KZB A;  3HUM A;  2Y91 A;  3IF6 C;  1YLW A;  4KZ5 A;  3RJU A;  4K0X A;  1K38 A;  3ZG7 B;  3WRZ A;  3MZD A;  4OP8 A;  3VP2 A;  5E2G A;  1ESU A;  4LCL A;  4ZJ3 A;  1K6R A;  1KE4 A;  1RGY A;  4OPQ A;  2WGW B;  5I94 A;  3IXB A;  2WAF A;  2EX8 A;  1I2W A;  2HPB A;  3W4Q A;  2XQZ A;  1SCW A;  4QB8 A;  3VP3 A;  3AGF A;  5J8X A;  1CI9 A;  1L0G A;  5FAT A;  2WYX A;  1PI5 A;  1VQQ A;  2RL3 A;  3GVB A;  5CHU A;  1FCN A;  1KGF A;  3UPP A;  3WS0 A;  3A3J A;  1IYS A;  4QU3 A;  3LCE A;  1U60 A;  4WMC A;  1KE0 A;  5EOE A;  2QZ6 A;  4GZB A;  4HBT A;  3LY4 A;  1O7E A;  4X53 A;  3TG9 A;  2Y4A A;  1BUL A;  1K4F A;  3N8S A;  2H0T A;  4JF6 A;  5HL1 A;  2ZMA A;  5FQI A;  5FAO A;  5TFQ A;  3P98 A;  1J9M A;  4FH4 A;  4OQG A;  1BLH A;  3MZE A;  3OPH A;  3BEC A;  1K25 A;  2H0Y A;  4BQM A;  1MKI A;  1YLT A;  4E3I A;  1DJB A;  3AGE A;  4S2J A;  2DRW A;  3M6B A;  2J9O A;  5EUA A;  5E2H A;  2PU2 A;  3FV7 A;  3V3R A;  4GDB A;  1ERM A;  1YLP A;  2X71 A;  4K0W A;  5AQ9 A;  4E3M A;  1SDE A;  3FKV A;  2ZC5 B;  1K56 A;  4R3J A;  3N4I A;  5GLC A;  2Y2J A;  3ZG0 A;  3FYZ A;  3ZVT A;  3ZNY A;  3C7V A;  4MBF A;  1LL9 A;  3OPL A;  5D3O A;  1I2S A;  1FQG A;  2DCF A;  1K57 A;  3SH7 A;  1AXB A;  4JKT A;  2ZQD A;  1BLC A;  3W8K A;  3OZH A;  1IEL A;  4JXV A;  4DE2 A;  5EOO A;  4EBL A;  2JCH A;  4Y0U A;  1CI8 A;  1E3U D;  1TEM A;  4BEN A;  2HDQ A;  2WKI A;  2XFT A;  1CK3 A;  3ZHH A;  4IVI A;  4OPZ A;  2ZLY A;  3VSL A;  1VM1 A;  4KZ8 A;  1IYP A;  1FOF A;  2EX6 A;  3D4F A;  1MWS A;  1CEG A;  1LLB A;  4RVA A;  5TGF A;  4C75 A;  1PWD A;  1ES3 A;  1FSW A;  4OLD A;  3UE1 A;  5M18 A;  2WGW A;  3BFD A;  3W4O A;  3IXD A;  2QPN A;  4PM5 A;  4GDN A;  5DTS A;  1I5Q A;  1KGG A;  4RA7 A;  4PM7 A;  4OH0 A;  4R1G A;  3C5A A;  3BYD A;  1OME A;  2PU4 A;  3IQA A;  3B3X A;  4P87 A;  1ERO A;  4S2P A;  4S2N A;  2GDN A;  3PBT A;  4L0L A;  1JTG A;  1XPB A;  4DE1 A;  1QME A;  1KE3 A;  1KGE A;  1W8Q A;  4WZ5 C;  5DTK A;  4E3J A;  2HP9 A;  4WYY A;  1MWU A;  4XXR A;  2ZQ9 A;  4CJN A;  1JWZ A;  1NRF A;  2E8I A;  5E43 A;  3HUO A;  5FAQ A;  1IEM A;  2IWD A;  4UA7 A;  5EVI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...