3IXBA

X-ray crystal structure of the extended-spectrum ampc e219k mutant beta-lactamase complexed with benzo(b)thiophene-2-boronic acid (bzb) at 1.63 angstrom resolution
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
358
structure length
352
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAKAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structural bases for stability-function tradeoffs in antibiotic resistance.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 113
structure length 352
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3ixbA00
1BULA 2RCXA 3GR2A 2Y2PA 4MBFA 4U3TA 1FOFA 4BQMA 1W5DA 3IF6B 4DXCA 4BLMA 4DE1A 2HDQA 3GSGA 3GVBA 4RX2A 1IEMA 3IXHA 5GHZA 3FKWA 1LL9A 4IVIA 1FCOA 4IBXA 3Q82A 4KG5A 5FQIA 1EWZA 4JPMA 1KVLA 3G32A 1K54A 3MBZA 3UPPA 2HP9A 3VMAA 3SS5A 1K57C 2ZD8A 3EQUA 4FD8A 5A91A 4IBRA 1XXMA 1SDNA 2XDMA 3VP3A 3PAEA 4KZ6A 4GKUA 5DTSA 1BT5A 2DNSA 2H10A 5CRFA 3RXWA 4E3NA 2FFYA 1FQGA 3VSKA 3W4OA 3ZNTA 2ZC6B 4WZ5C 5U47A 1PW8A 4Y7PA 4S2MA 5DTTA 4WYYA 2WUQA 4MBKA 3IQAA 4S2NA 4BD1A 5L2FA 4PM6A 3VOYA 1MPLA 4C6YA 5CHJA 1L0FA 3VP0A 1PW1A 2QPNA 4KENB 5M1AA 5E2EA 1W8YA 3CJMA 1CI8A 1GA9A 5FAQA 1DJBA 1PI4A 2QMIA 1W7FA 3VFFA 3HLFA 1ERQA 3HUMA 5HFOA 4JXGA 2JBFA 3IH9A 5AQAA 2Y2GA 1LI9A 2XFTA 1KGFA 4GD8A 3ZVTA 2ZQDA 4X53A 3ZG5A 1JTDA 4X69A 4K0XA 4DE3A 3BLMA 2H0YA 2B5RA 5FSRA 4DKIA 2Y2HA 2X01A 2UWXA 4R3JA 2EX6A 4KZBA 5KMWA 2JCHA 1IELA 3M6BA 4IVKA 3ZDJA 3Q81A 1CK3A 3Q7VA 5TGFA 3G30A 1Y54A 3MZDA 1K56D 3PBTA 3WRZA 1LL5A 1HVBA 3CZDA 3UO9A 5FI7A 1K6RA 3TOIA 3ZG8B 3W8KA 1KVMA 3N7WA 1SKFA 3NDGA 2ZQCA 4B4XA 3SS4A 1YLTA 4FSFA 1KGEA 4E3LA 4KZ4A 5CTNA 3TSGA 3JYIA 1RGYA 3EQVA 1IYSA 3CMZA 5CHMA 1WYCA 4JXVA 3RJUA 4UHUA 3LY3A 1GA0A 3N8SA 5EVIB 5G18A 4E6XA 1VM1A 4BJPA 3MXRA 1EROA 3QNCA 1SHVA 1RP5A 3ISGA 5CERA 4LV2A 2C5WB 3OCNA 1L0GA 4EV4A 3BFFA 4KQQA 4DRTA 4NETA 3M2JA 3ZG9B 3ZG0A 4P85A 3NCKA 4U0XA 1MBLA 4F94A 4WZ4A 3A3DA 4S2IA 5HAQA 3UDIA 1QMEA 4OONA 1RGZA 1FCMA 4PMAA 1IKIA 2XEPA 4KG6A 2H0TA 1MWSA 4QD4A 2ZLYA 4ZJ1A 1VQQA 1K57A 3Q7ZA 4X6TA 2DRWA 2ZQ8A 2HPBA 1K4EA 3BFCA 3NIAA 3HLGA 4Y0UA 1ESUA 4CJNA 2J9PA 4KQOA 1XPBA 1W8QA 3PBQA 4WEKA 4WELA 3UN7A 3UNWA 5M19A 2ZC4B 3AGFA 1TDLA 5FI2A 5HX9A 4E6WA 2Y2KA 3S1YA 4KZ7A 4ZJ2A 3V39A 3G31A 4WZ5A 2WGWA 3PTEA 4E3KA 3VOZA 2XH9A 2JE5A 3HLCA 3W4PA 3WWXA 4EWFA 4RVAA 5DF9A 5DVAA 3I7JA 4WMCA 3V50A 1L0DA 4GZBA 4HEFA 4JBFA 5GLBA 2OV5A 5HW3A 1ES4A 5FATA 1NJ4A 1PWGA 3PBNA 5AQBA 4LENA 4GD6A 5F1FA 3A3EA 3O86A 4WM9A 4C75A 5EE8A 1DJAA 1KDSA 3GMWA 3ZG7B 2Z2LB 1EI5A 4L0LA 2HP6A 4OQHA 3IWIA 2JC7A 3IF5A 2V2FF 4OLDA 4OPZA 3V3RA 3OPLA 3VP4A 4DDYA 1I2WA 1JWZA 1YQSA 4OH0A 4Y0OA 3GRJA 1IKGA 4EUZA 2Y2MA 4PM9A 1FR1A 3Q07A 1IYQA 1JTGA 5F82A 3S4XA 4E3JA 1NY0A 4X56A 4S2OA 5CGSA 4OKPA 2ZMAA 4B88A 5A92A 1XP4A 3FKVA 5FQJA 4KZ3A 4S2JA 4E3MA 1E3UD 4ZAMA 1M40A 2ZC7A 3MKFA 2OLVA 5EPHA 3VFHA 3GTCA 3LCEA 4JF5A 1J9MA 4P0MA 1MKIA 4HBTA 2VGJA 4OQGA 1PIOA 3G4PA 4GDNA 2A3UA 4GDBA 4YINA 5BOHA 3P09A 3S22A 1MWRA 5E43A 2ZM8A 2J9OA 3D4FA 2ZM2A 1L0EA 1FSWA 2XQZA 2PBYA 3AGEA 3BYDA 4PM7A 5KSCA 1RCJA 2G2WA 1N4OA 5IHVA 3PBSA 4OP5A 2WAEA 3ITBA 4WBGA 3SOIA 3ZNYA 3Q1FA 1XX2A 3UPOA 1PYYA 3FZCA 4N9LA 1H8YA 2OLUA 4OQIA 1TVFA 2Y2QA 4JXSA 5CGXA 4DF6A 1KGGA 3IF6C 4DXBA 2HDUA 3OC2A 4JF4A 1KDWA 5CEBA 3BFGA 1O7EA 3WS4A 2IWBA 4MLLA 5FQKA 1E3UA 5DF8A 5D3OA 4OPQA 3Q7VB 3UE1A 1HD8A 5GLAA 3MKEA 1OMEA 4N1XA 3UPNA 4KZ9A 2WZZA 2Y2LA 3PBOA 4FH2A 1ONGA 4JKTA 2WKIA 3VSLA 1ZC2A 2J7VA 3E2KA 1K38A 3M2KA 4XUZA 4RYEA 4NK3A 1CI9A 3AGDA 4BL2A 4QY5A 4JLFA 3V5MA 4C3QA 3HLDA 2Y2IA 4MEZA 1XKZA 4WMCD 1BLSA 3IH8A 4PPRA 2WADA 5EVLA 1NRFA 4K91A 2Y59A 4ID4A 2H5SA 4QB8A 1YMXA 4XUXA 2XF3A 4MNRA 5GHYA 3LY4A 4DE0A 2ZC5B 4LV0A 3A3FA 5DTKA 4BD0A 3N4IA 5HL1A 3DW0A 4OPRA 3IT9A 5FQMA 4D2OA 1E4DA 2WKHA 5CECA 1ZKJA 4JF6A 2WZXA 1PI5A 4K0WA 2EX8A 4HBUA 3M6HA 3UY6A 1HZOA 5FQQA 3VP2A 4Q8IA 2V20A 4GNUA 3G2ZA 3SH9A 1E25A 4LV1A 2ZM0A 3BM6A 4A5RA 3HLWA 4QY6A 2GDNA 4M3KA 3ZHHA 3V3SA 1BLPA 4N1HA 4YFMA 4BENA 3P98A 4MBHA 3N8RA 3A3IA 4LV3A 1YLPA 4IEDA 3LEZA 5GLDA 5TFQA 4B4ZA 2R9WA 5HARA 2XR0A 1Q2QA 4QHCA 1SDEA 3HUNA 1KE4A 4LCMA 5CXWA 4H8RA 3DWKA 1H5XA 5FI6A 2QZ6A 4R1GA 2WGWB 3HBRA 1HTZA 4UA6A 3MZFA 3N8LA 4GOGA 5JYPA 3IWQA 1CEFA 2ZQ9A 2ZQAA 2G2UA 4OPYA 1ZG4A 2HDRA 4Z9QA 2V1ZA 4BL3A 3WRTA 3WS5A 4OVDA 5EVIC 1YMSA 4EQIA 3C7UA 3IXGA 2PU2A 1K25A 1BTLA 3BFEA 3NDEA 2P9VA 3IXDA 5E2FA 5F1GA 3ZGAB 1U60A 2R9XA 3GQZA 4QU3A 4R3BA 5E2GA 4CPKA 3ZCZA 2PU4A 5EOEA 4QJGA 4O7DA 1FCNA 2Y2OA 2WKEA 1IYPA 1C3BA 2WGIA 1L2SA 3QHYA 1KE3A 1PZPA 3IF6A 1YM1A 3N6IA 4KG2A 4RA7A 4S2PA 4UA9A 1ALQA 1XGIA 3C4OA 3RXXA 3UE0A 3SH7A 3IHAA 4N92A 5JYOA 5GLCA 4OP8A 1LLBA 4LCLA 3B3XA 3A3JA 3FV7A 3G35A 4GN2A 3G2YA 4DDSA 2IWDA 3VP1A 1YLWA 2Q9MA 1LHYA 2VGKA 5TR7A 1WYBA 3FWLA 5DF7A 1H8ZA 3BFDA 3HL9A 5FDHA 3PBRA 5KSHA 1K55C 2P74A 4E3OA 2EX9A 3PAGA 3BRMA 1DJCA 2Y4AA 1PWCA 1GHIA 2HP5A 1GHPA 2EX2A 3DWZA 1W79A 4KZAA 2BLSA 4DE2A 1LI0A 5FASA 1YLZA 1I5QA 1NYMA 4FCFA 3BECA 1XA7A 4HESA 1ERMA 2X71A 2Y2JA 4OLGA 2X02A 3IHBA 4R0QA 5AQ7A 5FQ9A 5KZHA 2ZJ9A 1FSYA 1I2SA 5HAIA 2Y2NA 2CC1A 3DTMA 1BZAA 2WYXA 3WS1A 1G6AA 4OOLA 5E2HA 1QMFA 5M18A 5EECA 2XD1A 2ZC3B 3NC8A 5EVID 1ES3A 1NZUA 2Z2MB 3ITAA 1TDGA 3MXSA 3NI9A 4ZDXA 3IWOA 4R4SA 1M6KA 4ZJ3A 2XGNA 4KZ8A 4KZ5A 4PM5A 3FYZA 4N9KA 2E8IA 2RL3A 4OOMA 4R4RA 3C7VA 5CGWA 3UDFA 1K54C 5EUAA 1S0WA 1BUEA 2EXBA 4UAAA 4RX3A 5A90A 4GB7A 5FAPA 4FH4A 3G34A 2WAFA 1ES2A 2C6WB 4ZBEA 1ONHA 3UE3A 1IYOA 2A49A 3UDXA 3E2LA 3O3VA 4E3IA 1Z6FA 1K4FA 3HUOA 3ZFZA 1MWTA 4S2NC 3CG5A 3IXBA 4EBLA 3HLEA 3GV9A 5GL9A 4ZTKA 4OQ0A 1O07A 1WE4A 4S2KA 4P6BA 3WS2A 2Q9NA 3OCLA 2EFUA 3C4PA 5AQ9A 4R23A 2J8YA 1S6RA 5EVIA 5I94A 1G68A 4PM8A 2WK0A 4UA7A 2ZQ7A 4X55A 1BLHA 5EOOA 4X68A 3ZVWA 4Y0TA 1JVJA 3TG9A 5J8XA 4S2LA 1K6SA 3BEBA 3SH8A 2XD5A 5CEDA 1MXOA 2I72A 1NXYA 2IWCA 3QNBA 5FAOA 5HAPA 1GCEA 1MWUA 1PWDA 2XLNA 4EBPA 1YLYA 3HREA 3OPPA 3HVFA 4P87A 3WS0A 4OOYA 2DCFA 3NY4A 2Y91A 5CHUA 3W4QA 1DY6A 1PZOA 1TEMA 1YLJA 2Y55A 3O87A 3OZHA 3SS3A 1N9BA 1JWPA 1GHMA 1NYYA 1ES5A 3NBLA 1FR6A 1CEGA 4WEJA 1XA1A 1YT4A 1ZG6A 2XK1A 3OPHA 1JWVA 5F83A 4EBNA 4XXRA 1KE0A 1K56A 2WGVA 3BLSA 4KQRA 5FA7A 2FFFB 3OPRA 1AXBA 1BLCA 1BSGA 1K55A 3MFDA 3MZEA 5CTMA 1MY8A 2OSUA 1NZOA 1ESIA 2EXAA 3O88A 1Q2PA 2HDSA 4JXWA 5GHXA 5A93A 2BG1A 2P9VB 4U0TA 2EFXA 3HLBA 2XFSA 1SCWA 3LO7A 1XGJA 3C5AA
chains in the Genus database with same CATH superfamily
1BULA 3TJZC 3PHYA 2HF6A 4G3KA 4BLMA 4DE1A 2VJWA 5FQIA 3G32A 3MBZA 4H6JB 1K57C 2ZD8A 3EQUA 1MZUA 1SDNA 4GKUA 5DTSA 4ME4A 5HWWA 2FFYA 3L7HA 3QP5A 5U47A 1OTBA 4AFIA 4MBKA 3IQAA 4S2NA 1L0FA 2QPNA 5FAQA 1W8YA 1PI4A 2ZBBA 5HDDA 5HFOA 2Y2GA 1LI9A 2ZQDA 3ZG5A 3T4OA 4X69A 5L09A 3BLMA 1XFNA 2B5RA 2WKRA 3SZTA 4IVKA 3ZDJA 1FILA 3Q7VA 1TS6A 3G30A 3WRZA 3PBTA 3R7WB 3CZDA 1K6RA 3TOIA 5FDSA 1SKFA 4NG2A 4FSFA 1SKOB 5CHMA 4ESPA 1XJ3A 3RJUA 2VKSA 1VM1A 3E0YA 1EROA 3QNCA 5EFWA 1RP5A 2G7UA 1YSQA 3ISGA 3OCNA 1L0GA 4NETA 4P85A 4F94A 3A3DA 3UDIA 1RGZA 1FCMA 5C5KA 3KYEA 2E8JA 1F9IA 1K4EA 3NIAA 2J9PA 3UNWA 5M19A 1NRJA 5FI2A 3JPUA 2XH9A 5DF9A 4GS9B 2W1TB 2ZMFA 2OV5A 5FATA 1NJ4A 1PWGA 3H9WA 1S1ZA 5F1FA 3A3EA 3F1PB 4JGRA 5EE8A 4IHQA 1KDSA 3CITA 4L0LA 4OQHA 2ZMVA 3IF5A 4OLDA 1I2WA 1JWZA 3C38A 1IKGA 4EUZA 5F82A 2XRNA 3MQ0A 5CGSA 3SW1A 5A92A 5FQJA 4E3MA 3LR5A 4S2JA 1E3UD 3RTYA 3HJKA 3UB9A 1T1BA 2OLVA 5EPHA 3GTCA 4P0MA 4Y2FA 3PYPA 2VLGA 2J9OA 2ZM2A 3T50A 2XQZA 3AGEA 2HJ9C 4PM7A 5DFXA 2G2WA 1N4OA 4R3AA 5A8BA 3ZQ5A 3ITBA 1PYYA 2QJ7A 1G6OA 1TVFA 4JXSA 3LR3A 4GW9A 1Z09A 3NOPC 4LRYC 3WS4A 5TBMA 4MLLA 1E3UA 4UEYA 4EETB 5GLAA 3T1XA 3UPNA 1P9WA 1Y28A 2L0WA 2W3EA 3E4QA 2Y2LA 1ZTUA 4II7A 2VZWA 3HCYA 4ETXA 3M2KA 3JVVA 4KUOA 4B9OA 1IFQA 2OWHA 4WMCD 1UWNX 4PPRA 4F3LA 2ZOIA 2V9AA 4XUXA 5MC7A 4MNRA 5GHYA 3GDIA 4CLCE 4JF6A 2EX8A 3CWFA 3T12B 4QY6A 2PBDP 2BTFP 3RH8B 1GSXA 3LEZA 2XR0A 4HIAA 1SDEA 1TF1A 3DWKA 3BJNA 4UA6A 4GOGA 2ZQ9A 2ZQAA 4HY8A 2INWA 2HDRA 4Z9QA 4BL3A 5DKKA 4EQIA 3UMEA 3DTEA 1BTLA 3BFEA 3NDEA 3ZGAB 4R3BA 4O7DA 5F69A 3F1NB 1C3BA 1L2SA 3QHYA 1KE3A 1PZPA 2AVXA 4GHIB 2QYBA 1ALQA 3C4OA 3RXXA 5IS1A 1IOUA 2HJEA 3IHAA 3H82B 2NUPC 1YKDA 3FV7A 3VP1A 5DF7A 1H8ZA 3BFDA 5FDHA 4HQAA 5KSHA 1K55C 5L07A 2EX9A 3BRMA 1PWCA 1LSXA 3DWZA 2EX2A 3LIBA 4DE2A 2BLSA 1LI0A 5FASA 1I5QA 4OLGA 3KSHA 3IHBA 3S7PA 5EVID 4PAUA 3ITAA 3TW8A 4ZDXA 4ZJ3A 1WA9A 2XGNA 4KZ5A 4PM5A 1S67L 3UDFA 4FTXA 5EUAA 1S0WA 1BUEA 2EXBA 4UAAA 3KX0X 5A90A 1T1CA 4FH4A 2KOIA 3UE3A 1IYOA 3KSGA 1D1JA 2KX6A 1Z6FA 3ZFZA 3D72A 4HH2A 4S2NC 3CG5A 5F68A 4EBLA 1TS8A 3HLEA 5GL9A 5K5BA 2OOLA 1WE4A 4S2KA 4P6BA 4Q0IA 2J8YA 5EVIA 2OAQ1 4UA7A 3ZVWA 2DMWA 4X68A 3TG9A 3LICA 2ZL1B 3F1OA 1GCEA 3DTIA 1PWDA 1DRMA 3WS0A 1VEUA 2DCFA 1TEMA 3O87A 3ICYA 3SS3A 1N9BA 4WUJA 2WKQA 4EBNA 2JKFA 1N9OA 3H7WA 1BLCA 2GJ3A 2K7SA 3TRCA 2OSUA 3UB6A 2EXAA 2YKHA 1ZHHB 2P9VB 4WLAA 3LUQA 3P01A 1XGJA 4MBFA 4U3TA 1FOFA 3GSGA 4PKYA 4CQHA 1LSWA 3IXHA 5GHZA 3FKWA 4IBXA 3Q82A 1OTDA 1VETB 1EWZA 3SS5A 4FD8A 4IBRA 1XXMA 4KZ6A 2V8CA 4LFUA 2VV7A 3RXWA 4O01A 3VSKA 4Y7PA 4I5SA 4S2MA 5DTTA 1CJFA 3B42A 1FIKA 3CPTA 2Y8HA 1DP8A 1XJ2A 1CI8A 2PT7A 2QMIA 1W7FA 3HUMA 1H8MA 2JBFA 3IH9A 1KGFA 5IT5A 1TD5A 3D9YA 2H0YA 3NOTC 5FSRA 3IS2B 2EX6A 2JCHA 4I39A 1CK3A 5TGFA 3MZDA 1Y54A 1K56D 5FI7A 5FEGA 2EWWA 1KVMA 3NDGA 4B4XA 3OLOA 3E4OA 3NECA 5CTNA 3KYQA 1RGYA 1XJ6A 1IYSA 3CMZA 5EVEA 3LY3A 1GA0A 3QP8A 2B18A 4BJPA 3MF0A 5CERA 5EM0A 4EXOA 2C5WB 3IX3A 4E04A 3BFFA 4KQQA 3ZG9B 1MBLA 3JVUA 2GNXA 2ACGA 2A24B 4PMAA 2XEPA 1UWPX 4G3VA 4X6TA 4NXFA 2DRWA 2ZQ8A 2HPBA 4UQIS 4KQOA 3B33A 5HX9A 4E6WA 2Y2KA 5AJGA 4ZJ2A 4WZ5A 2WGWA 3VOZA 2JE5A 4Q0JA 5DVAA 4RVAA 3T4TA 3I7JA 1ODVA 1L0DA 4GZBA 4HEFA 4JBFA 3MQQA 4WM9A 3EEAA 5HZHA 3IWIA 3V3RA 3OPLA 3VP4A 2D02A 3S7OA 1F5MA 4OH0A 4HJ6A 4Q0HA 3Q07A 1TS0A 1JTGA 3S4XA 1NY0A 4S2OA 1XP4A 4ZAMA 3BW6A 3R4KA 4JF5A 4HHDA 3UB5P 1J9MA 2VGJA 4OQGA 3G4PA 4GDNA 2LB9A 3P09A 1FSWA 5HDSA 3PBSA 3A0SA 4OP5A 3Q1FA 1XX2A 3FZCA 3KYZA 4N9LA 5EM1A 1KGGA 4DXBA 5CEBA 4EU0A 2V1AA 5FQKA 3NHQA 3UE1A 2VK3A 3Q7VB 3CUEA 3LYXA 4KZ9A 4EW7A 3PBOA 1ONGA 4JKTA 2WKIA 5G4YA 1ZC2A 3E2KA 4XUZA 4NK3A 1CI9A 4QY5A 4JLFA 3V5MA 3U2AA 4NXEA 1P0ZA 4K91A 4DN0A 2Y59A 4ID4A 1YMXA 3FG8A 3LY4A 4DE0A 2ZC5B 4LV0A 3A3FA 4IUHA 4BBUA 2HV1A 3IT9A 5CECA 3FPWA 4BMWA 2W3FA 3M6HA 3UY6A 1HZOA 4Q8IA 2V20A 3BM6A 4A5RA 2K2NA 3V3SA 4KUKA 3UMDA 3N8RA 4IEDA 5DJTA 3HUNA 5CXWA 4R1GA 3HBRA 3MZFA 3IWQA 2G2UA 2V1BA 5AVEA 5EVIC 4XT2A 2XROA 3C7UA 3IXGA 4R38A 2VX8A 1K25A 3IXDA 1U60A 3FC7A 3T4SA 2R9XA 3GQZA 1N9NA 1T1AA 1NLYA 4QWOA 3DAVA 2Y2OA 2WKEA 1IYPA 3IF6A 3N6IA 4S2PA 4RA7A 1CQAA 1OTIA 1KOUA 1H0MA 1N9LA 3BY8A 5EV0A 3G35A 4GN2A 4DDSA 4UQIM 2M7VA 1YLWA 2Q9MA 3FWLA 2O9BA 3HL9A 4Y15A 3PAGA 1DJCA 5L8MA 1K0KA 1GHPA 4KZAA 3ULFA 1NYMA 3LI9A 4FCFA 4I3AA 3BECA 1XA7A 5KIZA 3LGOA 4R0QA 5FQ9A 3QP6A 2ZJ9A 1I2SA 1BZAA 2D01A 1G6AA 4OOLA 1QMFA 2PDRA 5EECA 3NC8A 1ES3A 1W63Q 3MXSA 3PR6A 4R4SA 4KZ8A 4OOMA 2E8IA 5TBMB 1H3QA 2JHEA 3B47A 4RX3A 2C6WB 4G3WA 1ONHA 4ZBEA 3OBFA 3LI8A 3UDXA 2JKGA 4ARZA 2JKRI 3O3VA 2CMNA 4E3IA 1EW0A 4Y5FA 3T4LA 4F3LB 2XA7S 2Q9NA 3OCLA 3C4PA 5AQ9A 1G68A 1BLHA 4Y0TA 1L3LA 1K6SA 3BEBA 5CEDA 1MXOA 2I72A 3BQ8A 1NXYA 4MDZA 5FAOA 4P87A 3HVFA 3NY4A 3U4LP 1T19A 1DY6A 1PZOA 1YLJA 2Z6DA 1ES5A 1SZVA 1V9YA 1CEGA 1YT4A 1ZG6A 2XK1A 3OPHA 1JWVA 4HJ3A 2L4RA 4QPRA 4D60A 4XXRA 2WGVA 4IUKA 3K3CA 1AXBA 3MFDA 2EWVA 1VHMA 4JXWA 5A93A 1LL8A 2BG1A 2GX5A 2Y79A 2XFSA 5HDCA 2M1CA 3GR2A 2HDQA 4RX2A 3GVBA 4WL9A 1LSVA 5CX7A 1LL9A 4IVIA 1FCOA 4JPMA 2PD8A 3IX4A 1KVLA 2HP9A 3VMAA 1BYWA 3VP3A 3PAEA 3FPVA 1BT5A 2DNSA 2H10A 2NUTC 4E3NA 1OJ5A 1FQGA 3W4OA 4WZ5C 3H82A 2A2LA 4WYYA 2WUQA 4PM6A 3VOYA 1MPLA 5CHJA 1PW1A 1UGUA 5M1AA 5E2EA 3VFFA 3HLFA 4JXGA 4GD8A 5L10A 3ZVTA 5FEFA 1JTDA 4K0XA 4DE3A 1V9ZA 4GCZA 4R6LA 2X01A 4KZBA 5KMWA 2QWSA 3EOIA 1NLZA 4CLCA 1F98A 1HVBA 5HPIA 1YLTA 4E3LA 1KGEA 4KZ4A 1YAXA 3JYIA 3EQVA 5HSQA 1WYCA 4JXVA 5EVIB 2BASA 5G18A 4E6XA 1SHVA 3LIAA 3DBAA 4LV2A 4DRTA 1ACFA 4U0XA 4WZ4A 1VEUB 4L9FA 4S2IA 2O9CA 4OONA 2O99A 4KG6A 2H0TA 1MWSA 3VE4A 4ZJ1A 3CUEC 4KQDA 3BFCA 4Y0UA 3HLGA 4CJNA 1ESUA 1XPBA 1F2KA 3PBQA 4MN5A 3H7WB 4WELA 4WEKA 4ZRRA 3UN7A 2ZC4B 3AGFA 1X0OA 2OWJA 4KZ7A 3G31A 1LT0A 3PTEA 4E3KA 3HLCA 3W4PA 3WWXA 5AVFA 1PFLA 1STZA 5HW3A 2FZ0A 2XA7M 4HJ4A 5AQBA 4LENA 3O86A 2KLIA 1DJAA 2W1RA 1EI5A 2M7UA 4EQ1A 2OAP1 3TE8A 4OPZA 2V2FF 4DDYA 4Y3IA 1A0KA 4Y0OA 4PM9A 1IYQA 3EEHA 4FOFA 5J3WA 4GLQA 4E3JA 4OKPA 1OTEA 3QP4A 4B88A 4KZ3A 1M40A 4LRZE 3MKFA 3LCEA 1S66L 1MKIA 1PIOA 2A3UA 2P08A 4GDBA 5BOHA 1MWRA 3CPTB 1L0EA 1JNUA 2PBYA 5KSCA 1RCJA 4NXBA 4WN5A 4WBGA 3SOIA 3ZNYA 1OPXA 3UPOA 4I38A 2Y2QA 4DF6A 2P04A 3IF6C 5F5YA 2HDUA 4MMNA 4JF4A 2YKFA 3BFGA 1O7EA 3CHWP 1DP9A 2O0YA 3MKEA 2PR5A 1OMEA 4N1XA 3S7QA 4FH2A 1CF0A 2V0WA 3VSLA 3AGDA 4YOFA 2PYRA 4I3IA 4C3QA 4MEZA 1XKZA 3LEQA 1BLSA 2UV0E 3IH8A 4X25A 4HH3A 3C2WA 3N4IA 4EERA 1E4DA 2EA9A 1ZKJA 2WZXA 1PI5A 4K08A 3E4PA 3SH9A 3EWKA 1E25A 2ZM0A 3IBRA 4RQ9A 2GDNA 3O5YA 1BLPA 4YFMA 3A3IA 1YLPA 5GLDA 5TFQA 4B4ZA 4QHCA 4LCMA 1H5XA 5FI6A 2WGWB 3K2NA 1MKMA 1HTZA 3N8LA 1CEFA 4LPZA 2V1ZA 1AWIA 3WRTA 3KSFA 3MSHA 4EEUA 3T1SA 2WKPA 3ZCZA 5EOEA 3CLOA 4P6ZS 2WGIA 1YM1A 1XGIA 3UE0A 2XSSA 3LR0A 4H6JA 3EGDC 3KSIA 4N92A 5JYOA 4OP8A 1LLBA 4LCLA 3G2YA 4NXGA 2VGKA 4E3OA 1W79A 3MFXA 4Y13A 2PAVP 4HESA 2R78A 2X02A 5AQ7A 3DTMA 2WYXA 3E98A 2ZC3B 2Z2MB 3NI9A 1P97A 3IWOA 1M6KA 3FYZA 4N9KA 3C7VA 1G28A 5IU1A 1ES2A 5DFYA 3IBJA 3UE6A 5LBRA 2HZ5A 3E2LA 5FL3A 3R7WA 1TS7A 1OTAA 3HUOA 5HL6A 1MWTA 2PD7A 3IXBA 3GV9A 4OQ0A 1OT6A 1SKOA 2EFUA 2PR6A 4R23A 1MC0A 4PM8A 5EOOA 2WK0A 4BQMA 1JVJA 5J8XA 4S2LA 3SH8A 2XD5A 4YNRA 2IWCA 2LB5A 3QNBA 4EBPA 1YLYA 4L9EA 3OPPA 4OOYA 3VE3A 2Y91A 3OZHA 1VB6A 2Y55A 3RFBA 1OT9A 1NYYA 1GHMA 4LRXC 4CLCC 1KE0A 2FFFB 3OPRA 2I9VA 3A0VA 4DJ2A 2VGLS 3T1RA 5CTMA 1MY8A 2ZOHA 3T1QB 5J4EA 1D06A 4XT2B 1ESIA 3O88A 4GS9A 2W1TA 4U0TA 2VA0A 4DJ3A 3C5AA 1D7EA 2RCXA 2Y2PA 1W5DA 3MXQA 3IF6B 4IJGA 3F1PA 4DXCA 2PRFA 1IEMA 3NOUC 4Y17A 4KG5A 3UPPA 1K54A 3T4KA 5A91A 1T18A 2J3TC 2XDMA 3ZYTA 2VV6A 5CRFA 3IX8A 1XJ4A 3ZNTA 2B95A 2ZC6B 1PW8A 4HP4A 2JKRM 3BY9A 4BD1A 5L2FA 4C6YA 3VP0A 4KENB 3CJMA 1GA9A 1DJBA 1ERQA 3MR0A 5AQAA 3MQOA 2XFTA 1OJGA 4X53A 4BBVA 3CAXA 4P6ZM 4HI4A 1XFQA 4DKIA 2Y2HA 2W3GA 2UWXA 5I5LA 4R3JA 3LR4A 3LFVA 1IELA 3M6BA 1GSWA 4ARZB 3Q81A 3DTKA 1LL5A 2W0NA 3UO9A 3ZG8B 3W8KA 3N7WA 2ZQCA 3SS4A 3TSGA 4DMZA 4UHUA 3N8SA 3NJAA 3MXRA 2IA2A 4I3JA 4BWIA 1P9RA 4ETZA 3LIDA 4EV4A 4NKPA 3ZG0A 3M2JA 3UB8A 3NCKA 1GSVA 4EUVA 5HAQA 1QMEA 3KO6A 1IKIA 5HD5A 5DJUA 3UB7A 4YWZA 4QD4A 2ZLYA 1VQQA 1K57A 3Q7ZA 1W8QA 1TDLA 2QKPA 3S1YA 4EEPA 3V39A 1Y4OA 4FUWA 4HP9A 4JGPA 4EWFA 2V8FA 4WMCA 3V50A 5GLBA 1ES4A 3C8CA 3V67A 1PNEA 3PBNA 4LGWA 4GD6A 4C75A 3GMWA 3ZG7B 2Z2LB 2HP6A 4PKYG 2JC7A 3L9KA 3F1NA 1YQSA 3GRJA 2Y2MA 1FR1A 4GHIA 4X56A 2ZMAA 1YPRA 3FKVA 4CLCD 3S7NA 2ZC7A 3VFHA 3K3DA 3D3OA 2MJ6A 2L1MA 4HBTA 3P7NA 4YINA 2VGLM 3S22A 5E43A 2ZM8A 3D4FA 2QJ5A 3BYDA 5IHVA 2WAEA 4LLOB 1H8YA 2OLUA 1DP6A 4OQIA 5CGXA 4BBTA 3EGXC 1J3WA 3OC2A 1KDWA 3GECA 4JGOA 2IWBA 5DF8A 5D3OA 2J3TD 4OPQA 1HD8A 4CLCB 2HGVA 2WZZA 3MS6A 3PXPA 3QP2A 5F6AA 2J7VA 1K38A 4RYEA 4BL2A 2J3WA 3HLDA 2Y2IA 2B02A 2WADA 5EVLA 1NRFA 2Q0OA 2H5SA 4QB8A 2XF3A 3A0RA 4BD0A 5DTKA 3F1OB 5HL1A 3DW0A 4OPRA 4D2OA 5FQMA 4X1LA 2WKHA 1S4SA 4K0WA 4HBUA 4MCWA 4HOIA 4O0PA 5FQQA 4Z1WA 3VP2A 4GNUA 3G2ZA 4LV1A 2ZL1A 3HLWA 4M3KA 3ZHHA 4N1HA 4BENA 3P98A 4MBHA 4LV3A 2R9WA 5HARA 1Q2QA 2VV8A 1KE4A 4H8RA 3T4QA 2QZ6A 2H28A 5JYPA 1G5UA 4OPYA 1ZG4A 3MMHA 1HLUP 3W2ZA 5HWTA 3WS5A 2O9AA 4OVDA 1YMSA 2PU2A 2J80A 2VEAA 5F1GA 2P9VA 3BWLA 5E2FA 3C30A 5E2GA 4QU3A 4HNBA 4CPKA 4R70A 2PU4A 2PYPA 4X1MA 4QJGA 3LIFA 1FCNA 4UA9A 4KG2A 3CI6A 5DKLA 3VV4A 2JKTM 1S1YA 1VETA 3SH7A 5J7EA 1S4RA 5GLCA 3B3XA 3A3JA 3NULA 5HPFA 2QHKA 2IWDA 1LHYA 5TR7A 1WYBA 2V0UA 3PBRA 3LIEA 2P74A 2Y4AA 5TJJA 1GHIA 2HP5A 1W63M 1YLZA 1ERMA 2X71A 2Y2JA 5KZHA 3HJIA 1FSYA 2JKTI 2K31A 5HAIA 2W27A 2Y2NA 2CC1A 3WS1A 5E2HA 5M18A 2XD1A 5HWVA 1NZUA 1TDGA 5HD3A 2RL3A 4R4RA 5CGWA 1K54C 4GB7A 5FAPA 5G4ZA 2Z6CA 3G34A 2WAFA 3IS2A 2KDKA 3MJQA 4B93A 2A49A 4NEED 2P7JA 1PRQA 2W3DA 1K4FA 4O8GA 4M4XA 4WF0A 4ZTKA 3OOVA 1O07A 4MN7A 3QP1A 3WS2A 3BQAA 1S6RA 5I94A 2W3HA 4X55A 2ZQ7A 5HAPA 1MWUA 2XLNA 3HREA 2GZAA 5CHUA 4JGQA 2A24A 3W4QA 4EESA 1JWPA 3NBLA 1FR6A 4WEJA 1XA1A 2FH5A 4MN6A 5F83A 4GJ4A 3G6OA 1K56A 3BLSA 4KQRA 5FA7A 2JN7A 1BSGA 1YSPA 3VOLA 1K55A 3MZEA 1NZOA 1NWZA 4L9GA 1Q2PA 4PHTA 2HDSA 5GHXA 2EFXA 3HLBA 1SCWA 3LO7A 2PHYA 3T4JA
chains in the Genus database with same CATH topology
1BULA 2RCXA 3GR2A 2Y2PA 4MBFA 4U3TA 1FOFA 4BQMA 1W5DA 3IF6B 4DXCA 4BLMA 4DE1A 2HDQA 3GSGA 3GVBA 4RX2A 1IEMA 3IXHA 5GHZA 3FKWA 1LL9A 4IVIA 1FCOA 4IBXA 3Q82A 4KG5A 5FQIA 1EWZA 4JPMA 1KVLA 3G32A 1K54A 3MBZA 3UPPA 2HP9A 3VMAA 3SS5A 1K57C 2ZD8A 3EQUA 4FD8A 5A91A 4IBRA 1XXMA 1SDNA 2XDMA 3VP3A 3PAEA 4KZ6A 4GKUA 5DTSA 1BT5A 2DNSA 2H10A 5CRFA 3RXWA 4E3NA 2FFYA 1FQGA 3VSKA 3W4OA 3ZNTA 2ZC6B 4WZ5C 5U47A 1PW8A 4Y7PA 4S2MA 5DTTA 4WYYA 2WUQA 4MBKA 3IQAA 4S2NA 4BD1A 5L2FA 4PM6A 3VOYA 1MPLA 4C6YA 5CHJA 1L0FA 3VP0A 1PW1A 2QPNA 4KENB 5M1AA 5E2EA 1W8YA 3CJMA 1CI8A 1GA9A 5FAQA 1DJBA 1PI4A 2QMIA 1W7FA 3VFFA 3HLFA 1ERQA 3HUMA 5HFOA 4JXGA 2JBFA 3IH9A 5AQAA 2Y2GA 1LI9A 2XFTA 1KGFA 4GD8A 3ZVTA 2ZQDA 4X53A 3ZG5A 1JTDA 4X69A 4K0XA 4DE3A 3BLMA 2H0YA 2B5RA 5FSRA 4DKIA 2Y2HA 2X01A 2UWXA 4R3JA 2EX6A 4KZBA 5KMWA 2JCHA 1IELA 3M6BA 4IVKA 3ZDJA 3Q81A 1CK3A 3Q7VA 5TGFA 3G30A 1Y54A 3MZDA 1K56D 3PBTA 3WRZA 1LL5A 1HVBA 3CZDA 3UO9A 5FI7A 1K6RA 3TOIA 3ZG8B 3W8KA 1KVMA 3N7WA 1SKFA 3NDGA 2ZQCA 4B4XA 3SS4A 1YLTA 4FSFA 1KGEA 4E3LA 4KZ4A 5CTNA 3TSGA 3JYIA 1RGYA 3EQVA 1IYSA 3CMZA 5CHMA 1WYCA 4JXVA 3RJUA 4UHUA 3LY3A 1GA0A 3N8SA 5EVIB 5G18A 4E6XA 1VM1A 4BJPA 3MXRA 1EROA 3QNCA 1SHVA 1RP5A 3ISGA 5CERA 4LV2A 2C5WB 3OCNA 1L0GA 4EV4A 3BFFA 4KQQA 4DRTA 4NETA 3M2JA 3ZG9B 3ZG0A 4P85A 3NCKA 4U0XA 1MBLA 4F94A 4WZ4A 3A3DA 4S2IA 5HAQA 3UDIA 1QMEA 4OONA 1RGZA 1FCMA 4PMAA 1IKIA 2XEPA 4KG6A 2H0TA 1MWSA 4QD4A 2ZLYA 4ZJ1A 1VQQA 1K57A 3Q7ZA 4X6TA 2DRWA 2ZQ8A 2HPBA 1K4EA 3BFCA 3NIAA 3HLGA 4Y0UA 1ESUA 4CJNA 2J9PA 4KQOA 1XPBA 1W8QA 3PBQA 4WEKA 4WELA 3UN7A 3UNWA 5M19A 2ZC4B 3AGFA 1TDLA 5FI2A 5HX9A 4E6WA 2Y2KA 3S1YA 4KZ7A 4ZJ2A 3V39A 3G31A 4WZ5A 2WGWA 3PTEA 4E3KA 3VOZA 2XH9A 2JE5A 3HLCA 3W4PA 3WWXA 4EWFA 4RVAA 5DF9A 5DVAA 3I7JA 4WMCA 3V50A 1L0DA 4GZBA 4HEFA 4JBFA 5GLBA 2OV5A 5HW3A 1ES4A 5FATA 1NJ4A 1PWGA 3PBNA 5AQBA 4LENA 4GD6A 5F1FA 3A3EA 3O86A 4WM9A 4C75A 5EE8A 1DJAA 1KDSA 3GMWA 3ZG7B 2Z2LB 1EI5A 4L0LA 2HP6A 4OQHA 3IWIA 2JC7A 3IF5A 2V2FF 4OLDA 4OPZA 3V3RA 3OPLA 3VP4A 4DDYA 1I2WA 1JWZA 1YQSA 4OH0A 4Y0OA 3GRJA 1IKGA 4EUZA 2Y2MA 4PM9A 1FR1A 3Q07A 1IYQA 1JTGA 5F82A 3S4XA 4E3JA 1NY0A 4X56A 4S2OA 5CGSA 4OKPA 2ZMAA 4B88A 5A92A 1XP4A 3FKVA 5FQJA 4KZ3A 4S2JA 4E3MA 1E3UD 4ZAMA 1M40A 2ZC7A 3MKFA 2OLVA 5EPHA 3VFHA 3GTCA 3LCEA 4JF5A 1J9MA 4P0MA 1MKIA 4HBTA 2VGJA 4OQGA 1PIOA 3G4PA 4GDNA 2A3UA 4GDBA 4YINA 5BOHA 3P09A 3S22A 1MWRA 5E43A 2ZM8A 2J9OA 3D4FA 2ZM2A 1L0EA 1FSWA 2XQZA 2PBYA 3AGEA 3BYDA 4PM7A 5KSCA 1RCJA 2G2WA 1N4OA 5IHVA 3PBSA 4OP5A 2WAEA 3ITBA 4WBGA 3SOIA 3ZNYA 3Q1FA 1XX2A 3UPOA 1PYYA 3FZCA 4N9LA 1H8YA 2OLUA 4OQIA 1TVFA 2Y2QA 4JXSA 5CGXA 4DF6A 1KGGA 3IF6C 4DXBA 2HDUA 3OC2A 4JF4A 1KDWA 5CEBA 3BFGA 1O7EA 3WS4A 2IWBA 4MLLA 5FQKA 1E3UA 5DF8A 5D3OA 4OPQA 3Q7VB 3UE1A 1HD8A 5GLAA 3MKEA 1OMEA 4N1XA 3UPNA 4KZ9A 2WZZA 2Y2LA 3PBOA 4FH2A 1ONGA 4JKTA 2WKIA 3VSLA 1ZC2A 2J7VA 3E2KA 1K38A 3M2KA 4XUZA 4RYEA 4NK3A 1CI9A 3AGDA 4BL2A 4QY5A 4JLFA 3V5MA 4C3QA 3HLDA 2Y2IA 4MEZA 1XKZA 4WMCD 1BLSA 3IH8A 4PPRA 2WADA 5EVLA 1NRFA 4K91A 2Y59A 4ID4A 2H5SA 4QB8A 1YMXA 4XUXA 2XF3A 4MNRA 5GHYA 3LY4A 4DE0A 2ZC5B 4LV0A 3A3FA 5DTKA 4BD0A 3N4IA 5HL1A 3DW0A 4OPRA 3IT9A 5FQMA 4D2OA 1E4DA 2WKHA 5CECA 1ZKJA 4JF6A 2WZXA 1PI5A 4K0WA 2EX8A 4HBUA 3M6HA 3UY6A 1HZOA 5FQQA 3VP2A 4Q8IA 2V20A 4GNUA 3G2ZA 3SH9A 1E25A 4LV1A 2ZM0A 3BM6A 4A5RA 3HLWA 4QY6A 2GDNA 4M3KA 3ZHHA 3V3SA 1BLPA 4N1HA 4YFMA 4BENA 3P98A 4MBHA 3N8RA 3A3IA 4LV3A 1YLPA 4IEDA 3LEZA 5GLDA 5TFQA 4B4ZA 2R9WA 5HARA 2XR0A 1Q2QA 4QHCA 1SDEA 3HUNA 1KE4A 4LCMA 5CXWA 4H8RA 3DWKA 1H5XA 5FI6A 2QZ6A 4R1GA 2WGWB 3HBRA 1HTZA 4UA6A 3MZFA 3N8LA 4GOGA 5JYPA 3IWQA 1CEFA 2ZQ9A 2ZQAA 2G2UA 4OPYA 1ZG4A 2HDRA 4Z9QA 2V1ZA 4BL3A 3WRTA 3WS5A 4OVDA 5EVIC 1YMSA 4EQIA 3C7UA 3IXGA 2PU2A 1K25A 1BTLA 3BFEA 3NDEA 2P9VA 3IXDA 5E2FA 5F1GA 3ZGAB 1U60A 2R9XA 3GQZA 4QU3A 4R3BA 5E2GA 4CPKA 3ZCZA 2PU4A 5EOEA 4QJGA 4O7DA 1FCNA 2Y2OA 2WKEA 1IYPA 1C3BA 2WGIA 1L2SA 3QHYA 1KE3A 1PZPA 3IF6A 1YM1A 3N6IA 4KG2A 4RA7A 4S2PA 4UA9A 1ALQA 1XGIA 3C4OA 3RXXA 3UE0A 3SH7A 3IHAA 4N92A 5JYOA 5GLCA 4OP8A 1LLBA 4LCLA 3B3XA 3A3JA 3FV7A 3G35A 4GN2A 3G2YA 4DDSA 2IWDA 3VP1A 1YLWA 2Q9MA 1LHYA 2VGKA 5TR7A 1WYBA 3FWLA 5DF7A 1H8ZA 3BFDA 3HL9A 5FDHA 3PBRA 5KSHA 1K55C 2P74A 4E3OA 2EX9A 3PAGA 3BRMA 1DJCA 2Y4AA 1PWCA 1GHIA 2HP5A 1GHPA 2EX2A 3DWZA 1W79A 4KZAA 2BLSA 4DE2A 1LI0A 5FASA 1YLZA 1I5QA 1NYMA 4FCFA 3BECA 1XA7A 4HESA 1ERMA 2X71A 2Y2JA 4OLGA 2X02A 3IHBA 4R0QA 5AQ7A 5FQ9A 5KZHA 2ZJ9A 1FSYA 1I2SA 5HAIA 2Y2NA 2CC1A 3DTMA 1BZAA 2WYXA 3WS1A 1G6AA 4OOLA 5E2HA 1QMFA 5M18A 5EECA 2XD1A 2ZC3B 3NC8A 5EVID 1ES3A 1NZUA 2Z2MB 3ITAA 1TDGA 3MXSA 3NI9A 4ZDXA 3IWOA 4R4SA 1M6KA 4ZJ3A 2XGNA 4KZ8A 4KZ5A 4PM5A 3FYZA 4N9KA 2E8IA 2RL3A 4OOMA 4R4RA 3C7VA 5CGWA 3UDFA 1K54C 5EUAA 1S0WA 1BUEA 2EXBA 4UAAA 4RX3A 5A90A 4GB7A 5FAPA 4FH4A 3G34A 2WAFA 1ES2A 2C6WB 4ZBEA 1ONHA 3UE3A 1IYOA 2A49A 3UDXA 3E2LA 3O3VA 4E3IA 1Z6FA 1K4FA 3HUOA 3ZFZA 1MWTA 4S2NC 3CG5A 3IXBA 4EBLA 3HLEA 3GV9A 5GL9A 4ZTKA 4OQ0A 1O07A 1WE4A 4S2KA 4P6BA 3WS2A 2Q9NA 3OCLA 2EFUA 3C4PA 5AQ9A 4R23A 2J8YA 1S6RA 5EVIA 5I94A 1G68A 4PM8A 2WK0A 4UA7A 2ZQ7A 4X55A 1BLHA 5EOOA 4X68A 3ZVWA 4Y0TA 1JVJA 3TG9A 5J8XA 4S2LA 1K6SA 3BEBA 3SH8A 2XD5A 5CEDA 1MXOA 2I72A 1NXYA 2IWCA 3QNBA 5FAOA 5HAPA 1GCEA 1MWUA 1PWDA 2XLNA 4EBPA 1YLYA 3HREA 3OPPA 3HVFA 4P87A 3WS0A 4OOYA 2DCFA 3NY4A 2Y91A 5CHUA 3W4QA 1DY6A 1PZOA 1TEMA 1YLJA 2Y55A 3O87A 3OZHA 3SS3A 1N9BA 1JWPA 1GHMA 1NYYA 1ES5A 3NBLA 1FR6A 1CEGA 4WEJA 1XA1A 1YT4A 1ZG6A 2XK1A 3OPHA 1JWVA 5F83A 4EBNA 4XXRA 1KE0A 1K56A 2WGVA 3BLSA 4KQRA 5FA7A 2FFFB 3OPRA 1AXBA 1BLCA 1BSGA 1K55A 3MFDA 3MZEA 5CTMA 1MY8A 2OSUA 1NZOA 1ESIA 2EXAA 3O88A 1Q2PA 2HDSA 4JXWA 5GHXA 5A93A 2BG1A 2P9VB 4U0TA 2EFXA 3HLBA 2XFSA 1SCWA 3LO7A 1XGJA 3C5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BUL A;  2RCX A;  3GR2 A;  2Y2P A;  4MBF A;  4U3T A;  1FOF A;  4BQM A;  1W5D A;  3IF6 B;  4DXC A;  4BLM A;  4DE1 A;  2HDQ A;  3GSG A;  3GVB A;  4RX2 A;  1IEM A;  3IXH A;  5GHZ A;  3FKW A;  1LL9 A;  4IVI A;  1FCO A;  4IBX A;  3Q82 A;  4KG5 A;  5FQI A;  1EWZ A;  4JPM A;  1KVL A;  3G32 A;  1K54 A;  3MBZ A;  3UPP A;  2HP9 A;  3VMA A;  3SS5 A;  1K57 C;  2ZD8 A;  3EQU A;  4FD8 A;  5A91 A;  4IBR A;  1XXM A;  1SDN A;  2XDM A;  3VP3 A;  3PAE A;  4KZ6 A;  4GKU A;  5DTS A;  1BT5 A;  2DNS A;  2H10 A;  5CRF A;  3RXW A;  4E3N A;  2FFY A;  1FQG A;  3VSK A;  3W4O A;  3ZNT A;  2ZC6 B;  4WZ5 C;  5U47 A;  1PW8 A;  4Y7P A;  4S2M A;  5DTT A;  4WYY A;  2WUQ A;  4MBK A;  3IQA A;  4S2N A;  4BD1 A;  5L2F A;  4PM6 A;  3VOY A;  1MPL A;  4C6Y A;  5CHJ A;  1L0F A;  3VP0 A;  1PW1 A;  2QPN A;  4KEN B;  5M1A A;  5E2E A;  1W8Y A;  3CJM A;  1CI8 A;  1GA9 A;  5FAQ A;  1DJB A;  1PI4 A;  2QMI A;  1W7F A;  3VFF A;  3HLF A;  1ERQ A;  3HUM A;  5HFO A;  4JXG A;  2JBF A;  3IH9 A;  5AQA A;  2Y2G A;  1LI9 A;  2XFT A;  1KGF A;  4GD8 A;  3ZVT A;  2ZQD A;  4X53 A;  3ZG5 A;  1JTD A;  4X69 A;  4K0X A;  4DE3 A;  3BLM A;  2H0Y A;  2B5R A;  5FSR A;  4DKI A;  2Y2H A;  2X01 A;  2UWX A;  4R3J A;  2EX6 A;  4KZB A;  5KMW A;  2JCH A;  1IEL A;  3M6B A;  4IVK A;  3ZDJ A;  3Q81 A;  1CK3 A;  3Q7V A;  5TGF A;  3G30 A;  1Y54 A;  3MZD A;  1K56 D;  3PBT A;  3WRZ A;  1LL5 A;  1HVB A;  3CZD A;  3UO9 A;  5FI7 A;  1K6R A;  3TOI A;  3ZG8 B;  3W8K A;  1KVM A;  3N7W A;  1SKF A;  3NDG A;  2ZQC A;  4B4X A;  3SS4 A;  1YLT A;  4FSF A;  1KGE A;  4E3L A;  4KZ4 A;  5CTN A;  3TSG A;  3JYI A;  1RGY A;  3EQV A;  1IYS A;  3CMZ A;  5CHM A;  1WYC A;  4JXV A;  3RJU A;  4UHU A;  3LY3 A;  1GA0 A;  3N8S A;  5EVI B;  5G18 A;  4E6X A;  1VM1 A;  4BJP A;  3MXR A;  1ERO A;  3QNC A;  1SHV A;  1RP5 A;  3ISG A;  5CER A;  4LV2 A;  2C5W B;  3OCN A;  1L0G A;  4EV4 A;  3BFF A;  4KQQ A;  4DRT A;  4NET A;  3M2J A;  3ZG9 B;  3ZG0 A;  4P85 A;  3NCK A;  4U0X A;  1MBL A;  4F94 A;  4WZ4 A;  3A3D A;  4S2I A;  5HAQ A;  3UDI A;  1QME A;  4OON A;  1RGZ A;  1FCM A;  4PMA A;  1IKI A;  2XEP A;  4KG6 A;  2H0T A;  1MWS A;  4QD4 A;  2ZLY A;  4ZJ1 A;  1VQQ A;  1K57 A;  3Q7Z A;  4X6T A;  2DRW A;  2ZQ8 A;  2HPB A;  1K4E A;  3BFC A;  3NIA A;  3HLG A;  4Y0U A;  1ESU A;  4CJN A;  2J9P A;  4KQO A;  1XPB A;  1W8Q A;  3PBQ A;  4WEK A;  4WEL A;  3UN7 A;  3UNW A;  5M19 A;  2ZC4 B;  3AGF A;  1TDL A;  5FI2 A;  5HX9 A;  4E6W A;  2Y2K A;  3S1Y A;  4KZ7 A;  4ZJ2 A;  3V39 A;  3G31 A;  4WZ5 A;  2WGW A;  3PTE A;  4E3K A;  3VOZ A;  2XH9 A;  2JE5 A;  3HLC A;  3W4P A;  3WWX A;  4EWF A;  4RVA A;  5DF9 A;  5DVA A;  3I7J A;  4WMC A;  3V50 A;  1L0D A;  4GZB A;  4HEF A;  4JBF A;  5GLB A;  2OV5 A;  5HW3 A;  1ES4 A;  5FAT A;  1NJ4 A;  1PWG A;  3PBN A;  5AQB A;  4LEN A;  4GD6 A;  5F1F A;  3A3E A;  3O86 A;  4WM9 A;  4C75 A;  5EE8 A;  1DJA A;  1KDS A;  3GMW A;  3ZG7 B;  2Z2L B;  1EI5 A;  4L0L A;  2HP6 A;  4OQH A;  3IWI A;  2JC7 A;  3IF5 A;  2V2F F;  4OLD A;  4OPZ A;  3V3R A;  3OPL A;  3VP4 A;  4DDY A;  1I2W A;  1JWZ A;  1YQS A;  4OH0 A;  4Y0O A;  3GRJ A;  1IKG A;  4EUZ A;  2Y2M A;  4PM9 A;  1FR1 A;  3Q07 A;  1IYQ A;  1JTG A;  5F82 A;  3S4X A;  4E3J A;  1NY0 A;  4X56 A;  4S2O A;  5CGS A;  4OKP A;  2ZMA A;  4B88 A;  5A92 A;  1XP4 A;  3FKV A;  5FQJ A;  4KZ3 A;  4S2J A;  4E3M A;  1E3U D;  4ZAM A;  1M40 A;  2ZC7 A;  3MKF A;  2OLV A;  5EPH A;  3VFH A;  3GTC A;  3LCE A;  4JF5 A;  1J9M A;  4P0M A;  1MKI A;  4HBT A;  2VGJ A;  4OQG A;  1PIO A;  3G4P A;  4GDN A;  2A3U A;  4GDB A;  4YIN A;  5BOH A;  3P09 A;  3S22 A;  1MWR A;  5E43 A;  2ZM8 A;  2J9O A;  3D4F A;  2ZM2 A;  1L0E A;  1FSW A;  2XQZ A;  2PBY A;  3AGE A;  3BYD A;  4PM7 A;  5KSC A;  1RCJ A;  2G2W A;  1N4O A;  5IHV A;  3PBS A;  4OP5 A;  2WAE A;  3ITB A;  4WBG A;  3SOI A;  3ZNY A;  3Q1F A;  1XX2 A;  3UPO A;  1PYY A;  3FZC A;  4N9L A;  1H8Y A;  2OLU A;  4OQI A;  1TVF A;  2Y2Q A;  4JXS A;  5CGX A;  4DF6 A;  1KGG A;  3IF6 C;  4DXB A;  2HDU A;  3OC2 A;  4JF4 A;  1KDW A;  5CEB A;  3BFG A;  1O7E A;  3WS4 A;  2IWB A;  4MLL A;  5FQK A;  1E3U A;  5DF8 A;  5D3O A;  4OPQ A;  3Q7V B;  3UE1 A;  1HD8 A;  5GLA A;  3MKE A;  1OME A;  4N1X A;  3UPN A;  4KZ9 A;  2WZZ A;  2Y2L A;  3PBO A;  4FH2 A;  1ONG A;  4JKT A;  2WKI A;  3VSL A;  1ZC2 A;  2J7V A;  3E2K A;  1K38 A;  3M2K A;  4XUZ A;  4RYE A;  4NK3 A;  1CI9 A;  3AGD A;  4BL2 A;  4QY5 A;  4JLF A;  3V5M A;  4C3Q A;  3HLD A;  2Y2I A;  4MEZ A;  1XKZ A;  4WMC D;  1BLS A;  3IH8 A;  4PPR A;  2WAD A;  5EVL A;  1NRF A;  4K91 A;  2Y59 A;  4ID4 A;  2H5S A;  4QB8 A;  1YMX A;  4XUX A;  2XF3 A;  4MNR A;  5GHY A;  3LY4 A;  4DE0 A;  2ZC5 B;  4LV0 A;  3A3F A;  5DTK A;  4BD0 A;  3N4I A;  5HL1 A;  3DW0 A;  4OPR A;  3IT9 A;  5FQM A;  4D2O A;  1E4D A;  2WKH A;  5CEC A;  1ZKJ A;  4JF6 A;  2WZX A;  1PI5 A;  4K0W A;  2EX8 A;  4HBU A;  3M6H A;  3UY6 A;  1HZO A;  5FQQ A;  3VP2 A;  4Q8I A;  2V20 A;  4GNU A;  3G2Z A;  3SH9 A;  1E25 A;  4LV1 A;  2ZM0 A;  3BM6 A;  4A5R A;  3HLW A;  4QY6 A;  2GDN A;  4M3K A;  3ZHH A;  3V3S A;  1BLP A;  4N1H A;  4YFM A;  4BEN A;  3P98 A;  4MBH A;  3N8R A;  3A3I A;  4LV3 A;  1YLP A;  4IED A;  3LEZ A;  5GLD A;  5TFQ A;  4B4Z A;  2R9W A;  5HAR A;  2XR0 A;  1Q2Q A;  4QHC A;  1SDE A;  3HUN A;  1KE4 A;  4LCM A;  5CXW A;  4H8R A;  3DWK A;  1H5X A;  5FI6 A;  2QZ6 A;  4R1G A;  2WGW B;  3HBR A;  1HTZ A;  4UA6 A;  3MZF A;  3N8L A;  4GOG A;  5JYP A;  3IWQ A;  1CEF A;  2ZQ9 A;  2ZQA A;  2G2U A;  4OPY A;  1ZG4 A;  2HDR A;  4Z9Q A;  2V1Z A;  4BL3 A;  3WRT A;  3WS5 A;  4OVD A;  5EVI C;  1YMS A;  4EQI A;  3C7U A;  3IXG A;  2PU2 A;  1K25 A;  1BTL A;  3BFE A;  3NDE A;  2P9V A;  3IXD A;  5E2F A;  5F1G A;  3ZGA B;  1U60 A;  2R9X A;  3GQZ A;  4QU3 A;  4R3B A;  5E2G A;  4CPK A;  3ZCZ A;  2PU4 A;  5EOE A;  4QJG A;  4O7D A;  1FCN A;  2Y2O A;  2WKE A;  1IYP A;  1C3B A;  2WGI A;  1L2S A;  3QHY A;  1KE3 A;  1PZP A;  3IF6 A;  1YM1 A;  3N6I A;  4KG2 A;  4RA7 A;  4S2P A;  4UA9 A;  1ALQ A;  1XGI A;  3C4O A;  3RXX A;  3UE0 A;  3SH7 A;  3IHA A;  4N92 A;  5JYO A;  5GLC A;  4OP8 A;  1LLB A;  4LCL A;  3B3X A;  3A3J A;  3FV7 A;  3G35 A;  4GN2 A;  3G2Y A;  4DDS A;  2IWD A;  3VP1 A;  1YLW A;  2Q9M A;  1LHY A;  2VGK A;  5TR7 A;  1WYB A;  3FWL A;  5DF7 A;  1H8Z A;  3BFD A;  3HL9 A;  5FDH A;  3PBR A;  5KSH A;  1K55 C;  2P74 A;  4E3O A;  2EX9 A;  3PAG A;  3BRM A;  1DJC A;  2Y4A A;  1PWC A;  1GHI A;  2HP5 A;  1GHP A;  2EX2 A;  3DWZ A;  1W79 A;  4KZA A;  2BLS A;  4DE2 A;  1LI0 A;  5FAS A;  1YLZ A;  1I5Q A;  1NYM A;  4FCF A;  3BEC A;  1XA7 A;  4HES A;  1ERM A;  2X71 A;  2Y2J A;  4OLG A;  2X02 A;  3IHB A;  4R0Q A;  5AQ7 A;  5FQ9 A;  5KZH A;  2ZJ9 A;  1FSY A;  1I2S A;  5HAI A;  2Y2N A;  2CC1 A;  3DTM A;  1BZA A;  2WYX A;  3WS1 A;  1G6A A;  4OOL A;  5E2H A;  1QMF A;  5M18 A;  5EEC A;  2XD1 A;  2ZC3 B;  3NC8 A;  5EVI D;  1ES3 A;  1NZU A;  2Z2M B;  3ITA A;  1TDG A;  3MXS A;  3NI9 A;  4ZDX A;  3IWO A;  4R4S A;  1M6K A;  4ZJ3 A;  2XGN A;  4KZ8 A;  4KZ5 A;  4PM5 A;  3FYZ A;  4N9K A;  2E8I A;  2RL3 A;  4OOM A;  4R4R A;  3C7V A;  5CGW A;  3UDF A;  1K54 C;  5EUA A;  1S0W A;  1BUE A;  2EXB A;  4UAA A;  4RX3 A;  5A90 A;  4GB7 A;  5FAP A;  4FH4 A;  3G34 A;  2WAF A;  1ES2 A;  2C6W B;  4ZBE A;  1ONH A;  3UE3 A;  1IYO A;  2A49 A;  3UDX A;  3E2L A;  3O3V A;  4E3I A;  1Z6F A;  1K4F A;  3HUO A;  3ZFZ A;  1MWT A;  4S2N C;  3CG5 A;  3IXB A;  4EBL A;  3HLE A;  3GV9 A;  5GL9 A;  4ZTK A;  4OQ0 A;  1O07 A;  1WE4 A;  4S2K A;  4P6B A;  3WS2 A;  2Q9N A;  3OCL A;  2EFU A;  3C4P A;  5AQ9 A;  4R23 A;  2J8Y A;  1S6R A;  5EVI A;  5I94 A;  1G68 A;  4PM8 A;  2WK0 A;  4UA7 A;  2ZQ7 A;  4X55 A;  1BLH A;  5EOO A;  4X68 A;  3ZVW A;  4Y0T A;  1JVJ A;  3TG9 A;  5J8X A;  4S2L A;  1K6S A;  3BEB A;  3SH8 A;  2XD5 A;  5CED A;  1MXO A;  2I72 A;  1NXY A;  2IWC A;  3QNB A;  5FAO A;  5HAP A;  1GCE A;  1MWU A;  1PWD A;  2XLN A;  4EBP A;  1YLY A;  3HRE A;  3OPP A;  3HVF A;  4P87 A;  3WS0 A;  4OOY A;  2DCF A;  3NY4 A;  2Y91 A;  5CHU A;  3W4Q A;  1DY6 A;  1PZO A;  1TEM A;  1YLJ A;  2Y55 A;  3O87 A;  3OZH A;  3SS3 A;  1N9B A;  1JWP A;  1GHM A;  1NYY A;  1ES5 A;  3NBL A;  1FR6 A;  1CEG A;  4WEJ A;  1XA1 A;  1YT4 A;  1ZG6 A;  2XK1 A;  3OPH A;  1JWV A;  5F83 A;  4EBN A;  4XXR A;  1KE0 A;  1K56 A;  2WGV A;  3BLS A;  4KQR A;  5FA7 A;  2FFF B;  3OPR A;  1AXB A;  1BLC A;  1BSG A;  1K55 A;  3MFD A;  3MZE A;  5CTM A;  1MY8 A;  2OSU A;  1NZO A;  1ESI A;  2EXA A;  3O88 A;  1Q2P A;  2HDS A;  4JXW A;  5GHX A;  5A93 A;  2BG1 A;  2P9V B;  4U0T A;  2EFX A;  3HLB A;  2XFS A;  1SCW A;  3LO7 A;  1XGJ A;  3C5A A; 
#chains in the Genus database with same CATH topology
 1BUL A;  3TJZ C;  3PHY A;  2HF6 A;  4G3K A;  4BLM A;  4DE1 A;  2VJW A;  5FQI A;  3G32 A;  3MBZ A;  4H6J B;  1K57 C;  2ZD8 A;  3EQU A;  1MZU A;  1SDN A;  4GKU A;  5DTS A;  4ME4 A;  5HWW A;  2FFY A;  3L7H A;  3QP5 A;  5U47 A;  1OTB A;  4AFI A;  4MBK A;  3IQA A;  4S2N A;  1L0F A;  2QPN A;  5FAQ A;  1W8Y A;  1PI4 A;  2ZBB A;  5HDD A;  5HFO A;  2Y2G A;  1LI9 A;  2ZQD A;  3ZG5 A;  3T4O A;  4X69 A;  5L09 A;  3BLM A;  1XFN A;  2B5R A;  2WKR A;  3SZT A;  4IVK A;  3ZDJ A;  1FIL A;  3Q7V A;  1TS6 A;  3G30 A;  3WRZ A;  3PBT A;  3R7W B;  3CZD A;  1K6R A;  3TOI A;  5FDS A;  1SKF A;  4NG2 A;  4FSF A;  1SKO B;  5CHM A;  4ESP A;  1XJ3 A;  3RJU A;  2VKS A;  1VM1 A;  3E0Y A;  1ERO A;  3QNC A;  5EFW A;  1RP5 A;  2G7U A;  1YSQ A;  3ISG A;  3OCN A;  1L0G A;  4NET A;  4P85 A;  4F94 A;  3A3D A;  3UDI A;  1RGZ A;  1FCM A;  5C5K A;  3KYE A;  2E8J A;  1F9I A;  1K4E A;  3NIA A;  2J9P A;  3UNW A;  5M19 A;  1NRJ A;  5FI2 A;  3JPU A;  2XH9 A;  5DF9 A;  4GS9 B;  2W1T B;  2ZMF A;  2OV5 A;  5FAT A;  1NJ4 A;  1PWG A;  3H9W A;  1S1Z A;  5F1F A;  3A3E A;  3F1P B;  4JGR A;  5EE8 A;  4IHQ A;  1KDS A;  3CIT A;  4L0L A;  4OQH A;  2ZMV A;  3IF5 A;  4OLD A;  1I2W A;  1JWZ A;  3C38 A;  1IKG A;  4EUZ A;  5F82 A;  2XRN A;  3MQ0 A;  5CGS A;  3SW1 A;  5A92 A;  5FQJ A;  4E3M A;  3LR5 A;  4S2J A;  1E3U D;  3RTY A;  3HJK A;  3UB9 A;  1T1B A;  2OLV A;  5EPH A;  3GTC A;  4P0M A;  4Y2F A;  3PYP A;  2VLG A;  2J9O A;  2ZM2 A;  3T50 A;  2XQZ A;  3AGE A;  2HJ9 C;  4PM7 A;  5DFX A;  2G2W A;  1N4O A;  4R3A A;  5A8B A;  3ZQ5 A;  3ITB A;  1PYY A;  2QJ7 A;  1G6O A;  1TVF A;  4JXS A;  3LR3 A;  4GW9 A;  1Z09 A;  3NOP C;  4LRY C;  3WS4 A;  5TBM A;  4MLL A;  1E3U A;  4UEY A;  4EET B;  5GLA A;  3T1X A;  3UPN A;  1P9W A;  1Y28 A;  2L0W A;  2W3E A;  3E4Q A;  2Y2L A;  1ZTU A;  4II7 A;  2VZW A;  3HCY A;  4ETX A;  3M2K A;  3JVV A;  4KUO A;  4B9O A;  1IFQ A;  2OWH A;  4WMC D;  1UWN X;  4PPR A;  4F3L A;  2ZOI A;  2V9A A;  4XUX A;  5MC7 A;  4MNR A;  5GHY A;  3GDI A;  4CLC E;  4JF6 A;  2EX8 A;  3CWF A;  3T12 B;  4QY6 A;  2PBD P;  2BTF P;  3RH8 B;  1GSX A;  3LEZ A;  2XR0 A;  4HIA A;  1SDE A;  1TF1 A;  3DWK A;  3BJN A;  4UA6 A;  4GOG A;  2ZQ9 A;  2ZQA A;  4HY8 A;  2INW A;  2HDR A;  4Z9Q A;  4BL3 A;  5DKK A;  4EQI A;  3UME A;  3DTE A;  1BTL A;  3BFE A;  3NDE A;  3ZGA B;  4R3B A;  4O7D A;  5F69 A;  3F1N B;  1C3B A;  1L2S A;  3QHY A;  1KE3 A;  1PZP A;  2AVX A;  4GHI B;  2QYB A;  1ALQ A;  3C4O A;  3RXX A;  5IS1 A;  1IOU A;  2HJE A;  3IHA A;  3H82 B;  2NUP C;  1YKD A;  3FV7 A;  3VP1 A;  5DF7 A;  1H8Z A;  3BFD A;  5FDH A;  4HQA A;  5KSH A;  1K55 C;  5L07 A;  2EX9 A;  3BRM A;  1PWC A;  1LSX A;  3DWZ A;  2EX2 A;  3LIB A;  4DE2 A;  2BLS A;  1LI0 A;  5FAS A;  1I5Q A;  4OLG A;  3KSH A;  3IHB A;  3S7P A;  5EVI D;  4PAU A;  3ITA A;  3TW8 A;  4ZDX A;  4ZJ3 A;  1WA9 A;  2XGN A;  4KZ5 A;  4PM5 A;  1S67 L;  3UDF A;  4FTX A;  5EUA A;  1S0W A;  1BUE A;  2EXB A;  4UAA A;  3KX0 X;  5A90 A;  1T1C A;  4FH4 A;  2KOI A;  3UE3 A;  1IYO A;  3KSG A;  1D1J A;  2KX6 A;  1Z6F A;  3ZFZ A;  3D72 A;  4HH2 A;  4S2N C;  3CG5 A;  5F68 A;  4EBL A;  1TS8 A;  3HLE A;  5GL9 A;  5K5B A;  2OOL A;  1WE4 A;  4S2K A;  4P6B A;  4Q0I A;  2J8Y A;  5EVI A;  2OAQ 1;  4UA7 A;  3ZVW A;  2DMW A;  4X68 A;  3TG9 A;  3LIC A;  2ZL1 B;  3F1O A;  1GCE A;  3DTI A;  1PWD A;  1DRM A;  3WS0 A;  1VEU A;  2DCF A;  1TEM A;  3O87 A;  3ICY A;  3SS3 A;  1N9B A;  4WUJ A;  2WKQ A;  4EBN A;  2JKF A;  1N9O A;  3H7W A;  1BLC A;  2GJ3 A;  2K7S A;  3TRC A;  2OSU A;  3UB6 A;  2EXA A;  2YKH A;  1ZHH B;  2P9V B;  4WLA A;  3LUQ A;  3P01 A;  1XGJ A;  4MBF A;  4U3T A;  1FOF A;  3GSG A;  4PKY A;  4CQH A;  1LSW A;  3IXH A;  5GHZ A;  3FKW A;  4IBX A;  3Q82 A;  1OTD A;  1VET B;  1EWZ A;  3SS5 A;  4FD8 A;  4IBR A;  1XXM A;  4KZ6 A;  2V8C A;  4LFU A;  2VV7 A;  3RXW A;  4O01 A;  3VSK A;  4Y7P A;  4I5S A;  4S2M A;  5DTT A;  1CJF A;  3B42 A;  1FIK A;  3CPT A;  2Y8H A;  1DP8 A;  1XJ2 A;  1CI8 A;  2PT7 A;  2QMI A;  1W7F A;  3HUM A;  1H8M A;  2JBF A;  3IH9 A;  1KGF A;  5IT5 A;  1TD5 A;  3D9Y A;  2H0Y A;  3NOT C;  5FSR A;  3IS2 B;  2EX6 A;  2JCH A;  4I39 A;  1CK3 A;  5TGF A;  3MZD A;  1Y54 A;  1K56 D;  5FI7 A;  5FEG A;  2EWW A;  1KVM A;  3NDG A;  4B4X A;  3OLO A;  3E4O A;  3NEC A;  5CTN A;  3KYQ A;  1RGY A;  1XJ6 A;  1IYS A;  3CMZ A;  5EVE A;  3LY3 A;  1GA0 A;  3QP8 A;  2B18 A;  4BJP A;  3MF0 A;  5CER A;  5EM0 A;  4EXO A;  2C5W B;  3IX3 A;  4E04 A;  3BFF A;  4KQQ A;  3ZG9 B;  1MBL A;  3JVU A;  2GNX A;  2ACG A;  2A24 B;  4PMA A;  2XEP A;  1UWP X;  4G3V A;  4X6T A;  4NXF A;  2DRW A;  2ZQ8 A;  2HPB A;  4UQI S;  4KQO A;  3B33 A;  5HX9 A;  4E6W A;  2Y2K A;  5AJG A;  4ZJ2 A;  4WZ5 A;  2WGW A;  3VOZ A;  2JE5 A;  4Q0J A;  5DVA A;  4RVA A;  3T4T A;  3I7J A;  1ODV A;  1L0D A;  4GZB A;  4HEF A;  4JBF A;  3MQQ A;  4WM9 A;  3EEA A;  5HZH A;  3IWI A;  3V3R A;  3OPL A;  3VP4 A;  2D02 A;  3S7O A;  1F5M A;  4OH0 A;  4HJ6 A;  4Q0H A;  3Q07 A;  1TS0 A;  1JTG A;  3S4X A;  1NY0 A;  4S2O A;  1XP4 A;  4ZAM A;  3BW6 A;  3R4K A;  4JF5 A;  4HHD A;  3UB5 P;  1J9M A;  2VGJ A;  4OQG A;  3G4P A;  4GDN A;  2LB9 A;  3P09 A;  1FSW A;  5HDS A;  3PBS A;  3A0S A;  4OP5 A;  3Q1F A;  1XX2 A;  3FZC A;  3KYZ A;  4N9L A;  5EM1 A;  1KGG A;  4DXB A;  5CEB A;  4EU0 A;  2V1A A;  5FQK A;  3NHQ A;  3UE1 A;  2VK3 A;  3Q7V B;  3CUE A;  3LYX A;  4KZ9 A;  4EW7 A;  3PBO A;  1ONG A;  4JKT A;  2WKI A;  5G4Y A;  1ZC2 A;  3E2K A;  4XUZ A;  4NK3 A;  1CI9 A;  4QY5 A;  4JLF A;  3V5M A;  3U2A A;  4NXE A;  1P0Z A;  4K91 A;  4DN0 A;  2Y59 A;  4ID4 A;  1YMX A;  3FG8 A;  3LY4 A;  4DE0 A;  2ZC5 B;  4LV0 A;  3A3F A;  4IUH A;  4BBU A;  2HV1 A;  3IT9 A;  5CEC A;  3FPW A;  4BMW A;  2W3F A;  3M6H A;  3UY6 A;  1HZO A;  4Q8I A;  2V20 A;  3BM6 A;  4A5R A;  2K2N A;  3V3S A;  4KUK A;  3UMD A;  3N8R A;  4IED A;  5DJT A;  3HUN A;  5CXW A;  4R1G A;  3HBR A;  3MZF A;  3IWQ A;  2G2U A;  2V1B A;  5AVE A;  5EVI C;  4XT2 A;  2XRO A;  3C7U A;  3IXG A;  4R38 A;  2VX8 A;  1K25 A;  3IXD A;  1U60 A;  3FC7 A;  3T4S A;  2R9X A;  3GQZ A;  1N9N A;  1T1A A;  1NLY A;  4QWO A;  3DAV A;  2Y2O A;  2WKE A;  1IYP A;  3IF6 A;  3N6I A;  4S2P A;  4RA7 A;  1CQA A;  1OTI A;  1KOU A;  1H0M A;  1N9L A;  3BY8 A;  5EV0 A;  3G35 A;  4GN2 A;  4DDS A;  4UQI M;  2M7V A;  1YLW A;  2Q9M A;  3FWL A;  2O9B A;  3HL9 A;  4Y15 A;  3PAG A;  1DJC A;  5L8M A;  1K0K A;  1GHP A;  4KZA A;  3ULF A;  1NYM A;  3LI9 A;  4FCF A;  4I3A A;  3BEC A;  1XA7 A;  5KIZ A;  3LGO A;  4R0Q A;  5FQ9 A;  3QP6 A;  2ZJ9 A;  1I2S A;  1BZA A;  2D01 A;  1G6A A;  4OOL A;  1QMF A;  2PDR A;  5EEC A;  3NC8 A;  1ES3 A;  1W63 Q;  3MXS A;  3PR6 A;  4R4S A;  4KZ8 A;  4OOM A;  2E8I A;  5TBM B;  1H3Q A;  2JHE A;  3B47 A;  4RX3 A;  2C6W B;  4G3W A;  1ONH A;  4ZBE A;  3OBF A;  3LI8 A;  3UDX A;  2JKG A;  4ARZ A;  2JKR I;  3O3V A;  2CMN A;  4E3I A;  1EW0 A;  4Y5F A;  3T4L A;  4F3L B;  2XA7 S;  2Q9N A;  3OCL A;  3C4P A;  5AQ9 A;  1G68 A;  1BLH A;  4Y0T A;  1L3L A;  1K6S A;  3BEB A;  5CED A;  1MXO A;  2I72 A;  3BQ8 A;  1NXY A;  4MDZ A;  5FAO A;  4P87 A;  3HVF A;  3NY4 A;  3U4L P;  1T19 A;  1DY6 A;  1PZO A;  1YLJ A;  2Z6D A;  1ES5 A;  1SZV A;  1V9Y A;  1CEG A;  1YT4 A;  1ZG6 A;  2XK1 A;  3OPH A;  1JWV A;  4HJ3 A;  2L4R A;  4QPR A;  4D60 A;  4XXR A;  2WGV A;  4IUK A;  3K3C A;  1AXB A;  3MFD A;  2EWV A;  1VHM A;  4JXW A;  5A93 A;  1LL8 A;  2BG1 A;  2GX5 A;  2Y79 A;  2XFS A;  5HDC A;  2M1C A;  3GR2 A;  2HDQ A;  4RX2 A;  3GVB A;  4WL9 A;  1LSV A;  5CX7 A;  1LL9 A;  4IVI A;  1FCO A;  4JPM A;  2PD8 A;  3IX4 A;  1KVL A;  2HP9 A;  3VMA A;  1BYW A;  3VP3 A;  3PAE A;  3FPV A;  1BT5 A;  2DNS A;  2H10 A;  2NUT C;  4E3N A;  1OJ5 A;  1FQG A;  3W4O A;  4WZ5 C;  3H82 A;  2A2L A;  4WYY A;  2WUQ A;  4PM6 A;  3VOY A;  1MPL A;  5CHJ A;  1PW1 A;  1UGU A;  5M1A A;  5E2E A;  3VFF A;  3HLF A;  4JXG A;  4GD8 A;  5L10 A;  3ZVT A;  5FEF A;  1JTD A;  4K0X A;  4DE3 A;  1V9Z A;  4GCZ A;  4R6L A;  2X01 A;  4KZB A;  5KMW A;  2QWS A;  3EOI A;  1NLZ A;  4CLC A;  1F98 A;  1HVB A;  5HPI A;  1YLT A;  4E3L A;  1KGE A;  4KZ4 A;  1YAX A;  3JYI A;  3EQV A;  5HSQ A;  1WYC A;  4JXV A;  5EVI B;  2BAS A;  5G18 A;  4E6X A;  1SHV A;  3LIA A;  3DBA A;  4LV2 A;  4DRT A;  1ACF A;  4U0X A;  4WZ4 A;  1VEU B;  4L9F A;  4S2I A;  2O9C A;  4OON A;  2O99 A;  4KG6 A;  2H0T A;  1MWS A;  3VE4 A;  4ZJ1 A;  3CUE C;  4KQD A;  3BFC A;  4Y0U A;  3HLG A;  4CJN A;  1ESU A;  1XPB A;  1F2K A;  3PBQ A;  4MN5 A;  3H7W B;  4WEL A;  4WEK A;  4ZRR A;  3UN7 A;  2ZC4 B;  3AGF A;  1X0O A;  2OWJ A;  4KZ7 A;  3G31 A;  1LT0 A;  3PTE A;  4E3K A;  3HLC A;  3W4P A;  3WWX A;  5AVF A;  1PFL A;  1STZ A;  5HW3 A;  2FZ0 A;  2XA7 M;  4HJ4 A;  5AQB A;  4LEN A;  3O86 A;  2KLI A;  1DJA A;  2W1R A;  1EI5 A;  2M7U A;  4EQ1 A;  2OAP 1;  3TE8 A;  4OPZ A;  2V2F F;  4DDY A;  4Y3I A;  1A0K A;  4Y0O A;  4PM9 A;  1IYQ A;  3EEH A;  4FOF A;  5J3W A;  4GLQ A;  4E3J A;  4OKP A;  1OTE A;  3QP4 A;  4B88 A;  4KZ3 A;  1M40 A;  4LRZ E;  3MKF A;  3LCE A;  1S66 L;  1MKI A;  1PIO A;  2A3U A;  2P08 A;  4GDB A;  5BOH A;  1MWR A;  3CPT B;  1L0E A;  1JNU A;  2PBY A;  5KSC A;  1RCJ A;  4NXB A;  4WN5 A;  4WBG A;  3SOI A;  3ZNY A;  1OPX A;  3UPO A;  4I38 A;  2Y2Q A;  4DF6 A;  2P04 A;  3IF6 C;  5F5Y A;  2HDU A;  4MMN A;  4JF4 A;  2YKF A;  3BFG A;  1O7E A;  3CHW P;  1DP9 A;  2O0Y A;  3MKE A;  2PR5 A;  1OME A;  4N1X A;  3S7Q A;  4FH2 A;  1CF0 A;  2V0W A;  3VSL A;  3AGD A;  4YOF A;  2PYR A;  4I3I A;  4C3Q A;  4MEZ A;  1XKZ A;  3LEQ A;  1BLS A;  2UV0 E;  3IH8 A;  4X25 A;  4HH3 A;  3C2W A;  3N4I A;  4EER A;  1E4D A;  2EA9 A;  1ZKJ A;  2WZX A;  1PI5 A;  4K08 A;  3E4P A;  3SH9 A;  3EWK A;  1E25 A;  2ZM0 A;  3IBR A;  4RQ9 A;  2GDN A;  3O5Y A;  1BLP A;  4YFM A;  3A3I A;  1YLP A;  5GLD A;  5TFQ A;  4B4Z A;  4QHC A;  4LCM A;  1H5X A;  5FI6 A;  2WGW B;  3K2N A;  1MKM A;  1HTZ A;  3N8L A;  1CEF A;  4LPZ A;  2V1Z A;  1AWI A;  3WRT A;  3KSF A;  3MSH A;  4EEU A;  3T1S A;  2WKP A;  3ZCZ A;  5EOE A;  3CLO A;  4P6Z S;  2WGI A;  1YM1 A;  1XGI A;  3UE0 A;  2XSS A;  3LR0 A;  4H6J A;  3EGD C;  3KSI A;  4N92 A;  5JYO A;  4OP8 A;  1LLB A;  4LCL A;  3G2Y A;  4NXG A;  2VGK A;  4E3O A;  1W79 A;  3MFX A;  4Y13 A;  2PAV P;  4HES A;  2R78 A;  2X02 A;  5AQ7 A;  3DTM A;  2WYX A;  3E98 A;  2ZC3 B;  2Z2M B;  3NI9 A;  1P97 A;  3IWO A;  1M6K A;  3FYZ A;  4N9K A;  3C7V A;  1G28 A;  5IU1 A;  1ES2 A;  5DFY A;  3IBJ A;  3UE6 A;  5LBR A;  2HZ5 A;  3E2L A;  5FL3 A;  3R7W A;  1TS7 A;  1OTA A;  3HUO A;  5HL6 A;  1MWT A;  2PD7 A;  3IXB A;  3GV9 A;  4OQ0 A;  1OT6 A;  1SKO A;  2EFU A;  2PR6 A;  4R23 A;  1MC0 A;  4PM8 A;  5EOO A;  2WK0 A;  4BQM A;  1JVJ A;  5J8X A;  4S2L A;  3SH8 A;  2XD5 A;  4YNR A;  2IWC A;  2LB5 A;  3QNB A;  4EBP A;  1YLY A;  4L9E A;  3OPP A;  4OOY A;  3VE3 A;  2Y91 A;  3OZH A;  1VB6 A;  2Y55 A;  3RFB A;  1OT9 A;  1NYY A;  1GHM A;  4LRX C;  4CLC C;  1KE0 A;  2FFF B;  3OPR A;  2I9V A;  3A0V A;  4DJ2 A;  2VGL S;  3T1R A;  5CTM A;  1MY8 A;  2ZOH A;  3T1Q B;  5J4E A;  1D06 A;  4XT2 B;  1ESI A;  3O88 A;  4GS9 A;  2W1T A;  4U0T A;  2VA0 A;  4DJ3 A;  3C5A A;  1D7E A;  2RCX A;  2Y2P A;  1W5D A;  3MXQ A;  3IF6 B;  4IJG A;  3F1P A;  4DXC A;  2PRF A;  1IEM A;  3NOU C;  4Y17 A;  4KG5 A;  3UPP A;  1K54 A;  3T4K A;  5A91 A;  1T18 A;  2J3T C;  2XDM A;  3ZYT A;  2VV6 A;  5CRF A;  3IX8 A;  1XJ4 A;  3ZNT A;  2B95 A;  2ZC6 B;  1PW8 A;  4HP4 A;  2JKR M;  3BY9 A;  4BD1 A;  5L2F A;  4C6Y A;  3VP0 A;  4KEN B;  3CJM A;  1GA9 A;  1DJB A;  1ERQ A;  3MR0 A;  5AQA A;  3MQO A;  2XFT A;  1OJG A;  4X53 A;  4BBV A;  3CAX A;  4P6Z M;  4HI4 A;  1XFQ A;  4DKI A;  2Y2H A;  2W3G A;  2UWX A;  5I5L A;  4R3J A;  3LR4 A;  3LFV A;  1IEL A;  3M6B A;  1GSW A;  4ARZ B;  3Q81 A;  3DTK A;  1LL5 A;  2W0N A;  3UO9 A;  3ZG8 B;  3W8K A;  3N7W A;  2ZQC A;  3SS4 A;  3TSG A;  4DMZ A;  4UHU A;  3N8S A;  3NJA A;  3MXR A;  2IA2 A;  4I3J A;  4BWI A;  1P9R A;  4ETZ A;  3LID A;  4EV4 A;  4NKP A;  3ZG0 A;  3M2J A;  3UB8 A;  3NCK A;  1GSV A;  4EUV A;  5HAQ A;  1QME A;  3KO6 A;  1IKI A;  5HD5 A;  5DJU A;  3UB7 A;  4YWZ A;  4QD4 A;  2ZLY A;  1VQQ A;  1K57 A;  3Q7Z A;  1W8Q A;  1TDL A;  2QKP A;  3S1Y A;  4EEP A;  3V39 A;  1Y4O A;  4FUW A;  4HP9 A;  4JGP A;  4EWF A;  2V8F A;  4WMC A;  3V50 A;  5GLB A;  1ES4 A;  3C8C A;  3V67 A;  1PNE A;  3PBN A;  4LGW A;  4GD6 A;  4C75 A;  3GMW A;  3ZG7 B;  2Z2L B;  2HP6 A;  4PKY G;  2JC7 A;  3L9K A;  3F1N A;  1YQS A;  3GRJ A;  2Y2M A;  1FR1 A;  4GHI A;  4X56 A;  2ZMA A;  1YPR A;  3FKV A;  4CLC D;  3S7N A;  2ZC7 A;  3VFH A;  3K3D A;  3D3O A;  2MJ6 A;  2L1M A;  4HBT A;  3P7N A;  4YIN A;  2VGL M;  3S22 A;  5E43 A;  2ZM8 A;  3D4F A;  2QJ5 A;  3BYD A;  5IHV A;  2WAE A;  4LLO B;  1H8Y A;  2OLU A;  1DP6 A;  4OQI A;  5CGX A;  4BBT A;  3EGX C;  1J3W A;  3OC2 A;  1KDW A;  3GEC A;  4JGO A;  2IWB A;  5DF8 A;  5D3O A;  2J3T D;  4OPQ A;  1HD8 A;  4CLC B;  2HGV A;  2WZZ A;  3MS6 A;  3PXP A;  3QP2 A;  5F6A A;  2J7V A;  1K38 A;  4RYE A;  4BL2 A;  2J3W A;  3HLD A;  2Y2I A;  2B02 A;  2WAD A;  5EVL A;  1NRF A;  2Q0O A;  2H5S A;  4QB8 A;  2XF3 A;  3A0R A;  4BD0 A;  5DTK A;  3F1O B;  5HL1 A;  3DW0 A;  4OPR A;  4D2O A;  5FQM A;  4X1L A;  2WKH A;  1S4S A;  4K0W A;  4HBU A;  4MCW A;  4HOI A;  4O0P A;  5FQQ A;  4Z1W A;  3VP2 A;  4GNU A;  3G2Z A;  4LV1 A;  2ZL1 A;  3HLW A;  4M3K A;  3ZHH A;  4N1H A;  4BEN A;  3P98 A;  4MBH A;  4LV3 A;  2R9W A;  5HAR A;  1Q2Q A;  2VV8 A;  1KE4 A;  4H8R A;  3T4Q A;  2QZ6 A;  2H28 A;  5JYP A;  1G5U A;  4OPY A;  1ZG4 A;  3MMH A;  1HLU P;  3W2Z A;  5HWT A;  3WS5 A;  2O9A A;  4OVD A;  1YMS A;  2PU2 A;  2J80 A;  2VEA A;  5F1G A;  2P9V A;  3BWL A;  5E2F A;  3C30 A;  5E2G A;  4QU3 A;  4HNB A;  4CPK A;  4R70 A;  2PU4 A;  2PYP A;  4X1M A;  4QJG A;  3LIF A;  1FCN A;  4UA9 A;  4KG2 A;  3CI6 A;  5DKL A;  3VV4 A;  2JKT M;  1S1Y A;  1VET A;  3SH7 A;  5J7E A;  1S4R A;  5GLC A;  3B3X A;  3A3J A;  3NUL A;  5HPF A;  2QHK A;  2IWD A;  1LHY A;  5TR7 A;  1WYB A;  2V0U A;  3PBR A;  3LIE A;  2P74 A;  2Y4A A;  5TJJ A;  1GHI A;  2HP5 A;  1W63 M;  1YLZ A;  1ERM A;  2X71 A;  2Y2J A;  5KZH A;  3HJI A;  1FSY A;  2JKT I;  2K31 A;  5HAI A;  2W27 A;  2Y2N A;  2CC1 A;  3WS1 A;  5E2H A;  5M18 A;  2XD1 A;  5HWV A;  1NZU A;  1TDG A;  5HD3 A;  2RL3 A;  4R4R A;  5CGW A;  1K54 C;  4GB7 A;  5FAP A;  5G4Z A;  2Z6C A;  3G34 A;  2WAF A;  3IS2 A;  2KDK A;  3MJQ A;  4B93 A;  2A49 A;  4NEE D;  2P7J A;  1PRQ A;  2W3D A;  1K4F A;  4O8G A;  4M4X A;  4WF0 A;  4ZTK A;  3OOV A;  1O07 A;  4MN7 A;  3QP1 A;  3WS2 A;  3BQA A;  1S6R A;  5I94 A;  2W3H A;  4X55 A;  2ZQ7 A;  5HAP A;  1MWU A;  2XLN A;  3HRE A;  2GZA A;  5CHU A;  4JGQ A;  2A24 A;  3W4Q A;  4EES A;  1JWP A;  3NBL A;  1FR6 A;  4WEJ A;  1XA1 A;  2FH5 A;  4MN6 A;  5F83 A;  4GJ4 A;  3G6O A;  1K56 A;  3BLS A;  4KQR A;  5FA7 A;  2JN7 A;  1BSG A;  1YSP A;  3VOL A;  1K55 A;  3MZE A;  1NZO A;  1NWZ A;  4L9G A;  1Q2P A;  4PHT A;  2HDS A;  5GHX A;  2EFX A;  3HLB A;  1SCW A;  3LO7 A;  2PHY A;  3T4J A; 
#chains in the Genus database with same CATH homology
 1BUL A;  2RCX A;  3GR2 A;  2Y2P A;  4MBF A;  4U3T A;  1FOF A;  4BQM A;  1W5D A;  3IF6 B;  4DXC A;  4BLM A;  4DE1 A;  2HDQ A;  3GSG A;  3GVB A;  4RX2 A;  1IEM A;  3IXH A;  5GHZ A;  3FKW A;  1LL9 A;  4IVI A;  1FCO A;  4IBX A;  3Q82 A;  4KG5 A;  5FQI A;  1EWZ A;  4JPM A;  1KVL A;  3G32 A;  1K54 A;  3MBZ A;  3UPP A;  2HP9 A;  3VMA A;  3SS5 A;  1K57 C;  2ZD8 A;  3EQU A;  4FD8 A;  5A91 A;  4IBR A;  1XXM A;  1SDN A;  2XDM A;  3VP3 A;  3PAE A;  4KZ6 A;  4GKU A;  5DTS A;  1BT5 A;  2DNS A;  2H10 A;  5CRF A;  3RXW A;  4E3N A;  2FFY A;  1FQG A;  3VSK A;  3W4O A;  3ZNT A;  2ZC6 B;  4WZ5 C;  5U47 A;  1PW8 A;  4Y7P A;  4S2M A;  5DTT A;  4WYY A;  2WUQ A;  4MBK A;  3IQA A;  4S2N A;  4BD1 A;  5L2F A;  4PM6 A;  3VOY A;  1MPL A;  4C6Y A;  5CHJ A;  1L0F A;  3VP0 A;  1PW1 A;  2QPN A;  4KEN B;  5M1A A;  5E2E A;  1W8Y A;  3CJM A;  1CI8 A;  1GA9 A;  5FAQ A;  1DJB A;  1PI4 A;  2QMI A;  1W7F A;  3VFF A;  3HLF A;  1ERQ A;  3HUM A;  5HFO A;  4JXG A;  2JBF A;  3IH9 A;  5AQA A;  2Y2G A;  1LI9 A;  2XFT A;  1KGF A;  4GD8 A;  3ZVT A;  2ZQD A;  4X53 A;  3ZG5 A;  1JTD A;  4X69 A;  4K0X A;  4DE3 A;  3BLM A;  2H0Y A;  2B5R A;  5FSR A;  4DKI A;  2Y2H A;  2X01 A;  2UWX A;  4R3J A;  2EX6 A;  4KZB A;  5KMW A;  2JCH A;  1IEL A;  3M6B A;  4IVK A;  3ZDJ A;  3Q81 A;  1CK3 A;  3Q7V A;  5TGF A;  3G30 A;  1Y54 A;  3MZD A;  1K56 D;  3PBT A;  3WRZ A;  1LL5 A;  1HVB A;  3CZD A;  3UO9 A;  5FI7 A;  1K6R A;  3TOI A;  3ZG8 B;  3W8K A;  1KVM A;  3N7W A;  1SKF A;  3NDG A;  2ZQC A;  4B4X A;  3SS4 A;  1YLT A;  4FSF A;  1KGE A;  4E3L A;  4KZ4 A;  5CTN A;  3TSG A;  3JYI A;  1RGY A;  3EQV A;  1IYS A;  3CMZ A;  5CHM A;  1WYC A;  4JXV A;  3RJU A;  4UHU A;  3LY3 A;  1GA0 A;  3N8S A;  5EVI B;  5G18 A;  4E6X A;  1VM1 A;  4BJP A;  3MXR A;  1ERO A;  3QNC A;  1SHV A;  1RP5 A;  3ISG A;  5CER A;  4LV2 A;  2C5W B;  3OCN A;  1L0G A;  4EV4 A;  3BFF A;  4KQQ A;  4DRT A;  4NET A;  3M2J A;  3ZG9 B;  3ZG0 A;  4P85 A;  3NCK A;  4U0X A;  1MBL A;  4F94 A;  4WZ4 A;  3A3D A;  4S2I A;  5HAQ A;  3UDI A;  1QME A;  4OON A;  1RGZ A;  1FCM A;  4PMA A;  1IKI A;  2XEP A;  4KG6 A;  2H0T A;  1MWS A;  4QD4 A;  2ZLY A;  4ZJ1 A;  1VQQ A;  1K57 A;  3Q7Z A;  4X6T A;  2DRW A;  2ZQ8 A;  2HPB A;  1K4E A;  3BFC A;  3NIA A;  3HLG A;  4Y0U A;  1ESU A;  4CJN A;  2J9P A;  4KQO A;  1XPB A;  1W8Q A;  3PBQ A;  4WEK A;  4WEL A;  3UN7 A;  3UNW A;  5M19 A;  2ZC4 B;  3AGF A;  1TDL A;  5FI2 A;  5HX9 A;  4E6W A;  2Y2K A;  3S1Y A;  4KZ7 A;  4ZJ2 A;  3V39 A;  3G31 A;  4WZ5 A;  2WGW A;  3PTE A;  4E3K A;  3VOZ A;  2XH9 A;  2JE5 A;  3HLC A;  3W4P A;  3WWX A;  4EWF A;  4RVA A;  5DF9 A;  5DVA A;  3I7J A;  4WMC A;  3V50 A;  1L0D A;  4GZB A;  4HEF A;  4JBF A;  5GLB A;  2OV5 A;  5HW3 A;  1ES4 A;  5FAT A;  1NJ4 A;  1PWG A;  3PBN A;  5AQB A;  4LEN A;  4GD6 A;  5F1F A;  3A3E A;  3O86 A;  4WM9 A;  4C75 A;  5EE8 A;  1DJA A;  1KDS A;  3GMW A;  3ZG7 B;  2Z2L B;  1EI5 A;  4L0L A;  2HP6 A;  4OQH A;  3IWI A;  2JC7 A;  3IF5 A;  2V2F F;  4OLD A;  4OPZ A;  3V3R A;  3OPL A;  3VP4 A;  4DDY A;  1I2W A;  1JWZ A;  1YQS A;  4OH0 A;  4Y0O A;  3GRJ A;  1IKG A;  4EUZ A;  2Y2M A;  4PM9 A;  1FR1 A;  3Q07 A;  1IYQ A;  1JTG A;  5F82 A;  3S4X A;  4E3J A;  1NY0 A;  4X56 A;  4S2O A;  5CGS A;  4OKP A;  2ZMA A;  4B88 A;  5A92 A;  1XP4 A;  3FKV A;  5FQJ A;  4KZ3 A;  4S2J A;  4E3M A;  1E3U D;  4ZAM A;  1M40 A;  2ZC7 A;  3MKF A;  2OLV A;  5EPH A;  3VFH A;  3GTC A;  3LCE A;  4JF5 A;  1J9M A;  4P0M A;  1MKI A;  4HBT A;  2VGJ A;  4OQG A;  1PIO A;  3G4P A;  4GDN A;  2A3U A;  4GDB A;  4YIN A;  5BOH A;  3P09 A;  3S22 A;  1MWR A;  5E43 A;  2ZM8 A;  2J9O A;  3D4F A;  2ZM2 A;  1L0E A;  1FSW A;  2XQZ A;  2PBY A;  3AGE A;  3BYD A;  4PM7 A;  5KSC A;  1RCJ A;  2G2W A;  1N4O A;  5IHV A;  3PBS A;  4OP5 A;  2WAE A;  3ITB A;  4WBG A;  3SOI A;  3ZNY A;  3Q1F A;  1XX2 A;  3UPO A;  1PYY A;  3FZC A;  4N9L A;  1H8Y A;  2OLU A;  4OQI A;  1TVF A;  2Y2Q A;  4JXS A;  5CGX A;  4DF6 A;  1KGG A;  3IF6 C;  4DXB A;  2HDU A;  3OC2 A;  4JF4 A;  1KDW A;  5CEB A;  3BFG A;  1O7E A;  3WS4 A;  2IWB A;  4MLL A;  5FQK A;  1E3U A;  5DF8 A;  5D3O A;  4OPQ A;  3Q7V B;  3UE1 A;  1HD8 A;  5GLA A;  3MKE A;  1OME A;  4N1X A;  3UPN A;  4KZ9 A;  2WZZ A;  2Y2L A;  3PBO A;  4FH2 A;  1ONG A;  4JKT A;  2WKI A;  3VSL A;  1ZC2 A;  2J7V A;  3E2K A;  1K38 A;  3M2K A;  4XUZ A;  4RYE A;  4NK3 A;  1CI9 A;  3AGD A;  4BL2 A;  4QY5 A;  4JLF A;  3V5M A;  4C3Q A;  3HLD A;  2Y2I A;  4MEZ A;  1XKZ A;  4WMC D;  1BLS A;  3IH8 A;  4PPR A;  2WAD A;  5EVL A;  1NRF A;  4K91 A;  2Y59 A;  4ID4 A;  2H5S A;  4QB8 A;  1YMX A;  4XUX A;  2XF3 A;  4MNR A;  5GHY A;  3LY4 A;  4DE0 A;  2ZC5 B;  4LV0 A;  3A3F A;  5DTK A;  4BD0 A;  3N4I A;  5HL1 A;  3DW0 A;  4OPR A;  3IT9 A;  5FQM A;  4D2O A;  1E4D A;  2WKH A;  5CEC A;  1ZKJ A;  4JF6 A;  2WZX A;  1PI5 A;  4K0W A;  2EX8 A;  4HBU A;  3M6H A;  3UY6 A;  1HZO A;  5FQQ A;  3VP2 A;  4Q8I A;  2V20 A;  4GNU A;  3G2Z A;  3SH9 A;  1E25 A;  4LV1 A;  2ZM0 A;  3BM6 A;  4A5R A;  3HLW A;  4QY6 A;  2GDN A;  4M3K A;  3ZHH A;  3V3S A;  1BLP A;  4N1H A;  4YFM A;  4BEN A;  3P98 A;  4MBH A;  3N8R A;  3A3I A;  4LV3 A;  1YLP A;  4IED A;  3LEZ A;  5GLD A;  5TFQ A;  4B4Z A;  2R9W A;  5HAR A;  2XR0 A;  1Q2Q A;  4QHC A;  1SDE A;  3HUN A;  1KE4 A;  4LCM A;  5CXW A;  4H8R A;  3DWK A;  1H5X A;  5FI6 A;  2QZ6 A;  4R1G A;  2WGW B;  3HBR A;  1HTZ A;  4UA6 A;  3MZF A;  3N8L A;  4GOG A;  5JYP A;  3IWQ A;  1CEF A;  2ZQ9 A;  2ZQA A;  2G2U A;  4OPY A;  1ZG4 A;  2HDR A;  4Z9Q A;  2V1Z A;  4BL3 A;  3WRT A;  3WS5 A;  4OVD A;  5EVI C;  1YMS A;  4EQI A;  3C7U A;  3IXG A;  2PU2 A;  1K25 A;  1BTL A;  3BFE A;  3NDE A;  2P9V A;  3IXD A;  5E2F A;  5F1G A;  3ZGA B;  1U60 A;  2R9X A;  3GQZ A;  4QU3 A;  4R3B A;  5E2G A;  4CPK A;  3ZCZ A;  2PU4 A;  5EOE A;  4QJG A;  4O7D A;  1FCN A;  2Y2O A;  2WKE A;  1IYP A;  1C3B A;  2WGI A;  1L2S A;  3QHY A;  1KE3 A;  1PZP A;  3IF6 A;  1YM1 A;  3N6I A;  4KG2 A;  4RA7 A;  4S2P A;  4UA9 A;  1ALQ A;  1XGI A;  3C4O A;  3RXX A;  3UE0 A;  3SH7 A;  3IHA A;  4N92 A;  5JYO A;  5GLC A;  4OP8 A;  1LLB A;  4LCL A;  3B3X A;  3A3J A;  3FV7 A;  3G35 A;  4GN2 A;  3G2Y A;  4DDS A;  2IWD A;  3VP1 A;  1YLW A;  2Q9M A;  1LHY A;  2VGK A;  5TR7 A;  1WYB A;  3FWL A;  5DF7 A;  1H8Z A;  3BFD A;  3HL9 A;  5FDH A;  3PBR A;  5KSH A;  1K55 C;  2P74 A;  4E3O A;  2EX9 A;  3PAG A;  3BRM A;  1DJC A;  2Y4A A;  1PWC A;  1GHI A;  2HP5 A;  1GHP A;  2EX2 A;  3DWZ A;  1W79 A;  4KZA A;  2BLS A;  4DE2 A;  1LI0 A;  5FAS A;  1YLZ A;  1I5Q A;  1NYM A;  4FCF A;  3BEC A;  1XA7 A;  4HES A;  1ERM A;  2X71 A;  2Y2J A;  4OLG A;  2X02 A;  3IHB A;  4R0Q A;  5AQ7 A;  5FQ9 A;  5KZH A;  2ZJ9 A;  1FSY A;  1I2S A;  5HAI A;  2Y2N A;  2CC1 A;  3DTM A;  1BZA A;  2WYX A;  3WS1 A;  1G6A A;  4OOL A;  5E2H A;  1QMF A;  5M18 A;  5EEC A;  2XD1 A;  2ZC3 B;  3NC8 A;  5EVI D;  1ES3 A;  1NZU A;  2Z2M B;  3ITA A;  1TDG A;  3MXS A;  3NI9 A;  4ZDX A;  3IWO A;  4R4S A;  1M6K A;  4ZJ3 A;  2XGN A;  4KZ8 A;  4KZ5 A;  4PM5 A;  3FYZ A;  4N9K A;  2E8I A;  2RL3 A;  4OOM A;  4R4R A;  3C7V A;  5CGW A;  3UDF A;  1K54 C;  5EUA A;  1S0W A;  1BUE A;  2EXB A;  4UAA A;  4RX3 A;  5A90 A;  4GB7 A;  5FAP A;  4FH4 A;  3G34 A;  2WAF A;  1ES2 A;  2C6W B;  4ZBE A;  1ONH A;  3UE3 A;  1IYO A;  2A49 A;  3UDX A;  3E2L A;  3O3V A;  4E3I A;  1Z6F A;  1K4F A;  3HUO A;  3ZFZ A;  1MWT A;  4S2N C;  3CG5 A;  3IXB A;  4EBL A;  3HLE A;  3GV9 A;  5GL9 A;  4ZTK A;  4OQ0 A;  1O07 A;  1WE4 A;  4S2K A;  4P6B A;  3WS2 A;  2Q9N A;  3OCL A;  2EFU A;  3C4P A;  5AQ9 A;  4R23 A;  2J8Y A;  1S6R A;  5EVI A;  5I94 A;  1G68 A;  4PM8 A;  2WK0 A;  4UA7 A;  2ZQ7 A;  4X55 A;  1BLH A;  5EOO A;  4X68 A;  3ZVW A;  4Y0T A;  1JVJ A;  3TG9 A;  5J8X A;  4S2L A;  1K6S A;  3BEB A;  3SH8 A;  2XD5 A;  5CED A;  1MXO A;  2I72 A;  1NXY A;  2IWC A;  3QNB A;  5FAO A;  5HAP A;  1GCE A;  1MWU A;  1PWD A;  2XLN A;  4EBP A;  1YLY A;  3HRE A;  3OPP A;  3HVF A;  4P87 A;  3WS0 A;  4OOY A;  2DCF A;  3NY4 A;  2Y91 A;  5CHU A;  3W4Q A;  1DY6 A;  1PZO A;  1TEM A;  1YLJ A;  2Y55 A;  3O87 A;  3OZH A;  3SS3 A;  1N9B A;  1JWP A;  1GHM A;  1NYY A;  1ES5 A;  3NBL A;  1FR6 A;  1CEG A;  4WEJ A;  1XA1 A;  1YT4 A;  1ZG6 A;  2XK1 A;  3OPH A;  1JWV A;  5F83 A;  4EBN A;  4XXR A;  1KE0 A;  1K56 A;  2WGV A;  3BLS A;  4KQR A;  5FA7 A;  2FFF B;  3OPR A;  1AXB A;  1BLC A;  1BSG A;  1K55 A;  3MFD A;  3MZE A;  5CTM A;  1MY8 A;  2OSU A;  1NZO A;  1ESI A;  2EXA A;  3O88 A;  1Q2P A;  2HDS A;  4JXW A;  5GHX A;  5A93 A;  2BG1 A;  2P9V B;  4U0T A;  2EFX A;  3HLB A;  2XFS A;  1SCW A;  3LO7 A;  1XGJ A;  3C5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...