3IXBA

X-ray crystal structure of the extended-spectrum ampc e219k mutant beta-lactamase complexed with benzo(b)thiophene-2-boronic acid (bzb) at 1.63 angstrom resolution
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
358
structure length
352
Chain Sequence
b'APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAKAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structural bases for stability-function tradeoffs in antibiotic resistance.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 113
structure length 352
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3ixbA00
5HFOA 3PAEA 2PU4A 1ESIA 4BENA 4E3MA 1H5XA 4GB7A 4HBUA 2WK0A 1S0WA 4EUZA 2WZXA 3CMZA 1M40A 1I2SA 2OV5A 2H10A 1L0DA 1PI5A 3IT9A 4KZ3A 3UPNA 1KGGA 4KZ9A 2XF3A 3LO7A 3GMWA 4ID4A 5E2FA 1PW8A 5CRFA 3Q07A 4X55A 5KMWA 1YMXA 5HAPA 4WZ4A 2ZD8A 4UA7A 1VM1A 4WYYA 1WE4A 1KGEA 1YT4A 1JTDA 2E8IA 2WGWA 1FSYA 3OPLA 3PBQA 2R9XA 5M1AA 1E4DA 1KVLA 3LY4A 1NXYA 2EX9A 4OPRA 4OPZA 2XEPA 4E3OA 1W79A 2WGWB 4DKIA 1L0EA 1L2SA 2WZZA 4JXSA 2PBYA 2EXBA 3BLSA 1BTLA 1YLJA 4H8RA 1IKGA 1LL5A 3AGDA 4ZTKA 4KZ7A 4Y0OA 4N9LA 4OVDA 3MZDA 1ZKJA 3BM6A 5DF9A 4XXRA 3MXSA 1GHPA 3OZHA 4OQHA 2G2UA 4GZBA 5CTNA 4Y0TA 3VOZA 3Q7ZA 2OLUA 3BFGA 2IWCA 4Y7PA 2Y2PA 4QB8A 3HLDA 4RYEA 1GA9A 5HARA 3QHYA 3ZG8B 3PBTA 3AGFA 1PZOA 4S2PA 4E3KA 1FR6A 3I7JA 4A5RA 4DE3A 4S2NC 4OP5A 3M6HA 2ZQCA 3ZG0A 4X69A 5EOOA 3MKFA 2ZC3B 1KVMA 5J8XA 3GRJA 1BZAA 5HX9A 3W4QA 2Y2MA 3A3FA 2C5WB 3HL9A 5DF8A 3WWXA 1DJBA 2ZQDA 1O07A 5M19A 4WEJA 1PIOA 2HDUA 2ZC5B 4HESA 4BJPA 5CEDA 5EVIA 4DRTA 1ZG4A 2Y2KA 3NY4A 2ZC7A 3FV7A 5KSHA 5FAQA 2V20A 3NI9A 5GLBA 1CI8A 2WAFA 3BECA 2BLSA 2XFTA 3BLMA 1QMFA 2ZQ7A 2V1ZA 4LV1A 3ITAA 3WS5A 4OOMA 5FI2A 3OPHA 3BEBA 1EROA 3LY3A 3RJUA 5GL9A 2PU2A 5AQ7A 3IQAA 4X53A 3ZG9B 2DNSA 4WEKA 2ZC4B 5TR7A 3VP1A 3UPOA 4UHUA 3NC8A 1OMEA 3IF5A 5EECA 3D4FA 5F82A 1ALQA 2EX2A 2Y4AA 3P98A 4R0QA 3RXXA 1GHMA 3V3SA 4E6XA 1RP5A 1J9MA 2XQZA 4CPKA 1K56D 4LV0A 1XGIA 1N9BA 4Q8IA 1XKZA 2Z2LB 3A3IA 4UA6A 3O87A 3UPPA 1SDNA 1M6KA 3CG5A 1FR1A 4BLMA 4UA9A 1MWTA 3IXHA 4X6TA 2HDRA 5CXWA 1YLWA 3PBRA 1IYQA 2WGVA 3DWZA 4OLDA 5GHYA 3W4OA 2J8YA 4YINA 3ZVWA 4P85A 3WS2A 3S1YA 4KG2A 4FCFA 4MLLA 3FWLA 3GSGA 5AQAA 2ZJ9A 1K54A 1SHVA 4KQOA 5EPHA 4FH2A 3HVFA 5EVIC 2WKIA 1GHIA 1LLBA 3O86A 2QMIA 2Y2LA 2XDMA 1IYOA 5FI7A 4DXCA 1JVJA 1FQGA 5CHMA 1SCWA 1K56A 2H5SA 4BD0A 4UAAA 4NK3A 1S6RA 5DTKA 2Q9NA 1YM1A 2ZC6B 2BG1A 3Q1FA 4X56A 4KG5A 4MBKA 2EFXA 3N8LA 1RCJA 3ZG7B 3ZFZA 5KZHA 1Z6FA 1I5QA 1TDGA 4N9KA 1FSWA 3C4OA 3HUNA 1XA7A 4GOGA 4S2JA 3SS5A 4KQRA 1IELA 3HUOA 1XX2A 5EE8A 1XXMA 1K25A 4NETA 5I94A 1W8QA 2IWBA 1N4OA 4PM9A 2XGNA 3UNWA 3IF6A 2G2WA 5FA7A 1ZC2A 3PAGA 2FFFB 3HREA 4E3NA 1YLYA 1DJAA 2ZQ9A 3MKEA 3G32A 4JXWA 3VP4A 1E3UA 5AQ9A 4ZJ3A 3SH7A 3IF6B 2Y55A 5D3OA 1GA0A 2QZ6A 3IXGA 3PTEA 3SS4A 3TSGA 3M6BA 2JE5A 5U47A 4BL3A 3VSLA 2OLVA 2P74A 1K4FA 1PWGA 3IH8A 1K54C 1K6RA 5EVID 5KSCA 3HLCA 1DJCA 1IYPA 1MKIA 1NYMA 2Y2QA 5DTTA 3ZNYA 4RX2A 4R4RA 2HDSA 3GV9A 3NCKA 4D2OA 3IXBA 5EOEA 3CJMA 5FAOA 3NBLA 3G34A 4OLGA 4GNUA 3UN7A 5JYOA 5FI6A 3UE3A 3WS0A 4JXVA 1LI9A 4B4ZA 1O7EA 3BFFA 3P09A 3ZNTA 1ESUA 1ES4A 5FQMA 3A3EA 1MWUA 3ZCZA 4WELA 2R9WA 5A92A 3MZFA 3N4IA 4FSFA 4DXBA 4GKUA 2XK1A 4U3TA 5GLDA 4GDBA 4RX3A 1MY8A 1CEGA 1YMSA 3OC2A 4XUZA 1W8YA 3PBOA 5IHVA 2ZM2A 2OSUA 5GHZA 1I2WA 3IF6C 3BFDA 1YLTA 3JYIA 3C7UA 1W5DA 5AQBA 3S22A 1FOFA 4JBFA 1PI4A 1NYYA 3LEZA 3MZEA 2I72A 3G4PA 2QPNA 4OPYA 5F83A 3VFHA 5DTSA 3OPRA 1ES5A 3M2JA 5EVIB 2VGJA 5F1GA 4OH0A 1KDWA 4KZ5A 5TGFA 3DWKA 1C3BA 3GR2A 3OCLA 3SOIA 4ZAMA 4KG6A 5CGSA 1ERMA 2EXAA 5FAPA 5FQIA 3EQUA 3IH9A 1BSGA 3N7WA 1K38A 3RXWA 1K55A 3BYDA 2UWXA 4P6BA 5DF7A 3SH9A 4E3LA 3IWIA 4DDYA 1H8ZA 4JPMA 2ZMAA 2EX8A 1PYYA 1G68A 3ZDJA 2Q9MA 4EBLA 1U60A 4EQIA 3WRTA 1YQSA 3GQZA 3MXRA 2WAEA 4K0WA 4KZ8A 3PBNA 1YLZA 1JWVA 4HBTA 1MPLA 1W7FA 3UDXA 4C3QA 3Q81A 2XD5A 5M18A 3SH8A 3MFDA 4KENB 3N8RA 2HP5A 3TOIA 3V5MA 3BFEA 3E2LA 3N8SA 5HAQA 3FYZA 1H8YA 4R23A 4C6YA 4X68A 4Z9QA 4IEDA 2XD1A 4PM6A 3TG9A 1FCMA 1BLCA 4S2LA 1ONHA 1Q2PA 4PM5A 4OOLA 4WZ5C 4B4XA 1MBLA 3B3XA 4N92A 3IXDA 3UDIA 2X71A 4OQIA 1L0GA 1WYBA 3E2KA 4JF4A 2RL3A 4GD8A 1E3UD 3GTCA 3CZDA 1Y54A 1XGJA 1YLPA 2V2FF 3N6IA 4OONA 1CEFA 3UO9A 3C5AA 4QHCA 2WYXA 5CERA 3S4XA 1CK3A 4MBHA 5DVAA 4F94A 1TVFA 3SS3A 2P9VA 2XR0A 3NDGA 1K55C 1ERQA 2A49A 1E25A 3WS1A 3GVBA 5F1FA 3G30A 1GCEA 4LCLA 3IHBA 4QU3A 2JC7A 4FD8A 1BT5A 4LV2A 3NDEA 3MBZA 5G18A 4GDNA 4K91A 3V50A 3M2KA 3VP2A 3VFFA 4ZDXA 3FZCA 4MEZA 4P87A 1SDEA 3HLGA 4QD4A 1JTGA 3ZGAB 1K57A 4JLFA 4MNRA 1KDSA 4KZ4A 4S2KA 4DE1A 1IKIA 2Y2JA 3IHAA 3IWOA 1MXOA 2XH9A 3NIAA 4BD1A 2IWDA 4KQQA 2EX6A 3V39A 2Y2OA 1HZOA 1TDLA 4JKTA 4ZJ1A 1HTZA 5TFQA 4BL2A 2HDQA 3VMAA 2RCXA 2WKEA 1EI5A 4DDSA 2C6WB 2VGKA 3OPPA 1CI9A 1BLSA 3HLBA 5EUAA 3HLFA 3AGEA 5EVLA 2GDNA 1FCOA 3LCEA 4YFMA 1ZG6A 2HP6A 1SKFA 4ZBEA 4LV3A 4PMAA 5CECA 4R4SA 1KE3A 5E2EA 2ZQ8A 4E6WA 3BFCA 4HEFA 4OQ0A 4LENA 3ZVTA 3C7VA 3O88A 5HL1A 5E43A 2FFYA 5CHUA 1XP4A 2XLNA 1EWZA 3FKWA 5GLAA 1DY6A 5E2HA 4DF6A 2Y2IA 4RVAA 2ZM0A 3HUMA 4K0XA 4WBGA 2EFUA 1NZOA 2DRWA 4N1XA 3FKVA 5GHXA 1FCNA 1IEMA 4ZJ2A 2A3UA 5BOHA 5A90A 2H0YA 4OP8A 4O7DA 3HLEA 4N1HA 1BUEA 4PM8A 3IWQA 2JBFA 4R3BA 1BLPA 1BULA 2X01A 4U0TA 4EBNA 1LI0A 2DCFA 4WZ5A 5HAIA 3UE1A 5A93A 3A3JA 3C4PA 3UY6A 4R1GA 1K57C 5HW3A 5FATA 5FSRA 3G2ZA 5FASA 1PZPA 3VOYA 1G6AA 3HLWA 3PBSA 4GD6A 2WADA 4LCMA 3WRZA 2WUQA 1KE0A 3WS4A 4U0XA 3UDFA 4S2MA 4WM9A 4MBFA 3VP3A 4JXGA 2HP9A 1JWPA 5CHJA 4B88A 1XPBA 4CJNA 1PWDA 3DTMA 2Y59A 1JWZA 3QNBA 2J9OA 3DW0A 4S2OA 4S2IA 2H0TA 4QJGA 2Y2GA 2WGIA 4M3KA 5E2GA 3HBRA 4FH4A 3UE0A 2Y2NA 3ZG5A 3Q7VA 4E3JA 2XFSA 3ZHHA 3V3RA 4EWFA 4S2NA 4QY6A 5FQKA 4OKPA 3BRMA 5FQ9A 1NRFA 4KZAA 3W4PA 2Y2HA 3Q7VB 1RGZA 4GN2A 4P0MA 5FDHA 1LHYA 2ZLYA 5CGXA 4IBXA 2J7VA 3VSKA 1KE4A 3W8KA 4OQGA 3OCNA 4KZBA 4DE2A 1MWSA 3G35A 3ITBA 4OOYA 2B5RA 1BLHA 1Q2QA 1IYSA 1RGYA 4WMCD 2J9PA 1HVBA 4IBRA 1NJ4A 2X02A 1ES2A 5CEBA 5CTMA 4EV4A 3VP0A 1QMEA 1PWCA 1PW1A 4JF5A 5GLCA 4XUXA 2HPBA 4JF6A 5FQJA 4R3JA 1TEMA 2Z2MB 1HD8A 4IVKA 4L0LA 4QY5A 1VQQA 4C75A 4IVIA 1WYCA 4PPRA 1XA1A 5FQQA 1NZUA 1AXBA 3ISGA 3Q82A 4RA7A 5JYPA 5A91A 4E3IA 3EQVA 1LL9A 1MWRA 2ZM8A 4BQMA 2CC1A 4DE0A 4EBPA 1KGFA 1L0FA 1K6SA 3G2YA 5L2FA 5CGWA 4Y0UA 4OPQA 3O3VA 2JCHA 4KZ6A 2ZQAA 1NY0A 3G31A 1K4EA 2P9VB 3QNCA 4WMCA 1ES3A 2Y91A 2WKHA 4PM7A 3A3DA 1ONGA
chains in the Genus database with same CATH superfamily
5HFOA 3PAEA 1ESIA 3S7QA 4HBUA 4EUZA 3LI8A 3IT9A 4KZ3A 5A8BA 1KGGA 5CRFA 3Q07A 4X55A 5IT5A 5KMWA 4MCWA 3H7WB 2ZD8A 1VM1A 1KGEA 3DTEA 3T1QB 2W3HA 1NXYA 2EX9A 4OPRA 3LICA 1D7EA 1S4SA 3K2NA 1L0EA 1L2SA 2WZZA 5EM0A 4EETB 1LL5A 4ZTKA 4KZ7A 3BM6A 5DF9A 3E4QA 4XXRA 3OZHA 3CI6A 4LPZA 4GZBA 4Y7PA 3BFGA 2IWCA 2QKPA 1G5UA 5HARA 2GX5A 1X0OA 3T4OA 3ZG8B 4JGRA 1PNEA 4Y13A 2JKTI 2V9AA 1YSPA 4NKPA 5DFXA 5EOOA 3LUQA 1ACFA 1BZAA 3V67A 5HX9A 2C5WB 5DF8A 1DJBA 5M19A 4WEJA 1PIOA 4Y2FA 5EVIA 2UV0E 3NY4A 3FV7A 2PD8A 5GLBA 1CI8A 1SZVA 2XFTA 1QMFA 3LIDA 4LV1A 5FI2A 3UMEA 3BEBA 5DJUA 5IS1A 3RJUA 4GCZA 4LRXC 2VK3A 4X53A 2DNSA 4WEKA 1UWNX 1OMEA 2Y8HA 3QP5A 1S66L 2Y4AA 4O8GA 2XQZA 4CPKA 4DN0A 2Z2LB 3A3IA 4UA6A 4GS9B 3SW1A 4R70A 4BLMA 1FR1A 4UA9A 1W63M 3MF0A 4MMNA 4OLDA 4H6JA 1OTEA 3FWLA 1K54A 1Y4OA 2KDKA 5EVIC 1LLBA 3O86A 3LR3A 2Y2LA 1T18A 5AVEA 2ZL1B 5CHMA 2H5SA 3T4QA 4NK3A 3QP6A 2Q9NA 1YM1A 3Q1FA 4NXGA 4X56A 4O0PA 3N8LA 1I5QA 2VV6A 1STZA 3HUNA 3SS5A 1FIKA 1W8QA 1N4OA 2ACGA 5TBMA 3ZYTA 5FA7A 5DKLA 2INWA 2FFFB 1YLYA 1E3UA 3SH7A 2YKFA 3IF6B 3BQ8A 3KYZA 3SS4A 3PTEA 2GZAA 3MMHA 4UEYA 3TSGA 2W3FA 5HDSA 2OLVA 1PWGA 4KUKA 1K54C 1S1YA 3T4LA 5DTTA 4R4RA 2WKPA 3MJQA 3IXBA 2PD7A 3FG8A 3G34A 2QWSA 5HWVA 2EA9A 4I3JA 3UN7A 4IHQA 1LI9A 1AWIA 5A92A 1MWUA 4FSFA 5G4ZA 2OWHA 5GLDA 2V0UA 1J3WA 1CEGA 3OC2A 1W8YA 2EWWA 3JYIA 3C7UA 4BBVA 3S22A 2W27A 3LEZA 2O9CA 2I72A 3VFHA 4HNBA 1XJ3A 5F1GA 2VGJA 3D72A 3DWKA 5CGSA 2PT7A 5FAPA 4HJ4A 2UWXA 4P6BA 3SH9A 2VA0A 3IWIA 3IX4A 1LSXA 4CQHA 1YLZA 4C3QA 4X1MA 3V5MA 2A24A 3EWKA 3TG9A 1BLCA 4PM5A 4OOLA 4WZ5C 4B4XA 3BJNA 1IFQA 1DRMA 5DKKA 3GTCA 1Y54A 2V2FF 1EW0A 1DP8A 2WYXA 3EGXC 5DVAA 1Z09A 2P9VA 4R6LA 5F69A 1ERQA 3G30A 2WKQA 2JC7A 3NDEA 2XRNA 2GJ3A 4GDNA 3FZCA 4I39A 2VZWA 3EGDC 2M7VA 3ZGAB 4B93A 1JTGA 1K57A 2JKFA 2D01A 1MXOA 2XH9A 4JKTA 1TDLA 1HTZA 3OBFA 1EI5A 2VGKA 1BLSA 4GHIB 5EUAA 3B42A 2GDNA 2K7SA 5LBRA 3E4PA 4LV3A 4PMAA 5HD3A 5E2EA 3O88A 4WLAA 4O01A 1XP4A 1EWZA 2Y2IA 4EW7A 4Y15A 2LB5A 4N1XA 4ZJ2A 2A3UA 5A90A 3HLEA 1F98A 1N9LA 1BLPA 1BULA 2X01A 3C8CA 3UE1A 4BWIA 4HY8A 4BBTA 4PHTA 2HJEA 3HJKA 1K57C 5FASA 3SZTA 2D02A 2WADA 3UDFA 4S2MA 3VP3A 1JWPA 1XPBA 3RFBA 4CJNA 2Y59A 3MQQA 3CUEA 1GSWA 2QJ7A 2H0TA 4FH4A 3UMDA 4QWOA 2HZ5A 3BWLA 1TD5A 4S2NA 5FQKA 1VETB 4NXEA 2PYPA 4GN2A 2JKTM 5FDHA 1TS0A 1LHYA 5HL1A 4IBXA 4OQGA 4WN5A 3G35A 1BLHA 1IYSA 2J9PA 2HV1A 1OTBA 1T1BA 1QMEA 4JF5A 2VKSA 1TEMA 2J3TD 4P6ZS 1LT0A 1WYCA 4RA7A 2V0WA 4DE0A 5HD5A 1L0FA 3CUEC 3O3VA 2JCHA 2O99A 1NY0A 1K4EA 1MZUA 4S2NC 3A3DA 3PYPA 2ZBBA 4E3MA 1H5XA 1PFLA 2OV5A 3UPNA 2H10A 1L0DA 4X25A 5E2FA 1PW8A 2K2NA 4WYYA 1WE4A 5KIZA 1JTDA 2WGWA 3OPLA 3PBQA 2IA2A 5M1AA 2XEPA 4R3AA 1W79A 5FL3A 5HDCA 4JXSA 1YPRA 4EQ1A 2W3DA 3BLSA 4Q0IA 3MQOA 1K0KA 1IKGA 5J4EA 3AGDA 3NOUC 4N9LA 4OVDA 1ZKJA 5L07A 3MXSA 4GW9A 4Q0HA 4OQHA 4Y0TA 3VOZA 2Y2PA 3PBTA 3AGFA 4E3KA 1F5MA 4DE3A 3ZQ5A 4EU0A 3M6HA 2ZQCA 3MKFA 2ZC3B 3GRJA 2Y2MA 2ZQDA 3BQAA 4DRTA 1ZG4A 2Y2KA 2ZC7A 3NI9A 3A0SA 2BLSA 3BLMA 3OPHA 5GL9A 1VEUA 3ZG9B 2ZC4B 3VP1A 5AVFA 2AVXA 4ZRRA 3UPOA 3A0RA 1ALQA 1TS6A 1GHMA 4E6XA 3C38A 3E4OA 1RP5A 2ZOHA 1K56D 1UGUA 5I5LA 3UPPA 1SDNA 3CG5A 3IXHA 2L4RA 3FPVA 1IYQA 3W4OA 3QP2A 3ZVWA 4P85A 4HP9A 4FCFA 3TRCA 3GSGA 2ZJ9A 1SHVA 4KQOA 2PHYA 1TS8A 2QMIA 4H6JB 1IYOA 1H3QA 3EOIA 1XJ6A 1FQGA 4ME4A 4BD0A 1NWZA 2PR5A 4I38A 1S6RA 1RCJA 3ZFZA 5KZHA 4N9KA 2VGLS 1FSWA 1IELA 1XXMA 1K25A 2L0WA 5FDSA 1MC0A 2IWBA 3FC7A 4DJ3A 3T4JA 4D60A 2G2WA 4R38A 1ZC2A 3T4SA 4WUJA 1DJAA 3G32A 4CLCA 5AQ9A 4DMZA 3TW8A 5D3OA 3RH8B 3M6BA 2JE5A 3NHQA 4F3LA 4NXFA 1P9WA 1DP9A 1IYPA 2JHEA 3KX0X 2HDSA 1DP6A 3CJMA 2G7UA 5FAOA 3NBLA 3T50A 2Y79A 1UWPX 4OLGA 3H82A 5FI6A 3K3CA 4B4ZA 1O7EA 3OLOA 1ZHHB 1ESUA 1ES4A 4WF0A 2PBDP 2R9WA 4MDZA 4DXBA 4GKUA 4GDBA 4RX3A 1YMSA 3PBOA 5IHVA 4EESA 2ZM2A 1I2WA 1W5DA 5AQBA 1NYYA 3MZEA 2QPNA 4CLCC 4OPYA 4K08A 5DTSA 1ES5A 1KDWA 3OCLA 4EUVA 2QYBA 1OPXA 3EQUA 3IH9A 2XA7M 2E8JA 2FH5A 3BYDA 5DF7A 3U2AA 3NULA 2ZMAA 2EX8A 4I3IA 3ZDJA 1YQSA 3GQZA 4KZ8A 4XT2A 3DAVA 1JWVA 4HBTA 1T1CA 2OWJA 5HWTA 3TOIA 3E2LA 3S7PA 4Z9QA 4PM6A 4YOFA 1FCMA 1OTAA 4S2LA 1Q2PA 3S7OA 1MBLA 2V8CA 4N92A 3E2KA 4GD8A 1NLYA 1XJ2A 4OONA 1XGJA 1YLPA 3C5AA 3L7HA 5CERA 1CK3A 4LRYC 5J3WA 1TVFA 2ZOIA 2QJ5A 1E25A 4QU3A 2L1MA 3MS6A 3MBZA 3VP2A 4MEZA 1XJ4A 3VE4A 4JLFA 4RQ9A 1IKIA 5C5KA 3IHAA 3CLOA 3V39A 4BL2A 4I3AA 4DDSA 4ETXA 1CI9A 4YFMA 1ZG6A 2P04A 1SKFA 4E6WA 4OQ0A 3ZVTA 4HOIA 3LR0A 3W2ZA 2XLNA 4DF6A 5GLAA 5E2HA 4RVAA 4G3KA 4WBGA 5GHXA 5HDDA 4OP8A 4PM8A 1LSVA 4R3BA 4U0TA 4WZ5A 5HAIA 5A93A 3A3JA 5HW3A 1BYWA 3WRZA 4LCMA 3PBSA 2J3TC 1N9OA 1MKMA 2KLIA 4WM9A 3E98A 3R7WA 2HP9A 5CHJA 4B88A 3QNBA 4S2OA 4QJGA 3HJIA 3LYXA 4UQIS 3UE0A 3Q7VA 2XFSA 3CHWP 3ZHHA 4OKPA 3F1OA 1ODVA 3BRMA 5FQ9A 1Y28A 1NRFA 4KZAA 2Y2HA 1RGZA 3UB8A 4P0MA 3VSKA 2ZLYA 4ARZB 3OCNA 4KZBA 1P9RA 1MWSA 4OOYA 4GS9A 4WMCD 1NJ4A 3KYQA 4WL9A 3CPTB 2HPBA 4JF6A 5FQJA 2Z2MB 1HD8A 4IVKA 4QY5A 3O5YA 4C75A 3VE3A 5JYPA 1NZUA 3ISGA 3Q82A 1TS7A 4E3IA 2DMWA 3T12B 4BQMA 4EBPA 1KGFA 5L2FA 5CX7A 1L3LA 2JN7A 4OPQA 2VX8A 3KSGA 2ZQAA 3G31A 1HLUP 4FOFA 1ZTUA 2Y91A 4NXBA 2OOLA 4BENA 4GB7A 1S0WA 2WZXA 3UB5P 1I2SA 1XFNA 1PI5A 3BY9A 4KZ9A 2XF3A 3GMWA 4ID4A 1NRJA 2QHKA 1YMXA 5HAPA 4B9OA 3IS2A 1YT4A 4EXOA 5L10A 1FSYA 2R9XA 1E4DA 2PR6A 3CITA 3LY4A 4E3OA 4IUHA 2VJWA 2WGWB 4NEED 3F1NA 4HJ3A 2PBYA 2EXBA 1BTLA 1YLJA 4H8RA 4JGQA 2HGVA 4LRZE 4Y0OA 3MZDA 4QB8A 1GA9A 3QHYA 1FR6A 1S4RA 2P08A 3I7JA 1W63Q 4OP5A 2B18A 3MXQA 5J8XA 3A3FA 3WWXA 1FILA 2HDUA 2ZC5B 4HESA 5CEDA 2V20A 5F5YA 1S67L 1EROA 3LY3A 2J3WA 1NLZA 2PU2A 3IQAA 3KSIA 3VV4A 3NC8A 3IF5A 3A0VA 2OAP1 5F82A 1XFQA 2EX2A 4R0QA 3RXXA 1XKZA 3LR5A 3O87A 4Y17A 1MWTA 4X6TA 5CXWA 1YLWA 3MR0A 3DWZA 5GHYA 3WS2A 3S1YA 4MLLA 1CF0A 3VOLA 5HWWA 3HVFA 1GHIA 2WKIA 4MN6A 4DXCA 4Q0JA 4Z1WA 2CMNA 4UAAA 5DTKA 2BG1A 4KG5A 3LIAA 1Z6FA 1TDGA 1SKOA 3C4OA 4GOGA 4S2JA 4KQRA 3HUOA 1XX2A 4NETA 5I94A 4PM9A 3UNWA 2OAQ1 3PAGA 1V9YA 3LI9A 4QPRA 2BTFP 3MKEA 4ZJ3A 5FEGA 2PAVP 2Y55A 1GA0A 2QZ6A 3IXGA 3TJZC 5U47A 3VSLA 2P74A 4CLCB 1K6RA 3NOTC 5KSCA 1DJCA 1MKIA 3ZNYA 4RX2A 4F3LB 3GV9A 2K31A 2I9VA 1LL8A 5J7EA 3UE3A 3WS0A 3ZNTA 5FQMA 3L9KA 3H82B 4U3TA 2O9BA 3IX3A 5GHZA 3BFDA 1YLTA 3PR6A 5F83A 4Y3IA 3M2JA 5EVIB 4OH0A 1C3BA 3SOIA 2W1TA 4ZAMA 2EXAA 5FQIA 3ICYA 3K3DA 1BSGA 2A2LA 3N7WA 1K38A 3T1RA 1K55A 4DDYA 4JPMA 5HPFA 2Q9MA 1U60A 3WRTA 4K0WA 3PBNA 3NJAA 1W7FA 3LIBA 2PRFA 3MFDA 4KENB 3FPWA 3BFEA 5HAQA 4XT2B 3FYZA 1H8YA 4R23A 3T4KA 4X68A 2XD1A 1ONHA 3B3XA 2NUTC 2X71A 4OQIA 1L0GA 1WYBA 2RL3A 4MN5A 1CEFA 3UO9A 4QHCA 4L9EA 5L09A 1A0KA 4IUKA 3S4XA 4F94A 3SS3A 2XR0A 4P6ZM 1K55C 2A49A 3GVBA 1GCEA 4JGOA 4LCLA 3IHBA 3DTIA 4HI4A 4FD8A 1BT5A 3BY8A 5G18A 4K91A 2JKRI 2W3EA 4ZDXA 4PAUA 1OT9A 4MNRA 1KDSA 3UE6A 4DE1A 3U4LP 5TBMB 3NIAA 4BD1A 2IWDA 1D06A 4KQQA 2EX6A 4ZJ1A 5TFQA 4HQAA 3T1XA 3VMAA 2RCXA 2WKEA 4MN7A 2C6WB 3OPPA 3AGEA 5EVLA 3UB6A 1FCOA 3LCEA 2HJ9C 2W3GA 4ZBEA 3QP8A 1OJGA 3IBRA 4R4SA 2ZQ8A 4LENA 3C7VA 2KOIA 2FFYA 5CHUA 3FKWA 3R4KA 3HUMA 1N9NA 3CAXA 2EFUA 1NZOA 2DRWA 1FCNA 4O7DA 2EWVA 4N1HA 1BUEA 3TE8A 2JBFA 1GSVA 2DCFA 2XSSA 3C30A 3UY6A 4R1GA 1F2KA 2V8FA 4G3WA 5FSRA 1PZPA 3VOYA 1G6AA 3HLWA 4GD6A 1JNUA 1PRQA 1KE0A 3WS4A 4MBFA 4JXGA 4Y5FA 3EEHA 1KOUA 1JWZA 3R7WB 4S2IA 3LIEA 2WGIA 4M3KA 5E2GA 3JVVA 4L9FA 4E3JA 3V3RA 3IX8A 2PYRA 1VHMA 4HP4A 3F1PA 3Q7VB 5CGXA 3ULFA 3W8KA 3F1OB 4X1LA 3ITBA 4HJ6A 3T4TA 2B5RA 1RGYA 1HVBA 2X02A 1ES2A 1V9ZA 2O0YA 5CTMA 5CEBA 1S1ZA 2A24B 4EV4A 1PWCA 5HSQA 4HH3A 4XUXA 2YKHA 5GLCA 1CQAA 1VQQA 4IVIA 4PPRA 1XA1A 5FQQA 1AXBA 5A91A 1LL9A 1MWRA 3LR4A 2CC1A 2M1CA 2W0NA 3NECA 4Y0UA 4KUOA 4KZ6A 2P9VB 1ES3A 2PU4A 4AFIA 2WK0A 3CMZA 3H7WA 4FUWA 3P01A 5HL6A 2M7UA 1M40A 3LO7A 2R78A 1OTDA 5F6AA 3RTYA 4WZ4A 4UA7A 2VGLM 3E0YA 2E8IA 4YWZA 1KVLA 1YAXA 4OPZA 3IS2B 5AJGA 5F68A 4DKIA 3B47A 3F1NB 1GSXA 1GHPA 2G2UA 5CTNA 3Q7ZA 2OLUA 3HLDA 4RYEA 5L8MA 4EEPA 4HIAA 4S2PA 1PZOA 3G6OA 5FEFA 4A5RA 4EEUA 4L9GA 2O9AA 3S7NA 3ZG0A 4X69A 1KVMA 2W1RA 3MFXA 3W4QA 4HH2A 3HL9A 4CLCE 1O07A 4BJPA 3MSHA 5KSHA 5FAQA 2WAFA 3BECA 2ZQ7A 2V1ZA 3D3OA 3ITAA 4NG2A 2V1BA 3WS5A 4OOMA 1YKDA 5AQ7A 5TR7A 4UHUA 5EECA 3KSHA 3D4FA 3P98A 3V3SA 4BMWA 1J9MA 5EVEA 3IBJA 3D9YA 1XGIA 4LV0A 1N9BA 4Q8IA 3PHYA 1T1AA 1M6KA 2KX6A 3DBAA 2HDRA 3PBRA 2WGVA 4HHDA 2J8YA 2Z6CA 2BASA 4YINA 2VEAA 4KG2A 2ZL1A 5AQAA 5EPHA 4FH2A 4M4XA 3UB7A 1F9IA 2XDMA 5FI7A 1JVJA 4YNRA 4CLCD 1SCWA 1K56A 1VB6A 4II7A 2ZC6B 1G6OA 1P97A 5HZHA 3ZG7B 4MBKA 2EFXA 3B33A 3KO6A 1XA7A 5EE8A 2J80A 2XGNA 1SKOB 3IF6A 1YSQA 2ZMVA 4G3VA 3HREA 4E3NA 2ZQ9A 4JXWA 2NUPC 3VP4A 2V1AA 3JVUA 4BL3A 1K4FA 3IH8A 5EVID 3HLCA 1NYMA 2Y2QA 3C2WA 4D2OA 3NCKA 2JKRM 5EOEA 5EFWA 1TF1A 4GLQA 4GNUA 5JYOA 3KSFA 4JXVA 2ZMFA 3BFFA 3P09A 3A3EA 3ZCZA 4WELA 3MZFA 3P7NA 3N4IA 2XK1A 1OJ5A 3BW6A 1MY8A 4XUZA 2OSUA 3IF6C 3GDIA 1FOFA 4JBFA 1PI4A 2VV8A 4BBUA 3G4PA 4PKYA 3OPRA 1T19A 3NOPC 4KZ5A 5TGFA 3GR2A 4KG6A 4E04A 1ERMA 3LFVA 3H9WA 3RXWA 2B02A 4E3LA 1VEUB 2W1TB 4ETZA 1H8ZA 2VLGA 1PYYA 1G68A 4EQIA 4EBLA 3MXRA 3PXPA 1OTIA 3GECA 2WAEA 4ARZA 1MPLA 3UDXA 3Q81A 2XD5A 5M18A 3SH8A 4UQIM 3N8RA 2HP5A 2FZ0A 3N8SA 4C6YA 4IJGA 3CPTA 4GJ4A 4IEDA 3LEQA 3UDIA 3IXDA 2LB9A 4JF4A 1E3UD 3CZDA 3N6IA 4LGWA 5IU1A 1H0MA 4MBHA 4JGPA 2HF6A 3NDGA 3WS1A 5F1FA 1LSWA 4LV2A 3V50A 3M2KA 5K5BA 3VFFA 4P87A 1SDEA 3HLGA 4QD4A 4KZ4A 4S2KA 2Y2JA 2XROA 3IWOA 2PDRA 4I5SA 4GHIA 2Y2OA 1HZOA 2P7JA 2HDQA 1D1JA 5G4YA 2Q0OA 4FTXA 2MJ6A 5HPIA 3HLBA 3HLFA 3QP4A 2HP6A 4LLOB 5CECA 1KE3A 3BFCA 3HCYA 4HEFA 5E43A 4ESPA 5DFYA 5TJJA 4KQDA 1DY6A 2ZM0A 4K0XA 3FKVA 5BOHA 1IEMA 1H8MA 2H0YA 2Z6DA 1IOUA 3IWQA 3KYEA 4EBNA 3DTKA 1G28A 1LI0A 4EERA 3MQ0A 3C4PA 3QP1A 5FATA 5MC7A 3G2ZA 3LIFA 2XA7S 2WUQA 4U0XA 2WKRA 2H28A 2GNXA 1PWDA 3DTMA 2J9OA 3DW0A 2Y2GA 3OOVA 3HBRA 1VETA 2Y2NA 3LGOA 3ZG5A 4EWFA 4QY6A 3W4PA 4DE2A 2J7VA 1KE4A 5EV0A 3F1PB 1Q2QA 4PKYG 3JPUA 4IBRA 1WA9A 4LFUA 3VP0A 1PW1A 2VV7A 4R3JA 1CJFA 1P0ZA 4L0LA 5DJTA 3UB9A 2JKGA 3EQVA 3CWFA 2ZM8A 2B95A 1K6SA 3EEAA 3G2YA 5CGWA 1OT6A 3T1SA 3QNCA 4WMCA 5EM1A 2WKHA 4PM7A 4DJ2A 1ONGA
chains in the Genus database with same CATH topology
5HFOA 3PAEA 2PU4A 1ESIA 4BENA 4E3MA 1H5XA 4GB7A 4HBUA 2WK0A 1S0WA 4EUZA 2WZXA 3CMZA 1M40A 1I2SA 2OV5A 2H10A 1L0DA 1PI5A 3IT9A 4KZ3A 3UPNA 1KGGA 4KZ9A 2XF3A 3LO7A 3GMWA 4ID4A 5E2FA 1PW8A 5CRFA 3Q07A 4X55A 5KMWA 1YMXA 5HAPA 4WZ4A 2ZD8A 4UA7A 1VM1A 4WYYA 1WE4A 1KGEA 1YT4A 1JTDA 2E8IA 2WGWA 1FSYA 3OPLA 3PBQA 2R9XA 5M1AA 1E4DA 1KVLA 3LY4A 1NXYA 2EX9A 4OPRA 4OPZA 2XEPA 4E3OA 1W79A 2WGWB 4DKIA 1L0EA 1L2SA 2WZZA 4JXSA 2PBYA 2EXBA 3BLSA 1BTLA 1YLJA 4H8RA 1IKGA 1LL5A 3AGDA 4ZTKA 4KZ7A 4Y0OA 4N9LA 4OVDA 3MZDA 1ZKJA 3BM6A 5DF9A 4XXRA 3MXSA 1GHPA 3OZHA 4OQHA 2G2UA 4GZBA 5CTNA 4Y0TA 3VOZA 3Q7ZA 2OLUA 3BFGA 2IWCA 4Y7PA 2Y2PA 4QB8A 3HLDA 4RYEA 1GA9A 5HARA 3QHYA 3ZG8B 3PBTA 3AGFA 1PZOA 4S2PA 4E3KA 1FR6A 3I7JA 4A5RA 4DE3A 4S2NC 4OP5A 3M6HA 2ZQCA 3ZG0A 4X69A 5EOOA 3MKFA 2ZC3B 1KVMA 5J8XA 3GRJA 1BZAA 5HX9A 3W4QA 2Y2MA 3A3FA 2C5WB 3HL9A 5DF8A 3WWXA 1DJBA 2ZQDA 1O07A 5M19A 4WEJA 1PIOA 2HDUA 2ZC5B 4HESA 4BJPA 5CEDA 5EVIA 4DRTA 1ZG4A 2Y2KA 3NY4A 2ZC7A 3FV7A 5KSHA 5FAQA 2V20A 3NI9A 5GLBA 1CI8A 2WAFA 3BECA 2BLSA 2XFTA 3BLMA 1QMFA 2ZQ7A 2V1ZA 4LV1A 3ITAA 3WS5A 4OOMA 5FI2A 3OPHA 3BEBA 1EROA 3LY3A 3RJUA 5GL9A 2PU2A 5AQ7A 3IQAA 4X53A 3ZG9B 2DNSA 4WEKA 2ZC4B 5TR7A 3VP1A 3UPOA 4UHUA 3NC8A 1OMEA 3IF5A 5EECA 3D4FA 5F82A 1ALQA 2EX2A 2Y4AA 3P98A 4R0QA 3RXXA 1GHMA 3V3SA 4E6XA 1RP5A 1J9MA 2XQZA 4CPKA 1K56D 4LV0A 1XGIA 1N9BA 4Q8IA 1XKZA 2Z2LB 3A3IA 4UA6A 3O87A 3UPPA 1SDNA 1M6KA 3CG5A 1FR1A 4BLMA 4UA9A 1MWTA 3IXHA 4X6TA 2HDRA 5CXWA 1YLWA 3PBRA 1IYQA 2WGVA 3DWZA 4OLDA 5GHYA 3W4OA 2J8YA 4YINA 3ZVWA 4P85A 3WS2A 3S1YA 4KG2A 4FCFA 4MLLA 3FWLA 3GSGA 5AQAA 2ZJ9A 1K54A 1SHVA 4KQOA 5EPHA 4FH2A 3HVFA 5EVIC 2WKIA 1GHIA 1LLBA 3O86A 2QMIA 2Y2LA 2XDMA 1IYOA 5FI7A 4DXCA 1JVJA 1FQGA 5CHMA 1SCWA 1K56A 2H5SA 4BD0A 4UAAA 4NK3A 1S6RA 5DTKA 2Q9NA 1YM1A 2ZC6B 2BG1A 3Q1FA 4X56A 4KG5A 4MBKA 2EFXA 3N8LA 1RCJA 3ZG7B 3ZFZA 5KZHA 1Z6FA 1I5QA 1TDGA 4N9KA 1FSWA 3C4OA 3HUNA 1XA7A 4GOGA 4S2JA 3SS5A 4KQRA 1IELA 3HUOA 1XX2A 5EE8A 1XXMA 1K25A 4NETA 5I94A 1W8QA 2IWBA 1N4OA 4PM9A 2XGNA 3UNWA 3IF6A 2G2WA 5FA7A 1ZC2A 3PAGA 2FFFB 3HREA 4E3NA 1YLYA 1DJAA 2ZQ9A 3MKEA 3G32A 4JXWA 3VP4A 1E3UA 5AQ9A 4ZJ3A 3SH7A 3IF6B 2Y55A 5D3OA 1GA0A 2QZ6A 3IXGA 3PTEA 3SS4A 3TSGA 3M6BA 2JE5A 5U47A 4BL3A 3VSLA 2OLVA 2P74A 1K4FA 1PWGA 3IH8A 1K54C 1K6RA 5EVID 5KSCA 3HLCA 1DJCA 1IYPA 1MKIA 1NYMA 2Y2QA 5DTTA 3ZNYA 4RX2A 4R4RA 2HDSA 3GV9A 3NCKA 4D2OA 3IXBA 5EOEA 3CJMA 5FAOA 3NBLA 3G34A 4OLGA 4GNUA 3UN7A 5JYOA 5FI6A 3UE3A 3WS0A 4JXVA 1LI9A 4B4ZA 1O7EA 3BFFA 3P09A 3ZNTA 1ESUA 1ES4A 5FQMA 3A3EA 1MWUA 3ZCZA 4WELA 2R9WA 5A92A 3MZFA 3N4IA 4FSFA 4DXBA 4GKUA 2XK1A 4U3TA 5GLDA 4GDBA 4RX3A 1MY8A 1CEGA 1YMSA 3OC2A 4XUZA 1W8YA 3PBOA 5IHVA 2ZM2A 2OSUA 5GHZA 1I2WA 3IF6C 3BFDA 1YLTA 3JYIA 3C7UA 1W5DA 5AQBA 3S22A 1FOFA 4JBFA 1PI4A 1NYYA 3LEZA 3MZEA 2I72A 3G4PA 2QPNA 4OPYA 5F83A 3VFHA 5DTSA 3OPRA 1ES5A 3M2JA 5EVIB 2VGJA 5F1GA 4OH0A 1KDWA 4KZ5A 5TGFA 3DWKA 1C3BA 3GR2A 3OCLA 3SOIA 4ZAMA 4KG6A 5CGSA 1ERMA 2EXAA 5FAPA 5FQIA 3EQUA 3IH9A 1BSGA 3N7WA 1K38A 3RXWA 1K55A 3BYDA 2UWXA 4P6BA 5DF7A 3SH9A 4E3LA 3IWIA 4DDYA 1H8ZA 4JPMA 2ZMAA 2EX8A 1PYYA 1G68A 3ZDJA 2Q9MA 4EBLA 1U60A 4EQIA 3WRTA 1YQSA 3GQZA 3MXRA 2WAEA 4K0WA 4KZ8A 3PBNA 1YLZA 1JWVA 4HBTA 1MPLA 1W7FA 3UDXA 4C3QA 3Q81A 2XD5A 5M18A 3SH8A 3MFDA 4KENB 3N8RA 2HP5A 3TOIA 3V5MA 3BFEA 3E2LA 3N8SA 5HAQA 3FYZA 1H8YA 4R23A 4C6YA 4X68A 4Z9QA 4IEDA 2XD1A 4PM6A 3TG9A 1FCMA 1BLCA 4S2LA 1ONHA 1Q2PA 4PM5A 4OOLA 4WZ5C 4B4XA 1MBLA 3B3XA 4N92A 3IXDA 3UDIA 2X71A 4OQIA 1L0GA 1WYBA 3E2KA 4JF4A 2RL3A 4GD8A 1E3UD 3GTCA 3CZDA 1Y54A 1XGJA 1YLPA 2V2FF 3N6IA 4OONA 1CEFA 3UO9A 3C5AA 4QHCA 2WYXA 5CERA 3S4XA 1CK3A 4MBHA 5DVAA 4F94A 1TVFA 3SS3A 2P9VA 2XR0A 3NDGA 1K55C 1ERQA 2A49A 1E25A 3WS1A 3GVBA 5F1FA 3G30A 1GCEA 4LCLA 3IHBA 4QU3A 2JC7A 4FD8A 1BT5A 4LV2A 3NDEA 3MBZA 5G18A 4GDNA 4K91A 3V50A 3M2KA 3VP2A 3VFFA 4ZDXA 3FZCA 4MEZA 4P87A 1SDEA 3HLGA 4QD4A 1JTGA 3ZGAB 1K57A 4JLFA 4MNRA 1KDSA 4KZ4A 4S2KA 4DE1A 1IKIA 2Y2JA 3IHAA 3IWOA 1MXOA 2XH9A 3NIAA 4BD1A 2IWDA 4KQQA 2EX6A 3V39A 2Y2OA 1HZOA 1TDLA 4JKTA 4ZJ1A 1HTZA 5TFQA 4BL2A 2HDQA 3VMAA 2RCXA 2WKEA 1EI5A 4DDSA 2C6WB 2VGKA 3OPPA 1CI9A 1BLSA 3HLBA 5EUAA 3HLFA 3AGEA 5EVLA 2GDNA 1FCOA 3LCEA 4YFMA 1ZG6A 2HP6A 1SKFA 4ZBEA 4LV3A 4PMAA 5CECA 4R4SA 1KE3A 5E2EA 2ZQ8A 4E6WA 3BFCA 4HEFA 4OQ0A 4LENA 3ZVTA 3C7VA 3O88A 5HL1A 5E43A 2FFYA 5CHUA 1XP4A 2XLNA 1EWZA 3FKWA 5GLAA 1DY6A 5E2HA 4DF6A 2Y2IA 4RVAA 2ZM0A 3HUMA 4K0XA 4WBGA 2EFUA 1NZOA 2DRWA 4N1XA 3FKVA 5GHXA 1FCNA 1IEMA 4ZJ2A 2A3UA 5BOHA 5A90A 2H0YA 4OP8A 4O7DA 3HLEA 4N1HA 1BUEA 4PM8A 3IWQA 2JBFA 4R3BA 1BLPA 1BULA 2X01A 4U0TA 4EBNA 1LI0A 2DCFA 4WZ5A 5HAIA 3UE1A 5A93A 3A3JA 3C4PA 3UY6A 4R1GA 1K57C 5HW3A 5FATA 5FSRA 3G2ZA 5FASA 1PZPA 3VOYA 1G6AA 3HLWA 3PBSA 4GD6A 2WADA 4LCMA 3WRZA 2WUQA 1KE0A 3WS4A 4U0XA 3UDFA 4S2MA 4WM9A 4MBFA 3VP3A 4JXGA 2HP9A 1JWPA 5CHJA 4B88A 1XPBA 4CJNA 1PWDA 3DTMA 2Y59A 1JWZA 3QNBA 2J9OA 3DW0A 4S2OA 4S2IA 2H0TA 4QJGA 2Y2GA 2WGIA 4M3KA 5E2GA 3HBRA 4FH4A 3UE0A 2Y2NA 3ZG5A 3Q7VA 4E3JA 2XFSA 3ZHHA 3V3RA 4EWFA 4S2NA 4QY6A 5FQKA 4OKPA 3BRMA 5FQ9A 1NRFA 4KZAA 3W4PA 2Y2HA 3Q7VB 1RGZA 4GN2A 4P0MA 5FDHA 1LHYA 2ZLYA 5CGXA 4IBXA 2J7VA 3VSKA 1KE4A 3W8KA 4OQGA 3OCNA 4KZBA 4DE2A 1MWSA 3G35A 3ITBA 4OOYA 2B5RA 1BLHA 1Q2QA 1IYSA 1RGYA 4WMCD 2J9PA 1HVBA 4IBRA 1NJ4A 2X02A 1ES2A 5CEBA 5CTMA 4EV4A 3VP0A 1QMEA 1PWCA 1PW1A 4JF5A 5GLCA 4XUXA 2HPBA 4JF6A 5FQJA 4R3JA 1TEMA 2Z2MB 1HD8A 4IVKA 4L0LA 4QY5A 1VQQA 4C75A 4IVIA 1WYCA 4PPRA 1XA1A 5FQQA 1NZUA 1AXBA 3ISGA 3Q82A 4RA7A 5JYPA 5A91A 4E3IA 3EQVA 1LL9A 1MWRA 2ZM8A 4BQMA 2CC1A 4DE0A 4EBPA 1KGFA 1L0FA 1K6SA 3G2YA 5L2FA 5CGWA 4Y0UA 4OPQA 3O3VA 2JCHA 4KZ6A 2ZQAA 1NY0A 3G31A 1K4EA 2P9VB 3QNCA 4WMCA 1ES3A 2Y91A 2WKHA 4PM7A 3A3DA 1ONGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HFO A;  3PAE A;  2PU4 A;  1ESI A;  4BEN A;  4E3M A;  1H5X A;  4GB7 A;  4HBU A;  2WK0 A;  1S0W A;  4EUZ A;  2WZX A;  3CMZ A;  1M40 A;  1I2S A;  2OV5 A;  2H10 A;  1L0D A;  1PI5 A;  3IT9 A;  4KZ3 A;  3UPN A;  1KGG A;  4KZ9 A;  2XF3 A;  3LO7 A;  3GMW A;  4ID4 A;  5E2F A;  1PW8 A;  5CRF A;  3Q07 A;  4X55 A;  5KMW A;  1YMX A;  5HAP A;  4WZ4 A;  2ZD8 A;  4UA7 A;  1VM1 A;  4WYY A;  1WE4 A;  1KGE A;  1YT4 A;  1JTD A;  2E8I A;  2WGW A;  1FSY A;  3OPL A;  3PBQ A;  2R9X A;  5M1A A;  1E4D A;  1KVL A;  3LY4 A;  1NXY A;  2EX9 A;  4OPR A;  4OPZ A;  2XEP A;  4E3O A;  1W79 A;  2WGW B;  4DKI A;  1L0E A;  1L2S A;  2WZZ A;  4JXS A;  2PBY A;  2EXB A;  3BLS A;  1BTL A;  1YLJ A;  4H8R A;  1IKG A;  1LL5 A;  3AGD A;  4ZTK A;  4KZ7 A;  4Y0O A;  4N9L A;  4OVD A;  3MZD A;  1ZKJ A;  3BM6 A;  5DF9 A;  4XXR A;  3MXS A;  1GHP A;  3OZH A;  4OQH A;  2G2U A;  4GZB A;  5CTN A;  4Y0T A;  3VOZ A;  3Q7Z A;  2OLU A;  3BFG A;  2IWC A;  4Y7P A;  2Y2P A;  4QB8 A;  3HLD A;  4RYE A;  1GA9 A;  5HAR A;  3QHY A;  3ZG8 B;  3PBT A;  3AGF A;  1PZO A;  4S2P A;  4E3K A;  1FR6 A;  3I7J A;  4A5R A;  4DE3 A;  4S2N C;  4OP5 A;  3M6H A;  2ZQC A;  3ZG0 A;  4X69 A;  5EOO A;  3MKF A;  2ZC3 B;  1KVM A;  5J8X A;  3GRJ A;  1BZA A;  5HX9 A;  3W4Q A;  2Y2M A;  3A3F A;  2C5W B;  3HL9 A;  5DF8 A;  3WWX A;  1DJB A;  2ZQD A;  1O07 A;  5M19 A;  4WEJ A;  1PIO A;  2HDU A;  2ZC5 B;  4HES A;  4BJP A;  5CED A;  5EVI A;  4DRT A;  1ZG4 A;  2Y2K A;  3NY4 A;  2ZC7 A;  3FV7 A;  5KSH A;  5FAQ A;  2V20 A;  3NI9 A;  5GLB A;  1CI8 A;  2WAF A;  3BEC A;  2BLS A;  2XFT A;  3BLM A;  1QMF A;  2ZQ7 A;  2V1Z A;  4LV1 A;  3ITA A;  3WS5 A;  4OOM A;  5FI2 A;  3OPH A;  3BEB A;  1ERO A;  3LY3 A;  3RJU A;  5GL9 A;  2PU2 A;  5AQ7 A;  3IQA A;  4X53 A;  3ZG9 B;  2DNS A;  4WEK A;  2ZC4 B;  5TR7 A;  3VP1 A;  3UPO A;  4UHU A;  3NC8 A;  1OME A;  3IF5 A;  5EEC A;  3D4F A;  5F82 A;  1ALQ A;  2EX2 A;  2Y4A A;  3P98 A;  4R0Q A;  3RXX A;  1GHM A;  3V3S A;  4E6X A;  1RP5 A;  1J9M A;  2XQZ A;  4CPK A;  1K56 D;  4LV0 A;  1XGI A;  1N9B A;  4Q8I A;  1XKZ A;  2Z2L B;  3A3I A;  4UA6 A;  3O87 A;  3UPP A;  1SDN A;  1M6K A;  3CG5 A;  1FR1 A;  4BLM A;  4UA9 A;  1MWT A;  3IXH A;  4X6T A;  2HDR A;  5CXW A;  1YLW A;  3PBR A;  1IYQ A;  2WGV A;  3DWZ A;  4OLD A;  5GHY A;  3W4O A;  2J8Y A;  4YIN A;  3ZVW A;  4P85 A;  3WS2 A;  3S1Y A;  4KG2 A;  4FCF A;  4MLL A;  3FWL A;  3GSG A;  5AQA A;  2ZJ9 A;  1K54 A;  1SHV A;  4KQO A;  5EPH A;  4FH2 A;  3HVF A;  5EVI C;  2WKI A;  1GHI A;  1LLB A;  3O86 A;  2QMI A;  2Y2L A;  2XDM A;  1IYO A;  5FI7 A;  4DXC A;  1JVJ A;  1FQG A;  5CHM A;  1SCW A;  1K56 A;  2H5S A;  4BD0 A;  4UAA A;  4NK3 A;  1S6R A;  5DTK A;  2Q9N A;  1YM1 A;  2ZC6 B;  2BG1 A;  3Q1F A;  4X56 A;  4KG5 A;  4MBK A;  2EFX A;  3N8L A;  1RCJ A;  3ZG7 B;  3ZFZ A;  5KZH A;  1Z6F A;  1I5Q A;  1TDG A;  4N9K A;  1FSW A;  3C4O A;  3HUN A;  1XA7 A;  4GOG A;  4S2J A;  3SS5 A;  4KQR A;  1IEL A;  3HUO A;  1XX2 A;  5EE8 A;  1XXM A;  1K25 A;  4NET A;  5I94 A;  1W8Q A;  2IWB A;  1N4O A;  4PM9 A;  2XGN A;  3UNW A;  3IF6 A;  2G2W A;  5FA7 A;  1ZC2 A;  3PAG A;  2FFF B;  3HRE A;  4E3N A;  1YLY A;  1DJA A;  2ZQ9 A;  3MKE A;  3G32 A;  4JXW A;  3VP4 A;  1E3U A;  5AQ9 A;  4ZJ3 A;  3SH7 A;  3IF6 B;  2Y55 A;  5D3O A;  1GA0 A;  2QZ6 A;  3IXG A;  3PTE A;  3SS4 A;  3TSG A;  3M6B A;  2JE5 A;  5U47 A;  4BL3 A;  3VSL A;  2OLV A;  2P74 A;  1K4F A;  1PWG A;  3IH8 A;  1K54 C;  1K6R A;  5EVI D;  5KSC A;  3HLC A;  1DJC A;  1IYP A;  1MKI A;  1NYM A;  2Y2Q A;  5DTT A;  3ZNY A;  4RX2 A;  4R4R A;  2HDS A;  3GV9 A;  3NCK A;  4D2O A;  3IXB A;  5EOE A;  3CJM A;  5FAO A;  3NBL A;  3G34 A;  4OLG A;  4GNU A;  3UN7 A;  5JYO A;  5FI6 A;  3UE3 A;  3WS0 A;  4JXV A;  1LI9 A;  4B4Z A;  1O7E A;  3BFF A;  3P09 A;  3ZNT A;  1ESU A;  1ES4 A;  5FQM A;  3A3E A;  1MWU A;  3ZCZ A;  4WEL A;  2R9W A;  5A92 A;  3MZF A;  3N4I A;  4FSF A;  4DXB A;  4GKU A;  2XK1 A;  4U3T A;  5GLD A;  4GDB A;  4RX3 A;  1MY8 A;  1CEG A;  1YMS A;  3OC2 A;  4XUZ A;  1W8Y A;  3PBO A;  5IHV A;  2ZM2 A;  2OSU A;  5GHZ A;  1I2W A;  3IF6 C;  3BFD A;  1YLT A;  3JYI A;  3C7U A;  1W5D A;  5AQB A;  3S22 A;  1FOF A;  4JBF A;  1PI4 A;  1NYY A;  3LEZ A;  3MZE A;  2I72 A;  3G4P A;  2QPN A;  4OPY A;  5F83 A;  3VFH A;  5DTS A;  3OPR A;  1ES5 A;  3M2J A;  5EVI B;  2VGJ A;  5F1G A;  4OH0 A;  1KDW A;  4KZ5 A;  5TGF A;  3DWK A;  1C3B A;  3GR2 A;  3OCL A;  3SOI A;  4ZAM A;  4KG6 A;  5CGS A;  1ERM A;  2EXA A;  5FAP A;  5FQI A;  3EQU A;  3IH9 A;  1BSG A;  3N7W A;  1K38 A;  3RXW A;  1K55 A;  3BYD A;  2UWX A;  4P6B A;  5DF7 A;  3SH9 A;  4E3L A;  3IWI A;  4DDY A;  1H8Z A;  4JPM A;  2ZMA A;  2EX8 A;  1PYY A;  1G68 A;  3ZDJ A;  2Q9M A;  4EBL A;  1U60 A;  4EQI A;  3WRT A;  1YQS A;  3GQZ A;  3MXR A;  2WAE A;  4K0W A;  4KZ8 A;  3PBN A;  1YLZ A;  1JWV A;  4HBT A;  1MPL A;  1W7F A;  3UDX A;  4C3Q A;  3Q81 A;  2XD5 A;  5M18 A;  3SH8 A;  3MFD A;  4KEN B;  3N8R A;  2HP5 A;  3TOI A;  3V5M A;  3BFE A;  3E2L A;  3N8S A;  5HAQ A;  3FYZ A;  1H8Y A;  4R23 A;  4C6Y A;  4X68 A;  4Z9Q A;  4IED A;  2XD1 A;  4PM6 A;  3TG9 A;  1FCM A;  1BLC A;  4S2L A;  1ONH A;  1Q2P A;  4PM5 A;  4OOL A;  4WZ5 C;  4B4X A;  1MBL A;  3B3X A;  4N92 A;  3IXD A;  3UDI A;  2X71 A;  4OQI A;  1L0G A;  1WYB A;  3E2K A;  4JF4 A;  2RL3 A;  4GD8 A;  1E3U D;  3GTC A;  3CZD A;  1Y54 A;  1XGJ A;  1YLP A;  2V2F F;  3N6I A;  4OON A;  1CEF A;  3UO9 A;  3C5A A;  4QHC A;  2WYX A;  5CER A;  3S4X A;  1CK3 A;  4MBH A;  5DVA A;  4F94 A;  1TVF A;  3SS3 A;  2P9V A;  2XR0 A;  3NDG A;  1K55 C;  1ERQ A;  2A49 A;  1E25 A;  3WS1 A;  3GVB A;  5F1F A;  3G30 A;  1GCE A;  4LCL A;  3IHB A;  4QU3 A;  2JC7 A;  4FD8 A;  1BT5 A;  4LV2 A;  3NDE A;  3MBZ A;  5G18 A;  4GDN A;  4K91 A;  3V50 A;  3M2K A;  3VP2 A;  3VFF A;  4ZDX A;  3FZC A;  4MEZ A;  4P87 A;  1SDE A;  3HLG A;  4QD4 A;  1JTG A;  3ZGA B;  1K57 A;  4JLF A;  4MNR A;  1KDS A;  4KZ4 A;  4S2K A;  4DE1 A;  1IKI A;  2Y2J A;  3IHA A;  3IWO A;  1MXO A;  2XH9 A;  3NIA A;  4BD1 A;  2IWD A;  4KQQ A;  2EX6 A;  3V39 A;  2Y2O A;  1HZO A;  1TDL A;  4JKT A;  4ZJ1 A;  1HTZ A;  5TFQ A;  4BL2 A;  2HDQ A;  3VMA A;  2RCX A;  2WKE A;  1EI5 A;  4DDS A;  2C6W B;  2VGK A;  3OPP A;  1CI9 A;  1BLS A;  3HLB A;  5EUA A;  3HLF A;  3AGE A;  5EVL A;  2GDN A;  1FCO A;  3LCE A;  4YFM A;  1ZG6 A;  2HP6 A;  1SKF A;  4ZBE A;  4LV3 A;  4PMA A;  5CEC A;  4R4S A;  1KE3 A;  5E2E A;  2ZQ8 A;  4E6W A;  3BFC A;  4HEF A;  4OQ0 A;  4LEN A;  3ZVT A;  3C7V A;  3O88 A;  5HL1 A;  5E43 A;  2FFY A;  5CHU A;  1XP4 A;  2XLN A;  1EWZ A;  3FKW A;  5GLA A;  1DY6 A;  5E2H A;  4DF6 A;  2Y2I A;  4RVA A;  2ZM0 A;  3HUM A;  4K0X A;  4WBG A;  2EFU A;  1NZO A;  2DRW A;  4N1X A;  3FKV A;  5GHX A;  1FCN A;  1IEM A;  4ZJ2 A;  2A3U A;  5BOH A;  5A90 A;  2H0Y A;  4OP8 A;  4O7D A;  3HLE A;  4N1H A;  1BUE A;  4PM8 A;  3IWQ A;  2JBF A;  4R3B A;  1BLP A;  1BUL A;  2X01 A;  4U0T A;  4EBN A;  1LI0 A;  2DCF A;  4WZ5 A;  5HAI A;  3UE1 A;  5A93 A;  3A3J A;  3C4P A;  3UY6 A;  4R1G A;  1K57 C;  5HW3 A;  5FAT A;  5FSR A;  3G2Z A;  5FAS A;  1PZP A;  3VOY A;  1G6A A;  3HLW A;  3PBS A;  4GD6 A;  2WAD A;  4LCM A;  3WRZ A;  2WUQ A;  1KE0 A;  3WS4 A;  4U0X A;  3UDF A;  4S2M A;  4WM9 A;  4MBF A;  3VP3 A;  4JXG A;  2HP9 A;  1JWP A;  5CHJ A;  4B88 A;  1XPB A;  4CJN A;  1PWD A;  3DTM A;  2Y59 A;  1JWZ A;  3QNB A;  2J9O A;  3DW0 A;  4S2O A;  4S2I A;  2H0T A;  4QJG A;  2Y2G A;  2WGI A;  4M3K A;  5E2G A;  3HBR A;  4FH4 A;  3UE0 A;  2Y2N A;  3ZG5 A;  3Q7V A;  4E3J A;  2XFS A;  3ZHH A;  3V3R A;  4EWF A;  4S2N A;  4QY6 A;  5FQK A;  4OKP A;  3BRM A;  5FQ9 A;  1NRF A;  4KZA A;  3W4P A;  2Y2H A;  3Q7V B;  1RGZ A;  4GN2 A;  4P0M A;  5FDH A;  1LHY A;  2ZLY A;  5CGX A;  4IBX A;  2J7V A;  3VSK A;  1KE4 A;  3W8K A;  4OQG A;  3OCN A;  4KZB A;  4DE2 A;  1MWS A;  3G35 A;  3ITB A;  4OOY A;  2B5R A;  1BLH A;  1Q2Q A;  1IYS A;  1RGY A;  4WMC D;  2J9P A;  1HVB A;  4IBR A;  1NJ4 A;  2X02 A;  1ES2 A;  5CEB A;  5CTM A;  4EV4 A;  3VP0 A;  1QME A;  1PWC A;  1PW1 A;  4JF5 A;  5GLC A;  4XUX A;  2HPB A;  4JF6 A;  5FQJ A;  4R3J A;  1TEM A;  2Z2M B;  1HD8 A;  4IVK A;  4L0L A;  4QY5 A;  1VQQ A;  4C75 A;  4IVI A;  1WYC A;  4PPR A;  1XA1 A;  5FQQ A;  1NZU A;  1AXB A;  3ISG A;  3Q82 A;  4RA7 A;  5JYP A;  5A91 A;  4E3I A;  3EQV A;  1LL9 A;  1MWR A;  2ZM8 A;  4BQM A;  2CC1 A;  4DE0 A;  4EBP A;  1KGF A;  1L0F A;  1K6S A;  3G2Y A;  5L2F A;  5CGW A;  4Y0U A;  4OPQ A;  3O3V A;  2JCH A;  4KZ6 A;  2ZQA A;  1NY0 A;  3G31 A;  1K4E A;  2P9V B;  3QNC A;  4WMC A;  1ES3 A;  2Y91 A;  2WKH A;  4PM7 A;  3A3D A;  1ONG A; 
#chains in the Genus database with same CATH topology
 5HFO A;  3PAE A;  1ESI A;  3S7Q A;  4HBU A;  4EUZ A;  3LI8 A;  3IT9 A;  4KZ3 A;  5A8B A;  1KGG A;  5CRF A;  3Q07 A;  4X55 A;  5IT5 A;  5KMW A;  4MCW A;  3H7W B;  2ZD8 A;  1VM1 A;  1KGE A;  3DTE A;  3T1Q B;  2W3H A;  1NXY A;  2EX9 A;  4OPR A;  3LIC A;  1D7E A;  1S4S A;  3K2N A;  1L0E A;  1L2S A;  2WZZ A;  5EM0 A;  4EET B;  1LL5 A;  4ZTK A;  4KZ7 A;  3BM6 A;  5DF9 A;  3E4Q A;  4XXR A;  3OZH A;  3CI6 A;  4LPZ A;  4GZB A;  4Y7P A;  3BFG A;  2IWC A;  2QKP A;  1G5U A;  5HAR A;  2GX5 A;  1X0O A;  3T4O A;  3ZG8 B;  4JGR A;  1PNE A;  4Y13 A;  2JKT I;  2V9A A;  1YSP A;  4NKP A;  5DFX A;  5EOO A;  3LUQ A;  1ACF A;  1BZA A;  3V67 A;  5HX9 A;  2C5W B;  5DF8 A;  1DJB A;  5M19 A;  4WEJ A;  1PIO A;  4Y2F A;  5EVI A;  2UV0 E;  3NY4 A;  3FV7 A;  2PD8 A;  5GLB A;  1CI8 A;  1SZV A;  2XFT A;  1QMF A;  3LID A;  4LV1 A;  5FI2 A;  3UME A;  3BEB A;  5DJU A;  5IS1 A;  3RJU A;  4GCZ A;  4LRX C;  2VK3 A;  4X53 A;  2DNS A;  4WEK A;  1UWN X;  1OME A;  2Y8H A;  3QP5 A;  1S66 L;  2Y4A A;  4O8G A;  2XQZ A;  4CPK A;  4DN0 A;  2Z2L B;  3A3I A;  4UA6 A;  4GS9 B;  3SW1 A;  4R70 A;  4BLM A;  1FR1 A;  4UA9 A;  1W63 M;  3MF0 A;  4MMN A;  4OLD A;  4H6J A;  1OTE A;  3FWL A;  1K54 A;  1Y4O A;  2KDK A;  5EVI C;  1LLB A;  3O86 A;  3LR3 A;  2Y2L A;  1T18 A;  5AVE A;  2ZL1 B;  5CHM A;  2H5S A;  3T4Q A;  4NK3 A;  3QP6 A;  2Q9N A;  1YM1 A;  3Q1F A;  4NXG A;  4X56 A;  4O0P A;  3N8L A;  1I5Q A;  2VV6 A;  1STZ A;  3HUN A;  3SS5 A;  1FIK A;  1W8Q A;  1N4O A;  2ACG A;  5TBM A;  3ZYT A;  5FA7 A;  5DKL A;  2INW A;  2FFF B;  1YLY A;  1E3U A;  3SH7 A;  2YKF A;  3IF6 B;  3BQ8 A;  3KYZ A;  3SS4 A;  3PTE A;  2GZA A;  3MMH A;  4UEY A;  3TSG A;  2W3F A;  5HDS A;  2OLV A;  1PWG A;  4KUK A;  1K54 C;  1S1Y A;  3T4L A;  5DTT A;  4R4R A;  2WKP A;  3MJQ A;  3IXB A;  2PD7 A;  3FG8 A;  3G34 A;  2QWS A;  5HWV A;  2EA9 A;  4I3J A;  3UN7 A;  4IHQ A;  1LI9 A;  1AWI A;  5A92 A;  1MWU A;  4FSF A;  5G4Z A;  2OWH A;  5GLD A;  2V0U A;  1J3W A;  1CEG A;  3OC2 A;  1W8Y A;  2EWW A;  3JYI A;  3C7U A;  4BBV A;  3S22 A;  2W27 A;  3LEZ A;  2O9C A;  2I72 A;  3VFH A;  4HNB A;  1XJ3 A;  5F1G A;  2VGJ A;  3D72 A;  3DWK A;  5CGS A;  2PT7 A;  5FAP A;  4HJ4 A;  2UWX A;  4P6B A;  3SH9 A;  2VA0 A;  3IWI A;  3IX4 A;  1LSX A;  4CQH A;  1YLZ A;  4C3Q A;  4X1M A;  3V5M A;  2A24 A;  3EWK A;  3TG9 A;  1BLC A;  4PM5 A;  4OOL A;  4WZ5 C;  4B4X A;  3BJN A;  1IFQ A;  1DRM A;  5DKK A;  3GTC A;  1Y54 A;  2V2F F;  1EW0 A;  1DP8 A;  2WYX A;  3EGX C;  5DVA A;  1Z09 A;  2P9V A;  4R6L A;  5F69 A;  1ERQ A;  3G30 A;  2WKQ A;  2JC7 A;  3NDE A;  2XRN A;  2GJ3 A;  4GDN A;  3FZC A;  4I39 A;  2VZW A;  3EGD C;  2M7V A;  3ZGA B;  4B93 A;  1JTG A;  1K57 A;  2JKF A;  2D01 A;  1MXO A;  2XH9 A;  4JKT A;  1TDL A;  1HTZ A;  3OBF A;  1EI5 A;  2VGK A;  1BLS A;  4GHI B;  5EUA A;  3B42 A;  2GDN A;  2K7S A;  5LBR A;  3E4P A;  4LV3 A;  4PMA A;  5HD3 A;  5E2E A;  3O88 A;  4WLA A;  4O01 A;  1XP4 A;  1EWZ A;  2Y2I A;  4EW7 A;  4Y15 A;  2LB5 A;  4N1X A;  4ZJ2 A;  2A3U A;  5A90 A;  3HLE A;  1F98 A;  1N9L A;  1BLP A;  1BUL A;  2X01 A;  3C8C A;  3UE1 A;  4BWI A;  4HY8 A;  4BBT A;  4PHT A;  2HJE A;  3HJK A;  1K57 C;  5FAS A;  3SZT A;  2D02 A;  2WAD A;  3UDF A;  4S2M A;  3VP3 A;  1JWP A;  1XPB A;  3RFB A;  4CJN A;  2Y59 A;  3MQQ A;  3CUE A;  1GSW A;  2QJ7 A;  2H0T A;  4FH4 A;  3UMD A;  4QWO A;  2HZ5 A;  3BWL A;  1TD5 A;  4S2N A;  5FQK A;  1VET B;  4NXE A;  2PYP A;  4GN2 A;  2JKT M;  5FDH A;  1TS0 A;  1LHY A;  5HL1 A;  4IBX A;  4OQG A;  4WN5 A;  3G35 A;  1BLH A;  1IYS A;  2J9P A;  2HV1 A;  1OTB A;  1T1B A;  1QME A;  4JF5 A;  2VKS A;  1TEM A;  2J3T D;  4P6Z S;  1LT0 A;  1WYC A;  4RA7 A;  2V0W A;  4DE0 A;  5HD5 A;  1L0F A;  3CUE C;  3O3V A;  2JCH A;  2O99 A;  1NY0 A;  1K4E A;  1MZU A;  4S2N C;  3A3D A;  3PYP A;  2ZBB A;  4E3M A;  1H5X A;  1PFL A;  2OV5 A;  3UPN A;  2H10 A;  1L0D A;  4X25 A;  5E2F A;  1PW8 A;  2K2N A;  4WYY A;  1WE4 A;  5KIZ A;  1JTD A;  2WGW A;  3OPL A;  3PBQ A;  2IA2 A;  5M1A A;  2XEP A;  4R3A A;  1W79 A;  5FL3 A;  5HDC A;  4JXS A;  1YPR A;  4EQ1 A;  2W3D A;  3BLS A;  4Q0I A;  3MQO A;  1K0K A;  1IKG A;  5J4E A;  3AGD A;  3NOU C;  4N9L A;  4OVD A;  1ZKJ A;  5L07 A;  3MXS A;  4GW9 A;  4Q0H A;  4OQH A;  4Y0T A;  3VOZ A;  2Y2P A;  3PBT A;  3AGF A;  4E3K A;  1F5M A;  4DE3 A;  3ZQ5 A;  4EU0 A;  3M6H A;  2ZQC A;  3MKF A;  2ZC3 B;  3GRJ A;  2Y2M A;  2ZQD A;  3BQA A;  4DRT A;  1ZG4 A;  2Y2K A;  2ZC7 A;  3NI9 A;  3A0S A;  2BLS A;  3BLM A;  3OPH A;  5GL9 A;  1VEU A;  3ZG9 B;  2ZC4 B;  3VP1 A;  5AVF A;  2AVX A;  4ZRR A;  3UPO A;  3A0R A;  1ALQ A;  1TS6 A;  1GHM A;  4E6X A;  3C38 A;  3E4O A;  1RP5 A;  2ZOH A;  1K56 D;  1UGU A;  5I5L A;  3UPP A;  1SDN A;  3CG5 A;  3IXH A;  2L4R A;  3FPV A;  1IYQ A;  3W4O A;  3QP2 A;  3ZVW A;  4P85 A;  4HP9 A;  4FCF A;  3TRC A;  3GSG A;  2ZJ9 A;  1SHV A;  4KQO A;  2PHY A;  1TS8 A;  2QMI A;  4H6J B;  1IYO A;  1H3Q A;  3EOI A;  1XJ6 A;  1FQG A;  4ME4 A;  4BD0 A;  1NWZ A;  2PR5 A;  4I38 A;  1S6R A;  1RCJ A;  3ZFZ A;  5KZH A;  4N9K A;  2VGL S;  1FSW A;  1IEL A;  1XXM A;  1K25 A;  2L0W A;  5FDS A;  1MC0 A;  2IWB A;  3FC7 A;  4DJ3 A;  3T4J A;  4D60 A;  2G2W A;  4R38 A;  1ZC2 A;  3T4S A;  4WUJ A;  1DJA A;  3G32 A;  4CLC A;  5AQ9 A;  4DMZ A;  3TW8 A;  5D3O A;  3RH8 B;  3M6B A;  2JE5 A;  3NHQ A;  4F3L A;  4NXF A;  1P9W A;  1DP9 A;  1IYP A;  2JHE A;  3KX0 X;  2HDS A;  1DP6 A;  3CJM A;  2G7U A;  5FAO A;  3NBL A;  3T50 A;  2Y79 A;  1UWP X;  4OLG A;  3H82 A;  5FI6 A;  3K3C A;  4B4Z A;  1O7E A;  3OLO A;  1ZHH B;  1ESU A;  1ES4 A;  4WF0 A;  2PBD P;  2R9W A;  4MDZ A;  4DXB A;  4GKU A;  4GDB A;  4RX3 A;  1YMS A;  3PBO A;  5IHV A;  4EES A;  2ZM2 A;  1I2W A;  1W5D A;  5AQB A;  1NYY A;  3MZE A;  2QPN A;  4CLC C;  4OPY A;  4K08 A;  5DTS A;  1ES5 A;  1KDW A;  3OCL A;  4EUV A;  2QYB A;  1OPX A;  3EQU A;  3IH9 A;  2XA7 M;  2E8J A;  2FH5 A;  3BYD A;  5DF7 A;  3U2A A;  3NUL A;  2ZMA A;  2EX8 A;  4I3I A;  3ZDJ A;  1YQS A;  3GQZ A;  4KZ8 A;  4XT2 A;  3DAV A;  1JWV A;  4HBT A;  1T1C A;  2OWJ A;  5HWT A;  3TOI A;  3E2L A;  3S7P A;  4Z9Q A;  4PM6 A;  4YOF A;  1FCM A;  1OTA A;  4S2L A;  1Q2P A;  3S7O A;  1MBL A;  2V8C A;  4N92 A;  3E2K A;  4GD8 A;  1NLY A;  1XJ2 A;  4OON A;  1XGJ A;  1YLP A;  3C5A A;  3L7H A;  5CER A;  1CK3 A;  4LRY C;  5J3W A;  1TVF A;  2ZOI A;  2QJ5 A;  1E25 A;  4QU3 A;  2L1M A;  3MS6 A;  3MBZ A;  3VP2 A;  4MEZ A;  1XJ4 A;  3VE4 A;  4JLF A;  4RQ9 A;  1IKI A;  5C5K A;  3IHA A;  3CLO A;  3V39 A;  4BL2 A;  4I3A A;  4DDS A;  4ETX A;  1CI9 A;  4YFM A;  1ZG6 A;  2P04 A;  1SKF A;  4E6W A;  4OQ0 A;  3ZVT A;  4HOI A;  3LR0 A;  3W2Z A;  2XLN A;  4DF6 A;  5GLA A;  5E2H A;  4RVA A;  4G3K A;  4WBG A;  5GHX A;  5HDD A;  4OP8 A;  4PM8 A;  1LSV A;  4R3B A;  4U0T A;  4WZ5 A;  5HAI A;  5A93 A;  3A3J A;  5HW3 A;  1BYW A;  3WRZ A;  4LCM A;  3PBS A;  2J3T C;  1N9O A;  1MKM A;  2KLI A;  4WM9 A;  3E98 A;  3R7W A;  2HP9 A;  5CHJ A;  4B88 A;  3QNB A;  4S2O A;  4QJG A;  3HJI A;  3LYX A;  4UQI S;  3UE0 A;  3Q7V A;  2XFS A;  3CHW P;  3ZHH A;  4OKP A;  3F1O A;  1ODV A;  3BRM A;  5FQ9 A;  1Y28 A;  1NRF A;  4KZA A;  2Y2H A;  1RGZ A;  3UB8 A;  4P0M A;  3VSK A;  2ZLY A;  4ARZ B;  3OCN A;  4KZB A;  1P9R A;  1MWS A;  4OOY A;  4GS9 A;  4WMC D;  1NJ4 A;  3KYQ A;  4WL9 A;  3CPT B;  2HPB A;  4JF6 A;  5FQJ A;  2Z2M B;  1HD8 A;  4IVK A;  4QY5 A;  3O5Y A;  4C75 A;  3VE3 A;  5JYP A;  1NZU A;  3ISG A;  3Q82 A;  1TS7 A;  4E3I A;  2DMW A;  3T12 B;  4BQM A;  4EBP A;  1KGF A;  5L2F A;  5CX7 A;  1L3L A;  2JN7 A;  4OPQ A;  2VX8 A;  3KSG A;  2ZQA A;  3G31 A;  1HLU P;  4FOF A;  1ZTU A;  2Y91 A;  4NXB A;  2OOL A;  4BEN A;  4GB7 A;  1S0W A;  2WZX A;  3UB5 P;  1I2S A;  1XFN A;  1PI5 A;  3BY9 A;  4KZ9 A;  2XF3 A;  3GMW A;  4ID4 A;  1NRJ A;  2QHK A;  1YMX A;  5HAP A;  4B9O A;  3IS2 A;  1YT4 A;  4EXO A;  5L10 A;  1FSY A;  2R9X A;  1E4D A;  2PR6 A;  3CIT A;  3LY4 A;  4E3O A;  4IUH A;  2VJW A;  2WGW B;  4NEE D;  3F1N A;  4HJ3 A;  2PBY A;  2EXB A;  1BTL A;  1YLJ A;  4H8R A;  4JGQ A;  2HGV A;  4LRZ E;  4Y0O A;  3MZD A;  4QB8 A;  1GA9 A;  3QHY A;  1FR6 A;  1S4R A;  2P08 A;  3I7J A;  1W63 Q;  4OP5 A;  2B18 A;  3MXQ A;  5J8X A;  3A3F A;  3WWX A;  1FIL A;  2HDU A;  2ZC5 B;  4HES A;  5CED A;  2V20 A;  5F5Y A;  1S67 L;  1ERO A;  3LY3 A;  2J3W A;  1NLZ A;  2PU2 A;  3IQA A;  3KSI A;  3VV4 A;  3NC8 A;  3IF5 A;  3A0V A;  2OAP 1;  5F82 A;  1XFQ A;  2EX2 A;  4R0Q A;  3RXX A;  1XKZ A;  3LR5 A;  3O87 A;  4Y17 A;  1MWT A;  4X6T A;  5CXW A;  1YLW A;  3MR0 A;  3DWZ A;  5GHY A;  3WS2 A;  3S1Y A;  4MLL A;  1CF0 A;  3VOL A;  5HWW A;  3HVF A;  1GHI A;  2WKI A;  4MN6 A;  4DXC A;  4Q0J A;  4Z1W A;  2CMN A;  4UAA A;  5DTK A;  2BG1 A;  4KG5 A;  3LIA A;  1Z6F A;  1TDG A;  1SKO A;  3C4O A;  4GOG A;  4S2J A;  4KQR A;  3HUO A;  1XX2 A;  4NET A;  5I94 A;  4PM9 A;  3UNW A;  2OAQ 1;  3PAG A;  1V9Y A;  3LI9 A;  4QPR A;  2BTF P;  3MKE A;  4ZJ3 A;  5FEG A;  2PAV P;  2Y55 A;  1GA0 A;  2QZ6 A;  3IXG A;  3TJZ C;  5U47 A;  3VSL A;  2P74 A;  4CLC B;  1K6R A;  3NOT C;  5KSC A;  1DJC A;  1MKI A;  3ZNY A;  4RX2 A;  4F3L B;  3GV9 A;  2K31 A;  2I9V A;  1LL8 A;  5J7E A;  3UE3 A;  3WS0 A;  3ZNT A;  5FQM A;  3L9K A;  3H82 B;  4U3T A;  2O9B A;  3IX3 A;  5GHZ A;  3BFD A;  1YLT A;  3PR6 A;  5F83 A;  4Y3I A;  3M2J A;  5EVI B;  4OH0 A;  1C3B A;  3SOI A;  2W1T A;  4ZAM A;  2EXA A;  5FQI A;  3ICY A;  3K3D A;  1BSG A;  2A2L A;  3N7W A;  1K38 A;  3T1R A;  1K55 A;  4DDY A;  4JPM A;  5HPF A;  2Q9M A;  1U60 A;  3WRT A;  4K0W A;  3PBN A;  3NJA A;  1W7F A;  3LIB A;  2PRF A;  3MFD A;  4KEN B;  3FPW A;  3BFE A;  5HAQ A;  4XT2 B;  3FYZ A;  1H8Y A;  4R23 A;  3T4K A;  4X68 A;  2XD1 A;  1ONH A;  3B3X A;  2NUT C;  2X71 A;  4OQI A;  1L0G A;  1WYB A;  2RL3 A;  4MN5 A;  1CEF A;  3UO9 A;  4QHC A;  4L9E A;  5L09 A;  1A0K A;  4IUK A;  3S4X A;  4F94 A;  3SS3 A;  2XR0 A;  4P6Z M;  1K55 C;  2A49 A;  3GVB A;  1GCE A;  4JGO A;  4LCL A;  3IHB A;  3DTI A;  4HI4 A;  4FD8 A;  1BT5 A;  3BY8 A;  5G18 A;  4K91 A;  2JKR I;  2W3E A;  4ZDX A;  4PAU A;  1OT9 A;  4MNR A;  1KDS A;  3UE6 A;  4DE1 A;  3U4L P;  5TBM B;  3NIA A;  4BD1 A;  2IWD A;  1D06 A;  4KQQ A;  2EX6 A;  4ZJ1 A;  5TFQ A;  4HQA A;  3T1X A;  3VMA A;  2RCX A;  2WKE A;  4MN7 A;  2C6W B;  3OPP A;  3AGE A;  5EVL A;  3UB6 A;  1FCO A;  3LCE A;  2HJ9 C;  2W3G A;  4ZBE A;  3QP8 A;  1OJG A;  3IBR A;  4R4S A;  2ZQ8 A;  4LEN A;  3C7V A;  2KOI A;  2FFY A;  5CHU A;  3FKW A;  3R4K A;  3HUM A;  1N9N A;  3CAX A;  2EFU A;  1NZO A;  2DRW A;  1FCN A;  4O7D A;  2EWV A;  4N1H A;  1BUE A;  3TE8 A;  2JBF A;  1GSV A;  2DCF A;  2XSS A;  3C30 A;  3UY6 A;  4R1G A;  1F2K A;  2V8F A;  4G3W A;  5FSR A;  1PZP A;  3VOY A;  1G6A A;  3HLW A;  4GD6 A;  1JNU A;  1PRQ A;  1KE0 A;  3WS4 A;  4MBF A;  4JXG A;  4Y5F A;  3EEH A;  1KOU A;  1JWZ A;  3R7W B;  4S2I A;  3LIE A;  2WGI A;  4M3K A;  5E2G A;  3JVV A;  4L9F A;  4E3J A;  3V3R A;  3IX8 A;  2PYR A;  1VHM A;  4HP4 A;  3F1P A;  3Q7V B;  5CGX A;  3ULF A;  3W8K A;  3F1O B;  4X1L A;  3ITB A;  4HJ6 A;  3T4T A;  2B5R A;  1RGY A;  1HVB A;  2X02 A;  1ES2 A;  1V9Z A;  2O0Y A;  5CTM A;  5CEB A;  1S1Z A;  2A24 B;  4EV4 A;  1PWC A;  5HSQ A;  4HH3 A;  4XUX A;  2YKH A;  5GLC A;  1CQA A;  1VQQ A;  4IVI A;  4PPR A;  1XA1 A;  5FQQ A;  1AXB A;  5A91 A;  1LL9 A;  1MWR A;  3LR4 A;  2CC1 A;  2M1C A;  2W0N A;  3NEC A;  4Y0U A;  4KUO A;  4KZ6 A;  2P9V B;  1ES3 A;  2PU4 A;  4AFI A;  2WK0 A;  3CMZ A;  3H7W A;  4FUW A;  3P01 A;  5HL6 A;  2M7U A;  1M40 A;  3LO7 A;  2R78 A;  1OTD A;  5F6A A;  3RTY A;  4WZ4 A;  4UA7 A;  2VGL M;  3E0Y A;  2E8I A;  4YWZ A;  1KVL A;  1YAX A;  4OPZ A;  3IS2 B;  5AJG A;  5F68 A;  4DKI A;  3B47 A;  3F1N B;  1GSX A;  1GHP A;  2G2U A;  5CTN A;  3Q7Z A;  2OLU A;  3HLD A;  4RYE A;  5L8M A;  4EEP A;  4HIA A;  4S2P A;  1PZO A;  3G6O A;  5FEF A;  4A5R A;  4EEU A;  4L9G A;  2O9A A;  3S7N A;  3ZG0 A;  4X69 A;  1KVM A;  2W1R A;  3MFX A;  3W4Q A;  4HH2 A;  3HL9 A;  4CLC E;  1O07 A;  4BJP A;  3MSH A;  5KSH A;  5FAQ A;  2WAF A;  3BEC A;  2ZQ7 A;  2V1Z A;  3D3O A;  3ITA A;  4NG2 A;  2V1B A;  3WS5 A;  4OOM A;  1YKD A;  5AQ7 A;  5TR7 A;  4UHU A;  5EEC A;  3KSH A;  3D4F A;  3P98 A;  3V3S A;  4BMW A;  1J9M A;  5EVE A;  3IBJ A;  3D9Y A;  1XGI A;  4LV0 A;  1N9B A;  4Q8I A;  3PHY A;  1T1A A;  1M6K A;  2KX6 A;  3DBA A;  2HDR A;  3PBR A;  2WGV A;  4HHD A;  2J8Y A;  2Z6C A;  2BAS A;  4YIN A;  2VEA A;  4KG2 A;  2ZL1 A;  5AQA A;  5EPH A;  4FH2 A;  4M4X A;  3UB7 A;  1F9I A;  2XDM A;  5FI7 A;  1JVJ A;  4YNR A;  4CLC D;  1SCW A;  1K56 A;  1VB6 A;  4II7 A;  2ZC6 B;  1G6O A;  1P97 A;  5HZH A;  3ZG7 B;  4MBK A;  2EFX A;  3B33 A;  3KO6 A;  1XA7 A;  5EE8 A;  2J80 A;  2XGN A;  1SKO B;  3IF6 A;  1YSQ A;  2ZMV A;  4G3V A;  3HRE A;  4E3N A;  2ZQ9 A;  4JXW A;  2NUP C;  3VP4 A;  2V1A A;  3JVU A;  4BL3 A;  1K4F A;  3IH8 A;  5EVI D;  3HLC A;  1NYM A;  2Y2Q A;  3C2W A;  4D2O A;  3NCK A;  2JKR M;  5EOE A;  5EFW A;  1TF1 A;  4GLQ A;  4GNU A;  5JYO A;  3KSF A;  4JXV A;  2ZMF A;  3BFF A;  3P09 A;  3A3E A;  3ZCZ A;  4WEL A;  3MZF A;  3P7N A;  3N4I A;  2XK1 A;  1OJ5 A;  3BW6 A;  1MY8 A;  4XUZ A;  2OSU A;  3IF6 C;  3GDI A;  1FOF A;  4JBF A;  1PI4 A;  2VV8 A;  4BBU A;  3G4P A;  4PKY A;  3OPR A;  1T19 A;  3NOP C;  4KZ5 A;  5TGF A;  3GR2 A;  4KG6 A;  4E04 A;  1ERM A;  3LFV A;  3H9W A;  3RXW A;  2B02 A;  4E3L A;  1VEU B;  2W1T B;  4ETZ A;  1H8Z A;  2VLG A;  1PYY A;  1G68 A;  4EQI A;  4EBL A;  3MXR A;  3PXP A;  1OTI A;  3GEC A;  2WAE A;  4ARZ A;  1MPL A;  3UDX A;  3Q81 A;  2XD5 A;  5M18 A;  3SH8 A;  4UQI M;  3N8R A;  2HP5 A;  2FZ0 A;  3N8S A;  4C6Y A;  4IJG A;  3CPT A;  4GJ4 A;  4IED A;  3LEQ A;  3UDI A;  3IXD A;  2LB9 A;  4JF4 A;  1E3U D;  3CZD A;  3N6I A;  4LGW A;  5IU1 A;  1H0M A;  4MBH A;  4JGP A;  2HF6 A;  3NDG A;  3WS1 A;  5F1F A;  1LSW A;  4LV2 A;  3V50 A;  3M2K A;  5K5B A;  3VFF A;  4P87 A;  1SDE A;  3HLG A;  4QD4 A;  4KZ4 A;  4S2K A;  2Y2J A;  2XRO A;  3IWO A;  2PDR A;  4I5S A;  4GHI A;  2Y2O A;  1HZO A;  2P7J A;  2HDQ A;  1D1J A;  5G4Y A;  2Q0O A;  4FTX A;  2MJ6 A;  5HPI A;  3HLB A;  3HLF A;  3QP4 A;  2HP6 A;  4LLO B;  5CEC A;  1KE3 A;  3BFC A;  3HCY A;  4HEF A;  5E43 A;  4ESP A;  5DFY A;  5TJJ A;  4KQD A;  1DY6 A;  2ZM0 A;  4K0X A;  3FKV A;  5BOH A;  1IEM A;  1H8M A;  2H0Y A;  2Z6D A;  1IOU A;  3IWQ A;  3KYE A;  4EBN A;  3DTK A;  1G28 A;  1LI0 A;  4EER A;  3MQ0 A;  3C4P A;  3QP1 A;  5FAT A;  5MC7 A;  3G2Z A;  3LIF A;  2XA7 S;  2WUQ A;  4U0X A;  2WKR A;  2H28 A;  2GNX A;  1PWD A;  3DTM A;  2J9O A;  3DW0 A;  2Y2G A;  3OOV A;  3HBR A;  1VET A;  2Y2N A;  3LGO A;  3ZG5 A;  4EWF A;  4QY6 A;  3W4P A;  4DE2 A;  2J7V A;  1KE4 A;  5EV0 A;  3F1P B;  1Q2Q A;  4PKY G;  3JPU A;  4IBR A;  1WA9 A;  4LFU A;  3VP0 A;  1PW1 A;  2VV7 A;  4R3J A;  1CJF A;  1P0Z A;  4L0L A;  5DJT A;  3UB9 A;  2JKG A;  3EQV A;  3CWF A;  2ZM8 A;  2B95 A;  1K6S A;  3EEA A;  3G2Y A;  5CGW A;  1OT6 A;  3T1S A;  3QNC A;  4WMC A;  5EM1 A;  2WKH A;  4PM7 A;  4DJ2 A;  1ONG A; 
#chains in the Genus database with same CATH homology
 5HFO A;  3PAE A;  2PU4 A;  1ESI A;  4BEN A;  4E3M A;  1H5X A;  4GB7 A;  4HBU A;  2WK0 A;  1S0W A;  4EUZ A;  2WZX A;  3CMZ A;  1M40 A;  1I2S A;  2OV5 A;  2H10 A;  1L0D A;  1PI5 A;  3IT9 A;  4KZ3 A;  3UPN A;  1KGG A;  4KZ9 A;  2XF3 A;  3LO7 A;  3GMW A;  4ID4 A;  5E2F A;  1PW8 A;  5CRF A;  3Q07 A;  4X55 A;  5KMW A;  1YMX A;  5HAP A;  4WZ4 A;  2ZD8 A;  4UA7 A;  1VM1 A;  4WYY A;  1WE4 A;  1KGE A;  1YT4 A;  1JTD A;  2E8I A;  2WGW A;  1FSY A;  3OPL A;  3PBQ A;  2R9X A;  5M1A A;  1E4D A;  1KVL A;  3LY4 A;  1NXY A;  2EX9 A;  4OPR A;  4OPZ A;  2XEP A;  4E3O A;  1W79 A;  2WGW B;  4DKI A;  1L0E A;  1L2S A;  2WZZ A;  4JXS A;  2PBY A;  2EXB A;  3BLS A;  1BTL A;  1YLJ A;  4H8R A;  1IKG A;  1LL5 A;  3AGD A;  4ZTK A;  4KZ7 A;  4Y0O A;  4N9L A;  4OVD A;  3MZD A;  1ZKJ A;  3BM6 A;  5DF9 A;  4XXR A;  3MXS A;  1GHP A;  3OZH A;  4OQH A;  2G2U A;  4GZB A;  5CTN A;  4Y0T A;  3VOZ A;  3Q7Z A;  2OLU A;  3BFG A;  2IWC A;  4Y7P A;  2Y2P A;  4QB8 A;  3HLD A;  4RYE A;  1GA9 A;  5HAR A;  3QHY A;  3ZG8 B;  3PBT A;  3AGF A;  1PZO A;  4S2P A;  4E3K A;  1FR6 A;  3I7J A;  4A5R A;  4DE3 A;  4S2N C;  4OP5 A;  3M6H A;  2ZQC A;  3ZG0 A;  4X69 A;  5EOO A;  3MKF A;  2ZC3 B;  1KVM A;  5J8X A;  3GRJ A;  1BZA A;  5HX9 A;  3W4Q A;  2Y2M A;  3A3F A;  2C5W B;  3HL9 A;  5DF8 A;  3WWX A;  1DJB A;  2ZQD A;  1O07 A;  5M19 A;  4WEJ A;  1PIO A;  2HDU A;  2ZC5 B;  4HES A;  4BJP A;  5CED A;  5EVI A;  4DRT A;  1ZG4 A;  2Y2K A;  3NY4 A;  2ZC7 A;  3FV7 A;  5KSH A;  5FAQ A;  2V20 A;  3NI9 A;  5GLB A;  1CI8 A;  2WAF A;  3BEC A;  2BLS A;  2XFT A;  3BLM A;  1QMF A;  2ZQ7 A;  2V1Z A;  4LV1 A;  3ITA A;  3WS5 A;  4OOM A;  5FI2 A;  3OPH A;  3BEB A;  1ERO A;  3LY3 A;  3RJU A;  5GL9 A;  2PU2 A;  5AQ7 A;  3IQA A;  4X53 A;  3ZG9 B;  2DNS A;  4WEK A;  2ZC4 B;  5TR7 A;  3VP1 A;  3UPO A;  4UHU A;  3NC8 A;  1OME A;  3IF5 A;  5EEC A;  3D4F A;  5F82 A;  1ALQ A;  2EX2 A;  2Y4A A;  3P98 A;  4R0Q A;  3RXX A;  1GHM A;  3V3S A;  4E6X A;  1RP5 A;  1J9M A;  2XQZ A;  4CPK A;  1K56 D;  4LV0 A;  1XGI A;  1N9B A;  4Q8I A;  1XKZ A;  2Z2L B;  3A3I A;  4UA6 A;  3O87 A;  3UPP A;  1SDN A;  1M6K A;  3CG5 A;  1FR1 A;  4BLM A;  4UA9 A;  1MWT A;  3IXH A;  4X6T A;  2HDR A;  5CXW A;  1YLW A;  3PBR A;  1IYQ A;  2WGV A;  3DWZ A;  4OLD A;  5GHY A;  3W4O A;  2J8Y A;  4YIN A;  3ZVW A;  4P85 A;  3WS2 A;  3S1Y A;  4KG2 A;  4FCF A;  4MLL A;  3FWL A;  3GSG A;  5AQA A;  2ZJ9 A;  1K54 A;  1SHV A;  4KQO A;  5EPH A;  4FH2 A;  3HVF A;  5EVI C;  2WKI A;  1GHI A;  1LLB A;  3O86 A;  2QMI A;  2Y2L A;  2XDM A;  1IYO A;  5FI7 A;  4DXC A;  1JVJ A;  1FQG A;  5CHM A;  1SCW A;  1K56 A;  2H5S A;  4BD0 A;  4UAA A;  4NK3 A;  1S6R A;  5DTK A;  2Q9N A;  1YM1 A;  2ZC6 B;  2BG1 A;  3Q1F A;  4X56 A;  4KG5 A;  4MBK A;  2EFX A;  3N8L A;  1RCJ A;  3ZG7 B;  3ZFZ A;  5KZH A;  1Z6F A;  1I5Q A;  1TDG A;  4N9K A;  1FSW A;  3C4O A;  3HUN A;  1XA7 A;  4GOG A;  4S2J A;  3SS5 A;  4KQR A;  1IEL A;  3HUO A;  1XX2 A;  5EE8 A;  1XXM A;  1K25 A;  4NET A;  5I94 A;  1W8Q A;  2IWB A;  1N4O A;  4PM9 A;  2XGN A;  3UNW A;  3IF6 A;  2G2W A;  5FA7 A;  1ZC2 A;  3PAG A;  2FFF B;  3HRE A;  4E3N A;  1YLY A;  1DJA A;  2ZQ9 A;  3MKE A;  3G32 A;  4JXW A;  3VP4 A;  1E3U A;  5AQ9 A;  4ZJ3 A;  3SH7 A;  3IF6 B;  2Y55 A;  5D3O A;  1GA0 A;  2QZ6 A;  3IXG A;  3PTE A;  3SS4 A;  3TSG A;  3M6B A;  2JE5 A;  5U47 A;  4BL3 A;  3VSL A;  2OLV A;  2P74 A;  1K4F A;  1PWG A;  3IH8 A;  1K54 C;  1K6R A;  5EVI D;  5KSC A;  3HLC A;  1DJC A;  1IYP A;  1MKI A;  1NYM A;  2Y2Q A;  5DTT A;  3ZNY A;  4RX2 A;  4R4R A;  2HDS A;  3GV9 A;  3NCK A;  4D2O A;  3IXB A;  5EOE A;  3CJM A;  5FAO A;  3NBL A;  3G34 A;  4OLG A;  4GNU A;  3UN7 A;  5JYO A;  5FI6 A;  3UE3 A;  3WS0 A;  4JXV A;  1LI9 A;  4B4Z A;  1O7E A;  3BFF A;  3P09 A;  3ZNT A;  1ESU A;  1ES4 A;  5FQM A;  3A3E A;  1MWU A;  3ZCZ A;  4WEL A;  2R9W A;  5A92 A;  3MZF A;  3N4I A;  4FSF A;  4DXB A;  4GKU A;  2XK1 A;  4U3T A;  5GLD A;  4GDB A;  4RX3 A;  1MY8 A;  1CEG A;  1YMS A;  3OC2 A;  4XUZ A;  1W8Y A;  3PBO A;  5IHV A;  2ZM2 A;  2OSU A;  5GHZ A;  1I2W A;  3IF6 C;  3BFD A;  1YLT A;  3JYI A;  3C7U A;  1W5D A;  5AQB A;  3S22 A;  1FOF A;  4JBF A;  1PI4 A;  1NYY A;  3LEZ A;  3MZE A;  2I72 A;  3G4P A;  2QPN A;  4OPY A;  5F83 A;  3VFH A;  5DTS A;  3OPR A;  1ES5 A;  3M2J A;  5EVI B;  2VGJ A;  5F1G A;  4OH0 A;  1KDW A;  4KZ5 A;  5TGF A;  3DWK A;  1C3B A;  3GR2 A;  3OCL A;  3SOI A;  4ZAM A;  4KG6 A;  5CGS A;  1ERM A;  2EXA A;  5FAP A;  5FQI A;  3EQU A;  3IH9 A;  1BSG A;  3N7W A;  1K38 A;  3RXW A;  1K55 A;  3BYD A;  2UWX A;  4P6B A;  5DF7 A;  3SH9 A;  4E3L A;  3IWI A;  4DDY A;  1H8Z A;  4JPM A;  2ZMA A;  2EX8 A;  1PYY A;  1G68 A;  3ZDJ A;  2Q9M A;  4EBL A;  1U60 A;  4EQI A;  3WRT A;  1YQS A;  3GQZ A;  3MXR A;  2WAE A;  4K0W A;  4KZ8 A;  3PBN A;  1YLZ A;  1JWV A;  4HBT A;  1MPL A;  1W7F A;  3UDX A;  4C3Q A;  3Q81 A;  2XD5 A;  5M18 A;  3SH8 A;  3MFD A;  4KEN B;  3N8R A;  2HP5 A;  3TOI A;  3V5M A;  3BFE A;  3E2L A;  3N8S A;  5HAQ A;  3FYZ A;  1H8Y A;  4R23 A;  4C6Y A;  4X68 A;  4Z9Q A;  4IED A;  2XD1 A;  4PM6 A;  3TG9 A;  1FCM A;  1BLC A;  4S2L A;  1ONH A;  1Q2P A;  4PM5 A;  4OOL A;  4WZ5 C;  4B4X A;  1MBL A;  3B3X A;  4N92 A;  3IXD A;  3UDI A;  2X71 A;  4OQI A;  1L0G A;  1WYB A;  3E2K A;  4JF4 A;  2RL3 A;  4GD8 A;  1E3U D;  3GTC A;  3CZD A;  1Y54 A;  1XGJ A;  1YLP A;  2V2F F;  3N6I A;  4OON A;  1CEF A;  3UO9 A;  3C5A A;  4QHC A;  2WYX A;  5CER A;  3S4X A;  1CK3 A;  4MBH A;  5DVA A;  4F94 A;  1TVF A;  3SS3 A;  2P9V A;  2XR0 A;  3NDG A;  1K55 C;  1ERQ A;  2A49 A;  1E25 A;  3WS1 A;  3GVB A;  5F1F A;  3G30 A;  1GCE A;  4LCL A;  3IHB A;  4QU3 A;  2JC7 A;  4FD8 A;  1BT5 A;  4LV2 A;  3NDE A;  3MBZ A;  5G18 A;  4GDN A;  4K91 A;  3V50 A;  3M2K A;  3VP2 A;  3VFF A;  4ZDX A;  3FZC A;  4MEZ A;  4P87 A;  1SDE A;  3HLG A;  4QD4 A;  1JTG A;  3ZGA B;  1K57 A;  4JLF A;  4MNR A;  1KDS A;  4KZ4 A;  4S2K A;  4DE1 A;  1IKI A;  2Y2J A;  3IHA A;  3IWO A;  1MXO A;  2XH9 A;  3NIA A;  4BD1 A;  2IWD A;  4KQQ A;  2EX6 A;  3V39 A;  2Y2O A;  1HZO A;  1TDL A;  4JKT A;  4ZJ1 A;  1HTZ A;  5TFQ A;  4BL2 A;  2HDQ A;  3VMA A;  2RCX A;  2WKE A;  1EI5 A;  4DDS A;  2C6W B;  2VGK A;  3OPP A;  1CI9 A;  1BLS A;  3HLB A;  5EUA A;  3HLF A;  3AGE A;  5EVL A;  2GDN A;  1FCO A;  3LCE A;  4YFM A;  1ZG6 A;  2HP6 A;  1SKF A;  4ZBE A;  4LV3 A;  4PMA A;  5CEC A;  4R4S A;  1KE3 A;  5E2E A;  2ZQ8 A;  4E6W A;  3BFC A;  4HEF A;  4OQ0 A;  4LEN A;  3ZVT A;  3C7V A;  3O88 A;  5HL1 A;  5E43 A;  2FFY A;  5CHU A;  1XP4 A;  2XLN A;  1EWZ A;  3FKW A;  5GLA A;  1DY6 A;  5E2H A;  4DF6 A;  2Y2I A;  4RVA A;  2ZM0 A;  3HUM A;  4K0X A;  4WBG A;  2EFU A;  1NZO A;  2DRW A;  4N1X A;  3FKV A;  5GHX A;  1FCN A;  1IEM A;  4ZJ2 A;  2A3U A;  5BOH A;  5A90 A;  2H0Y A;  4OP8 A;  4O7D A;  3HLE A;  4N1H A;  1BUE A;  4PM8 A;  3IWQ A;  2JBF A;  4R3B A;  1BLP A;  1BUL A;  2X01 A;  4U0T A;  4EBN A;  1LI0 A;  2DCF A;  4WZ5 A;  5HAI A;  3UE1 A;  5A93 A;  3A3J A;  3C4P A;  3UY6 A;  4R1G A;  1K57 C;  5HW3 A;  5FAT A;  5FSR A;  3G2Z A;  5FAS A;  1PZP A;  3VOY A;  1G6A A;  3HLW A;  3PBS A;  4GD6 A;  2WAD A;  4LCM A;  3WRZ A;  2WUQ A;  1KE0 A;  3WS4 A;  4U0X A;  3UDF A;  4S2M A;  4WM9 A;  4MBF A;  3VP3 A;  4JXG A;  2HP9 A;  1JWP A;  5CHJ A;  4B88 A;  1XPB A;  4CJN A;  1PWD A;  3DTM A;  2Y59 A;  1JWZ A;  3QNB A;  2J9O A;  3DW0 A;  4S2O A;  4S2I A;  2H0T A;  4QJG A;  2Y2G A;  2WGI A;  4M3K A;  5E2G A;  3HBR A;  4FH4 A;  3UE0 A;  2Y2N A;  3ZG5 A;  3Q7V A;  4E3J A;  2XFS A;  3ZHH A;  3V3R A;  4EWF A;  4S2N A;  4QY6 A;  5FQK A;  4OKP A;  3BRM A;  5FQ9 A;  1NRF A;  4KZA A;  3W4P A;  2Y2H A;  3Q7V B;  1RGZ A;  4GN2 A;  4P0M A;  5FDH A;  1LHY A;  2ZLY A;  5CGX A;  4IBX A;  2J7V A;  3VSK A;  1KE4 A;  3W8K A;  4OQG A;  3OCN A;  4KZB A;  4DE2 A;  1MWS A;  3G35 A;  3ITB A;  4OOY A;  2B5R A;  1BLH A;  1Q2Q A;  1IYS A;  1RGY A;  4WMC D;  2J9P A;  1HVB A;  4IBR A;  1NJ4 A;  2X02 A;  1ES2 A;  5CEB A;  5CTM A;  4EV4 A;  3VP0 A;  1QME A;  1PWC A;  1PW1 A;  4JF5 A;  5GLC A;  4XUX A;  2HPB A;  4JF6 A;  5FQJ A;  4R3J A;  1TEM A;  2Z2M B;  1HD8 A;  4IVK A;  4L0L A;  4QY5 A;  1VQQ A;  4C75 A;  4IVI A;  1WYC A;  4PPR A;  1XA1 A;  5FQQ A;  1NZU A;  1AXB A;  3ISG A;  3Q82 A;  4RA7 A;  5JYP A;  5A91 A;  4E3I A;  3EQV A;  1LL9 A;  1MWR A;  2ZM8 A;  4BQM A;  2CC1 A;  4DE0 A;  4EBP A;  1KGF A;  1L0F A;  1K6S A;  3G2Y A;  5L2F A;  5CGW A;  4Y0U A;  4OPQ A;  3O3V A;  2JCH A;  4KZ6 A;  2ZQA A;  1NY0 A;  3G31 A;  1K4E A;  2P9V B;  3QNC A;  4WMC A;  1ES3 A;  2Y91 A;  2WKH A;  4PM7 A;  3A3D A;  1ONG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...