3OLOA

Crystal structure of a pas domain from two-component sensor histidine kinase
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
111
structure length
111
Chain Sequence
QSELEFKFAHYLINNAVEASFCLGDNWQFLYVNDATCRMTEYSREQLLSMNLQDIDVDFALHDWEEIRQKNNYTFKTRYRSQSGRIFLVEMSLTFLEDQERRFSCVFVREK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Two-component sensor histidine kinase
publication title Crystal structure of a PAS domain from two-component sensor histidine kinase
rcsb
source organism Nostoc sp.
total genus 39
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3oloA00
3F1PB 3F1PA 3B33A 3C2WA 4JGRA 2PR5A 2R78A 1V9YA 3LIEA 2PR6A 2PYPA 1LT0A 2BASA 4LRXC 3IBRA 2CMNA 1T1AA 3F1OA 5HD3A 5I5LA 2B02A 1S66L 3RTYA 4HY8A 2QJ7A 3KX0X 1XJ2A 2L0WA 3MFXA 4F3LA 3NHQA 5EFWA 1XJ4A 4EEPA 2H28A 1T1BA 4NXFA 4LLOB 4L9FA 1DP8A 4EW7A 2L4RA 4B9OA 5G4ZA 5DJUA 2P7JA 5G4YA 2L1MA 5DKKA 3UMDA 2YKFA 4R6LA 3ZQ5A 4JGQA 3MJQA 2PHYA 4HNBA 3HJIA 4KQDA 4DJ3A 5J4EA 1DRMA 5KIZA 3CWFA 4NXBA 1BYWA 1N9LA 3K3DA 1TS0A 2EA9A 5TBMB 2PDRA 2W0NA 4HP9A 4EQ1A 4MN5A 4I38A 3LYXA 2INWA 3VE3A 3CAXA 3ICYA 3VE4A 5IS1A 2VEAA 2V9AA 2OWJA 2YKHA 4RQ9A 1NWZA 4LRYC 1UGUA 1T18A 2J80A 1XJ3A 2GJ3A 3BY8A 1OTIA 3E4PA 5HDDA 3A0SA 5HWTA 4GHIB 5HWWA 2QJ5A 4E04A 1P97A 2PYRA 5DJTA 2OOLA 3H9WA 5DKLA 3NOUC 4BBTA 1D7EA 5F68A 3EEHA 1XFNA 4I3AA 1OJ5A 4PKYG 1T19A 2ZOHA 3P7NA 5AVFA 1JNUA 2QWSA 4GS9B 2PD7A 2JHEA 4I39A 3UB8A 1LSVA 3CLOA 3F1NB 3F1NA 4HJ4A 4BBUA 4GCZA 3MQOA 1DP6A 1S1YA 2ZBBA 3D72A 3LIFA 1OT9A 5F5YA 5HZHA 4PKYA 5AVEA 2QKPA 1V9ZA 4JGOA 2PD8A 4HQAA 3K3CA 2D02A 2V1BA 4JGPA 3A0VA 3BWLA 4KUKA 3MR0A 2OWHA 3GDIA 2ZOIA 5TBMA 3NJAA 1UWNX 4HOIA 1OTDA 1GSXA 3OLOA 1S4RA 4DJ2A 5F6AA 3UE6A 1ODVA 3LI9A 4HJ3A 4H6JB 3IS2B 4H6JA 3NOTC 4EETB 4K08A 2K7SA 2A24B 5IU1A 1TS8A 3LICA 4HI4A 1KOUA 4WF0A 3MXQA 4I3IA 5HD5A 3H7WB 3H82B 2D01A 1OTEA 3E4OA 3PYPA 1LL8A 1F9IA 1VB6A 4GHIA 3BY9A 3PHYA 1G28A 4EXOA 3LIBA 1LSXA 1F98A 3FC7A 2WKRA 3EWKA 4R70A 2HV1A 4L9GA 4NXEA 3RH8B 4EESA 4GS9A 1T1CA 3SW1A 3LI8A 5HDSA 4HIAA 4HJ6A 1LSWA 2W27A 3UB6A 3F1OB 3C8CA 4HHDA 1N9NA 1Y28A 4I3JA 2VV8A 2KDKA 3VOLA 4XT2B 4XT2A 2V1AA 5A8BA 2I9VA 3MQQA 5HDCA 4I5SA 3UB9A 4WN5A 3LIDA 4GW9A 3T50A 5HSQA 3UB7A 4F3LB 1S1ZA 2Z6CA 1XFQA 2WKPA 5F69A 4WLAA 5J3WA 1S67L 4EERA 4LRZE 1OJGA 2QHKA 1OTBA 3GECA 3UMEA 1UWPX 4LPZA 1S4SA 3LIAA 4HH2A 4EEUA 4HP4A 1DP9A 1X0OA 4YWZA 3LUQA 3FG8A 2JN7A 1OT6A 2VV6A 3G6OA 1TS6A 1WA9A 1P0ZA 3IS2A 4L9EA 4M4XA 2V0WA 1GSWA 3E4QA 3ULFA 1OTAA 2WKQA 1MZUA 2A24A 4NXGA 4WUJA 1TS7A 4WL9A 4R38A 1D06A 5J7EA 1GSVA 2V0UA 2VLGA 3NOPC 3H7WA 3H82A 4HH3A 2VV7A 1N9OA 2M1CA 4KUOA 5HWVA 3HJKA 4BBVA 2KX6A 1EW0A 2Z6DA 3A0RA 4R3AA 4MN6A 1XJ6A
chains in the Genus database with same CATH superfamily
3T4KA 4KZ9A 5EOOA 3C2WA 4S2NA 3BFDA 3KSHA 2OAQ1 1OPXA 3E2LA 2EX9A 2P9VA 2PYPA 3Q7ZA 4UA7A 3Q7VB 4GB7A 4GZBA 1D1JA 3IBRA 5FA7A 1VM1A 4ZTKA 4MEZA 3ZVTA 5KMWA 2Y55A 4JF5A 3BJNA 3ZGAB 5A91A 4WZ4A 5DTSA 5HL1A 1CI8A 2CC1A 4IEDA 1PRQA 1FSYA 3DWKA 3G2YA 4F3LA 1GHMA 2HDQA 5CGXA 1FCOA 1XJ4A 3G30A 3UPPA 3M2KA 3GRJA 1YKDA 2FZ0A 1IKIA 4EEPA 1BLPA 3Q81A 1KDWA 4NXFA 3DAVA 4MMNA 2ZQ9A 4EW7A 4FTXA 2L4RA 4B9OA 1ES3A 5G4ZA 5DJUA 3LY4A 1FCMA 2J9PA 3P01A 4GJ4A 3UDFA 4CLCB 4JGQA 1N4OA 3E0YA 4DJ3A 4U0XA 2Z2LB 5KIZA 4X55A 3JVVA 3CWFA 4FCFA 4NXBA 1GA0A 4Q0IA 4OLGA 3UY6A 4RVAA 1J3WA 5TBMB 3GV9A 1IYPA 1NY0A 3ZG7B 2WGWB 2XR0A 1S6RA 3N4IA 1VEUA 4I38A 3LYXA 3VE3A 4BWIA 4OOYA 5FI6A 1Z09A 4QHCA 4R1GA 1ES4A 3SS5A 3W4PA 5HAQA 3LR0A 1ZG4A 2WZXA 3T4QA 1TVFA 3KSFA 3LFVA 3JVUA 3BYDA 1NWZA 4RQ9A 1VQQA 3MKEA 1PI5A 1SDNA 2J80A 4Y0TA 5DFXA 4JXVA 1W79A 5FAPA 1TDGA 1K6SA 4GHIB 2JKTM 2WKHA 2H0TA 1SKOB 1YLWA 3LR3A 2PYRA 3A3JA 5DKLA 4Y2FA 4B4ZA 1CJFA 3R4KA 3MBZA 1XFNA 5FI7A 2ZOHA 3P7NA 1ZHHB 2H5SA 2QWSA 4GS9B 5K5BA 2JHEA 4KQQA 2GX5A 2HP9A 3GVBA 1L3LA 1LLBA 2P74A 3N8RA 4HJ4A 1NYMA 3MQOA 1NRFA 1W63Q 3SH9A 3O87A 4DE2A 4ZJ3A 5CHMA 4OQIA 3V39A 2ZQCA 1FSWA 2PBYA 3NIAA 4NETA 1K55C 1KE3A 4PKYA 2EWWA 4KQRA 1JWVA 1V9ZA 2PD8A 4OQHA 2D02A 1BZAA 4FD8A 1E4DA 4WEKA 3BWLA 2WAFA 3PR6A 4IUHA 3DTEA 2H10A 5EVID 4MLLA 3TJZC 2HDRA 1UWNX 1HD8A 1MPLA 1OTDA 1GSXA 4U3TA 1FOFA 1MKMA 5GLAA 3UE6A 2HPBA 1L0FA 1TD5A 1WYCA 2O9CA 4PM6A 2OSUA 5FQMA 3A3EA 1NXYA 5FEFA 5L07A 2ZM2A 1XPBA 4PM5A 4FOFA 4E3NA 2ZD8A 2K7SA 5IU1A 5DF9A 1CK3A 2O99A 4QPRA 2ZJ9A 2DCFA 4LV2A 1ES2A 4DF6A 3LEQA 4WF0A 4C75A 4NEED 1HZOA 2Y4AA 3H82B 5U47A 1W8YA 1OTEA 3D3OA 3ZG9B 4JBFA 4DN0A 1VETB 3CPTB 1VB6A 4IHQA 3EOIA 3PHYA 1G28A 3VFFA 2Q9NA 3OCNA 2WKRA 4R3BA 2XD5A 2BLSA 1BT5A 1P9WA 3VV4A 3KYQA 4GDNA 2ZMFA 4R70A 1ONGA 3ZYTA 1MKIA 4KZ3A 2VGLS 2IA2A 5GLBA 3TOIA 5FASA 1CEGA 1NZOA 3QP8A 2C5WB 2W27A 2Y2PA 3F1OB 2W3FA 1N9NA 1K57C 1G6OA 4QJGA 5CGWA 3GSGA 1XP4A 4N9LA 2BG1A 3VFHA 5A8BA 2I9VA 4ESPA 1ESIA 1K55A 2RL3A 2WKPA 3QNCA 3PBQA 4ME4A 1AWIA 1YQSA 5J3WA 2PBDP 2EWVA 3GMWA 5F83A 1OJGA 2Y2GA 4LPZA 3G34A 3G4PA 1S4SA 2ZC3B 1ERQA 4E6XA 4KG2A 5FSRA 4OPRA 3CI6A 1RCJA 3FG8A 1K0KA 2VV6A 4E3KA 1TS6A 1WA9A 4Y17A 3IS2A 4DE1A 2HJ9C 2KOIA 3RXXA 3FZCA 3ITAA 1PW8A 3BQ8A 3VP0A 2A24A 3MF0A 4WMCD 3LO7A 2XQZA 3HCYA 2V20A 2A49A 1YSPA 2W1TB 1D06A 4D60A 3WS0A 2V0UA 4CPKA 4ZJ2A 3Q07A 3H7WA 1SCWA 3VMAA 4K91A 4YOFA 4Q8IA 1KVMA 3G32A 4P6ZM 3IH8A 1MWUA 5HWVA 2ZQAA 3IWIA 3DTIA 1S0WA 4BBVA 4R3AA 1SHVA 1M40A 3OOVA 2AVXA 4BQMA 5A93A 1K54C 1XJ6A 5DTKA 3V3SA 3NDEA 5DF7A 3F1PB 3F1PA 5DVAA 1E3UD 2HF6A 3B33A 3BM6A 3W2ZA 3T1QB 1U60A 2OAP1 2PR6A 5EM0A 1FCNA 5AQ9A 4GOGA 4IJGA 4LCMA 1ZTUA 2M7VA 3TW8A 1Y54A 4Q0HA 4LRXC 1DJCA 3C7VA 1YT4A 4E3IA 5CERA 2P04A 4KZAA 4IUKA 1DJBA 3M6BA 2IWDA 2B02A 1IEMA 3S1YA 1XXMA 3ZNYA 4P0MA 4S2JA 2Y2IA 4P85A 3KX0X 1YM1A 1XGIA 3FPVA 4DXCA 1P9RA 5FQJA 2NUTC 3HVFA 2H28A 2OLUA 4QY6A 4L9FA 1DP8A 2ZL1A 4R4RA 5EVIC 4EBNA 1NRJA 4D2OA 2LB9A 2Y2KA 1GHIA 2P7JA 3NY4A 2WKIA 3UMDA 5EOEA 2O9AA 3O86A 4MCWA 4Y7PA 2PU4A 2H0YA 4OLDA 4KQDA 3ZDJA 2ZQ8A 1NZUA 5J4EA 3C5AA 4PM7A 1PNEA 3KO6A 4UEYA 1TS0A 2PDRA 1G68A 2ZQDA 3PBRA 2W0NA 3B42A 4II7A 4LCLA 2W3EA 4Y13A 3CHWP 3S4XA 3E2KA 5TR7A 5E2FA 3C7UA 2J7VA 5IS1A 1HTZA 3U4LP 2DMWA 1IFQA 3W4OA 2HGVA 3T1SA 2XA7S 1IYQA 3NECA 4C3QA 5FQQA 1UGUA 1K54A 2B95A 1XJ3A 2X71A 5HX9A 3BY8A 5EPHA 2FH5A 3WS5A 1I2WA 1OTIA 4FUWA 5F1FA 5HWWA 3C38A 5FEGA 4E04A 5J8XA 3DBAA 1MBLA 5L09A 1P97A 2XF3A 4IBXA 3IX8A 3Q7VA 4R3JA 5EUAA 5DJTA 3H9WA 4KQOA 3NOUC 4BBTA 4P87A 1PW1A 3EEHA 3MMHA 4PKYG 2EXAA 3N7WA 1T19A 3U2AA 1XGJA 1J9MA 2WK0A 1JNUA 3PBNA 2WZZA 1BLHA 4I39A 3T4JA 5CX7A 3MS6A 4P6BA 3D4FA 4PMAA 1H8YA 1DP6A 1PWGA 1S1YA 3MQ0A 1SDEA 4YNRA 2VGKA 3R7WB 3AGEA 4BLMA 1OT9A 2E8JA 5EVIB 5F5YA 3JPUA 1IELA 2ZC5B 3FV7A 2O9BA 2QKPA 3HBRA 4N1HA 4XUZA 2QMIA 3QP6A 4CLCA 3O3VA 2V1BA 1GA9A 4JGPA 4X1MA 3A0VA 1F2KA 5DTTA 1L0DA 1GCEA 4FH2A 1ALQA 3IWOA 2QYBA 1W5DA 5TBMA 4U0TA 4E3LA 1S4RA 4DJ2A 4R23A 2WGWA 3CMZA 2JE5A 2OLVA 4X68A 3LI9A 5E2GA 4H6JB 4H6JA 4EETB 1YMXA 2ZLYA 1ES5A 4R0QA 4RX3A 1I2SA 3OC2A 4S2IA 5EVLA 2Y2JA 3IXHA 2JKTI 3MXQA 4NK3A 5CHJA 5HD5A 1AXBA 3G2ZA 3ZG0A 4O0PA 3ZFZA 4BL2A 3V50A 1F5MA 2K31A 4GKUA 3TRCA 1F9IA 4GHIA 4XXRA 3BY9A 1IKGA 4KZ7A 1SKOA 1F98A 1TF1A 3FPWA 2HP6A 1FILA 4HBTA 3EWKA 3RXWA 5GLCA 5FDHA 3RH8B 1PWCA 3LGOA 4GS9A 1MC0A 1T1CA 5GHZA 3SW1A 4X69A 5EECA 3WS1A 1RP5A 4XUXA 3LI8A 5M18A 1N9BA 1LSWA 2XEPA 2X01A 4BMWA 3WRTA 5C5KA 3VOLA 2ZM8A 3T4SA 1BUEA 3MQQA 1XX2A 5HDCA 4GW9A 3UB7A 3CG5A 3ZCZA 3EQVA 4WLAA 3BLMA 4H8RA 2V8FA 3UN7A 3QNBA 4FSFA 1H8ZA 4LRZE 3SH8A 3UNWA 1K4EA 1QMEA 3HLEA 3UMEA 1BLCA 4EQIA 2NUPC 4OQGA 3IF5A 4JXGA 3HLWA 4DRTA 5JYPA 4WMCA 3VOYA 1H0MA 3K2NA 1L2SA 2V2FF 3PTEA 3Q1FA 5HW3A 3G6OA 1P0ZA 4S2MA 4ARZB 2VX8A 3E4QA 4X6TA 3ULFA 4Y0OA 3MFDA 4PM8A 1XA7A 1Q2PA 3O88A 4ETXA 1KGEA 4KZ4A 5FQIA 3NOPC 4G3VA 3H82A 1RGYA 4QD4A 2Y2HA 3OZHA 4KUOA 1VETA 3CPTA 4KZ5A 4EBPA 1EW0A 3GR2A 3PAEA 4MN6A 5EM1A 4BJPA 2G2WA 3T4TA 2J3TD 2VZWA 1YPRA 1PWDA 3IQAA 3MKFA 1LHYA 3LIEA 1I5QA 2R9XA 1LT0A 2BASA 3M6HA 3FKVA 1G5UA 1T1AA 3F1OA 5M1AA 5A90A 5HD3A 5I5LA 4MN7A 2GDNA 2VGLM 5HL6A 1S66L 3BLSA 4HY8A 2QJ7A 1XJ2A 3MZEA 2L0WA 4N92A 3MFXA 1W7FA 5FDSA 5HARA 5EFWA 3W8KA 4IVIA 3ZG8B 5GLDA 3O5YA 2Y2NA 2G7UA 5E2HA 2HP5A 3PBSA 2EX2A 2HDSA 5DKKA 1K56D 2Y2QA 2YKFA 4R6LA 1FR1A 2LB5A 3ZQ5A 2PU2A 3MJQA 4LGWA 1K4FA 2PHYA 4HNBA 2ZQ7A 1DRMA 2EFUA 4ZAMA 5L2FA 4ID4A 2OV5A 1N9LA 4LV0A 2EA9A 1L0EA 3ZVWA 3V3RA 4EQ1A 1LI0A 1BTLA 2W1TA 1TEMA 5DFYA 4MN5A 5TFQA 4Z9QA 4M3KA 5CECA 4MBKA 3VE4A 3VP3A 2VKSA 3AGDA 1WE4A 5EV0A 2KLIA 3N6IA 5CGSA 3MZDA 1CQAA 2EX6A 2OWJA 2YKHA 3OPLA 5KZHA 4WELA 1GHPA 3JYIA 3UPNA 2FFFB 1CF0A 1T18A 3G31A 2GZAA 2GJ3A 2VGJA 2V1ZA 3HLFA 4Y0UA 4HBUA 3E4PA 5HDDA 4GN2A 3S22A 4ZJ1A 3C4PA 3NDGA 3P09A 3PBTA 2JBFA 4BD0A 1YAXA 4JKTA 1SZVA 4Y5FA 4WZ5C 4K0XA 1D7EA 2ZMAA 5CHUA 3IXGA 5F68A 4FH4A 4LENA 4KG5A 1K57A 2I72A 1OJ5A 4S2NC 2WGIA 3PAGA 4OONA 4GNUA 4UQIM 2XROA 2ZMVA 4PPRA 2XD1A 3MXRA 2B5RA 3UB8A 3CLOA 4NKPA 5HPIA 4N1XA 1L0GA 2B18A 1OMEA 4OOLA 3S7QA 1O7EA 3HUMA 2VK3A 2ZBBA 3VOZA 3D72A 3IF6B 4KZ8A 3LIFA 3L7HA 4QB8A 3KSIA 2XFSA 4BENA 2WYXA 4DE0A 4UA9A 5L8MA 4HQAA 3K3CA 3T12B 3IHAA 1PIOA 3Q82A 5DF8A 2JKRI 4KUKA 3IX4A 4OQ0A 3QP1A 5L10A 3MR0A 2EXBA 3GDIA 2ZOIA 3WS4A 2WADA 4OPQA 3NJAA 4HOIA 1Z6FA 3OLOA 5KSCA 5F6AA 3IT9A 1KGFA 1YSQA 3NOTC 3QHYA 5TJJA 3MSHA 4K08A 2Y59A 3G35A 4C6YA 2O0YA 2W3HA 3IX3A 4QY5A 3BFGA 1TS8A 4OVDA 3LICA 3V5MA 4MDZA 3KYEA 2DRWA 5FQKA 5CEDA 3CJMA 4BL3A 2J3TC 4I3IA 3PBOA 2ZC6B 3UO9A 1NLYA 2VJWA 3IBJA 2PT7A 5E2EA 1LL8A 2HJEA 2HDUA 3UB5P 1HLUP 3RFBA 2XA7M 2XK1A 3P98A 4R4SA 3EEAA 1STZA 3LIBA 1LSXA 4OOMA 2RCXA 3FC7A 4WZ5A 3UE3A 1HVBA 4KZBA 5HPFA 4K0WA 3NCKA 1KDSA 1DJAA 3HUNA 1BULA 4L9GA 1PZPA 4NXEA 1MWSA 2P9VB 1K38A 5AQBA 5HFOA 2Y91A 2WKEA 3A3IA 4RYEA 4EESA 1JVJA 4RX2A 4JXWA 4PAUA 3D9YA 4O7DA 5HDSA 4HIAA 3CITA 3L9KA 3UB6A 3NBLA 5FQ9A 1DY6A 2VV8A 2KDKA 4MNRA 1MWTA 3UE0A 2V1AA 4E3MA 3R7WA 3C4OA 3BRMA 3UB9A 5EVIA 4WN5A 5BOHA 3T50A 4F3LB 1K25A 5F69A 4DE3A 2IWBA 1JWPA 1S67L 4MBFA 4EERA 2XH9A 5F82A 3UPOA 3SH7A 3DW0A 3RJUA 1OTBA 4O8GA 5E43A 1IOUA 4CJNA 4NG2A 3WWXA 3SZTA 3LIAA 4EUZA 4GD8A 3A3FA 1NJ4A 1E25A 4HP4A 1DP9A 1X0OA 5M19A 4B93A 4X56A 3LUQA 2JN7A 4L9EA 4M4XA 1WYBA 2V0WA 1GSWA 1YLPA 1OTAA 4ETZA 5G18A 2V8CA 2UV0E 5I94A 1FQGA 2HZ5A 4Q0JA 1H8MA 4KG6A 4NXGA 3T1XA 2XLNA 1IYSA 1TS7A 4KENB 5F1GA 5J7EA 1GSVA 2P08A 2XDMA 1VEUB 2ZC7A 2VLGA 1MXOA 2PAVP 3UDIA 4HH3A 1SKFA 1N9OA 2M1CA 3TG9A 2Z6DA 3A0RA 2XFTA 5CEBA 2C6WB 3N8LA 1A0KA 3EGXC 4JF6A 5A92A 4O01A 4JGRA 3FYZA 2PR5A 4GDBA 1YLJA 4E3JA 2R78A 1V9YA 3QP2A 4PHTA 4E3OA 3HREA 2J3WA 2UWXA 4DDYA 2BTFP 1FR6A 4PM9A 2CMNA 4OP5A 4JPMA 5AJGA 4DMZA 2WGVA 2Q0OA 4B4XA 3DTKA 1NLZA 3RTYA 4G3WA 4ZRRA 2A2LA 4OPYA 1M6KA 4S2OA 3NHQA 1K56A 4QU3A 1ZC2A 3BFFA 1T1BA 4LLOB 4X53A 4Y15A 4UAAA 5EVEA 3T4LA 4KZ6A 4YINA 5G4YA 3I7JA 2L1MA 2PRFA 4JF4A 4DDSA 1JTDA 1PZOA 3HLDA 4G3KA 3ITBA 3HJIA 1W63M 3IHBA 4ARZA 1BYWA 3K3DA 1ONHA 1W8QA 4CQHA 3B47A 5IT5A 2QZ6A 3SS3A 3BECA 4HESA 4YFMA 3IH9A 3B3XA 4HP9A 4WYYA 3UE1A 4UHUA 4CLCD 1E3UA 2INWA 2MJ6A 3CAXA 3ICYA 3VP1A 4Z1WA 5HAPA 3MXSA 4JLFA 3NI9A 3PXPA 3GQZA 2VEAA 2JCHA 2V9AA 4L0LA 2M7UA 4QWOA 4LRYC 5AQ7A 1TDLA 1YLTA 5FAOA 4UA6A 3OPPA 4X1LA 3A0SA 5HWTA 3BFCA 2QJ5A 2IWCA 1YLYA 4DXBA 4EWFA 4S2PA 1KE0A 3FKWA 5JYOA 3UDXA 2OOLA 4A5RA 2Q9MA 2XGNA 5D3OA 5MC7A 3OCLA 4I3AA 4GLQA 3A3DA 3ZNTA 2J8YA 3BEBA 5AVFA 2FFYA 2PD7A 5GHXA 1LSVA 3F1NB 2A3UA 3F1NA 4BBUA 4GCZA 1O07A 4N9KA 3E98A 1H3QA 3T1RA 2QPNA 1PYYA 3TSGA 3HLCA 3NULA 5TGFA 2JKGA 5FI2A 3IF6C 2Y8HA 5FATA 3CUEC 5HZHA 5AVEA 5LBRA 4LV1A 4JGOA 2XRNA 4OP8A 3MZFA 5AQAA 2JKFA 3VP2A 3V67A 3HLBA 3SOIA 2Y79A 2W3GA 1JWZA 3DWZA 4EUVA 1EI5A 1KGGA 3EGDC 2OWHA 3QP5A 1LI9A 4LV3A 5FAQA 4GD6A 3LR5A 1JTGA 1ZKJA 4S2LA 1ODVA 3ZHHA 4OPZA 4HJ3A 4EU0A 3IS2B 2ZC4B 1KVLA 4S2KA 2A24B 4P6ZS 5CTMA 3ISGA 4HI4A 3QP4A 1KOUA 1YMSA 3BW6A 3H7WB 1H5XA 2D01A 1C3BA 1EWZA 3E4OA 4ZDXA 3PYPA 3LCEA 2WAEA 3CZDA 2X02A 1XA1A 4EXOA 4JXSA 2GNXA 3LR4A 2Y2LA 5HAIA 1BLSA 1NYYA 1CI9A 2JC7A 1FIKA 3M2JA 1XKZA 3AGFA 5IHVA 3OPRA 2HV1A 2XSSA 4B88A 4WEJA 4UQIS 3HLGA 4HEFA 1MY8A 2ACGA 4EBLA 1Q2QA 4DKIA 3S7NA 1RGZA 3BQAA 3WS2A 2E8IA 1KE4A 4HJ6A 5EE8A 1BSGA 3C8CA 4HHDA 5GHYA 1Y28A 4I3JA 3C30A 3VSLA 3NC8A 4WBGA 4XT2B 4X25A 4XT2A 4WM9A 3S7OA 1Y4OA 3IF6A 3CUEA 4OKPA 4I5SA 4OH0A 3LIDA 1ESUA 3VP4A 5HSQA 1S1ZA 2Z6CA 1XFQA 2W1RA 3FWLA 3LEZA 2DNSA 1ERMA 1LL5A 1VHMA 3DTMA 3VSKA 4AFIA 2ZL1B 1IYOA 1ACFA 2QHKA 2WUQA 3GECA 1CEFA 1UWPX 3N8SA 4Y3IA 3WRZA 3IXDA 3IWQA 4LFUA 3OPHA 3HUOA 3HL9A 2Y2OA 5CXWA 3LY3A 3ZG5A 3OBFA 4HH2A 4CLCE 4EEUA 3TE8A 4EV4A 4CLCC 4YWZA 1PFLA 1OT6A 5GL9A 2Z2MB 2R9WA 1EROA 4ZBEA 2WKQA 2JKRM 1MZUA 4IVKA 1LL9A 1QMFA 1G6AA 1PI4A 2ZM0A 3S7PA 4WUJA 3W4QA 1YLZA 3T4OA 4WL9A 4R38A 4MBHA 3KYZA 2J9OA 2K2NA 2EFXA 2VV7A 2W3DA 1K6RA 3GTCA 3BFEA 1MWRA 4RA7A 4IBRA 2G2UA 4BD1A 4E6WA 5FL3A 5CRFA 3HJKA 3SS4A 2KX6A 2EX8A 5CTNA 2Y2MA 5KSHA 3IXBA 4F94A 1ZG6A 3KSGA 3EQUA 2VA0A
chains in the Genus database with same CATH topology
3T4KA 3EGXC 2VZWA 3F1PB 3F1PA 2HF6A 3B33A 3C2WA 4O01A 4JGRA 3W2ZA 2PR5A 2R78A 3KSHA 2OAQ1 2OAP1 1V9YA 1OPXA 2PR6A 3LIEA 4PHTA 2PYPA 4IJGA 1ZTUA 2J3WA 2M7VA 3TW8A 1LT0A 3T4TA 2BASA 4Q0HA 4LRXC 3IBRA 2P04A 2CMNA 4IUKA 1T1AA 3F1OA 5AJGA 4DMZA 5HD3A 5I5LA 3BJNA 4MN7A 2B02A 2VGLM 5HL6A 1S66L 1NLZA 3RTYA 4G3WA 4ZRRA 4HY8A 2QJ7A 3KX0X 2A2LA 1XJ2A 2L0WA 3MFXA 4F3LA 3NHQA 3FPVA 5EFWA 1XJ4A 1P9RA 1YKDA 2FZ0A 2NUTC 4EEPA 2H28A 1T1BA 4NXFA 4LLOB 4MMNA 4L9FA 3O5YA 1DP8A 4EW7A 3T4LA 2G7UA 2L4RA 4B9OA 1NRJA 2LB9A 5G4ZA 5DJUA 3PBSA 2P7JA 5G4YA 2L1MA 5DKKA 3P01A 3UMDA 2YKFA 4R6LA 3ZQ5A 2LB5A 4GJ4A 2O9AA 4CLCB 4JGQA 4MCWA 3MJQA 4G3KA 2PHYA 4HNBA 3HJIA 4KQDA 1W63M 3E0YA 4DJ3A 5J4EA 1DRMA 5KIZA 3JVVA 3CWFA 4NXBA 4ARZA 1BYWA 4Q0IA 3KO6A 1N9LA 3K3DA 4UEYA 4CQHA 1TS0A 3B47A 2EA9A 5TBMB 5IT5A 2PDRA 3PBRA 2W0NA 3B42A 4II7A 4HP9A 4EQ1A 2W3EA 2W1TA 4CLCD 5DFYA 4MN5A 4I38A 2MJ6A 2INWA 3LYXA 3VE3A 4BWIA 3CAXA 3ICYA 4Z1WA 3VE4A 2VKSA 2KLIA 3PXPA 5IS1A 3LR0A 2VEAA 2V9AA 2DMWA 3T4QA 1IFQA 2HGVA 3LFVA 3KSFA 2OWJA 4L0LA 2YKHA 2XA7S 2M7UA 3JVUA 4WELA 4RQ9A 1NWZA 4LRYC 1UGUA 1T18A 2J80A 1XJ3A 2GZAA 2GJ3A 3BY8A 5DFXA 2FH5A 1OTIA 3E4PA 5HDDA 3A0SA 5HWTA 4GHIB 5HWWA 3C38A 2QJ5A 4E04A 2JKTM 3DBAA 1P97A 3PBTA 3KSGA 3LR3A 1YAXA 2PYRA 5DJTA 2OOLA 3H9WA 4KQOA 4Y5FA 4Y2FA 5DKLA 3NOUC 4BBTA 1D7EA 3R4KA 5F68A 5MC7A 3EEHA 1XFNA 3MMHA 3OCLA 4I3AA 1OJ5A 4GLQA 4PKYG 1T19A 2ZOHA 3U2AA 3P7NA 5AVFA 4UQIM 2XROA 1ZHHB 1JNUA 2QWSA 4GS9B 3PBNA 2ZMVA 5K5BA 2PD7A 2JHEA 2GX5A 4I39A 3UB8A 3T4JA 1LSVA 3CLOA 5CX7A 4NKPA 5HPIA 3F1NB 3F1NA 4HJ4A 4BBUA 4GCZA 3MQOA 1W63Q 2B18A 4OOLA 1DP6A 3S7QA 3E98A 1S1YA 3MQ0A 1H3QA 4YNRA 2ZBBA 3D72A 3R7WB 3LIFA 1OT9A 2Y8HA 5F5YA 3CUEC 2EWWA 5HZHA 3KSIA 4PKYA 2O9BA 2QKPA 5AVEA 5LBRA 1V9ZA 4JGOA 2PD8A 5L8MA 4HQAA 3K3CA 2XRNA 2D02A 4CLCA 2V1BA 3V67A 4WEKA 2Y79A 2JKRI 4JGPA 3A0VA 2W3GA 3BWLA 4KUKA 4EUVA 3PR6A 4IUHA 3MR0A 3EGDC 2OWHA 3GDIA 2ZOIA 2QYBA 5TBMA 3NJAA 3TJZC 1UWNX 4HOIA 1OTDA 1GSXA 3OLOA 1S4RA 3LR5A 4DJ2A 5F6AA 1MKMA 3UE6A 1ODVA 3LI9A 1TD5A 4HJ3A 4EU0A 2O9CA 4H6JB 3IS2B 4H6JA 1YSQA 3NOTC 5TJJA 4EETB 4K08A 2O0YA 2W3HA 4FOFA 2K7SA 2A24B 4P6ZS 5DF9A 5IU1A 1TS8A 2O99A 3LICA 4QPRA 4MDZA 3OC2A 4HI4A 1KOUA 4WF0A 2J3TC 2JKTI 3BW6A 3MXQA 3PBOA 4I3IA 4NEED 5HD5A 1NLYA 3H7WB 2VJWA 3H82B 3IBJA 4O0PA 2D01A 1OTEA 3D3OA 1F5MA 3E4OA 2K31A 2PT7A 3PYPA 4DN0A 1LL8A 2HJEA 3TRCA 1F9IA 1VB6A 4GHIA 4IHQA 3EOIA 3RFBA 3BY9A 2XA7M 3PHYA 1G28A 4EXOA 3EEAA 1STZA 2GNXA 3LIBA 1LSXA 3LR4A 1F98A 4OOMA 3FC7A 1TF1A 2WKRA 3OCNA 3FPWA 3UE3A 1P9WA 3VV4A 3KYQA 5HPFA 2ZMFA 3EWKA 4R70A 3ZYTA 2HV1A 4L9GA 4NXEA 2XSSA 3RH8B 2VGLS 4WEJA 2IA2A 4UQIS 4EESA 4GS9A 1MC0A 1T1CA 3S7NA 3SW1A 3BQAA 4PAUA 3LI8A 5HDSA 4HIAA 3CITA 4HJ6A 1LSWA 2W27A 3UB6A 3F1OB 3C8CA 2W3FA 4HHDA 1N9NA 1Y28A 4I3JA 1G6OA 3C30A 4BMWA 2VV8A 2KDKA 5C5KA 3VOLA 4XT2B 4XT2A 3S7OA 3T4SA 2V1AA 5A8BA 3R7WA 2I9VA 3CUEA 3MQQA 5HDCA 4I5SA 3UB9A 4WN5A 3LIDA 4GW9A 3T50A 5HSQA 3UB7A 4F3LB 1S1ZA 2Z6CA 1XFQA 2WKPA 2W1RA 3PBQA 5F69A 3EQVA 4ME4A 4WLAA 5J3WA 2EWVA 1S67L 4FSFA 4EERA 1VHMA 4LRZE 4AFIA 1OJGA 2QHKA 1OTBA 3GECA 4O8GA 3UMEA 1IOUA 1UWPX 4LPZA 4Y3IA 2NUPC 1S4SA 3LIAA 3OBFA 4HH2A 4CLCE 4EEUA 3TE8A 4HP4A 1DP9A 4CLCC 1X0OA 4YWZA 3K2NA 4B93A 3CI6A 3LUQA 3FG8A 2JN7A 1OT6A 2VV6A 3G6OA 1TS6A 1WA9A 1P0ZA 3IS2A 4L9EA 4ARZB 2VX8A 4M4XA 2V0WA 1GSWA 2HJ9C 2KOIA 3E4QA 3ULFA 1OTAA 4ETZA 2WKQA 3BQ8A 2JKRM 1MZUA 2A24A 4Q0JA 1H8MA 3MF0A 3S7PA 4NXGA 4WUJA 3HCYA 3T4OA 1YSPA 2W1TB 4ETXA 1TS7A 4WL9A 4R38A 1D06A 5J7EA 1GSVA 2P08A 3KYZA 2V0UA 2VLGA 2K2NA 3NOPC 4G3VA 3H7WA 3H82A 4HH3A 2VV7A 2W3DA 1N9OA 2M1CA 4YOFA 4KUOA 4P6ZM 5FL3A 5HWVA 3HJKA 4BBVA 2KX6A 1EW0A 2Z6DA 3A0RA 4R3AA 5KSHA 4MN6A 3OOVA 4BJPA 1XJ6A 3EQUA 2VA0A 2J3TD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F1P B;  3F1P A;  3B33 A;  3C2W A;  4JGR A;  2PR5 A;  2R78 A;  1V9Y A;  3LIE A;  2PR6 A;  2PYP A;  1LT0 A;  2BAS A;  4LRX C;  3IBR A;  2CMN A;  1T1A A;  3F1O A;  5HD3 A;  5I5L A;  2B02 A;  1S66 L;  3RTY A;  4HY8 A;  2QJ7 A;  3KX0 X;  1XJ2 A;  2L0W A;  3MFX A;  4F3L A;  3NHQ A;  5EFW A;  1XJ4 A;  4EEP A;  2H28 A;  1T1B A;  4NXF A;  4LLO B;  4L9F A;  1DP8 A;  4EW7 A;  2L4R A;  4B9O A;  5G4Z A;  5DJU A;  2P7J A;  5G4Y A;  2L1M A;  5DKK A;  3UMD A;  2YKF A;  4R6L A;  3ZQ5 A;  4JGQ A;  3MJQ A;  2PHY A;  4HNB A;  3HJI A;  4KQD A;  4DJ3 A;  5J4E A;  1DRM A;  5KIZ A;  3CWF A;  4NXB A;  1BYW A;  1N9L A;  3K3D A;  1TS0 A;  2EA9 A;  5TBM B;  2PDR A;  2W0N A;  4HP9 A;  4EQ1 A;  4MN5 A;  4I38 A;  3LYX A;  2INW A;  3VE3 A;  3CAX A;  3ICY A;  3VE4 A;  5IS1 A;  2VEA A;  2V9A A;  2OWJ A;  2YKH A;  4RQ9 A;  1NWZ A;  4LRY C;  1UGU A;  1T18 A;  2J80 A;  1XJ3 A;  2GJ3 A;  3BY8 A;  1OTI A;  3E4P A;  5HDD A;  3A0S A;  5HWT A;  4GHI B;  5HWW A;  2QJ5 A;  4E04 A;  1P97 A;  2PYR A;  5DJT A;  2OOL A;  3H9W A;  5DKL A;  3NOU C;  4BBT A;  1D7E A;  5F68 A;  3EEH A;  1XFN A;  4I3A A;  1OJ5 A;  4PKY G;  1T19 A;  2ZOH A;  3P7N A;  5AVF A;  1JNU A;  2QWS A;  4GS9 B;  2PD7 A;  2JHE A;  4I39 A;  3UB8 A;  1LSV A;  3CLO A;  3F1N B;  3F1N A;  4HJ4 A;  4BBU A;  4GCZ A;  3MQO A;  1DP6 A;  1S1Y A;  2ZBB A;  3D72 A;  3LIF A;  1OT9 A;  5F5Y A;  5HZH A;  4PKY A;  5AVE A;  2QKP A;  1V9Z A;  4JGO A;  2PD8 A;  4HQA A;  3K3C A;  2D02 A;  2V1B A;  4JGP A;  3A0V A;  3BWL A;  4KUK A;  3MR0 A;  2OWH A;  3GDI A;  2ZOI A;  5TBM A;  3NJA A;  1UWN X;  4HOI A;  1OTD A;  1GSX A;  3OLO A;  1S4R A;  4DJ2 A;  5F6A A;  3UE6 A;  1ODV A;  3LI9 A;  4HJ3 A;  4H6J B;  3IS2 B;  4H6J A;  3NOT C;  4EET B;  4K08 A;  2K7S A;  2A24 B;  5IU1 A;  1TS8 A;  3LIC A;  4HI4 A;  1KOU A;  4WF0 A;  3MXQ A;  4I3I A;  5HD5 A;  3H7W B;  3H82 B;  2D01 A;  1OTE A;  3E4O A;  3PYP A;  1LL8 A;  1F9I A;  1VB6 A;  4GHI A;  3BY9 A;  3PHY A;  1G28 A;  4EXO A;  3LIB A;  1LSX A;  1F98 A;  3FC7 A;  2WKR A;  3EWK A;  4R70 A;  2HV1 A;  4L9G A;  4NXE A;  3RH8 B;  4EES A;  4GS9 A;  1T1C A;  3SW1 A;  3LI8 A;  5HDS A;  4HIA A;  4HJ6 A;  1LSW A;  2W27 A;  3UB6 A;  3F1O B;  3C8C A;  4HHD A;  1N9N A;  1Y28 A;  4I3J A;  2VV8 A;  2KDK A;  3VOL A;  4XT2 B;  4XT2 A;  2V1A A;  5A8B A;  2I9V A;  3MQQ A;  5HDC A;  4I5S A;  3UB9 A;  4WN5 A;  3LID A;  4GW9 A;  3T50 A;  5HSQ A;  3UB7 A;  4F3L B;  1S1Z A;  2Z6C A;  1XFQ A;  2WKP A;  5F69 A;  4WLA A;  5J3W A;  1S67 L;  4EER A;  4LRZ E;  1OJG A;  2QHK A;  1OTB A;  3GEC A;  3UME A;  1UWP X;  4LPZ A;  1S4S A;  3LIA A;  4HH2 A;  4EEU A;  4HP4 A;  1DP9 A;  1X0O A;  4YWZ A;  3LUQ A;  3FG8 A;  2JN7 A;  1OT6 A;  2VV6 A;  3G6O A;  1TS6 A;  1WA9 A;  1P0Z A;  3IS2 A;  4L9E A;  4M4X A;  2V0W A;  1GSW A;  3E4Q A;  3ULF A;  1OTA A;  2WKQ A;  1MZU A;  2A24 A;  4NXG A;  4WUJ A;  1TS7 A;  4WL9 A;  4R38 A;  1D06 A;  5J7E A;  1GSV A;  2V0U A;  2VLG A;  3NOP C;  3H7W A;  3H82 A;  4HH3 A;  2VV7 A;  1N9O A;  2M1C A;  4KUO A;  5HWV A;  3HJK A;  4BBV A;  2KX6 A;  1EW0 A;  2Z6D A;  3A0R A;  4R3A A;  4MN6 A;  1XJ6 A; 
#chains in the Genus database with same CATH topology
 3T4K A;  4KZ9 A;  5EOO A;  3C2W A;  4S2N A;  3BFD A;  3KSH A;  2OAQ 1;  1OPX A;  3E2L A;  2EX9 A;  2P9V A;  2PYP A;  3Q7Z A;  4UA7 A;  3Q7V B;  4GB7 A;  4GZB A;  1D1J A;  3IBR A;  5FA7 A;  1VM1 A;  4ZTK A;  4MEZ A;  3ZVT A;  5KMW A;  2Y55 A;  4JF5 A;  3BJN A;  3ZGA B;  5A91 A;  4WZ4 A;  5DTS A;  5HL1 A;  1CI8 A;  2CC1 A;  4IED A;  1PRQ A;  1FSY A;  3DWK A;  3G2Y A;  4F3L A;  1GHM A;  2HDQ A;  5CGX A;  1FCO A;  1XJ4 A;  3G30 A;  3UPP A;  3M2K A;  3GRJ A;  1YKD A;  2FZ0 A;  1IKI A;  4EEP A;  1BLP A;  3Q81 A;  1KDW A;  4NXF A;  3DAV A;  4MMN A;  2ZQ9 A;  4EW7 A;  4FTX A;  2L4R A;  4B9O A;  1ES3 A;  5G4Z A;  5DJU A;  3LY4 A;  1FCM A;  2J9P A;  3P01 A;  4GJ4 A;  3UDF A;  4CLC B;  4JGQ A;  1N4O A;  3E0Y A;  4DJ3 A;  4U0X A;  2Z2L B;  5KIZ A;  4X55 A;  3JVV A;  3CWF A;  4FCF A;  4NXB A;  1GA0 A;  4Q0I A;  4OLG A;  3UY6 A;  4RVA A;  1J3W A;  5TBM B;  3GV9 A;  1IYP A;  1NY0 A;  3ZG7 B;  2WGW B;  2XR0 A;  1S6R A;  3N4I A;  1VEU A;  4I38 A;  3LYX A;  3VE3 A;  4BWI A;  4OOY A;  5FI6 A;  1Z09 A;  4QHC A;  4R1G A;  1ES4 A;  3SS5 A;  3W4P A;  5HAQ A;  3LR0 A;  1ZG4 A;  2WZX A;  3T4Q A;  1TVF A;  3KSF A;  3LFV A;  3JVU A;  3BYD A;  1NWZ A;  4RQ9 A;  1VQQ A;  3MKE A;  1PI5 A;  1SDN A;  2J80 A;  4Y0T A;  5DFX A;  4JXV A;  1W79 A;  5FAP A;  1TDG A;  1K6S A;  4GHI B;  2JKT M;  2WKH A;  2H0T A;  1SKO B;  1YLW A;  3LR3 A;  2PYR A;  3A3J A;  5DKL A;  4Y2F A;  4B4Z A;  1CJF A;  3R4K A;  3MBZ A;  1XFN A;  5FI7 A;  2ZOH A;  3P7N A;  1ZHH B;  2H5S A;  2QWS A;  4GS9 B;  5K5B A;  2JHE A;  4KQQ A;  2GX5 A;  2HP9 A;  3GVB A;  1L3L A;  1LLB A;  2P74 A;  3N8R A;  4HJ4 A;  1NYM A;  3MQO A;  1NRF A;  1W63 Q;  3SH9 A;  3O87 A;  4DE2 A;  4ZJ3 A;  5CHM A;  4OQI A;  3V39 A;  2ZQC A;  1FSW A;  2PBY A;  3NIA A;  4NET A;  1K55 C;  1KE3 A;  4PKY A;  2EWW A;  4KQR A;  1JWV A;  1V9Z A;  2PD8 A;  4OQH A;  2D02 A;  1BZA A;  4FD8 A;  1E4D A;  4WEK A;  3BWL A;  2WAF A;  3PR6 A;  4IUH A;  3DTE A;  2H10 A;  5EVI D;  4MLL A;  3TJZ C;  2HDR A;  1UWN X;  1HD8 A;  1MPL A;  1OTD A;  1GSX A;  4U3T A;  1FOF A;  1MKM A;  5GLA A;  3UE6 A;  2HPB A;  1L0F A;  1TD5 A;  1WYC A;  2O9C A;  4PM6 A;  2OSU A;  5FQM A;  3A3E A;  1NXY A;  5FEF A;  5L07 A;  2ZM2 A;  1XPB A;  4PM5 A;  4FOF A;  4E3N A;  2ZD8 A;  2K7S A;  5IU1 A;  5DF9 A;  1CK3 A;  2O99 A;  4QPR A;  2ZJ9 A;  2DCF A;  4LV2 A;  1ES2 A;  4DF6 A;  3LEQ A;  4WF0 A;  4C75 A;  4NEE D;  1HZO A;  2Y4A A;  3H82 B;  5U47 A;  1W8Y A;  1OTE A;  3D3O A;  3ZG9 B;  4JBF A;  4DN0 A;  1VET B;  3CPT B;  1VB6 A;  4IHQ A;  3EOI A;  3PHY A;  1G28 A;  3VFF A;  2Q9N A;  3OCN A;  2WKR A;  4R3B A;  2XD5 A;  2BLS A;  1BT5 A;  1P9W A;  3VV4 A;  3KYQ A;  4GDN A;  2ZMF A;  4R70 A;  1ONG A;  3ZYT A;  1MKI A;  4KZ3 A;  2VGL S;  2IA2 A;  5GLB A;  3TOI A;  5FAS A;  1CEG A;  1NZO A;  3QP8 A;  2C5W B;  2W27 A;  2Y2P A;  3F1O B;  2W3F A;  1N9N A;  1K57 C;  1G6O A;  4QJG A;  5CGW A;  3GSG A;  1XP4 A;  4N9L A;  2BG1 A;  3VFH A;  5A8B A;  2I9V A;  4ESP A;  1ESI A;  1K55 A;  2RL3 A;  2WKP A;  3QNC A;  3PBQ A;  4ME4 A;  1AWI A;  1YQS A;  5J3W A;  2PBD P;  2EWV A;  3GMW A;  5F83 A;  1OJG A;  2Y2G A;  4LPZ A;  3G34 A;  3G4P A;  1S4S A;  2ZC3 B;  1ERQ A;  4E6X A;  4KG2 A;  5FSR A;  4OPR A;  3CI6 A;  1RCJ A;  3FG8 A;  1K0K A;  2VV6 A;  4E3K A;  1TS6 A;  1WA9 A;  4Y17 A;  3IS2 A;  4DE1 A;  2HJ9 C;  2KOI A;  3RXX A;  3FZC A;  3ITA A;  1PW8 A;  3BQ8 A;  3VP0 A;  2A24 A;  3MF0 A;  4WMC D;  3LO7 A;  2XQZ A;  3HCY A;  2V20 A;  2A49 A;  1YSP A;  2W1T B;  1D06 A;  4D60 A;  3WS0 A;  2V0U A;  4CPK A;  4ZJ2 A;  3Q07 A;  3H7W A;  1SCW A;  3VMA A;  4K91 A;  4YOF A;  4Q8I A;  1KVM A;  3G32 A;  4P6Z M;  3IH8 A;  1MWU A;  5HWV A;  2ZQA A;  3IWI A;  3DTI A;  1S0W A;  4BBV A;  4R3A A;  1SHV A;  1M40 A;  3OOV A;  2AVX A;  4BQM A;  5A93 A;  1K54 C;  1XJ6 A;  5DTK A;  3V3S A;  3NDE A;  5DF7 A;  3F1P B;  3F1P A;  5DVA A;  1E3U D;  2HF6 A;  3B33 A;  3BM6 A;  3W2Z A;  3T1Q B;  1U60 A;  2OAP 1;  2PR6 A;  5EM0 A;  1FCN A;  5AQ9 A;  4GOG A;  4IJG A;  4LCM A;  1ZTU A;  2M7V A;  3TW8 A;  1Y54 A;  4Q0H A;  4LRX C;  1DJC A;  3C7V A;  1YT4 A;  4E3I A;  5CER A;  2P04 A;  4KZA A;  4IUK A;  1DJB A;  3M6B A;  2IWD A;  2B02 A;  1IEM A;  3S1Y A;  1XXM A;  3ZNY A;  4P0M A;  4S2J A;  2Y2I A;  4P85 A;  3KX0 X;  1YM1 A;  1XGI A;  3FPV A;  4DXC A;  1P9R A;  5FQJ A;  2NUT C;  3HVF A;  2H28 A;  2OLU A;  4QY6 A;  4L9F A;  1DP8 A;  2ZL1 A;  4R4R A;  5EVI C;  4EBN A;  1NRJ A;  4D2O A;  2LB9 A;  2Y2K A;  1GHI A;  2P7J A;  3NY4 A;  2WKI A;  3UMD A;  5EOE A;  2O9A A;  3O86 A;  4MCW A;  4Y7P A;  2PU4 A;  2H0Y A;  4OLD A;  4KQD A;  3ZDJ A;  2ZQ8 A;  1NZU A;  5J4E A;  3C5A A;  4PM7 A;  1PNE A;  3KO6 A;  4UEY A;  1TS0 A;  2PDR A;  1G68 A;  2ZQD A;  3PBR A;  2W0N A;  3B42 A;  4II7 A;  4LCL A;  2W3E A;  4Y13 A;  3CHW P;  3S4X A;  3E2K A;  5TR7 A;  5E2F A;  3C7U A;  2J7V A;  5IS1 A;  1HTZ A;  3U4L P;  2DMW A;  1IFQ A;  3W4O A;  2HGV A;  3T1S A;  2XA7 S;  1IYQ A;  3NEC A;  4C3Q A;  5FQQ A;  1UGU A;  1K54 A;  2B95 A;  1XJ3 A;  2X71 A;  5HX9 A;  3BY8 A;  5EPH A;  2FH5 A;  3WS5 A;  1I2W A;  1OTI A;  4FUW A;  5F1F A;  5HWW A;  3C38 A;  5FEG A;  4E04 A;  5J8X A;  3DBA A;  1MBL A;  5L09 A;  1P97 A;  2XF3 A;  4IBX A;  3IX8 A;  3Q7V A;  4R3J A;  5EUA A;  5DJT A;  3H9W A;  4KQO A;  3NOU C;  4BBT A;  4P87 A;  1PW1 A;  3EEH A;  3MMH A;  4PKY G;  2EXA A;  3N7W A;  1T19 A;  3U2A A;  1XGJ A;  1J9M A;  2WK0 A;  1JNU A;  3PBN A;  2WZZ A;  1BLH A;  4I39 A;  3T4J A;  5CX7 A;  3MS6 A;  4P6B A;  3D4F A;  4PMA A;  1H8Y A;  1DP6 A;  1PWG A;  1S1Y A;  3MQ0 A;  1SDE A;  4YNR A;  2VGK A;  3R7W B;  3AGE A;  4BLM A;  1OT9 A;  2E8J A;  5EVI B;  5F5Y A;  3JPU A;  1IEL A;  2ZC5 B;  3FV7 A;  2O9B A;  2QKP A;  3HBR A;  4N1H A;  4XUZ A;  2QMI A;  3QP6 A;  4CLC A;  3O3V A;  2V1B A;  1GA9 A;  4JGP A;  4X1M A;  3A0V A;  1F2K A;  5DTT A;  1L0D A;  1GCE A;  4FH2 A;  1ALQ A;  3IWO A;  2QYB A;  1W5D A;  5TBM A;  4U0T A;  4E3L A;  1S4R A;  4DJ2 A;  4R23 A;  2WGW A;  3CMZ A;  2JE5 A;  2OLV A;  4X68 A;  3LI9 A;  5E2G A;  4H6J B;  4H6J A;  4EET B;  1YMX A;  2ZLY A;  1ES5 A;  4R0Q A;  4RX3 A;  1I2S A;  3OC2 A;  4S2I A;  5EVL A;  2Y2J A;  3IXH A;  2JKT I;  3MXQ A;  4NK3 A;  5CHJ A;  5HD5 A;  1AXB A;  3G2Z A;  3ZG0 A;  4O0P A;  3ZFZ A;  4BL2 A;  3V50 A;  1F5M A;  2K31 A;  4GKU A;  3TRC A;  1F9I A;  4GHI A;  4XXR A;  3BY9 A;  1IKG A;  4KZ7 A;  1SKO A;  1F98 A;  1TF1 A;  3FPW A;  2HP6 A;  1FIL A;  4HBT A;  3EWK A;  3RXW A;  5GLC A;  5FDH A;  3RH8 B;  1PWC A;  3LGO A;  4GS9 A;  1MC0 A;  1T1C A;  5GHZ A;  3SW1 A;  4X69 A;  5EEC A;  3WS1 A;  1RP5 A;  4XUX A;  3LI8 A;  5M18 A;  1N9B A;  1LSW A;  2XEP A;  2X01 A;  4BMW A;  3WRT A;  5C5K A;  3VOL A;  2ZM8 A;  3T4S A;  1BUE A;  3MQQ A;  1XX2 A;  5HDC A;  4GW9 A;  3UB7 A;  3CG5 A;  3ZCZ A;  3EQV A;  4WLA A;  3BLM A;  4H8R A;  2V8F A;  3UN7 A;  3QNB A;  4FSF A;  1H8Z A;  4LRZ E;  3SH8 A;  3UNW A;  1K4E A;  1QME A;  3HLE A;  3UME A;  1BLC A;  4EQI A;  2NUP C;  4OQG A;  3IF5 A;  4JXG A;  3HLW A;  4DRT A;  5JYP A;  4WMC A;  3VOY A;  1H0M A;  3K2N A;  1L2S A;  2V2F F;  3PTE A;  3Q1F A;  5HW3 A;  3G6O A;  1P0Z A;  4S2M A;  4ARZ B;  2VX8 A;  3E4Q A;  4X6T A;  3ULF A;  4Y0O A;  3MFD A;  4PM8 A;  1XA7 A;  1Q2P A;  3O88 A;  4ETX A;  1KGE A;  4KZ4 A;  5FQI A;  3NOP C;  4G3V A;  3H82 A;  1RGY A;  4QD4 A;  2Y2H A;  3OZH A;  4KUO A;  1VET A;  3CPT A;  4KZ5 A;  4EBP A;  1EW0 A;  3GR2 A;  3PAE A;  4MN6 A;  5EM1 A;  4BJP A;  2G2W A;  3T4T A;  2J3T D;  2VZW A;  1YPR A;  1PWD A;  3IQA A;  3MKF A;  1LHY A;  3LIE A;  1I5Q A;  2R9X A;  1LT0 A;  2BAS A;  3M6H A;  3FKV A;  1G5U A;  1T1A A;  3F1O A;  5M1A A;  5A90 A;  5HD3 A;  5I5L A;  4MN7 A;  2GDN A;  2VGL M;  5HL6 A;  1S66 L;  3BLS A;  4HY8 A;  2QJ7 A;  1XJ2 A;  3MZE A;  2L0W A;  4N92 A;  3MFX A;  1W7F A;  5FDS A;  5HAR A;  5EFW A;  3W8K A;  4IVI A;  3ZG8 B;  5GLD A;  3O5Y A;  2Y2N A;  2G7U A;  5E2H A;  2HP5 A;  3PBS A;  2EX2 A;  2HDS A;  5DKK A;  1K56 D;  2Y2Q A;  2YKF A;  4R6L A;  1FR1 A;  2LB5 A;  3ZQ5 A;  2PU2 A;  3MJQ A;  4LGW A;  1K4F A;  2PHY A;  4HNB A;  2ZQ7 A;  1DRM A;  2EFU A;  4ZAM A;  5L2F A;  4ID4 A;  2OV5 A;  1N9L A;  4LV0 A;  2EA9 A;  1L0E A;  3ZVW A;  3V3R A;  4EQ1 A;  1LI0 A;  1BTL A;  2W1T A;  1TEM A;  5DFY A;  4MN5 A;  5TFQ A;  4Z9Q A;  4M3K A;  5CEC A;  4MBK A;  3VE4 A;  3VP3 A;  2VKS A;  3AGD A;  1WE4 A;  5EV0 A;  2KLI A;  3N6I A;  5CGS A;  3MZD A;  1CQA A;  2EX6 A;  2OWJ A;  2YKH A;  3OPL A;  5KZH A;  4WEL A;  1GHP A;  3JYI A;  3UPN A;  2FFF B;  1CF0 A;  1T18 A;  3G31 A;  2GZA A;  2GJ3 A;  2VGJ A;  2V1Z A;  3HLF A;  4Y0U A;  4HBU A;  3E4P A;  5HDD A;  4GN2 A;  3S22 A;  4ZJ1 A;  3C4P A;  3NDG A;  3P09 A;  3PBT A;  2JBF A;  4BD0 A;  1YAX A;  4JKT A;  1SZV A;  4Y5F A;  4WZ5 C;  4K0X A;  1D7E A;  2ZMA A;  5CHU A;  3IXG A;  5F68 A;  4FH4 A;  4LEN A;  4KG5 A;  1K57 A;  2I72 A;  1OJ5 A;  4S2N C;  2WGI A;  3PAG A;  4OON A;  4GNU A;  4UQI M;  2XRO A;  2ZMV A;  4PPR A;  2XD1 A;  3MXR A;  2B5R A;  3UB8 A;  3CLO A;  4NKP A;  5HPI A;  4N1X A;  1L0G A;  2B18 A;  1OME A;  4OOL A;  3S7Q A;  1O7E A;  3HUM A;  2VK3 A;  2ZBB A;  3VOZ A;  3D72 A;  3IF6 B;  4KZ8 A;  3LIF A;  3L7H A;  4QB8 A;  3KSI A;  2XFS A;  4BEN A;  2WYX A;  4DE0 A;  4UA9 A;  5L8M A;  4HQA A;  3K3C A;  3T12 B;  3IHA A;  1PIO A;  3Q82 A;  5DF8 A;  2JKR I;  4KUK A;  3IX4 A;  4OQ0 A;  3QP1 A;  5L10 A;  3MR0 A;  2EXB A;  3GDI A;  2ZOI A;  3WS4 A;  2WAD A;  4OPQ A;  3NJA A;  4HOI A;  1Z6F A;  3OLO A;  5KSC A;  5F6A A;  3IT9 A;  1KGF A;  1YSQ A;  3NOT C;  3QHY A;  5TJJ A;  3MSH A;  4K08 A;  2Y59 A;  3G35 A;  4C6Y A;  2O0Y A;  2W3H A;  3IX3 A;  4QY5 A;  3BFG A;  1TS8 A;  4OVD A;  3LIC A;  3V5M A;  4MDZ A;  3KYE A;  2DRW A;  5FQK A;  5CED A;  3CJM A;  4BL3 A;  2J3T C;  4I3I A;  3PBO A;  2ZC6 B;  3UO9 A;  1NLY A;  2VJW A;  3IBJ A;  2PT7 A;  5E2E A;  1LL8 A;  2HJE A;  2HDU A;  3UB5 P;  1HLU P;  3RFB A;  2XA7 M;  2XK1 A;  3P98 A;  4R4S A;  3EEA A;  1STZ A;  3LIB A;  1LSX A;  4OOM A;  2RCX A;  3FC7 A;  4WZ5 A;  3UE3 A;  1HVB A;  4KZB A;  5HPF A;  4K0W A;  3NCK A;  1KDS A;  1DJA A;  3HUN A;  1BUL A;  4L9G A;  1PZP A;  4NXE A;  1MWS A;  2P9V B;  1K38 A;  5AQB A;  5HFO A;  2Y91 A;  2WKE A;  3A3I A;  4RYE A;  4EES A;  1JVJ A;  4RX2 A;  4JXW A;  4PAU A;  3D9Y A;  4O7D A;  5HDS A;  4HIA A;  3CIT A;  3L9K A;  3UB6 A;  3NBL A;  5FQ9 A;  1DY6 A;  2VV8 A;  2KDK A;  4MNR A;  1MWT A;  3UE0 A;  2V1A A;  4E3M A;  3R7W A;  3C4O A;  3BRM A;  3UB9 A;  5EVI A;  4WN5 A;  5BOH A;  3T50 A;  4F3L B;  1K25 A;  5F69 A;  4DE3 A;  2IWB A;  1JWP A;  1S67 L;  4MBF A;  4EER A;  2XH9 A;  5F82 A;  3UPO A;  3SH7 A;  3DW0 A;  3RJU A;  1OTB A;  4O8G A;  5E43 A;  1IOU A;  4CJN A;  4NG2 A;  3WWX A;  3SZT A;  3LIA A;  4EUZ A;  4GD8 A;  3A3F A;  1NJ4 A;  1E25 A;  4HP4 A;  1DP9 A;  1X0O A;  5M19 A;  4B93 A;  4X56 A;  3LUQ A;  2JN7 A;  4L9E A;  4M4X A;  1WYB A;  2V0W A;  1GSW A;  1YLP A;  1OTA A;  4ETZ A;  5G18 A;  2V8C A;  2UV0 E;  5I94 A;  1FQG A;  2HZ5 A;  4Q0J A;  1H8M A;  4KG6 A;  4NXG A;  3T1X A;  2XLN A;  1IYS A;  1TS7 A;  4KEN B;  5F1G A;  5J7E A;  1GSV A;  2P08 A;  2XDM A;  1VEU B;  2ZC7 A;  2VLG A;  1MXO A;  2PAV P;  3UDI A;  4HH3 A;  1SKF A;  1N9O A;  2M1C A;  3TG9 A;  2Z6D A;  3A0R A;  2XFT A;  5CEB A;  2C6W B;  3N8L A;  1A0K A;  3EGX C;  4JF6 A;  5A92 A;  4O01 A;  4JGR A;  3FYZ A;  2PR5 A;  4GDB A;  1YLJ A;  4E3J A;  2R78 A;  1V9Y A;  3QP2 A;  4PHT A;  4E3O A;  3HRE A;  2J3W A;  2UWX A;  4DDY A;  2BTF P;  1FR6 A;  4PM9 A;  2CMN A;  4OP5 A;  4JPM A;  5AJG A;  4DMZ A;  2WGV A;  2Q0O A;  4B4X A;  3DTK A;  1NLZ A;  3RTY A;  4G3W A;  4ZRR A;  2A2L A;  4OPY A;  1M6K A;  4S2O A;  3NHQ A;  1K56 A;  4QU3 A;  1ZC2 A;  3BFF A;  1T1B A;  4LLO B;  4X53 A;  4Y15 A;  4UAA A;  5EVE A;  3T4L A;  4KZ6 A;  4YIN A;  5G4Y A;  3I7J A;  2L1M A;  2PRF A;  4JF4 A;  4DDS A;  1JTD A;  1PZO A;  3HLD A;  4G3K A;  3ITB A;  3HJI A;  1W63 M;  3IHB A;  4ARZ A;  1BYW A;  3K3D A;  1ONH A;  1W8Q A;  4CQH A;  3B47 A;  5IT5 A;  2QZ6 A;  3SS3 A;  3BEC A;  4HES A;  4YFM A;  3IH9 A;  3B3X A;  4HP9 A;  4WYY A;  3UE1 A;  4UHU A;  4CLC D;  1E3U A;  2INW A;  2MJ6 A;  3CAX A;  3ICY A;  3VP1 A;  4Z1W A;  5HAP A;  3MXS A;  4JLF A;  3NI9 A;  3PXP A;  3GQZ A;  2VEA A;  2JCH A;  2V9A A;  4L0L A;  2M7U A;  4QWO A;  4LRY C;  5AQ7 A;  1TDL A;  1YLT A;  5FAO A;  4UA6 A;  3OPP A;  4X1L A;  3A0S A;  5HWT A;  3BFC A;  2QJ5 A;  2IWC A;  1YLY A;  4DXB A;  4EWF A;  4S2P A;  1KE0 A;  3FKW A;  5JYO A;  3UDX A;  2OOL A;  4A5R A;  2Q9M A;  2XGN A;  5D3O A;  5MC7 A;  3OCL A;  4I3A A;  4GLQ A;  3A3D A;  3ZNT A;  2J8Y A;  3BEB A;  5AVF A;  2FFY A;  2PD7 A;  5GHX A;  1LSV A;  3F1N B;  2A3U A;  3F1N A;  4BBU A;  4GCZ A;  1O07 A;  4N9K A;  3E98 A;  1H3Q A;  3T1R A;  2QPN A;  1PYY A;  3TSG A;  3HLC A;  3NUL A;  5TGF A;  2JKG A;  5FI2 A;  3IF6 C;  2Y8H A;  5FAT A;  3CUE C;  5HZH A;  5AVE A;  5LBR A;  4LV1 A;  4JGO A;  2XRN A;  4OP8 A;  3MZF A;  5AQA A;  2JKF A;  3VP2 A;  3V67 A;  3HLB A;  3SOI A;  2Y79 A;  2W3G A;  1JWZ A;  3DWZ A;  4EUV A;  1EI5 A;  1KGG A;  3EGD C;  2OWH A;  3QP5 A;  1LI9 A;  4LV3 A;  5FAQ A;  4GD6 A;  3LR5 A;  1JTG A;  1ZKJ A;  4S2L A;  1ODV A;  3ZHH A;  4OPZ A;  4HJ3 A;  4EU0 A;  3IS2 B;  2ZC4 B;  1KVL A;  4S2K A;  2A24 B;  4P6Z S;  5CTM A;  3ISG A;  4HI4 A;  3QP4 A;  1KOU A;  1YMS A;  3BW6 A;  3H7W B;  1H5X A;  2D01 A;  1C3B A;  1EWZ A;  3E4O A;  4ZDX A;  3PYP A;  3LCE A;  2WAE A;  3CZD A;  2X02 A;  1XA1 A;  4EXO A;  4JXS A;  2GNX A;  3LR4 A;  2Y2L A;  5HAI A;  1BLS A;  1NYY A;  1CI9 A;  2JC7 A;  1FIK A;  3M2J A;  1XKZ A;  3AGF A;  5IHV A;  3OPR A;  2HV1 A;  2XSS A;  4B88 A;  4WEJ A;  4UQI S;  3HLG A;  4HEF A;  1MY8 A;  2ACG A;  4EBL A;  1Q2Q A;  4DKI A;  3S7N A;  1RGZ A;  3BQA A;  3WS2 A;  2E8I A;  1KE4 A;  4HJ6 A;  5EE8 A;  1BSG A;  3C8C A;  4HHD A;  5GHY A;  1Y28 A;  4I3J A;  3C30 A;  3VSL A;  3NC8 A;  4WBG A;  4XT2 B;  4X25 A;  4XT2 A;  4WM9 A;  3S7O A;  1Y4O A;  3IF6 A;  3CUE A;  4OKP A;  4I5S A;  4OH0 A;  3LID A;  1ESU A;  3VP4 A;  5HSQ A;  1S1Z A;  2Z6C A;  1XFQ A;  2W1R A;  3FWL A;  3LEZ A;  2DNS A;  1ERM A;  1LL5 A;  1VHM A;  3DTM A;  3VSK A;  4AFI A;  2ZL1 B;  1IYO A;  1ACF A;  2QHK A;  2WUQ A;  3GEC A;  1CEF A;  1UWP X;  3N8S A;  4Y3I A;  3WRZ A;  3IXD A;  3IWQ A;  4LFU A;  3OPH A;  3HUO A;  3HL9 A;  2Y2O A;  5CXW A;  3LY3 A;  3ZG5 A;  3OBF A;  4HH2 A;  4CLC E;  4EEU A;  3TE8 A;  4EV4 A;  4CLC C;  4YWZ A;  1PFL A;  1OT6 A;  5GL9 A;  2Z2M B;  2R9W A;  1ERO A;  4ZBE A;  2WKQ A;  2JKR M;  1MZU A;  4IVK A;  1LL9 A;  1QMF A;  1G6A A;  1PI4 A;  2ZM0 A;  3S7P A;  4WUJ A;  3W4Q A;  1YLZ A;  3T4O A;  4WL9 A;  4R38 A;  4MBH A;  3KYZ A;  2J9O A;  2K2N A;  2EFX A;  2VV7 A;  2W3D A;  1K6R A;  3GTC A;  3BFE A;  1MWR A;  4RA7 A;  4IBR A;  2G2U A;  4BD1 A;  4E6W A;  5FL3 A;  5CRF A;  3HJK A;  3SS4 A;  2KX6 A;  2EX8 A;  5CTN A;  2Y2M A;  5KSH A;  3IXB A;  4F94 A;  1ZG6 A;  3KSG A;  3EQU A;  2VA0 A; 
#chains in the Genus database with same CATH homology
 3T4K A;  3EGX C;  2VZW A;  3F1P B;  3F1P A;  2HF6 A;  3B33 A;  3C2W A;  4O01 A;  4JGR A;  3W2Z A;  2PR5 A;  2R78 A;  3KSH A;  2OAQ 1;  2OAP 1;  1V9Y A;  1OPX A;  2PR6 A;  3LIE A;  4PHT A;  2PYP A;  4IJG A;  1ZTU A;  2J3W A;  2M7V A;  3TW8 A;  1LT0 A;  3T4T A;  2BAS A;  4Q0H A;  4LRX C;  3IBR A;  2P04 A;  2CMN A;  4IUK A;  1T1A A;  3F1O A;  5AJG A;  4DMZ A;  5HD3 A;  5I5L A;  3BJN A;  4MN7 A;  2B02 A;  2VGL M;  5HL6 A;  1S66 L;  1NLZ A;  3RTY A;  4G3W A;  4ZRR A;  4HY8 A;  2QJ7 A;  3KX0 X;  2A2L A;  1XJ2 A;  2L0W A;  3MFX A;  4F3L A;  3NHQ A;  3FPV A;  5EFW A;  1XJ4 A;  1P9R A;  1YKD A;  2FZ0 A;  2NUT C;  4EEP A;  2H28 A;  1T1B A;  4NXF A;  4LLO B;  4MMN A;  4L9F A;  3O5Y A;  1DP8 A;  4EW7 A;  3T4L A;  2G7U A;  2L4R A;  4B9O A;  1NRJ A;  2LB9 A;  5G4Z A;  5DJU A;  3PBS A;  2P7J A;  5G4Y A;  2L1M A;  5DKK A;  3P01 A;  3UMD A;  2YKF A;  4R6L A;  3ZQ5 A;  2LB5 A;  4GJ4 A;  2O9A A;  4CLC B;  4JGQ A;  4MCW A;  3MJQ A;  4G3K A;  2PHY A;  4HNB A;  3HJI A;  4KQD A;  1W63 M;  3E0Y A;  4DJ3 A;  5J4E A;  1DRM A;  5KIZ A;  3JVV A;  3CWF A;  4NXB A;  4ARZ A;  1BYW A;  4Q0I A;  3KO6 A;  1N9L A;  3K3D A;  4UEY A;  4CQH A;  1TS0 A;  3B47 A;  2EA9 A;  5TBM B;  5IT5 A;  2PDR A;  3PBR A;  2W0N A;  3B42 A;  4II7 A;  4HP9 A;  4EQ1 A;  2W3E A;  2W1T A;  4CLC D;  5DFY A;  4MN5 A;  4I38 A;  2MJ6 A;  2INW A;  3LYX A;  3VE3 A;  4BWI A;  3CAX A;  3ICY A;  4Z1W A;  3VE4 A;  2VKS A;  2KLI A;  3PXP A;  5IS1 A;  3LR0 A;  2VEA A;  2V9A A;  2DMW A;  3T4Q A;  1IFQ A;  2HGV A;  3LFV A;  3KSF A;  2OWJ A;  4L0L A;  2YKH A;  2XA7 S;  2M7U A;  3JVU A;  4WEL A;  4RQ9 A;  1NWZ A;  4LRY C;  1UGU A;  1T18 A;  2J80 A;  1XJ3 A;  2GZA A;  2GJ3 A;  3BY8 A;  5DFX A;  2FH5 A;  1OTI A;  3E4P A;  5HDD A;  3A0S A;  5HWT A;  4GHI B;  5HWW A;  3C38 A;  2QJ5 A;  4E04 A;  2JKT M;  3DBA A;  1P97 A;  3PBT A;  3KSG A;  3LR3 A;  1YAX A;  2PYR A;  5DJT A;  2OOL A;  3H9W A;  4KQO A;  4Y5F A;  4Y2F A;  5DKL A;  3NOU C;  4BBT A;  1D7E A;  3R4K A;  5F68 A;  5MC7 A;  3EEH A;  1XFN A;  3MMH A;  3OCL A;  4I3A A;  1OJ5 A;  4GLQ A;  4PKY G;  1T19 A;  2ZOH A;  3U2A A;  3P7N A;  5AVF A;  4UQI M;  2XRO A;  1ZHH B;  1JNU A;  2QWS A;  4GS9 B;  3PBN A;  2ZMV A;  5K5B A;  2PD7 A;  2JHE A;  2GX5 A;  4I39 A;  3UB8 A;  3T4J A;  1LSV A;  3CLO A;  5CX7 A;  4NKP A;  5HPI A;  3F1N B;  3F1N A;  4HJ4 A;  4BBU A;  4GCZ A;  3MQO A;  1W63 Q;  2B18 A;  4OOL A;  1DP6 A;  3S7Q A;  3E98 A;  1S1Y A;  3MQ0 A;  1H3Q A;  4YNR A;  2ZBB A;  3D72 A;  3R7W B;  3LIF A;  1OT9 A;  2Y8H A;  5F5Y A;  3CUE C;  2EWW A;  5HZH A;  3KSI A;  4PKY A;  2O9B A;  2QKP A;  5AVE A;  5LBR A;  1V9Z A;  4JGO A;  2PD8 A;  5L8M A;  4HQA A;  3K3C A;  2XRN A;  2D02 A;  4CLC A;  2V1B A;  3V67 A;  4WEK A;  2Y79 A;  2JKR I;  4JGP A;  3A0V A;  2W3G A;  3BWL A;  4KUK A;  4EUV A;  3PR6 A;  4IUH A;  3MR0 A;  3EGD C;  2OWH A;  3GDI A;  2ZOI A;  2QYB A;  5TBM A;  3NJA A;  3TJZ C;  1UWN X;  4HOI A;  1OTD A;  1GSX A;  3OLO A;  1S4R A;  3LR5 A;  4DJ2 A;  5F6A A;  1MKM A;  3UE6 A;  1ODV A;  3LI9 A;  1TD5 A;  4HJ3 A;  4EU0 A;  2O9C A;  4H6J B;  3IS2 B;  4H6J A;  1YSQ A;  3NOT C;  5TJJ A;  4EET B;  4K08 A;  2O0Y A;  2W3H A;  4FOF A;  2K7S A;  2A24 B;  4P6Z S;  5DF9 A;  5IU1 A;  1TS8 A;  2O99 A;  3LIC A;  4QPR A;  4MDZ A;  3OC2 A;  4HI4 A;  1KOU A;  4WF0 A;  2J3T C;  2JKT I;  3BW6 A;  3MXQ A;  3PBO A;  4I3I A;  4NEE D;  5HD5 A;  1NLY A;  3H7W B;  2VJW A;  3H82 B;  3IBJ A;  4O0P A;  2D01 A;  1OTE A;  3D3O A;  1F5M A;  3E4O A;  2K31 A;  2PT7 A;  3PYP A;  4DN0 A;  1LL8 A;  2HJE A;  3TRC A;  1F9I A;  1VB6 A;  4GHI A;  4IHQ A;  3EOI A;  3RFB A;  3BY9 A;  2XA7 M;  3PHY A;  1G28 A;  4EXO A;  3EEA A;  1STZ A;  2GNX A;  3LIB A;  1LSX A;  3LR4 A;  1F98 A;  4OOM A;  3FC7 A;  1TF1 A;  2WKR A;  3OCN A;  3FPW A;  3UE3 A;  1P9W A;  3VV4 A;  3KYQ A;  5HPF A;  2ZMF A;  3EWK A;  4R70 A;  3ZYT A;  2HV1 A;  4L9G A;  4NXE A;  2XSS A;  3RH8 B;  2VGL S;  4WEJ A;  2IA2 A;  4UQI S;  4EES A;  4GS9 A;  1MC0 A;  1T1C A;  3S7N A;  3SW1 A;  3BQA A;  4PAU A;  3LI8 A;  5HDS A;  4HIA A;  3CIT A;  4HJ6 A;  1LSW A;  2W27 A;  3UB6 A;  3F1O B;  3C8C A;  2W3F A;  4HHD A;  1N9N A;  1Y28 A;  4I3J A;  1G6O A;  3C30 A;  4BMW A;  2VV8 A;  2KDK A;  5C5K A;  3VOL A;  4XT2 B;  4XT2 A;  3S7O A;  3T4S A;  2V1A A;  5A8B A;  3R7W A;  2I9V A;  3CUE A;  3MQQ A;  5HDC A;  4I5S A;  3UB9 A;  4WN5 A;  3LID A;  4GW9 A;  3T50 A;  5HSQ A;  3UB7 A;  4F3L B;  1S1Z A;  2Z6C A;  1XFQ A;  2WKP A;  2W1R A;  3PBQ A;  5F69 A;  3EQV A;  4ME4 A;  4WLA A;  5J3W A;  2EWV A;  1S67 L;  4FSF A;  4EER A;  1VHM A;  4LRZ E;  4AFI A;  1OJG A;  2QHK A;  1OTB A;  3GEC A;  4O8G A;  3UME A;  1IOU A;  1UWP X;  4LPZ A;  4Y3I A;  2NUP C;  1S4S A;  3LIA A;  3OBF A;  4HH2 A;  4CLC E;  4EEU A;  3TE8 A;  4HP4 A;  1DP9 A;  4CLC C;  1X0O A;  4YWZ A;  3K2N A;  4B93 A;  3CI6 A;  3LUQ A;  3FG8 A;  2JN7 A;  1OT6 A;  2VV6 A;  3G6O A;  1TS6 A;  1WA9 A;  1P0Z A;  3IS2 A;  4L9E A;  4ARZ B;  2VX8 A;  4M4X A;  2V0W A;  1GSW A;  2HJ9 C;  2KOI A;  3E4Q A;  3ULF A;  1OTA A;  4ETZ A;  2WKQ A;  3BQ8 A;  2JKR M;  1MZU A;  2A24 A;  4Q0J A;  1H8M A;  3MF0 A;  3S7P A;  4NXG A;  4WUJ A;  3HCY A;  3T4O A;  1YSP A;  2W1T B;  4ETX A;  1TS7 A;  4WL9 A;  4R38 A;  1D06 A;  5J7E A;  1GSV A;  2P08 A;  3KYZ A;  2V0U A;  2VLG A;  2K2N A;  3NOP C;  4G3V A;  3H7W A;  3H82 A;  4HH3 A;  2VV7 A;  2W3D A;  1N9O A;  2M1C A;  4YOF A;  4KUO A;  4P6Z M;  5FL3 A;  5HWV A;  3HJK A;  4BBV A;  2KX6 A;  1EW0 A;  2Z6D A;  3A0R A;  4R3A A;  5KSH A;  4MN6 A;  3OOV A;  4BJP A;  1XJ6 A;  3EQU A;  2VA0 A;  2J3T D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...