3OOVA

Crystal structure of a methyl-accepting chemotaxis protein, residues 122 to 287
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
164
structure length
164
Chain Sequence
QISSRIQKSIDVDEVLRLCAEGLHDVLGYERVNILMADTARTSLSFVAAVGTADFNPAGVVLPLDQRGGVITKCFTDRQVYMIDDVSAYPTDFRLQSPYDAIRALRSKSFVICPIVVKGEAIGVFAVDNRSSRRSLNDTDVDTIKLFADQASSAIVRINLLKAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Methyl-accepting chemotaxis protein, putative
publication title Crystal structure of a methyl-accepting chemotaxis protein, residues 122 to 287
rcsb
source organism Geobacter sulfurreducens
total genus 49
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3oovA00
4IJGA 4ETZA 4O01A 3KSGA 3OOVA 4FOFA 3MMHA 2W3FA 4G3WA 4PAUA 1ZTUA 2W1TA 3E98A 2VEAA 4MMNA 3E0YA 3KSFA 4RQ9A 2O0YA 2XRNA 3IBRA 3R4KA 4ME4A 4O8GA 2K2NA 2VZWA 2W3EA 2LB9A 2KLIA 4EUVA 5HPFA 5HL6A 3NOUC 4Y5FA 4MCWA 4R70A 4Y2FA 3LFVA 3NOPC 4EU0A 2W1TB 2O9AA 3KSIA 4YNRA 3KO6A 1YKDA 5I5LA 2HGVA 4MN7A 4LRYC 2W3DA 3S7OA 2O9CA 5LBRA 4LRZE 4IUKA 3TRCA 3KSHA 4GLQA 4YOFA 4MDZA 3C2WA 4Z1WA 3DBAA 2B18A 4QPRA 4CQHA 4IUHA 1MC0A 4Q0HA 3EEAA 1MKMA 3W2ZA 3MQ0A 2VJWA 2VKSA 5TJJA 2Y79A 3NHQA 3IBJA 3CI6A 1YSQA 3S7NA 5L8MA 4DN0A 5K5BA 2QYBA 4E04A 1TF1A 4Q0JA 1YSPA 2GX5A 5AJGA 4Y3IA 3BJNA 1VHMA 5C5KA 2LB5A 1STZA 5HSQA 3RFBA 3VV4A 4G3KA 3ZQ5A 5DFYA 3HCYA 2W1RA 2G7UA 2M7UA 4R6LA 4ZRRA 5HPIA 1F5MA 2Y8HA 2O99A 2ZMFA 3S7PA 4LRXC 3O5YA 4ETXA 3CITA 4O0PA 3OBFA 2W3GA 4GW9A 2M7VA 3S7QA 4BWIA 4DMZA 2W3HA 3NOTC 4G3VA 5DFXA 3K2NA 2KOIA 4Q0IA 1TD5A 3D3OA 2XROA 2OOLA 3MF0A 2K31A 2XSSA 3G6OA 2IA2A 2O9BA
chains in the Genus database with same CATH superfamily
2FFFB 1SKOA 4OVDA 4K91A 3MXQA 2ACGA 4K08A 4WBGA 1KE3A 3HREA 2VLGA 4WLAA 4L0LA 4KZ8A 2W3FA 2A49A 3DTEA 4X1MA 1CEGA 1W7FA 2XFTA 1KE4A 3DTKA 5GLCA 1K54A 2V0WA 4KZBA 3SS4A 1LL9A 2VGLM 3PYPA 2WAFA 3P09A 4FSFA 4JXVA 3B47A 1MWRA 2DNSA 4HJ3A 3KSIA 5I5LA 1UGUA 2WYXA 5DTSA 1E3UA 4EW7A 1O07A 1KOUA 3BECA 4OPZA 3CZDA 3F1OA 5EVEA 5CEDA 4UA6A 3EEAA 3ICYA 2VJWA 2VKSA 1YSQA 3PBQA 1XA7A 3KX0X 2NUTC 3DTMA 5CRFA 5CGSA 1BTLA 4B88A 3IXHA 1KE0A 3CMZA 1XXMA 4S2LA 2Y2OA 4FCFA 3UDIA 4R1GA 2HPBA 2M7UA 1ZG6A 3CJMA 2W3GA 2H0YA 2WUQA 5F5YA 3IF6A 1FCOA 5E43A 2JKRI 4HY8A 3T4KA 4OPQA 3NECA 4ARZB 1MXOA 3HLGA 4OP5A 4RX2A 2IA2A 2VX8A 2VV6A 4DE2A 4CLCB 3SH9A 4OQ0A 1LSWA 1TS0A 4NXEA 3PXPA 3ZG8B 3QP6A 2XRNA 3ZFZA 3R7WA 1ES2A 4ME4A 3UMEA 3GMWA 2P74A 4EXOA 2LB9A 3FKVA 3FWLA 4WUJA 1FCMA 3LFVA 2WAEA 4K0WA 4N9LA 5HDCA 3TSGA 3MSHA 4EU0A 1OMEA 5CERA 3S22A 3CUEA 3V50A 2JCHA 4BBTA 3UDFA 1A0KA 3KO6A 5FQQA 4DXBA 4FH2A 1WA9A 4BL3A 1JWVA 1ESUA 1DJCA 2AVXA 4GN2A 2JKRM 2OSUA 4HIAA 4GLQA 1DRMA 1W63M 1MZUA 4KZ5A 1BSGA 2A2LA 1EWZA 4LGWA 3GSGA 2ZOHA 3HLWA 4EWFA 5F69A 3VP0A 2GX5A 3CAXA 4E3NA 2W27A 1UWNX 3CHWP 4ESPA 4NEED 3EGXC 5EVLA 3CPTB 3G2ZA 1MWUA 4UQIM 1PW1A 3BY9A 1V9YA 4PHTA 4HOIA 3MFXA 4KQQA 4QHCA 5DFXA 3CG5A 4N1XA 1AWIA 3IS2B 3TE8A 2BLSA 2WKHA 1FCNA 5KMWA 4LCMA 3N7WA 1ES5A 2ZD8A 3N8LA 5DF7A 5GL9A 4PM5A 2RL3A 1MBLA 1NLYA 4ETZA 3PTEA 1LSVA 2Y4AA 1K55A 1XGJA 2JN7A 1Z09A 3HLEA 1BULA 1T18A 2VEAA 1RGZA 1IYQA 3IHAA 2JC7A 4MBHA 5IHVA 2PR5A 4M3KA 3H9WA 4O8GA 1F2KA 4ZJ3A 2L0WA 2OLVA 2ZOIA 2XFSA 3BFEA 1DY6A 1KGFA 3IWOA 3HUMA 3NOPC 5FSRA 4X69A 5HWTA 3LR3A 4JF4A 5FI7A 2HGVA 4LCLA 4LRYC 5DF9A 2J9OA 4I5SA 5IT5A 1NZOA 4S2NC 4KQOA 2Y2MA 2Y59A 3N8RA 4F3LB 3W4OA 5L2FA 1H8MA 2PYPA 2BASA 3HLCA 4KG5A 3VMAA 2FH5A 4NXBA 5L8MA 3ZYTA 2QYBA 1T19A 3H82A 5EV0A 1OTDA 3ISGA 1EW0A 1TDGA 2J3TC 1OTEA 3LR4A 5DFYA 3LI8A 3UB8A 2ZQ8A 2QHKA 4LRXC 5GLBA 5AVEA 5E2GA 3NOTC 4EESA 3DWKA 3D3OA 1MPLA 3PBSA 3HLDA 4JF5A 5EPHA 3MF0A 3T4TA 4GD8A 3MQOA 5DJUA 3F1NB 3RTYA 3A3DA 3ZCZA 4EV4A 1S4SA 5FQ9A 4E3LA 1XFNA 4R4RA 3UE6A 4PM7A 1L2SA 3W4QA 2XDMA 1L3LA 3LIAA 3G32A 4F94A 4RQ9A 2XA7M 1VB6A 3LY3A 3LI9A 2P04A 3GV9A 5HL6A 3PBRA 1U60A 3HVFA 1Q2QA 2QJ7A 1NYYA 4JPMA 3V67A 2XLNA 1YKDA 4RYEA 3D4FA 2GJ3A 2HV1A 1SHVA 4MN7A 5F6AA 3D9YA 2ZQ7A 4JGPA 3L7HA 5LBRA 1YPRA 1H8YA 4U0XA 2H5SA 1OT9A 3BM6A 4Z1WA 1VQQA 5FAOA 4QPRA 1SDNA 3VP2A 3OC2A 3W2ZA 5A91A 1FOFA 4YINA 3LIBA 3ZG9B 2I72A 2J7VA 4E04A 4OOYA 4HI4A 3O88A 1S6RA 1IEMA 2V8FA 2GNXA 5EVID 5EOEA 1K54C 3UPNA 3VP3A 5KIZA 5DTKA 1PWGA 1PI5A 2PBYA 1H5XA 4Z9QA 5G4YA 5FI2A 2IWCA 1PZPA 1ONHA 4Q0IA 3JYIA 3QP8A 2INWA 5FEGA 2OOLA 5HDSA 3MKEA 4PKYA 4KQDA 3P01A 4OPRA 3EQUA 1FSYA 4EBLA 4OPYA 3VSLA 3KYEA 4FOFA 1NZUA 3IXBA 3SW1A 4EETB 5HAQA 4S2JA 4MMNA 2ZC3B 2A24B 4DJ3A 2K2NA 2VZWA 5HPFA 3UY6A 3T4QA 1DJBA 4K0XA 3OPPA 4HP4A 1BZAA 4PM6A 1PI4A 2ZL1B 3K3DA 3IF6C 5HFOA 1YLPA 3HJKA 3TRCA 5GHXA 3G31A 3QP1A 1JNUA 2EXAA 2Y2IA 4GD6A 1RGYA 2IWBA 2EX2A 3V3SA 3OLOA 1ACFA 4HJ4A 1BLPA 1Z6FA 1ERQA 3WS2A 3A3FA 4UHUA 2NUPC 3WWXA 4DDSA 1LT0A 3F1PA 1ZC2A 1F9IA 4YWZA 1S67L 1ESIA 3K3CA 1F5MA 2C6WB 2V1BA 3S7PA 2W0NA 1W79A 4NETA 3VOZA 4BBVA 4JXGA 5HD3A 3T4JA 1NYMA 1N9NA 3V5MA 3A3EA 2J8YA 3ZHHA 3CUEC 4Y17A 5EVIB 4RVAA 3QHYA 2ZC5B 3OPLA 4ZAMA 4GCZA 3G34A 4S2IA 4B93A 3OOVA 3ZVWA 1LI9A 2WKIA 5FA7A 1ES4A 3EEHA 4CLCD 3E0YA 3G35A 3KSFA 4GOGA 4O7DA 4MBKA 5KSHA 2ZQ9A 2E8IA 5E2HA 4Y5FA 4DKIA 2BG1A 4I3AA 5FATA 4WELA 2XD1A 3M6BA 2FZ0A 3NDGA 3VP4A 3P98A 1LSXA 4S2PA 4MN6A 1GSXA 3DWZA 3EQVA 1PWDA 4Y0OA 2XK1A 5AQ7A 1T1AA 1H3QA 4UA7A 4JF6A 5CTNA 4DJ2A 2Y2NA 1GSWA 3U4LP 3GVBA 4DN0A 5AQBA 5GLAA 2J80A 1K55C 4P85A 5CGWA 4Y3IA 4XUZA 1VHMA 2VA0A 1JWPA 2BTFP 4IBXA 5C5KA 2V1AA 3MXRA 3VV4A 3HCYA 4ZRRA 3VE3A 2HDUA 5HARA 2L4RA 3L9KA 3CITA 2M7VA 1PW8A 1BUEA 4H6JA 3FV7A 3HUNA 3HBRA 3NBLA 1M40A 4JLFA 3H7WA 3QP4A 3QP5A 4BBUA 5EUAA 4XXRA 5EM1A 1XJ2A 3Q82A 3G6OA 1HTZA 1N9BA 4FTXA 5DVAA 1K6RA 5FAPA 3MQQA 5HX9A 3ZDJA 1S66L 1SKFA 3PBNA 4LV3A 2PU4A 3T1RA 1P9WA 2QZ6A 2XF3A 5EE8A 1KVMA 1DP8A 3LICA 4P6ZM 2PYRA 1I5QA 2PD7A 3MZFA 4R0QA 1S1YA 1G28A 2J3WA 3AGFA 4X55A 4LV1A 2Y91A 4R4SA 3WRZA 1XJ3A 3Q07A 3S7OA 1ONGA 2D01A 4KQRA 2ZC6B 5A8BA 2Y2GA 1RP5A 2DRWA 1K4FA 4IUHA 2ZC7A 4GDBA 2B5RA 4HH2A 5J4EA 3ZG0A 5GHYA 2EXBA 1KDSA 2Q9NA 1IKGA 4WEJA 4X68A 3ZVTA 1PNEA 1TF1A 1CQAA 3ZNTA 3P7NA 2LB5A 1STZA 5AQ9A 4JXWA 5HWWA 1G6AA 4WF0A 5EVIA 3BFFA 4BWIA 4Y13A 5L10A 5FQJA 4WN5A 1FR1A 5HL1A 2VGKA 1CI9A 2EWWA 1JVJA 3E2KA 3T1XA 1M6KA 1HVBA 1S4RA 4HH3A 4LPZA 4IJGA 4U0TA 2Y2LA 1QMEA 3V39A 4QY5A 2V0UA 3WS1A 4PAUA 3PBOA 4HQAA 2PT7A 4HEFA 2PHYA 1NJ4A 1CEFA 2WKPA 3BLMA 2G2UA 4GNUA 3E4QA 4LV2A 3OPHA 4BJPA 4HP9A 4FH4A 3LY4A 3OZHA 4WYYA 2HP5A 4UA9A 1GA9A 1MY8A 3JVVA 2Z6DA 3PAGA 4CQHA 4ZBEA 1MC0A 1XX2A 3UPPA 1K38A 1GHIA 2HDSA 3LIEA 2JE5A 1XA1A 1PYYA 5FQIA 3N4IA 4Y0UA 2CMNA 1G68A 3M2JA 4I3IA 2MJ6A 3C7UA 4R3AA 2PD8A 4S2MA 3WRTA 5IU1A 1VEUB 4P87A 1GHMA 5TBMB 2ZMFA 1YLWA 4BQMA 3OBFA 2PU2A 3UB6A 1KVLA 1OJGA 3G4PA 3T4OA 2M1CA 3B42A 3DW0A 1SCWA 4OQGA 5JYOA 3CWFA 3S1YA 4I3JA 4KENB 4WM9A 5CXWA 4JGRA 4ARZA 3NC8A 4UAAA 4DE1A 1LHYA 2XD5A 2QPNA 3ITBA 3T4SA 3G30A 1HD8A 4Y0TA 3PR6A 4PM9A 3LIFA 3NDEA 1BLSA 4CLCA 3UMDA 2HZ5A 5HAPA 2Y2QA 4E3MA 1PWCA 2GDNA 3HLFA 4B9OA 2WGWB 4PMAA 4DE3A 3E2LA 3Q81A 3IXGA 3PAEA 2OLUA 3QNBA 3FPWA 2Y2KA 1FQGA 1NRJA 4WL9A 4HHDA 3NHQA 4DF6A 1TEMA 1Q2PA 3BFCA 4WZ4A 2K7SA 2PR6A 3BYDA 4DE0A 2Z2LB 4JKTA 1YLJA 4I39A 4Y7PA 1D7EA 5F1FA 3Q7ZA 4KG6A 5HPIA 3T50A 4L9EA 4MN5A 3AGEA 2UV0E 1CF0A 4D2OA 4H8RA 5E2FA 5IS1A 3CPTA 3LEZA 2ZQDA 4I38A 5FQMA 1D06A 1IYSA 2VGLS 3KYZA 2XROA 2Y2HA 1SKOB 5EOOA 3IS2A 4EBPA 2L1MA 2QKPA 2H28A 4O01A 3JPUA 2A3UA 3KSGA 4N9KA 2EFUA 3OPRA 3A0RA 3MMHA 2V2FF 3BRMA 5AQAA 2EWVA 1ODVA 4JBFA 2O0YA 1J9MA 3FPVA 4ID4A 3ITAA 3NOUC 2V20A 4OH0A 4MCWA 1Y54A 3W8KA 4R70A 1O7EA 5FDSA 1H0MA 1TDLA 3GTCA 2HJ9C 3GECA 1PZOA 4WEKA 2OAP1 1P97A 3O87A 2ZM2A 4HBTA 4BMWA 2PAVP 3F1OB 1AXBA 5HD5A 2DCFA 2H10A 4IEDA 3KSHA 5F82A 2ZMVA 4KUKA 3TW8A 4MBFA 3RXWA 2VV8A 4IVIA 4F3LA 4KG2A 5HZHA 1K57A 1NXYA 1XFQA 4II7A 1IKIA 4EUZA 3QP2A 3SZTA 3IX8A 1QMFA 3LUQA 3LCEA 3IWQA 5FDHA 3FYZA 5TBMA 3S7NA 1YMXA 1CJFA 4PM8A 4S2KA 3VFFA 1YSPA 5KZHA 5AJGA 1OT6A 3NI9A 4WMCD 3SH8A 4OQIA 4BD1A 2I9VA 2YKFA 3ZQ5A 1IELA 1IYPA 2EX8A 3IF6B 1W63Q 1ZHHB 2EA9A 2Y8HA 1XKZA 4ZJ2A 5TGFA 3PBTA 3BQAA 5A90A 3IQAA 2EFXA 3DAVA 1VETB 4G3VA 4DRTA 4BENA 2QMIA 3GRJA 1ES3A 4QU3A 3IX3A 4GDNA 4A5RA 3VOLA 4N1HA 5HW3A 1NLZA 3FC7A 2QJ5A 3BWLA 4EBNA 2O9BA 2VV7A 5FEFA 3F1NA 4R23A 1GA0A 3UDXA 3V3RA 2WGWA 2WZXA 3NULA 3R7WB 3B33A 2PRFA 3VSKA 2B95A 3SS3A 1OTAA 4XT2B 2ZLYA 3HJIA 3WS5A 1PFLA 3W4PA 1N9OA 4BD0A 4UEYA 3LR5A 4Y2FA 4EERA 1YLTA 2O9AA 5CHJA 5EVIC 4EQIA 4M4XA 5J8XA 4E3IA 1T1BA 3HL9A 5CECA 1WYBA 3U2AA 5TFQA 2GZAA 5F83A 3IWIA 4UQIS 1K25A 2HP9A 5J3WA 4QY6A 1V9ZA 1J3WA 1P0ZA 2B18A 1L0EA 4QWOA 1ALQA 1MKMA 4RA7A 5A93A 4RX3A 5A92A 5K5BA 5FASA 1IYOA 4ZJ1A 4PKYG 2P9VB 4HNBA 2W1RA 2EX6A 2QWSA 1H8ZA 3DTIA 4HBUA 4XUXA 2HJEA 4WZ5A 2XGNA 3EGDC 3LIDA 2RCXA 1K56D 4CJNA 3NCKA 2R9XA 4E3JA 3M2KA 1XJ4A 4MEZA 2K31A 4C6YA 2X02A 5D3OA 3FKWA 3ZG5A 4R3JA 1K0KA 5FL3A 2WK0A 2HDRA 1XJ6A 2JKTI 2WZZA 1DP6A 4MNRA 5FI6A 4X56A 3G2YA 3MBZA 3R4KA 2ZMAA 2ZJ9A 2W3EA 1IFQA 2A24A 3HLBA 5M1AA 1TS6A 3SS5A 2W1TB 3MKFA 1MWSA 2WGIA 4HJ6A 3GQZA 2D02A 4X6TA 3Q1FA 1HLUP 1W8QA 3MR0A 4BLMA 1PIOA 2XH9A 2ZL1A 3VFHA 4B4XA 1KGGA 5FQKA 3RH8B 3DBAA 4U3TA 3A3JA 5DKKA 5L09A 1LL8A 1G6OA 3BFGA 3H82B 3EOIA 3CI6A 4KZ3A 2ZC4B 3KYQA 2C5WB 4E6XA 3OCNA 1VETA 3WS0A 5DJTA 1GSVA 2JKTM 5CGXA 1FR6A 1NWZA 1PRQA 4CLCC 2G7UA 2X01A 4R6LA 1Y4OA 2ZQAA 1EROA 2HP6A 5EM0A 4E3OA 5JYPA 1E4DA 3S4XA 2ZM8A 3C4PA 2XA7S 3A0SA 2XR0A 4DMZA 2W3HA 2DMWA 3A3IA 5GHZA 2WKRA 1N4OA 1CK3A 4IVKA 3D72A 4R38A 2WADA 5TR7A 4XT2A 3T12B 2ZQCA 3O3VA 3MXSA 4KUOA 4LENA 4E3KA 3FG8A 2Z6CA 3MJQA 3UE0A 5HAIA 4Q8IA 1L0FA 3UN7A 2J3TD 3E98A 1TVFA 3LYXA 1Y28A 3ULFA 5CEBA 1KDWA 1K6SA 4IBRA 1YMSA 5CHMA 2OWJA 3UB9A 1UWPX 2FFYA 3TG9A 5MC7A 3MZEA 1ZG4A 1XGIA 5F68A 3SH7A 2W3DA 1IOUA 5GLDA 2HDQA 2Y55A 1W8YA 5F1GA 2WKQA 1OTBA 2JKGA 2VK3A 4JXSA 2P9VA 3MQ0A 2B02A 5CX7A 2J9PA 4GJ4A 3JVUA 1T1CA 3PHYA 1F98A 4NK3A 4Q0JA 3BJNA 2V9AA 3IXDA 1EI5A 4WMCA 3RFBA 4AFIA 1DP9A 1S1ZA 1GHPA 4ETXA 1OPXA 2Z2MB 1X0OA 4P0MA 5I94A 1C3BA 2OWHA 1TS8A 2V1ZA 4DXCA 3C38A 3Q7VB 2X71A 1ERMA 4JGOA 5KSCA 3C30A 4N92A 3OCLA 1VM1A 3UPOA 1K57C 2ZBBA 3RJUA 1ZTUA 1E25A 2W1TA 4OQHA 2Q9MA 3TOIA 1JWZA 3IBRA 2P08A 4IHQA 3LGOA 1WE4A 5DF8A 2JBFA 2IWDA 1FIKA 4DDYA 4YNRA 2WGVA 4GS9B 5CTMA 3LO7A 1G5UA 4NXFA 3QNCA 1E3UD 2O9CA 2VGJA 2R78A 4X1LA 5EFWA 2G2WA 3NY4A 3C2WA 4R3BA 1FSWA 5U47A 1YT4A 3N6IA 1K4EA 1YLZA 3EWKA 3T4LA 5AVFA 3IBJA 2PBDP 2WKEA 3F1PB 1JTGA 1LI0A 3MZDA 4EQ1A 3BY8A 2KDKA 5FAQA 3TJZC 5HSQA 3MS6A 4FD8A 2CC1A 2O99A 3LR0A 3NIAA 4GW9A 4QJGA 3K2NA 1K56A 1TD5A 5M19A 4OKPA 2Q0OA 2KX6A 3WS4A 4GHIB 4LFUA 3IH8A 1GCEA 3A0VA 3O86A 3GDIA 4KZ6A 2E8JA 4MLLA 2OV5A 5HDDA 5EECA 1BYWA 3T1QB 1L0GA 4G3WA 1W5DA 3BW6A 5E2EA 1I2WA 4QB8A 4NKPA 3N8SA 1YM1A 2ZM0A 4FUWA 4OLDA 5DTTA 3SOIA 4JGQA 3ZGAB 4OLGA 3E4OA 4EEUA 1XPBA 1OTIA 1N9LA 4ZTKA 4WZ5C 3IHBA 4D60A 1I2SA 1NY0A 2UWXA 3B3XA 3UB5P 4IUKA 1BLHA 4YOFA 3MFDA 3T1SA 1SDEA 1HZOA 2PDRA 5J7EA 3UE3A 2JKFA 3BEBA 1DJAA 1S0WA 1YAXA 5HWVA 3VP1A 3VE4A 4PPRA 1P9RA 2OAQ1 3C4OA 4G3KA 3ZG7B 4BL2A 1YQSA 4H6JB 3Q7VA 1VEUA 4P6ZS 3S7QA 5CHUA 4KZ9A 4CPKA 1BLCA 3H7WB 4S2NA 4KZAA 2V8CA 5G4ZA 4P6BA 3HUOA 1MKIA 4X53A 1KGEA 4B4ZA 4C3QA 2XSSA 1CI8A 3E4PA 1FILA 4Y15A 4X25A 1L0DA 2XEPA 1TS7A 2H0TA 4OOLA 1MWTA 3UE1A 3UO9A 3UB7A 4GZBA 2R9WA 1OJ5A 1LLBA 5DKLA 4EEPA 4GS9A 3LEQA 4GB7A 1SZVA 4NG2A 3GR2A 3IT9A 2KLIA 4EUVA 1D1JA 4KZ7A 5BOHA 4YFMA 4S2OA 3IX4A 1JTDA 3NJAA 3I7JA 3C7VA 2JHEA 5G18A 3RXXA 5M18A 4NXGA 4ZDXA 2Y2JA 4HESA 3BLSA 4LRZE 4QD4A 4MDZA 4E6WA 2Y2PA 1YLYA 4KZ4A 2P7JA 4OOMA 3AGDA 4Q0HA 3BQ8A 5TJJA 3IF5A 2Y79A 3IH9A 2XQZA 3FZCA 4LV0A 4OONA 3ZNYA 3VOYA 4C75A 3BFDA 4OP8A 4LLOB 2HF6A 3CLOA 4L9GA 4GHIA 4CLCE 1WYCA 3O5YA 4O0PA 5L07A 1XP4A 1ZKJA 3M6HA 1BT5A 2KOIA 4GKUA 4L9FA 2YKHA 1LL5A 1NRFA 3C5AA 1RCJA 3C8CA 3UNWA 2EX9A
chains in the Genus database with same CATH topology
3D72A 4R38A 4ARZA 4XT2A 3EQUA 3MXQA 4K08A 4KUOA 2VLGA 3FG8A 2Z6CA 3MJQA 4L0LA 4WLAA 3T4SA 4FOFA 2W3FA 3SW1A 3PR6A 4EETB 2J3TD 3E98A 3LIFA 4MMNA 4CLCA 3UMDA 3LYXA 1Y28A 2A24B 3ULFA 4DJ3A 2K2NA 2VZWA 2V0WA 5HPFA 2VGLM 3PYPA 4B9OA 3T4QA 4FSFA 2OWJA 3B47A 3UB9A 1UWPX 4HP4A 4HJ3A 3KSIA 5MC7A 5I5LA 5F68A 1UGUA 2W3DA 3K3DA 1IOUA 3HJKA 3TRCA 4EW7A 3FPWA 1KOUA 1JNUA 3F1OA 2WKQA 1NRJA 1OTBA 3OLOA 3EEAA 3ICYA 4HJ4A 4WL9A 4HHDA 3MQ0A 2VJWA 2VKSA 3NHQA 2B02A 5CX7A 1YSQA 3PBQA 2NUPC 3KX0X 2NUTC 2K7SA 4GJ4A 2PR6A 3JVUA 1T1CA 3PHYA 1F98A 4Q0JA 1LT0A 3F1PA 1F9IA 3BJNA 2V9AA 4I39A 4YWZA 1S67L 1D7EA 3RFBA 4AFIA 1DP9A 1S1ZA 2M7UA 3K3CA 5HPIA 1F5MA 3T50A 4L9EA 2V1BA 4MN5A 3S7PA 2W0NA 4ETXA 2W3GA 4BBVA 5F5YA 5IS1A 5HD3A 1OPXA 3T4JA 1X0OA 1N9NA 2JKRI 4HY8A 3T4KA 4I38A 3CUEC 1D06A 2OWHA 2VGLS 3KYZA 1TS8A 2XROA 4ARZB 3IS2A 3C38A 2L1MA 2IA2A 4JGOA 2QKPA 3C30A 2H28A 3OCLA 4GCZA 4O01A 2VX8A 3KSGA 2VV6A 4B93A 4CLCB 3OOVA 3A0RA 3MMHA 1LSWA 2ZBBA 1ZTUA 2W1TA 1TS0A 3EEHA 4CLCD 4NXEA 3PXPA 3E0YA 3KSFA 2EWVA 1ODVA 2O0YA 2XRNA 3IBRA 3R7WA 5KSHA 4ME4A 3UMEA 3FPVA 2P08A 4EXOA 4IHQA 2LB9A 3NOUC 4Y5FA 4WUJA 4MCWA 4R70A 3LFVA 4I3AA 4WELA 5HDCA 2HJ9C 4EU0A 3GECA 3CUEA 4WEKA 2OAP1 4YNRA 4BBTA 4GS9B 3KO6A 2FZ0A 1P97A 1WA9A 4BMWA 1LSXA 4NXFA 2O9CA 3F1OB 2R78A 4MN6A 1GSXA 5EFWA 5HD5A 2JKRM 3EQVA 3KSHA 4GLQA 4HIAA 3C2WA 1DRMA 2ZMVA 4KUKA 3TW8A 1W63M 1T1AA 1H3QA 1MZUA 2VV8A 4F3LA 5HZHA 1XFQA 4II7A 2A2LA 4DJ2A 3T4LA 1GSWA 3EWKA 5AVFA 3LUQA 3IBJA 5TBMA 2ZOHA 3F1PB 3S7NA 4DN0A 5F69A 4EQ1A 2J80A 3BY8A 1YSPA 2GX5A 5AJGA 1OT6A 3CAXA 4Y3IA 1VHMA 2KDKA 2VA0A 5C5KA 2W27A 2V1AA 3TJZC 5HSQA 3VV4A 1UWNX 2I9VA 2YKFA 3ZQ5A 4NEED 3HCYA 3EGXC 4ZRRA 3VE3A 1W63Q 1ZHHB 2EA9A 2Y8HA 2O99A 3LR0A 4UQIM 2L4RA 3CITA 3PBTA 4GW9A 2M7VA 3BY9A 1V9YA 3BQAA 4PHTA 4HOIA 3MFXA 4H6JA 4G3VA 5DFXA 3K2NA 3IS2B 3TE8A 1TD5A 3H7WA 2KX6A 4BBUA 4GHIB 3VOLA 1XJ2A 1NLZA 3FC7A 2QJ5A 3BWLA 3G6OA 2O9BA 3A0VA 1NLYA 4ETZA 3GDIA 3MQQA 2VV7A 1LSVA 1S66L 3F1NA 3PBNA 5HDDA 1BYWA 2JN7A 1P9WA 4G3WA 3R7WB 1DP8A 1T18A 3B33A 3LICA 2VEAA 2PYRA 3BW6A 4P6ZM 2PD7A 2PR5A 4NKPA 1OTAA 4XT2B 3H9WA 4O8GA 3HJIA 2L0WA 1N9OA 4UEYA 2ZOIA 1S1YA 1G28A 2J3WA 3LR5A 4Y2FA 4EERA 3NOPC 4JGQA 2O9AA 1XJ3A 3E4OA 4EEUA 5HWTA 3LR3A 4M4XA 1OTIA 1N9LA 2HGVA 4LRYC 1T1BA 5DF9A 4I5SA 3S7OA 5IT5A 4KQOA 3U2AA 2D01A 2GZAA 4IUKA 4UQIS 4F3LB 5A8BA 4YOFA 5J3WA 1V9ZA 1P0ZA 2B18A 1H8MA 2PDRA 4IUHA 2PYPA 5J7EA 2BASA 3UE3A 4HH2A 5J4EA 2FH5A 1MKMA 4NXBA 5L8MA 3ZYTA 4WEJA 5K5BA 2QYBA 1YAXA 1T19A 3H82A 1OTDA 1TF1A 5HWVA 3VE4A 4PKYG 3P7NA 1P9RA 2LB5A 1EW0A 2OAQ1 1STZA 4G3KA 2J3TC 1OTEA 3LR4A 5DFYA 3LI8A 4HNBA 2W1RA 5HWWA 3UB8A 4WF0A 2QWSA 4H6JB 2QHKA 4LRXC 4P6ZS 4BWIA 3S7QA 2HJEA 3EGDC 3H7WB 5AVEA 3LIDA 3NOTC 4EESA 4WN5A 5G4ZA 3D3OA 3PBSA 2EWWA 1XJ4A 3MF0A 3T4TA 2K31A 3MQOA 2XSSA 5DJUA 1S4RA 3E4PA 3F1NB 4HH3A 4LPZA 3RTYA 4IJGA 1S4SA 5FL3A 1TS7A 1XFNA 4OOLA 3UB7A 2V0UA 1OJ5A 1XJ6A 4PAUA 3PBOA 3UE6A 2JKTI 4HQAA 5DKLA 4EEPA 2PT7A 3LIAA 4GS9A 1DP6A 2PHYA 4RQ9A 2XA7M 2WKPA 1VB6A 3E4QA 3R4KA 3LI9A 2P04A 2W3EA 2KLIA 4EUVA 4BJPA 5HL6A 1IFQA 4HP9A 3PBRA 2A24A 3NJAA 2JHEA 2QJ7A 1TS6A 2W1TB 4HJ6A 3V67A 2D02A 1YKDA 4NXGA 2GJ3A 2HV1A 4MN7A 3JVVA 5F6AA 2Z6DA 3MR0A 4JGPA 5LBRA 4LRZE 1OT9A 4MDZA 4Z1WA 3RH8B 3DBAA 4QPRA 4CQHA 2P7JA 5DKKA 4OOMA 1MC0A 1LL8A 3OC2A 4Q0HA 1G6OA 3W2ZA 3LIEA 3BQ8A 3H82B 5TJJA 3EOIA 2Y79A 2CMNA 3CI6A 3LIBA 3KYQA 4I3IA 4E04A 4HI4A 2MJ6A 4R3AA 2PD8A 3OCNA 5DJTA 1GSVA 2JKTM 1NWZA 5IU1A 4LLOB 2HF6A 2GNXA 4CLCC 3CLOA 2G7UA 4L9GA 4GHIA 4R6LA 4CLCE 5TBMB 2ZMFA 5KIZA 3O5YA 4O0PA 3OBFA 3UB6A 2XA7S 3A0SA 1OJGA 5G4YA 4DMZA 2W3HA 2DMWA 3T4OA 2M1CA 3B42A 3CWFA 2KOIA 4L9FA 4Q0IA 2INWA 2YKHA 2OOLA 5HDSA 4I3JA 4PKYA 2WKRA 3C8CA 4KQDA 3P01A 4JGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJG A;  4ETZ A;  4O01 A;  3KSG A;  3OOV A;  4FOF A;  3MMH A;  2W3F A;  4G3W A;  4PAU A;  1ZTU A;  2W1T A;  3E98 A;  2VEA A;  4MMN A;  3E0Y A;  3KSF A;  4RQ9 A;  2O0Y A;  2XRN A;  3IBR A;  3R4K A;  4ME4 A;  4O8G A;  2K2N A;  2VZW A;  2W3E A;  2LB9 A;  2KLI A;  4EUV A;  5HPF A;  5HL6 A;  3NOU C;  4Y5F A;  4MCW A;  4R70 A;  4Y2F A;  3LFV A;  3NOP C;  4EU0 A;  2W1T B;  2O9A A;  3KSI A;  4YNR A;  3KO6 A;  1YKD A;  5I5L A;  2HGV A;  4MN7 A;  4LRY C;  2W3D A;  3S7O A;  2O9C A;  5LBR A;  4LRZ E;  4IUK A;  3TRC A;  3KSH A;  4GLQ A;  4YOF A;  4MDZ A;  3C2W A;  4Z1W A;  3DBA A;  2B18 A;  4QPR A;  4CQH A;  4IUH A;  1MC0 A;  4Q0H A;  3EEA A;  1MKM A;  3W2Z A;  3MQ0 A;  2VJW A;  2VKS A;  5TJJ A;  2Y79 A;  3NHQ A;  3IBJ A;  3CI6 A;  1YSQ A;  3S7N A;  5L8M A;  4DN0 A;  5K5B A;  2QYB A;  4E04 A;  1TF1 A;  4Q0J A;  1YSP A;  2GX5 A;  5AJG A;  4Y3I A;  3BJN A;  1VHM A;  5C5K A;  2LB5 A;  1STZ A;  5HSQ A;  3RFB A;  3VV4 A;  4G3K A;  3ZQ5 A;  5DFY A;  3HCY A;  2W1R A;  2G7U A;  2M7U A;  4R6L A;  4ZRR A;  5HPI A;  1F5M A;  2Y8H A;  2O99 A;  2ZMF A;  3S7P A;  4LRX C;  3O5Y A;  4ETX A;  3CIT A;  4O0P A;  3OBF A;  2W3G A;  4GW9 A;  2M7V A;  3S7Q A;  4BWI A;  4DMZ A;  2W3H A;  3NOT C;  4G3V A;  5DFX A;  3K2N A;  2KOI A;  4Q0I A;  1TD5 A;  3D3O A;  2XRO A;  2OOL A;  3MF0 A;  2K31 A;  2XSS A;  3G6O A;  2IA2 A;  2O9B A; 
#chains in the Genus database with same CATH topology
 2FFF B;  1SKO A;  4OVD A;  4K91 A;  3MXQ A;  2ACG A;  4K08 A;  4WBG A;  1KE3 A;  3HRE A;  2VLG A;  4WLA A;  4L0L A;  4KZ8 A;  2W3F A;  2A49 A;  3DTE A;  4X1M A;  1CEG A;  1W7F A;  2XFT A;  1KE4 A;  3DTK A;  5GLC A;  1K54 A;  2V0W A;  4KZB A;  3SS4 A;  1LL9 A;  2VGL M;  3PYP A;  2WAF A;  3P09 A;  4FSF A;  4JXV A;  3B47 A;  1MWR A;  2DNS A;  4HJ3 A;  3KSI A;  5I5L A;  1UGU A;  2WYX A;  5DTS A;  1E3U A;  4EW7 A;  1O07 A;  1KOU A;  3BEC A;  4OPZ A;  3CZD A;  3F1O A;  5EVE A;  5CED A;  4UA6 A;  3EEA A;  3ICY A;  2VJW A;  2VKS A;  1YSQ A;  3PBQ A;  1XA7 A;  3KX0 X;  2NUT C;  3DTM A;  5CRF A;  5CGS A;  1BTL A;  4B88 A;  3IXH A;  1KE0 A;  3CMZ A;  1XXM A;  4S2L A;  2Y2O A;  4FCF A;  3UDI A;  4R1G A;  2HPB A;  2M7U A;  1ZG6 A;  3CJM A;  2W3G A;  2H0Y A;  2WUQ A;  5F5Y A;  3IF6 A;  1FCO A;  5E43 A;  2JKR I;  4HY8 A;  3T4K A;  4OPQ A;  3NEC A;  4ARZ B;  1MXO A;  3HLG A;  4OP5 A;  4RX2 A;  2IA2 A;  2VX8 A;  2VV6 A;  4DE2 A;  4CLC B;  3SH9 A;  4OQ0 A;  1LSW A;  1TS0 A;  4NXE A;  3PXP A;  3ZG8 B;  3QP6 A;  2XRN A;  3ZFZ A;  3R7W A;  1ES2 A;  4ME4 A;  3UME A;  3GMW A;  2P74 A;  4EXO A;  2LB9 A;  3FKV A;  3FWL A;  4WUJ A;  1FCM A;  3LFV A;  2WAE A;  4K0W A;  4N9L A;  5HDC A;  3TSG A;  3MSH A;  4EU0 A;  1OME A;  5CER A;  3S22 A;  3CUE A;  3V50 A;  2JCH A;  4BBT A;  3UDF A;  1A0K A;  3KO6 A;  5FQQ A;  4DXB A;  4FH2 A;  1WA9 A;  4BL3 A;  1JWV A;  1ESU A;  1DJC A;  2AVX A;  4GN2 A;  2JKR M;  2OSU A;  4HIA A;  4GLQ A;  1DRM A;  1W63 M;  1MZU A;  4KZ5 A;  1BSG A;  2A2L A;  1EWZ A;  4LGW A;  3GSG A;  2ZOH A;  3HLW A;  4EWF A;  5F69 A;  3VP0 A;  2GX5 A;  3CAX A;  4E3N A;  2W27 A;  1UWN X;  3CHW P;  4ESP A;  4NEE D;  3EGX C;  5EVL A;  3CPT B;  3G2Z A;  1MWU A;  4UQI M;  1PW1 A;  3BY9 A;  1V9Y A;  4PHT A;  4HOI A;  3MFX A;  4KQQ A;  4QHC A;  5DFX A;  3CG5 A;  4N1X A;  1AWI A;  3IS2 B;  3TE8 A;  2BLS A;  2WKH A;  1FCN A;  5KMW A;  4LCM A;  3N7W A;  1ES5 A;  2ZD8 A;  3N8L A;  5DF7 A;  5GL9 A;  4PM5 A;  2RL3 A;  1MBL A;  1NLY A;  4ETZ A;  3PTE A;  1LSV A;  2Y4A A;  1K55 A;  1XGJ A;  2JN7 A;  1Z09 A;  3HLE A;  1BUL A;  1T18 A;  2VEA A;  1RGZ A;  1IYQ A;  3IHA A;  2JC7 A;  4MBH A;  5IHV A;  2PR5 A;  4M3K A;  3H9W A;  4O8G A;  1F2K A;  4ZJ3 A;  2L0W A;  2OLV A;  2ZOI A;  2XFS A;  3BFE A;  1DY6 A;  1KGF A;  3IWO A;  3HUM A;  3NOP C;  5FSR A;  4X69 A;  5HWT A;  3LR3 A;  4JF4 A;  5FI7 A;  2HGV A;  4LCL A;  4LRY C;  5DF9 A;  2J9O A;  4I5S A;  5IT5 A;  1NZO A;  4S2N C;  4KQO A;  2Y2M A;  2Y59 A;  3N8R A;  4F3L B;  3W4O A;  5L2F A;  1H8M A;  2PYP A;  2BAS A;  3HLC A;  4KG5 A;  3VMA A;  2FH5 A;  4NXB A;  5L8M A;  3ZYT A;  2QYB A;  1T19 A;  3H82 A;  5EV0 A;  1OTD A;  3ISG A;  1EW0 A;  1TDG A;  2J3T C;  1OTE A;  3LR4 A;  5DFY A;  3LI8 A;  3UB8 A;  2ZQ8 A;  2QHK A;  4LRX C;  5GLB A;  5AVE A;  5E2G A;  3NOT C;  4EES A;  3DWK A;  3D3O A;  1MPL A;  3PBS A;  3HLD A;  4JF5 A;  5EPH A;  3MF0 A;  3T4T A;  4GD8 A;  3MQO A;  5DJU A;  3F1N B;  3RTY A;  3A3D A;  3ZCZ A;  4EV4 A;  1S4S A;  5FQ9 A;  4E3L A;  1XFN A;  4R4R A;  3UE6 A;  4PM7 A;  1L2S A;  3W4Q A;  2XDM A;  1L3L A;  3LIA A;  3G32 A;  4F94 A;  4RQ9 A;  2XA7 M;  1VB6 A;  3LY3 A;  3LI9 A;  2P04 A;  3GV9 A;  5HL6 A;  3PBR A;  1U60 A;  3HVF A;  1Q2Q A;  2QJ7 A;  1NYY A;  4JPM A;  3V67 A;  2XLN A;  1YKD A;  4RYE A;  3D4F A;  2GJ3 A;  2HV1 A;  1SHV A;  4MN7 A;  5F6A A;  3D9Y A;  2ZQ7 A;  4JGP A;  3L7H A;  5LBR A;  1YPR A;  1H8Y A;  4U0X A;  2H5S A;  1OT9 A;  3BM6 A;  4Z1W A;  1VQQ A;  5FAO A;  4QPR A;  1SDN A;  3VP2 A;  3OC2 A;  3W2Z A;  5A91 A;  1FOF A;  4YIN A;  3LIB A;  3ZG9 B;  2I72 A;  2J7V A;  4E04 A;  4OOY A;  4HI4 A;  3O88 A;  1S6R A;  1IEM A;  2V8F A;  2GNX A;  5EVI D;  5EOE A;  1K54 C;  3UPN A;  3VP3 A;  5KIZ A;  5DTK A;  1PWG A;  1PI5 A;  2PBY A;  1H5X A;  4Z9Q A;  5G4Y A;  5FI2 A;  2IWC A;  1PZP A;  1ONH A;  4Q0I A;  3JYI A;  3QP8 A;  2INW A;  5FEG A;  2OOL A;  5HDS A;  3MKE A;  4PKY A;  4KQD A;  3P01 A;  4OPR A;  3EQU A;  1FSY A;  4EBL A;  4OPY A;  3VSL A;  3KYE A;  4FOF A;  1NZU A;  3IXB A;  3SW1 A;  4EET B;  5HAQ A;  4S2J A;  4MMN A;  2ZC3 B;  2A24 B;  4DJ3 A;  2K2N A;  2VZW A;  5HPF A;  3UY6 A;  3T4Q A;  1DJB A;  4K0X A;  3OPP A;  4HP4 A;  1BZA A;  4PM6 A;  1PI4 A;  2ZL1 B;  3K3D A;  3IF6 C;  5HFO A;  1YLP A;  3HJK A;  3TRC A;  5GHX A;  3G31 A;  3QP1 A;  1JNU A;  2EXA A;  2Y2I A;  4GD6 A;  1RGY A;  2IWB A;  2EX2 A;  3V3S A;  3OLO A;  1ACF A;  4HJ4 A;  1BLP A;  1Z6F A;  1ERQ A;  3WS2 A;  3A3F A;  4UHU A;  2NUP C;  3WWX A;  4DDS A;  1LT0 A;  3F1P A;  1ZC2 A;  1F9I A;  4YWZ A;  1S67 L;  1ESI A;  3K3C A;  1F5M A;  2C6W B;  2V1B A;  3S7P A;  2W0N A;  1W79 A;  4NET A;  3VOZ A;  4BBV A;  4JXG A;  5HD3 A;  3T4J A;  1NYM A;  1N9N A;  3V5M A;  3A3E A;  2J8Y A;  3ZHH A;  3CUE C;  4Y17 A;  5EVI B;  4RVA A;  3QHY A;  2ZC5 B;  3OPL A;  4ZAM A;  4GCZ A;  3G34 A;  4S2I A;  4B93 A;  3OOV A;  3ZVW A;  1LI9 A;  2WKI A;  5FA7 A;  1ES4 A;  3EEH A;  4CLC D;  3E0Y A;  3G35 A;  3KSF A;  4GOG A;  4O7D A;  4MBK A;  5KSH A;  2ZQ9 A;  2E8I A;  5E2H A;  4Y5F A;  4DKI A;  2BG1 A;  4I3A A;  5FAT A;  4WEL A;  2XD1 A;  3M6B A;  2FZ0 A;  3NDG A;  3VP4 A;  3P98 A;  1LSX A;  4S2P A;  4MN6 A;  1GSX A;  3DWZ A;  3EQV A;  1PWD A;  4Y0O A;  2XK1 A;  5AQ7 A;  1T1A A;  1H3Q A;  4UA7 A;  4JF6 A;  5CTN A;  4DJ2 A;  2Y2N A;  1GSW A;  3U4L P;  3GVB A;  4DN0 A;  5AQB A;  5GLA A;  2J80 A;  1K55 C;  4P85 A;  5CGW A;  4Y3I A;  4XUZ A;  1VHM A;  2VA0 A;  1JWP A;  2BTF P;  4IBX A;  5C5K A;  2V1A A;  3MXR A;  3VV4 A;  3HCY A;  4ZRR A;  3VE3 A;  2HDU A;  5HAR A;  2L4R A;  3L9K A;  3CIT A;  2M7V A;  1PW8 A;  1BUE A;  4H6J A;  3FV7 A;  3HUN A;  3HBR A;  3NBL A;  1M40 A;  4JLF A;  3H7W A;  3QP4 A;  3QP5 A;  4BBU A;  5EUA A;  4XXR A;  5EM1 A;  1XJ2 A;  3Q82 A;  3G6O A;  1HTZ A;  1N9B A;  4FTX A;  5DVA A;  1K6R A;  5FAP A;  3MQQ A;  5HX9 A;  3ZDJ A;  1S66 L;  1SKF A;  3PBN A;  4LV3 A;  2PU4 A;  3T1R A;  1P9W A;  2QZ6 A;  2XF3 A;  5EE8 A;  1KVM A;  1DP8 A;  3LIC A;  4P6Z M;  2PYR A;  1I5Q A;  2PD7 A;  3MZF A;  4R0Q A;  1S1Y A;  1G28 A;  2J3W A;  3AGF A;  4X55 A;  4LV1 A;  2Y91 A;  4R4S A;  3WRZ A;  1XJ3 A;  3Q07 A;  3S7O A;  1ONG A;  2D01 A;  4KQR A;  2ZC6 B;  5A8B A;  2Y2G A;  1RP5 A;  2DRW A;  1K4F A;  4IUH A;  2ZC7 A;  4GDB A;  2B5R A;  4HH2 A;  5J4E A;  3ZG0 A;  5GHY A;  2EXB A;  1KDS A;  2Q9N A;  1IKG A;  4WEJ A;  4X68 A;  3ZVT A;  1PNE A;  1TF1 A;  1CQA A;  3ZNT A;  3P7N A;  2LB5 A;  1STZ A;  5AQ9 A;  4JXW A;  5HWW A;  1G6A A;  4WF0 A;  5EVI A;  3BFF A;  4BWI A;  4Y13 A;  5L10 A;  5FQJ A;  4WN5 A;  1FR1 A;  5HL1 A;  2VGK A;  1CI9 A;  2EWW A;  1JVJ A;  3E2K A;  3T1X A;  1M6K A;  1HVB A;  1S4R A;  4HH3 A;  4LPZ A;  4IJG A;  4U0T A;  2Y2L A;  1QME A;  3V39 A;  4QY5 A;  2V0U A;  3WS1 A;  4PAU A;  3PBO A;  4HQA A;  2PT7 A;  4HEF A;  2PHY A;  1NJ4 A;  1CEF A;  2WKP A;  3BLM A;  2G2U A;  4GNU A;  3E4Q A;  4LV2 A;  3OPH A;  4BJP A;  4HP9 A;  4FH4 A;  3LY4 A;  3OZH A;  4WYY A;  2HP5 A;  4UA9 A;  1GA9 A;  1MY8 A;  3JVV A;  2Z6D A;  3PAG A;  4CQH A;  4ZBE A;  1MC0 A;  1XX2 A;  3UPP A;  1K38 A;  1GHI A;  2HDS A;  3LIE A;  2JE5 A;  1XA1 A;  1PYY A;  5FQI A;  3N4I A;  4Y0U A;  2CMN A;  1G68 A;  3M2J A;  4I3I A;  2MJ6 A;  3C7U A;  4R3A A;  2PD8 A;  4S2M A;  3WRT A;  5IU1 A;  1VEU B;  4P87 A;  1GHM A;  5TBM B;  2ZMF A;  1YLW A;  4BQM A;  3OBF A;  2PU2 A;  3UB6 A;  1KVL A;  1OJG A;  3G4P A;  3T4O A;  2M1C A;  3B42 A;  3DW0 A;  1SCW A;  4OQG A;  5JYO A;  3CWF A;  3S1Y A;  4I3J A;  4KEN B;  4WM9 A;  5CXW A;  4JGR A;  4ARZ A;  3NC8 A;  4UAA A;  4DE1 A;  1LHY A;  2XD5 A;  2QPN A;  3ITB A;  3T4S A;  3G30 A;  1HD8 A;  4Y0T A;  3PR6 A;  4PM9 A;  3LIF A;  3NDE A;  1BLS A;  4CLC A;  3UMD A;  2HZ5 A;  5HAP A;  2Y2Q A;  4E3M A;  1PWC A;  2GDN A;  3HLF A;  4B9O A;  2WGW B;  4PMA A;  4DE3 A;  3E2L A;  3Q81 A;  3IXG A;  3PAE A;  2OLU A;  3QNB A;  3FPW A;  2Y2K A;  1FQG A;  1NRJ A;  4WL9 A;  4HHD A;  3NHQ A;  4DF6 A;  1TEM A;  1Q2P A;  3BFC A;  4WZ4 A;  2K7S A;  2PR6 A;  3BYD A;  4DE0 A;  2Z2L B;  4JKT A;  1YLJ A;  4I39 A;  4Y7P A;  1D7E A;  5F1F A;  3Q7Z A;  4KG6 A;  5HPI A;  3T50 A;  4L9E A;  4MN5 A;  3AGE A;  2UV0 E;  1CF0 A;  4D2O A;  4H8R A;  5E2F A;  5IS1 A;  3CPT A;  3LEZ A;  2ZQD A;  4I38 A;  5FQM A;  1D06 A;  1IYS A;  2VGL S;  3KYZ A;  2XRO A;  2Y2H A;  1SKO B;  5EOO A;  3IS2 A;  4EBP A;  2L1M A;  2QKP A;  2H28 A;  4O01 A;  3JPU A;  2A3U A;  3KSG A;  4N9K A;  2EFU A;  3OPR A;  3A0R A;  3MMH A;  2V2F F;  3BRM A;  5AQA A;  2EWV A;  1ODV A;  4JBF A;  2O0Y A;  1J9M A;  3FPV A;  4ID4 A;  3ITA A;  3NOU C;  2V20 A;  4OH0 A;  4MCW A;  1Y54 A;  3W8K A;  4R70 A;  1O7E A;  5FDS A;  1H0M A;  1TDL A;  3GTC A;  2HJ9 C;  3GEC A;  1PZO A;  4WEK A;  2OAP 1;  1P97 A;  3O87 A;  2ZM2 A;  4HBT A;  4BMW A;  2PAV P;  3F1O B;  1AXB A;  5HD5 A;  2DCF A;  2H10 A;  4IED A;  3KSH A;  5F82 A;  2ZMV A;  4KUK A;  3TW8 A;  4MBF A;  3RXW A;  2VV8 A;  4IVI A;  4F3L A;  4KG2 A;  5HZH A;  1K57 A;  1NXY A;  1XFQ A;  4II7 A;  1IKI A;  4EUZ A;  3QP2 A;  3SZT A;  3IX8 A;  1QMF A;  3LUQ A;  3LCE A;  3IWQ A;  5FDH A;  3FYZ A;  5TBM A;  3S7N A;  1YMX A;  1CJF A;  4PM8 A;  4S2K A;  3VFF A;  1YSP A;  5KZH A;  5AJG A;  1OT6 A;  3NI9 A;  4WMC D;  3SH8 A;  4OQI A;  4BD1 A;  2I9V A;  2YKF A;  3ZQ5 A;  1IEL A;  1IYP A;  2EX8 A;  3IF6 B;  1W63 Q;  1ZHH B;  2EA9 A;  2Y8H A;  1XKZ A;  4ZJ2 A;  5TGF A;  3PBT A;  3BQA A;  5A90 A;  3IQA A;  2EFX A;  3DAV A;  1VET B;  4G3V A;  4DRT A;  4BEN A;  2QMI A;  3GRJ A;  1ES3 A;  4QU3 A;  3IX3 A;  4GDN A;  4A5R A;  3VOL A;  4N1H A;  5HW3 A;  1NLZ A;  3FC7 A;  2QJ5 A;  3BWL A;  4EBN A;  2O9B A;  2VV7 A;  5FEF A;  3F1N A;  4R23 A;  1GA0 A;  3UDX A;  3V3R A;  2WGW A;  2WZX A;  3NUL A;  3R7W B;  3B33 A;  2PRF A;  3VSK A;  2B95 A;  3SS3 A;  1OTA A;  4XT2 B;  2ZLY A;  3HJI A;  3WS5 A;  1PFL A;  3W4P A;  1N9O A;  4BD0 A;  4UEY A;  3LR5 A;  4Y2F A;  4EER A;  1YLT A;  2O9A A;  5CHJ A;  5EVI C;  4EQI A;  4M4X A;  5J8X A;  4E3I A;  1T1B A;  3HL9 A;  5CEC A;  1WYB A;  3U2A A;  5TFQ A;  2GZA A;  5F83 A;  3IWI A;  4UQI S;  1K25 A;  2HP9 A;  5J3W A;  4QY6 A;  1V9Z A;  1J3W A;  1P0Z A;  2B18 A;  1L0E A;  4QWO A;  1ALQ A;  1MKM A;  4RA7 A;  5A93 A;  4RX3 A;  5A92 A;  5K5B A;  5FAS A;  1IYO A;  4ZJ1 A;  4PKY G;  2P9V B;  4HNB A;  2W1R A;  2EX6 A;  2QWS A;  1H8Z A;  3DTI A;  4HBU A;  4XUX A;  2HJE A;  4WZ5 A;  2XGN A;  3EGD C;  3LID A;  2RCX A;  1K56 D;  4CJN A;  3NCK A;  2R9X A;  4E3J A;  3M2K A;  1XJ4 A;  4MEZ A;  2K31 A;  4C6Y A;  2X02 A;  5D3O A;  3FKW A;  3ZG5 A;  4R3J A;  1K0K A;  5FL3 A;  2WK0 A;  2HDR A;  1XJ6 A;  2JKT I;  2WZZ A;  1DP6 A;  4MNR A;  5FI6 A;  4X56 A;  3G2Y A;  3MBZ A;  3R4K A;  2ZMA A;  2ZJ9 A;  2W3E A;  1IFQ A;  2A24 A;  3HLB A;  5M1A A;  1TS6 A;  3SS5 A;  2W1T B;  3MKF A;  1MWS A;  2WGI A;  4HJ6 A;  3GQZ A;  2D02 A;  4X6T A;  3Q1F A;  1HLU P;  1W8Q A;  3MR0 A;  4BLM A;  1PIO A;  2XH9 A;  2ZL1 A;  3VFH A;  4B4X A;  1KGG A;  5FQK A;  3RH8 B;  3DBA A;  4U3T A;  3A3J A;  5DKK A;  5L09 A;  1LL8 A;  1G6O A;  3BFG A;  3H82 B;  3EOI A;  3CI6 A;  4KZ3 A;  2ZC4 B;  3KYQ A;  2C5W B;  4E6X A;  3OCN A;  1VET A;  3WS0 A;  5DJT A;  1GSV A;  2JKT M;  5CGX A;  1FR6 A;  1NWZ A;  1PRQ A;  4CLC C;  2G7U A;  2X01 A;  4R6L A;  1Y4O A;  2ZQA A;  1ERO A;  2HP6 A;  5EM0 A;  4E3O A;  5JYP A;  1E4D A;  3S4X A;  2ZM8 A;  3C4P A;  2XA7 S;  3A0S A;  2XR0 A;  4DMZ A;  2W3H A;  2DMW A;  3A3I A;  5GHZ A;  2WKR A;  1N4O A;  1CK3 A;  4IVK A;  3D72 A;  4R38 A;  2WAD A;  5TR7 A;  4XT2 A;  3T12 B;  2ZQC A;  3O3V A;  3MXS A;  4KUO A;  4LEN A;  4E3K A;  3FG8 A;  2Z6C A;  3MJQ A;  3UE0 A;  5HAI A;  4Q8I A;  1L0F A;  3UN7 A;  2J3T D;  3E98 A;  1TVF A;  3LYX A;  1Y28 A;  3ULF A;  5CEB A;  1KDW A;  1K6S A;  4IBR A;  1YMS A;  5CHM A;  2OWJ A;  3UB9 A;  1UWP X;  2FFY A;  3TG9 A;  5MC7 A;  3MZE A;  1ZG4 A;  1XGI A;  5F68 A;  3SH7 A;  2W3D A;  1IOU A;  5GLD A;  2HDQ A;  2Y55 A;  1W8Y A;  5F1G A;  2WKQ A;  1OTB A;  2JKG A;  2VK3 A;  4JXS A;  2P9V A;  3MQ0 A;  2B02 A;  5CX7 A;  2J9P A;  4GJ4 A;  3JVU A;  1T1C A;  3PHY A;  1F98 A;  4NK3 A;  4Q0J A;  3BJN A;  2V9A A;  3IXD A;  1EI5 A;  4WMC A;  3RFB A;  4AFI A;  1DP9 A;  1S1Z A;  1GHP A;  4ETX A;  1OPX A;  2Z2M B;  1X0O A;  4P0M A;  5I94 A;  1C3B A;  2OWH A;  1TS8 A;  2V1Z A;  4DXC A;  3C38 A;  3Q7V B;  2X71 A;  1ERM A;  4JGO A;  5KSC A;  3C30 A;  4N92 A;  3OCL A;  1VM1 A;  3UPO A;  1K57 C;  2ZBB A;  3RJU A;  1ZTU A;  1E25 A;  2W1T A;  4OQH A;  2Q9M A;  3TOI A;  1JWZ A;  3IBR A;  2P08 A;  4IHQ A;  3LGO A;  1WE4 A;  5DF8 A;  2JBF A;  2IWD A;  1FIK A;  4DDY A;  4YNR A;  2WGV A;  4GS9 B;  5CTM A;  3LO7 A;  1G5U A;  4NXF A;  3QNC A;  1E3U D;  2O9C A;  2VGJ A;  2R78 A;  4X1L A;  5EFW A;  2G2W A;  3NY4 A;  3C2W A;  4R3B A;  1FSW A;  5U47 A;  1YT4 A;  3N6I A;  1K4E A;  1YLZ A;  3EWK A;  3T4L A;  5AVF A;  3IBJ A;  2PBD P;  2WKE A;  3F1P B;  1JTG A;  1LI0 A;  3MZD A;  4EQ1 A;  3BY8 A;  2KDK A;  5FAQ A;  3TJZ C;  5HSQ A;  3MS6 A;  4FD8 A;  2CC1 A;  2O99 A;  3LR0 A;  3NIA A;  4GW9 A;  4QJG A;  3K2N A;  1K56 A;  1TD5 A;  5M19 A;  4OKP A;  2Q0O A;  2KX6 A;  3WS4 A;  4GHI B;  4LFU A;  3IH8 A;  1GCE A;  3A0V A;  3O86 A;  3GDI A;  4KZ6 A;  2E8J A;  4MLL A;  2OV5 A;  5HDD A;  5EEC A;  1BYW A;  3T1Q B;  1L0G A;  4G3W A;  1W5D A;  3BW6 A;  5E2E A;  1I2W A;  4QB8 A;  4NKP A;  3N8S A;  1YM1 A;  2ZM0 A;  4FUW A;  4OLD A;  5DTT A;  3SOI A;  4JGQ A;  3ZGA B;  4OLG A;  3E4O A;  4EEU A;  1XPB A;  1OTI A;  1N9L A;  4ZTK A;  4WZ5 C;  3IHB A;  4D60 A;  1I2S A;  1NY0 A;  2UWX A;  3B3X A;  3UB5 P;  4IUK A;  1BLH A;  4YOF A;  3MFD A;  3T1S A;  1SDE A;  1HZO A;  2PDR A;  5J7E A;  3UE3 A;  2JKF A;  3BEB A;  1DJA A;  1S0W A;  1YAX A;  5HWV A;  3VP1 A;  3VE4 A;  4PPR A;  1P9R A;  2OAQ 1;  3C4O A;  4G3K A;  3ZG7 B;  4BL2 A;  1YQS A;  4H6J B;  3Q7V A;  1VEU A;  4P6Z S;  3S7Q A;  5CHU A;  4KZ9 A;  4CPK A;  1BLC A;  3H7W B;  4S2N A;  4KZA A;  2V8C A;  5G4Z A;  4P6B A;  3HUO A;  1MKI A;  4X53 A;  1KGE A;  4B4Z A;  4C3Q A;  2XSS A;  1CI8 A;  3E4P A;  1FIL A;  4Y15 A;  4X25 A;  1L0D A;  2XEP A;  1TS7 A;  2H0T A;  4OOL A;  1MWT A;  3UE1 A;  3UO9 A;  3UB7 A;  4GZB A;  2R9W A;  1OJ5 A;  1LLB A;  5DKL A;  4EEP A;  4GS9 A;  3LEQ A;  4GB7 A;  1SZV A;  4NG2 A;  3GR2 A;  3IT9 A;  2KLI A;  4EUV A;  1D1J A;  4KZ7 A;  5BOH A;  4YFM A;  4S2O A;  3IX4 A;  1JTD A;  3NJA A;  3I7J A;  3C7V A;  2JHE A;  5G18 A;  3RXX A;  5M18 A;  4NXG A;  4ZDX A;  2Y2J A;  4HES A;  3BLS A;  4LRZ E;  4QD4 A;  4MDZ A;  4E6W A;  2Y2P A;  1YLY A;  4KZ4 A;  2P7J A;  4OOM A;  3AGD A;  4Q0H A;  3BQ8 A;  5TJJ A;  3IF5 A;  2Y79 A;  3IH9 A;  2XQZ A;  3FZC A;  4LV0 A;  4OON A;  3ZNY A;  3VOY A;  4C75 A;  3BFD A;  4OP8 A;  4LLO B;  2HF6 A;  3CLO A;  4L9G A;  4GHI A;  4CLC E;  1WYC A;  3O5Y A;  4O0P A;  5L07 A;  1XP4 A;  1ZKJ A;  3M6H A;  1BT5 A;  2KOI A;  4GKU A;  4L9F A;  2YKH A;  1LL5 A;  1NRF A;  3C5A A;  1RCJ A;  3C8C A;  3UNW A;  2EX9 A; 
#chains in the Genus database with same CATH homology
 3D72 A;  4R38 A;  4ARZ A;  4XT2 A;  3EQU A;  3MXQ A;  4K08 A;  4KUO A;  2VLG A;  3FG8 A;  2Z6C A;  3MJQ A;  4L0L A;  4WLA A;  3T4S A;  4FOF A;  2W3F A;  3SW1 A;  3PR6 A;  4EET B;  2J3T D;  3E98 A;  3LIF A;  4MMN A;  4CLC A;  3UMD A;  3LYX A;  1Y28 A;  2A24 B;  3ULF A;  4DJ3 A;  2K2N A;  2VZW A;  2V0W A;  5HPF A;  2VGL M;  3PYP A;  4B9O A;  3T4Q A;  4FSF A;  2OWJ A;  3B47 A;  3UB9 A;  1UWP X;  4HP4 A;  4HJ3 A;  3KSI A;  5MC7 A;  5I5L A;  5F68 A;  1UGU A;  2W3D A;  3K3D A;  1IOU A;  3HJK A;  3TRC A;  4EW7 A;  3FPW A;  1KOU A;  1JNU A;  3F1O A;  2WKQ A;  1NRJ A;  1OTB A;  3OLO A;  3EEA A;  3ICY A;  4HJ4 A;  4WL9 A;  4HHD A;  3MQ0 A;  2VJW A;  2VKS A;  3NHQ A;  2B02 A;  5CX7 A;  1YSQ A;  3PBQ A;  2NUP C;  3KX0 X;  2NUT C;  2K7S A;  4GJ4 A;  2PR6 A;  3JVU A;  1T1C A;  3PHY A;  1F98 A;  4Q0J A;  1LT0 A;  3F1P A;  1F9I A;  3BJN A;  2V9A A;  4I39 A;  4YWZ A;  1S67 L;  1D7E A;  3RFB A;  4AFI A;  1DP9 A;  1S1Z A;  2M7U A;  3K3C A;  5HPI A;  1F5M A;  3T50 A;  4L9E A;  2V1B A;  4MN5 A;  3S7P A;  2W0N A;  4ETX A;  2W3G A;  4BBV A;  5F5Y A;  5IS1 A;  5HD3 A;  1OPX A;  3T4J A;  1X0O A;  1N9N A;  2JKR I;  4HY8 A;  3T4K A;  4I38 A;  3CUE C;  1D06 A;  2OWH A;  2VGL S;  3KYZ A;  1TS8 A;  2XRO A;  4ARZ B;  3IS2 A;  3C38 A;  2L1M A;  2IA2 A;  4JGO A;  2QKP A;  3C30 A;  2H28 A;  3OCL A;  4GCZ A;  4O01 A;  2VX8 A;  3KSG A;  2VV6 A;  4B93 A;  4CLC B;  3OOV A;  3A0R A;  3MMH A;  1LSW A;  2ZBB A;  1ZTU A;  2W1T A;  1TS0 A;  3EEH A;  4CLC D;  4NXE A;  3PXP A;  3E0Y A;  3KSF A;  2EWV A;  1ODV A;  2O0Y A;  2XRN A;  3IBR A;  3R7W A;  5KSH A;  4ME4 A;  3UME A;  3FPV A;  2P08 A;  4EXO A;  4IHQ A;  2LB9 A;  3NOU C;  4Y5F A;  4WUJ A;  4MCW A;  4R70 A;  3LFV A;  4I3A A;  4WEL A;  5HDC A;  2HJ9 C;  4EU0 A;  3GEC A;  3CUE A;  4WEK A;  2OAP 1;  4YNR A;  4BBT A;  4GS9 B;  3KO6 A;  2FZ0 A;  1P97 A;  1WA9 A;  4BMW A;  1LSX A;  4NXF A;  2O9C A;  3F1O B;  2R78 A;  4MN6 A;  1GSX A;  5EFW A;  5HD5 A;  2JKR M;  3EQV A;  3KSH A;  4GLQ A;  4HIA A;  3C2W A;  1DRM A;  2ZMV A;  4KUK A;  3TW8 A;  1W63 M;  1T1A A;  1H3Q A;  1MZU A;  2VV8 A;  4F3L A;  5HZH A;  1XFQ A;  4II7 A;  2A2L A;  4DJ2 A;  3T4L A;  1GSW A;  3EWK A;  5AVF A;  3LUQ A;  3IBJ A;  5TBM A;  2ZOH A;  3F1P B;  3S7N A;  4DN0 A;  5F69 A;  4EQ1 A;  2J80 A;  3BY8 A;  1YSP A;  2GX5 A;  5AJG A;  1OT6 A;  3CAX A;  4Y3I A;  1VHM A;  2KDK A;  2VA0 A;  5C5K A;  2W27 A;  2V1A A;  3TJZ C;  5HSQ A;  3VV4 A;  1UWN X;  2I9V A;  2YKF A;  3ZQ5 A;  4NEE D;  3HCY A;  3EGX C;  4ZRR A;  3VE3 A;  1W63 Q;  1ZHH B;  2EA9 A;  2Y8H A;  2O99 A;  3LR0 A;  4UQI M;  2L4R A;  3CIT A;  3PBT A;  4GW9 A;  2M7V A;  3BY9 A;  1V9Y A;  3BQA A;  4PHT A;  4HOI A;  3MFX A;  4H6J A;  4G3V A;  5DFX A;  3K2N A;  3IS2 B;  3TE8 A;  1TD5 A;  3H7W A;  2KX6 A;  4BBU A;  4GHI B;  3VOL A;  1XJ2 A;  1NLZ A;  3FC7 A;  2QJ5 A;  3BWL A;  3G6O A;  2O9B A;  3A0V A;  1NLY A;  4ETZ A;  3GDI A;  3MQQ A;  2VV7 A;  1LSV A;  1S66 L;  3F1N A;  3PBN A;  5HDD A;  1BYW A;  2JN7 A;  1P9W A;  4G3W A;  3R7W B;  1DP8 A;  1T18 A;  3B33 A;  3LIC A;  2VEA A;  2PYR A;  3BW6 A;  4P6Z M;  2PD7 A;  2PR5 A;  4NKP A;  1OTA A;  4XT2 B;  3H9W A;  4O8G A;  3HJI A;  2L0W A;  1N9O A;  4UEY A;  2ZOI A;  1S1Y A;  1G28 A;  2J3W A;  3LR5 A;  4Y2F A;  4EER A;  3NOP C;  4JGQ A;  2O9A A;  1XJ3 A;  3E4O A;  4EEU A;  5HWT A;  3LR3 A;  4M4X A;  1OTI A;  1N9L A;  2HGV A;  4LRY C;  1T1B A;  5DF9 A;  4I5S A;  3S7O A;  5IT5 A;  4KQO A;  3U2A A;  2D01 A;  2GZA A;  4IUK A;  4UQI S;  4F3L B;  5A8B A;  4YOF A;  5J3W A;  1V9Z A;  1P0Z A;  2B18 A;  1H8M A;  2PDR A;  4IUH A;  2PYP A;  5J7E A;  2BAS A;  3UE3 A;  4HH2 A;  5J4E A;  2FH5 A;  1MKM A;  4NXB A;  5L8M A;  3ZYT A;  4WEJ A;  5K5B A;  2QYB A;  1YAX A;  1T19 A;  3H82 A;  1OTD A;  1TF1 A;  5HWV A;  3VE4 A;  4PKY G;  3P7N A;  1P9R A;  2LB5 A;  1EW0 A;  2OAQ 1;  1STZ A;  4G3K A;  2J3T C;  1OTE A;  3LR4 A;  5DFY A;  3LI8 A;  4HNB A;  2W1R A;  5HWW A;  3UB8 A;  4WF0 A;  2QWS A;  4H6J B;  2QHK A;  4LRX C;  4P6Z S;  4BWI A;  3S7Q A;  2HJE A;  3EGD C;  3H7W B;  5AVE A;  3LID A;  3NOT C;  4EES A;  4WN5 A;  5G4Z A;  3D3O A;  3PBS A;  2EWW A;  1XJ4 A;  3MF0 A;  3T4T A;  2K31 A;  3MQO A;  2XSS A;  5DJU A;  1S4R A;  3E4P A;  3F1N B;  4HH3 A;  4LPZ A;  3RTY A;  4IJG A;  1S4S A;  5FL3 A;  1TS7 A;  1XFN A;  4OOL A;  3UB7 A;  2V0U A;  1OJ5 A;  1XJ6 A;  4PAU A;  3PBO A;  3UE6 A;  2JKT I;  4HQA A;  5DKL A;  4EEP A;  2PT7 A;  3LIA A;  4GS9 A;  1DP6 A;  2PHY A;  4RQ9 A;  2XA7 M;  2WKP A;  1VB6 A;  3E4Q A;  3R4K A;  3LI9 A;  2P04 A;  2W3E A;  2KLI A;  4EUV A;  4BJP A;  5HL6 A;  1IFQ A;  4HP9 A;  3PBR A;  2A24 A;  3NJA A;  2JHE A;  2QJ7 A;  1TS6 A;  2W1T B;  4HJ6 A;  3V67 A;  2D02 A;  1YKD A;  4NXG A;  2GJ3 A;  2HV1 A;  4MN7 A;  3JVV A;  5F6A A;  2Z6D A;  3MR0 A;  4JGP A;  5LBR A;  4LRZ E;  1OT9 A;  4MDZ A;  4Z1W A;  3RH8 B;  3DBA A;  4QPR A;  4CQH A;  2P7J A;  5DKK A;  4OOM A;  1MC0 A;  1LL8 A;  3OC2 A;  4Q0H A;  1G6O A;  3W2Z A;  3LIE A;  3BQ8 A;  3H82 B;  5TJJ A;  3EOI A;  2Y79 A;  2CMN A;  3CI6 A;  3LIB A;  3KYQ A;  4I3I A;  4E04 A;  4HI4 A;  2MJ6 A;  4R3A A;  2PD8 A;  3OCN A;  5DJT A;  1GSV A;  2JKT M;  1NWZ A;  5IU1 A;  4LLO B;  2HF6 A;  2GNX A;  4CLC C;  3CLO A;  2G7U A;  4L9G A;  4GHI A;  4R6L A;  4CLC E;  5TBM B;  2ZMF A;  5KIZ A;  3O5Y A;  4O0P A;  3OBF A;  3UB6 A;  2XA7 S;  3A0S A;  1OJG A;  5G4Y A;  4DMZ A;  2W3H A;  2DMW A;  3T4O A;  2M1C A;  3B42 A;  3CWF A;  2KOI A;  4L9F A;  4Q0I A;  2INW A;  2YKH A;  2OOL A;  5HDS A;  4I3J A;  4PKY A;  2WKR A;  3C8C A;  4KQD A;  3P01 A;  4JGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...