3OOVA

Crystal structure of a methyl-accepting chemotaxis protein, residues 122 to 287
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
164
structure length
164
Chain Sequence
QISSRIQKSIDVDEVLRLCAEGLHDVLGYERVNILMADTARTSLSFVAAVGTADFNPAGVVLPLDQRGGVITKCFTDRQVYMIDDVSAYPTDFRLQSPYDAIRALRSKSFVICPIVVKGEAIGVFAVDNRSSRRSLNDTDVDTIKLFADQASSAIVRINLLKAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyl-accepting chemotaxis protein, putative
publication title Crystal structure of a methyl-accepting chemotaxis protein, residues 122 to 287
rcsb
source organism Geobacter sulfurreducens
molecule tags Signaling protein
total genus 49
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3oovA00
4O01A 4R6LA 4CQHA 2VZWA 3KSHA 2VEAA 4Y2FA 2G7UA 3ZQ5A 2GX5A 4YNRA 4Z1WA 4Q0JA 2XROA 4MCWA 2LB9A 3S7NA 3R4KA 4G3VA 4BWIA 1STZA 3E98A 1ZTUA 2K31A 4G3KA 2LB5A 2W1TB 4RQ9A 1MC0A 4ZRRA 4EU0A 3NOPC 1F5MA 3VV4A 2Y8HA 3KSIA 2K2NA 3NOUC 4MDZA 3S7QA 4PAUA 3OOVA 2O99A 2ZMFA 5DFXA 2KOIA 3EEAA 2VJWA 4LRXC 4Y3IA 3K2NA 3S7OA 3G6OA 4ME4A 4GLQA 4MMNA 4E04A 3CITA 5AJGA 4DN0A 4YOFA 4Y5FA 5HPFA 4IJGA 2W3HA 3KO6A 5HPIA 4ETXA 2W1TA 5LBRA 4G3WA 2W3DA 5TJJA 3MF0A 1VHMA 4GW9A 5L8MA 3DBAA 2W3EA 2QYBA 5C5KA 1TF1A 2KLIA 2W1RA 4QPRA 2O0YA 2OOLA 2M7VA 1YSPA 2O9CA 4MN7A 4Q0IA 3LFVA 3O5YA 4EUVA 5DFYA 3NOTC 3MQ0A 4Q0HA 3OBFA 4FOFA 4O0PA 3RFBA 2W3GA 3IBJA 3KSFA 2O9BA 5HSQA 1MKMA 5I5LA 2VKSA 1YSQA 4O8GA 3CI6A 4LRZE 3D3OA 4LRYC 3KSGA 3IBRA 4ETZA 1YKDA 3C2WA 3E0YA 3BJNA 3HCYA 2B18A 2M7UA 2XRNA 2IA2A 3NHQA 2O9AA 5K5BA 4IUKA 3TRCA 2XSSA 3MMHA 2HGVA 4DMZA 5HL6A 2W3FA 2Y79A 1TD5A 4R70A 3S7PA 4IUHA 3W2ZA
chains in the Genus database with same CATH superfamily
3PBNA 5I94A 3CAXA 3QP1A 3G35A 4FH4A 1ZKJA 4GNUA 3F1OA 5CTNA 2WKRA 1FILA 3IF5A 4OH0A 4BJPA 1ZTUA 3WRZA 3T1SA 5FEGA 3PYPA 4BBUA 1TEMA 4EWFA 4FD8A 1SKFA 1F5MA 3WS4A 5CGWA 3TG9A 4K08A 3V3SA 3B42A 3S7QA 2O99A 2ZMFA 2ZC5B 3GTCA 1QMEA 3VFFA 2P9VB 4EETB 1NXYA 3CLOA 3Q7VA 4YOFA 3W4QA 4JKTA 3GDIA 4WYYA 4EEPA 3WWXA 4MNRA 4ETXA 2VGJA 4WLAA 3NI9A 4OOMA 1XA7A 1WYBA 1FR1A 2X01A 1ZC2A 2QMIA 2J9PA 3UDFA 2PBYA 2EXBA 5E2FA 1MWSA 4K0XA 5CHUA 3A0RA 4R23A 2RCXA 3PXPA 5BOHA 3V39A 5CHMA 1P0ZA 3LICA 3VP4A 2Z2MB 1TDGA 3NC8A 5FEFA 4P85A 2W3FA 4BMWA 3SZTA 4WN5A 1IOUA 2XEPA 4H6JB 1FSWA 4YNRA 1DJAA 1BUEA 1IYQA 3SH7A 4NXEA 2PU2A 3UE3A 2ZC6B 3B3XA 4D2OA 2A49A 3P7NA 1BYWA 1D06A 1K6RA 4GHIB 4DF6A 1JNUA 3KSIA 2XH9A 1EROA 2Y2GA 1K57A 1WE4A 5CX7A 4GB7A 2KOIA 3VP2A 3G6OA 4XT2B 1SZVA 4MMNA 3VFHA 4CLCE 2L0WA 3FPWA 3HUMA 3LEQA 1VHMA 5DTSA 4OQHA 1ES5A 2OWHA 4S2KA 4MN7A 4GKUA 1HD8A 3O5YA 3TSGA 3UMEA 1L0GA 5HWVA 4OVDA 4O0PA 4WL9A 4R0QA 1K54C 1XFNA 3F1PA 4M3KA 3CI6A 5HAPA 5CTMA 2J80A 5F69A 2BTFP 3IT9A 4QHCA 4QY5A 1JWPA 1ERMA 4HJ4A 3MZFA 2A24A 3DTIA 2XSSA 1ONHA 5FQQA 4DE1A 4KZ3A 4WMCD 4GOGA 3G31A 3CZDA 5F82A 1W5DA 2XGNA 3W2ZA 2VLGA 3T4SA 4LPZA 3IHAA 4Y2FA 2G7UA 3UMDA 4L9GA 2JCHA 4IBRA 3IWIA 1CEGA 4DJ3A 3E4PA 3F1OB 5FI2A 1NRJA 1NY0A 3MXRA 3LIAA 4HQAA 1RCJA 2OAQ1 5M1AA 5FQIA 1YM1A 2ACGA 4Y0TA 2J8YA 3KYQA 1BLHA 4R1GA 4DJ2A 1S0WA 3PAEA 1IKGA 1TS0A 2QKPA 2WAEA 3CWFA 2DNSA 4PAUA 5DFXA 3MQOA 2VJWA 1M40A 3M2KA 4Y3IA 1VQQA 2JKGA 1F2KA 4JGPA 4LV3A 3IXDA 1LSXA 2JHEA 1MWRA 2XA7S 2ZJ9A 1GHMA 1KDSA 2HP6A 4KQOA 2W1TA 4ZBEA 1T1BA 2QYBA 4KG2A 3U4LP 1W63M 5F1GA 1BLCA 1H8MA 4BLMA 3DTMA 3HBRA 3E2KA 5EV0A 4EESA 1S67L 3P09A 1K54A 1XJ3A 3LIFA 3SW1A 4FOFA 3OPLA 1OTAA 3SS3A 1OTBA 4NKPA 2ZC4B 2VKSA 3BFCA 1BULA 2EWVA 4IHQA 3BEBA 4EBNA 2Z6DA 3H9WA 1CEFA 4I39A 4ESPA 3VMAA 3MMHA 1L2SA 1L0EA 4L9EA 4A5RA 1ZHHB 4EERA 4F94A 3C4PA 1ESUA 2R78A 3O88A 3C5AA 1YMSA 1CJFA 4KENB 5AVFA 4JLFA 2IWBA 1Z6FA 3HUNA 4N1XA 4JXWA 4OQGA 3MZEA 4MCWA 3ICYA 5HARA 2ZQ8A 4B88A 5F6AA 4OPYA 4HH3A 2H5SA 3Q1FA 4CLCB 1Q2QA 4S2PA 5J3WA 2EFXA 3T12B 1Y4OA 3BWLA 5GLAA 3BFDA 4ZAMA 1MPLA 2FH5A 4KZ9A 3A3IA 4X1MA 5HD3A 3NY4A 2MJ6A 5A93A 4OP5A 1YMXA 4LGWA 3MS6A 2ZC7A 1ZG4A 5GHYA 5FASA 4G3WA 3ZG8B 1NJ4A 2PR5A 4GW9A 4AFIA 3SOIA 2O0YA 4WEKA 2INWA 2VGLM 5DFYA 1YLZA 1TS6A 2OLVA 4OOLA 1S1ZA 1D1JA 2P9VA 2ZM0A 2GZAA 3OPPA 2VA0A 4PHTA 4OQ0A 1E3UA 1GSVA 4LV1A 1MKMA 1HVBA 1YSQA 4OQIA 1G5UA 1T19A 2J3TD 3BECA 4PM7A 4PM5A 2Y2MA 5HWWA 4EXOA 4X69A 5K5BA 3TRCA 3H82B 3UDXA 3UE1A 2WGWB 4GJ4A 4S2NC 1V9ZA 3S7PA 3ZQ5A 5GHZA 4CQHA 4OOYA 2VEAA 3IX4A 5HW3A 2JBFA 5HWTA 4HESA 4DRTA 1LSVA 4DDSA 2GDNA 1S6RA 3BLSA 5CRFA 4R4SA 2X02A 1G6AA 4NXGA 5HL1A 1BZAA 3Q81A 5F83A 3LI9A 4MDZA 5IT5A 1ALQA 3EEAA 3DTEA 4MEZA 4KQRA 3G32A 3T50A 4GDNA 5EVIC 1IYPA 5HPIA 4B4ZA 4R4RA 3NJAA 4GHIA 3VOLA 3Q7ZA 4BENA 3CUEC 5FAPA 4Q0IA 4E3OA 3NOTC 3T4TA 3UDIA 4XT2A 1YLYA 3RFBA 2HP5A 5KSHA 2UV0E 5CECA 2P7JA 4O8GA 5FQJA 5E43A 4LRZE 3RH8B 3IF6B 1RP5A 2V0UA 1Y28A 2WGIA 1I2WA 4ETZA 3WS0A 4BBTA 1JTDA 2CMNA 2ZM8A 3G34A 2HDUA 4S2JA 3NCKA 2G2UA 1XGIA 2EA9A 1MZUA 4S2NA 2DMWA 2JKRM 2QWSA 1OT6A 4KG5A 2Y79A 3PBOA 2QJ7A 2Z2LB 4NXBA 3Q82A 1H3QA 1VB6A 4I38A 1GSWA 5A8BA 3P01A 4KZ4A 2WADA 5FAQA 4BL2A 5DF9A 2JC7A 4GCZA 2PD8A 5DTTA 2FFYA 2V9AA 2GNXA 3BY9A 2WYXA 2JN7A 5CEDA 3OPHA 3OCLA 3M6HA 4DXBA 3VSKA 1XFQA 5AVEA 1XJ6A 3LR0A 3UB9A 2V1BA 3M2JA 5FL3A 2C5WB 4GD8A 3PTEA 4KG6A 4LV0A 2E8JA 3E4OA 3M6BA 1FIKA 5EVIA 4BBVA 3CITA 4OLGA 4DN0A 3BM6A 2IWDA 2VX8A 5HPFA 3D4FA 4KQDA 1K6SA 4CLCC 5LBRA 1FCMA 5AQ7A 5TJJA 1ACFA 2BG1A 3ZVWA 3CUEA 4LCMA 1WA9A 4ZTKA 3V50A 4EUVA 4M4XA 3PBTA 3ZVTA 3A3JA 4Y17A 2V2FF 4ZJ3A 2J3WA 2PYRA 2X71A 2W3GA 5M19A 1VM1A 4XUZA 1LL5A 4K91A 1L0DA 1BLPA 3HLWA 4ZJ1A 1H8YA 3LCEA 1BTLA 3TOIA 3GVBA 3HCYA 3ITBA 5IU1A 3BFFA 4X55A 3PR6A 3D72A 3QP4A 3NHQA 1DJCA 2C6WB 2R9XA 3C30A 2HGVA 1DRMA 5FA7A 2V0WA 2Y55A 3CJMA 3V3RA 1PNEA 4FSFA 2GX5A 4BD1A 3GECA 4I3IA 1DY6A 4DXCA 2LB9A 1K25A 5FDHA 4HI4A 3GMWA 3UB6A 2HF6A 1XGJA 1FCNA 4R3AA 4YINA 2OV5A 4OP8A 1PWCA 5GHXA 2OAP1 3SH9A 2UWXA 1Q2PA 1D7EA 2H10A 1OJGA 4LRXC 1MWTA 4QJGA 3S7OA 4JF4A 2WKHA 5EOOA 1ES4A 5EM0A 3C8CA 3B33A 4K0WA 3LIDA 3LGOA 5AJGA 4CLCA 5GLDA 3IXHA 4R3JA 3FZCA 1IKIA 3LY3A 2YKHA 1KVLA 3VOYA 1YLTA 1KE0A 4L0LA 1ES2A 2Y91A 1KGEA 2ZL1B 1PW1A 4QY6A 4UQIS 2HDRA 3PBSA 4GZBA 2B95A 5L07A 2Y2KA 3OC2A 3OBFA 4JBFA 1HLUP 3IXBA 1G6OA 2JKTI 2W27A 4OPRA 3O86A 3LY4A 1XJ2A 2ZOIA 1YKDA 1Z09A 2VV8A 2PT7A 1X0OA 2OLUA 5J4EA 1S4RA 2O9AA 2Y2QA 2ZM2A 4DKIA 5TBMB 4UA6A 4ZDXA 3IS2B 3ZCZA 4B93A 5CGSA 2WKQA 1MKIA 1LI0A 1NZUA 1KGGA 1T1CA 2XA7M 2FZ0A 4HP9A 3IF6C 2H0TA 1KDWA 2RL3A 1STZA 1I5QA 3H82A 4MBHA 3TE8A 3NBLA 5CHJA 1SKOB 2WGWA 5EUAA 2Q9MA 3C4OA 3HLEA 2Y8HA 5F1FA 3BQ8A 1QMFA 3N8LA 3OOVA 3FWLA 3K2NA 3VP1A 5EVIB 3BW6A 2ZLYA 4GLQA 4UAAA 5KSCA 5EPHA 3SH8A 5M18A 1UGUA 3C7UA 4R38A 4YWZA 3DBAA 2JKFA 1CI8A 2KDKA 3N4IA 5HX9A 4X56A 2Z6CA 1RGYA 3A3FA 2Y4AA 1OJ5A 4WMCA 4I3AA 4MBFA 5F68A 4WZ5C 2WKIA 4FH2A 3IQAA 3K3DA 2R9WA 3UPPA 4JF5A 2O9BA 1F9IA 2J9OA 4E3KA 5EVEA 4XUXA 1I2SA 4JXGA 4ZJ2A 3UB8A 1ESIA 1WYCA 3T1RA 1FSYA 4X6TA 2PAVP 3IHBA 2B5RA 4HOIA 3S1YA 3CHWP 4HHDA 2B02A 1TD5A 4WM9A 3ZNTA 4O01A 1NYYA 3K3CA 4EW7A 3HJIA 1VEUA 5EFWA 5DKLA 3IF6A 4WF0A 3JVVA 4Q0JA 1IYSA 2Y2OA 1AWIA 3SS5A 3E4QA 4G3VA 1ES3A 3MKEA 3QHYA 2VV7A 4HP4A 3W4PA 4LV2A 3WS2A 5TGFA 1PFLA 3UB7A 3UPOA 5HZHA 5FATA 4S2IA 1LSWA 4C6YA 1PWGA 4JGRA 3T4KA 4X1LA 4LCLA 2WK0A 1L0FA 4DE2A 4C75A 2J3TC 2ZQCA 2I72A 2J7VA 3CG5A 1HZOA 4S2MA 3HLGA 4WUJA 5C5KA 1GA9A 4P87A 4JXSA 1JWVA 3GV9A 3LIEA 3ZG9B 1XPBA 1LT0A 4IEDA 4WZ5A 1G68A 2D02A 1W8YA 3SS4A 4KZ5A 5J8XA 2NUPC 1LI9A 5FAOA 1H0MA 4EEUA 1E3UD 3C2WA 2BASA 1N9OA 2W0NA 3IWQA 5CXWA 1O7EA 3HL9A 4R3BA 3ZG7B 3NULA 3OZHA 1XP4A 1CF0A 4QU3A 2VK3A 3KSHA 3QP6A 4P0MA 4NETA 4CPKA 3N8RA 4EQIA 4NEED 4Y0OA 1DP9A 3QP2A 2A3UA 1K56D 4E3NA 1OTEA 3HLCA 2EXAA 3ZHHA 1IFQA 2Y2IA 3FKVA 1DP8A 4X25A 3G2ZA 3I7JA 2K31A 3UB5P 1OTIA 2EX9A 2LB5A 4F3LB 4B9OA 1NLZA 4X53A 4LENA 1PI4A 4HY8A 1H8ZA 4EQ1A 4HBTA 4ARZB 1U60A 1YQSA 3VSLA 1XA1A 3QP5A 5HAQA 3GQZA 2PYPA 2Y2NA 4N1HA 3MR0A 1E4DA 3A0SA 2EFUA 3VP0A 4LFUA 4E3MA 2Y2PA 1ERQA 1MXOA 4CJNA 2I9VA 4Y15A 5F5YA 4KZBA 4DDYA 2V8FA 3IBJA 4E6WA 4N92A 1EWZA 3BFEA 4Y0UA 2H0YA 4WBGA 3D3OA 4KZAA 4LRYC 5CEBA 1V9YA 3NIAA 1TS8A 1A0KA 2ZQ7A 5E2EA 4LLOB 2ZL1A 1BLSA 1K4EA 1SDEA 5AQBA 5MC7A 4R70A 4OPZA 1EI5A 3JVUA 2PD7A 2ZQ9A 4FCFA 1VEUB 3O87A 4UEYA 5TFQA 1DJBA 5EE8A 4BL3A 2H28A 1VETB 4NG2A 4L9FA 2ZQAA 3AGDA 5TBMA 3MXSA 5GLCA 1PZOA 5GLBA 3ZG5A 3IS2A 3G4PA 5D3OA 2GJ3A 3H7WA 1ODVA 3RJUA 2EX6A 2XD1A 3LIBA 2OWJA 1FR6A 5GL9A 4Y7PA 1N9NA 3EOIA 3A3EA 3HLFA 1YLWA 4ME4A 3WS5A 2NUTC 3ULFA 1CI9A 3MSHA 4JGOA 3IWOA 2V20A 5TR7A 5G4ZA 4Y5FA 1M6KA 1SKOA 1NRFA 3HLBA 1ONGA 1JVJA 4FUWA 3N8SA 4QPRA 4Y13A 2D01A 2XLNA 4EBLA 2O9CA 1T1AA 1S1YA 1SHVA 3LFVA 3HVFA 4Q0HA 4ID4A 1OTDA 2E8IA 3U2AA 1KOUA 1YLPA 3KYEA 3GRJA 5IHVA 1KGFA 2M1CA 4U0TA 3DTKA 3RTYA 2FFFB 1PRQA 3KYZA 1IELA 3E0YA 3WRTA 1EW0A 4UA9A 3OCNA 2L1MA 3IH8A 4IUKA 5AQ9A 2HPBA 1ZG6A 3MJQA 3VP3A 4P6ZS 3CPTB 4EUZA 1PI5A 4OPQA 4Z1WA 2DCFA 4S2LA 2XROA 1BT5A 2Y59A 1K57C 3NDGA 4KUKA 3JYIA 2ZQDA 1GHIA 4OKPA 5HD5A 4YFMA 1K4FA 1J9MA 4UQIM 3EEHA 4MLLA 3DWKA 4RQ9A 2HDSA 2WGVA 3KX0X 2WAFA 3EGDC 4PM6A 3VE4A 4HNBA 5DKKA 2WUQA 3EWKA 2WZZA 2PBDP 4E3IA 1Y54A 5EOEA 2ZBBA 4HEFA 1PW8A 1GA0A 4RX3A 4CLCD 3MF0A 3Q07A 4GN2A 1BSGA 2W3EA 2OOLA 1CQAA 1YSPA 1GSXA 2HZ5A 3S22A 4JF6A 4O7DA 3IXGA 4II7A 3QNCA 4HIAA 4RA7A 1YT4A 1F98A 5HSQA 2YKFA 2G2WA 1RGZA 3T4LA 1H5XA 2HP9A 4UHUA 2P08A 3OPRA 4U0XA 3BJNA 4GDBA 3LI8A 4MBKA 2Y2HA 2V1AA 4N9KA 1S4SA 1OMEA 3B47A 3E2LA 4HBUA 4DMZA 1KE3A 4BQMA 4PKYA 3UNWA 2XFTA 2VZWA 4PKYG 4HH2A 1O07A 3T1XA 3MFDA 2P74A 3LO7A 3IH9A 3V5MA 4Z9QA 4BWIA 5HFOA 1HTZA 3N7WA 2V8CA 1CK3A 3IX8A 1MC0A 1FCOA 3TW8A 1GCEA 3H7WB 3NECA 4ZRRA 5L2FA 3F1NB 4RX2A 2K2NA 4RVAA 1LL8A 4D60A 1L3LA 1FQGA 3BQAA 4I3JA 3BRMA 2K7SA 5HDDA 1NZOA 3UE6A 4E3LA 2HDQA 1MY8A 3DWZA 2AVXA 4E3JA 5A92A 1NYMA 2WKEA 1P97A 3PAGA 4WELA 2ZMVA 2XFSA 3HREA 4IVIA 4F3LA 2VV6A 4I5SA 4Q8IA 3IX3A 2XQZA 4C3QA 2Q0OA 1YLJA 3ZNYA 4ARZA 4KZ8A 2JE5A 1JTGA 2BLSA 3V67A 3BYDA 2PDRA 2V1ZA 1SCWA 5DJTA 3BFGA 2PR6A 3AGFA 2QHKA 3IBRA 2PRFA 4GS9A 5KIZA 3HUOA 4PMAA 3G2YA 4HJ6A 1PWDA 1K38A 1E25A 3LR4A 1W79A 3MZDA 2WKPA 5AQAA 5DJUA 5EECA 2IWCA 1XXMA 4IUHA 5FQMA 4R6LA 3JPUA 3LEZA 4MN5A 3GSGA 1LLBA 5HDSA 3EGXC 1OPXA 4PM9A 2PHYA 4PPRA 3E98A 3Q7VB 3DW0A 4OONA 3LUQA 3ZYTA 3QNBA 3ITAA 3G30A 4B4XA 1KVMA 1JWZA 3ZG0A 3EQVA 3NOUC 3QP8A 5DF7A 3N6IA 3OLOA 2ZD8A 4BD0A 4DE0A 3BY8A 1VETA 2EX2A 3T4OA 2Q9NA 1S66L 3UN7A 5FDSA 3A3DA 3C38A 3KO6A 4NXFA 1W7FA 5EM1A 2W3DA 5L8MA 2VGKA 3VE3A 2W1RA 2KLIA 3FV7A 2KX6A 2OSUA 4S2OA 4EBPA 3R7WA 1W8QA 4JGQA 5JYPA 5L10A 1K55C 3FYZA 2DRWA 2JKTM 3UY6A 3W8KA 1XKZA 5A90A 3DAVA 1YPRA 4WEJA 1TVFA 2HJ9C 1T18A 3C7VA 2XDMA 3KSGA 4MN6A 4EV4A 3CMZA 3TJZC 4RYEA 2CC1A 2B18A 1XX2A 1PIOA 1G28A 4H8RA 1UWNX 4IBXA 3D9YA 3T4QA 1PZPA 2JKRI 5DVAA 3AGEA 3T1QB 3HLDA 3MBZA 3LR3A 1OT9A 5DTKA 3R4KA 1FOFA 1NLYA 4QB8A 4U3TA 5JYOA 2HJEA 2A2LA 5HDCA 4G3KA 4JPMA 1TS7A 5G4YA 4EU0A 4E6XA 3VV4A 3CPTA 1SDNA 2WZXA 3MQQA 3PBRA 5FQKA 5HAIA 3FPVA 1P9RA 2EWWA 2XR0A 4E04A 3EQUA 3LYXA 2W3HA 3F1PB 1N9BA 4PM8A 2ZOHA 1K0KA 3GR2A 4IVKA 1K55A 2XF3A 4OLDA 2A24B 5CERA 3MQ0A 1LHYA 3PBQA 5J7EA 5FSRA 5G18A 5KZHA 1K56A 3FG8A 1LL9A 5I5LA 4P6BA 3LR5A 3A0VA 1GHPA 1YAXA 4GS9B 5DF8A 1J3WA 5FI6A 4X68A 5A91A 1C3BA 3ZDJA 1W63Q 4NK3A 2EX8A 2XRNA 5FQ9A 3HJKA 5HL6A 3FC7A 4QD4A 2Y2LA 2P04A 3UE0A 5EVLA 4H6JA 1NWZA 2VGLS 2XD5A 3MKFA 5FI7A 3ISGA 3S7NA 1N9LA 2QJ5A 1XJ4A 4UA7A 4KQQA 3NDEA 4QWOA 3P98A 5E2HA 2PU4A 1P9WA 2W1TB 1MWUA 4N9LA 4KZ6A 3NOPC 4KUOA 3W4OA 2XK1A 1TDLA 1IEMA 1IYOA 2ZC3B 2QPNA 3L9KA 1MBLA 3WS1A 4DE3A 3PHYA 4GD6A 4KZ7A 5KMWA 4IJGA 1PYYA 2Y2JA 3BLMA 1N4OA 3F1NA 1TF1A 1UWPX 3ZGAB 5E2GA 5IS1A 2ZMAA 2M7VA 4P6ZM 3UPNA 3R7WB 3VOZA 5CGXA 4WZ4A 5U47A 3L7HA 4FTXA 3KSFA 3T4JA 2QZ6A 3UO9A 1KE4A 5EVID 5L09A 2L4RA 3MXQA 3S4XA 3ZFZA 3RXXA 1AXBA 3RXWA 2M7UA 2IA2A 3O3VA 1DP6A 3MFXA 2HV1A 4XXRA 3FKWA 4HJ3A 4JXVA
chains in the Genus database with same CATH topology
4O01A 3PBNA 4CQHA 3CAXA 3K3CA 2VZWA 4PKYG 4EW7A 2VEAA 3HJIA 5EFWA 4HH2A 3ZQ5A 5DKLA 4WF0A 5HWTA 3JVVA 4Q0JA 3F1OA 1LSVA 3E4QA 4G3VA 2WKRA 4BWIA 2VV7A 4HP4A 1ZTUA 4BJPA 3PYPA 4BBUA 1MC0A 3TW8A 3H7WB 4ZRRA 4NXGA 1F5MA 3F1NB 3UB7A 2K2NA 4K08A 5HZHA 1LL8A 3LI9A 3B42A 1LSWA 4MDZA 3S7QA 3BQAA 5IT5A 2O99A 2ZMFA 4I3JA 5HDDA 2K7SA 3EEAA 4JGRA 3UE6A 3T4KA 3T50A 4EETB 3CLOA 4YOFA 1P97A 4WELA 3GDIA 4EEPA 5HPIA 4ETXA 2J3TC 2ZMVA 3NJAA 4WLAA 4F3LA 4GHIA 3VOLA 2VV6A 4I5SA 4WUJA 5C5KA 4OOMA 3LIEA 3CUEC 1LT0A 4ARZA 4Q0IA 3NOTC 3T4TA 4XT2A 2D02A 3V67A 2PDRA 5DJTA 3RFBA 2NUPC 2PR6A 5KSHA 3A0RA 2P7JA 2QHKA 4O8GA 4LRZE 3RH8B 3PXPA 2V0UA 3IBRA 4EEUA 1Y28A 4GS9A 1P0ZA 3LICA 4ETZA 3C2WA 4BBTA 2BASA 5KIZA 1N9OA 2CMNA 2W0NA 4HJ6A 3LR4A 2EA9A 1MZUA 2WKPA 2DMWA 2JKRM 2QWSA 1OT6A 2W3FA 2Y79A 5DJUA 4BMWA 3PBOA 4WN5A 4IUHA 2QJ7A 1IOUA 4R6LA 3KSHA 4H6JB 4NXBA 4I38A 1H3QA 1VB6A 4NEED 1GSWA 5A8BA 1DP9A 4MN5A 4YNRA 3P01A 1OTEA 5HDSA 3EGXC 1OPXA 1IFQA 1DP8A 4NXEA 5DF9A 2PHYA 3UE3A 4GCZA 2PD8A 3E98A 2V9AA 2K31A 2GNXA 3P7NA 1BYWA 3BY9A 2JN7A 3LUQA 1OTIA 1D06A 3ZYTA 2LB5A 4F3LB 4B9OA 3OCLA 4GHIB 1XFQA 5AVEA 1NLZA 1XJ6A 1JNUA 3LR0A 3UB9A 2V1BA 3KSIA 5FL3A 4HY8A 3EQVA 3NOUC 4EQ1A 4ARZB 3OLOA 5CX7A 2KOIA 3BY8A 3G6OA 4XT2B 3T4OA 3E4OA 1S66L 4MMNA 4BBVA 3CITA 4DN0A 4CLCE 2L0WA 2PYPA 3FPWA 2VX8A 5HPFA 3C38A 3KO6A 4KQDA 4NXFA 4CLCC 5LBRA 2W3DA 5TJJA 3MR0A 5L8MA 1VHMA 3A0SA 3VE3A 2OWHA 2W1RA 2KLIA 3CUEA 2KX6A 1WA9A 3R7WA 4JGQA 4MN7A 2I9VA 3O5YA 4M4XA 4EUVA 3UMEA 3PBTA 5F5YA 5HWVA 2JKTM 4O0PA 2J3WA 2PYRA 4WL9A 2W3GA 3IBJA 1XFNA 4WEJA 3F1PA 3CI6A 2HJ9C 3D3OA 1T18A 4LRYC 5F69A 2J80A 3KSGA 4MN6A 1V9YA 3TJZC 1TS8A 3HCYA 4LLOB 2B18A 5IU1A 3PR6A 3D72A 1G28A 4HJ4A 2A24A 3NHQA 1UWNX 2XSSA 3C30A 2HGVA 1DRMA 2V0WA 5MC7A 4R70A 4FSFA 3W2ZA 3JVUA 2PD7A 3T4QA 2VLGA 3T4SA 4LPZA 2JKRI 4Y2FA 2G7UA 3UMDA 4UEYA 2GX5A 4L9GA 3LR3A 3GECA 4I3IA 4DJ3A 3E4PA 2LB9A 3F1OB 1OT9A 2H28A 3R4KA 1NRJA 4HI4A 3UB6A 1NLYA 3LIAA 4HQAA 4L9FA 2OAQ1 2HF6A 2HJEA 5TBMA 2A2LA 5HDCA 4G3KA 4R3AA 1TS7A 3IS2A 5G4YA 3KYQA 2GJ3A 3H7WA 4EU0A 1ODVA 4DJ2A 3VV4A 3LIBA 2OAP1 1TS0A 2OWJA 2QKPA 3CWFA 3MQQA 3PBRA 4PAUA 1N9NA 3EOIA 5DFXA 3MQOA 1D7EA 2VJWA 3FPVA 1OJGA 1P9RA 4LRXC 4Y3IA 4JGPA 2EWWA 3S7OA 4ME4A 2NUTC 3ULFA 1LSXA 3C8CA 4E04A 3B33A 4JGOA 2JHEA 3LIDA 2XA7S 3EQUA 5AJGA 4CLCA 5G4ZA 3LYXA 4Y5FA 2W3HA 4KQOA 3F1PB 2W1TA 2YKHA 2ZOHA 1T1BA 2QYBA 4L0LA 1W63M 4QPRA 2D01A 2O9CA 1T1AA 1H8MA 4UQIS 1S1YA 3PBSA 2A24B 3LFVA 3OC2A 3MQ0A 4Q0HA 1OTDA 4EESA 3OBFA 1S67L 3U2AA 1KOUA 3PBQA 1XJ3A 3LIFA 3SW1A 4FOFA 5J7EA 1OTAA 1G6OA 3FG8A 1OTBA 4NKPA 2JKTI 2M1CA 5I5LA 2W27A 2VKSA 1XJ2A 3RTYA 3LR5A 3A0VA 1YAXA 4GS9B 2EWVA 4IHQA 2ZOIA 3KYZA 1YKDA 2Z6DA 3E0YA 3H9WA 1W63Q 1EW0A 2PT7A 2VV8A 3OCNA 1X0OA 2XRNA 2L1MA 4I39A 3HJKA 1S4RA 5J4EA 2O9AA 4IUKA 3MMHA 4L9EA 1ZHHB 4EERA 5TBMB 5HL6A 3MJQA 3FC7A 2R78A 3IS2B 4B93A 2WKQA 2P04A 4P6ZS 5AVFA 4H6JA 1NWZA 1T1CA 2VGLS 2XA7M 3S7PA 2FZ0A 4HP9A 4Z1WA 2XROA 4MCWA 3ICYA 3S7NA 1N9LA 2QJ5A 4KUKA 1XJ4A 5F6AA 4HH3A 1STZA 5HD5A 4CLCB 3H82A 4UQIM 3TE8A 1P9WA 5J3WA 3EEHA 3BWLA 2W1TB 4RQ9A 3KX0X 2FH5A 3NOPC 5HD3A 2Y8HA 4KUOA 3BQ8A 3EGDC 3VE4A 2MJ6A 4HNBA 3OOVA 5DKKA 3EWKA 3K2NA 3PHYA 3BW6A 4GLQA 2ZBBA 4IJGA 1UGUA 4G3WA 4R38A 4YWZA 4CLCD 2PR5A 3MF0A 4GW9A 3DBAA 2W3EA 3F1NA 4AFIA 2KDKA 1TF1A 1UWPX 2O0YA 2Z6CA 2OOLA 5IS1A 2M7VA 1YSPA 4WEKA 4P6ZM 3R7WB 1GSXA 2INWA 2VGLM 1OJ5A 4I3AA 5DFYA 5F68A 1TS6A 4II7A 4OOLA 1S1ZA 4HIAA 2GZAA 3K3DA 2VA0A 1F98A 3KSFA 2O9BA 4PHTA 1F9IA 3T4JA 1GSVA 5HSQA 2YKFA 1MKMA 1YSQA 1T19A 3T4LA 2J3TD 2L4RA 3MXQA 3UB8A 2P08A 3BJNA 3LI8A 5HWWA 4EXOA 2V1AA 2M7UA 2IA2A 1S4SA 1DP6A 3MFXA 5K5BA 3TRCA 3H82B 2HV1A 4HOIA 3B47A 4DMZA 4HHDA 2B02A 4GJ4A 1TD5A 1V9ZA 4PKYA 4HJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O01 A;  4R6L A;  4CQH A;  2VZW A;  3KSH A;  2VEA A;  4Y2F A;  2G7U A;  3ZQ5 A;  2GX5 A;  4YNR A;  4Z1W A;  4Q0J A;  2XRO A;  4MCW A;  2LB9 A;  3S7N A;  3R4K A;  4G3V A;  4BWI A;  1STZ A;  3E98 A;  1ZTU A;  2K31 A;  4G3K A;  2LB5 A;  2W1T B;  4RQ9 A;  1MC0 A;  4ZRR A;  4EU0 A;  3NOP C;  1F5M A;  3VV4 A;  2Y8H A;  3KSI A;  2K2N A;  3NOU C;  4MDZ A;  3S7Q A;  4PAU A;  3OOV A;  2O99 A;  2ZMF A;  5DFX A;  2KOI A;  3EEA A;  2VJW A;  4LRX C;  4Y3I A;  3K2N A;  3S7O A;  3G6O A;  4ME4 A;  4GLQ A;  4MMN A;  4E04 A;  3CIT A;  5AJG A;  4DN0 A;  4YOF A;  4Y5F A;  5HPF A;  4IJG A;  2W3H A;  3KO6 A;  5HPI A;  4ETX A;  2W1T A;  5LBR A;  4G3W A;  2W3D A;  5TJJ A;  3MF0 A;  1VHM A;  4GW9 A;  5L8M A;  3DBA A;  2W3E A;  2QYB A;  5C5K A;  1TF1 A;  2KLI A;  2W1R A;  4QPR A;  2O0Y A;  2OOL A;  2M7V A;  1YSP A;  2O9C A;  4MN7 A;  4Q0I A;  3LFV A;  3O5Y A;  4EUV A;  5DFY A;  3NOT C;  3MQ0 A;  4Q0H A;  3OBF A;  4FOF A;  4O0P A;  3RFB A;  2W3G A;  3IBJ A;  3KSF A;  2O9B A;  5HSQ A;  1MKM A;  5I5L A;  2VKS A;  1YSQ A;  4O8G A;  3CI6 A;  4LRZ E;  3D3O A;  4LRY C;  3KSG A;  3IBR A;  4ETZ A;  1YKD A;  3C2W A;  3E0Y A;  3BJN A;  3HCY A;  2B18 A;  2M7U A;  2XRN A;  2IA2 A;  3NHQ A;  2O9A A;  5K5B A;  4IUK A;  3TRC A;  2XSS A;  3MMH A;  2HGV A;  4DMZ A;  5HL6 A;  2W3F A;  2Y79 A;  1TD5 A;  4R70 A;  3S7P A;  4IUH A;  3W2Z A; 
#chains in the Genus database with same CATH topology
 3PBN A;  5I94 A;  3CAX A;  3QP1 A;  3G35 A;  4FH4 A;  1ZKJ A;  4GNU A;  3F1O A;  5CTN A;  2WKR A;  1FIL A;  3IF5 A;  4OH0 A;  4BJP A;  1ZTU A;  3WRZ A;  3T1S A;  5FEG A;  3PYP A;  4BBU A;  1TEM A;  4EWF A;  4FD8 A;  1SKF A;  1F5M A;  3WS4 A;  5CGW A;  3TG9 A;  4K08 A;  3V3S A;  3B42 A;  3S7Q A;  2O99 A;  2ZMF A;  2ZC5 B;  3GTC A;  1QME A;  3VFF A;  2P9V B;  4EET B;  1NXY A;  3CLO A;  3Q7V A;  4YOF A;  3W4Q A;  4JKT A;  3GDI A;  4WYY A;  4EEP A;  3WWX A;  4MNR A;  4ETX A;  2VGJ A;  4WLA A;  3NI9 A;  4OOM A;  1XA7 A;  1WYB A;  1FR1 A;  2X01 A;  1ZC2 A;  2QMI A;  2J9P A;  3UDF A;  2PBY A;  2EXB A;  5E2F A;  1MWS A;  4K0X A;  5CHU A;  3A0R A;  4R23 A;  2RCX A;  3PXP A;  5BOH A;  3V39 A;  5CHM A;  1P0Z A;  3LIC A;  3VP4 A;  2Z2M B;  1TDG A;  3NC8 A;  5FEF A;  4P85 A;  2W3F A;  4BMW A;  3SZT A;  4WN5 A;  1IOU A;  2XEP A;  4H6J B;  1FSW A;  4YNR A;  1DJA A;  1BUE A;  1IYQ A;  3SH7 A;  4NXE A;  2PU2 A;  3UE3 A;  2ZC6 B;  3B3X A;  4D2O A;  2A49 A;  3P7N A;  1BYW A;  1D06 A;  1K6R A;  4GHI B;  4DF6 A;  1JNU A;  3KSI A;  2XH9 A;  1ERO A;  2Y2G A;  1K57 A;  1WE4 A;  5CX7 A;  4GB7 A;  2KOI A;  3VP2 A;  3G6O A;  4XT2 B;  1SZV A;  4MMN A;  3VFH A;  4CLC E;  2L0W A;  3FPW A;  3HUM A;  3LEQ A;  1VHM A;  5DTS A;  4OQH A;  1ES5 A;  2OWH A;  4S2K A;  4MN7 A;  4GKU A;  1HD8 A;  3O5Y A;  3TSG A;  3UME A;  1L0G A;  5HWV A;  4OVD A;  4O0P A;  4WL9 A;  4R0Q A;  1K54 C;  1XFN A;  3F1P A;  4M3K A;  3CI6 A;  5HAP A;  5CTM A;  2J80 A;  5F69 A;  2BTF P;  3IT9 A;  4QHC A;  4QY5 A;  1JWP A;  1ERM A;  4HJ4 A;  3MZF A;  2A24 A;  3DTI A;  2XSS A;  1ONH A;  5FQQ A;  4DE1 A;  4KZ3 A;  4WMC D;  4GOG A;  3G31 A;  3CZD A;  5F82 A;  1W5D A;  2XGN A;  3W2Z A;  2VLG A;  3T4S A;  4LPZ A;  3IHA A;  4Y2F A;  2G7U A;  3UMD A;  4L9G A;  2JCH A;  4IBR A;  3IWI A;  1CEG A;  4DJ3 A;  3E4P A;  3F1O B;  5FI2 A;  1NRJ A;  1NY0 A;  3MXR A;  3LIA A;  4HQA A;  1RCJ A;  2OAQ 1;  5M1A A;  5FQI A;  1YM1 A;  2ACG A;  4Y0T A;  2J8Y A;  3KYQ A;  1BLH A;  4R1G A;  4DJ2 A;  1S0W A;  3PAE A;  1IKG A;  1TS0 A;  2QKP A;  2WAE A;  3CWF A;  2DNS A;  4PAU A;  5DFX A;  3MQO A;  2VJW A;  1M40 A;  3M2K A;  4Y3I A;  1VQQ A;  2JKG A;  1F2K A;  4JGP A;  4LV3 A;  3IXD A;  1LSX A;  2JHE A;  1MWR A;  2XA7 S;  2ZJ9 A;  1GHM A;  1KDS A;  2HP6 A;  4KQO A;  2W1T A;  4ZBE A;  1T1B A;  2QYB A;  4KG2 A;  3U4L P;  1W63 M;  5F1G A;  1BLC A;  1H8M A;  4BLM A;  3DTM A;  3HBR A;  3E2K A;  5EV0 A;  4EES A;  1S67 L;  3P09 A;  1K54 A;  1XJ3 A;  3LIF A;  3SW1 A;  4FOF A;  3OPL A;  1OTA A;  3SS3 A;  1OTB A;  4NKP A;  2ZC4 B;  2VKS A;  3BFC A;  1BUL A;  2EWV A;  4IHQ A;  3BEB A;  4EBN A;  2Z6D A;  3H9W A;  1CEF A;  4I39 A;  4ESP A;  3VMA A;  3MMH A;  1L2S A;  1L0E A;  4L9E A;  4A5R A;  1ZHH B;  4EER A;  4F94 A;  3C4P A;  1ESU A;  2R78 A;  3O88 A;  3C5A A;  1YMS A;  1CJF A;  4KEN B;  5AVF A;  4JLF A;  2IWB A;  1Z6F A;  3HUN A;  4N1X A;  4JXW A;  4OQG A;  3MZE A;  4MCW A;  3ICY A;  5HAR A;  2ZQ8 A;  4B88 A;  5F6A A;  4OPY A;  4HH3 A;  2H5S A;  3Q1F A;  4CLC B;  1Q2Q A;  4S2P A;  5J3W A;  2EFX A;  3T12 B;  1Y4O A;  3BWL A;  5GLA A;  3BFD A;  4ZAM A;  1MPL A;  2FH5 A;  4KZ9 A;  3A3I A;  4X1M A;  5HD3 A;  3NY4 A;  2MJ6 A;  5A93 A;  4OP5 A;  1YMX A;  4LGW A;  3MS6 A;  2ZC7 A;  1ZG4 A;  5GHY A;  5FAS A;  4G3W A;  3ZG8 B;  1NJ4 A;  2PR5 A;  4GW9 A;  4AFI A;  3SOI A;  2O0Y A;  4WEK A;  2INW A;  2VGL M;  5DFY A;  1YLZ A;  1TS6 A;  2OLV A;  4OOL A;  1S1Z A;  1D1J A;  2P9V A;  2ZM0 A;  2GZA A;  3OPP A;  2VA0 A;  4PHT A;  4OQ0 A;  1E3U A;  1GSV A;  4LV1 A;  1MKM A;  1HVB A;  1YSQ A;  4OQI A;  1G5U A;  1T19 A;  2J3T D;  3BEC A;  4PM7 A;  4PM5 A;  2Y2M A;  5HWW A;  4EXO A;  4X69 A;  5K5B A;  3TRC A;  3H82 B;  3UDX A;  3UE1 A;  2WGW B;  4GJ4 A;  4S2N C;  1V9Z A;  3S7P A;  3ZQ5 A;  5GHZ A;  4CQH A;  4OOY A;  2VEA A;  3IX4 A;  5HW3 A;  2JBF A;  5HWT A;  4HES A;  4DRT A;  1LSV A;  4DDS A;  2GDN A;  1S6R A;  3BLS A;  5CRF A;  4R4S A;  2X02 A;  1G6A A;  4NXG A;  5HL1 A;  1BZA A;  3Q81 A;  5F83 A;  3LI9 A;  4MDZ A;  5IT5 A;  1ALQ A;  3EEA A;  3DTE A;  4MEZ A;  4KQR A;  3G32 A;  3T50 A;  4GDN A;  5EVI C;  1IYP A;  5HPI A;  4B4Z A;  4R4R A;  3NJA A;  4GHI A;  3VOL A;  3Q7Z A;  4BEN A;  3CUE C;  5FAP A;  4Q0I A;  4E3O A;  3NOT C;  3T4T A;  3UDI A;  4XT2 A;  1YLY A;  3RFB A;  2HP5 A;  5KSH A;  2UV0 E;  5CEC A;  2P7J A;  4O8G A;  5FQJ A;  5E43 A;  4LRZ E;  3RH8 B;  3IF6 B;  1RP5 A;  2V0U A;  1Y28 A;  2WGI A;  1I2W A;  4ETZ A;  3WS0 A;  4BBT A;  1JTD A;  2CMN A;  2ZM8 A;  3G34 A;  2HDU A;  4S2J A;  3NCK A;  2G2U A;  1XGI A;  2EA9 A;  1MZU A;  4S2N A;  2DMW A;  2JKR M;  2QWS A;  1OT6 A;  4KG5 A;  2Y79 A;  3PBO A;  2QJ7 A;  2Z2L B;  4NXB A;  3Q82 A;  1H3Q A;  1VB6 A;  4I38 A;  1GSW A;  5A8B A;  3P01 A;  4KZ4 A;  2WAD A;  5FAQ A;  4BL2 A;  5DF9 A;  2JC7 A;  4GCZ A;  2PD8 A;  5DTT A;  2FFY A;  2V9A A;  2GNX A;  3BY9 A;  2WYX A;  2JN7 A;  5CED A;  3OPH A;  3OCL A;  3M6H A;  4DXB A;  3VSK A;  1XFQ A;  5AVE A;  1XJ6 A;  3LR0 A;  3UB9 A;  2V1B A;  3M2J A;  5FL3 A;  2C5W B;  4GD8 A;  3PTE A;  4KG6 A;  4LV0 A;  2E8J A;  3E4O A;  3M6B A;  1FIK A;  5EVI A;  4BBV A;  3CIT A;  4OLG A;  4DN0 A;  3BM6 A;  2IWD A;  2VX8 A;  5HPF A;  3D4F A;  4KQD A;  1K6S A;  4CLC C;  5LBR A;  1FCM A;  5AQ7 A;  5TJJ A;  1ACF A;  2BG1 A;  3ZVW A;  3CUE A;  4LCM A;  1WA9 A;  4ZTK A;  3V50 A;  4EUV A;  4M4X A;  3PBT A;  3ZVT A;  3A3J A;  4Y17 A;  2V2F F;  4ZJ3 A;  2J3W A;  2PYR A;  2X71 A;  2W3G A;  5M19 A;  1VM1 A;  4XUZ A;  1LL5 A;  4K91 A;  1L0D A;  1BLP A;  3HLW A;  4ZJ1 A;  1H8Y A;  3LCE A;  1BTL A;  3TOI A;  3GVB A;  3HCY A;  3ITB A;  5IU1 A;  3BFF A;  4X55 A;  3PR6 A;  3D72 A;  3QP4 A;  3NHQ A;  1DJC A;  2C6W B;  2R9X A;  3C30 A;  2HGV A;  1DRM A;  5FA7 A;  2V0W A;  2Y55 A;  3CJM A;  3V3R A;  1PNE A;  4FSF A;  2GX5 A;  4BD1 A;  3GEC A;  4I3I A;  1DY6 A;  4DXC A;  2LB9 A;  1K25 A;  5FDH A;  4HI4 A;  3GMW A;  3UB6 A;  2HF6 A;  1XGJ A;  1FCN A;  4R3A A;  4YIN A;  2OV5 A;  4OP8 A;  1PWC A;  5GHX A;  2OAP 1;  3SH9 A;  2UWX A;  1Q2P A;  1D7E A;  2H10 A;  1OJG A;  4LRX C;  1MWT A;  4QJG A;  3S7O A;  4JF4 A;  2WKH A;  5EOO A;  1ES4 A;  5EM0 A;  3C8C A;  3B33 A;  4K0W A;  3LID A;  3LGO A;  5AJG A;  4CLC A;  5GLD A;  3IXH A;  4R3J A;  3FZC A;  1IKI A;  3LY3 A;  2YKH A;  1KVL A;  3VOY A;  1YLT A;  1KE0 A;  4L0L A;  1ES2 A;  2Y91 A;  1KGE A;  2ZL1 B;  1PW1 A;  4QY6 A;  4UQI S;  2HDR A;  3PBS A;  4GZB A;  2B95 A;  5L07 A;  2Y2K A;  3OC2 A;  3OBF A;  4JBF A;  1HLU P;  3IXB A;  1G6O A;  2JKT I;  2W27 A;  4OPR A;  3O86 A;  3LY4 A;  1XJ2 A;  2ZOI A;  1YKD A;  1Z09 A;  2VV8 A;  2PT7 A;  1X0O A;  2OLU A;  5J4E A;  1S4R A;  2O9A A;  2Y2Q A;  2ZM2 A;  4DKI A;  5TBM B;  4UA6 A;  4ZDX A;  3IS2 B;  3ZCZ A;  4B93 A;  5CGS A;  2WKQ A;  1MKI A;  1LI0 A;  1NZU A;  1KGG A;  1T1C A;  2XA7 M;  2FZ0 A;  4HP9 A;  3IF6 C;  2H0T A;  1KDW A;  2RL3 A;  1STZ A;  1I5Q A;  3H82 A;  4MBH A;  3TE8 A;  3NBL A;  5CHJ A;  1SKO B;  2WGW A;  5EUA A;  2Q9M A;  3C4O A;  3HLE A;  2Y8H A;  5F1F A;  3BQ8 A;  1QMF A;  3N8L A;  3OOV A;  3FWL A;  3K2N A;  3VP1 A;  5EVI B;  3BW6 A;  2ZLY A;  4GLQ A;  4UAA A;  5KSC A;  5EPH A;  3SH8 A;  5M18 A;  1UGU A;  3C7U A;  4R38 A;  4YWZ A;  3DBA A;  2JKF A;  1CI8 A;  2KDK A;  3N4I A;  5HX9 A;  4X56 A;  2Z6C A;  1RGY A;  3A3F A;  2Y4A A;  1OJ5 A;  4WMC A;  4I3A A;  4MBF A;  5F68 A;  4WZ5 C;  2WKI A;  4FH2 A;  3IQA A;  3K3D A;  2R9W A;  3UPP A;  4JF5 A;  2O9B A;  1F9I A;  2J9O A;  4E3K A;  5EVE A;  4XUX A;  1I2S A;  4JXG A;  4ZJ2 A;  3UB8 A;  1ESI A;  1WYC A;  3T1R A;  1FSY A;  4X6T A;  2PAV P;  3IHB A;  2B5R A;  4HOI A;  3S1Y A;  3CHW P;  4HHD A;  2B02 A;  1TD5 A;  4WM9 A;  3ZNT A;  4O01 A;  1NYY A;  3K3C A;  4EW7 A;  3HJI A;  1VEU A;  5EFW A;  5DKL A;  3IF6 A;  4WF0 A;  3JVV A;  4Q0J A;  1IYS A;  2Y2O A;  1AWI A;  3SS5 A;  3E4Q A;  4G3V A;  1ES3 A;  3MKE A;  3QHY A;  2VV7 A;  4HP4 A;  3W4P A;  4LV2 A;  3WS2 A;  5TGF A;  1PFL A;  3UB7 A;  3UPO A;  5HZH A;  5FAT A;  4S2I A;  1LSW A;  4C6Y A;  1PWG A;  4JGR A;  3T4K A;  4X1L A;  4LCL A;  2WK0 A;  1L0F A;  4DE2 A;  4C75 A;  2J3T C;  2ZQC A;  2I72 A;  2J7V A;  3CG5 A;  1HZO A;  4S2M A;  3HLG A;  4WUJ A;  5C5K A;  1GA9 A;  4P87 A;  4JXS A;  1JWV A;  3GV9 A;  3LIE A;  3ZG9 B;  1XPB A;  1LT0 A;  4IED A;  4WZ5 A;  1G68 A;  2D02 A;  1W8Y A;  3SS4 A;  4KZ5 A;  5J8X A;  2NUP C;  1LI9 A;  5FAO A;  1H0M A;  4EEU A;  1E3U D;  3C2W A;  2BAS A;  1N9O A;  2W0N A;  3IWQ A;  5CXW A;  1O7E A;  3HL9 A;  4R3B A;  3ZG7 B;  3NUL A;  3OZH A;  1XP4 A;  1CF0 A;  4QU3 A;  2VK3 A;  3KSH A;  3QP6 A;  4P0M A;  4NET A;  4CPK A;  3N8R A;  4EQI A;  4NEE D;  4Y0O A;  1DP9 A;  3QP2 A;  2A3U A;  1K56 D;  4E3N A;  1OTE A;  3HLC A;  2EXA A;  3ZHH A;  1IFQ A;  2Y2I A;  3FKV A;  1DP8 A;  4X25 A;  3G2Z A;  3I7J A;  2K31 A;  3UB5 P;  1OTI A;  2EX9 A;  2LB5 A;  4F3L B;  4B9O A;  1NLZ A;  4X53 A;  4LEN A;  1PI4 A;  4HY8 A;  1H8Z A;  4EQ1 A;  4HBT A;  4ARZ B;  1U60 A;  1YQS A;  3VSL A;  1XA1 A;  3QP5 A;  5HAQ A;  3GQZ A;  2PYP A;  2Y2N A;  4N1H A;  3MR0 A;  1E4D A;  3A0S A;  2EFU A;  3VP0 A;  4LFU A;  4E3M A;  2Y2P A;  1ERQ A;  1MXO A;  4CJN A;  2I9V A;  4Y15 A;  5F5Y A;  4KZB A;  4DDY A;  2V8F A;  3IBJ A;  4E6W A;  4N92 A;  1EWZ A;  3BFE A;  4Y0U A;  2H0Y A;  4WBG A;  3D3O A;  4KZA A;  4LRY C;  5CEB A;  1V9Y A;  3NIA A;  1TS8 A;  1A0K A;  2ZQ7 A;  5E2E A;  4LLO B;  2ZL1 A;  1BLS A;  1K4E A;  1SDE A;  5AQB A;  5MC7 A;  4R70 A;  4OPZ A;  1EI5 A;  3JVU A;  2PD7 A;  2ZQ9 A;  4FCF A;  1VEU B;  3O87 A;  4UEY A;  5TFQ A;  1DJB A;  5EE8 A;  4BL3 A;  2H28 A;  1VET B;  4NG2 A;  4L9F A;  2ZQA A;  3AGD A;  5TBM A;  3MXS A;  5GLC A;  1PZO A;  5GLB A;  3ZG5 A;  3IS2 A;  3G4P A;  5D3O A;  2GJ3 A;  3H7W A;  1ODV A;  3RJU A;  2EX6 A;  2XD1 A;  3LIB A;  2OWJ A;  1FR6 A;  5GL9 A;  4Y7P A;  1N9N A;  3EOI A;  3A3E A;  3HLF A;  1YLW A;  4ME4 A;  3WS5 A;  2NUT C;  3ULF A;  1CI9 A;  3MSH A;  4JGO A;  3IWO A;  2V20 A;  5TR7 A;  5G4Z A;  4Y5F A;  1M6K A;  1SKO A;  1NRF A;  3HLB A;  1ONG A;  1JVJ A;  4FUW A;  3N8S A;  4QPR A;  4Y13 A;  2D01 A;  2XLN A;  4EBL A;  2O9C A;  1T1A A;  1S1Y A;  1SHV A;  3LFV A;  3HVF A;  4Q0H A;  4ID4 A;  1OTD A;  2E8I A;  3U2A A;  1KOU A;  1YLP A;  3KYE A;  3GRJ A;  5IHV A;  1KGF A;  2M1C A;  4U0T A;  3DTK A;  3RTY A;  2FFF B;  1PRQ A;  3KYZ A;  1IEL A;  3E0Y A;  3WRT A;  1EW0 A;  4UA9 A;  3OCN A;  2L1M A;  3IH8 A;  4IUK A;  5AQ9 A;  2HPB A;  1ZG6 A;  3MJQ A;  3VP3 A;  4P6Z S;  3CPT B;  4EUZ A;  1PI5 A;  4OPQ A;  4Z1W A;  2DCF A;  4S2L A;  2XRO A;  1BT5 A;  2Y59 A;  1K57 C;  3NDG A;  4KUK A;  3JYI A;  2ZQD A;  1GHI A;  4OKP A;  5HD5 A;  4YFM A;  1K4F A;  1J9M A;  4UQI M;  3EEH A;  4MLL A;  3DWK A;  4RQ9 A;  2HDS A;  2WGV A;  3KX0 X;  2WAF A;  3EGD C;  4PM6 A;  3VE4 A;  4HNB A;  5DKK A;  2WUQ A;  3EWK A;  2WZZ A;  2PBD P;  4E3I A;  1Y54 A;  5EOE A;  2ZBB A;  4HEF A;  1PW8 A;  1GA0 A;  4RX3 A;  4CLC D;  3MF0 A;  3Q07 A;  4GN2 A;  1BSG A;  2W3E A;  2OOL A;  1CQA A;  1YSP A;  1GSX A;  2HZ5 A;  3S22 A;  4JF6 A;  4O7D A;  3IXG A;  4II7 A;  3QNC A;  4HIA A;  4RA7 A;  1YT4 A;  1F98 A;  5HSQ A;  2YKF A;  2G2W A;  1RGZ A;  3T4L A;  1H5X A;  2HP9 A;  4UHU A;  2P08 A;  3OPR A;  4U0X A;  3BJN A;  4GDB A;  3LI8 A;  4MBK A;  2Y2H A;  2V1A A;  4N9K A;  1S4S A;  1OME A;  3B47 A;  3E2L A;  4HBU A;  4DMZ A;  1KE3 A;  4BQM A;  4PKY A;  3UNW A;  2XFT A;  2VZW A;  4PKY G;  4HH2 A;  1O07 A;  3T1X A;  3MFD A;  2P74 A;  3LO7 A;  3IH9 A;  3V5M A;  4Z9Q A;  4BWI A;  5HFO A;  1HTZ A;  3N7W A;  2V8C A;  1CK3 A;  3IX8 A;  1MC0 A;  1FCO A;  3TW8 A;  1GCE A;  3H7W B;  3NEC A;  4ZRR A;  5L2F A;  3F1N B;  4RX2 A;  2K2N A;  4RVA A;  1LL8 A;  4D60 A;  1L3L A;  1FQG A;  3BQA A;  4I3J A;  3BRM A;  2K7S A;  5HDD A;  1NZO A;  3UE6 A;  4E3L A;  2HDQ A;  1MY8 A;  3DWZ A;  2AVX A;  4E3J A;  5A92 A;  1NYM A;  2WKE A;  1P97 A;  3PAG A;  4WEL A;  2ZMV A;  2XFS A;  3HRE A;  4IVI A;  4F3L A;  2VV6 A;  4I5S A;  4Q8I A;  3IX3 A;  2XQZ A;  4C3Q A;  2Q0O A;  1YLJ A;  3ZNY A;  4ARZ A;  4KZ8 A;  2JE5 A;  1JTG A;  2BLS A;  3V67 A;  3BYD A;  2PDR A;  2V1Z A;  1SCW A;  5DJT A;  3BFG A;  2PR6 A;  3AGF A;  2QHK A;  3IBR A;  2PRF A;  4GS9 A;  5KIZ A;  3HUO A;  4PMA A;  3G2Y A;  4HJ6 A;  1PWD A;  1K38 A;  1E25 A;  3LR4 A;  1W79 A;  3MZD A;  2WKP A;  5AQA A;  5DJU A;  5EEC A;  2IWC A;  1XXM A;  4IUH A;  5FQM A;  4R6L A;  3JPU A;  3LEZ A;  4MN5 A;  3GSG A;  1LLB A;  5HDS A;  3EGX C;  1OPX A;  4PM9 A;  2PHY A;  4PPR A;  3E98 A;  3Q7V B;  3DW0 A;  4OON A;  3LUQ A;  3ZYT A;  3QNB A;  3ITA A;  3G30 A;  4B4X A;  1KVM A;  1JWZ A;  3ZG0 A;  3EQV A;  3NOU C;  3QP8 A;  5DF7 A;  3N6I A;  3OLO A;  2ZD8 A;  4BD0 A;  4DE0 A;  3BY8 A;  1VET A;  2EX2 A;  3T4O A;  2Q9N A;  1S66 L;  3UN7 A;  5FDS A;  3A3D A;  3C38 A;  3KO6 A;  4NXF A;  1W7F A;  5EM1 A;  2W3D A;  5L8M A;  2VGK A;  3VE3 A;  2W1R A;  2KLI A;  3FV7 A;  2KX6 A;  2OSU A;  4S2O A;  4EBP A;  3R7W A;  1W8Q A;  4JGQ A;  5JYP A;  5L10 A;  1K55 C;  3FYZ A;  2DRW A;  2JKT M;  3UY6 A;  3W8K A;  1XKZ A;  5A90 A;  3DAV A;  1YPR A;  4WEJ A;  1TVF A;  2HJ9 C;  1T18 A;  3C7V A;  2XDM A;  3KSG A;  4MN6 A;  4EV4 A;  3CMZ A;  3TJZ C;  4RYE A;  2CC1 A;  2B18 A;  1XX2 A;  1PIO A;  1G28 A;  4H8R A;  1UWN X;  4IBX A;  3D9Y A;  3T4Q A;  1PZP A;  2JKR I;  5DVA A;  3AGE A;  3T1Q B;  3HLD A;  3MBZ A;  3LR3 A;  1OT9 A;  5DTK A;  3R4K A;  1FOF A;  1NLY A;  4QB8 A;  4U3T A;  5JYO A;  2HJE A;  2A2L A;  5HDC A;  4G3K A;  4JPM A;  1TS7 A;  5G4Y A;  4EU0 A;  4E6X A;  3VV4 A;  3CPT A;  1SDN A;  2WZX A;  3MQQ A;  3PBR A;  5FQK A;  5HAI A;  3FPV A;  1P9R A;  2EWW A;  2XR0 A;  4E04 A;  3EQU A;  3LYX A;  2W3H A;  3F1P B;  1N9B A;  4PM8 A;  2ZOH A;  1K0K A;  3GR2 A;  4IVK A;  1K55 A;  2XF3 A;  4OLD A;  2A24 B;  5CER A;  3MQ0 A;  1LHY A;  3PBQ A;  5J7E A;  5FSR A;  5G18 A;  5KZH A;  1K56 A;  3FG8 A;  1LL9 A;  5I5L A;  4P6B A;  3LR5 A;  3A0V A;  1GHP A;  1YAX A;  4GS9 B;  5DF8 A;  1J3W A;  5FI6 A;  4X68 A;  5A91 A;  1C3B A;  3ZDJ A;  1W63 Q;  4NK3 A;  2EX8 A;  2XRN A;  5FQ9 A;  3HJK A;  5HL6 A;  3FC7 A;  4QD4 A;  2Y2L A;  2P04 A;  3UE0 A;  5EVL A;  4H6J A;  1NWZ A;  2VGL S;  2XD5 A;  3MKF A;  5FI7 A;  3ISG A;  3S7N A;  1N9L A;  2QJ5 A;  1XJ4 A;  4UA7 A;  4KQQ A;  3NDE A;  4QWO A;  3P98 A;  5E2H A;  2PU4 A;  1P9W A;  2W1T B;  1MWU A;  4N9L A;  4KZ6 A;  3NOP C;  4KUO A;  3W4O A;  2XK1 A;  1TDL A;  1IEM A;  1IYO A;  2ZC3 B;  2QPN A;  3L9K A;  1MBL A;  3WS1 A;  4DE3 A;  3PHY A;  4GD6 A;  4KZ7 A;  5KMW A;  4IJG A;  1PYY A;  2Y2J A;  3BLM A;  1N4O A;  3F1N A;  1TF1 A;  1UWP X;  3ZGA B;  5E2G A;  5IS1 A;  2ZMA A;  2M7V A;  4P6Z M;  3UPN A;  3R7W B;  3VOZ A;  5CGX A;  4WZ4 A;  5U47 A;  3L7H A;  4FTX A;  3KSF A;  3T4J A;  2QZ6 A;  3UO9 A;  1KE4 A;  5EVI D;  5L09 A;  2L4R A;  3MXQ A;  3S4X A;  3ZFZ A;  3RXX A;  1AXB A;  3RXW A;  2M7U A;  2IA2 A;  3O3V A;  1DP6 A;  3MFX A;  2HV1 A;  4XXR A;  3FKW A;  4HJ3 A;  4JXV A; 
#chains in the Genus database with same CATH homology
 4O01 A;  3PBN A;  4CQH A;  3CAX A;  3K3C A;  2VZW A;  4PKY G;  4EW7 A;  2VEA A;  3HJI A;  5EFW A;  4HH2 A;  3ZQ5 A;  5DKL A;  4WF0 A;  5HWT A;  3JVV A;  4Q0J A;  3F1O A;  1LSV A;  3E4Q A;  4G3V A;  2WKR A;  4BWI A;  2VV7 A;  4HP4 A;  1ZTU A;  4BJP A;  3PYP A;  4BBU A;  1MC0 A;  3TW8 A;  3H7W B;  4ZRR A;  4NXG A;  1F5M A;  3F1N B;  3UB7 A;  2K2N A;  4K08 A;  5HZH A;  1LL8 A;  3LI9 A;  3B42 A;  1LSW A;  4MDZ A;  3S7Q A;  3BQA A;  5IT5 A;  2O99 A;  2ZMF A;  4I3J A;  5HDD A;  2K7S A;  3EEA A;  4JGR A;  3UE6 A;  3T4K A;  3T50 A;  4EET B;  3CLO A;  4YOF A;  1P97 A;  4WEL A;  3GDI A;  4EEP A;  5HPI A;  4ETX A;  2J3T C;  2ZMV A;  3NJA A;  4WLA A;  4F3L A;  4GHI A;  3VOL A;  2VV6 A;  4I5S A;  4WUJ A;  5C5K A;  4OOM A;  3LIE A;  3CUE C;  1LT0 A;  4ARZ A;  4Q0I A;  3NOT C;  3T4T A;  4XT2 A;  2D02 A;  3V67 A;  2PDR A;  5DJT A;  3RFB A;  2NUP C;  2PR6 A;  5KSH A;  3A0R A;  2P7J A;  2QHK A;  4O8G A;  4LRZ E;  3RH8 B;  3PXP A;  2V0U A;  3IBR A;  4EEU A;  1Y28 A;  4GS9 A;  1P0Z A;  3LIC A;  4ETZ A;  3C2W A;  4BBT A;  2BAS A;  5KIZ A;  1N9O A;  2CMN A;  2W0N A;  4HJ6 A;  3LR4 A;  2EA9 A;  1MZU A;  2WKP A;  2DMW A;  2JKR M;  2QWS A;  1OT6 A;  2W3F A;  2Y79 A;  5DJU A;  4BMW A;  3PBO A;  4WN5 A;  4IUH A;  2QJ7 A;  1IOU A;  4R6L A;  3KSH A;  4H6J B;  4NXB A;  4I38 A;  1H3Q A;  1VB6 A;  4NEE D;  1GSW A;  5A8B A;  1DP9 A;  4MN5 A;  4YNR A;  3P01 A;  1OTE A;  5HDS A;  3EGX C;  1OPX A;  1IFQ A;  1DP8 A;  4NXE A;  5DF9 A;  2PHY A;  3UE3 A;  4GCZ A;  2PD8 A;  3E98 A;  2V9A A;  2K31 A;  2GNX A;  3P7N A;  1BYW A;  3BY9 A;  2JN7 A;  3LUQ A;  1OTI A;  1D06 A;  3ZYT A;  2LB5 A;  4F3L B;  4B9O A;  3OCL A;  4GHI B;  1XFQ A;  5AVE A;  1NLZ A;  1XJ6 A;  1JNU A;  3LR0 A;  3UB9 A;  2V1B A;  3KSI A;  5FL3 A;  4HY8 A;  3EQV A;  3NOU C;  4EQ1 A;  4ARZ B;  3OLO A;  5CX7 A;  2KOI A;  3BY8 A;  3G6O A;  4XT2 B;  3T4O A;  3E4O A;  1S66 L;  4MMN A;  4BBV A;  3CIT A;  4DN0 A;  4CLC E;  2L0W A;  2PYP A;  3FPW A;  2VX8 A;  5HPF A;  3C38 A;  3KO6 A;  4KQD A;  4NXF A;  4CLC C;  5LBR A;  2W3D A;  5TJJ A;  3MR0 A;  5L8M A;  1VHM A;  3A0S A;  3VE3 A;  2OWH A;  2W1R A;  2KLI A;  3CUE A;  2KX6 A;  1WA9 A;  3R7W A;  4JGQ A;  4MN7 A;  2I9V A;  3O5Y A;  4M4X A;  4EUV A;  3UME A;  3PBT A;  5F5Y A;  5HWV A;  2JKT M;  4O0P A;  2J3W A;  2PYR A;  4WL9 A;  2W3G A;  3IBJ A;  1XFN A;  4WEJ A;  3F1P A;  3CI6 A;  2HJ9 C;  3D3O A;  1T18 A;  4LRY C;  5F69 A;  2J80 A;  3KSG A;  4MN6 A;  1V9Y A;  3TJZ C;  1TS8 A;  3HCY A;  4LLO B;  2B18 A;  5IU1 A;  3PR6 A;  3D72 A;  1G28 A;  4HJ4 A;  2A24 A;  3NHQ A;  1UWN X;  2XSS A;  3C30 A;  2HGV A;  1DRM A;  2V0W A;  5MC7 A;  4R70 A;  4FSF A;  3W2Z A;  3JVU A;  2PD7 A;  3T4Q A;  2VLG A;  3T4S A;  4LPZ A;  2JKR I;  4Y2F A;  2G7U A;  3UMD A;  4UEY A;  2GX5 A;  4L9G A;  3LR3 A;  3GEC A;  4I3I A;  4DJ3 A;  3E4P A;  2LB9 A;  3F1O B;  1OT9 A;  2H28 A;  3R4K A;  1NRJ A;  4HI4 A;  3UB6 A;  1NLY A;  3LIA A;  4HQA A;  4L9F A;  2OAQ 1;  2HF6 A;  2HJE A;  5TBM A;  2A2L A;  5HDC A;  4G3K A;  4R3A A;  1TS7 A;  3IS2 A;  5G4Y A;  3KYQ A;  2GJ3 A;  3H7W A;  4EU0 A;  1ODV A;  4DJ2 A;  3VV4 A;  3LIB A;  2OAP 1;  1TS0 A;  2OWJ A;  2QKP A;  3CWF A;  3MQQ A;  3PBR A;  4PAU A;  1N9N A;  3EOI A;  5DFX A;  3MQO A;  1D7E A;  2VJW A;  3FPV A;  1OJG A;  1P9R A;  4LRX C;  4Y3I A;  4JGP A;  2EWW A;  3S7O A;  4ME4 A;  2NUT C;  3ULF A;  1LSX A;  3C8C A;  4E04 A;  3B33 A;  4JGO A;  2JHE A;  3LID A;  2XA7 S;  3EQU A;  5AJG A;  4CLC A;  5G4Z A;  3LYX A;  4Y5F A;  2W3H A;  4KQO A;  3F1P B;  2W1T A;  2YKH A;  2ZOH A;  1T1B A;  2QYB A;  4L0L A;  1W63 M;  4QPR A;  2D01 A;  2O9C A;  1T1A A;  1H8M A;  4UQI S;  1S1Y A;  3PBS A;  2A24 B;  3LFV A;  3OC2 A;  3MQ0 A;  4Q0H A;  1OTD A;  4EES A;  3OBF A;  1S67 L;  3U2A A;  1KOU A;  3PBQ A;  1XJ3 A;  3LIF A;  3SW1 A;  4FOF A;  5J7E A;  1OTA A;  1G6O A;  3FG8 A;  1OTB A;  4NKP A;  2JKT I;  2M1C A;  5I5L A;  2W27 A;  2VKS A;  1XJ2 A;  3RTY A;  3LR5 A;  3A0V A;  1YAX A;  4GS9 B;  2EWV A;  4IHQ A;  2ZOI A;  3KYZ A;  1YKD A;  2Z6D A;  3E0Y A;  3H9W A;  1W63 Q;  1EW0 A;  2PT7 A;  2VV8 A;  3OCN A;  1X0O A;  2XRN A;  2L1M A;  4I39 A;  3HJK A;  1S4R A;  5J4E A;  2O9A A;  4IUK A;  3MMH A;  4L9E A;  1ZHH B;  4EER A;  5TBM B;  5HL6 A;  3MJQ A;  3FC7 A;  2R78 A;  3IS2 B;  4B93 A;  2WKQ A;  2P04 A;  4P6Z S;  5AVF A;  4H6J A;  1NWZ A;  1T1C A;  2VGL S;  2XA7 M;  3S7P A;  2FZ0 A;  4HP9 A;  4Z1W A;  2XRO A;  4MCW A;  3ICY A;  3S7N A;  1N9L A;  2QJ5 A;  4KUK A;  1XJ4 A;  5F6A A;  4HH3 A;  1STZ A;  5HD5 A;  4CLC B;  3H82 A;  4UQI M;  3TE8 A;  1P9W A;  5J3W A;  3EEH A;  3BWL A;  2W1T B;  4RQ9 A;  3KX0 X;  2FH5 A;  3NOP C;  5HD3 A;  2Y8H A;  4KUO A;  3BQ8 A;  3EGD C;  3VE4 A;  2MJ6 A;  4HNB A;  3OOV A;  5DKK A;  3EWK A;  3K2N A;  3PHY A;  3BW6 A;  4GLQ A;  2ZBB A;  4IJG A;  1UGU A;  4G3W A;  4R38 A;  4YWZ A;  4CLC D;  2PR5 A;  3MF0 A;  4GW9 A;  3DBA A;  2W3E A;  3F1N A;  4AFI A;  2KDK A;  1TF1 A;  1UWP X;  2O0Y A;  2Z6C A;  2OOL A;  5IS1 A;  2M7V A;  1YSP A;  4WEK A;  4P6Z M;  3R7W B;  1GSX A;  2INW A;  2VGL M;  1OJ5 A;  4I3A A;  5DFY A;  5F68 A;  1TS6 A;  4II7 A;  4OOL A;  1S1Z A;  4HIA A;  2GZA A;  3K3D A;  2VA0 A;  1F98 A;  3KSF A;  2O9B A;  4PHT A;  1F9I A;  3T4J A;  1GSV A;  5HSQ A;  2YKF A;  1MKM A;  1YSQ A;  1T19 A;  3T4L A;  2J3T D;  2L4R A;  3MXQ A;  3UB8 A;  2P08 A;  3BJN A;  3LI8 A;  5HWW A;  4EXO A;  2V1A A;  2M7U A;  2IA2 A;  1S4S A;  1DP6 A;  3MFX A;  5K5B A;  3TRC A;  3H82 B;  2HV1 A;  4HOI A;  3B47 A;  4DMZ A;  4HHD A;  2B02 A;  4GJ4 A;  1TD5 A;  1V9Z A;  4PKY A;  4HJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...