4HP4A

Crystal structure of pas domain from the fruit-fly elk potassium channel
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
123
structure length
112
Chain Sequence
NTFLDTIATRFDGTHSNFVLGNAQANGNPIVYCSDGFVDLTGYSRAQIMQGCSCHFLYGPDTEEHQQIESLSNMELLEVIFYEGAPFWCLFDIVPINERDVVLFLASHDITH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural properties of PAS domains from the KCNH potassium channels
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein
molecule keywords Eag-like K[+] channel
total genus 26
structure length 112
sequence length 123
chains with identical sequence B
ec nomenclature ec 2.7.3.-:
pdb deposition date 2012-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hp4A00
1OT6A 4HQAA 1OTIA 3MXQA 4NXFA 4F3LA 4JGPA 5EFWA 3A0RA 4HY8A 4EEPA 2V0WA 1UGUA 1XFQA 1XJ6A 3ICYA 1T18A 1GSVA 4NXEA 4HOIA 4EW7A 4F3LB 3FG8A 1XFNA 4LPZA 4NXBA 2Z6DA 2JN7A 3LIEA 3MFXA 4GS9A 1D7EA 3LIAA 3NOTC 5G4ZA 3NOPC 4E04A 5G4YA 2V1BA 1P0ZA 3MR0A 4I38A 3C8CA 5TBMB 4R70A 3EEHA 2QKPA 3RTYA 2YKHA 1KOUA 4HJ4A 4DJ2A 2PD7A 4R38A 4K08A 3LUQA 3UB9A 4BBUA 3A0SA 5TBMA 3E4OA 4JGOA 5AVFA 4RQ9A 1GSXA 5HDDA 3LYXA 1WA9A 3H9WA 3NJAA 4I3JA 4EESA 3LI8A 2WKRA 4GS9B 3ULFA 1T1BA 3GECA 4JGRA 3LI9A 4M4XA 1OTDA 4KUOA 5HDSA 1X0OA 2B02A 4B9OA 4HIAA 5IS1A 4BBVA 2QJ7A 2VV6A 4LRXC 4EXOA 1BYWA 4I3AA 2QHKA 3LIBA 4DJ3A 3FC7A 4HI4A 2I9VA 3PHYA 4GCZA 4HH3A 5F68A 3UMEA 2VV8A 2KDKA 4EQ1A 2A24A 1DRMA 5J4EA 3E4QA 4KQDA 5HWWA 2WKQA 4MN6A 2EA9A 4XT2A 5KIZA 1TS0A 1XJ4A 3UE6A 1D06A 3H7WB 4PKYA 2PHYA 4LRZE 5DJTA 2W0NA 5HD3A 2L0WA 3G6OA 3F1PA 4YWZA 4JGQA 5I5LA 4GHIB 4BBTA 4EEUA 2P7JA 4HP9A 3EWKA 3MJQA 2PDRA 3H7WA 1DP8A 1UWPX 2K7SA 3HJIA 1VB6A 4WUJA 4HH2A 4HNBA 1V9ZA 3LICA 2L4RA 4PKYG 3RH8B 3K3DA 1F98A 3CWFA 4HHDA 3A0VA 5HZHA 1LSWA 1T19A 2OOLA 1GSWA 3D72A 4L9FA 4WL9A 2W27A 5DJUA 5HDCA 2BASA 1UWNX 4I39A 1OJ5A 2Z6CA 1N9LA 2PYRA 2VEAA 4KUKA 4HJ3A 1T1AA 1S67L 2WKPA 2M1CA 4R3AA 5A8BA 1N9OA 2D01A 2YKFA 1TS7A 1OJGA 3ZQ5A 1OTBA 4GHIA 4NXGA 4MN5A 2V0UA 3BWLA 3F1PB 4HP4A 3VOLA 4L9EA 1MZUA 3K3CA 2L1MA 3CAXA 3H82B 4I3IA 3VE4A 1ODVA 3B33A 2PR6A 4XT2B 1S4SA 2CMNA 3C2WA 5HSQA 3UB6A 1EW0A 1OTEA 5HWTA 2D02A 3F1NA 2H28A 4LLOB 4WLAA 2QJ5A 3SW1A 3KX0X 5HWVA 3UB8A 4EETB 3MQOA 2R78A 1T1CA 2INWA 1F9IA 2J80A 5HD5A 1S1YA 1N9NA 4R6LA 1LSVA 5F69A 5IU1A 3IS2B 2PD8A 2PR5A 3NOUC 3UB7A 2GJ3A 3IBRA 5AVEA 1S66L 2HV1A 2A24B 3F1OA 1NWZA 1S1ZA 3GDIA 4WF0A 4L9GA 1G28A 3T50A 3LIFA 1Y28A 4EERA 3IS2A 4I5SA 2JHEA 2ZBBA 4H6JB 3UMDA 3VE3A 2KX6A 1XJ3A 4LRYC 5DKKA 3P7NA 1P97A 1OTAA 1DP6A 1S4RA 3BY9A 1XJ2A 5F5YA 3NHQA 5DKLA 5J7EA 3MQQA 2V9AA 3E4PA 1OT9A 2VLGA 2ZOIA 2V1AA 2PYPA 2QWSA 1LT0A 3BY8A 3F1NB 3PYPA 3LIDA 4GW9A 1JNUA 4H6JA 3HJKA 1LL8A 3CLOA 4HJ6A 4WN5A 3OLOA 2OWHA 1V9YA 1DP9A 1LSXA 1TS6A 2OWJA 2ZOHA 3H82A 2VV7A 5F6AA 5J3WA 1TS8A 3F1OB
chains in the Genus database with same CATH superfamily
1OT6A 2ZM2A 1LLBA 1FCNA 1XFQA 3ITBA 2HDQA 2Y4AA 3S7OA 4DN0A 3FZCA 4R70A 3M6HA 3UE3A 5HL6A 5FQ9A 2I72A 1K38A 3E4OA 3SH7A 1PWCA 2A3UA 3A3EA 1F2KA 2IWCA 1X0OA 3IF5A 1RGZA 2A24A 1JVJA 3BLSA 3VV4A 4KQQA 1YAXA 5CTMA 1MWRA 5DJTA 4BENA 3SZTA 1YT4A 2OAQ1 3MJQA 3ZVTA 2PDRA 2VZWA 1TD5A 3HLWA 4D60A 1HZOA 1RCJA 2W27A 1E3UD 2WYXA 4GN2A 4A5RA 4HJ3A 5CXWA 2D01A 5GHZA 2RCXA 2V0UA 3RXXA 4N1XA 1K6RA 3IX8A 2ZJ9A 3Q7VA 2Y8HA 4XT2B 3TE8A 3UB8A 4X68A 1PW8A 2K31A 3M6BA 1YLPA 2PBDP 5FEFA 3IXHA 4FD8A 2PAVP 3IS2A 3DAVA 4JBFA 3MS6A 1L0GA 3MBZA 3MQQA 4I3IA 3VE4A 3PYPA 2M7UA 4WN5A 4OH0A 4HJ6A 2FH5A 5BOHA 4NXFA 2JKGA 3OPPA 5EVIA 1WE4A 3LIEA 2E8JA 3E2KA 3O3VA 1JWVA 2V1BA 3CPTB 2JKTI 5KZHA 3UPNA 1BZAA 3Q81A 5DFYA 3S22A 4CLCE 5HPFA 4ID4A 1AXBA 5F82A 3VSLA 3HCYA 3QNBA 1IKGA 2B02A 2ZQ7A 3EEAA 3LIBA 4LV1A 1FIKA 3KSFA 4UA7A 4DJ3A 4HH3A 1M6KA 4R3BA 1CI9A 3BRMA 5EVEA 1ZKJA 1W8YA 2EWVA 4YNRA 3WS1A 1I2SA 4ZJ1A 3IBJA 3NCKA 2Y91A 4DDSA 3A3DA 1LSWA 4R1GA 2OOLA 1MBLA 4OLDA 3BFFA 1MKIA 2BASA 3KYZA 2DRWA 2VGLS 1N9BA 1E3UA 5TFQA 4QD4A 3T1XA 2J3TC 4MN5A 3RJUA 4DRTA 3LY3A 1MWSA 1L2SA 3CHWP 3LEQA 4CLCA 3MQOA 4ARZB 2XR0A 3IBRA 2JBFA 4IVKA 3F1OA 4FTXA 3HUMA 5KSHA 4ETXA 4LRYC 3BY9A 3BQAA 3E4PA 1FQGA 4OPRA 3TSGA 4Q8IA 3N8RA 3OLOA 2RL3A 2GX5A 3OZHA 5CGWA 1ES3A 2GZAA 1KE3A 1T18A 3DWKA 2IWBA 3OCLA 4LV3A 1D7EA 2Y59A 4L0LA 2X01A 3ZGAB 3NULA 3G4PA 5KMWA 4LCLA 4GZBA 3UPOA 5TBMB 2VK3A 4R38A 5IHVA 3JYIA 3G34A 5HDDA 3HUOA 1YKDA 3MZFA 4B9OA 1ZTUA 2P9VB 1YLZA 4RYEA 4B93A 3OC2A 3EQVA 4DF6A 4R23A 1PWDA 4MBKA 3G6OA 2QMIA 5FI2A 4HP9A 3ZG7B 5F1GA 2ZL1B 3HJIA 3LICA 3A3FA 3WS0A 1GSWA 3C7VA 3L7HA 3B47A 4GD8A 4XXRA 1IYQA 2WKPA 2XA7M 3QP5A 4L9EA 3EGDC 5FL3A 5GLAA 2H28A 3Q1FA 4KZ7A 5FQMA 5HWVA 3ZG0A 4BMWA 1HVBA 4R6LA 4DXBA 5EVLA 3T50A 2OLUA 4GB7A 2WGIA 5FAQA 2QPNA 1YPRA 2WGWB 4KZ3A 5TR7A 3V3SA 1MXOA 2QWSA 3BFEA 3MZEA 3T4OA 3CLOA 3M2KA 4KENB 4OPQA 5A93A 1Z6FA 3UE1A 4EWFA 1CEGA 4HOIA 5DVAA 3LCEA 4NXBA 3U2AA 4EV4A 4WM9A 4Y13A 2JKFA 3MR0A 3BFDA 1ACFA 4M3KA 4JGOA 4Y0UA 2OAP1 3QHYA 2Y55A 1XGIA 4PM8A 4WZ5A 1K4EA 5HWWA 4K0XA 1TS0A 1Q2PA 5CGSA 1EI5A 3VFFA 2L0WA 1FSYA 3OPHA 2ZQ8A 4CLCC 2DMWA 5L09A 4PKYG 1V9ZA 2IA2A 4OQIA 2ZC5B 1YSPA 5DJUA 2UV0E 4BD0A 2EX2A 3BFCA 1NZOA 3UY6A 4RX3A 4WEJA 4N1HA 5K5BA 3H82B 3JVUA 2D02A 3NI9A 1T1CA 3EOIA 1SDNA 3NOUC 3EQUA 4YOFA 5AVEA 3R7WA 1S1ZA 2G2UA 1IEMA 4I5SA 1OTAA 3PR6A 4MCWA 4JPMA 5F6AA 4OOLA 3DTMA 4K0WA 1ES2A 1K57C 1OTIA 3A0RA 4HY8A 4EEPA 4NXEA 2XEPA 1KDSA 2Y2MA 4LPZA 2ZC4B 1PW1A 3MFXA 4UQIS 5L8MA 4S2LA 4B4ZA 1M40A 3EEHA 4U0TA 3WS4A 3HLDA 3VMAA 3LUQA 5DF9A 4X25A 1IYOA 5CEBA 4M4XA 1OTDA 4MNRA 1K55C 3UMEA 3C30A 1DRMA 3SH8A 1NXYA 2H5SA 4XT2A 3O86A 3UE6A 3V39A 4FH2A 4ARZA 3DTEA 2WGWA 1IYPA 2P08A 1YQSA 3H7WA 5EM1A 5C5KA 2HP9A 3CUEC 3B42A 4UA6A 4DE1A 2Y2KA 4Q0IA 2HZ5A 4Q0HA 4IEDA 5HDCA 3HBRA 3VFHA 1P9WA 1T1AA 5EUAA 2PRFA 5GHXA 5GLCA 3KYQA 2B5RA 4HP4A 3VOLA 3OPRA 4WZ4A 3WS5A 1LL5A 1PWGA 4PAUA 1BTLA 2EXBA 1PI4A 1N4OA 1LSVA 4NG2A 4KZ8A 4E6XA 1Y28A 1L0EA 4X1LA 1KGFA 3ZHHA 3H9WA 2OWHA 4F3LA 3VOYA 2NUPC 1GCEA 1QMFA 3V67A 4GS9A 1NLYA 5FAPA 3T4SA 5EOEA 2HDSA 1TDGA 4BD1A 1CQAA 3ZCZA 4DJ2A 1ERMA 4DXCA 5TBMA 1XKZA 2XH9A 1FSWA 3LYXA 5HX9A 2WZZA 2QJ7A 3A3JA 5EOOA 1LL9A 3FC7A 4GCZA 2Y2JA 3IXDA 5CTNA 3RXWA 1Q2QA 5EV0A 3KSHA 4Y17A 5EPHA 3U4LP 2IWDA 1NRFA 2P7JA 1VETA 1OPXA 5HL1A 1VM1A 3G2ZA 2XSSA 3PAEA 3OPLA 1UWNX 2PYRA 4E3LA 4EBNA 3OBFA 1MWUA 5EE8A 1BLPA 2VX8A 3Q07A 4O7DA 3UDXA 4MN7A 3T4JA 3HUNA 3TOIA 1CK3A 4EUVA 4EETB 3E2LA 4PHTA 5HD5A 5GLDA 2EWWA 5IU1A 2VJWA 3IS2B 5TJJA 4Y3IA 4KZ9A 3UDFA 1ESUA 5F83A 5I94A 3KYEA 4N9LA 2V9AA 2XDMA 4NEED 3LFVA 4GW9A 4L9GA 4H6JA 4D2OA 1LL8A 4E3NA 2X02A 3F1OB 3Q7ZA 4II7A 4E3OA 2WK0A 1GSVA 4QWOA 2ACGA 4JLFA 4S2KA 1K56D 2XD5A 2ZM8A 4EQIA 1FILA 4HESA 2Y2GA 4BJPA 3SS5A 3VP3A 3LR3A 3LR4A 4KZ6A 4X69A 2XLNA 4GS9B 3GECA 4JGRA 5CEDA 5IS1A 4KUOA 4Y7PA 1RP5A 4EUZA 5KSCA 4ETZA 4XUZA 5LBRA 3W2ZA 1G6AA 5HAQA 3TRCA 4BL3A 1WYBA 5EVID 3O87A 4LRZE 3F1PA 4Y2FA 4MBFA 4DE3A 3G30A 5M19A 2JC7A 4K91A 1SCWA 3RH8B 4HHDA 3QP8A 4WMCA 2ZMVA 2XK1A 3BJNA 2V1ZA 1ZG6A 3D3OA 1OJGA 2V20A 3OCNA 1YSQA 2VGJA 1IYSA 3FPVA 4AFIA 2KLIA 1K55A 5HWTA 3KX0X 5FQJA 1H8YA 3BQ8A 1ES5A 4ZRRA 3BFGA 4OPYA 1NY0A 4O01A 2XQZA 2ZLYA 4PPRA 4EBLA 2O9AA 5F5YA 1BT5A 5FQQA 3F1NB 4NETA 5E2HA 1V9YA 1LSXA 2ZOHA 2PR6A 2G2WA 1ZC2A 3V5MA 3GR2A 2B95A 1KGGA 2JN7A 3MFDA 3CG5A 3I7JA 3C8CA 3RTYA 1FCOA 4GJ4A 4BQMA 3GSGA 1PYYA 1K4FA 3DTKA 1XA7A 3GTCA 5FASA 4RQ9A 3PBSA 4KZAA 4BBVA 4LRXC 4KG2A 2QHKA 2Y79A 4OVDA 3S7PA 4ZAMA 1K54A 4XUXA 5FI7A 1I2WA 4GLQA 3E98A 3EGXC 1KDWA 4DE0A 4EEUA 1K6SA 1MWTA 1VB6A 1W63M 4HNBA 4R4RA 1F98A 5AQBA 1O07A 5HZHA 4EU0A 3L9KA 1Y54A 2H0TA 2J8YA 4QJGA 5HFOA 4CQHA 2YKFA 3ZQ5A 1JWPA 2WAFA 3O5YA 4IHQA 1KE0A 1XGJA 4KQRA 2CMNA 1NYYA 3BLMA 1OTEA 3SW1A 4GDBA 3VP0A 2R78A 1N9NA 3JVVA 4QB8A 2PD8A 4QY6A 1XP4A 2CC1A 1PZPA 3HLFA 4H6JB 4PM5A 3P7NA 4S2MA 2XD1A 3CPTA 1FR1A 1RGYA 1DP9A 1H8MA 5CHMA 1IKIA 5HAPA 3MXQA 2WGVA 4JGPA 5F1FA 1J3WA 4DDYA 3UNWA 4YINA 4OQGA 3LIAA 5A92A 2J9OA 2XFSA 2Q9MA 2VA0A 5DFXA 2C6WB 1TDLA 5AQAA 4K08A 1QMEA 3T4LA 1H0MA 1WA9A 3TG9A 4HIAA 1S6RA 4IVIA 5DTSA 4RX2A 5J4EA 3G31A 2HP6A 1D06A 4PKYA 3FKWA 2E8IA 3VSKA 3PBOA 3VP1A 1I5QA 3CITA 4R3JA 1P9RA 4WL9A 3LGOA 4X6TA 1ONGA 4LFUA 2PT7A 3AGDA 3LR0A 3F1PB 4FSFA 1NLZA 1C3BA 4F94A 2J3TD 4S2PA 1J9MA 4B4XA 3PBQA 1YLWA 1YLYA 4JF5A 4CLCD 4UHUA 4Z1WA 2XF3A 4PM6A 1ES4A 3ZNYA 2JHEA 2ZBBA 1STZA 3VE3A 1OT9A 3DBAA 4R0QA 2VKSA 3WWXA 5L2FA 4OP5A 1TS6A 3H82A 2MJ6A 3UB6A 1IFQA 1GA9A 4UAAA 5EVIB 2Y2QA 1PI5A 3MQ0A 3BEBA 4EW7A 1HD8A 2ZC7A 4E04A 3IXGA 1NYMA 1P0ZA 5CECA 4JXGA 3C4OA 4HJ4A 3QP1A 4JXSA 2JKTM 3SOIA 1SKFA 1ONHA 4MMNA 2ZQAA 1GSXA 3UPPA 1SDEA 2VV6A 4I3AA 4IJGA 4QY5A 2XA7S 5HAIA 4MN6A 3PXPA 3P98A 3N4IA 3MZDA 4C6YA 4LCMA 4ME4A 1TVFA 4BBTA 4Z9QA 2K7SA 2A49A 1AWIA 3BM6A 3K3DA 1ESIA 2FFYA 3NC8A 2XFTA 3S7QA 1N9LA 3BECA 5TGFA 5A8BA 1IELA 3K2NA 4NXGA 4ZJ3A 4OONA 3ZVWA 3ZYTA 3K3CA 4JF6A 1Z09A 1ODVA 5MC7A 4QPRA 4WELA 1S1YA 2ZL1A 5CERA 2W3HA 5CHUA 2Y2PA 5FAOA 3C38A 1S66L 1U60A 1L0DA 2Y2HA 4C3QA 2PU4A 2ZM0A 3IWOA 4UA9A 4Y15A 4FOFA 4CJNA 5DF7A 5AJGA 2V1AA 3BY8A 1OMEA 3HLEA 5DTKA 4P0MA 3GVBA 2VGKA 1E25A 4P85A 1W8QA 3T1SA 4F3LB 1XFNA 5FQIA 2M7VA 4PMAA 4E3KA 5G4YA 5CRFA 4WEKA 3SH9A 2QYBA 5G18A 2R9XA 2H10A 3NJAA 3LI8A 2WKRA 2BLSA 4KZ5A 2EXAA 2V8FA 3PHYA 3S7NA 2OSUA 3HVFA 2HJEA 4KQDA 2ZC3B 4NK3A 1NRJA 2JKRM 5HD3A 5A90A 1BSGA 4LV2A 4WUJA 1UWPX 2L4RA 1LHYA 1Y4OA 3RFBA 1A0KA 1T19A 3D72A 4L9FA 3BW6A 4I39A 1N9OA 4HBTA 3HL9A 4GHIA 1ZG4A 3MXRA 5FI6A 3LEZA 3G32A 2O0YA 1EW0A 2WADA 5EVIC 4IBXA 4Y0OA 2QJ5A 3MXSA 2A2LA 2W1TA 4DE2A 2WKHA 3LO7A 3UMDA 4OOYA 5DKKA 5E2GA 2KX6A 3PTEA 3IF6B 1S4RA 5DKLA 2EFXA 3JPUA 3LIDA 4FCFA 1BLCA 1K54C 1TS8A 2C5WB 5FQKA 3IHAA 4HQAA 4S2NC 3DWZA 4RVAA 5EFWA 2V0WA 3QNCA 5A91A 3FG8A 4OQHA 3VP4A 3R7WB 2WAEA 3NOPC 1FR6A 4PM9A 2VGLM 4QHCA 4Y5FA 3G35A 2DCFA 4S2OA 3A0SA 1E4DA 3G2YA 3UN7A 1JTGA 5HDSA 1BYWA 4P6ZM 1JTDA 3AGEA 2P74A 1PFLA 4EQ1A 3T12B 2HF6A 2WKEA 3GV9A 2WKQA 1MKMA 3MMHA 4O8GA 4P87A 3HLBA 2PHYA 1G5UA 2W0NA 2HDRA 2PU2A 3QP2A 3LR5A 2W3EA 3PBTA 3V50A 3KO6A 1LI9A 1DP8A 3QP4A 4GDNA 4ZDXA 3CWFA 3A0VA 2W1TB 5JYPA 1ZHHB 5GLBA 4KG6A 1GHIA 4ZTKA 2ZQ9A 2Y2IA 2OLVA 4X1MA 3KSGA 3B33A 1BLHA 4WZ5C 1ERQA 2WKIA 4H8RA 4GOGA 5HSQA 2EX8A 2ZMFA 3IWQA 4OPZA 3UO9A 5J8XA 1F9IA 3Q7VB 3ZG9B 1KVLA 3GMWA 2GNXA 3IF6C 3ITAA 4OLGA 4EERA 5E2EA 4WBGA 3ZG8B 3N8LA 3SS4A 2J7VA 5FDHA 4MLLA 1KGEA 5J7EA 1H8ZA 3C7UA 1EROA 1JNUA 2HP5A 4S2JA 3VP2A 4EXOA 1EWZA 3ZDJA 1XX2A 5D3OA 5M1AA 3WRTA 4E3JA 3P01A 3GQZA 4X55A 3NDEA 1SKOB 3NOTC 3S4XA 2EX6A 5FDSA 2QKPA 3HLCA 4LENA 3HREA 2PD7A 4KQOA 3MKFA 2W1RA 1NZUA 3C4PA 1MPLA 4I3JA 3QP6A 1H3QA 3LI9A 2JKRI 3T1QB 5HARA 3V3RA 1MY8A 2O9BA 5U47A 4KZ4A 1YLJA 4JF4A 4IBRA 4YWZA 4IUKA 3PBNA 3N8SA 4MBHA 4RA7A 3T4TA 4ZJ2A 4FH4A 4S2IA 2XGNA 2O9CA 2VEAA 2ZMAA 1OTBA 4JXVA 5E43A 1MZUA 3CAXA 3M2JA 1S4SA 3IH8A 1KE4A 5L10A 3W4QA 1D1JA 4GD6A 4S2NA 2J80A 3N7WA 1CJFA 2LB5A 2LB9A 3UB7A 5M18A 1K56A 1NWZA 3GDIA 1CEFA 3LIFA 4R4SA 3UE0A 1P97A 3Q82A 4C75A 4X53A 3C5AA 5DF8A 3BYDA 3LY4A 4GKUA 2JE5A 2Q0OA 2UWXA 4NKPA 3T4KA 4E3MA 3ZNTA 2HPBA 3UB5P 3T1RA 1W7FA 3E0YA 1G6OA 2NUTC 5G4ZA 3WS2A 3P09A 4MEZA 4I38A 4PM7A 1VETB 1KOUA 4CLCB 4Y0TA 2EFUA 3UB9A 5L07A 4UEYA 5AVFA 3OOVA 4LV0A 2HGVA 2I9VA 2WUQA 3W4PA 2KDKA 3UDIA 2HJ9C 3IH9A 1JWZA 5DTTA 2V2FF 5I5LA 3IX4A 4DKIA 3EWKA 1G68A 3S1YA 1NJ4A 5HW3A 5GL9A 3TJZC 4UQIM 2Q9NA 1OJ5A 2Z6CA 1S67L 2M1CA 5FATA 1TS7A 2JCHA 3NECA 4LGWA 1F5MA 3IHBA 3C2WA 1XPBA 2Y2LA 3PAGA 2R9WA 2ZC6B 5AQ7A 3CZDA 4LLOB 1IOUA 3IWIA 1VQQA 5JYOA 2GDNA 2BG1A 3ISGA 1DY6A 1FOFA 2FFFB 1L3LA 1S0WA 3ZFZA 2J3WA 1G28A 2XROA 3N6IA 2W3FA 4P6BA 1VEUA 1XJ2A 3NHQA 2ZD8A 2PYPA 4MDZA 1K57A 3HJKA 3HLGA 5CHJA 1GHPA 2HDUA 3ICYA 1XJ6A 2ZQCA 3IQAA 1XXMA 2W3GA 2Z6DA 4P6ZS 5CX7A 2P9VA 4IUHA 4BWIA 1YLTA 1W63Q 3NY4A 4OKPA 3A3IA 1PZOA 5FSRA 4N9KA 5FEGA 4HEFA 2VV8A 2G7UA 3E4QA 2KOIA 1MC0A 3H7WB 3DTIA 2ZQDA 3B3XA 4BLMA 1ALQA 3PBRA 4JGQA 4GHIB 3W4OA 2OV5A 3VOZA 5HPIA 4WYYA 4HH2A 3W8KA 1HLUP 1O7EA 1K25A 5FA7A 5GHYA 4JKTA 4DMZA 2O99A 4ESPA 5EECA 5IT5A 4G3KA 4R3AA 3D9YA 4G3WA 2L1MA 2Z2LB 4KZBA 1L0FA 1FCMA 3SS3A 3R4KA 1PIOA 2DNSA 1DJBA 1XA1A 3CI6A 2PR5A 1YMSA 2Y2NA 2HV1A 2A24B 4WF0A 1W79A 3IX3A 4U0XA 2V8CA 1KVMA 3NDGA 1LI0A 3NIAA 2Z2MB 1DP6A 3T4QA 2VLGA 1DJCA 1HTZA 5KIZA 5J3WA 3ZG5A 1PNEA 2PBYA 4X56A 1UGUA 3KSIA 2WZXA 1SKOA 4B88A 1TF1A 1SZVA 1W5DA 2FZ0A 4WMCD 4U3TA 2XRNA 1H5XA 3IT9A 3MSHA 3GRJA 2YKHA 1GA0A 1PRQA 3IF6A 4BBUA 1SHVA 4QU3A 4EESA 1BULA 2J9PA 3DW0A 3ULFA 1T1BA 1K0KA 4OOMA 4KG5A 1DJAA 3CJMA 3NBLA 4HI4A 5F68A 1YMXA 2AVXA 2EA9A 1XJ4A 4FUWA 3FKVA 4G3VA 4JXWA 3AGFA 1CF0A 3FYZA 3IXBA 2EX9A 1CI8A 1VHMA 4E6WA 3MKEA 4OQ0A 5EM0A 3FPWA 1YM1A 4EBPA 5E2FA 4GNUA 4HBUA 4KUKA 4CPKA 3BWLA 3CUEA 2K2NA 1TEMA 4BL2A 4E3IA 1BLSA 3F1NA 4WLAA 2P04A 3FWLA 5AQ9A 2QZ6A 2X71A 2INWA 2BTFP 3D4FA 5F69A 1GHMA 3O88A 2GJ3A 1VEUB 4N92A 4Q0JA 4O0PA 4OP8A 1XJ3A 1WYCA 3TW8A 2W3DA 2ZOIA 1LT0A 4ZBEA 1BUEA 3MF0A 2B18A 3CMZA 3WRZA 2OWJA 3FV7A 2Y2OA 5CGXA 2H0YA 2VV7A 4YFMA
chains in the Genus database with same CATH topology
1OT6A 1OTIA 3MXQA 4JGPA 3A0RA 4HY8A 4EEPA 1XFQA 3P01A 4NXEA 4LPZA 3MFXA 3S7OA 4UQIS 5L8MA 3LIAA 3NOTC 4DN0A 2VA0A 5DFXA 4R70A 3EEHA 2QKPA 3UE3A 2PD7A 4KQOA 4K08A 3LUQA 5HL6A 5DF9A 3E4OA 2W1RA 3T4LA 1WA9A 4I3JA 1H3QA 4M4XA 3LI9A 1OTDA 1X0OA 2JKRI 4HIAA 3UMEA 2A24A 3C30A 1DRMA 5J4EA 2O9BA 3VV4A 1YAXA 4XT2A 3UE6A 1D06A 4PKYA 5DJTA 4ARZA 4YWZA 4IUKA 3PBNA 2OAQ1 3PBOA 2P08A 3MJQA 2PDRA 3H7WA 5C5KA 2VZWA 3T4TA 3CUEC 3B42A 3CITA 4Q0IA 1TD5A 4Q0HA 1P9RA 4WL9A 2W27A 2O9CA 5HDCA 2VEAA 1P9WA 4HJ3A 1T1AA 2D01A 1OTBA 3KYQA 2PT7A 2V0UA 3LR0A 3F1PB 4HP4A 3VOLA 1MZUA 3CAXA 4FSFA 1NLZA 2J3TD 4XT2B 1S4SA 2Y8HA 4PAUA 3TE8A 3UB8A 2J80A 3PBQA 1LSVA 2LB5A 4CLCD 2LB9A 3UB7A 4Z1WA 2K31A 1NWZA 3GDIA 3LIFA 1Y28A 3IS2A 2JHEA 2ZBBA 1STZA 3VE3A 1P97A 3MQQA 3H9WA 1OT9A 3DBAA 4I3IA 3VE4A 3PYPA 2VKSA 2M7UA 4WN5A 2OWHA 1TS6A 3H82A 4HJ6A 2MJ6A 3UB6A 1IFQA 4NKPA 2FH5A 3T4KA 4NXFA 4F3LA 3MQ0A 2NUPC 4EW7A 3V67A 3LIEA 3E0YA 4GS9A 1G6OA 1NLYA 2NUTC 5G4ZA 3T4SA 4E04A 2V1BA 1P0ZA 4I38A 2JKTI 1KOUA 4HJ4A 4CLCB 4DJ2A 5DFYA 3UB9A 2JKTM 4CLCE 5HPFA 5TBMA 4MMNA 4UEYA 5AVFA 3OOVA 1GSXA 3LYXA 3HCYA 2B02A 2QJ7A 2HGVA 2VV6A 3EEAA 4I3AA 3LIBA 4IJGA 3FC7A 3KSFA 2I9VA 4DJ3A 2XA7S 4GCZA 4HH3A 2KDKA 2HJ9C 4MN6A 3PXPA 3KSHA 2EWVA 4YNRA 5I5LA 4ME4A 4BBTA 2P7JA 3EWKA 3IBJA 2K7SA 1OPXA 3K3DA 1LSWA 2XSSA 2OOLA 3TJZC 4UQIM 2BASA 1UWNX 3KYZA 1OJ5A 2Z6CA 1N9LA 2PYRA 3S7QA 3OBFA 2VGLS 1S67L 5A8BA 2M1CA 3K2NA 1TS7A 2J3TC 4NXGA 4MN5A 2VX8A 3ZYTA 3K3CA 1ODVA 5MC7A 1F5MA 4MN7A 3C2WA 3T4JA 1IOUA 4LLOB 4QPRA 4EUVA 4CLCA 4WELA 4EETB 3MQOA 4ARZB 4PHTA 5HD5A 1S1YA 2EWWA 5IU1A 2VJWA 2W3HA 3IS2B 5TJJA 4Y3IA 3IBRA 3C38A 1S66L 3F1OA 2J3WA 1G28A 2XROA 5KSHA 4ETXA 4LRYC 2W3FA 3BY9A 1XJ2A 3NHQA 4FOFA 3BQAA 2V9AA 3E4PA 5AJGA 2V1AA 2PYPA 3LFVA 3BY8A 4GW9A 4H6JA 4L9GA 4MDZA 4NEED 3HJKA 1LL8A 3OLOA 2GX5A 3F1OB 4II7A 3ICYA 1XJ6A 2GZAA 1T18A 1GSVA 4F3LB 2W3GA 1XFNA 2M7VA 2Z6DA 4P6ZS 3OCLA 1D7EA 5CX7A 4L0LA 5G4YA 4WEKA 5TBMB 4IUHA 4BWIA 2QYBA 4R38A 4BJPA 1W63Q 3LR3A 3LR4A 5HDDA 3NJAA 1YKDA 3LI8A 2WKRA 4GS9B 3GECA 4B9OA 4JGRA 5IS1A 4KUOA 1ZTUA 4ETZA 5LBRA 3W2ZA 3PHYA 3S7NA 4B93A 2VV8A 2G7UA 3TRCA 3OC2A 3E4QA 2HJEA 3EQVA 4KQDA 2KOIA 1MC0A 3H7WB 1NRJA 2JKRM 4LRZE 5HD3A 3G6OA 3F1PA 4Y2FA 4JGQA 3PBRA 4GHIB 5HPIA 4HP9A 3HJIA 4WUJA 1UWPX 4HH2A 3LICA 3RH8B 2L4RA 4HHDA 3RFBA 1T19A 1GSWA 3D72A 4L9FA 3B47A 2O99A 3BW6A 2ZMVA 4DMZA 4I39A 3BJNA 5IT5A 4G3KA 2WKPA 4R3AA 2XA7M 1N9OA 3D3OA 1OJGA 3OCNA 4GHIA 1YSQA 4G3WA 4L9EA 2L1MA 3EGDC 3FPVA 4AFIA 5FL3A 2O0YA 2KLIA 3R4KA 1EW0A 5HWTA 2H28A 2QJ5A 2A2LA 2W1TA 3KX0X 5HWVA 4BMWA 3BQ8A 3CI6A 4R6LA 4ZRRA 2PR5A 2HV1A 2A24B 4WF0A 3T50A 4O01A 3UMDA 2KX6A 5DKKA 1DP6A 1S4RA 2O9AA 3T4QA 5F5YA 5DKLA 3F1NB 2VLGA 2QWSA 3LIDA 3T4OA 3CLOA 1V9YA 1LSXA 2ZOHA 5KIZA 5J3WA 2PR6A 1TS8A 4HQAA 5EFWA 2V0WA 1UGUA 3KSIA 4HOIA 5F6AA 3FG8A 1TF1A 2FZ0A 4NXBA 3U2AA 2JN7A 3R7WB 2XRNA 3NOPC 3MR0A 2VGLM 3C8CA 3RTYA 4Y5FA 2YKHA 4GJ4A 4BBUA 3A0SA 4JGOA 4RQ9A 3PBSA 4EESA 3ULFA 1T1BA 2OAP1 4OOMA 5HDSA 4BBVA 4LRXC 1BYWA 2QHKA 4P6ZM 2Y79A 4HI4A 3S7PA 5F68A 4EQ1A 2HF6A 5HWWA 3MMHA 2WKQA 1MKMA 4GLQA 2EA9A 3E98A 3EGXC 4O8GA 1TS0A 1XJ4A 2PHYA 2W0NA 2L0WA 4G3VA 4EEUA 3LR5A 2W3EA 3PBTA 4CLCC 3KO6A 1DP8A 2DMWA 1VB6A 1W63M 4HNBA 1V9ZA 4PKYG 2IA2A 1F98A 1VHMA 3CWFA 3A0VA 2W1TB 5HZHA 4EU0A 1ZHHB 1YSPA 3FPWA 5DJUA 4KUKA 4CQHA 2YKFA 3ZQ5A 3O5YA 3BWLA 4WEJA 3CUEA 2K2NA 4IHQA 5K5BA 3H82B 3KSGA 3B33A 2CMNA 3JVUA 5HSQA 1OTEA 2D02A 2ZMFA 3F1NA 4WLAA 2P04A 3SW1A 2R78A 1T1CA 2INWA 1F9IA 3EOIA 1N9NA 5F69A 3JVVA 2PD8A 3NOUC 2GJ3A 3EQUA 4YOFA 5AVEA 3R7WA 1S1ZA 2GNXA 4EERA 4Q0JA 4O0PA 4I5SA 4H6JB 1XJ3A 3TW8A 3P7NA 1OTAA 3PR6A 2W3DA 5J7EA 2ZOIA 1LT0A 4MCWA 1JNUA 3MF0A 2B18A 2OWJA 1DP9A 4EXOA 2VV7A 4OOLA 1H8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OT6 A;  4HQA A;  1OTI A;  3MXQ A;  4NXF A;  4F3L A;  4JGP A;  5EFW A;  3A0R A;  4HY8 A;  4EEP A;  2V0W A;  1UGU A;  1XFQ A;  1XJ6 A;  3ICY A;  1T18 A;  1GSV A;  4NXE A;  4HOI A;  4EW7 A;  4F3L B;  3FG8 A;  1XFN A;  4LPZ A;  4NXB A;  2Z6D A;  2JN7 A;  3LIE A;  3MFX A;  4GS9 A;  1D7E A;  3LIA A;  3NOT C;  5G4Z A;  3NOP C;  4E04 A;  5G4Y A;  2V1B A;  1P0Z A;  3MR0 A;  4I38 A;  3C8C A;  5TBM B;  4R70 A;  3EEH A;  2QKP A;  3RTY A;  2YKH A;  1KOU A;  4HJ4 A;  4DJ2 A;  2PD7 A;  4R38 A;  4K08 A;  3LUQ A;  3UB9 A;  4BBU A;  3A0S A;  5TBM A;  3E4O A;  4JGO A;  5AVF A;  4RQ9 A;  1GSX A;  5HDD A;  3LYX A;  1WA9 A;  3H9W A;  3NJA A;  4I3J A;  4EES A;  3LI8 A;  2WKR A;  4GS9 B;  3ULF A;  1T1B A;  3GEC A;  4JGR A;  3LI9 A;  4M4X A;  1OTD A;  4KUO A;  5HDS A;  1X0O A;  2B02 A;  4B9O A;  4HIA A;  5IS1 A;  4BBV A;  2QJ7 A;  2VV6 A;  4LRX C;  4EXO A;  1BYW A;  4I3A A;  2QHK A;  3LIB A;  4DJ3 A;  3FC7 A;  4HI4 A;  2I9V A;  3PHY A;  4GCZ A;  4HH3 A;  5F68 A;  3UME A;  2VV8 A;  2KDK A;  4EQ1 A;  2A24 A;  1DRM A;  5J4E A;  3E4Q A;  4KQD A;  5HWW A;  2WKQ A;  4MN6 A;  2EA9 A;  4XT2 A;  5KIZ A;  1TS0 A;  1XJ4 A;  3UE6 A;  1D06 A;  3H7W B;  4PKY A;  2PHY A;  4LRZ E;  5DJT A;  2W0N A;  5HD3 A;  2L0W A;  3G6O A;  3F1P A;  4YWZ A;  4JGQ A;  5I5L A;  4GHI B;  4BBT A;  4EEU A;  2P7J A;  4HP9 A;  3EWK A;  3MJQ A;  2PDR A;  3H7W A;  1DP8 A;  1UWP X;  2K7S A;  3HJI A;  1VB6 A;  4WUJ A;  4HH2 A;  4HNB A;  1V9Z A;  3LIC A;  2L4R A;  4PKY G;  3RH8 B;  3K3D A;  1F98 A;  3CWF A;  4HHD A;  3A0V A;  5HZH A;  1LSW A;  1T19 A;  2OOL A;  1GSW A;  3D72 A;  4L9F A;  4WL9 A;  2W27 A;  5DJU A;  5HDC A;  2BAS A;  1UWN X;  4I39 A;  1OJ5 A;  2Z6C A;  1N9L A;  2PYR A;  2VEA A;  4KUK A;  4HJ3 A;  1T1A A;  1S67 L;  2WKP A;  2M1C A;  4R3A A;  5A8B A;  1N9O A;  2D01 A;  2YKF A;  1TS7 A;  1OJG A;  3ZQ5 A;  1OTB A;  4GHI A;  4NXG A;  4MN5 A;  2V0U A;  3BWL A;  3F1P B;  4HP4 A;  3VOL A;  4L9E A;  1MZU A;  3K3C A;  2L1M A;  3CAX A;  3H82 B;  4I3I A;  3VE4 A;  1ODV A;  3B33 A;  2PR6 A;  4XT2 B;  1S4S A;  2CMN A;  3C2W A;  5HSQ A;  3UB6 A;  1EW0 A;  1OTE A;  5HWT A;  2D02 A;  3F1N A;  2H28 A;  4LLO B;  4WLA A;  2QJ5 A;  3SW1 A;  3KX0 X;  5HWV A;  3UB8 A;  4EET B;  3MQO A;  2R78 A;  1T1C A;  2INW A;  1F9I A;  2J80 A;  5HD5 A;  1S1Y A;  1N9N A;  4R6L A;  1LSV A;  5F69 A;  5IU1 A;  3IS2 B;  2PD8 A;  2PR5 A;  3NOU C;  3UB7 A;  2GJ3 A;  3IBR A;  5AVE A;  1S66 L;  2HV1 A;  2A24 B;  3F1O A;  1NWZ A;  1S1Z A;  3GDI A;  4WF0 A;  4L9G A;  1G28 A;  3T50 A;  3LIF A;  1Y28 A;  4EER A;  3IS2 A;  4I5S A;  2JHE A;  2ZBB A;  4H6J B;  3UMD A;  3VE3 A;  2KX6 A;  1XJ3 A;  4LRY C;  5DKK A;  3P7N A;  1P97 A;  1OTA A;  1DP6 A;  1S4R A;  3BY9 A;  1XJ2 A;  5F5Y A;  3NHQ A;  5DKL A;  5J7E A;  3MQQ A;  2V9A A;  3E4P A;  1OT9 A;  2VLG A;  2ZOI A;  2V1A A;  2PYP A;  2QWS A;  1LT0 A;  3BY8 A;  3F1N B;  3PYP A;  3LID A;  4GW9 A;  1JNU A;  4H6J A;  3HJK A;  1LL8 A;  3CLO A;  4HJ6 A;  4WN5 A;  3OLO A;  2OWH A;  1V9Y A;  1DP9 A;  1LSX A;  1TS6 A;  2OWJ A;  2ZOH A;  3H82 A;  2VV7 A;  5F6A A;  5J3W A;  1TS8 A;  3F1O B; 
#chains in the Genus database with same CATH topology
 1OT6 A;  2ZM2 A;  1LLB A;  1FCN A;  1XFQ A;  3ITB A;  2HDQ A;  2Y4A A;  3S7O A;  4DN0 A;  3FZC A;  4R70 A;  3M6H A;  3UE3 A;  5HL6 A;  5FQ9 A;  2I72 A;  1K38 A;  3E4O A;  3SH7 A;  1PWC A;  2A3U A;  3A3E A;  1F2K A;  2IWC A;  1X0O A;  3IF5 A;  1RGZ A;  2A24 A;  1JVJ A;  3BLS A;  3VV4 A;  4KQQ A;  1YAX A;  5CTM A;  1MWR A;  5DJT A;  4BEN A;  3SZT A;  1YT4 A;  2OAQ 1;  3MJQ A;  3ZVT A;  2PDR A;  2VZW A;  1TD5 A;  3HLW A;  4D60 A;  1HZO A;  1RCJ A;  2W27 A;  1E3U D;  2WYX A;  4GN2 A;  4A5R A;  4HJ3 A;  5CXW A;  2D01 A;  5GHZ A;  2RCX A;  2V0U A;  3RXX A;  4N1X A;  1K6R A;  3IX8 A;  2ZJ9 A;  3Q7V A;  2Y8H A;  4XT2 B;  3TE8 A;  3UB8 A;  4X68 A;  1PW8 A;  2K31 A;  3M6B A;  1YLP A;  2PBD P;  5FEF A;  3IXH A;  4FD8 A;  2PAV P;  3IS2 A;  3DAV A;  4JBF A;  3MS6 A;  1L0G A;  3MBZ A;  3MQQ A;  4I3I A;  3VE4 A;  3PYP A;  2M7U A;  4WN5 A;  4OH0 A;  4HJ6 A;  2FH5 A;  5BOH A;  4NXF A;  2JKG A;  3OPP A;  5EVI A;  1WE4 A;  3LIE A;  2E8J A;  3E2K A;  3O3V A;  1JWV A;  2V1B A;  3CPT B;  2JKT I;  5KZH A;  3UPN A;  1BZA A;  3Q81 A;  5DFY A;  3S22 A;  4CLC E;  5HPF A;  4ID4 A;  1AXB A;  5F82 A;  3VSL A;  3HCY A;  3QNB A;  1IKG A;  2B02 A;  2ZQ7 A;  3EEA A;  3LIB A;  4LV1 A;  1FIK A;  3KSF A;  4UA7 A;  4DJ3 A;  4HH3 A;  1M6K A;  4R3B A;  1CI9 A;  3BRM A;  5EVE A;  1ZKJ A;  1W8Y A;  2EWV A;  4YNR A;  3WS1 A;  1I2S A;  4ZJ1 A;  3IBJ A;  3NCK A;  2Y91 A;  4DDS A;  3A3D A;  1LSW A;  4R1G A;  2OOL A;  1MBL A;  4OLD A;  3BFF A;  1MKI A;  2BAS A;  3KYZ A;  2DRW A;  2VGL S;  1N9B A;  1E3U A;  5TFQ A;  4QD4 A;  3T1X A;  2J3T C;  4MN5 A;  3RJU A;  4DRT A;  3LY3 A;  1MWS A;  1L2S A;  3CHW P;  3LEQ A;  4CLC A;  3MQO A;  4ARZ B;  2XR0 A;  3IBR A;  2JBF A;  4IVK A;  3F1O A;  4FTX A;  3HUM A;  5KSH A;  4ETX A;  4LRY C;  3BY9 A;  3BQA A;  3E4P A;  1FQG A;  4OPR A;  3TSG A;  4Q8I A;  3N8R A;  3OLO A;  2RL3 A;  2GX5 A;  3OZH A;  5CGW A;  1ES3 A;  2GZA A;  1KE3 A;  1T18 A;  3DWK A;  2IWB A;  3OCL A;  4LV3 A;  1D7E A;  2Y59 A;  4L0L A;  2X01 A;  3ZGA B;  3NUL A;  3G4P A;  5KMW A;  4LCL A;  4GZB A;  3UPO A;  5TBM B;  2VK3 A;  4R38 A;  5IHV A;  3JYI A;  3G34 A;  5HDD A;  3HUO A;  1YKD A;  3MZF A;  4B9O A;  1ZTU A;  2P9V B;  1YLZ A;  4RYE A;  4B93 A;  3OC2 A;  3EQV A;  4DF6 A;  4R23 A;  1PWD A;  4MBK A;  3G6O A;  2QMI A;  5FI2 A;  4HP9 A;  3ZG7 B;  5F1G A;  2ZL1 B;  3HJI A;  3LIC A;  3A3F A;  3WS0 A;  1GSW A;  3C7V A;  3L7H A;  3B47 A;  4GD8 A;  4XXR A;  1IYQ A;  2WKP A;  2XA7 M;  3QP5 A;  4L9E A;  3EGD C;  5FL3 A;  5GLA A;  2H28 A;  3Q1F A;  4KZ7 A;  5FQM A;  5HWV A;  3ZG0 A;  4BMW A;  1HVB A;  4R6L A;  4DXB A;  5EVL A;  3T50 A;  2OLU A;  4GB7 A;  2WGI A;  5FAQ A;  2QPN A;  1YPR A;  2WGW B;  4KZ3 A;  5TR7 A;  3V3S A;  1MXO A;  2QWS A;  3BFE A;  3MZE A;  3T4O A;  3CLO A;  3M2K A;  4KEN B;  4OPQ A;  5A93 A;  1Z6F A;  3UE1 A;  4EWF A;  1CEG A;  4HOI A;  5DVA A;  3LCE A;  4NXB A;  3U2A A;  4EV4 A;  4WM9 A;  4Y13 A;  2JKF A;  3MR0 A;  3BFD A;  1ACF A;  4M3K A;  4JGO A;  4Y0U A;  2OAP 1;  3QHY A;  2Y55 A;  1XGI A;  4PM8 A;  4WZ5 A;  1K4E A;  5HWW A;  4K0X A;  1TS0 A;  1Q2P A;  5CGS A;  1EI5 A;  3VFF A;  2L0W A;  1FSY A;  3OPH A;  2ZQ8 A;  4CLC C;  2DMW A;  5L09 A;  4PKY G;  1V9Z A;  2IA2 A;  4OQI A;  2ZC5 B;  1YSP A;  5DJU A;  2UV0 E;  4BD0 A;  2EX2 A;  3BFC A;  1NZO A;  3UY6 A;  4RX3 A;  4WEJ A;  4N1H A;  5K5B A;  3H82 B;  3JVU A;  2D02 A;  3NI9 A;  1T1C A;  3EOI A;  1SDN A;  3NOU C;  3EQU A;  4YOF A;  5AVE A;  3R7W A;  1S1Z A;  2G2U A;  1IEM A;  4I5S A;  1OTA A;  3PR6 A;  4MCW A;  4JPM A;  5F6A A;  4OOL A;  3DTM A;  4K0W A;  1ES2 A;  1K57 C;  1OTI A;  3A0R A;  4HY8 A;  4EEP A;  4NXE A;  2XEP A;  1KDS A;  2Y2M A;  4LPZ A;  2ZC4 B;  1PW1 A;  3MFX A;  4UQI S;  5L8M A;  4S2L A;  4B4Z A;  1M40 A;  3EEH A;  4U0T A;  3WS4 A;  3HLD A;  3VMA A;  3LUQ A;  5DF9 A;  4X25 A;  1IYO A;  5CEB A;  4M4X A;  1OTD A;  4MNR A;  1K55 C;  3UME A;  3C30 A;  1DRM A;  3SH8 A;  1NXY A;  2H5S A;  4XT2 A;  3O86 A;  3UE6 A;  3V39 A;  4FH2 A;  4ARZ A;  3DTE A;  2WGW A;  1IYP A;  2P08 A;  1YQS A;  3H7W A;  5EM1 A;  5C5K A;  2HP9 A;  3CUE C;  3B42 A;  4UA6 A;  4DE1 A;  2Y2K A;  4Q0I A;  2HZ5 A;  4Q0H A;  4IED A;  5HDC A;  3HBR A;  3VFH A;  1P9W A;  1T1A A;  5EUA A;  2PRF A;  5GHX A;  5GLC A;  3KYQ A;  2B5R A;  4HP4 A;  3VOL A;  3OPR A;  4WZ4 A;  3WS5 A;  1LL5 A;  1PWG A;  4PAU A;  1BTL A;  2EXB A;  1PI4 A;  1N4O A;  1LSV A;  4NG2 A;  4KZ8 A;  4E6X A;  1Y28 A;  1L0E A;  4X1L A;  1KGF A;  3ZHH A;  3H9W A;  2OWH A;  4F3L A;  3VOY A;  2NUP C;  1GCE A;  1QMF A;  3V67 A;  4GS9 A;  1NLY A;  5FAP A;  3T4S A;  5EOE A;  2HDS A;  1TDG A;  4BD1 A;  1CQA A;  3ZCZ A;  4DJ2 A;  1ERM A;  4DXC A;  5TBM A;  1XKZ A;  2XH9 A;  1FSW A;  3LYX A;  5HX9 A;  2WZZ A;  2QJ7 A;  3A3J A;  5EOO A;  1LL9 A;  3FC7 A;  4GCZ A;  2Y2J A;  3IXD A;  5CTN A;  3RXW A;  1Q2Q A;  5EV0 A;  3KSH A;  4Y17 A;  5EPH A;  3U4L P;  2IWD A;  1NRF A;  2P7J A;  1VET A;  1OPX A;  5HL1 A;  1VM1 A;  3G2Z A;  2XSS A;  3PAE A;  3OPL A;  1UWN X;  2PYR A;  4E3L A;  4EBN A;  3OBF A;  1MWU A;  5EE8 A;  1BLP A;  2VX8 A;  3Q07 A;  4O7D A;  3UDX A;  4MN7 A;  3T4J A;  3HUN A;  3TOI A;  1CK3 A;  4EUV A;  4EET B;  3E2L A;  4PHT A;  5HD5 A;  5GLD A;  2EWW A;  5IU1 A;  2VJW A;  3IS2 B;  5TJJ A;  4Y3I A;  4KZ9 A;  3UDF A;  1ESU A;  5F83 A;  5I94 A;  3KYE A;  4N9L A;  2V9A A;  2XDM A;  4NEE D;  3LFV A;  4GW9 A;  4L9G A;  4H6J A;  4D2O A;  1LL8 A;  4E3N A;  2X02 A;  3F1O B;  3Q7Z A;  4II7 A;  4E3O A;  2WK0 A;  1GSV A;  4QWO A;  2ACG A;  4JLF A;  4S2K A;  1K56 D;  2XD5 A;  2ZM8 A;  4EQI A;  1FIL A;  4HES A;  2Y2G A;  4BJP A;  3SS5 A;  3VP3 A;  3LR3 A;  3LR4 A;  4KZ6 A;  4X69 A;  2XLN A;  4GS9 B;  3GEC A;  4JGR A;  5CED A;  5IS1 A;  4KUO A;  4Y7P A;  1RP5 A;  4EUZ A;  5KSC A;  4ETZ A;  4XUZ A;  5LBR A;  3W2Z A;  1G6A A;  5HAQ A;  3TRC A;  4BL3 A;  1WYB A;  5EVI D;  3O87 A;  4LRZ E;  3F1P A;  4Y2F A;  4MBF A;  4DE3 A;  3G30 A;  5M19 A;  2JC7 A;  4K91 A;  1SCW A;  3RH8 B;  4HHD A;  3QP8 A;  4WMC A;  2ZMV A;  2XK1 A;  3BJN A;  2V1Z A;  1ZG6 A;  3D3O A;  1OJG A;  2V20 A;  3OCN A;  1YSQ A;  2VGJ A;  1IYS A;  3FPV A;  4AFI A;  2KLI A;  1K55 A;  5HWT A;  3KX0 X;  5FQJ A;  1H8Y A;  3BQ8 A;  1ES5 A;  4ZRR A;  3BFG A;  4OPY A;  1NY0 A;  4O01 A;  2XQZ A;  2ZLY A;  4PPR A;  4EBL A;  2O9A A;  5F5Y A;  1BT5 A;  5FQQ A;  3F1N B;  4NET A;  5E2H A;  1V9Y A;  1LSX A;  2ZOH A;  2PR6 A;  2G2W A;  1ZC2 A;  3V5M A;  3GR2 A;  2B95 A;  1KGG A;  2JN7 A;  3MFD A;  3CG5 A;  3I7J A;  3C8C A;  3RTY A;  1FCO A;  4GJ4 A;  4BQM A;  3GSG A;  1PYY A;  1K4F A;  3DTK A;  1XA7 A;  3GTC A;  5FAS A;  4RQ9 A;  3PBS A;  4KZA A;  4BBV A;  4LRX C;  4KG2 A;  2QHK A;  2Y79 A;  4OVD A;  3S7P A;  4ZAM A;  1K54 A;  4XUX A;  5FI7 A;  1I2W A;  4GLQ A;  3E98 A;  3EGX C;  1KDW A;  4DE0 A;  4EEU A;  1K6S A;  1MWT A;  1VB6 A;  1W63 M;  4HNB A;  4R4R A;  1F98 A;  5AQB A;  1O07 A;  5HZH A;  4EU0 A;  3L9K A;  1Y54 A;  2H0T A;  2J8Y A;  4QJG A;  5HFO A;  4CQH A;  2YKF A;  3ZQ5 A;  1JWP A;  2WAF A;  3O5Y A;  4IHQ A;  1KE0 A;  1XGJ A;  4KQR A;  2CMN A;  1NYY A;  3BLM A;  1OTE A;  3SW1 A;  4GDB A;  3VP0 A;  2R78 A;  1N9N A;  3JVV A;  4QB8 A;  2PD8 A;  4QY6 A;  1XP4 A;  2CC1 A;  1PZP A;  3HLF A;  4H6J B;  4PM5 A;  3P7N A;  4S2M A;  2XD1 A;  3CPT A;  1FR1 A;  1RGY A;  1DP9 A;  1H8M A;  5CHM A;  1IKI A;  5HAP A;  3MXQ A;  2WGV A;  4JGP A;  5F1F A;  1J3W A;  4DDY A;  3UNW A;  4YIN A;  4OQG A;  3LIA A;  5A92 A;  2J9O A;  2XFS A;  2Q9M A;  2VA0 A;  5DFX A;  2C6W B;  1TDL A;  5AQA A;  4K08 A;  1QME A;  3T4L A;  1H0M A;  1WA9 A;  3TG9 A;  4HIA A;  1S6R A;  4IVI A;  5DTS A;  4RX2 A;  5J4E A;  3G31 A;  2HP6 A;  1D06 A;  4PKY A;  3FKW A;  2E8I A;  3VSK A;  3PBO A;  3VP1 A;  1I5Q A;  3CIT A;  4R3J A;  1P9R A;  4WL9 A;  3LGO A;  4X6T A;  1ONG A;  4LFU A;  2PT7 A;  3AGD A;  3LR0 A;  3F1P B;  4FSF A;  1NLZ A;  1C3B A;  4F94 A;  2J3T D;  4S2P A;  1J9M A;  4B4X A;  3PBQ A;  1YLW A;  1YLY A;  4JF5 A;  4CLC D;  4UHU A;  4Z1W A;  2XF3 A;  4PM6 A;  1ES4 A;  3ZNY A;  2JHE A;  2ZBB A;  1STZ A;  3VE3 A;  1OT9 A;  3DBA A;  4R0Q A;  2VKS A;  3WWX A;  5L2F A;  4OP5 A;  1TS6 A;  3H82 A;  2MJ6 A;  3UB6 A;  1IFQ A;  1GA9 A;  4UAA A;  5EVI B;  2Y2Q A;  1PI5 A;  3MQ0 A;  3BEB A;  4EW7 A;  1HD8 A;  2ZC7 A;  4E04 A;  3IXG A;  1NYM A;  1P0Z A;  5CEC A;  4JXG A;  3C4O A;  4HJ4 A;  3QP1 A;  4JXS A;  2JKT M;  3SOI A;  1SKF A;  1ONH A;  4MMN A;  2ZQA A;  1GSX A;  3UPP A;  1SDE A;  2VV6 A;  4I3A A;  4IJG A;  4QY5 A;  2XA7 S;  5HAI A;  4MN6 A;  3PXP A;  3P98 A;  3N4I A;  3MZD A;  4C6Y A;  4LCM A;  4ME4 A;  1TVF A;  4BBT A;  4Z9Q A;  2K7S A;  2A49 A;  1AWI A;  3BM6 A;  3K3D A;  1ESI A;  2FFY A;  3NC8 A;  2XFT A;  3S7Q A;  1N9L A;  3BEC A;  5TGF A;  5A8B A;  1IEL A;  3K2N A;  4NXG A;  4ZJ3 A;  4OON A;  3ZVW A;  3ZYT A;  3K3C A;  4JF6 A;  1Z09 A;  1ODV A;  5MC7 A;  4QPR A;  4WEL A;  1S1Y A;  2ZL1 A;  5CER A;  2W3H A;  5CHU A;  2Y2P A;  5FAO A;  3C38 A;  1S66 L;  1U60 A;  1L0D A;  2Y2H A;  4C3Q A;  2PU4 A;  2ZM0 A;  3IWO A;  4UA9 A;  4Y15 A;  4FOF A;  4CJN A;  5DF7 A;  5AJG A;  2V1A A;  3BY8 A;  1OME A;  3HLE A;  5DTK A;  4P0M A;  3GVB A;  2VGK A;  1E25 A;  4P85 A;  1W8Q A;  3T1S A;  4F3L B;  1XFN A;  5FQI A;  2M7V A;  4PMA A;  4E3K A;  5G4Y A;  5CRF A;  4WEK A;  3SH9 A;  2QYB A;  5G18 A;  2R9X A;  2H10 A;  3NJA A;  3LI8 A;  2WKR A;  2BLS A;  4KZ5 A;  2EXA A;  2V8F A;  3PHY A;  3S7N A;  2OSU A;  3HVF A;  2HJE A;  4KQD A;  2ZC3 B;  4NK3 A;  1NRJ A;  2JKR M;  5HD3 A;  5A90 A;  1BSG A;  4LV2 A;  4WUJ A;  1UWP X;  2L4R A;  1LHY A;  1Y4O A;  3RFB A;  1A0K A;  1T19 A;  3D72 A;  4L9F A;  3BW6 A;  4I39 A;  1N9O A;  4HBT A;  3HL9 A;  4GHI A;  1ZG4 A;  3MXR A;  5FI6 A;  3LEZ A;  3G32 A;  2O0Y A;  1EW0 A;  2WAD A;  5EVI C;  4IBX A;  4Y0O A;  2QJ5 A;  3MXS A;  2A2L A;  2W1T A;  4DE2 A;  2WKH A;  3LO7 A;  3UMD A;  4OOY A;  5DKK A;  5E2G A;  2KX6 A;  3PTE A;  3IF6 B;  1S4R A;  5DKL A;  2EFX A;  3JPU A;  3LID A;  4FCF A;  1BLC A;  1K54 C;  1TS8 A;  2C5W B;  5FQK A;  3IHA A;  4HQA A;  4S2N C;  3DWZ A;  4RVA A;  5EFW A;  2V0W A;  3QNC A;  5A91 A;  3FG8 A;  4OQH A;  3VP4 A;  3R7W B;  2WAE A;  3NOP C;  1FR6 A;  4PM9 A;  2VGL M;  4QHC A;  4Y5F A;  3G35 A;  2DCF A;  4S2O A;  3A0S A;  1E4D A;  3G2Y A;  3UN7 A;  1JTG A;  5HDS A;  1BYW A;  4P6Z M;  1JTD A;  3AGE A;  2P74 A;  1PFL A;  4EQ1 A;  3T12 B;  2HF6 A;  2WKE A;  3GV9 A;  2WKQ A;  1MKM A;  3MMH A;  4O8G A;  4P87 A;  3HLB A;  2PHY A;  1G5U A;  2W0N A;  2HDR A;  2PU2 A;  3QP2 A;  3LR5 A;  2W3E A;  3PBT A;  3V50 A;  3KO6 A;  1LI9 A;  1DP8 A;  3QP4 A;  4GDN A;  4ZDX A;  3CWF A;  3A0V A;  2W1T B;  5JYP A;  1ZHH B;  5GLB A;  4KG6 A;  1GHI A;  4ZTK A;  2ZQ9 A;  2Y2I A;  2OLV A;  4X1M A;  3KSG A;  3B33 A;  1BLH A;  4WZ5 C;  1ERQ A;  2WKI A;  4H8R A;  4GOG A;  5HSQ A;  2EX8 A;  2ZMF A;  3IWQ A;  4OPZ A;  3UO9 A;  5J8X A;  1F9I A;  3Q7V B;  3ZG9 B;  1KVL A;  3GMW A;  2GNX A;  3IF6 C;  3ITA A;  4OLG A;  4EER A;  5E2E A;  4WBG A;  3ZG8 B;  3N8L A;  3SS4 A;  2J7V A;  5FDH A;  4MLL A;  1KGE A;  5J7E A;  1H8Z A;  3C7U A;  1ERO A;  1JNU A;  2HP5 A;  4S2J A;  3VP2 A;  4EXO A;  1EWZ A;  3ZDJ A;  1XX2 A;  5D3O A;  5M1A A;  3WRT A;  4E3J A;  3P01 A;  3GQZ A;  4X55 A;  3NDE A;  1SKO B;  3NOT C;  3S4X A;  2EX6 A;  5FDS A;  2QKP A;  3HLC A;  4LEN A;  3HRE A;  2PD7 A;  4KQO A;  3MKF A;  2W1R A;  1NZU A;  3C4P A;  1MPL A;  4I3J A;  3QP6 A;  1H3Q A;  3LI9 A;  2JKR I;  3T1Q B;  5HAR A;  3V3R A;  1MY8 A;  2O9B A;  5U47 A;  4KZ4 A;  1YLJ A;  4JF4 A;  4IBR A;  4YWZ A;  4IUK A;  3PBN A;  3N8S A;  4MBH A;  4RA7 A;  3T4T A;  4ZJ2 A;  4FH4 A;  4S2I A;  2XGN A;  2O9C A;  2VEA A;  2ZMA A;  1OTB A;  4JXV A;  5E43 A;  1MZU A;  3CAX A;  3M2J A;  1S4S A;  3IH8 A;  1KE4 A;  5L10 A;  3W4Q A;  1D1J A;  4GD6 A;  4S2N A;  2J80 A;  3N7W A;  1CJF A;  2LB5 A;  2LB9 A;  3UB7 A;  5M18 A;  1K56 A;  1NWZ A;  3GDI A;  1CEF A;  3LIF A;  4R4S A;  3UE0 A;  1P97 A;  3Q82 A;  4C75 A;  4X53 A;  3C5A A;  5DF8 A;  3BYD A;  3LY4 A;  4GKU A;  2JE5 A;  2Q0O A;  2UWX A;  4NKP A;  3T4K A;  4E3M A;  3ZNT A;  2HPB A;  3UB5 P;  3T1R A;  1W7F A;  3E0Y A;  1G6O A;  2NUT C;  5G4Z A;  3WS2 A;  3P09 A;  4MEZ A;  4I38 A;  4PM7 A;  1VET B;  1KOU A;  4CLC B;  4Y0T A;  2EFU A;  3UB9 A;  5L07 A;  4UEY A;  5AVF A;  3OOV A;  4LV0 A;  2HGV A;  2I9V A;  2WUQ A;  3W4P A;  2KDK A;  3UDI A;  2HJ9 C;  3IH9 A;  1JWZ A;  5DTT A;  2V2F F;  5I5L A;  3IX4 A;  4DKI A;  3EWK A;  1G68 A;  3S1Y A;  1NJ4 A;  5HW3 A;  5GL9 A;  3TJZ C;  4UQI M;  2Q9N A;  1OJ5 A;  2Z6C A;  1S67 L;  2M1C A;  5FAT A;  1TS7 A;  2JCH A;  3NEC A;  4LGW A;  1F5M A;  3IHB A;  3C2W A;  1XPB A;  2Y2L A;  3PAG A;  2R9W A;  2ZC6 B;  5AQ7 A;  3CZD A;  4LLO B;  1IOU A;  3IWI A;  1VQQ A;  5JYO A;  2GDN A;  2BG1 A;  3ISG A;  1DY6 A;  1FOF A;  2FFF B;  1L3L A;  1S0W A;  3ZFZ A;  2J3W A;  1G28 A;  2XRO A;  3N6I A;  2W3F A;  4P6B A;  1VEU A;  1XJ2 A;  3NHQ A;  2ZD8 A;  2PYP A;  4MDZ A;  1K57 A;  3HJK A;  3HLG A;  5CHJ A;  1GHP A;  2HDU A;  3ICY A;  1XJ6 A;  2ZQC A;  3IQA A;  1XXM A;  2W3G A;  2Z6D A;  4P6Z S;  5CX7 A;  2P9V A;  4IUH A;  4BWI A;  1YLT A;  1W63 Q;  3NY4 A;  4OKP A;  3A3I A;  1PZO A;  5FSR A;  4N9K A;  5FEG A;  4HEF A;  2VV8 A;  2G7U A;  3E4Q A;  2KOI A;  1MC0 A;  3H7W B;  3DTI A;  2ZQD A;  3B3X A;  4BLM A;  1ALQ A;  3PBR A;  4JGQ A;  4GHI B;  3W4O A;  2OV5 A;  3VOZ A;  5HPI A;  4WYY A;  4HH2 A;  3W8K A;  1HLU P;  1O7E A;  1K25 A;  5FA7 A;  5GHY A;  4JKT A;  4DMZ A;  2O99 A;  4ESP A;  5EEC A;  5IT5 A;  4G3K A;  4R3A A;  3D9Y A;  4G3W A;  2L1M A;  2Z2L B;  4KZB A;  1L0F A;  1FCM A;  3SS3 A;  3R4K A;  1PIO A;  2DNS A;  1DJB A;  1XA1 A;  3CI6 A;  2PR5 A;  1YMS A;  2Y2N A;  2HV1 A;  2A24 B;  4WF0 A;  1W79 A;  3IX3 A;  4U0X A;  2V8C A;  1KVM A;  3NDG A;  1LI0 A;  3NIA A;  2Z2M B;  1DP6 A;  3T4Q A;  2VLG A;  1DJC A;  1HTZ A;  5KIZ A;  5J3W A;  3ZG5 A;  1PNE A;  2PBY A;  4X56 A;  1UGU A;  3KSI A;  2WZX A;  1SKO A;  4B88 A;  1TF1 A;  1SZV A;  1W5D A;  2FZ0 A;  4WMC D;  4U3T A;  2XRN A;  1H5X A;  3IT9 A;  3MSH A;  3GRJ A;  2YKH A;  1GA0 A;  1PRQ A;  3IF6 A;  4BBU A;  1SHV A;  4QU3 A;  4EES A;  1BUL A;  2J9P A;  3DW0 A;  3ULF A;  1T1B A;  1K0K A;  4OOM A;  4KG5 A;  1DJA A;  3CJM A;  3NBL A;  4HI4 A;  5F68 A;  1YMX A;  2AVX A;  2EA9 A;  1XJ4 A;  4FUW A;  3FKV A;  4G3V A;  4JXW A;  3AGF A;  1CF0 A;  3FYZ A;  3IXB A;  2EX9 A;  1CI8 A;  1VHM A;  4E6W A;  3MKE A;  4OQ0 A;  5EM0 A;  3FPW A;  1YM1 A;  4EBP A;  5E2F A;  4GNU A;  4HBU A;  4KUK A;  4CPK A;  3BWL A;  3CUE A;  2K2N A;  1TEM A;  4BL2 A;  4E3I A;  1BLS A;  3F1N A;  4WLA A;  2P04 A;  3FWL A;  5AQ9 A;  2QZ6 A;  2X71 A;  2INW A;  2BTF P;  3D4F A;  5F69 A;  1GHM A;  3O88 A;  2GJ3 A;  1VEU B;  4N92 A;  4Q0J A;  4O0P A;  4OP8 A;  1XJ3 A;  1WYC A;  3TW8 A;  2W3D A;  2ZOI A;  1LT0 A;  4ZBE A;  1BUE A;  3MF0 A;  2B18 A;  3CMZ A;  3WRZ A;  2OWJ A;  3FV7 A;  2Y2O A;  5CGX A;  2H0Y A;  2VV7 A;  4YFM A; 
#chains in the Genus database with same CATH homology
 1OT6 A;  1OTI A;  3MXQ A;  4JGP A;  3A0R A;  4HY8 A;  4EEP A;  1XFQ A;  3P01 A;  4NXE A;  4LPZ A;  3MFX A;  3S7O A;  4UQI S;  5L8M A;  3LIA A;  3NOT C;  4DN0 A;  2VA0 A;  5DFX A;  4R70 A;  3EEH A;  2QKP A;  3UE3 A;  2PD7 A;  4KQO A;  4K08 A;  3LUQ A;  5HL6 A;  5DF9 A;  3E4O A;  2W1R A;  3T4L A;  1WA9 A;  4I3J A;  1H3Q A;  4M4X A;  3LI9 A;  1OTD A;  1X0O A;  2JKR I;  4HIA A;  3UME A;  2A24 A;  3C30 A;  1DRM A;  5J4E A;  2O9B A;  3VV4 A;  1YAX A;  4XT2 A;  3UE6 A;  1D06 A;  4PKY A;  5DJT A;  4ARZ A;  4YWZ A;  4IUK A;  3PBN A;  2OAQ 1;  3PBO A;  2P08 A;  3MJQ A;  2PDR A;  3H7W A;  5C5K A;  2VZW A;  3T4T A;  3CUE C;  3B42 A;  3CIT A;  4Q0I A;  1TD5 A;  4Q0H A;  1P9R A;  4WL9 A;  2W27 A;  2O9C A;  5HDC A;  2VEA A;  1P9W A;  4HJ3 A;  1T1A A;  2D01 A;  1OTB A;  3KYQ A;  2PT7 A;  2V0U A;  3LR0 A;  3F1P B;  4HP4 A;  3VOL A;  1MZU A;  3CAX A;  4FSF A;  1NLZ A;  2J3T D;  4XT2 B;  1S4S A;  2Y8H A;  4PAU A;  3TE8 A;  3UB8 A;  2J80 A;  3PBQ A;  1LSV A;  2LB5 A;  4CLC D;  2LB9 A;  3UB7 A;  4Z1W A;  2K31 A;  1NWZ A;  3GDI A;  3LIF A;  1Y28 A;  3IS2 A;  2JHE A;  2ZBB A;  1STZ A;  3VE3 A;  1P97 A;  3MQQ A;  3H9W A;  1OT9 A;  3DBA A;  4I3I A;  3VE4 A;  3PYP A;  2VKS A;  2M7U A;  4WN5 A;  2OWH A;  1TS6 A;  3H82 A;  4HJ6 A;  2MJ6 A;  3UB6 A;  1IFQ A;  4NKP A;  2FH5 A;  3T4K A;  4NXF A;  4F3L A;  3MQ0 A;  2NUP C;  4EW7 A;  3V67 A;  3LIE A;  3E0Y A;  4GS9 A;  1G6O A;  1NLY A;  2NUT C;  5G4Z A;  3T4S A;  4E04 A;  2V1B A;  1P0Z A;  4I38 A;  2JKT I;  1KOU A;  4HJ4 A;  4CLC B;  4DJ2 A;  5DFY A;  3UB9 A;  2JKT M;  4CLC E;  5HPF A;  5TBM A;  4MMN A;  4UEY A;  5AVF A;  3OOV A;  1GSX A;  3LYX A;  3HCY A;  2B02 A;  2QJ7 A;  2HGV A;  2VV6 A;  3EEA A;  4I3A A;  3LIB A;  4IJG A;  3FC7 A;  3KSF A;  2I9V A;  4DJ3 A;  2XA7 S;  4GCZ A;  4HH3 A;  2KDK A;  2HJ9 C;  4MN6 A;  3PXP A;  3KSH A;  2EWV A;  4YNR A;  5I5L A;  4ME4 A;  4BBT A;  2P7J A;  3EWK A;  3IBJ A;  2K7S A;  1OPX A;  3K3D A;  1LSW A;  2XSS A;  2OOL A;  3TJZ C;  4UQI M;  2BAS A;  1UWN X;  3KYZ A;  1OJ5 A;  2Z6C A;  1N9L A;  2PYR A;  3S7Q A;  3OBF A;  2VGL S;  1S67 L;  5A8B A;  2M1C A;  3K2N A;  1TS7 A;  2J3T C;  4NXG A;  4MN5 A;  2VX8 A;  3ZYT A;  3K3C A;  1ODV A;  5MC7 A;  1F5M A;  4MN7 A;  3C2W A;  3T4J A;  1IOU A;  4LLO B;  4QPR A;  4EUV A;  4CLC A;  4WEL A;  4EET B;  3MQO A;  4ARZ B;  4PHT A;  5HD5 A;  1S1Y A;  2EWW A;  5IU1 A;  2VJW A;  2W3H A;  3IS2 B;  5TJJ A;  4Y3I A;  3IBR A;  3C38 A;  1S66 L;  3F1O A;  2J3W A;  1G28 A;  2XRO A;  5KSH A;  4ETX A;  4LRY C;  2W3F A;  3BY9 A;  1XJ2 A;  3NHQ A;  4FOF A;  3BQA A;  2V9A A;  3E4P A;  5AJG A;  2V1A A;  2PYP A;  3LFV A;  3BY8 A;  4GW9 A;  4H6J A;  4L9G A;  4MDZ A;  4NEE D;  3HJK A;  1LL8 A;  3OLO A;  2GX5 A;  3F1O B;  4II7 A;  3ICY A;  1XJ6 A;  2GZA A;  1T18 A;  1GSV A;  4F3L B;  2W3G A;  1XFN A;  2M7V A;  2Z6D A;  4P6Z S;  3OCL A;  1D7E A;  5CX7 A;  4L0L A;  5G4Y A;  4WEK A;  5TBM B;  4IUH A;  4BWI A;  2QYB A;  4R38 A;  4BJP A;  1W63 Q;  3LR3 A;  3LR4 A;  5HDD A;  3NJA A;  1YKD A;  3LI8 A;  2WKR A;  4GS9 B;  3GEC A;  4B9O A;  4JGR A;  5IS1 A;  4KUO A;  1ZTU A;  4ETZ A;  5LBR A;  3W2Z A;  3PHY A;  3S7N A;  4B93 A;  2VV8 A;  2G7U A;  3TRC A;  3OC2 A;  3E4Q A;  2HJE A;  3EQV A;  4KQD A;  2KOI A;  1MC0 A;  3H7W B;  1NRJ A;  2JKR M;  4LRZ E;  5HD3 A;  3G6O A;  3F1P A;  4Y2F A;  4JGQ A;  3PBR A;  4GHI B;  5HPI A;  4HP9 A;  3HJI A;  4WUJ A;  1UWP X;  4HH2 A;  3LIC A;  3RH8 B;  2L4R A;  4HHD A;  3RFB A;  1T19 A;  1GSW A;  3D72 A;  4L9F A;  3B47 A;  2O99 A;  3BW6 A;  2ZMV A;  4DMZ A;  4I39 A;  3BJN A;  5IT5 A;  4G3K A;  2WKP A;  4R3A A;  2XA7 M;  1N9O A;  3D3O A;  1OJG A;  3OCN A;  4GHI A;  1YSQ A;  4G3W A;  4L9E A;  2L1M A;  3EGD C;  3FPV A;  4AFI A;  5FL3 A;  2O0Y A;  2KLI A;  3R4K A;  1EW0 A;  5HWT A;  2H28 A;  2QJ5 A;  2A2L A;  2W1T A;  3KX0 X;  5HWV A;  4BMW A;  3BQ8 A;  3CI6 A;  4R6L A;  4ZRR A;  2PR5 A;  2HV1 A;  2A24 B;  4WF0 A;  3T50 A;  4O01 A;  3UMD A;  2KX6 A;  5DKK A;  1DP6 A;  1S4R A;  2O9A A;  3T4Q A;  5F5Y A;  5DKL A;  3F1N B;  2VLG A;  2QWS A;  3LID A;  3T4O A;  3CLO A;  1V9Y A;  1LSX A;  2ZOH A;  5KIZ A;  5J3W A;  2PR6 A;  1TS8 A;  4HQA A;  5EFW A;  2V0W A;  1UGU A;  3KSI A;  4HOI A;  5F6A A;  3FG8 A;  1TF1 A;  2FZ0 A;  4NXB A;  3U2A A;  2JN7 A;  3R7W B;  2XRN A;  3NOP C;  3MR0 A;  2VGL M;  3C8C A;  3RTY A;  4Y5F A;  2YKH A;  4GJ4 A;  4BBU A;  3A0S A;  4JGO A;  4RQ9 A;  3PBS A;  4EES A;  3ULF A;  1T1B A;  2OAP 1;  4OOM A;  5HDS A;  4BBV A;  4LRX C;  1BYW A;  2QHK A;  4P6Z M;  2Y79 A;  4HI4 A;  3S7P A;  5F68 A;  4EQ1 A;  2HF6 A;  5HWW A;  3MMH A;  2WKQ A;  1MKM A;  4GLQ A;  2EA9 A;  3E98 A;  3EGX C;  4O8G A;  1TS0 A;  1XJ4 A;  2PHY A;  2W0N A;  2L0W A;  4G3V A;  4EEU A;  3LR5 A;  2W3E A;  3PBT A;  4CLC C;  3KO6 A;  1DP8 A;  2DMW A;  1VB6 A;  1W63 M;  4HNB A;  1V9Z A;  4PKY G;  2IA2 A;  1F98 A;  1VHM A;  3CWF A;  3A0V A;  2W1T B;  5HZH A;  4EU0 A;  1ZHH B;  1YSP A;  3FPW A;  5DJU A;  4KUK A;  4CQH A;  2YKF A;  3ZQ5 A;  3O5Y A;  3BWL A;  4WEJ A;  3CUE A;  2K2N A;  4IHQ A;  5K5B A;  3H82 B;  3KSG A;  3B33 A;  2CMN A;  3JVU A;  5HSQ A;  1OTE A;  2D02 A;  2ZMF A;  3F1N A;  4WLA A;  2P04 A;  3SW1 A;  2R78 A;  1T1C A;  2INW A;  1F9I A;  3EOI A;  1N9N A;  5F69 A;  3JVV A;  2PD8 A;  3NOU C;  2GJ3 A;  3EQU A;  4YOF A;  5AVE A;  3R7W A;  1S1Z A;  2GNX A;  4EER A;  4Q0J A;  4O0P A;  4I5S A;  4H6J B;  1XJ3 A;  3TW8 A;  3P7N A;  1OTA A;  3PR6 A;  2W3D A;  5J7E A;  2ZOI A;  1LT0 A;  4MCW A;  1JNU A;  3MF0 A;  2B18 A;  2OWJ A;  1DP9 A;  4EXO A;  2VV7 A;  4OOL A;  1H8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...