4HP4A

Crystal structure of pas domain from the fruit-fly elk potassium channel
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
123
structure length
112
Chain Sequence
NTFLDTIATRFDGTHSNFVLGNAQANGNPIVYCSDGFVDLTGYSRAQIMQGCSCHFLYGPDTEEHQQIESLSNMELLEVIFYEGAPFWCLFDIVPINERDVVLFLASHDITH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eag-like K[+] channel
publication title Structural properties of PAS domains from the KCNH potassium channels
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein
total genus 26
structure length 112
sequence length 123
chains with identical sequence B
ec nomenclature ec 2.7.3.-:
pdb deposition date 2012-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hp4A00
2JHEA 1OT9A 2K7SA 4GHIB 1Y28A 4BBUA 5HWWA 4I3JA 1X0OA 2Z6CA 3MR0A 3OLOA 5HDDA 2QWSA 5HDCA 5HWTA 4MN6A 1LL8A 2WKQA 2OOLA 2QJ7A 3C2WA 4HIAA 1T18A 2VV7A 3F1NA 3MQOA 1TS6A 3FC7A 5DJTA 2CMNA 2A24A 3LYXA 5TBMA 2V0UA 2VV8A 4HHDA 4HJ6A 3RTYA 5EFWA 2VV6A 1S1ZA 3EWKA 2VEAA 4HNBA 2V1BA 2D01A 2QJ5A 4GS9A 4HQAA 2PD7A 4WF0A 1UGUA 1S66L 1S1YA 3UB8A 3NJAA 5DKKA 3H9WA 4R38A 1WA9A 1D7EA 3UE6A 1N9OA 2V0WA 1LT0A 3NOUC 4GW9A 5HWVA 1GSVA 2L0WA 2OWHA 5F69A 2J80A 4PKYA 3GDIA 4KUKA 5J4EA 4L9EA 1GSWA 2PYPA 2B02A 1OTEA 3SW1A 2R78A 3F1PA 3IS2B 2YKFA 1DP8A 4MN5A 4XT2A 3LIBA 2PYRA 4WN5A 3ICYA 4DJ3A 2PHYA 1XFQA 4R6LA 1N9NA 3LIDA 4HH2A 4EQ1A 1ODVA 3LI8A 5TBMB 5AVFA 3E4QA 3CWFA 2WKRA 3B33A 1XJ3A 5A8BA 2ZBBA 2EA9A 3LUQA 2L1MA 1NWZA 2GJ3A 1XJ6A 3H82A 4HI4A 3F1OA 5KIZA 1D06A 4KQDA 4LRYC 3MXQA 1TS8A 5IS1A 4HH3A 1XFNA 3NHQA 4H6JA 3NOPC 4NXBA 4EERA 5HDSA 3FG8A 4F3LA 1T1AA 2Z6DA 3C8CA 3A0RA 1GSXA 3UMEA 1S4SA 3K3DA 3ULFA 3CLOA 5J3WA 1P0ZA 1F9IA 1N9LA 5F5YA 1EW0A 2D02A 4NXEA 2KX6A 4R3AA 4HJ3A 4L9GA 4L9FA 4KUOA 1OTDA 4GHIA 4I3AA 4I38A 3E4PA 3MQQA 4WLAA 3CAXA 3NOTC 5IU1A 2HV1A 1OJ5A 1UWPX 1VB6A 3E4OA 3K3CA 1V9YA 4JGOA 3UMDA 2YKHA 1T1BA 4DJ2A 1LSXA 4JGRA 3F1NB 4EXOA 2INWA 3MJQA 1LSWA 2I9VA 2A24B 3D72A 2H28A 4BBTA 1OT6A 3UB7A 2V9AA 2P7JA 3BY8A 5I5LA 5HD3A 1DRMA 3VE4A 4GS9B 4B9OA 2KDKA 1LSVA 1OTIA 1XJ4A 2W0NA 5HZHA 3H7WA 3LI9A 3PHYA 4LLOB 3KX0X 4EEPA 1OTAA 2ZOIA 2VLGA 4YWZA 4BBVA 1DP6A 1XJ2A 4HOIA 3LIEA 2PR5A 4K08A 3IS2A 4HP4A 4LRZE 3A0VA 4HP9A 2W27A 5G4YA 3ZQ5A 2JN7A 2QKPA 2OWJA 1T1CA 4PKYG 4GCZA 3IBRA 3F1PB 4I3IA 4XT2B 3PYPA 2PDRA 3VOLA 4I39A 2L4RA 1S4RA 1UWNX 4EW7A 2BASA 5AVEA 4LRXC 5G4ZA 2M1CA 2V1AA 3T50A 3LIFA 1MZUA 4NXFA 4NXGA 4I5SA 2PD8A 3P7NA 1T19A 3UB9A 1TS7A 1JNUA 5DKLA 3H82B 4LPZA 3A0SA 4M4XA 4E04A 1V9ZA 3F1OB 3H7WB 4HY8A 5F6AA 5J7EA 1P97A 3BWLA 3LICA 1TS0A 1OJGA 1BYWA 4R70A 4JGPA 3UB6A 4WL9A 1S67L 4H6JB 4RQ9A 5F68A 3G6OA 3BY9A 4EEUA 3EEHA 3HJKA 1DP9A 3LIAA 4F3LB 3MFXA 3GECA 4EESA 2ZOHA 3HJIA 5HD5A 1F98A 5DJUA 4EETB 5HSQA 2PR6A 1OTBA 2QHKA 1KOUA 3VE3A 2WKPA 4HJ4A 1G28A 4WUJA 4JGQA 3RH8B
chains in the Genus database with same CATH superfamily
2JHEA 5F83A 2ZQ8A 4GHIB 3N8LA 5HWWA 4GD6A 1ESIA 3CPTA 3O86A 4QB8A 1LL8A 4Z1WA 4EUVA 4FD8A 2WKQA 3GQZA 3C2WA 1CJFA 4HIAA 5AJGA 1FSWA 2W3HA 4PM9A 1Y4OA 1KE3A 3LYXA 4FH4A 4EV4A 5TBMA 1Z09A 2ZMFA 5CGWA 4ARZA 5MC7A 2NUPC 4WEKA 2ZQ9A 4WZ5C 5DF9A 3T4SA 1YLPA 2ZM8A 2VEAA 4M3KA 3ZNTA 4JLFA 1PRQA 4HQAA 2D01A 4X6TA 4N92A 2PD7A 4WF0A 1G5UA 5GL9A 2Y91A 3HREA 3NJAA 4YINA 1HVBA 3MZEA 2QPNA 4GB7A 1IFQA 2Y2GA 4NEED 3MSHA 4X1MA 1YAXA 3ZNYA 3BYDA 1WA9A 1D7EA 5FQ9A 4UQIM 3NOUC 1GSVA 5CEDA 2V8FA 4S2NA 2L0WA 2OWHA 4Y3IA 5F69A 1DJBA 3GDIA 3VFFA 4PM8A 4R4RA 3UN7A 3Q7ZA 2PYPA 3O88A 3SW1A 2R78A 3UPOA 3BECA 3F1PA 3NY4A 5EVIC 3CPTB 2EX6A 4A5RA 4E3LA 1CI9A 1W63Q 3SS4A 1BZAA 3DW0A 4DJ3A 3OBFA 2PHYA 4BWIA 1K54C 1N9NA 3ZFZA 4PM6A 5EPHA 1IYOA 4NK3A 4WZ4A 4EQ1A 1ODVA 3QNBA 3LI8A 4UHUA 5TBMB 2W3EA 1K56A 3OC2A 1MWTA 5AVFA 3CWFA 4ESPA 4ARZB 3B33A 2ZL1A 2HGVA 1BLHA 2EA9A 2K31A 3LUQA 1SZVA 1W79A 2A3UA 1MKIA 2HDQA 1YM1A 2WGWA 5AQ9A 4MMNA 4Q0IA 1K38A 3NIAA 1ACFA 5KSCA 4U3TA 5GHXA 1GHMA 3VP4A 1RGYA 1L0EA 2JKRI 3IH9A 3MZDA 4OOYA 4H6JA 2ZC6B 1E25A 4EERA 4RA7A 5TGFA 4KG6A 1HTZA 4UQIS 1PNEA 4Q0JA 1FQGA 2OV5A 4OQ0A 3A0RA 3IH8A 1YSQA 1K0KA 3GR2A 1S4SA 3PAGA 3K3DA 2XFSA 2VZWA 1PWGA 5J3WA 2ZQCA 3JVVA 1F9IA 3S7QA 3B3XA 4CLCB 5F5YA 3NCKA 3BRMA 4MBKA 4ZRRA 3LCEA 1KGGA 3MQQA 4GDBA 4WLAA 1ES2A 4RVAA 3IXBA 3NOTC 3EEAA 2WGWB 1ESUA 4XXRA 2Q0OA 2IA2A 4LCLA 5FAPA 3IHAA 4ZDXA 5EVID 3UMDA 2ZQAA 2YKHA 4ZAMA 2ZD8A 3HUNA 5CHJA 2OAP1 2ZC5B 1M40A 1NRJA 3VFHA 2INWA 5KZHA 2UWXA 3MJQA 2A24B 4N1HA 2H28A 1VETA 5AQ7A 5FQIA 2W1RA 3CHWP 1H8ZA 2FFFB 1C3BA 2H0TA 1NZOA 1LI0A 3G2ZA 3DTIA 2E8JA 2ZC3B 4Y15A 4B9OA 2KDKA 2DMWA 2O9BA 3BLSA 4ME4A 1XJ4A 5HZHA 1F5MA 1ZTUA 3LI9A 3IWIA 3MZFA 4KZ9A 3L7HA 1J3WA 4JF6A 2GDNA 1HZOA 4AFIA 2Y8HA 5G4YA 2JN7A 2XROA 1E3UA 4FOFA 5F82A 3VP3A 1T1CA 5A91A 4GD8A 3EQVA 1K57A 1XXMA 4MEZA 4XT2B 3VP1A 3PYPA 5F1FA 5FQKA 1S4RA 2JKFA 4EW7A 1PZOA 3ZDJA 5AVEA 4LRXC 4KZ4A 4LFUA 1MZUA 3T4JA 3QP2A 4R0QA 1VHMA 2H0YA 3V67A 2PD8A 4WM9A 3QP4A 1FR6A 1T19A 1K55A 4BLMA 3FZCA 4XUXA 1S6RA 1JNUA 5DKLA 5EM1A 3C4PA 2P74A 2XDMA 5M19A 4QHCA 4X68A 1JWZA 3LR3A 4UEYA 5CHMA 4R70A 4EQIA 4PAUA 4BENA 1SCWA 2JKTM 2B5RA 3S7PA 4UAAA 3G6OA 3BY9A 2W1TB 3LIAA 3MFXA 3NECA 3OOVA 2QMIA 2ZQDA 1OPXA 3UO9A 2WK0A 4C6YA 4OONA 3G2YA 5GLCA 2JE5A 4O7DA 3W4QA 4EETB 3PBRA 3MQ0A 4QY5A 1BTLA 1MBLA 3LY4A 4MCWA 2WKPA 3MXRA 3N7WA 4HJ4A 2JKTI 2OLUA 1H8MA 2CC1A 4WUJA 4JXGA 4N1XA 4OQHA 2Y55A 3RH8B 4CJNA 4Y13A 4GZBA 1OT9A 1Z6FA 1NLZA 1EWZA 2O99A 2K7SA 1Y28A 3ITBA 1S0WA 1X0OA 2GNXA 1K56D 5HDCA 4MN6A 1BLPA 2Y2NA 4B4ZA 2OOLA 2QJ7A 3OPHA 4PM5A 1TS6A 1WYCA 3FC7A 5DJTA 4EBNA 3PBTA 2HJ9C 2WUQA 4II7A 4DDYA 4GNUA 1P9WA 2EX8A 1TDLA 5HX9A 2FFYA 5DF8A 4Y0OA 2JKGA 3RTYA 1PZPA 4E6XA 2O0YA 4HNBA 4IBXA 5HW3A 5EVIA 1XGJA 1S1YA 3CUEA 4JF4A 1ES3A 2VX8A 5K5BA 1LLBA 2WADA 2JCHA 3HLBA 4K91A 1KGFA 4MDZA 3KSIA 1IKGA 4GW9A 5HWVA 1K57C 1YLZA 3Q81A 1VEUB 1IELA 2J80A 1CF0A 3DWZA 4PKYA 1Q2QA 1SHVA 3Q07A 4O0PA 5IT5A 3G34A 1GHPA 2B02A 2VJWA 2A49A 3GSGA 4EUZA 1W5DA 1DY6A 4OLDA 3LEQA 2WAEA 3LIBA 1W63M 1TDGA 2Y2HA 4DXBA 3ICYA 5D3OA 4E3IA 1K55C 4KZ6A 3JVUA 3D4FA 2J8YA 5L07A 3LIDA 2X71A 3TRCA 4OH0A 3T4KA 3O87A 1L2SA 2PU4A 3EGDC 3IF5A 1FCOA 3LY3A 3SH7A 1MPLA 2L1MA 2EWVA 3IQAA 3VSKA 3P98A 3IF6A 5EVIB 2GJ3A 2MJ6A 4LGWA 4HI4A 3F1OA 4E3JA 3BFCA 5KIZA 2M7UA 2XD1A 3UPNA 3S7OA 2XA7M 1YLJA 1L3LA 3UNWA 5IS1A 4NG2A 3DBAA 4R1GA 1YLTA 4HBUA 3R7WA 4QJGA 4KG2A 4ZBEA 5HDSA 4F3LA 2HZ5A 4QD4A 2VGKA 1GSXA 3UE0A 4OQIA 5U47A 3G32A 4ZJ2A 5DTSA 1ZHHB 4S2JA 3KYZA 3P09A 4LV2A 1N9LA 1BSGA 1E3UD 4NXEA 5FATA 3PAEA 1W7FA 4R3AA 4DN0A 4L9GA 5L8MA 3WS1A 3W4PA 4FUWA 4IUHA 3HUMA 4ETZA 3E4PA 4BQMA 4CLCE 5IHVA 3RXWA 2ZC7A 3CAXA 1L0FA 2BG1A 5IU1A 3KYQA 4OVDA 3ZHHA 1PI4A 3FV7A 3PBOA 3E4OA 3K3CA 3CMZA 4GN2A 2QZ6A 3CUEC 2HP9A 4BD1A 2V8CA 4DJ2A 3DAVA 5HL1A 1NJ4A 1IYSA 3A3DA 1CI8A 3TOIA 3D72A 4JXWA 2Y59A 5FDSA 1PIOA 2V9AA 2P7JA 3BY8A 2JKRM 3B42A 3T4OA 5I5LA 3M6BA 3T1SA 1DRMA 4H8RA 2XA7S 1YLYA 1XP4A 1XGIA 3VE4A 2VKSA 2W3FA 5CGXA 3WS2A 4BD0A 1FSYA 4OPYA 4WYYA 4E3OA 5TFQA 1JWPA 5FQMA 1KVMA 4JKTA 4Q8IA 1ALQA 1OTAA 5BOHA 4YWZA 3AGFA 1DP6A 1AWIA 3TE8A 3JPUA 4DE0A 1KE0A 3C7VA 1KDSA 1W8QA 1EROA 2PR5A 3IS2A 5TJJA 3S4XA 1YMXA 3A0VA 1BT5A 1CK3A 2EXBA 2QKPA 4PKYG 3GRJA 2HDRA 3IBRA 3F1PB 3IF6C 2ZM2A 4P85A 3TG9A 4I39A 3GV9A 3U2AA 1FCNA 1MC0A 4DMZA 1UWNX 2XQZA 2W3GA 3U4LP 1KVLA 2C5WB 3T50A 2NUTC 3M6HA 2FH5A 3UPPA 4ZTKA 4KZ8A 3S7NA 3GMWA 5FI2A 5E2EA 2ZL1B 3HUOA 4DXCA 2EX9A 2VK3A 1PWDA 4LCMA 4Y0TA 5L09A 2XD5A 1FILA 4WEJA 2WZXA 4X56A 4CPKA 3AGDA 1IKIA 3LR5A 3IXGA 3A0SA 1NXYA 2EXAA 2Y2KA 4E3MA 2Y2PA 5GHYA 5J7EA 5FI7A 4BJPA 4KZ7A 1BLCA 5GLAA 4JGPA 1DJCA 2XEPA 2WGVA 1S67L 3E0YA 4H6JB 3IXDA 5FQJA 3CI6A 3HJKA 3HL9A 2DCFA 1LL9A 3GECA 2K2NA 2PBYA 4WELA 4JPMA 5HD5A 4OP8A 4KZ3A 3A3FA 3OZHA 2XGNA 3PXPA 4X55A 1YKDA 5HSQA 2PR6A 3S1YA 4BL2A 2I72A 3C30A 3VE3A 4Y17A 1MY8A 3WWXA 1G68A 4DDSA 5EOOA 3BFEA 3C7UA 1VQQA 2WYXA 2XK1A 1DJAA 1TVFA 2B95A 2WKEA 2Z6CA 3OLOA 3OPPA 3MMHA 4FTXA 1T18A 3VMAA 4JBFA 2VV7A 3EGXC 3PBQA 3F1NA 3MQOA 5HAQA 2CMNA 3VP0A 3WS4A 2WKIA 5DF7A 2RCXA 4S2MA 2XH9A 4Y2FA 4HJ6A 1N4OA 1YPRA 4U0XA 3JYIA 4OQGA 2VV6A 1ZG6A 5HPIA 1S1ZA 3EWKA 4C75A 1VETB 3MKEA 3BJNA 4YFMA 2V1BA 2QJ5A 4GS9A 3GVBA 4OP5A 3UB8A 3CG5A 3HCYA 1H0MA 4OPQA 3UE6A 3R4KA 2V0WA 1LT0A 3ZVTA 2QYBA 5GLBA 4ID4A 5FQQA 3D3OA 1SKOA 4X25A 3BQAA 1K4EA 2G2UA 4MBHA 4KUKA 4DKIA 4EBLA 2VGJA 4L9EA 2ZLYA 1GSWA 1OTEA 4Q0HA 1N9BA 5LBRA 2PRFA 4IVKA 4Y7PA 4DRTA 1J9MA 3RJUA 2AVXA 5TR7A 1ERQA 5EV0A 2P9VA 5EE8A 5C5KA 4KZ5A 4PHTA 2P08A 4GKUA 3HLCA 3Q1FA 1OMEA 3V50A 1HLUP 4HH2A 3V3RA 3ZVWA 2Y2MA 4BMWA 3T4TA 3LGOA 5A8BA 2J3WA 3EOIA 3HLWA 3BM6A 1NWZA 3BLMA 3A3EA 3H82A 1HD8A 1ZG4A 3QNCA 4S2KA 2GZAA 4KQDA 4LRYC 1GA0A 5GLDA 5CECA 2ZJ9A 2Y4AA 4F94A 1ES5A 5FAOA 2XF3A 3ZGAB 1MXOA 2Y2OA 2XSSA 4PPRA 4RYEA 1XFNA 3FKWA 4NXBA 1SKFA 3IBJA 5EM0A 4WBGA 1YLWA 2BLSA 5FDHA 3T1XA 4JXVA 4OKPA 1T1AA 2HPBA 1ZC2A 1NY0A 5KMWA 3C8CA 4D60A 5CX7A 5AQAA 3VOZA 1XA7A 3UMEA 5CGSA 1K25A 3ULFA 3A3IA 5EUAA 3G4PA 1FOFA 3CLOA 3Q7VA 2RL3A 2P9VB 1L0GA 2Y2JA 1P0ZA 1W8YA 4IVIA 2DNSA 1GCEA 1CEGA 3ITAA 3CJMA 2D02A 2KX6A 3BQ8A 4HJ3A 1H8YA 4L9FA 2EWWA 1OTDA 1I2SA 4GHIA 4I38A 1L0DA 1G6AA 3PR6A 4E6WA 1PFLA 3FPWA 4GJ4A 4R3BA 4G3VA 1VB6A 4OPRA 3UE3A 4HESA 1KGEA 2OLVA 5FASA 3NBLA 3ZG5A 3LFVA 4N9KA 3OPRA 2KOIA 4JGRA 2PBDP 4EXOA 5FA7A 1NLYA 3UDIA 1LSWA 3IT9A 1PW8A 3ZG8B 1G6OA 3FWLA 1WE4A 3IWQA 4PMAA 3C4OA 2O9CA 5HD3A 5GHZA 3D9YA 5CTMA 3LR0A 1XX2A 1OTIA 3FPVA 4R3JA 3Q7VB 2W0NA 3HLEA 2UV0E 1WYBA 2ZC4B 4Z9QA 4DF6A 3PHYA 4LLOB 2ZMAA 2ZOIA 2VLGA 4BBVA 2OSUA 2Y2IA 1JTGA 5DFXA 4KQRA 5JYOA 4DE1A 4OLGA 3CITA 3LIEA 2ZM0A 5CTNA 2DRWA 4LRZE 5CHUA 5DTTA 4HP9A 3AGEA 1QMFA 2W27A 5FEFA 3ZQ5A 4UA6A 5FSRA 3NC8A 4L0LA 4MBFA 5DFYA 2WZZA 3KSHA 4I3IA 3WS5A 2WGIA 4OPZA 1GHIA 2L4RA 2A2LA 2R9WA 3T4QA 5EVEA 5G4ZA 2M1CA 1RGZA 2J9OA 3IHBA 5FL3A 3ZYTA 3DWKA 4X53A 4R23A 3LIFA 3TSGA 1I5QA 2X01A 1A0KA 4B4XA 4LENA 4WMCD 2V20A 3WS0A 2JBFA 4I5SA 5JYPA 1VM1A 3G30A 1NYYA 3UB9A 3SOIA 3IF6B 4XUZA 1TS7A 5E2FA 3T1RA 1K6RA 4PM7A 1O7EA 4LPZA 4M4XA 3RFBA 3T12B 1U60A 1ZKJA 2BTFP 3F1OB 3IWOA 4S2LA 3BWLA 3PBSA 3VP2A 3DTKA 4IBRA 4KQQA 4ETXA 1BYWA 2J9PA 1BUEA 3UB6A 1XA1A 3KSGA 4BL3A 1TD5A 5L10A 4MN7A 1IYQA 4RQ9A 1H3QA 3R7WB 4MLLA 4EEUA 1MWUA 3IX8A 3VV4A 1DP9A 4KQOA 4F3LB 4EESA 2KLIA 3HJIA 5KSHA 4E3NA 4IJGA 5E2HA 4CLCA 2J7VA 3QP8A 4S2IA 2HDSA 3UY6A 3KO6A 1KOUA 2G2WA 5DVAA 1K4FA 4O01A 2WAFA 3T1QB 3NDEA 1TF1A 2HJEA 4LV0A 2HF6A 5A93A 3MF0A 2XFTA 5HFOA 2HP5A 2V1ZA 4BBUA 4X1LA 4E3KA 4I3JA 2B18A 3MR0A 5HDDA 4QY6A 2QWSA 4G3WA 3LEZA 4NETA 3UE1A 3M2KA 3FKVA 5HWTA 2EFUA 1QMEA 3WRZA 2R9XA 4RX3A 2ACGA 2H10A 4KZBA 1XKZA 2IWBA 1FR1A 2A24A 3IX4A 1JTDA 2V0UA 2VV8A 1O07A 4ZJ1A 4HHDA 5EFWA 2XRNA 4KZAA 2V2FF 4ZJ3A 1SDNA 3SH8A 3QHYA 1JWVA 3DTEA 5M1AA 5EOEA 1S66L 1UGUA 5CERA 1BLSA 5DKKA 3ZG9B 1I2WA 5G18A 2P04A 3H9WA 3O3VA 3GTCA 4R38A 3HLDA 1N9OA 1F2KA 4B93A 2FZ0A 5HL6A 3I7JA 5CEBA 4RX2A 5EECA 4FCFA 1P9RA 3Q82A 5J4EA 2PT7A 4JXSA 5FI6A 3P01A 1ONGA 3TW8A 1ES4A 3IS2B 4P0MA 2YKFA 1DP8A 4MN5A 5HAPA 4XT2A 1RP5A 2EFXA 2W3DA 3UB5P 2Q9NA 2PYRA 4WN5A 4UA9A 4P6BA 3ZG7B 2HDUA 1XFQA 4R6LA 2X02A 4S2OA 2VA0A 3KYEA 3DTMA 4S2NC 4OOLA 3MBZA 3E4QA 1KDWA 4KENB 2WKRA 1JVJA 4C3QA 4GOGA 1XJ3A 2ZBBA 1NRFA 3LO7A 1ERMA 3PBNA 3IX3A 4FH2A 2Z2MB 1MKMA 3VOYA 2LB5A 3E98A 1XJ6A 1MWSA 3N6IA 4GDNA 2WKHA 1D1JA 3HLGA 1D06A 2C6WB 3V39A 3MXQA 1TS8A 4U0TA 1YMSA 3ZG0A 1IOUA 4CLCC 4WMCA 2XLNA 4HH3A 3BEBA 3W4OA 4P6ZM 3NHQA 2J3TC 5AQBA 1LI9A 3NOPC 4X69A 5L2FA 2W1TA 5HARA 3UDFA 5FAQA 3FG8A 3V5MA 3EQUA 2Z6DA 3SS5A 3QP6A 4D2OA 3IXHA 2ZMVA 5HAIA 4UA7A 5FEGA 3TJZC 3MS6A 3QP1A 5E43A 2ZQ7A 1IEMA 4QU3A 1CQAA 3HBRA 4OOMA 2EX2A 3G35A 1YQSA 1PYYA 4YNRA 1EW0A 3O5YA 3C5AA 3C38A 3VSLA 4KUOA 1LHYA 4I3AA 1NYMA 4B88A 1RCJA 2Q9MA 3M2JA 3SS3A 3HLFA 1CEFA 3BW6A 2HV1A 1OJ5A 1TEMA 1UWPX 1NZUA 3W8KA 2E8IA 1YSPA 3E2KA 3V3SA 1V9YA 3MKFA 4EWFA 4JGOA 4Y5FA 1E4DA 3L9KA 4NKPA 2O9AA 1T1BA 3HVFA 5CXWA 1LSXA 1PI5A 3F1NB 4N9LA 1AXBA 3OCLA 2I9VA 4BBTA 1OT6A 3UB7A 1K6SA 1XPBA 4R4SA 3BFFA 1SDEA 4MNRA 3ZCZA 3N4IA 3N8RA 2Y2QA 3LR4A 4FSFA 3NDGA 4P6ZS 4GS9B 3FYZA 4HEFA 2Y79A 3T4LA 1BULA 1MWRA 4CQHA 1LSVA 4K0XA 2IWDA 1LL5A 3MFDA 3H7WA 1GA9A 1VEUA 3N8SA 3KX0X 4EEPA 3KSFA 4S2PA 3OPLA 3OCNA 4WZ5A 1XJ2A 4HOIA 1M6KA 2HP6A 5F1GA 2VGLM 1SKOB 3BFDA 4QWOA 4G3KA 4CLCD 4K08A 4HP4A 5A90A 2J3TD 3B47A 3WRTA 2Y2LA 2OWJA 5I94A 1H5XA 4GCZA 5A92A 4IHQA 2H5SA 2PDRA 3VOLA 4HBTA 5M18A 4QPRA 2XR0A 1PW1A 2BASA 4DE3A 5E2GA 5J8XA 1FIKA 2V1AA 3NULA 2IWCA 4EU0A 4NXFA 2OAQ1 3BFGA 2GX5A 4DE2A 4NXGA 3A3JA 1PWCA 1EI5A 4GLQA 3E2LA 3NI9A 3P7NA 4K0WA 1STZA 4LV3A 1K54A 2LB9A 2JC7A 3H82B 1KE4A 4YOFA 4E04A 1V9ZA 3H7WB 4HY8A 5F6AA 4KG5A 1P97A 3LICA 1TS0A 1OJGA 3K2NA 1Q2PA 4JF5A 5DTKA 5CRFA 4WL9A 1Y54A 2Z2LB 4IUKA 4LV1A 5F68A 5EVLA 3SZTA 3EEHA 3MXSA 2G7UA 2PU2A 4Y0UA 3QP5A 1IYPA 4EBPA 1ONHA 2ZOHA 3ISGA 1F98A 5DJUA 4P87A 2VGLS 3PTEA 3G31A 3CZDA 1OTBA 2QHKA 3UDXA 1FCMA 3S22A 3W2ZA 4IEDA 3RXXA 2PAVP 1G28A 4JGQA 5HPFA 2M7VA 3SH9A 4O8GA 1YT4A
chains in the Genus database with same CATH topology
2JHEA 1OT9A 1NLZA 2O99A 2K7SA 4GHIB 1Y28A 4BBUA 5HWWA 4I3JA 1X0OA 2GNXA 2B18A 2Z6CA 3MR0A 3OLOA 5HDDA 2QWSA 4G3WA 3MMHA 5HDCA 5HWTA 4MN6A 1LL8A 4Z1WA 4EUVA 2WKQA 2OOLA 2QJ7A 3C2WA 4HIAA 1T18A 2VV7A 3EGXC 5AJGA 3PBQA 3F1NA 3MQOA 1TS6A 2W3HA 3FC7A 5DJTA 3PBTA 2CMNA 2HJ9C 2A24A 4II7A 3LYXA 1P9WA 5TBMA 2V0UA 2VV8A 4Y2FA 2ZMFA 4HHDA 4ARZA 4HJ6A 3RTYA 5MC7A 5EFWA 2NUPC 2XRNA 4WEKA 2VV6A 2O0YA 5DF9A 1S1ZA 3EWKA 3T4SA 5HPIA 2VEAA 4HNBA 3BJNA 2V1BA 2D01A 2QJ5A 4GS9A 4HQAA 2PD7A 4WF0A 1S66L 1UGUA 1S1YA 3CUEA 3UB8A 3NJAA 5DKKA 2P04A 2VX8A 3H9WA 4R38A 1IFQA 5K5BA 4NEED 3HCYA 1YAXA 1WA9A 1D7EA 4MDZA 3KSIA 4UQIM 3UE6A 1N9OA 2V0WA 3R4KA 4B93A 1LT0A 3NOUC 2FZ0A 4GW9A 1GSVA 5HL6A 5HWVA 2QYBA 2L0WA 3D3OA 2OWHA 4Y3IA 5F69A 3BQAA 2J80A 4PKYA 3GDIA 1P9RA 4KUKA 5J4EA 4O0PA 5IT5A 2PT7A 4L9EA 1GSWA 2PYPA 3P01A 2B02A 2VJWA 1OTEA 3SW1A 3TW8A 2R78A 4Q0HA 3F1PA 3IS2B 2YKFA 1DP8A 4MN5A 5LBRA 4XT2A 3LIBA 1W63M 2W3DA 1W63Q 2PYRA 4WN5A 3ICYA 4DJ3A 3OBFA 2PHYA 4BWIA 3JVUA 1XFQA 4R6LA 1N9NA 5C5KA 4PHTA 2P08A 3LIDA 2VA0A 3TRCA 4HH2A 4EQ1A 1ODVA 3T4KA 4OOLA 3LI8A 5TBMB 2W3EA 4BMWA 3OC2A 3EGDC 5AVFA 3T4TA 3E4QA 3CWFA 2WKRA 4ARZB 3B33A 2HGVA 1XJ3A 5A8BA 2ZBBA 2EA9A 2J3WA 3EOIA 2K31A 3LUQA 2L1MA 3PBNA 2EWVA 1NWZA 1MKMA 2GJ3A 2LB5A 2MJ6A 3E98A 4MMNA 4Q0IA 1XJ6A 3H82A 4HI4A 3F1OA 5KIZA 2GZAA 1D06A 4KQDA 2M7UA 4LRYC 3MXQA 1TS8A 3S7OA 2XA7M 2JKRI 1IOUA 4CLCC 5IS1A 2XSSA 4HH3A 1XFNA 4P6ZM 3NHQA 2J3TC 3DBAA 4H6JA 3NOPC 4NXBA 3R7WA 4EERA 3IBJA 2W1TA 5HDSA 3FG8A 4F3LA 1T1AA 4UQIS 3EQUA 2Z6DA 4Q0JA 3C8CA 5CX7A 3A0RA 1YSQA 1GSXA 3UMEA 2ZMVA 1S4SA 3K3DA 3TJZC 3ULFA 3CLOA 2VZWA 5J3WA 4OOMA 1ZHHB 3JVVA 3KYZA 1P0ZA 1F9IA 4YNRA 3S7QA 1N9LA 4CLCB 5F5YA 1EW0A 2D02A 4NXEA 3O5YA 2KX6A 4R3AA 4DN0A 3BQ8A 4HJ3A 4L9GA 4L9FA 2EWWA 3C38A 5L8MA 4KUOA 1OTDA 4GHIA 4I3AA 4I38A 4ZRRA 4IUHA 3PR6A 4ETZA 3E4PA 4CLCE 3MQQA 3BW6A 4WLAA 3FPWA 4GJ4A 3CAXA 3NOTC 4G3VA 3EEAA 2HV1A 1OJ5A 3KYQA 5IU1A 1UWPX 1VB6A 1YSPA 3UE3A 2IA2A 3PBOA 3E4OA 3K3CA 1V9YA 3CUEC 4JGOA 4Y5FA 3UMDA 4NKPA 2YKHA 2O9AA 1T1BA 4DJ2A 3LFVA 1LSXA 2KOIA 4JGRA 3F1NB 2OAP1 4EXOA 1NRJA 1NLYA 2INWA 3OCLA 3MJQA 1LSWA 2I9VA 2A24B 3D72A 2H28A 4BBTA 1OT6A 3UB7A 2W1RA 2V9AA 1G6OA 2P7JA 3BY8A 2JKRM 3B42A 3T4OA 2O9CA 5I5LA 5HD3A 1DRMA 2XA7S 3LR4A 4FSFA 3VE4A 3LR0A 2VKSA 4P6ZS 4GS9B 4B9OA 2W3FA 2KDKA 2Y79A 3T4LA 4CQHA 1LSVA 1OTIA 2DMWA 2O9BA 3FPVA 4ME4A 1XJ4A 2W0NA 5HZHA 1F5MA 3H7WA 1ZTUA 3LI9A 3PHYA 4LLOB 3KX0X 4EEPA 1OTAA 3KSFA 2ZOIA 2VLGA 4YWZA 3OCNA 4BBVA 1DP6A 1XJ2A 3TE8A 4HOIA 5DFXA 2VGLM 4G3KA 3CITA 3LIEA 4CLCD 2PR5A 4K08A 3IS2A 4HP4A 5TJJA 4LRZE 2J3TD 3A0VA 4HP9A 4AFIA 3B47A 2W27A 2Y8HA 5G4YA 3ZQ5A 2JN7A 2QKPA 2XROA 2OWJA 4FOFA 4L0LA 1T1CA 4PKYG 4GCZA 3IBRA 3F1PB 5DFYA 3KSHA 3EQVA 4I3IA 4XT2B 3PYPA 4IHQA 2PDRA 3VOLA 4I39A 3U2AA 4QPRA 2L4RA 2A2LA 1S4RA 1MC0A 3T4QA 4DMZA 1UWNX 4EW7A 2BASA 2W3GA 5AVEA 4LRXC 5G4ZA 2M1CA 5FL3A 2V1AA 3ZYTA 4EU0A 3T50A 2NUTC 2FH5A 3LIFA 1MZUA 2OAQ1 4NXFA 3S7NA 3T4JA 2GX5A 4NXGA 1VHMA 4I5SA 3V67A 4GLQA 2PD8A 3P7NA 1STZA 1T19A 3UB9A 4WEJA 2LB9A 1TS7A 1JNUA 5DKLA 3LR5A 3H82B 4LPZA 3A0SA 4M4XA 3RFBA 4YOFA 4E04A 1V9ZA 3F1OB 3H7WB 4HY8A 5F6AA 5J7EA 1P97A 3BWLA 3LICA 1TS0A 3PBSA 1OJGA 3LR3A 4UEYA 4BJPA 4ETXA 1BYWA 3K2NA 4R70A 4PAUA 4JGPA 3UB6A 4WL9A 3KSGA 1TD5A 2JKTM 3S7PA 1S67L 4IUKA 3E0YA 4H6JB 4MN7A 4RQ9A 1H3QA 5F68A 3R7WB 3G6OA 3BY9A 2W1TB 4EEUA 3CI6A 3EEHA 3HJKA 3VV4A 1DP9A 2G7UA 3LIAA 4KQOA 4F3LB 3MFXA 3OOVA 3GECA 2K2NA 4EESA 1OPXA 2KLIA 4WELA 2ZOHA 3HJIA 5HD5A 1F98A 5KSHA 5DJUA 4IJGA 2VGLS 3PXPA 4EETB 1YKDA 5HSQA 2PR6A 4CLCA 3PBRA 1OTBA 3MQ0A 2QHKA 3KO6A 1KOUA 3W2ZA 3C30A 4MCWA 2WKPA 3VE3A 4O01A 4HJ4A 2JKTI 1H8MA 1G28A 4WUJA 1TF1A 2HJEA 4JGQA 5HPFA 2HF6A 2M7VA 4O8GA 3RH8B 3MF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JHE A;  1OT9 A;  2K7S A;  4GHI B;  1Y28 A;  4BBU A;  5HWW A;  4I3J A;  1X0O A;  2Z6C A;  3MR0 A;  3OLO A;  5HDD A;  2QWS A;  5HDC A;  5HWT A;  4MN6 A;  1LL8 A;  2WKQ A;  2OOL A;  2QJ7 A;  3C2W A;  4HIA A;  1T18 A;  2VV7 A;  3F1N A;  3MQO A;  1TS6 A;  3FC7 A;  5DJT A;  2CMN A;  2A24 A;  3LYX A;  5TBM A;  2V0U A;  2VV8 A;  4HHD A;  4HJ6 A;  3RTY A;  5EFW A;  2VV6 A;  1S1Z A;  3EWK A;  2VEA A;  4HNB A;  2V1B A;  2D01 A;  2QJ5 A;  4GS9 A;  4HQA A;  2PD7 A;  4WF0 A;  1UGU A;  1S66 L;  1S1Y A;  3UB8 A;  3NJA A;  5DKK A;  3H9W A;  4R38 A;  1WA9 A;  1D7E A;  3UE6 A;  1N9O A;  2V0W A;  1LT0 A;  3NOU C;  4GW9 A;  5HWV A;  1GSV A;  2L0W A;  2OWH A;  5F69 A;  2J80 A;  4PKY A;  3GDI A;  4KUK A;  5J4E A;  4L9E A;  1GSW A;  2PYP A;  2B02 A;  1OTE A;  3SW1 A;  2R78 A;  3F1P A;  3IS2 B;  2YKF A;  1DP8 A;  4MN5 A;  4XT2 A;  3LIB A;  2PYR A;  4WN5 A;  3ICY A;  4DJ3 A;  2PHY A;  1XFQ A;  4R6L A;  1N9N A;  3LID A;  4HH2 A;  4EQ1 A;  1ODV A;  3LI8 A;  5TBM B;  5AVF A;  3E4Q A;  3CWF A;  2WKR A;  3B33 A;  1XJ3 A;  5A8B A;  2ZBB A;  2EA9 A;  3LUQ A;  2L1M A;  1NWZ A;  2GJ3 A;  1XJ6 A;  3H82 A;  4HI4 A;  3F1O A;  5KIZ A;  1D06 A;  4KQD A;  4LRY C;  3MXQ A;  1TS8 A;  5IS1 A;  4HH3 A;  1XFN A;  3NHQ A;  4H6J A;  3NOP C;  4NXB A;  4EER A;  5HDS A;  3FG8 A;  4F3L A;  1T1A A;  2Z6D A;  3C8C A;  3A0R A;  1GSX A;  3UME A;  1S4S A;  3K3D A;  3ULF A;  3CLO A;  5J3W A;  1P0Z A;  1F9I A;  1N9L A;  5F5Y A;  1EW0 A;  2D02 A;  4NXE A;  2KX6 A;  4R3A A;  4HJ3 A;  4L9G A;  4L9F A;  4KUO A;  1OTD A;  4GHI A;  4I3A A;  4I38 A;  3E4P A;  3MQQ A;  4WLA A;  3CAX A;  3NOT C;  5IU1 A;  2HV1 A;  1OJ5 A;  1UWP X;  1VB6 A;  3E4O A;  3K3C A;  1V9Y A;  4JGO A;  3UMD A;  2YKH A;  1T1B A;  4DJ2 A;  1LSX A;  4JGR A;  3F1N B;  4EXO A;  2INW A;  3MJQ A;  1LSW A;  2I9V A;  2A24 B;  3D72 A;  2H28 A;  4BBT A;  1OT6 A;  3UB7 A;  2V9A A;  2P7J A;  3BY8 A;  5I5L A;  5HD3 A;  1DRM A;  3VE4 A;  4GS9 B;  4B9O A;  2KDK A;  1LSV A;  1OTI A;  1XJ4 A;  2W0N A;  5HZH A;  3H7W A;  3LI9 A;  3PHY A;  4LLO B;  3KX0 X;  4EEP A;  1OTA A;  2ZOI A;  2VLG A;  4YWZ A;  4BBV A;  1DP6 A;  1XJ2 A;  4HOI A;  3LIE A;  2PR5 A;  4K08 A;  3IS2 A;  4HP4 A;  4LRZ E;  3A0V A;  4HP9 A;  2W27 A;  5G4Y A;  3ZQ5 A;  2JN7 A;  2QKP A;  2OWJ A;  1T1C A;  4PKY G;  4GCZ A;  3IBR A;  3F1P B;  4I3I A;  4XT2 B;  3PYP A;  2PDR A;  3VOL A;  4I39 A;  2L4R A;  1S4R A;  1UWN X;  4EW7 A;  2BAS A;  5AVE A;  4LRX C;  5G4Z A;  2M1C A;  2V1A A;  3T50 A;  3LIF A;  1MZU A;  4NXF A;  4NXG A;  4I5S A;  2PD8 A;  3P7N A;  1T19 A;  3UB9 A;  1TS7 A;  1JNU A;  5DKL A;  3H82 B;  4LPZ A;  3A0S A;  4M4X A;  4E04 A;  1V9Z A;  3F1O B;  3H7W B;  4HY8 A;  5F6A A;  5J7E A;  1P97 A;  3BWL A;  3LIC A;  1TS0 A;  1OJG A;  1BYW A;  4R70 A;  4JGP A;  3UB6 A;  4WL9 A;  1S67 L;  4H6J B;  4RQ9 A;  5F68 A;  3G6O A;  3BY9 A;  4EEU A;  3EEH A;  3HJK A;  1DP9 A;  3LIA A;  4F3L B;  3MFX A;  3GEC A;  4EES A;  2ZOH A;  3HJI A;  5HD5 A;  1F98 A;  5DJU A;  4EET B;  5HSQ A;  2PR6 A;  1OTB A;  2QHK A;  1KOU A;  3VE3 A;  2WKP A;  4HJ4 A;  1G28 A;  4WUJ A;  4JGQ A;  3RH8 B; 
#chains in the Genus database with same CATH topology
 2JHE A;  5F83 A;  2ZQ8 A;  4GHI B;  3N8L A;  5HWW A;  4GD6 A;  1ESI A;  3CPT A;  3O86 A;  4QB8 A;  1LL8 A;  4Z1W A;  4EUV A;  4FD8 A;  2WKQ A;  3GQZ A;  3C2W A;  1CJF A;  4HIA A;  5AJG A;  1FSW A;  2W3H A;  4PM9 A;  1Y4O A;  1KE3 A;  3LYX A;  4FH4 A;  4EV4 A;  5TBM A;  1Z09 A;  2ZMF A;  5CGW A;  4ARZ A;  5MC7 A;  2NUP C;  4WEK A;  2ZQ9 A;  4WZ5 C;  5DF9 A;  3T4S A;  1YLP A;  2ZM8 A;  2VEA A;  4M3K A;  3ZNT A;  4JLF A;  1PRQ A;  4HQA A;  2D01 A;  4X6T A;  4N92 A;  2PD7 A;  4WF0 A;  1G5U A;  5GL9 A;  2Y91 A;  3HRE A;  3NJA A;  4YIN A;  1HVB A;  3MZE A;  2QPN A;  4GB7 A;  1IFQ A;  2Y2G A;  4NEE D;  3MSH A;  4X1M A;  1YAX A;  3ZNY A;  3BYD A;  1WA9 A;  1D7E A;  5FQ9 A;  4UQI M;  3NOU C;  1GSV A;  5CED A;  2V8F A;  4S2N A;  2L0W A;  2OWH A;  4Y3I A;  5F69 A;  1DJB A;  3GDI A;  3VFF A;  4PM8 A;  4R4R A;  3UN7 A;  3Q7Z A;  2PYP A;  3O88 A;  3SW1 A;  2R78 A;  3UPO A;  3BEC A;  3F1P A;  3NY4 A;  5EVI C;  3CPT B;  2EX6 A;  4A5R A;  4E3L A;  1CI9 A;  1W63 Q;  3SS4 A;  1BZA A;  3DW0 A;  4DJ3 A;  3OBF A;  2PHY A;  4BWI A;  1K54 C;  1N9N A;  3ZFZ A;  4PM6 A;  5EPH A;  1IYO A;  4NK3 A;  4WZ4 A;  4EQ1 A;  1ODV A;  3QNB A;  3LI8 A;  4UHU A;  5TBM B;  2W3E A;  1K56 A;  3OC2 A;  1MWT A;  5AVF A;  3CWF A;  4ESP A;  4ARZ B;  3B33 A;  2ZL1 A;  2HGV A;  1BLH A;  2EA9 A;  2K31 A;  3LUQ A;  1SZV A;  1W79 A;  2A3U A;  1MKI A;  2HDQ A;  1YM1 A;  2WGW A;  5AQ9 A;  4MMN A;  4Q0I A;  1K38 A;  3NIA A;  1ACF A;  5KSC A;  4U3T A;  5GHX A;  1GHM A;  3VP4 A;  1RGY A;  1L0E A;  2JKR I;  3IH9 A;  3MZD A;  4OOY A;  4H6J A;  2ZC6 B;  1E25 A;  4EER A;  4RA7 A;  5TGF A;  4KG6 A;  1HTZ A;  4UQI S;  1PNE A;  4Q0J A;  1FQG A;  2OV5 A;  4OQ0 A;  3A0R A;  3IH8 A;  1YSQ A;  1K0K A;  3GR2 A;  1S4S A;  3PAG A;  3K3D A;  2XFS A;  2VZW A;  1PWG A;  5J3W A;  2ZQC A;  3JVV A;  1F9I A;  3S7Q A;  3B3X A;  4CLC B;  5F5Y A;  3NCK A;  3BRM A;  4MBK A;  4ZRR A;  3LCE A;  1KGG A;  3MQQ A;  4GDB A;  4WLA A;  1ES2 A;  4RVA A;  3IXB A;  3NOT C;  3EEA A;  2WGW B;  1ESU A;  4XXR A;  2Q0O A;  2IA2 A;  4LCL A;  5FAP A;  3IHA A;  4ZDX A;  5EVI D;  3UMD A;  2ZQA A;  2YKH A;  4ZAM A;  2ZD8 A;  3HUN A;  5CHJ A;  2OAP 1;  2ZC5 B;  1M40 A;  1NRJ A;  3VFH A;  2INW A;  5KZH A;  2UWX A;  3MJQ A;  2A24 B;  4N1H A;  2H28 A;  1VET A;  5AQ7 A;  5FQI A;  2W1R A;  3CHW P;  1H8Z A;  2FFF B;  1C3B A;  2H0T A;  1NZO A;  1LI0 A;  3G2Z A;  3DTI A;  2E8J A;  2ZC3 B;  4Y15 A;  4B9O A;  2KDK A;  2DMW A;  2O9B A;  3BLS A;  4ME4 A;  1XJ4 A;  5HZH A;  1F5M A;  1ZTU A;  3LI9 A;  3IWI A;  3MZF A;  4KZ9 A;  3L7H A;  1J3W A;  4JF6 A;  2GDN A;  1HZO A;  4AFI A;  2Y8H A;  5G4Y A;  2JN7 A;  2XRO A;  1E3U A;  4FOF A;  5F82 A;  3VP3 A;  1T1C A;  5A91 A;  4GD8 A;  3EQV A;  1K57 A;  1XXM A;  4MEZ A;  4XT2 B;  3VP1 A;  3PYP A;  5F1F A;  5FQK A;  1S4R A;  2JKF A;  4EW7 A;  1PZO A;  3ZDJ A;  5AVE A;  4LRX C;  4KZ4 A;  4LFU A;  1MZU A;  3T4J A;  3QP2 A;  4R0Q A;  1VHM A;  2H0Y A;  3V67 A;  2PD8 A;  4WM9 A;  3QP4 A;  1FR6 A;  1T19 A;  1K55 A;  4BLM A;  3FZC A;  4XUX A;  1S6R A;  1JNU A;  5DKL A;  5EM1 A;  3C4P A;  2P74 A;  2XDM A;  5M19 A;  4QHC A;  4X68 A;  1JWZ A;  3LR3 A;  4UEY A;  5CHM A;  4R70 A;  4EQI A;  4PAU A;  4BEN A;  1SCW A;  2JKT M;  2B5R A;  3S7P A;  4UAA A;  3G6O A;  3BY9 A;  2W1T B;  3LIA A;  3MFX A;  3NEC A;  3OOV A;  2QMI A;  2ZQD A;  1OPX A;  3UO9 A;  2WK0 A;  4C6Y A;  4OON A;  3G2Y A;  5GLC A;  2JE5 A;  4O7D A;  3W4Q A;  4EET B;  3PBR A;  3MQ0 A;  4QY5 A;  1BTL A;  1MBL A;  3LY4 A;  4MCW A;  2WKP A;  3MXR A;  3N7W A;  4HJ4 A;  2JKT I;  2OLU A;  1H8M A;  2CC1 A;  4WUJ A;  4JXG A;  4N1X A;  4OQH A;  2Y55 A;  3RH8 B;  4CJN A;  4Y13 A;  4GZB A;  1OT9 A;  1Z6F A;  1NLZ A;  1EWZ A;  2O99 A;  2K7S A;  1Y28 A;  3ITB A;  1S0W A;  1X0O A;  2GNX A;  1K56 D;  5HDC A;  4MN6 A;  1BLP A;  2Y2N A;  4B4Z A;  2OOL A;  2QJ7 A;  3OPH A;  4PM5 A;  1TS6 A;  1WYC A;  3FC7 A;  5DJT A;  4EBN A;  3PBT A;  2HJ9 C;  2WUQ A;  4II7 A;  4DDY A;  4GNU A;  1P9W A;  2EX8 A;  1TDL A;  5HX9 A;  2FFY A;  5DF8 A;  4Y0O A;  2JKG A;  3RTY A;  1PZP A;  4E6X A;  2O0Y A;  4HNB A;  4IBX A;  5HW3 A;  5EVI A;  1XGJ A;  1S1Y A;  3CUE A;  4JF4 A;  1ES3 A;  2VX8 A;  5K5B A;  1LLB A;  2WAD A;  2JCH A;  3HLB A;  4K91 A;  1KGF A;  4MDZ A;  3KSI A;  1IKG A;  4GW9 A;  5HWV A;  1K57 C;  1YLZ A;  3Q81 A;  1VEU B;  1IEL A;  2J80 A;  1CF0 A;  3DWZ A;  4PKY A;  1Q2Q A;  1SHV A;  3Q07 A;  4O0P A;  5IT5 A;  3G34 A;  1GHP A;  2B02 A;  2VJW A;  2A49 A;  3GSG A;  4EUZ A;  1W5D A;  1DY6 A;  4OLD A;  3LEQ A;  2WAE A;  3LIB A;  1W63 M;  1TDG A;  2Y2H A;  4DXB A;  3ICY A;  5D3O A;  4E3I A;  1K55 C;  4KZ6 A;  3JVU A;  3D4F A;  2J8Y A;  5L07 A;  3LID A;  2X71 A;  3TRC A;  4OH0 A;  3T4K A;  3O87 A;  1L2S A;  2PU4 A;  3EGD C;  3IF5 A;  1FCO A;  3LY3 A;  3SH7 A;  1MPL A;  2L1M A;  2EWV A;  3IQA A;  3VSK A;  3P98 A;  3IF6 A;  5EVI B;  2GJ3 A;  2MJ6 A;  4LGW A;  4HI4 A;  3F1O A;  4E3J A;  3BFC A;  5KIZ A;  2M7U A;  2XD1 A;  3UPN A;  3S7O A;  2XA7 M;  1YLJ A;  1L3L A;  3UNW A;  5IS1 A;  4NG2 A;  3DBA A;  4R1G A;  1YLT A;  4HBU A;  3R7W A;  4QJG A;  4KG2 A;  4ZBE A;  5HDS A;  4F3L A;  2HZ5 A;  4QD4 A;  2VGK A;  1GSX A;  3UE0 A;  4OQI A;  5U47 A;  3G32 A;  4ZJ2 A;  5DTS A;  1ZHH B;  4S2J A;  3KYZ A;  3P09 A;  4LV2 A;  1N9L A;  1BSG A;  1E3U D;  4NXE A;  5FAT A;  3PAE A;  1W7F A;  4R3A A;  4DN0 A;  4L9G A;  5L8M A;  3WS1 A;  3W4P A;  4FUW A;  4IUH A;  3HUM A;  4ETZ A;  3E4P A;  4BQM A;  4CLC E;  5IHV A;  3RXW A;  2ZC7 A;  3CAX A;  1L0F A;  2BG1 A;  5IU1 A;  3KYQ A;  4OVD A;  3ZHH A;  1PI4 A;  3FV7 A;  3PBO A;  3E4O A;  3K3C A;  3CMZ A;  4GN2 A;  2QZ6 A;  3CUE C;  2HP9 A;  4BD1 A;  2V8C A;  4DJ2 A;  3DAV A;  5HL1 A;  1NJ4 A;  1IYS A;  3A3D A;  1CI8 A;  3TOI A;  3D72 A;  4JXW A;  2Y59 A;  5FDS A;  1PIO A;  2V9A A;  2P7J A;  3BY8 A;  2JKR M;  3B42 A;  3T4O A;  5I5L A;  3M6B A;  3T1S A;  1DRM A;  4H8R A;  2XA7 S;  1YLY A;  1XP4 A;  1XGI A;  3VE4 A;  2VKS A;  2W3F A;  5CGX A;  3WS2 A;  4BD0 A;  1FSY A;  4OPY A;  4WYY A;  4E3O A;  5TFQ A;  1JWP A;  5FQM A;  1KVM A;  4JKT A;  4Q8I A;  1ALQ A;  1OTA A;  5BOH A;  4YWZ A;  3AGF A;  1DP6 A;  1AWI A;  3TE8 A;  3JPU A;  4DE0 A;  1KE0 A;  3C7V A;  1KDS A;  1W8Q A;  1ERO A;  2PR5 A;  3IS2 A;  5TJJ A;  3S4X A;  1YMX A;  3A0V A;  1BT5 A;  1CK3 A;  2EXB A;  2QKP A;  4PKY G;  3GRJ A;  2HDR A;  3IBR A;  3F1P B;  3IF6 C;  2ZM2 A;  4P85 A;  3TG9 A;  4I39 A;  3GV9 A;  3U2A A;  1FCN A;  1MC0 A;  4DMZ A;  1UWN X;  2XQZ A;  2W3G A;  3U4L P;  1KVL A;  2C5W B;  3T50 A;  2NUT C;  3M6H A;  2FH5 A;  3UPP A;  4ZTK A;  4KZ8 A;  3S7N A;  3GMW A;  5FI2 A;  5E2E A;  2ZL1 B;  3HUO A;  4DXC A;  2EX9 A;  2VK3 A;  1PWD A;  4LCM A;  4Y0T A;  5L09 A;  2XD5 A;  1FIL A;  4WEJ A;  2WZX A;  4X56 A;  4CPK A;  3AGD A;  1IKI A;  3LR5 A;  3IXG A;  3A0S A;  1NXY A;  2EXA A;  2Y2K A;  4E3M A;  2Y2P A;  5GHY A;  5J7E A;  5FI7 A;  4BJP A;  4KZ7 A;  1BLC A;  5GLA A;  4JGP A;  1DJC A;  2XEP A;  2WGV A;  1S67 L;  3E0Y A;  4H6J B;  3IXD A;  5FQJ A;  3CI6 A;  3HJK A;  3HL9 A;  2DCF A;  1LL9 A;  3GEC A;  2K2N A;  2PBY A;  4WEL A;  4JPM A;  5HD5 A;  4OP8 A;  4KZ3 A;  3A3F A;  3OZH A;  2XGN A;  3PXP A;  4X55 A;  1YKD A;  5HSQ A;  2PR6 A;  3S1Y A;  4BL2 A;  2I72 A;  3C30 A;  3VE3 A;  4Y17 A;  1MY8 A;  3WWX A;  1G68 A;  4DDS A;  5EOO A;  3BFE A;  3C7U A;  1VQQ A;  2WYX A;  2XK1 A;  1DJA A;  1TVF A;  2B95 A;  2WKE A;  2Z6C A;  3OLO A;  3OPP A;  3MMH A;  4FTX A;  1T18 A;  3VMA A;  4JBF A;  2VV7 A;  3EGX C;  3PBQ A;  3F1N A;  3MQO A;  5HAQ A;  2CMN A;  3VP0 A;  3WS4 A;  2WKI A;  5DF7 A;  2RCX A;  4S2M A;  2XH9 A;  4Y2F A;  4HJ6 A;  1N4O A;  1YPR A;  4U0X A;  3JYI A;  4OQG A;  2VV6 A;  1ZG6 A;  5HPI A;  1S1Z A;  3EWK A;  4C75 A;  1VET B;  3MKE A;  3BJN A;  4YFM A;  2V1B A;  2QJ5 A;  4GS9 A;  3GVB A;  4OP5 A;  3UB8 A;  3CG5 A;  3HCY A;  1H0M A;  4OPQ A;  3UE6 A;  3R4K A;  2V0W A;  1LT0 A;  3ZVT A;  2QYB A;  5GLB A;  4ID4 A;  5FQQ A;  3D3O A;  1SKO A;  4X25 A;  3BQA A;  1K4E A;  2G2U A;  4MBH A;  4KUK A;  4DKI A;  4EBL A;  2VGJ A;  4L9E A;  2ZLY A;  1GSW A;  1OTE A;  4Q0H A;  1N9B A;  5LBR A;  2PRF A;  4IVK A;  4Y7P A;  4DRT A;  1J9M A;  3RJU A;  2AVX A;  5TR7 A;  1ERQ A;  5EV0 A;  2P9V A;  5EE8 A;  5C5K A;  4KZ5 A;  4PHT A;  2P08 A;  4GKU A;  3HLC A;  3Q1F A;  1OME A;  3V50 A;  1HLU P;  4HH2 A;  3V3R A;  3ZVW A;  2Y2M A;  4BMW A;  3T4T A;  3LGO A;  5A8B A;  2J3W A;  3EOI A;  3HLW A;  3BM6 A;  1NWZ A;  3BLM A;  3A3E A;  3H82 A;  1HD8 A;  1ZG4 A;  3QNC A;  4S2K A;  2GZA A;  4KQD A;  4LRY C;  1GA0 A;  5GLD A;  5CEC A;  2ZJ9 A;  2Y4A A;  4F94 A;  1ES5 A;  5FAO A;  2XF3 A;  3ZGA B;  1MXO A;  2Y2O A;  2XSS A;  4PPR A;  4RYE A;  1XFN A;  3FKW A;  4NXB A;  1SKF A;  3IBJ A;  5EM0 A;  4WBG A;  1YLW A;  2BLS A;  5FDH A;  3T1X A;  4JXV A;  4OKP A;  1T1A A;  2HPB A;  1ZC2 A;  1NY0 A;  5KMW A;  3C8C A;  4D60 A;  5CX7 A;  5AQA A;  3VOZ A;  1XA7 A;  3UME A;  5CGS A;  1K25 A;  3ULF A;  3A3I A;  5EUA A;  3G4P A;  1FOF A;  3CLO A;  3Q7V A;  2RL3 A;  2P9V B;  1L0G A;  2Y2J A;  1P0Z A;  1W8Y A;  4IVI A;  2DNS A;  1GCE A;  1CEG A;  3ITA A;  3CJM A;  2D02 A;  2KX6 A;  3BQ8 A;  4HJ3 A;  1H8Y A;  4L9F A;  2EWW A;  1OTD A;  1I2S A;  4GHI A;  4I38 A;  1L0D A;  1G6A A;  3PR6 A;  4E6W A;  1PFL A;  3FPW A;  4GJ4 A;  4R3B A;  4G3V A;  1VB6 A;  4OPR A;  3UE3 A;  4HES A;  1KGE A;  2OLV A;  5FAS A;  3NBL A;  3ZG5 A;  3LFV A;  4N9K A;  3OPR A;  2KOI A;  4JGR A;  2PBD P;  4EXO A;  5FA7 A;  1NLY A;  3UDI A;  1LSW A;  3IT9 A;  1PW8 A;  3ZG8 B;  1G6O A;  3FWL A;  1WE4 A;  3IWQ A;  4PMA A;  3C4O A;  2O9C A;  5HD3 A;  5GHZ A;  3D9Y A;  5CTM A;  3LR0 A;  1XX2 A;  1OTI A;  3FPV A;  4R3J A;  3Q7V B;  2W0N A;  3HLE A;  2UV0 E;  1WYB A;  2ZC4 B;  4Z9Q A;  4DF6 A;  3PHY A;  4LLO B;  2ZMA A;  2ZOI A;  2VLG A;  4BBV A;  2OSU A;  2Y2I A;  1JTG A;  5DFX A;  4KQR A;  5JYO A;  4DE1 A;  4OLG A;  3CIT A;  3LIE A;  2ZM0 A;  5CTN A;  2DRW A;  4LRZ E;  5CHU A;  5DTT A;  4HP9 A;  3AGE A;  1QMF A;  2W27 A;  5FEF A;  3ZQ5 A;  4UA6 A;  5FSR A;  3NC8 A;  4L0L A;  4MBF A;  5DFY A;  2WZZ A;  3KSH A;  4I3I A;  3WS5 A;  2WGI A;  4OPZ A;  1GHI A;  2L4R A;  2A2L A;  2R9W A;  3T4Q A;  5EVE A;  5G4Z A;  2M1C A;  1RGZ A;  2J9O A;  3IHB A;  5FL3 A;  3ZYT A;  3DWK A;  4X53 A;  4R23 A;  3LIF A;  3TSG A;  1I5Q A;  2X01 A;  1A0K A;  4B4X A;  4LEN A;  4WMC D;  2V20 A;  3WS0 A;  2JBF A;  4I5S A;  5JYP A;  1VM1 A;  3G30 A;  1NYY A;  3UB9 A;  3SOI A;  3IF6 B;  4XUZ A;  1TS7 A;  5E2F A;  3T1R A;  1K6R A;  4PM7 A;  1O7E A;  4LPZ A;  4M4X A;  3RFB A;  3T12 B;  1U60 A;  1ZKJ A;  2BTF P;  3F1O B;  3IWO A;  4S2L A;  3BWL A;  3PBS A;  3VP2 A;  3DTK A;  4IBR A;  4KQQ A;  4ETX A;  1BYW A;  2J9P A;  1BUE A;  3UB6 A;  1XA1 A;  3KSG A;  4BL3 A;  1TD5 A;  5L10 A;  4MN7 A;  1IYQ A;  4RQ9 A;  1H3Q A;  3R7W B;  4MLL A;  4EEU A;  1MWU A;  3IX8 A;  3VV4 A;  1DP9 A;  4KQO A;  4F3L B;  4EES A;  2KLI A;  3HJI A;  5KSH A;  4E3N A;  4IJG A;  5E2H A;  4CLC A;  2J7V A;  3QP8 A;  4S2I A;  2HDS A;  3UY6 A;  3KO6 A;  1KOU A;  2G2W A;  5DVA A;  1K4F A;  4O01 A;  2WAF A;  3T1Q B;  3NDE A;  1TF1 A;  2HJE A;  4LV0 A;  2HF6 A;  5A93 A;  3MF0 A;  2XFT A;  5HFO A;  2HP5 A;  2V1Z A;  4BBU A;  4X1L A;  4E3K A;  4I3J A;  2B18 A;  3MR0 A;  5HDD A;  4QY6 A;  2QWS A;  4G3W A;  3LEZ A;  4NET A;  3UE1 A;  3M2K A;  3FKV A;  5HWT A;  2EFU A;  1QME A;  3WRZ A;  2R9X A;  4RX3 A;  2ACG A;  2H10 A;  4KZB A;  1XKZ A;  2IWB A;  1FR1 A;  2A24 A;  3IX4 A;  1JTD A;  2V0U A;  2VV8 A;  1O07 A;  4ZJ1 A;  4HHD A;  5EFW A;  2XRN A;  4KZA A;  2V2F F;  4ZJ3 A;  1SDN A;  3SH8 A;  3QHY A;  1JWV A;  3DTE A;  5M1A A;  5EOE A;  1S66 L;  1UGU A;  5CER A;  1BLS A;  5DKK A;  3ZG9 B;  1I2W A;  5G18 A;  2P04 A;  3H9W A;  3O3V A;  3GTC A;  4R38 A;  3HLD A;  1N9O A;  1F2K A;  4B93 A;  2FZ0 A;  5HL6 A;  3I7J A;  5CEB A;  4RX2 A;  5EEC A;  4FCF A;  1P9R A;  3Q82 A;  5J4E A;  2PT7 A;  4JXS A;  5FI6 A;  3P01 A;  1ONG A;  3TW8 A;  1ES4 A;  3IS2 B;  4P0M A;  2YKF A;  1DP8 A;  4MN5 A;  5HAP A;  4XT2 A;  1RP5 A;  2EFX A;  2W3D A;  3UB5 P;  2Q9N A;  2PYR A;  4WN5 A;  4UA9 A;  4P6B A;  3ZG7 B;  2HDU A;  1XFQ A;  4R6L A;  2X02 A;  4S2O A;  2VA0 A;  3KYE A;  3DTM A;  4S2N C;  4OOL A;  3MBZ A;  3E4Q A;  1KDW A;  4KEN B;  2WKR A;  1JVJ A;  4C3Q A;  4GOG A;  1XJ3 A;  2ZBB A;  1NRF A;  3LO7 A;  1ERM A;  3PBN A;  3IX3 A;  4FH2 A;  2Z2M B;  1MKM A;  3VOY A;  2LB5 A;  3E98 A;  1XJ6 A;  1MWS A;  3N6I A;  4GDN A;  2WKH A;  1D1J A;  3HLG A;  1D06 A;  2C6W B;  3V39 A;  3MXQ A;  1TS8 A;  4U0T A;  1YMS A;  3ZG0 A;  1IOU A;  4CLC C;  4WMC A;  2XLN A;  4HH3 A;  3BEB A;  3W4O A;  4P6Z M;  3NHQ A;  2J3T C;  5AQB A;  1LI9 A;  3NOP C;  4X69 A;  5L2F A;  2W1T A;  5HAR A;  3UDF A;  5FAQ A;  3FG8 A;  3V5M A;  3EQU A;  2Z6D A;  3SS5 A;  3QP6 A;  4D2O A;  3IXH A;  2ZMV A;  5HAI A;  4UA7 A;  5FEG A;  3TJZ C;  3MS6 A;  3QP1 A;  5E43 A;  2ZQ7 A;  1IEM A;  4QU3 A;  1CQA A;  3HBR A;  4OOM A;  2EX2 A;  3G35 A;  1YQS A;  1PYY A;  4YNR A;  1EW0 A;  3O5Y A;  3C5A A;  3C38 A;  3VSL A;  4KUO A;  1LHY A;  4I3A A;  1NYM A;  4B88 A;  1RCJ A;  2Q9M A;  3M2J A;  3SS3 A;  3HLF A;  1CEF A;  3BW6 A;  2HV1 A;  1OJ5 A;  1TEM A;  1UWP X;  1NZU A;  3W8K A;  2E8I A;  1YSP A;  3E2K A;  3V3S A;  1V9Y A;  3MKF A;  4EWF A;  4JGO A;  4Y5F A;  1E4D A;  3L9K A;  4NKP A;  2O9A A;  1T1B A;  3HVF A;  5CXW A;  1LSX A;  1PI5 A;  3F1N B;  4N9L A;  1AXB A;  3OCL A;  2I9V A;  4BBT A;  1OT6 A;  3UB7 A;  1K6S A;  1XPB A;  4R4S A;  3BFF A;  1SDE A;  4MNR A;  3ZCZ A;  3N4I A;  3N8R A;  2Y2Q A;  3LR4 A;  4FSF A;  3NDG A;  4P6Z S;  4GS9 B;  3FYZ A;  4HEF A;  2Y79 A;  3T4L A;  1BUL A;  1MWR A;  4CQH A;  1LSV A;  4K0X A;  2IWD A;  1LL5 A;  3MFD A;  3H7W A;  1GA9 A;  1VEU A;  3N8S A;  3KX0 X;  4EEP A;  3KSF A;  4S2P A;  3OPL A;  3OCN A;  4WZ5 A;  1XJ2 A;  4HOI A;  1M6K A;  2HP6 A;  5F1G A;  2VGL M;  1SKO B;  3BFD A;  4QWO A;  4G3K A;  4CLC D;  4K08 A;  4HP4 A;  5A90 A;  2J3T D;  3B47 A;  3WRT A;  2Y2L A;  2OWJ A;  5I94 A;  1H5X A;  4GCZ A;  5A92 A;  4IHQ A;  2H5S A;  2PDR A;  3VOL A;  4HBT A;  5M18 A;  4QPR A;  2XR0 A;  1PW1 A;  2BAS A;  4DE3 A;  5E2G A;  5J8X A;  1FIK A;  2V1A A;  3NUL A;  2IWC A;  4EU0 A;  4NXF A;  2OAQ 1;  3BFG A;  2GX5 A;  4DE2 A;  4NXG A;  3A3J A;  1PWC A;  1EI5 A;  4GLQ A;  3E2L A;  3NI9 A;  3P7N A;  4K0W A;  1STZ A;  4LV3 A;  1K54 A;  2LB9 A;  2JC7 A;  3H82 B;  1KE4 A;  4YOF A;  4E04 A;  1V9Z A;  3H7W B;  4HY8 A;  5F6A A;  4KG5 A;  1P97 A;  3LIC A;  1TS0 A;  1OJG A;  3K2N A;  1Q2P A;  4JF5 A;  5DTK A;  5CRF A;  4WL9 A;  1Y54 A;  2Z2L B;  4IUK A;  4LV1 A;  5F68 A;  5EVL A;  3SZT A;  3EEH A;  3MXS A;  2G7U A;  2PU2 A;  4Y0U A;  3QP5 A;  1IYP A;  4EBP A;  1ONH A;  2ZOH A;  3ISG A;  1F98 A;  5DJU A;  4P87 A;  2VGL S;  3PTE A;  3G31 A;  3CZD A;  1OTB A;  2QHK A;  3UDX A;  1FCM A;  3S22 A;  3W2Z A;  4IED A;  3RXX A;  2PAV P;  1G28 A;  4JGQ A;  5HPF A;  2M7V A;  3SH9 A;  4O8G A;  1YT4 A; 
#chains in the Genus database with same CATH homology
 2JHE A;  1OT9 A;  1NLZ A;  2O99 A;  2K7S A;  4GHI B;  1Y28 A;  4BBU A;  5HWW A;  4I3J A;  1X0O A;  2GNX A;  2B18 A;  2Z6C A;  3MR0 A;  3OLO A;  5HDD A;  2QWS A;  4G3W A;  3MMH A;  5HDC A;  5HWT A;  4MN6 A;  1LL8 A;  4Z1W A;  4EUV A;  2WKQ A;  2OOL A;  2QJ7 A;  3C2W A;  4HIA A;  1T18 A;  2VV7 A;  3EGX C;  5AJG A;  3PBQ A;  3F1N A;  3MQO A;  1TS6 A;  2W3H A;  3FC7 A;  5DJT A;  3PBT A;  2CMN A;  2HJ9 C;  2A24 A;  4II7 A;  3LYX A;  1P9W A;  5TBM A;  2V0U A;  2VV8 A;  4Y2F A;  2ZMF A;  4HHD A;  4ARZ A;  4HJ6 A;  3RTY A;  5MC7 A;  5EFW A;  2NUP C;  2XRN A;  4WEK A;  2VV6 A;  2O0Y A;  5DF9 A;  1S1Z A;  3EWK A;  3T4S A;  5HPI A;  2VEA A;  4HNB A;  3BJN A;  2V1B A;  2D01 A;  2QJ5 A;  4GS9 A;  4HQA A;  2PD7 A;  4WF0 A;  1S66 L;  1UGU A;  1S1Y A;  3CUE A;  3UB8 A;  3NJA A;  5DKK A;  2P04 A;  2VX8 A;  3H9W A;  4R38 A;  1IFQ A;  5K5B A;  4NEE D;  3HCY A;  1YAX A;  1WA9 A;  1D7E A;  4MDZ A;  3KSI A;  4UQI M;  3UE6 A;  1N9O A;  2V0W A;  3R4K A;  4B93 A;  1LT0 A;  3NOU C;  2FZ0 A;  4GW9 A;  1GSV A;  5HL6 A;  5HWV A;  2QYB A;  2L0W A;  3D3O A;  2OWH A;  4Y3I A;  5F69 A;  3BQA A;  2J80 A;  4PKY A;  3GDI A;  1P9R A;  4KUK A;  5J4E A;  4O0P A;  5IT5 A;  2PT7 A;  4L9E A;  1GSW A;  2PYP A;  3P01 A;  2B02 A;  2VJW A;  1OTE A;  3SW1 A;  3TW8 A;  2R78 A;  4Q0H A;  3F1P A;  3IS2 B;  2YKF A;  1DP8 A;  4MN5 A;  5LBR A;  4XT2 A;  3LIB A;  1W63 M;  2W3D A;  1W63 Q;  2PYR A;  4WN5 A;  3ICY A;  4DJ3 A;  3OBF A;  2PHY A;  4BWI A;  3JVU A;  1XFQ A;  4R6L A;  1N9N A;  5C5K A;  4PHT A;  2P08 A;  3LID A;  2VA0 A;  3TRC A;  4HH2 A;  4EQ1 A;  1ODV A;  3T4K A;  4OOL A;  3LI8 A;  5TBM B;  2W3E A;  4BMW A;  3OC2 A;  3EGD C;  5AVF A;  3T4T A;  3E4Q A;  3CWF A;  2WKR A;  4ARZ B;  3B33 A;  2HGV A;  1XJ3 A;  5A8B A;  2ZBB A;  2EA9 A;  2J3W A;  3EOI A;  2K31 A;  3LUQ A;  2L1M A;  3PBN A;  2EWV A;  1NWZ A;  1MKM A;  2GJ3 A;  2LB5 A;  2MJ6 A;  3E98 A;  4MMN A;  4Q0I A;  1XJ6 A;  3H82 A;  4HI4 A;  3F1O A;  5KIZ A;  2GZA A;  1D06 A;  4KQD A;  2M7U A;  4LRY C;  3MXQ A;  1TS8 A;  3S7O A;  2XA7 M;  2JKR I;  1IOU A;  4CLC C;  5IS1 A;  2XSS A;  4HH3 A;  1XFN A;  4P6Z M;  3NHQ A;  2J3T C;  3DBA A;  4H6J A;  3NOP C;  4NXB A;  3R7W A;  4EER A;  3IBJ A;  2W1T A;  5HDS A;  3FG8 A;  4F3L A;  1T1A A;  4UQI S;  3EQU A;  2Z6D A;  4Q0J A;  3C8C A;  5CX7 A;  3A0R A;  1YSQ A;  1GSX A;  3UME A;  2ZMV A;  1S4S A;  3K3D A;  3TJZ C;  3ULF A;  3CLO A;  2VZW A;  5J3W A;  4OOM A;  1ZHH B;  3JVV A;  3KYZ A;  1P0Z A;  1F9I A;  4YNR A;  3S7Q A;  1N9L A;  4CLC B;  5F5Y A;  1EW0 A;  2D02 A;  4NXE A;  3O5Y A;  2KX6 A;  4R3A A;  4DN0 A;  3BQ8 A;  4HJ3 A;  4L9G A;  4L9F A;  2EWW A;  3C38 A;  5L8M A;  4KUO A;  1OTD A;  4GHI A;  4I3A A;  4I38 A;  4ZRR A;  4IUH A;  3PR6 A;  4ETZ A;  3E4P A;  4CLC E;  3MQQ A;  3BW6 A;  4WLA A;  3FPW A;  4GJ4 A;  3CAX A;  3NOT C;  4G3V A;  3EEA A;  2HV1 A;  1OJ5 A;  3KYQ A;  5IU1 A;  1UWP X;  1VB6 A;  1YSP A;  3UE3 A;  2IA2 A;  3PBO A;  3E4O A;  3K3C A;  1V9Y A;  3CUE C;  4JGO A;  4Y5F A;  3UMD A;  4NKP A;  2YKH A;  2O9A A;  1T1B A;  4DJ2 A;  3LFV A;  1LSX A;  2KOI A;  4JGR A;  3F1N B;  2OAP 1;  4EXO A;  1NRJ A;  1NLY A;  2INW A;  3OCL A;  3MJQ A;  1LSW A;  2I9V A;  2A24 B;  3D72 A;  2H28 A;  4BBT A;  1OT6 A;  3UB7 A;  2W1R A;  2V9A A;  1G6O A;  2P7J A;  3BY8 A;  2JKR M;  3B42 A;  3T4O A;  2O9C A;  5I5L A;  5HD3 A;  1DRM A;  2XA7 S;  3LR4 A;  4FSF A;  3VE4 A;  3LR0 A;  2VKS A;  4P6Z S;  4GS9 B;  4B9O A;  2W3F A;  2KDK A;  2Y79 A;  3T4L A;  4CQH A;  1LSV A;  1OTI A;  2DMW A;  2O9B A;  3FPV A;  4ME4 A;  1XJ4 A;  2W0N A;  5HZH A;  1F5M A;  3H7W A;  1ZTU A;  3LI9 A;  3PHY A;  4LLO B;  3KX0 X;  4EEP A;  1OTA A;  3KSF A;  2ZOI A;  2VLG A;  4YWZ A;  3OCN A;  4BBV A;  1DP6 A;  1XJ2 A;  3TE8 A;  4HOI A;  5DFX A;  2VGL M;  4G3K A;  3CIT A;  3LIE A;  4CLC D;  2PR5 A;  4K08 A;  3IS2 A;  4HP4 A;  5TJJ A;  4LRZ E;  2J3T D;  3A0V A;  4HP9 A;  4AFI A;  3B47 A;  2W27 A;  2Y8H A;  5G4Y A;  3ZQ5 A;  2JN7 A;  2QKP A;  2XRO A;  2OWJ A;  4FOF A;  4L0L A;  1T1C A;  4PKY G;  4GCZ A;  3IBR A;  3F1P B;  5DFY A;  3KSH A;  3EQV A;  4I3I A;  4XT2 B;  3PYP A;  4IHQ A;  2PDR A;  3VOL A;  4I39 A;  3U2A A;  4QPR A;  2L4R A;  2A2L A;  1S4R A;  1MC0 A;  3T4Q A;  4DMZ A;  1UWN X;  4EW7 A;  2BAS A;  2W3G A;  5AVE A;  4LRX C;  5G4Z A;  2M1C A;  5FL3 A;  2V1A A;  3ZYT A;  4EU0 A;  3T50 A;  2NUT C;  2FH5 A;  3LIF A;  1MZU A;  2OAQ 1;  4NXF A;  3S7N A;  3T4J A;  2GX5 A;  4NXG A;  1VHM A;  4I5S A;  3V67 A;  4GLQ A;  2PD8 A;  3P7N A;  1STZ A;  1T19 A;  3UB9 A;  4WEJ A;  2LB9 A;  1TS7 A;  1JNU A;  5DKL A;  3LR5 A;  3H82 B;  4LPZ A;  3A0S A;  4M4X A;  3RFB A;  4YOF A;  4E04 A;  1V9Z A;  3F1O B;  3H7W B;  4HY8 A;  5F6A A;  5J7E A;  1P97 A;  3BWL A;  3LIC A;  1TS0 A;  3PBS A;  1OJG A;  3LR3 A;  4UEY A;  4BJP A;  4ETX A;  1BYW A;  3K2N A;  4R70 A;  4PAU A;  4JGP A;  3UB6 A;  4WL9 A;  3KSG A;  1TD5 A;  2JKT M;  3S7P A;  1S67 L;  4IUK A;  3E0Y A;  4H6J B;  4MN7 A;  4RQ9 A;  1H3Q A;  5F68 A;  3R7W B;  3G6O A;  3BY9 A;  2W1T B;  4EEU A;  3CI6 A;  3EEH A;  3HJK A;  3VV4 A;  1DP9 A;  2G7U A;  3LIA A;  4KQO A;  4F3L B;  3MFX A;  3OOV A;  3GEC A;  2K2N A;  4EES A;  1OPX A;  2KLI A;  4WEL A;  2ZOH A;  3HJI A;  5HD5 A;  1F98 A;  5KSH A;  5DJU A;  4IJG A;  2VGL S;  3PXP A;  4EET B;  1YKD A;  5HSQ A;  2PR6 A;  4CLC A;  3PBR A;  1OTB A;  3MQ0 A;  2QHK A;  3KO6 A;  1KOU A;  3W2Z A;  3C30 A;  4MCW A;  2WKP A;  3VE3 A;  4O01 A;  4HJ4 A;  2JKT I;  1H8M A;  1G28 A;  4WUJ A;  1TF1 A;  2HJE A;  4JGQ A;  5HPF A;  2HF6 A;  2M7V A;  4O8G A;  3RH8 B;  3MF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...