4HP4A

Crystal structure of pas domain from the fruit-fly elk potassium channel
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
123
structure length
112
Chain Sequence
NTFLDTIATRFDGTHSNFVLGNAQANGNPIVYCSDGFVDLTGYSRAQIMQGCSCHFLYGPDTEEHQQIESLSNMELLEVIFYEGAPFWCLFDIVPINERDVVLFLASHDITH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Eag-like K[+] channel
publication title Structural properties of PAS domains from the KCNH potassium channels
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 26
structure length 112
sequence length 123
chains with identical sequence B
ec nomenclature ec 2.7.3.-:
pdb deposition date 2012-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hp4A00
4EESA 1UWNX 3B33A 1T18A 3C8CA 4RQ9A 1GSWA 3A0VA 4HH3A 2V0WA 3ZQ5A 2VV6A 3E4QA 3F1NB 1DRMA 3NOTC 5F6AA 3EEHA 3F1NA 4LRXC 4I39A 3NOUC 1P0ZA 4BBTA 4GHIB 4PKYA 1T1AA 2P7JA 1VB6A 2W0NA 1TS0A 1LL8A 2QWSA 4GHIA 4HJ6A 2KDKA 4KUOA 3NOPC 1MZUA 1OTIA 3C2WA 4I5SA 4HJ3A 4I38A 1XFNA 1S4SA 4NXGA 3LUQA 4DJ3A 4DJ2A 4PKYG 4JGPA 4NXBA 3K3CA 2H28A 4HOIA 1OTDA 2A24B 1D7EA 2PYRA 3ICYA 4HNBA 2VV7A 5J3WA 3PHYA 2A24A 4MN5A 4R70A 3UMDA 4R3AA 2K7SA 4GW9A 5IU1A 3UB9A 1XFQA 3F1OB 3VE4A 2PDRA 3LI8A 1S67L 3F1OA 2ZOIA 4EXOA 3UB8A 1TS8A 2L4RA 5G4YA 2PHYA 3H7WB 1OJGA 3UMEA 4EERA 2PD7A 2YKHA 3MFXA 3H7WA 4M4XA 5J7EA 2WKRA 3BWLA 3FC7A 4EETB 5TBMB 4I3AA 2HV1A 2WKPA 3T50A 5DKLA 2VLGA 3VOLA 3K3DA 5TBMA 1OT6A 1GSXA 4L9GA 4NXEA 5EFWA 4H6JB 2ZOHA 4LPZA 4GS9B 4GS9A 1XJ4A 3ULFA 3CLOA 3LIAA 4R38A 2OWJA 1N9OA 2B02A 1OJ5A 3P7NA 3BY8A 2OOLA 4WUJA 3E4PA 3RH8B 3MJQA 1WA9A 3A0SA 2PD8A 1S66L 4EEPA 3NJAA 2ZBBA 5A8BA 5DJUA 1S1YA 1P97A 5AVEA 4HH2A 5DJTA 2JN7A 4HI4A 4HY8A 4R6LA 5HSQA 1T1BA 1DP8A 5HD5A 4B9OA 2L0WA 2D02A 2EA9A 4EW7A 3RTYA 4HHDA 3NHQA 2QHKA 1V9ZA 1XJ6A 1X0OA 1OTAA 3CAXA 4LRYC 5F5YA 4HP9A 2BASA 4EEUA 1Y28A 1OTBA 5HWVA 1S1ZA 3UB6A 4KQDA 2V9AA 2PR6A 2Z6DA 3HJIA 1V9YA 3KX0X 5AVFA 1KOUA 3D72A 2GJ3A 3MQOA 1UWPX 2KX6A 5HWTA 2J80A 4WLAA 4I3JA 4BBUA 5IS1A 3E4OA 3UE6A 3SW1A 1XJ2A 5I5LA 5HZHA 4WF0A 2M1CA 2QKPA 3F1PB 1S4RA 1LSWA 5F68A 3F1PA 2I9VA 4BBVA 5HDCA 4JGQA 1JNUA 4H6JA 3H82B 2W27A 4EQ1A 4JGRA 1ODVA 3LIDA 3H82A 4L9FA 1UGUA 3GECA 1TS6A 2PR5A 1GSVA 3A0RA 4HQAA 2PYPA 4YWZA 4I3IA 1T19A 3GDIA 1D06A 1NWZA 1LSXA 1BYWA 2YKFA 3LIEA 4JGOA 1LSVA 1LT0A 3OLOA 5HDDA 2R78A 1DP9A 5J4EA 2V1BA 2QJ7A 4L9EA 3G6OA 4HJ4A 4WL9A 5KIZA 3FG8A 4K08A 3UB7A 3LICA 2VV8A 3LIFA 4E04A 1N9LA 3IBRA 2INWA 4LRZE 1F98A 5G4ZA 3VE3A 3LYXA 5HWWA 2OWHA 1DP6A 2Z6CA 2CMNA 3LIBA 2QJ5A 4HIAA 1TS7A 4F3LB 3LI9A 4HP4A 4GCZA 5DKKA 4F3LA 4NXFA 2L1MA 1N9NA 3H9WA 3MXQA 2V1AA 3MR0A 3HJKA 3BY9A 2VEAA 1OTEA 3IS2B 4MN6A 2WKQA 1G28A 4KUKA 1F9IA 1T1CA 2V0UA 2JHEA 3IS2A 1XJ3A 3EWKA 5HD3A 4XT2B 4WN5A 5F69A 4XT2A 1OT9A 3CWFA 5HDSA 3PYPA 4LLOB 2D01A 1EW0A 3MQQA
chains in the Genus database with same CATH superfamily
3C4OA 4O8GA 2ACGA 1I2WA 1UWNX 4RA7A 1P9WA 1BLCA 2Y91A 4KG2A 3PAEA 2M7UA 1T18A 4OQHA 1FCOA 1SHVA 2V1ZA 2VV6A 1YLZA 2VGJA 4HBUA 4X25A 4Y2FA 2DNSA 4I39A 1KGFA 4BBTA 1XA1A 4KQQA 2P7JA 4RX2A 3WWXA 4GHIA 2FFYA 5L07A 2KDKA 5EECA 1D1JA 3TG9A 1OTIA 3UN7A 2BTFP 3IWIA 4HJ3A 4I38A 4ARZA 1S4SA 3ISGA 3CPTA 2JKTI 1Z09A 1GA0A 3K3CA 4EBPA 2H28A 4KQRA 2ZQAA 4QY6A 3DW0A 2OAP1 5KZHA 2C5WB 5CGSA 2PYRA 4CLCB 2CC1A 3ICYA 3MS6A 3PHYA 2A24A 1G6AA 4Q0JA 2K7SA 4Y17A 1NRFA 4O7DA 3EQUA 3O86A 1KVLA 1XFQA 3VFHA 3E2LA 4II7A 4MDZA 3E0YA 2MJ6A 2L4RA 4YFMA 3B47A 1EI5A 3KO6A 3JVUA 4HBTA 2J3WA 4M4XA 3WS5A 5J7EA 1MKMA 4Z9QA 3MQ0A 2EXBA 3ZG9B 3V39A 5AQAA 1ESIA 1XX2A 2HV1A 5EE8A 4QHCA 3HLFA 4LV0A 4R3JA 5DKLA 2VLGA 2HDUA 3SS3A 1FIKA 1L0GA 5TBMA 3DTEA 4ME4A 1W8YA 1K57C 3N7WA 3PTEA 4P87A 5EFWA 5CXWA 3SZTA 3O88A 4K0WA 3G34A 1YKDA 4Y0TA 4UEYA 3OPPA 5U47A 2W1TB 4E3IA 4Y13A 4EBNA 2JKGA 4KZ6A 3ULFA 2E8IA 3LO7A 2OWJA 3DWKA 1YSPA 1GHPA 3VP1A 2OOLA 4Y15A 3IF6A 3RH8B 2KOIA 1WA9A 1ERQA 5F83A 3NJAA 1P97A 1K25A 3CITA 5AVEA 4YINA 5C5KA 2ZMVA 3MZEA 2PAVP 1MWRA 1G5UA 1H8MA 4ZTKA 4CLCC 3PBRA 4C3QA 1DP8A 3QNBA 5EVLA 2O0YA 2D02A 3C38A 2B18A 4UA7A 5GLCA 1BLPA 1TDGA 4WMCD 3RTYA 2JCHA 4HHDA 2XGNA 2QHKA 4LGWA 3BFGA 1X0OA 5EVID 3GSGA 1Y28A 1OTBA 1MBLA 2EFXA 4Q0IA 3HJIA 1F5MA 1V9YA 1K55A 3D72A 3G31A 1HLUP 4E6XA 1UWPX 3T4QA 4WZ5C 5HWTA 4XXRA 4WLAA 5HW3A 1ALQA 3PXPA 2Y2LA 5FSRA 1VETA 3E4OA 1DJAA 3R4KA 5GL9A 3UE6A 3SW1A 3RXWA 3T4SA 2J3TC 3L7HA 4JF4A 5DFXA 4ZRRA 3MFDA 2FFFB 1YLJA 1MC0A 1H5XA 1S4RA 1YQSA 4FH4A 1JTDA 3F1PA 2I9VA 4KENB 1PZPA 2Q0OA 5CHJA 1JNUA 4H6JA 4DXCA 3H82B 1NLYA 4B88A 5FAPA 2HP9A 2Q9MA 4JGRA 1UGUA 3G4PA 3GR2A 3FV7A 5TFQA 4WMCA 1IYQA 3ZNYA 4Y0UA 3C5AA 2WGWA 2ZL1B 5HAPA 1T19A 4N1XA 2Y79A 3FKWA 5EOOA 4U0TA 5EVIA 3GDIA 1NWZA 4KZ4A 1CEGA 1I2SA 1BYWA 2Y2PA 3G32A 3S22A 4PMAA 3VSKA 2EWVA 3OCNA 4GD8A 1HZOA 2O9BA 2VJWA 3NULA 5J4EA 4MMNA 2OLUA 2R9WA 5BOHA 3GRJA 5M19A 3LEZA 4E3MA 1PIOA 1LI9A 3MKEA 4GLQA 1Q2PA 2A2LA 2XDMA 4E04A 3IBRA 4LCMA 3FWLA 3ZYTA 5FASA 4UQIS 1PWDA 1JTGA 2Y2MA 2ZC3B 1VEUA 3NIAA 4OOLA 1H0MA 3LIBA 1YMSA 5KSHA 5FL3A 2WGVA 4DDSA 5FAQA 3BECA 1PI5A 2HDSA 5DKKA 2ZMAA 1LI0A 1SZVA 1YPRA 2WAFA 5FEFA 4FCFA 3MXQA 2V1AA 3MR0A 3CUEA 3HJKA 3VOZA 3D9YA 4P0MA 1G28A 3BEBA 2AVXA 2RCXA 1F9IA 3IXHA 3AGFA 1PZOA 3EWKA 3ZCZA 2Q9NA 3GQZA 4LV3A 5FI2A 2JC7A 3N8LA 2ZM2A 4U0XA 4FSFA 3N8SA 4XT2A 3CWFA 5HDSA 3UPNA 1FSWA 2D01A 5FDSA 4D60A 3G2YA 1XKZA 2FH5A 1XXMA 2XA7S 4RQ9A 4HH3A 1S6RA 1DRMA 3NOTC 1XGIA 2OSUA 2W3GA 5A91A 4ZJ1A 3Q7VA 3F1NA 3VFFA 1KDSA 4E3LA 1NZOA 4GDNA 3OZHA 3OOVA 4PKYA 1LHYA 1T1AA 3UE0A 2PRFA 4Y0OA 1TS0A 2QWSA 1MZUA 3IH8A 4MCWA 3Q81A 4I5SA 4PM7A 3HVFA 5KSCA 3BFCA 3M6BA 4GKUA 1G68A 4DJ3A 2EX8A 5EPHA 1ZKJA 2XEPA 3S4XA 3QP6A 4NG2A 4KZ3A 1KGGA 2DCFA 3A3IA 4GD6A 4QB8A 2VV7A 5DF9A 5J3WA 1L0EA 4MBFA 2W1RA 1RCJA 1VHMA 1K56D 4QU3A 1CI9A 4O0PA 4GN2A 4B4ZA 2ZQ9A 4HESA 2G2WA 2VZWA 3A3EA 4CPKA 1GA9A 5IU1A 3G35A 2P9VB 1E4DA 1ONGA 4IEDA 1S67L 5K5BA 2WKIA 4OQIA 5FA7A 3F1OA 1PRQA 3UDXA 4QWOA 1E25A 3UB8A 1TS8A 2PHYA 1WYCA 3CHWP 5AQBA 3UMEA 4DRTA 2OAQ1 2PD7A 1YSQA 4CJNA 4ESPA 4R4SA 1PW8A 5A92A 1K4EA 3H7WA 4N92A 2WKRA 1SDNA 4JF5A 2QPNA 4ZJ2A 2HGVA 3ZVTA 2WKPA 4KZBA 3T50A 2X01A 2ZQ7A 5DTKA 5CX7A 3LR3A 5EOEA 3SH7A 4H6JB 3BFFA 1CK3A 5FQJA 4IHQA 3SH8A 3MZFA 1RGYA 3NDGA 4JF6A 4GS9A 3T4JA 4WELA 4DE0A 3LCEA 3T12B 4R38A 2JBFA 5F82A 1OJ5A 1YLWA 1NLZA 4BL2A 1K56A 4WM9A 2HPBA 3FPWA 2OLVA 3WS2A 4JLFA 1JWPA 2EFUA 3HUOA 3IX3A 4EEPA 1S0WA 1S1YA 3OC2A 4EQIA 3Q82A 4JKTA 5GLBA 3S7OA 4HI4A 4HY8A 1DJBA 4EWFA 4S2NC 1BT5A 2JKTM 3UDFA 3GMWA 2G2UA 3KSHA 2X02A 3A3JA 4EW7A 4GJ4A 3S7NA 4KG5A 4PHTA 1PFLA 2EX6A 2ZJ9A 3ZHHA 2QZ6A 3CAXA 5F5YA 4ZDXA 2Y2NA 3IBJA 3HLCA 1S1ZA 5KMWA 3V50A 4UQIM 1PNEA 2PR6A 4NK3A 1IYPA 3KX0X 1KOUA 4Y5FA 2GDNA 3MBZA 5EV0A 4DKIA 1KGEA 4H8RA 3T4OA 5DTTA 1N9BA 4LV2A 2J80A 2UWXA 4BBUA 4DXBA 1K54C 3WS0A 3TW8A 1XJ2A 4WF0A 1YLPA 3JVVA 5GLAA 2W3HA 5GHXA 1LSWA 3BFEA 1F2KA 1GHIA 5F68A 3BM6A 5FDHA 5EM0A 4BENA 5HDCA 1TVFA 4JGQA 3CI6A 1IOUA 4NKPA 4GNUA 3VP4A 4EQ1A 4MEZA 1ODVA 2W3FA 3LIDA 3IWOA 3QP2A 1TF1A 2XD1A 3CG5A 2PR5A 3OPHA 2VA0A 2PYPA 3HLEA 2LB9A 4I3IA 2WZZA 1IEMA 3KYZA 2XA7M 1IKGA 1LSXA 3LIEA 1W5DA 1LSVA 5EUAA 5F1FA 1BULA 1IELA 3IF5A 1JVJA 5HDDA 1DP9A 1FILA 4AFIA 3CJMA 3AGEA 4L9EA 3R7WB 3QP1A 1AWIA 4BL3A 3BFDA 3HUNA 5FQKA 4WL9A 4IVKA 5TGFA 3IWQA 5JYPA 1WYBA 3P09A 1LL9A 4KQOA 3LIFA 1N9LA 1XP4A 4LCLA 1CJFA 2H0TA 1EWZA 1HTZA 3O87A 2JKFA 3ZG7B 1CEFA 1ES4A 2OWHA 3WRZA 4Q0HA 1DP6A 2CMNA 2BG1A 3D3OA 4OQGA 3PBOA 5EM1A 3QP5A 1TS7A 3CUEC 5G18A 3LI9A 4HP4A 4OKPA 4GCZA 4OVDA 1NY0A 4RVAA 5CGXA 1FCNA 5FQQA 4F3LA 2HP6A 2L1MA 4NXFA 3TSGA 2PU4A 2ZLYA 3H9WA 4X55A 4GB7A 2PBDP 1IKIA 1CQAA 2XH9A 5CERA 3MXSA 1ONHA 5J8XA 3UE3A 2V2FF 1SKOA 1ZHHB 4LFUA 5AQ9A 4Y7PA 2JE5A 4MN6A 3KSFA 3MMHA 2V8CA 3N4IA 5CGWA 3IS2A 1XJ3A 1FOFA 3ZG8B 3EEAA 5F69A 4CLCD 2NUPC 1OT9A 3NDEA 3LGOA 3A3DA 3N6IA 5FAOA 3MQQA 1CF0A 1GHMA 4R23A 3B33A 3CZDA 3HUMA 3Q1FA 3C8CA 2ZQ8A 4WBGA 3A0VA 3C7UA 2V0WA 3UB5P 2ZM0A 3E4QA 1W7FA 5F6AA 1PI4A 2VX8A 5FEGA 1U60A 2J8YA 1WE4A 4LRXC 2XQZA 3FYZA 4BJPA 5E2HA 1P0ZA 4GHIB 5CRFA 3VP0A 4S2KA 2W0NA 1LL8A 4HJ6A 2XFSA 4FUWA 1ES5A 2XF3A 5TJJA 3NOPC 3ZDJA 4ARZB 4E3JA 2HZ5A 3CPTB 1ES2A 3K2NA 3IH9A 2J3TD 1XFNA 1L2SA 5HFOA 4YOFA 3TE8A 5M18A 4JGPA 3P98A 1OTDA 2A24B 3BQAA 5E2FA 1D7EA 3LR4A 4G3KA 2OV5A 1K6SA 4OLGA 4JBFA 4X68A 4IUHA 1CI8A 1ES3A 1BUEA 4R70A 3UMDA 3HLGA 5JYOA 4CLCA 1KDWA 2H0YA 4R3AA 3BLMA 4OPRA 3T4TA 3NC8A 2K31A 4DE3A 4OOMA 4GW9A 2O99A 2FZ0A 1ACFA 4DMZA 1Q2QA 2Y59A 3V67A 3LI8A 1VM1A 3PBNA 5HL6A 4KZAA 5E43A 4EXOA 2QMIA 1H8ZA 4P85A 4N9LA 3EGDC 4EERA 3E2KA 2J7VA 4FD8A 3G30A 4GOGA 3IHAA 1RP5A 1H8YA 3FC7A 5TBMB 5A93A 2WYXA 1NYMA 4I3AA 2JKRI 3TOIA 1ZC2A 4WZ5A 3V3RA 1P9RA 4U3TA 3K3DA 2KLIA 1ZG6A 4IJGA 4JXGA 2JKRM 4NXEA 5FATA 4MBHA 2XR0A 3V5MA 1LL5A 3PBTA 2ZOHA 1MKIA 3SOIA 1L0DA 4X69A 1M6KA 3HLWA 3UNWA 1IYSA 1XJ4A 5L2FA 4X56A 2W1TA 3CLOA 4PM8A 3LIAA 4X1MA 3IF6B 1N9OA 2B02A 1K0KA 3P7NA 4ETZA 4ZBEA 4WUJA 2QYBA 3E4PA 3MJQA 4B93A 3ITAA 3EQVA 2VGKA 2PD8A 4JXSA 3O3VA 5A8BA 5DJUA 3UPOA 1PW1A 4HH2A 2P74A 5DJTA 1LLBA 4ETXA 4NETA 4WEKA 1QMFA 1ZG4A 4OQ0A 2HF6A 5HD5A 3HLBA 2Y2JA 3LFVA 2Y8HA 2WK0A 4DDYA 3U2AA 3W4QA 1G6OA 3NHQA 1OPXA 2K2NA 1V9ZA 1OTAA 4LRYC 3EOIA 2HJEA 4EEUA 2WKEA 1NXYA 4KG6A 4DF6A 2V9AA 4BQMA 4BLMA 3QP8A 4PM9A 4R4RA 3BJNA 4Y3IA 3IX4A 3M2JA 4IBRA 3SS4A 3MQOA 1ERMA 4QD4A 2KX6A 3CMZA 1FQGA 4DE1A 1VETB 4IBXA 4I3JA 1STZA 5IS1A 5FQMA 3VP3A 5I5LA 1BZAA 3NI9A 2QKPA 3F1PB 5HAIA 4MLLA 5GHZA 2VKSA 5IHVA 3KYQA 5DF7A 3TRCA 4S2MA 3B42A 3IF6C 2GNXA 4LENA 4L9FA 5FI7A 3H82A 1IFQA 2WGWB 2Y2HA 1TS6A 2ZC6B 4HQAA 4O01A 5EVIB 2XROA 2HP5A 2IWBA 1C3BA 1D06A 1FCMA 4JXWA 2ZL1A 1TDLA 2VK3A 2GZAA 3OLOA 3SH9A 1XA7A 4UAAA 5L8MA 2R78A 4S2PA 4FTXA 4FOFA 1PWCA 2V20A 5AQ7A 2V1BA 2WKHA 2XD5A 3G6OA 4BD1A 4HJ4A 2W3EA 4DN0A 5KIZA 3JPUA 5L10A 4EBLA 3UY6A 4Q8IA 5LBRA 3SS5A 2PBYA 4HEFA 3LICA 2VV8A 1K55C 4MNRA 3BQ8A 2INWA 1VEUB 4LRZE 3IXBA 2NUTC 3MXRA 5HWWA 2WZXA 5HL1A 4N1HA 2QJ5A 4IVIA 2HDQA 3W2ZA 1NYYA 3C30A 2Y4AA 2VGLS 4DE2A 1MPLA 4BWIA 3LY4A 1N9NA 4A5RA 4OPQA 3O5YA 1W63Q 3WS1A 3BY9A 3NBLA 2VEAA 4S2JA 4K0XA 4GZBA 2BLSA 1YAXA 4NEED 2ZMFA 5HAQA 3QHYA 1J9MA 2V0UA 5CEDA 1W8QA 4XT2B 3W8KA 1KE4A 4E3NA 2W3DA 1A0KA 2Y2KA 5EVIC 3UPPA 4JPMA 1EW0A 4UA9A 4EESA 5IT5A 2C6WB 3IHBA 1BTLA 4GDBA 3Q07A 3PBSA 1GSWA 3VMAA 3ZQ5A 4R1GA 3Q7VB 4OPZA 1GCEA 1K4FA 3F1NB 2ZQDA 4K91A 4FH2A 3EEHA 3UDIA 3OPLA 5FI6A 2PT7A 3ZFZA 2ZM8A 3NOUC 4QJGA 3BRMA 1PWGA 1K38A 3Q7ZA 2EX9A 1Y4OA 1XGJA 1VB6A 1FSYA 2ZC7A 1I5QA 3GTCA 4KUOA 3FPVA 4P6ZS 3RXXA 4EV4A 3C2WA 2J9PA 3W4OA 4ID4A 2ZQCA 1NJ4A 3GVBA 4NXGA 3LUQA 3LY3A 5F1GA 4N9KA 4DJ2A 2WADA 4PM6A 5DTSA 1XPBA 5GHYA 1YM1A 3S7QA 4PKYG 2IWDA 1VQQA 4NXBA 2Y55A 4G3VA 4HOIA 4KZ7A 3MSHA 4S2LA 3T4KA 3I7JA 4HNBA 4PM5A 3DTKA 3OCLA 3T1QB 3P01A 4MN5A 3VV4A 3AGDA 1YMXA 4S2NA 3IT9A 1ZTUA 1YT4A 5CEBA 4XUXA 5HX9A 4Z1WA 3W4PA 5CECA 3JYIA 5FQIA 3UB9A 3ZNTA 4C6YA 3GV9A 1Z6FA 2I72A 3F1OB 1E3UD 1MWUA 4S2OA 3VE4A 2PDRA 3RFBA 1KE3A 2ZOIA 2P9VA 1W79A 5DF8A 3LR0A 5G4YA 1M40A 1HD8A 1MWTA 3H7WB 1OJGA 5I94A 3HCYA 1KE0A 2YKHA 3MFXA 2Z2MB 5CHUA 2EWWA 2IA2A 3BWLA 3KSIA 3OPRA 3RJUA 2UV0E 4EETB 4X1LA 5CHMA 2A49A 4YNRA 4X6TA 3VOLA 1TEMA 1OT6A 1GSXA 1SKFA 3DAVA 1K54A 4L9GA 4D2OA 4KZ8A 4OPYA 2R9XA 3ZVWA 3T1SA 4E6WA 1BLHA 4LPZA 4GS9B 1SCWA 1K57A 1SDEA 1DJCA 4JXVA 1DY6A 3DTMA 4F94A 2B5RA 1HVBA 4OP8A 2RL3A 4BD0A 2DRWA 3BY8A 3PBQA 3QP4A 4OOYA 5DVAA 2XRNA 5EVEA 3T1RA 4OP5A 2WAEA 3A0SA 2WGIA 4UA6A 2XLNA 2HDRA 1RGZA 4ZAMA 1S66L 1IYOA 1E3UA 2ZBBA 3IX8A 4C75A 3M6HA 2IWCA 1W63M 1AXBA 1MWSA 2JN7A 3FKVA 4R6LA 4E3OA 5HSQA 2Z2LB 1T1BA 4R3BA 1Y54A 5CTMA 4B9OA 2P08A 2L0WA 2EA9A 3MKFA 3OBFA 2V8FA 4MN7A 4CLCE 3L9KA 4OONA 4KZ5A 2GX5A 3DTIA 4L0LA 4QY5A 2P04A 2Y2IA 4X53A 3HBRA 2WUQA 2EX2A 1XJ6A 3N8RA 4HP9A 2BASA 4B4XA 5HWVA 3MZDA 3E98A 3UB6A 4WEJA 4KQDA 3U4LP 3ZGAB 2H10A 2Z6DA 3S1YA 5AVFA 1H3QA 3WRTA 2LB5A 2GJ3A 4E3KA 2M7VA 3IXDA 5DFYA 3T4LA 4EU0A 2XK1A 3BLSA 5L09A 5E2EA 3T1XA 3NECA 2VGLM 3LEQA 3UE1A 1MXOA 3BW6A 2ZC5B 4PAUA 3DWZA 5HZHA 4PPRA 2M1CA 2Y2QA 4XUZA 4LV1A 4S2IA 4ZJ3A 3V3SA 1NZUA 4BMWA 1TD5A 5AJGA 4MBKA 3BYDA 4RX3A 4P6BA 4BBVA 4WZ4A 5HPFA 3LR5A 4RYEA 5FQ9A 2W27A 1YLTA 2O9AA 5HPIA 3GECA 4M3KA 3A0RA 1GSVA 4CQHA 4YWZA 5MC7A 1JWZA 5E2GA 2PU2A 3TJZC 3VSLA 3C4PA 2YKFA 1MY8A 4JGOA 2Y2GA 3IXGA 1YLYA 1LT0A 3WS4A 2H5SA 1BSGA 4KZ9A 5TR7A 3EGXC 3KYEA 5HARA 2QJ7A 3D4FA 2EXAA 4P6ZM 3C7VA 1FR6A 4G3WA 3R7WA 3ZG0A 3FG8A 2X71A 2B95A 2HJ9C 5GLDA 4K08A 3UB7A 3HL9A 1K6RA 1L3LA 2O9CA 2A3UA 1EROA 1L0FA 2XSSA 3G2ZA 1F98A 2ZC4B 5G4ZA 3VE3A 3LYXA 1O07A 2XFTA 2Z6CA 4OLDA 2ZD8A 1J3WA 1PYYA 3HLDA 4HIAA 4UHUA 1O7EA 2J9OA 4F3LB 4EUVA 3ITBA 3VOYA 1BLSA 4IUKA 5M1AA 3NY4A 4R0QA 4WYYA 3UO9A 1SKOB 2G7UA 4OH0A 5D3OA 1JWVA 1N4OA 2E8JA 3FZCA 3KSGA 1KVMA 1OTEA 3IS2B 2WKQA 5A90A 4KUKA 1OMEA 3HREA 1T1CA 2JHEA 5HD3A 2DMWA 4EUZA 4QPRA 1QMEA 3QNCA 1FR1A 4WN5A 1NRJA 3NCKA 3DBAA 3VP2A 3A3FA 3MF0A 1ESUA 3B3XA 3ZG5A 3M2KA 3PR6A 3IQAA 3PAGA 3PYPA 3S7PA 4LLOB 2Y2OA 5CTNA
chains in the Genus database with same CATH topology
4EESA 5IT5A 4O8GA 1UWNX 1P9WA 3B33A 2M7UA 2FH5A 1T18A 2XA7S 3C8CA 3PBSA 4RQ9A 1GSWA 3A0VA 4HH3A 2V0WA 3ZQ5A 2VV6A 3E4QA 3F1NB 1DRMA 3NOTC 5F6AA 2W3GA 2VX8A 3EEHA 3F1NA 4LRXC 4Y2FA 4BJPA 2PT7A 4I39A 3NOUC 1P0ZA 4BBTA 4GHIB 3OOVA 4PKYA 1T1AA 2P7JA 1VB6A 2W0NA 1TS0A 1LL8A 2QWSA 4GHIA 4HJ6A 2KDKA 5TJJA 4KUOA 3NOPC 1MZUA 3FPVA 4P6ZS 4ARZB 1OTIA 4MCWA 3C2WA 4I5SA 4HJ3A 4I38A 3K2NA 4ARZA 2J3TD 1XFNA 1S4SA 4NXGA 3LUQA 4DJ3A 2JKTI 4DJ2A 3S7QA 4PKYG 4YOFA 3TE8A 4JGPA 4NXBA 3K3CA 2H28A 4G3VA 4HOIA 1OTDA 2A24B 3BQAA 1D7EA 3LR4A 4G3KA 2OAP1 2PYRA 3T4KA 4CLCB 3ICYA 4HNBA 2VV7A 5DF9A 5J3WA 4IUHA 3OCLA 3PHYA 2A24A 3P01A 4MN5A 4R70A 3UMDA 3VV4A 2W1RA 4Q0JA 1VHMA 4CLCA 4R3AA 2K7SA 4O0PA 1ZTUA 3T4TA 2K31A 4Z1WA 2VZWA 3EQUA 4GW9A 4OOMA 2O99A 2FZ0A 5IU1A 3UB9A 1XFQA 3F1OB 4DMZA 3VE4A 3V67A 2PDRA 3LI8A 3PBNA 1S67L 4II7A 5HL6A 5K5BA 4MDZA 3E0YA 3F1OA 3RFBA 2ZOIA 4EXOA 2MJ6A 3UB8A 3LR0A 1TS8A 2L4RA 5G4YA 2PHYA 3B47A 3H7WB 1OJGA 3UMEA 3HCYA 3EGDC 4EERA 2OAQ1 2PD7A 1YSQA 2YKHA 3KO6A 3MFXA 3JVUA 2J3WA 2EWWA 3H7WA 4M4XA 1MKMA 2IA2A 3MQ0A 5J7EA 2WKRA 3BWLA 3KSIA 2HGVA 3FC7A 4EETB 5TBMB 4I3AA 2HV1A 2JKRI 2WKPA 4YNRA 3T50A 5DKLA 2VLGA 1P9RA 3VOLA 3K3DA 5TBMA 1OT6A 1GSXA 2KLIA 4IJGA 4ME4A 5CX7A 4L9GA 3LR3A 2JKRM 4NXEA 5EFWA 4H6JB 3PBTA 1YKDA 4IHQA 2ZOHA 4LPZA 4UEYA 4GS9B 2W1TB 4GS9A 3T4JA 4WELA 1XJ4A 3ULFA 2W1TA 3CLOA 3LIAA 4R38A 2OWJA 1N9OA 2B02A 1YSPA 1OJ5A 1NLZA 3P7NA 3BY8A 3PBQA 4ETZA 2OOLA 4WUJA 2QYBA 2XRNA 3FPWA 3E4PA 3RH8B 2KOIA 3MJQA 1WA9A 3A0SA 4B93A 3EQVA 2PD8A 1S66L 4EEPA 3NJAA 2ZBBA 5A8BA 5DJUA 1S1YA 1P97A 3OC2A 3CITA 5AVEA 4HH2A 5C5KA 5DJTA 4ETXA 4WEKA 2ZMVA 1W63M 2JN7A 4HI4A 4HY8A 3S7OA 1H8MA 4R6LA 5HSQA 4CLCC 3PBRA 2HF6A 1T1BA 1DP8A 5HD5A 4B9OA 2P08A 2JKTM 2L0WA 2O0YA 2D02A 2EA9A 3C38A 2B18A 3KSHA 3LFVA 2Y8HA 3OBFA 4MN7A 3U2AA 4CLCE 3RTYA 1G6OA 4EW7A 4GJ4A 4HHDA 3S7NA 3NHQA 4PHTA 1OPXA 2GX5A 2K2NA 2QHKA 1V9ZA 4L0LA 2P04A 1XJ6A 1X0OA 1OTAA 3CAXA 4LRYC 3EOIA 2HJEA 5F5YA 4HP9A 2BASA 4EEUA 1Y28A 1OTBA 5HWVA 3IBJA 1S1ZA 3E98A 3UB6A 4WEJA 4KQDA 4UQIM 4Q0IA 2V9AA 2PR6A 2Z6DA 3HJIA 1F5MA 1V9YA 3KX0X 1H3QA 3BJNA 1KOUA 4Y5FA 5AVFA 2LB5A 4Y3IA 3D72A 2GJ3A 2M7VA 5DFYA 3MQOA 1UWPX 3T4LA 3T4OA 3T4QA 2KX6A 4EU0A 5HWTA 2J80A 4WLAA 4I3JA 4BBUA 1STZA 2VGLM 3PXPA 5IS1A 3R4KA 3E4OA 3TW8A 3BW6A 3UE6A 3SW1A 4PAUA 3T4SA 2J3TC 1XJ2A 5I5LA 5DFXA 4WF0A 4ZRRA 5HZHA 2M1CA 2QKPA 3JVVA 2W3HA 3F1PB 1MC0A 1S4RA 1LSWA 2VKSA 4BMWA 1TD5A 5AJGA 5F68A 3KYQA 3F1PA 2I9VA 4BBVA 5HDCA 4JGQA 5HPFA 3CI6A 1JNUA 4H6JA 3LR5A 3H82B 1NLYA 1IOUA 4NKPA 3TRCA 3B42A 2W27A 2GNXA 4EQ1A 4JGRA 3LIDA 1ODVA 2W3FA 3H82A 1UGUA 2O9AA 4L9FA 1IFQA 1TF1A 5HPIA 3GECA 1TS6A 3A0RA 1GSVA 2PR5A 4HQAA 2VA0A 4O01A 4CQHA 2PYPA 4YWZA 2XROA 2LB9A 4I3IA 5MC7A 1T19A 2Y79A 3KYZA 2XA7M 3GDIA 1D06A 1NWZA 3TJZC 1LSXA 1BYWA 2YKFA 3LIEA 2GZAA 4JGOA 1LSVA 1LT0A 3OLOA 2EWVA 5HDDA 5L8MA 2R78A 1DP9A 3OCNA 2O9BA 4AFIA 2VJWA 4FOFA 3EGXC 5J4EA 2V1BA 4MMNA 2QJ7A 4L9EA 3R7WB 3G6OA 4HJ4A 2W3EA 4DN0A 4WL9A 5KIZA 4P6ZM 4G3WA 3R7WA 3FG8A 5LBRA 4KQOA 2HJ9C 4K08A 3UB7A 4GLQA 3LICA 2A2LA 2O9CA 2VV8A 3LIFA 4E04A 1N9LA 3IBRA 2XSSA 3BQ8A 2INWA 4LRZE 3ZYTA 1F98A 2NUTC 4UQIS 5G4ZA 3VE3A 3LYXA 5HWWA 2OWHA 4Q0HA 1DP6A 2Z6CA 2CMNA 4OOLA 3LIBA 2QJ5A 3D3OA 4HIAA 5KSHA 5FL3A 3PBOA 1TS7A 3CUEC 3W2ZA 4F3LB 4EUVA 3LI9A 4HP4A 3C30A 4GCZA 5DKKA 2VGLS 4IUKA 4BWIA 4F3LA 4NXFA 2L1MA 1N9NA 2G7UA 3H9WA 3MXQA 2V1AA 3MR0A 3CUEA 3O5YA 1W63Q 3UE3A 3HJKA 3BY9A 3KSGA 1ZHHB 2VEAA 1OTEA 3IS2B 4MN6A 2WKQA 3KSFA 3MMHA 1G28A 4KUKA 1F9IA 1YAXA 4NEED 1T1CA 2ZMFA 2V0UA 2JHEA 3IS2A 1XJ3A 3EWKA 5HD3A 2DMWA 4QPRA 4XT2B 4WN5A 3EEAA 1NRJA 3DBAA 5F69A 4CLCD 4FSFA 2W3DA 3MF0A 4XT2A 2NUPC 1OT9A 3PR6A 3CWFA 5HDSA 3S7PA 3PYPA 4LLOB 2D01A 1EW0A 3MQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EES A;  1UWN X;  3B33 A;  1T18 A;  3C8C A;  4RQ9 A;  1GSW A;  3A0V A;  4HH3 A;  2V0W A;  3ZQ5 A;  2VV6 A;  3E4Q A;  3F1N B;  1DRM A;  3NOT C;  5F6A A;  3EEH A;  3F1N A;  4LRX C;  4I39 A;  3NOU C;  1P0Z A;  4BBT A;  4GHI B;  4PKY A;  1T1A A;  2P7J A;  1VB6 A;  2W0N A;  1TS0 A;  1LL8 A;  2QWS A;  4GHI A;  4HJ6 A;  2KDK A;  4KUO A;  3NOP C;  1MZU A;  1OTI A;  3C2W A;  4I5S A;  4HJ3 A;  4I38 A;  1XFN A;  1S4S A;  4NXG A;  3LUQ A;  4DJ3 A;  4DJ2 A;  4PKY G;  4JGP A;  4NXB A;  3K3C A;  2H28 A;  4HOI A;  1OTD A;  2A24 B;  1D7E A;  2PYR A;  3ICY A;  4HNB A;  2VV7 A;  5J3W A;  3PHY A;  2A24 A;  4MN5 A;  4R70 A;  3UMD A;  4R3A A;  2K7S A;  4GW9 A;  5IU1 A;  3UB9 A;  1XFQ A;  3F1O B;  3VE4 A;  2PDR A;  3LI8 A;  1S67 L;  3F1O A;  2ZOI A;  4EXO A;  3UB8 A;  1TS8 A;  2L4R A;  5G4Y A;  2PHY A;  3H7W B;  1OJG A;  3UME A;  4EER A;  2PD7 A;  2YKH A;  3MFX A;  3H7W A;  4M4X A;  5J7E A;  2WKR A;  3BWL A;  3FC7 A;  4EET B;  5TBM B;  4I3A A;  2HV1 A;  2WKP A;  3T50 A;  5DKL A;  2VLG A;  3VOL A;  3K3D A;  5TBM A;  1OT6 A;  1GSX A;  4L9G A;  4NXE A;  5EFW A;  4H6J B;  2ZOH A;  4LPZ A;  4GS9 B;  4GS9 A;  1XJ4 A;  3ULF A;  3CLO A;  3LIA A;  4R38 A;  2OWJ A;  1N9O A;  2B02 A;  1OJ5 A;  3P7N A;  3BY8 A;  2OOL A;  4WUJ A;  3E4P A;  3RH8 B;  3MJQ A;  1WA9 A;  3A0S A;  2PD8 A;  1S66 L;  4EEP A;  3NJA A;  2ZBB A;  5A8B A;  5DJU A;  1S1Y A;  1P97 A;  5AVE A;  4HH2 A;  5DJT A;  2JN7 A;  4HI4 A;  4HY8 A;  4R6L A;  5HSQ A;  1T1B A;  1DP8 A;  5HD5 A;  4B9O A;  2L0W A;  2D02 A;  2EA9 A;  4EW7 A;  3RTY A;  4HHD A;  3NHQ A;  2QHK A;  1V9Z A;  1XJ6 A;  1X0O A;  1OTA A;  3CAX A;  4LRY C;  5F5Y A;  4HP9 A;  2BAS A;  4EEU A;  1Y28 A;  1OTB A;  5HWV A;  1S1Z A;  3UB6 A;  4KQD A;  2V9A A;  2PR6 A;  2Z6D A;  3HJI A;  1V9Y A;  3KX0 X;  5AVF A;  1KOU A;  3D72 A;  2GJ3 A;  3MQO A;  1UWP X;  2KX6 A;  5HWT A;  2J80 A;  4WLA A;  4I3J A;  4BBU A;  5IS1 A;  3E4O A;  3UE6 A;  3SW1 A;  1XJ2 A;  5I5L A;  5HZH A;  4WF0 A;  2M1C A;  2QKP A;  3F1P B;  1S4R A;  1LSW A;  5F68 A;  3F1P A;  2I9V A;  4BBV A;  5HDC A;  4JGQ A;  1JNU A;  4H6J A;  3H82 B;  2W27 A;  4EQ1 A;  4JGR A;  1ODV A;  3LID A;  3H82 A;  4L9F A;  1UGU A;  3GEC A;  1TS6 A;  2PR5 A;  1GSV A;  3A0R A;  4HQA A;  2PYP A;  4YWZ A;  4I3I A;  1T19 A;  3GDI A;  1D06 A;  1NWZ A;  1LSX A;  1BYW A;  2YKF A;  3LIE A;  4JGO A;  1LSV A;  1LT0 A;  3OLO A;  5HDD A;  2R78 A;  1DP9 A;  5J4E A;  2V1B A;  2QJ7 A;  4L9E A;  3G6O A;  4HJ4 A;  4WL9 A;  5KIZ A;  3FG8 A;  4K08 A;  3UB7 A;  3LIC A;  2VV8 A;  3LIF A;  4E04 A;  1N9L A;  3IBR A;  2INW A;  4LRZ E;  1F98 A;  5G4Z A;  3VE3 A;  3LYX A;  5HWW A;  2OWH A;  1DP6 A;  2Z6C A;  2CMN A;  3LIB A;  2QJ5 A;  4HIA A;  1TS7 A;  4F3L B;  3LI9 A;  4HP4 A;  4GCZ A;  5DKK A;  4F3L A;  4NXF A;  2L1M A;  1N9N A;  3H9W A;  3MXQ A;  2V1A A;  3MR0 A;  3HJK A;  3BY9 A;  2VEA A;  1OTE A;  3IS2 B;  4MN6 A;  2WKQ A;  1G28 A;  4KUK A;  1F9I A;  1T1C A;  2V0U A;  2JHE A;  3IS2 A;  1XJ3 A;  3EWK A;  5HD3 A;  4XT2 B;  4WN5 A;  5F69 A;  4XT2 A;  1OT9 A;  3CWF A;  5HDS A;  3PYP A;  4LLO B;  2D01 A;  1EW0 A;  3MQQ A; 
#chains in the Genus database with same CATH topology
 3C4O A;  4O8G A;  2ACG A;  1I2W A;  1UWN X;  4RA7 A;  1P9W A;  1BLC A;  2Y91 A;  4KG2 A;  3PAE A;  2M7U A;  1T18 A;  4OQH A;  1FCO A;  1SHV A;  2V1Z A;  2VV6 A;  1YLZ A;  2VGJ A;  4HBU A;  4X25 A;  4Y2F A;  2DNS A;  4I39 A;  1KGF A;  4BBT A;  1XA1 A;  4KQQ A;  2P7J A;  4RX2 A;  3WWX A;  4GHI A;  2FFY A;  5L07 A;  2KDK A;  5EEC A;  1D1J A;  3TG9 A;  1OTI A;  3UN7 A;  2BTF P;  3IWI A;  4HJ3 A;  4I38 A;  4ARZ A;  1S4S A;  3ISG A;  3CPT A;  2JKT I;  1Z09 A;  1GA0 A;  3K3C A;  4EBP A;  2H28 A;  4KQR A;  2ZQA A;  4QY6 A;  3DW0 A;  2OAP 1;  5KZH A;  2C5W B;  5CGS A;  2PYR A;  4CLC B;  2CC1 A;  3ICY A;  3MS6 A;  3PHY A;  2A24 A;  1G6A A;  4Q0J A;  2K7S A;  4Y17 A;  1NRF A;  4O7D A;  3EQU A;  3O86 A;  1KVL A;  1XFQ A;  3VFH A;  3E2L A;  4II7 A;  4MDZ A;  3E0Y A;  2MJ6 A;  2L4R A;  4YFM A;  3B47 A;  1EI5 A;  3KO6 A;  3JVU A;  4HBT A;  2J3W A;  4M4X A;  3WS5 A;  5J7E A;  1MKM A;  4Z9Q A;  3MQ0 A;  2EXB A;  3ZG9 B;  3V39 A;  5AQA A;  1ESI A;  1XX2 A;  2HV1 A;  5EE8 A;  4QHC A;  3HLF A;  4LV0 A;  4R3J A;  5DKL A;  2VLG A;  2HDU A;  3SS3 A;  1FIK A;  1L0G A;  5TBM A;  3DTE A;  4ME4 A;  1W8Y A;  1K57 C;  3N7W A;  3PTE A;  4P87 A;  5EFW A;  5CXW A;  3SZT A;  3O88 A;  4K0W A;  3G34 A;  1YKD A;  4Y0T A;  4UEY A;  3OPP A;  5U47 A;  2W1T B;  4E3I A;  4Y13 A;  4EBN A;  2JKG A;  4KZ6 A;  3ULF A;  2E8I A;  3LO7 A;  2OWJ A;  3DWK A;  1YSP A;  1GHP A;  3VP1 A;  2OOL A;  4Y15 A;  3IF6 A;  3RH8 B;  2KOI A;  1WA9 A;  1ERQ A;  5F83 A;  3NJA A;  1P97 A;  1K25 A;  3CIT A;  5AVE A;  4YIN A;  5C5K A;  2ZMV A;  3MZE A;  2PAV P;  1MWR A;  1G5U A;  1H8M A;  4ZTK A;  4CLC C;  3PBR A;  4C3Q A;  1DP8 A;  3QNB A;  5EVL A;  2O0Y A;  2D02 A;  3C38 A;  2B18 A;  4UA7 A;  5GLC A;  1BLP A;  1TDG A;  4WMC D;  3RTY A;  2JCH A;  4HHD A;  2XGN A;  2QHK A;  4LGW A;  3BFG A;  1X0O A;  5EVI D;  3GSG A;  1Y28 A;  1OTB A;  1MBL A;  2EFX A;  4Q0I A;  3HJI A;  1F5M A;  1V9Y A;  1K55 A;  3D72 A;  3G31 A;  1HLU P;  4E6X A;  1UWP X;  3T4Q A;  4WZ5 C;  5HWT A;  4XXR A;  4WLA A;  5HW3 A;  1ALQ A;  3PXP A;  2Y2L A;  5FSR A;  1VET A;  3E4O A;  1DJA A;  3R4K A;  5GL9 A;  3UE6 A;  3SW1 A;  3RXW A;  3T4S A;  2J3T C;  3L7H A;  4JF4 A;  5DFX A;  4ZRR A;  3MFD A;  2FFF B;  1YLJ A;  1MC0 A;  1H5X A;  1S4R A;  1YQS A;  4FH4 A;  1JTD A;  3F1P A;  2I9V A;  4KEN B;  1PZP A;  2Q0O A;  5CHJ A;  1JNU A;  4H6J A;  4DXC A;  3H82 B;  1NLY A;  4B88 A;  5FAP A;  2HP9 A;  2Q9M A;  4JGR A;  1UGU A;  3G4P A;  3GR2 A;  3FV7 A;  5TFQ A;  4WMC A;  1IYQ A;  3ZNY A;  4Y0U A;  3C5A A;  2WGW A;  2ZL1 B;  5HAP A;  1T19 A;  4N1X A;  2Y79 A;  3FKW A;  5EOO A;  4U0T A;  5EVI A;  3GDI A;  1NWZ A;  4KZ4 A;  1CEG A;  1I2S A;  1BYW A;  2Y2P A;  3G32 A;  3S22 A;  4PMA A;  3VSK A;  2EWV A;  3OCN A;  4GD8 A;  1HZO A;  2O9B A;  2VJW A;  3NUL A;  5J4E A;  4MMN A;  2OLU A;  2R9W A;  5BOH A;  3GRJ A;  5M19 A;  3LEZ A;  4E3M A;  1PIO A;  1LI9 A;  3MKE A;  4GLQ A;  1Q2P A;  2A2L A;  2XDM A;  4E04 A;  3IBR A;  4LCM A;  3FWL A;  3ZYT A;  5FAS A;  4UQI S;  1PWD A;  1JTG A;  2Y2M A;  2ZC3 B;  1VEU A;  3NIA A;  4OOL A;  1H0M A;  3LIB A;  1YMS A;  5KSH A;  5FL3 A;  2WGV A;  4DDS A;  5FAQ A;  3BEC A;  1PI5 A;  2HDS A;  5DKK A;  2ZMA A;  1LI0 A;  1SZV A;  1YPR A;  2WAF A;  5FEF A;  4FCF A;  3MXQ A;  2V1A A;  3MR0 A;  3CUE A;  3HJK A;  3VOZ A;  3D9Y A;  4P0M A;  1G28 A;  3BEB A;  2AVX A;  2RCX A;  1F9I A;  3IXH A;  3AGF A;  1PZO A;  3EWK A;  3ZCZ A;  2Q9N A;  3GQZ A;  4LV3 A;  5FI2 A;  2JC7 A;  3N8L A;  2ZM2 A;  4U0X A;  4FSF A;  3N8S A;  4XT2 A;  3CWF A;  5HDS A;  3UPN A;  1FSW A;  2D01 A;  5FDS A;  4D60 A;  3G2Y A;  1XKZ A;  2FH5 A;  1XXM A;  2XA7 S;  4RQ9 A;  4HH3 A;  1S6R A;  1DRM A;  3NOT C;  1XGI A;  2OSU A;  2W3G A;  5A91 A;  4ZJ1 A;  3Q7V A;  3F1N A;  3VFF A;  1KDS A;  4E3L A;  1NZO A;  4GDN A;  3OZH A;  3OOV A;  4PKY A;  1LHY A;  1T1A A;  3UE0 A;  2PRF A;  4Y0O A;  1TS0 A;  2QWS A;  1MZU A;  3IH8 A;  4MCW A;  3Q81 A;  4I5S A;  4PM7 A;  3HVF A;  5KSC A;  3BFC A;  3M6B A;  4GKU A;  1G68 A;  4DJ3 A;  2EX8 A;  5EPH A;  1ZKJ A;  2XEP A;  3S4X A;  3QP6 A;  4NG2 A;  4KZ3 A;  1KGG A;  2DCF A;  3A3I A;  4GD6 A;  4QB8 A;  2VV7 A;  5DF9 A;  5J3W A;  1L0E A;  4MBF A;  2W1R A;  1RCJ A;  1VHM A;  1K56 D;  4QU3 A;  1CI9 A;  4O0P A;  4GN2 A;  4B4Z A;  2ZQ9 A;  4HES A;  2G2W A;  2VZW A;  3A3E A;  4CPK A;  1GA9 A;  5IU1 A;  3G35 A;  2P9V B;  1E4D A;  1ONG A;  4IED A;  1S67 L;  5K5B A;  2WKI A;  4OQI A;  5FA7 A;  3F1O A;  1PRQ A;  3UDX A;  4QWO A;  1E25 A;  3UB8 A;  1TS8 A;  2PHY A;  1WYC A;  3CHW P;  5AQB A;  3UME A;  4DRT A;  2OAQ 1;  2PD7 A;  1YSQ A;  4CJN A;  4ESP A;  4R4S A;  1PW8 A;  5A92 A;  1K4E A;  3H7W A;  4N92 A;  2WKR A;  1SDN A;  4JF5 A;  2QPN A;  4ZJ2 A;  2HGV A;  3ZVT A;  2WKP A;  4KZB A;  3T50 A;  2X01 A;  2ZQ7 A;  5DTK A;  5CX7 A;  3LR3 A;  5EOE A;  3SH7 A;  4H6J B;  3BFF A;  1CK3 A;  5FQJ A;  4IHQ A;  3SH8 A;  3MZF A;  1RGY A;  3NDG A;  4JF6 A;  4GS9 A;  3T4J A;  4WEL A;  4DE0 A;  3LCE A;  3T12 B;  4R38 A;  2JBF A;  5F82 A;  1OJ5 A;  1YLW A;  1NLZ A;  4BL2 A;  1K56 A;  4WM9 A;  2HPB A;  3FPW A;  2OLV A;  3WS2 A;  4JLF A;  1JWP A;  2EFU A;  3HUO A;  3IX3 A;  4EEP A;  1S0W A;  1S1Y A;  3OC2 A;  4EQI A;  3Q82 A;  4JKT A;  5GLB A;  3S7O A;  4HI4 A;  4HY8 A;  1DJB A;  4EWF A;  4S2N C;  1BT5 A;  2JKT M;  3UDF A;  3GMW A;  2G2U A;  3KSH A;  2X02 A;  3A3J A;  4EW7 A;  4GJ4 A;  3S7N A;  4KG5 A;  4PHT A;  1PFL A;  2EX6 A;  2ZJ9 A;  3ZHH A;  2QZ6 A;  3CAX A;  5F5Y A;  4ZDX A;  2Y2N A;  3IBJ A;  3HLC A;  1S1Z A;  5KMW A;  3V50 A;  4UQI M;  1PNE A;  2PR6 A;  4NK3 A;  1IYP A;  3KX0 X;  1KOU A;  4Y5F A;  2GDN A;  3MBZ A;  5EV0 A;  4DKI A;  1KGE A;  4H8R A;  3T4O A;  5DTT A;  1N9B A;  4LV2 A;  2J80 A;  2UWX A;  4BBU A;  4DXB A;  1K54 C;  3WS0 A;  3TW8 A;  1XJ2 A;  4WF0 A;  1YLP A;  3JVV A;  5GLA A;  2W3H A;  5GHX A;  1LSW A;  3BFE A;  1F2K A;  1GHI A;  5F68 A;  3BM6 A;  5FDH A;  5EM0 A;  4BEN A;  5HDC A;  1TVF A;  4JGQ A;  3CI6 A;  1IOU A;  4NKP A;  4GNU A;  3VP4 A;  4EQ1 A;  4MEZ A;  1ODV A;  2W3F A;  3LID A;  3IWO A;  3QP2 A;  1TF1 A;  2XD1 A;  3CG5 A;  2PR5 A;  3OPH A;  2VA0 A;  2PYP A;  3HLE A;  2LB9 A;  4I3I A;  2WZZ A;  1IEM A;  3KYZ A;  2XA7 M;  1IKG A;  1LSX A;  3LIE A;  1W5D A;  1LSV A;  5EUA A;  5F1F A;  1BUL A;  1IEL A;  3IF5 A;  1JVJ A;  5HDD A;  1DP9 A;  1FIL A;  4AFI A;  3CJM A;  3AGE A;  4L9E A;  3R7W B;  3QP1 A;  1AWI A;  4BL3 A;  3BFD A;  3HUN A;  5FQK A;  4WL9 A;  4IVK A;  5TGF A;  3IWQ A;  5JYP A;  1WYB A;  3P09 A;  1LL9 A;  4KQO A;  3LIF A;  1N9L A;  1XP4 A;  4LCL A;  1CJF A;  2H0T A;  1EWZ A;  1HTZ A;  3O87 A;  2JKF A;  3ZG7 B;  1CEF A;  1ES4 A;  2OWH A;  3WRZ A;  4Q0H A;  1DP6 A;  2CMN A;  2BG1 A;  3D3O A;  4OQG A;  3PBO A;  5EM1 A;  3QP5 A;  1TS7 A;  3CUE C;  5G18 A;  3LI9 A;  4HP4 A;  4OKP A;  4GCZ A;  4OVD A;  1NY0 A;  4RVA A;  5CGX A;  1FCN A;  5FQQ A;  4F3L A;  2HP6 A;  2L1M A;  4NXF A;  3TSG A;  2PU4 A;  2ZLY A;  3H9W A;  4X55 A;  4GB7 A;  2PBD P;  1IKI A;  1CQA A;  2XH9 A;  5CER A;  3MXS A;  1ONH A;  5J8X A;  3UE3 A;  2V2F F;  1SKO A;  1ZHH B;  4LFU A;  5AQ9 A;  4Y7P A;  2JE5 A;  4MN6 A;  3KSF A;  3MMH A;  2V8C A;  3N4I A;  5CGW A;  3IS2 A;  1XJ3 A;  1FOF A;  3ZG8 B;  3EEA A;  5F69 A;  4CLC D;  2NUP C;  1OT9 A;  3NDE A;  3LGO A;  3A3D A;  3N6I A;  5FAO A;  3MQQ A;  1CF0 A;  1GHM A;  4R23 A;  3B33 A;  3CZD A;  3HUM A;  3Q1F A;  3C8C A;  2ZQ8 A;  4WBG A;  3A0V A;  3C7U A;  2V0W A;  3UB5 P;  2ZM0 A;  3E4Q A;  1W7F A;  5F6A A;  1PI4 A;  2VX8 A;  5FEG A;  1U60 A;  2J8Y A;  1WE4 A;  4LRX C;  2XQZ A;  3FYZ A;  4BJP A;  5E2H A;  1P0Z A;  4GHI B;  5CRF A;  3VP0 A;  4S2K A;  2W0N A;  1LL8 A;  4HJ6 A;  2XFS A;  4FUW A;  1ES5 A;  2XF3 A;  5TJJ A;  3NOP C;  3ZDJ A;  4ARZ B;  4E3J A;  2HZ5 A;  3CPT B;  1ES2 A;  3K2N A;  3IH9 A;  2J3T D;  1XFN A;  1L2S A;  5HFO A;  4YOF A;  3TE8 A;  5M18 A;  4JGP A;  3P98 A;  1OTD A;  2A24 B;  3BQA A;  5E2F A;  1D7E A;  3LR4 A;  4G3K A;  2OV5 A;  1K6S A;  4OLG A;  4JBF A;  4X68 A;  4IUH A;  1CI8 A;  1ES3 A;  1BUE A;  4R70 A;  3UMD A;  3HLG A;  5JYO A;  4CLC A;  1KDW A;  2H0Y A;  4R3A A;  3BLM A;  4OPR A;  3T4T A;  3NC8 A;  2K31 A;  4DE3 A;  4OOM A;  4GW9 A;  2O99 A;  2FZ0 A;  1ACF A;  4DMZ A;  1Q2Q A;  2Y59 A;  3V67 A;  3LI8 A;  1VM1 A;  3PBN A;  5HL6 A;  4KZA A;  5E43 A;  4EXO A;  2QMI A;  1H8Z A;  4P85 A;  4N9L A;  3EGD C;  4EER A;  3E2K A;  2J7V A;  4FD8 A;  3G30 A;  4GOG A;  3IHA A;  1RP5 A;  1H8Y A;  3FC7 A;  5TBM B;  5A93 A;  2WYX A;  1NYM A;  4I3A A;  2JKR I;  3TOI A;  1ZC2 A;  4WZ5 A;  3V3R A;  1P9R A;  4U3T A;  3K3D A;  2KLI A;  1ZG6 A;  4IJG A;  4JXG A;  2JKR M;  4NXE A;  5FAT A;  4MBH A;  2XR0 A;  3V5M A;  1LL5 A;  3PBT A;  2ZOH A;  1MKI A;  3SOI A;  1L0D A;  4X69 A;  1M6K A;  3HLW A;  3UNW A;  1IYS A;  1XJ4 A;  5L2F A;  4X56 A;  2W1T A;  3CLO A;  4PM8 A;  3LIA A;  4X1M A;  3IF6 B;  1N9O A;  2B02 A;  1K0K A;  3P7N A;  4ETZ A;  4ZBE A;  4WUJ A;  2QYB A;  3E4P A;  3MJQ A;  4B93 A;  3ITA A;  3EQV A;  2VGK A;  2PD8 A;  4JXS A;  3O3V A;  5A8B A;  5DJU A;  3UPO A;  1PW1 A;  4HH2 A;  2P74 A;  5DJT A;  1LLB A;  4ETX A;  4NET A;  4WEK A;  1QMF A;  1ZG4 A;  4OQ0 A;  2HF6 A;  5HD5 A;  3HLB A;  2Y2J A;  3LFV A;  2Y8H A;  2WK0 A;  4DDY A;  3U2A A;  3W4Q A;  1G6O A;  3NHQ A;  1OPX A;  2K2N A;  1V9Z A;  1OTA A;  4LRY C;  3EOI A;  2HJE A;  4EEU A;  2WKE A;  1NXY A;  4KG6 A;  4DF6 A;  2V9A A;  4BQM A;  4BLM A;  3QP8 A;  4PM9 A;  4R4R A;  3BJN A;  4Y3I A;  3IX4 A;  3M2J A;  4IBR A;  3SS4 A;  3MQO A;  1ERM A;  4QD4 A;  2KX6 A;  3CMZ A;  1FQG A;  4DE1 A;  1VET B;  4IBX A;  4I3J A;  1STZ A;  5IS1 A;  5FQM A;  3VP3 A;  5I5L A;  1BZA A;  3NI9 A;  2QKP A;  3F1P B;  5HAI A;  4MLL A;  5GHZ A;  2VKS A;  5IHV A;  3KYQ A;  5DF7 A;  3TRC A;  4S2M A;  3B42 A;  3IF6 C;  2GNX A;  4LEN A;  4L9F A;  5FI7 A;  3H82 A;  1IFQ A;  2WGW B;  2Y2H A;  1TS6 A;  2ZC6 B;  4HQA A;  4O01 A;  5EVI B;  2XRO A;  2HP5 A;  2IWB A;  1C3B A;  1D06 A;  1FCM A;  4JXW A;  2ZL1 A;  1TDL A;  2VK3 A;  2GZA A;  3OLO A;  3SH9 A;  1XA7 A;  4UAA A;  5L8M A;  2R78 A;  4S2P A;  4FTX A;  4FOF A;  1PWC A;  2V20 A;  5AQ7 A;  2V1B A;  2WKH A;  2XD5 A;  3G6O A;  4BD1 A;  4HJ4 A;  2W3E A;  4DN0 A;  5KIZ A;  3JPU A;  5L10 A;  4EBL A;  3UY6 A;  4Q8I A;  5LBR A;  3SS5 A;  2PBY A;  4HEF A;  3LIC A;  2VV8 A;  1K55 C;  4MNR A;  3BQ8 A;  2INW A;  1VEU B;  4LRZ E;  3IXB A;  2NUT C;  3MXR A;  5HWW A;  2WZX A;  5HL1 A;  4N1H A;  2QJ5 A;  4IVI A;  2HDQ A;  3W2Z A;  1NYY A;  3C30 A;  2Y4A A;  2VGL S;  4DE2 A;  1MPL A;  4BWI A;  3LY4 A;  1N9N A;  4A5R A;  4OPQ A;  3O5Y A;  1W63 Q;  3WS1 A;  3BY9 A;  3NBL A;  2VEA A;  4S2J A;  4K0X A;  4GZB A;  2BLS A;  1YAX A;  4NEE D;  2ZMF A;  5HAQ A;  3QHY A;  1J9M A;  2V0U A;  5CED A;  1W8Q A;  4XT2 B;  3W8K A;  1KE4 A;  4E3N A;  2W3D A;  1A0K A;  2Y2K A;  5EVI C;  3UPP A;  4JPM A;  1EW0 A;  4UA9 A;  4EES A;  5IT5 A;  2C6W B;  3IHB A;  1BTL A;  4GDB A;  3Q07 A;  3PBS A;  1GSW A;  3VMA A;  3ZQ5 A;  4R1G A;  3Q7V B;  4OPZ A;  1GCE A;  1K4F A;  3F1N B;  2ZQD A;  4K91 A;  4FH2 A;  3EEH A;  3UDI A;  3OPL A;  5FI6 A;  2PT7 A;  3ZFZ A;  2ZM8 A;  3NOU C;  4QJG A;  3BRM A;  1PWG A;  1K38 A;  3Q7Z A;  2EX9 A;  1Y4O A;  1XGJ A;  1VB6 A;  1FSY A;  2ZC7 A;  1I5Q A;  3GTC A;  4KUO A;  3FPV A;  4P6Z S;  3RXX A;  4EV4 A;  3C2W A;  2J9P A;  3W4O A;  4ID4 A;  2ZQC A;  1NJ4 A;  3GVB A;  4NXG A;  3LUQ A;  3LY3 A;  5F1G A;  4N9K A;  4DJ2 A;  2WAD A;  4PM6 A;  5DTS A;  1XPB A;  5GHY A;  1YM1 A;  3S7Q A;  4PKY G;  2IWD A;  1VQQ A;  4NXB A;  2Y55 A;  4G3V A;  4HOI A;  4KZ7 A;  3MSH A;  4S2L A;  3T4K A;  3I7J A;  4HNB A;  4PM5 A;  3DTK A;  3OCL A;  3T1Q B;  3P01 A;  4MN5 A;  3VV4 A;  3AGD A;  1YMX A;  4S2N A;  3IT9 A;  1ZTU A;  1YT4 A;  5CEB A;  4XUX A;  5HX9 A;  4Z1W A;  3W4P A;  5CEC A;  3JYI A;  5FQI A;  3UB9 A;  3ZNT A;  4C6Y A;  3GV9 A;  1Z6F A;  2I72 A;  3F1O B;  1E3U D;  1MWU A;  4S2O A;  3VE4 A;  2PDR A;  3RFB A;  1KE3 A;  2ZOI A;  2P9V A;  1W79 A;  5DF8 A;  3LR0 A;  5G4Y A;  1M40 A;  1HD8 A;  1MWT A;  3H7W B;  1OJG A;  5I94 A;  3HCY A;  1KE0 A;  2YKH A;  3MFX A;  2Z2M B;  5CHU A;  2EWW A;  2IA2 A;  3BWL A;  3KSI A;  3OPR A;  3RJU A;  2UV0 E;  4EET B;  4X1L A;  5CHM A;  2A49 A;  4YNR A;  4X6T A;  3VOL A;  1TEM A;  1OT6 A;  1GSX A;  1SKF A;  3DAV A;  1K54 A;  4L9G A;  4D2O A;  4KZ8 A;  4OPY A;  2R9X A;  3ZVW A;  3T1S A;  4E6W A;  1BLH A;  4LPZ A;  4GS9 B;  1SCW A;  1K57 A;  1SDE A;  1DJC A;  4JXV A;  1DY6 A;  3DTM A;  4F94 A;  2B5R A;  1HVB A;  4OP8 A;  2RL3 A;  4BD0 A;  2DRW A;  3BY8 A;  3PBQ A;  3QP4 A;  4OOY A;  5DVA A;  2XRN A;  5EVE A;  3T1R A;  4OP5 A;  2WAE A;  3A0S A;  2WGI A;  4UA6 A;  2XLN A;  2HDR A;  1RGZ A;  4ZAM A;  1S66 L;  1IYO A;  1E3U A;  2ZBB A;  3IX8 A;  4C75 A;  3M6H A;  2IWC A;  1W63 M;  1AXB A;  1MWS A;  2JN7 A;  3FKV A;  4R6L A;  4E3O A;  5HSQ A;  2Z2L B;  1T1B A;  4R3B A;  1Y54 A;  5CTM A;  4B9O A;  2P08 A;  2L0W A;  2EA9 A;  3MKF A;  3OBF A;  2V8F A;  4MN7 A;  4CLC E;  3L9K A;  4OON A;  4KZ5 A;  2GX5 A;  3DTI A;  4L0L A;  4QY5 A;  2P04 A;  2Y2I A;  4X53 A;  3HBR A;  2WUQ A;  2EX2 A;  1XJ6 A;  3N8R A;  4HP9 A;  2BAS A;  4B4X A;  5HWV A;  3MZD A;  3E98 A;  3UB6 A;  4WEJ A;  4KQD A;  3U4L P;  3ZGA B;  2H10 A;  2Z6D A;  3S1Y A;  5AVF A;  1H3Q A;  3WRT A;  2LB5 A;  2GJ3 A;  4E3K A;  2M7V A;  3IXD A;  5DFY A;  3T4L A;  4EU0 A;  2XK1 A;  3BLS A;  5L09 A;  5E2E A;  3T1X A;  3NEC A;  2VGL M;  3LEQ A;  3UE1 A;  1MXO A;  3BW6 A;  2ZC5 B;  4PAU A;  3DWZ A;  5HZH A;  4PPR A;  2M1C A;  2Y2Q A;  4XUZ A;  4LV1 A;  4S2I A;  4ZJ3 A;  3V3S A;  1NZU A;  4BMW A;  1TD5 A;  5AJG A;  4MBK A;  3BYD A;  4RX3 A;  4P6B A;  4BBV A;  4WZ4 A;  5HPF A;  3LR5 A;  4RYE A;  5FQ9 A;  2W27 A;  1YLT A;  2O9A A;  5HPI A;  3GEC A;  4M3K A;  3A0R A;  1GSV A;  4CQH A;  4YWZ A;  5MC7 A;  1JWZ A;  5E2G A;  2PU2 A;  3TJZ C;  3VSL A;  3C4P A;  2YKF A;  1MY8 A;  4JGO A;  2Y2G A;  3IXG A;  1YLY A;  1LT0 A;  3WS4 A;  2H5S A;  1BSG A;  4KZ9 A;  5TR7 A;  3EGX C;  3KYE A;  5HAR A;  2QJ7 A;  3D4F A;  2EXA A;  4P6Z M;  3C7V A;  1FR6 A;  4G3W A;  3R7W A;  3ZG0 A;  3FG8 A;  2X71 A;  2B95 A;  2HJ9 C;  5GLD A;  4K08 A;  3UB7 A;  3HL9 A;  1K6R A;  1L3L A;  2O9C A;  2A3U A;  1ERO A;  1L0F A;  2XSS A;  3G2Z A;  1F98 A;  2ZC4 B;  5G4Z A;  3VE3 A;  3LYX A;  1O07 A;  2XFT A;  2Z6C A;  4OLD A;  2ZD8 A;  1J3W A;  1PYY A;  3HLD A;  4HIA A;  4UHU A;  1O7E A;  2J9O A;  4F3L B;  4EUV A;  3ITB A;  3VOY A;  1BLS A;  4IUK A;  5M1A A;  3NY4 A;  4R0Q A;  4WYY A;  3UO9 A;  1SKO B;  2G7U A;  4OH0 A;  5D3O A;  1JWV A;  1N4O A;  2E8J A;  3FZC A;  3KSG A;  1KVM A;  1OTE A;  3IS2 B;  2WKQ A;  5A90 A;  4KUK A;  1OME A;  3HRE A;  1T1C A;  2JHE A;  5HD3 A;  2DMW A;  4EUZ A;  4QPR A;  1QME A;  3QNC A;  1FR1 A;  4WN5 A;  1NRJ A;  3NCK A;  3DBA A;  3VP2 A;  3A3F A;  3MF0 A;  1ESU A;  3B3X A;  3ZG5 A;  3M2K A;  3PR6 A;  3IQA A;  3PAG A;  3PYP A;  3S7P A;  4LLO B;  2Y2O A;  5CTN A; 
#chains in the Genus database with same CATH homology
 4EES A;  5IT5 A;  4O8G A;  1UWN X;  1P9W A;  3B33 A;  2M7U A;  2FH5 A;  1T18 A;  2XA7 S;  3C8C A;  3PBS A;  4RQ9 A;  1GSW A;  3A0V A;  4HH3 A;  2V0W A;  3ZQ5 A;  2VV6 A;  3E4Q A;  3F1N B;  1DRM A;  3NOT C;  5F6A A;  2W3G A;  2VX8 A;  3EEH A;  3F1N A;  4LRX C;  4Y2F A;  4BJP A;  2PT7 A;  4I39 A;  3NOU C;  1P0Z A;  4BBT A;  4GHI B;  3OOV A;  4PKY A;  1T1A A;  2P7J A;  1VB6 A;  2W0N A;  1TS0 A;  1LL8 A;  2QWS A;  4GHI A;  4HJ6 A;  2KDK A;  5TJJ A;  4KUO A;  3NOP C;  1MZU A;  3FPV A;  4P6Z S;  4ARZ B;  1OTI A;  4MCW A;  3C2W A;  4I5S A;  4HJ3 A;  4I38 A;  3K2N A;  4ARZ A;  2J3T D;  1XFN A;  1S4S A;  4NXG A;  3LUQ A;  4DJ3 A;  2JKT I;  4DJ2 A;  3S7Q A;  4PKY G;  4YOF A;  3TE8 A;  4JGP A;  4NXB A;  3K3C A;  2H28 A;  4G3V A;  4HOI A;  1OTD A;  2A24 B;  3BQA A;  1D7E A;  3LR4 A;  4G3K A;  2OAP 1;  2PYR A;  3T4K A;  4CLC B;  3ICY A;  4HNB A;  2VV7 A;  5DF9 A;  5J3W A;  4IUH A;  3OCL A;  3PHY A;  2A24 A;  3P01 A;  4MN5 A;  4R70 A;  3UMD A;  3VV4 A;  2W1R A;  4Q0J A;  1VHM A;  4CLC A;  4R3A A;  2K7S A;  4O0P A;  1ZTU A;  3T4T A;  2K31 A;  4Z1W A;  2VZW A;  3EQU A;  4GW9 A;  4OOM A;  2O99 A;  2FZ0 A;  5IU1 A;  3UB9 A;  1XFQ A;  3F1O B;  4DMZ A;  3VE4 A;  3V67 A;  2PDR A;  3LI8 A;  3PBN A;  1S67 L;  4II7 A;  5HL6 A;  5K5B A;  4MDZ A;  3E0Y A;  3F1O A;  3RFB A;  2ZOI A;  4EXO A;  2MJ6 A;  3UB8 A;  3LR0 A;  1TS8 A;  2L4R A;  5G4Y A;  2PHY A;  3B47 A;  3H7W B;  1OJG A;  3UME A;  3HCY A;  3EGD C;  4EER A;  2OAQ 1;  2PD7 A;  1YSQ A;  2YKH A;  3KO6 A;  3MFX A;  3JVU A;  2J3W A;  2EWW A;  3H7W A;  4M4X A;  1MKM A;  2IA2 A;  3MQ0 A;  5J7E A;  2WKR A;  3BWL A;  3KSI A;  2HGV A;  3FC7 A;  4EET B;  5TBM B;  4I3A A;  2HV1 A;  2JKR I;  2WKP A;  4YNR A;  3T50 A;  5DKL A;  2VLG A;  1P9R A;  3VOL A;  3K3D A;  5TBM A;  1OT6 A;  1GSX A;  2KLI A;  4IJG A;  4ME4 A;  5CX7 A;  4L9G A;  3LR3 A;  2JKR M;  4NXE A;  5EFW A;  4H6J B;  3PBT A;  1YKD A;  4IHQ A;  2ZOH A;  4LPZ A;  4UEY A;  4GS9 B;  2W1T B;  4GS9 A;  3T4J A;  4WEL A;  1XJ4 A;  3ULF A;  2W1T A;  3CLO A;  3LIA A;  4R38 A;  2OWJ A;  1N9O A;  2B02 A;  1YSP A;  1OJ5 A;  1NLZ A;  3P7N A;  3BY8 A;  3PBQ A;  4ETZ A;  2OOL A;  4WUJ A;  2QYB A;  2XRN A;  3FPW A;  3E4P A;  3RH8 B;  2KOI A;  3MJQ A;  1WA9 A;  3A0S A;  4B93 A;  3EQV A;  2PD8 A;  1S66 L;  4EEP A;  3NJA A;  2ZBB A;  5A8B A;  5DJU A;  1S1Y A;  1P97 A;  3OC2 A;  3CIT A;  5AVE A;  4HH2 A;  5C5K A;  5DJT A;  4ETX A;  4WEK A;  2ZMV A;  1W63 M;  2JN7 A;  4HI4 A;  4HY8 A;  3S7O A;  1H8M A;  4R6L A;  5HSQ A;  4CLC C;  3PBR A;  2HF6 A;  1T1B A;  1DP8 A;  5HD5 A;  4B9O A;  2P08 A;  2JKT M;  2L0W A;  2O0Y A;  2D02 A;  2EA9 A;  3C38 A;  2B18 A;  3KSH A;  3LFV A;  2Y8H A;  3OBF A;  4MN7 A;  3U2A A;  4CLC E;  3RTY A;  1G6O A;  4EW7 A;  4GJ4 A;  4HHD A;  3S7N A;  3NHQ A;  4PHT A;  1OPX A;  2GX5 A;  2K2N A;  2QHK A;  1V9Z A;  4L0L A;  2P04 A;  1XJ6 A;  1X0O A;  1OTA A;  3CAX A;  4LRY C;  3EOI A;  2HJE A;  5F5Y A;  4HP9 A;  2BAS A;  4EEU A;  1Y28 A;  1OTB A;  5HWV A;  3IBJ A;  1S1Z A;  3E98 A;  3UB6 A;  4WEJ A;  4KQD A;  4UQI M;  4Q0I A;  2V9A A;  2PR6 A;  2Z6D A;  3HJI A;  1F5M A;  1V9Y A;  3KX0 X;  1H3Q A;  3BJN A;  1KOU A;  4Y5F A;  5AVF A;  2LB5 A;  4Y3I A;  3D72 A;  2GJ3 A;  2M7V A;  5DFY A;  3MQO A;  1UWP X;  3T4L A;  3T4O A;  3T4Q A;  2KX6 A;  4EU0 A;  5HWT A;  2J80 A;  4WLA A;  4I3J A;  4BBU A;  1STZ A;  2VGL M;  3PXP A;  5IS1 A;  3R4K A;  3E4O A;  3TW8 A;  3BW6 A;  3UE6 A;  3SW1 A;  4PAU A;  3T4S A;  2J3T C;  1XJ2 A;  5I5L A;  5DFX A;  4WF0 A;  4ZRR A;  5HZH A;  2M1C A;  2QKP A;  3JVV A;  2W3H A;  3F1P B;  1MC0 A;  1S4R A;  1LSW A;  2VKS A;  4BMW A;  1TD5 A;  5AJG A;  5F68 A;  3KYQ A;  3F1P A;  2I9V A;  4BBV A;  5HDC A;  4JGQ A;  5HPF A;  3CI6 A;  1JNU A;  4H6J A;  3LR5 A;  3H82 B;  1NLY A;  1IOU A;  4NKP A;  3TRC A;  3B42 A;  2W27 A;  2GNX A;  4EQ1 A;  4JGR A;  3LID A;  1ODV A;  2W3F A;  3H82 A;  1UGU A;  2O9A A;  4L9F A;  1IFQ A;  1TF1 A;  5HPI A;  3GEC A;  1TS6 A;  3A0R A;  1GSV A;  2PR5 A;  4HQA A;  2VA0 A;  4O01 A;  4CQH A;  2PYP A;  4YWZ A;  2XRO A;  2LB9 A;  4I3I A;  5MC7 A;  1T19 A;  2Y79 A;  3KYZ A;  2XA7 M;  3GDI A;  1D06 A;  1NWZ A;  3TJZ C;  1LSX A;  1BYW A;  2YKF A;  3LIE A;  2GZA A;  4JGO A;  1LSV A;  1LT0 A;  3OLO A;  2EWV A;  5HDD A;  5L8M A;  2R78 A;  1DP9 A;  3OCN A;  2O9B A;  4AFI A;  2VJW A;  4FOF A;  3EGX C;  5J4E A;  2V1B A;  4MMN A;  2QJ7 A;  4L9E A;  3R7W B;  3G6O A;  4HJ4 A;  2W3E A;  4DN0 A;  4WL9 A;  5KIZ A;  4P6Z M;  4G3W A;  3R7W A;  3FG8 A;  5LBR A;  4KQO A;  2HJ9 C;  4K08 A;  3UB7 A;  4GLQ A;  3LIC A;  2A2L A;  2O9C A;  2VV8 A;  3LIF A;  4E04 A;  1N9L A;  3IBR A;  2XSS A;  3BQ8 A;  2INW A;  4LRZ E;  3ZYT A;  1F98 A;  2NUT C;  4UQI S;  5G4Z A;  3VE3 A;  3LYX A;  5HWW A;  2OWH A;  4Q0H A;  1DP6 A;  2Z6C A;  2CMN A;  4OOL A;  3LIB A;  2QJ5 A;  3D3O A;  4HIA A;  5KSH A;  5FL3 A;  3PBO A;  1TS7 A;  3CUE C;  3W2Z A;  4F3L B;  4EUV A;  3LI9 A;  4HP4 A;  3C30 A;  4GCZ A;  5DKK A;  2VGL S;  4IUK A;  4BWI A;  4F3L A;  4NXF A;  2L1M A;  1N9N A;  2G7U A;  3H9W A;  3MXQ A;  2V1A A;  3MR0 A;  3CUE A;  3O5Y A;  1W63 Q;  3UE3 A;  3HJK A;  3BY9 A;  3KSG A;  1ZHH B;  2VEA A;  1OTE A;  3IS2 B;  4MN6 A;  2WKQ A;  3KSF A;  3MMH A;  1G28 A;  4KUK A;  1F9I A;  1YAX A;  4NEE D;  1T1C A;  2ZMF A;  2V0U A;  2JHE A;  3IS2 A;  1XJ3 A;  3EWK A;  5HD3 A;  2DMW A;  4QPR A;  4XT2 B;  4WN5 A;  3EEA A;  1NRJ A;  3DBA A;  5F69 A;  4CLC D;  4FSF A;  2W3D A;  3MF0 A;  4XT2 A;  2NUP C;  1OT9 A;  3PR6 A;  3CWF A;  5HDS A;  3S7P A;  3PYP A;  4LLO B;  2D01 A;  1EW0 A;  3MQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...