4HP4A

Crystal structure of pas domain from the fruit-fly elk potassium channel
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
123
structure length
112
Chain Sequence
NTFLDTIATRFDGTHSNFVLGNAQANGNPIVYCSDGFVDLTGYSRAQIMQGCSCHFLYGPDTEEHQQIESLSNMELLEVIFYEGAPFWCLFDIVPINERDVVLFLASHDITH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eag-like K[+] channel
publication title Structural properties of PAS domains from the KCNH potassium channels
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein
total genus 26
structure length 112
sequence length 123
chains with identical sequence B
ec nomenclature ec 2.7.3.-:
pdb deposition date 2012-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hp4A00
2M1CA 3MR0A 5EFWA 4DJ2A 4HJ6A 3LICA 1UWNX 1GSWA 3KX0X 3H82B 3LYXA 1LL8A 2PHYA 1DP8A 4BBUA 1DP9A 2QJ7A 4YWZA 3VE4A 3ULFA 4WN5A 2R78A 2PYRA 1D7EA 4XT2B 2OWHA 3PHYA 4JGPA 3GECA 1NWZA 2PR6A 3SW1A 2OWJA 3NOUC 1KOUA 1T18A 5IU1A 4HIAA 4F3LB 4HNBA 2Z6DA 5KIZA 2V0UA 4DJ3A 4GW9A 1TS8A 2PR5A 5AVFA 2OOLA 2A24B 5I5LA 4WLAA 1T19A 2D01A 4EW7A 3NHQA 4GS9B 1V9ZA 3T50A 4HHDA 3B33A 3LIFA 1UGUA 2PDRA 2GJ3A 2L4RA 4HJ3A 2VLGA 5HDDA 5HWTA 2KDKA 3MQOA 4WL9A 3EEHA 1S4SA 3C8CA 4KUKA 1XJ6A 2ZBBA 4NXGA 4I3IA 3A0RA 4MN5A 1JNUA 4EQ1A 1LSXA 4RQ9A 5TBMB 4H6JA 1S67L 5A8BA 2HV1A 1OJGA 4GHIB 3MJQA 3UB7A 5HD3A 2QKPA 3LI8A 4KQDA 3H7WA 5G4YA 1T1CA 4E04A 5G4ZA 1GSXA 3GDIA 3IS2A 3MFXA 4EEPA 1TS7A 3BY9A 2I9VA 4I3AA 4HH3A 1D06A 1V9YA 4L9FA 1N9OA 3F1NB 3F1OA 2BASA 1OT9A 1F9IA 2YKHA 3HJKA 2K7SA 2Z6CA 1MZUA 2P7JA 4HH2A 4WF0A 4HI4A 3F1PA 4JGQA 1N9LA 5HWVA 4JGRA 1G28A 2JN7A 5J3WA 4LLOB 4EXOA 1BYWA 2V0WA 4HP9A 1DRMA 1S4RA 4BBVA 1Y28A 3OLOA 3K3CA 5HWWA 3H82A 2PYPA 4BBTA 4R38A 3RH8B 3ZQ5A 1WA9A 2V1AA 4I5SA 2YKFA 3A0VA 2V9AA 4XT2A 1LSWA 3UB9A 4EERA 3EWKA 4L9GA 4HY8A 2QWSA 4R3AA 5F69A 3NOTC 4PKYG 4NXBA 4HP4A 3NJAA 2WKRA 1S1YA 3C2WA 1OT6A 1OJ5A 2W27A 3P7NA 4R6LA 4F3LA 3FC7A 4I3JA 3CAXA 3G6OA 3LIAA 3CWFA 3E4QA 1TS0A 5AVEA 2H28A 2VV7A 1X0OA 4M4XA 5J7EA 4B9OA 2A24A 5DJUA 1XFQA 5HDCA 1F98A 2V1BA 1T1BA 4EEUA 1P97A 4GS9A 4K08A 3LUQA 2L1MA 1OTIA 1OTBA 3PYPA 4HOIA 3LIDA 3E4OA 1TS6A 4L9EA 4JGOA 2QJ5A 2EA9A 4NXEA 4WUJA 3A0SA 3UE6A 2PD8A 4HJ4A 5TBMA 2INWA 5IS1A 4EESA 3VOLA 3NOPC 4GHIA 2B02A 1GSVA 3K3DA 4LPZA 5DJTA 2WKQA 1XJ2A 2PD7A 3LI9A 1LSVA 1T1AA 5F68A 5HSQA 1XJ3A 3BY8A 2VV6A 3HJIA 4GCZA 4NXFA 1VB6A 1OTDA 1XFNA 4I38A 2L0WA 3UB6A 2ZOHA 3IBRA 1XJ4A 1N9NA 3BWLA 3D72A 3F1NA 4PKYA 2D02A 4H6JB 1DP6A 4KUOA 2J80A 5HZHA 1OTAA 1P0ZA 3H9WA 2QHKA 3ICYA 4EETB 3H7WB 5DKLA 3LIBA 2CMNA 1LT0A 1UWPX 3CLOA 3RTYA 5J4EA 4R70A 2WKPA 1ODVA 4LRYC 3IS2B 4I39A 5F5YA 4LRZE 3UB8A 3UMEA 1OTEA 2KX6A 3E4PA 2VEAA 3MQQA 5HDSA 2ZOIA 4LRXC 5F6AA 3VE3A 5DKKA 3F1OB 3LIEA 1EW0A 2JHEA 3UMDA 1S66L 1S1ZA 2W0NA 3FG8A 5HD5A 2VV8A 3F1PB 4MN6A 4HQAA 3MXQA
chains in the Genus database with same CATH superfamily
5L07A 1W8QA 2GDNA 2WZZA 2QMIA 1ES5A 5TFQA 2WGWB 1BULA 1UWNX 1I2SA 2H0YA 3LFVA 1YM1A 1YQSA 3LY4A 2FFFB 4BBUA 4P85A 3HREA 2JKTM 2ZM2A 4OPRA 4OQ0A 2HJ9C 1SZVA 3W2ZA 1WE4A 2GZAA 1FCNA 1D7EA 2BG1A 3WS5A 1MWUA 4S2JA 4CLCD 2ZLYA 3IBJA 4U3TA 4CPKA 3UE1A 3ZVTA 3ZNYA 4MBHA 2WKHA 4Y17A 3NOUC 3OCNA 1KOUA 3HLFA 4HIAA 1XGIA 2V2FF 3BECA 2Z6DA 2M7UA 4ESPA 1KE4A 3T4TA 1VQQA 1Q2QA 2XDMA 1TS8A 4MBFA 2PR5A 3MFDA 3Q1FA 5HL6A 5DF8A 3DBAA 3ZFZA 5DTKA 5MC7A 1IYQA 2WAFA 3NHQA 1V9ZA 3LY3A 1L0EA 2A2LA 2Y55A 1YLWA 4HJ3A 1MY8A 1XPBA 1ZG6A 2ZMAA 2ZQ9A 3EEHA 3QHYA 4ZJ3A 3UPOA 4NXGA 3MZDA 3V3SA 3A3DA 3A3EA 4E6WA 1NYYA 4U0XA 4OQGA 5TBMB 4H6JA 1S0WA 3B3XA 1S67L 5U47A 5AQBA 2V20A 5HD3A 2JKFA 3LI8A 1TEMA 3P01A 4PM7A 5G4YA 3DTMA 1E25A 3B42A 4JKTA 1W5DA 5KSCA 1U60A 3GDIA 5AQAA 5CHUA 4R23A 4EEPA 4WMCD 2ACGA 5HPIA 2XR0A 3IHAA 1G6AA 5KZHA 3KSHA 3E2KA 3T1RA 3ZYTA 4E3LA 4FOFA 5E43A 1F9IA 3P98A 1KGEA 1N9BA 1MZUA 2P7JA 1GA0A 4HH2A 1WYCA 4KG2A 4L0LA 1EWZA 2JN7A 2XQZA 1ONGA 5CGWA 3K2NA 1BYWA 2NUPC 2GNXA 1K25A 4BL2A 2WGWA 3U2AA 4BLMA 2P9VA 3K3CA 3V3RA 2VGJA 5HAPA 5HWWA 5BOHA 2PYPA 3L9KA 4D2OA 1FILA 1YKDA 3IH8A 2EWVA 3ZNTA 3TG9A 2VK3A 1NXYA 2UWXA 1AXBA 1WA9A 1K54C 2VX8A 3WRTA 3IF5A 4I5SA 4O7DA 4E3NA 2Y2NA 1IYPA 1HZOA 1YLTA 1IFQA 5A93A 1ACFA 5HAIA 3SOIA 4C6YA 3CUEC 3EWKA 1YLYA 3NOTC 4PKYG 4HP4A 3KYEA 3NDEA 3CMZA 4LV0A 3LR0A 2EFXA 5FAPA 3PR6A 1H5XA 1EI5A 2W27A 5JYOA 1NRJA 3VSLA 2JKRI 4B88A 5HFOA 3BLSA 5CECA 1ZHHB 2ZC7A 4DDSA 3LIAA 3TW8A 2ZL1A 1J9MA 4RA7A 3AGFA 1DJCA 5AJGA 3LR5A 5AVEA 4YFMA 2VV7A 1X0OA 2CC1A 1LHYA 3EGXC 2XROA 2Q9MA 4DXBA 3E2LA 1Z6FA 1FR6A 2FFYA 1F98A 1P97A 4BL3A 2A3UA 3V5MA 2IA2A 5DFYA 1VEUA 3CITA 1K6RA 3IXGA 4FTXA 1OTIA 4WBGA 5HARA 3W8KA 4QPRA 1RGZA 1CI9A 3WS1A 1VHMA 4PPRA 4RX3A 1FIKA 3IXHA 3HL9A 4KZ3A 1S6RA 4WUJA 3DTEA 3GV9A 2Y2MA 3NDGA 1W79A 5TBMA 4EESA 1TDGA 3QP8A 3TE8A 1PZOA 3K3DA 2WKQA 3LI9A 2IWBA 4G3VA 3UPPA 1T1AA 2FZ0A 1NRFA 1YPRA 3KYZA 5EPHA 5GHXA 4JXVA 3LR3A 3CG5A 2QPNA 1JVJA 2DRWA 4EWFA 2HDUA 3UE3A 2ZQ7A 4DN0A 4YNRA 2ZOHA 3W4OA 2HF6A 1YLJA 4FSFA 3EEAA 2OSUA 3EGDC 3QP4A 4OQIA 4LV2A 4XXRA 2D02A 4LENA 1LI0A 5AQ7A 4KUOA 5CHJA 3UDXA 1OTAA 2Y2LA 4OH0A 4K0WA 5L8MA 2VA0A 1K56D 3VV4A 3CLOA 5J4EA 4JF4A 2WKPA 1ODVA 1NZUA 1BT5A 3BFFA 1L0GA 3S4XA 3UMEA 2C5WB 2V1ZA 3S7QA 5TR7A 3G2YA 2VEAA 1K38A 3I7JA 3JPUA 5EV0A 3MSHA 2XSSA 4LRXC 3UPNA 4PM9A 3VE3A 3DTIA 4WMCA 5CTNA 1LL5A 2NUTC 3LIEA 4DMZA 3P09A 2ZMVA 4JXWA 1ONHA 3FG8A 5HD5A 3M6HA 2VV8A 5FAQA 3UB5P 3MXQA 1F5MA 3S7PA 1YLPA 3NCKA 3IT9A 2M1CA 3R7WB 4KZBA 3WS4A 1XP4A 5DF7A 4DJ2A 4GN2A 1K6SA 1GSWA 4QHCA 4BMWA 3H82B 2E8JA 3LYXA 2VKSA 3O88A 5FI6A 5EM1A 2J8YA 2ZC5B 1GCEA 4YWZA 3VE4A 5HX9A 5E2EA 2XRNA 1PFLA 4HESA 4OQHA 4XT2B 3CPTB 2OWHA 3NY4A 5K5BA 3HBRA 5HAQA 2HJEA 2XH9A 3IH9A 2HP9A 3O3VA 3FYZA 3VFHA 5F82A 3PBTA 4MDZA 4EV4A 1T18A 3SZTA 5EM0A 4HNBA 4N1HA 4MBKA 3Q81A 4A5RA 4OVDA 1XA1A 3IWQA 4DJ3A 5FATA 4GW9A 5IHVA 5GL9A 4OP8A 3QP6A 2G2WA 2K31A 2ZQDA 4UAAA 4N92A 4GS9B 4JLFA 4FUWA 1ES4A 4HHDA 5DVAA 3SH7A 3B33A 4DE3A 1UGUA 1KGGA 2GJ3A 1XKZA 2O9CA 4N1XA 1SKFA 3S7NA 2JCHA 4P87A 3C7VA 2W3EA 2Q0OA 1YLZA 1XA7A 3BQAA 2O0YA 5EVIC 3A0RA 1W7FA 2W3DA 4QWOA 4O0PA 4ZBEA 2P04A 3C5AA 4EQ1A 3FZCA 3CUEA 4DXCA 3KSFA 4MMNA 1IELA 3FWLA 5JYPA 3EOIA 4GHIB 3MJQA 2XLNA 4DRTA 2PU4A 4X68A 4H8RA 1MBLA 1Y54A 3V67A 4OOYA 1A0KA 4IHQA 1VETB 3HUMA 4LFUA 2H10A 5EECA 1HD8A 4GDBA 4B93A 4HH3A 3TRCA 3PBQA 5FQKA 2EWWA 4GD6A 4WZ5C 3SS5A 1ZKJA 2VGLS 4ZAMA 3S22A 2BASA 3IF6C 1OT9A 3HJKA 2K7SA 2Z6CA 2EX6A 1IYOA 1ZC2A 3MZEA 4OPZA 2DCFA 5EVID 1KE3A 3QNBA 1N9LA 1G28A 5TJJA 4DKIA 2H5SA 1PNEA 2XF3A 4LLOB 3R7WA 1NZOA 5CXWA 4HP9A 3BFGA 2O99A 1Y28A 3CZDA 4R1GA 4GLQA 3H82A 5FSRA 4X1MA 3U4LP 1OMEA 4OLGA 2XFTA 4UQIS 3T1SA 4R38A 5CGXA 2P08A 2Y2QA 1PRQA 3FKWA 3M6BA 3C7UA 3BW6A 1KDWA 4BWIA 1MWRA 2LB9A 1KGFA 4XT2A 3TOIA 4NEED 2QWSA 5M19A 3IX4A 4II7A 4D60A 3RFBA 1BLCA 4PMAA 4OLDA 3HLDA 4CLCB 2W3FA 1WYBA 4QY6A 3ZG7B 3C2WA 5EVIB 2WGVA 1OJ5A 4XUXA 3N6IA 1LL9A 4R6LA 3PBNA 3SH8A 1GHMA 3FC7A 5I94A 2I72A 2HDSA 2ZJ9A 4Y5FA 4GKUA 3GRJA 1TS0A 2H28A 3OPPA 4IJGA 3SS4A 3MMHA 2MJ6A 3ZG5A 4RVAA 5EOEA 1XGJA 2G7UA 2Y2HA 1T1BA 2X01A 4EEUA 4Z9QA 4GS9A 3EQVA 3NECA 4S2NC 3IWIA 3D4FA 4X55A 3LUQA 4E3KA 1OTBA 4HBUA 2V8FA 3LGOA 3G35A 2IWCA 4UHUA 4EUVA 4JGOA 3PBOA 4UA7A 3A0SA 3ZG9B 3UE6A 2PBDP 2PU2A 1K55C 2PD8A 4PAUA 4HJ4A 5M1AA 1SKOB 2QYBA 4LV3A 2WKEA 3GQZA 4GHIA 5C5KA 1H0MA 5DJTA 2PD7A 1LSVA 4KQRA 1XXMA 5HSQA 4NXFA 3ZG0A 1VB6A 4R0QA 5L09A 3AGDA 1K0KA 1XFNA 3Q7VB 4ZDXA 1FR1A 3M2JA 2ZQ8A 1F2KA 3VP3A 2XD5A 3IBRA 4EBLA 5HPFA 1SHVA 4GNUA 1XJ4A 2V8CA 1PWDA 2QZ6A 3PBSA 4QB8A 3IXDA 1P0ZA 3Q82A 3V39A 3VOYA 4FCFA 3VFFA 3D3OA 3HLEA 4X6TA 4OONA 3H7WB 1MWTA 1LT0A 4UA6A 1K57A 1NY0A 2EXAA 3IS2B 1KDSA 1N4OA 3LR4A 1YMSA 3MXRA 2KX6A 4JXSA 1YMXA 4ZTKA 4KZ6A 2ZOIA 2OV5A 3VP2A 2EFUA 4R3BA 3OBFA 5F6AA 3F1OB 5FDHA 2HP6A 2HDQA 1S66L 4Q0IA 1ZG4A 3T4LA 1D1JA 2LB5A 1YAXA 4MN6A 4S2KA 2J3TC 4EBPA 1Z09A 4CLCA 5EFWA 3ZHHA 4HJ6A 2EX9A 3LICA 1L0FA 3LEQA 3CJMA 1LL8A 3A3FA 1DP8A 4WEJA 4Z1WA 1DP9A 3BLMA 3C4OA 4HEFA 1L3LA 4WN5A 2R78A 2PYRA 2HGVA 3G31A 5GLDA 1DJAA 3GMWA 1ESUA 2W1TB 3PHYA 4JGPA 3GECA 2ZM0A 3UE0A 5FI7A 4QJGA 3SW1A 2H0TA 4KQQA 1GA9A 1FOFA 2ZM8A 1CI8A 4Q8IA 4KZ5A 3ZVWA 2K2NA 4WZ4A 3A3JA 1JWPA 4FD8A 4OPYA 2Y2PA 4E6XA 4ARZB 2J3TD 3NC8A 1RCJA 3BM6A 1MWSA 1PI4A 1K4FA 1FCMA 3IX3A 2Y79A 3NI9A 2A24B 4WLAA 1SKOA 4GDNA 3BJNA 4KZ8A 5EE8A 3CHWP 4EW7A 1PWCA 1BTLA 3T50A 4MEZA 1BSGA 2RL3A 4BENA 2XEPA 2PDRA 2L4RA 1FCOA 4QD4A 5HDDA 4S2LA 5FQQA 2KDKA 3DTKA 4WL9A 4ETXA 3C8CA 4KUKA 1XJ6A 2KLIA 4BD1A 3WS0A 5HL1A 3KO6A 1CF0A 4PM8A 3GR2A 2ZC4B 3PTEA 1DJBA 1LSXA 4RQ9A 1CQAA 2EX2A 2X71A 2P74A 1OJGA 5CTMA 5E2HA 3VP4A 3MKEA 2VJWA 4KQDA 3H7WA 5A92A 4LV1A 3HVFA 3D9YA 3W4QA 1T1CA 3S7OA 4E04A 1ESIA 3IS2A 5CERA 1IEMA 4OOMA 1TF1A 3GSGA 3MFXA 3JYIA 2Y4AA 2I9VA 1O07A 3MQ0A 4PHTA 2WUQA 4IEDA 2GX5A 1RGYA 1V9YA 4L9FA 4Q0JA 2BLSA 4M3KA 4YOFA 3F1NB 1MXOA 3HLGA 4LCLA 3F1OA 3LO7A 2WZXA 2JE5A 3T1QB 4KG6A 4KZ7A 2YKHA 3N4IA 3N8RA 3Q07A 2W3HA 4HI4A 1HTZA 4JGRA 4IVIA 4UEYA 5J3WA 2V0WA 5GLCA 2PBYA 1G6OA 3T4JA 1S4RA 5GHYA 3UDFA 1FSWA 4NG2A 1KVMA 3VMAA 3WWXA 4CJNA 3TJZC 5FI2A 3OPLA 4BBTA 3N8SA 3ZQ5A 3NULA 2B5RA 3FPVA 4S2IA 5FQMA 1BLSA 2YKFA 3M2KA 1PI5A 2XA7S 5CHMA 3N7WA 3C38A 3MBZA 4MN7A 1LSWA 3QP5A 5F1FA 2W1TA 3DWZA 4KENB 4L9GA 4HY8A 3MF0A 4R3AA 5F69A 3WS2A 3VP1A 5E2GA 1RP5A 4WM9A 2DNSA 2WKRA 1K54A 5FDSA 1OT6A 4X69A 2C6WB 3P7NA 1FQGA 3UN7A 4Y0TA 2O9BA 1IKGA 4AFIA 2G2UA 4ME4A 3G6OA 3PAEA 3CWFA 3E4QA 3RXWA 4BJPA 4OKPA 5CEDA 1SCWA 2ZQAA 4ETZA 1C3BA 4EU0A 3OZHA 3BYDA 4NETA 2A24A 2XFSA 3QP1A 1XFQA 5HDCA 3LEZA 4B4XA 4RYEA 4JPMA 3ITAA 4E3OA 5E2FA 4K91A 3GTCA 3KSGA 1TDLA 3R4KA 2WKIA 3B47A 2M7VA 4HOIA 1IYSA 2OAQ1 3LIDA 3E4OA 2P9VB 1TS6A 3TSGA 1P9WA 2Y91A 2QJ5A 4NXEA 3T4KA 2HDRA 5IS1A 3BEBA 5KSHA 3NOPC 1NJ4A 1CK3A 2B02A 4LPZA 2J9PA 4MNRA 2VZWA 3IHBA 1XJ3A 3HJIA 4GCZA 5CRFA 3UY6A 1Y4OA 3NIAA 4KZAA 2B95A 1GHIA 1K56A 1MKMA 1M6KA 4P0MA 4I38A 3UB6A 4FH4A 5CGSA 1TD5A 1PIOA 2J7VA 3BWLA 2KOIA 3D72A 3F1NA 4X53A 2ZL1B 3SH9A 3ZCZA 4MLLA 3CPTA 5HZHA 1PZPA 4BD0A 1H8MA 3H9WA 4G3KA 3IQAA 3G4PA 3LIBA 4LCMA 4R70A 4LRYC 4WYYA 2JKGA 1XX2A 1VEUB 2WADA 3UB8A 1OTEA 5J8XA 4OOLA 3BRMA 1AWIA 3ZDJA 3HLCA 1IKIA 4X25A 2Y2JA 4S2PA 5F83A 1NLZA 3JVVA 4RX2A 1LI9A 1MC0A 1ALQA 4Y7PA 1EW0A 2JHEA 3UMDA 2HZ5A 1S1ZA 2W0NA 4Y0UA 1H8YA 2WYXA 5EOOA 2HP5A 2Z2MB 3F1PB 5TGFA 2PRFA 4HQAA 5FQIA 3G2ZA 4Y15A 3O86A 3MR0A 1E3UD 3SS3A 4BQMA 3IF6B 3KX0X 3HLWA 2Y8HA 3OOVA 2PHYA 2WK0A 3UO9A 3AGEA 3ISGA 3LCEA 2QJ7A 4DE0A 3MS6A 3ULFA 3IXBA 1M40A 5AQ9A 3DWKA 3FKVA 3BFCA 5DTSA 2JC7A 3T4QA 1BLPA 2O9AA 5FEFA 1VETA 1O7EA 3V50A 1NWZA 2PR6A 4KZ9A 4P6ZS 4ZJ1A 2XA7M 2OWJA 2Y2KA 4X1LA 4F94A 2J3WA 3G34A 4IVKA 4GB7A 3UNWA 3N8LA 5IU1A 2R9WA 4F3LB 4IBXA 3BQ8A 5EUAA 2HPBA 1W63M 5KIZA 3IX8A 1ZTUA 4DE2A 2V0UA 5L10A 4S2OA 2BTFP 3MXSA 3HLBA 1GHPA 4ZJ2A 4K0XA 5AVFA 2OOLA 5DFXA 5I5LA 1ES3A 1T19A 2D01A 3WRZA 4WELA 3CI6A 2W1RA 4P6BA 1IOUA 2ZMFA 1H8ZA 1W63Q 3ZG8B 2XGNA 2ZD8A 3LIFA 4QU3A 5F1GA 4NK3A 2VLGA 5HWTA 3EQUA 5IT5A 1TVFA 3MQOA 5GLAA 4MCWA 1S4SA 1PW8A 2ZBBA 2Y59A 4I3IA 1PWGA 4KZ4A 1STZA 2AVXA 3FV7A 4EBNA 1SDEA 4B4ZA 1JWZA 4EQIA 3A3IA 4MN5A 1JNUA 5FQ9A 1JTGA 3T1XA 2VGLM 5A8BA 2HV1A 4R4SA 4DF6A 5HW3A 3UB7A 5CEBA 1MPLA 3T12B 2QKPA 3RJUA 4GD8A 3O5YA 5DF9A 1EROA 5EVIA 5G4ZA 1GSXA 3T4OA 4IBRA 4G3WA 1BUEA 1TS7A 3BY9A 1G5UA 1CJFA 5M18A 3HUNA 1KVLA 4S2MA 4I3AA 4O01A 3ITBA 1D06A 3QP2A 2XD1A 4GOGA 1N9OA 2Q9NA 2EX8A 2OLVA 5DTTA 5GLBA 4UQIM 3G32A 1HVBA 4WF0A 4Y13A 2WGIA 3QNCA 2X02A 5GHZA 3F1PA 4JGQA 1J3WA 2FH5A 3T4SA 4JF6A 5HWVA 3RXXA 4C75A 1P9RA 4WZ5A 4EXOA 1ES2A 1DRMA 3UDIA 1YSQA 4BBVA 4NKPA 3OLOA 3IF6A 2RCXA 3L7HA 3VSKA 4R3JA 4JXGA 5G18A 2W3GA 5CX7A 4E3MA 3RH8B 1PW1A 2V1AA 2ZC6B 3A0VA 4R4RA 4OPQA 2J9OA 1NYMA 4IUHA 2V9AA 1CEGA 4GJ4A 3UB9A 2PT7A 4EERA 4ID4A 2E8IA 5A90A 3DW0A 4NXBA 3NJAA 1QMFA 3Q7VA 2JKTI 3BFEA 5KMWA 1S1YA 2OLUA 5FQJA 4GZBA 1ERMA 4F3LA 4Y3IA 5FL3A 1JTDA 1K4EA 4I3JA 3CAXA 4N9LA 1E3UA 3E0YA 3NBLA 3MZFA 3JVUA 4M4XA 5FA7A 4PM6A 5J7EA 4JF5A 4B9OA 2ZQCA 3PAGA 5DJUA 1I5QA 4CQHA 1PYYA 2V1BA 5LBRA 4X56A 4K08A 4QY5A 1YSPA 4CLCE 4FH2A 4Q0HA 2A49A 1Q2PA 2L1MA 2IWDA 5A91A 4Y2FA 1G68A 1NLYA 3PYPA 4HBTA 1BZAA 2VGKA 3Q7ZA 3MKFA 4P6ZM 3OPHA 2Y2GA 2B18A 2WAEA 4L9EA 4ZRRA 2EA9A 2R9XA 1JWVA 4S2NA 4DDYA 2Z2LB 3HUOA 3PXPA 2INWA 3C4PA 3G30A 4Y0OA 4KG5A 3VOLA 3O87A 5FASA 1GSVA 2PAVP 1XJ2A 3E98A 2ZC3B 2JKRM 1E4DA 5F68A 1SDNA 3BY8A 2VV6A 5FAOA 5EVLA 4PM5A 3VP0A 1CEFA 4XUZA 1OTDA 4YINA 5FEGA 2Y2IA 3HCYA 1K55A 3OPRA 2L0WA 4KQOA 4JBFA 4OP5A 1K57C 4IUKA 1N9NA 1FSYA 4PKYA 2OAP1 4H6JB 1DP6A 4WEKA 2J80A 3ZGAB 2QHKA 1YT4A 1VM1A 1BLHA 3ICYA 4UA9A 4EETB 4LGWA 1ERQA 5DKLA 4U0TA 4E3IA 2CMNA 4DE1A 3KSIA 1UWPX 2EXBA 3RTYA 3GVBA 3FPWA 1L0DA 4I39A 5F5YA 2UV0E 1QMEA 1HLUP 4LRZE 4EUZA 4ARZA 4C3QA 1I2WA 3KYQA 1DY6A 5EVEA 3E4PA 3MQQA 1KE0A 3DAVA 5HDSA 3S1YA 3BFDA 3OC2A 3IWOA 2Y2OA 1W8YA 4CLCC 4O8GA 1H3QA 5DKKA 1MKIA 2DMWA 3W4PA 1LLBA 5D3OA 3VOZA 4E3JA 5L2FA 1OPXA 2XK1A 3C30A 3OCLA 1L2SA 3PBRA 2JBFA 4N9KA
chains in the Genus database with same CATH topology
1F5MA 3S7PA 2J3TC 2M1CA 3R7WB 4CLCA 3MR0A 5EFWA 4DJ2A 4HJ6A 3LICA 1UWNX 1GSWA 3KX0X 2Y8HA 4BMWA 3H82B 3LYXA 2VKSA 3OOVA 1LL8A 2PHYA 3LFVA 1DP8A 4WEJA 4Z1WA 4BBUA 1DP9A 2QJ7A 4YWZA 2JKTM 3VE4A 3ULFA 4WN5A 2HJ9C 2R78A 2XRNA 2PYRA 3W2ZA 2HGVA 2GZAA 1D7EA 3T4QA 2O9AA 4XT2B 2OWHA 2W1TB 3PHYA 4JGPA 3GECA 4CLCD 5K5BA 1NWZA 2HJEA 2PR6A 3IBJA 3SW1A 4P6ZS 2XA7M 2OWJA 2J3WA 3PBTA 4MDZA 3NOUC 3OCNA 1KOUA 1T18A 2K2NA 5IU1A 4HIAA 4F3LB 3BQ8A 4HNBA 2Z6DA 2M7UA 1W63M 5KIZA 4ARZB 2J3TD 3T4TA 1ZTUA 2V0UA 4DJ3A 4GW9A 1TS8A 2PR5A 5HL6A 5AVFA 2Y79A 2OOLA 2A24B 5DFXA 3DBAA 5I5LA 4WLAA 3BJNA 1T19A 5MC7A 2D01A 2K31A 4WELA 4EW7A 3CI6A 2W1RA 3NHQA 1IOUA 4GS9B 2ZMFA 1V9ZA 3T50A 1W63Q 4HHDA 3B33A 3LIFA 1UGUA 2A2LA 2PDRA 2GJ3A 2L4RA 4HJ3A 2O9CA 2VLGA 3S7NA 5HDDA 5HWTA 3EQUA 2KDKA 5IT5A 3MQOA 4WL9A 3EEHA 4MCWA 1S4SA 4ETXA 2W3EA 3C8CA 4KUKA 1XJ6A 2KLIA 2ZBBA 3BQAA 4NXGA 2O0YA 3KO6A 4I3IA 1STZA 3A0RA 2W3DA 4O0PA 2P04A 4MN5A 1JNUA 4EQ1A 1LSXA 4RQ9A 3CUEA 3KSFA 4MMNA 5TBMB 4H6JA 2VGLM 1S67L 5A8BA 2HV1A 1OJGA 3EOIA 4GHIB 3MJQA 3UB7A 5HD3A 2VJWA 2QKPA 3LI8A 4KQDA 3P01A 3H7WA 5G4YA 3O5YA 3B42A 5DF9A 3V67A 1T1CA 4IHQA 3S7OA 4E04A 5G4ZA 1GSXA 3GDIA 3IS2A 3T4OA 4OOMA 1TF1A 4G3WA 3MFXA 4EEPA 1TS7A 3BY9A 4B93A 2I9VA 3MQ0A 4I3AA 4O01A 4PHTA 4HH3A 3TRCA 1D06A 5HPIA 3PBQA 2EWWA 2GX5A 1V9YA 3KSHA 4L9FA 4Q0JA 1N9OA 4YOFA 3ZYTA 2VGLS 3F1NB 3F1OA 4FOFA 2BASA 4UQIM 1OT9A 1F9IA 2YKHA 3HJKA 2K7SA 2Z6CA 1MZUA 2P7JA 4HH2A 4WF0A 2W3HA 4HI4A 3F1PA 4JGQA 1N9LA 2FH5A 3T4SA 4L0LA 5HWVA 4JGRA 1G28A 2JN7A 5TJJA 4UEYA 5J3WA 1P9RA 4LLOB 4EXOA 3R7WA 3K2NA 1BYWA 2V0WA 4HP9A 1DRMA 1G6OA 2NUPC 2GNXA 1YSQA 3T4JA 1S4RA 4BBVA 2O99A 4NKPA 1Y28A 3OLOA 3U2AA 3K3CA 4GLQA 5HWWA 3H82A 2PYPA 3TJZC 2W3GA 1YKDA 2EWVA 5CX7A 4UQIS 4BBTA 4R38A 3RH8B 3ZQ5A 1WA9A 2VX8A 3FPVA 2P08A 2V1AA 4I5SA 3BW6A 2YKFA 3A0VA 4BWIA 2XA7S 2LB9A 4IUHA 2V9AA 3C38A 4MN7A 1IFQA 4GJ4A 4XT2A 1LSWA 3UB9A 4NEED 2W1TA 2PT7A 3CUEC 3EWKA 4HY8A 4L9GA 2QWSA 3MF0A 4R3AA 4EERA 4II7A 5F69A 3RFBA 3NOTC 4PKYG 4NXBA 4HP4A 3NJAA 2JKTI 4CLCB 2W3FA 2WKRA 3LR0A 1S1YA 3C2WA 1OT6A 3PR6A 1OJ5A 2W27A 3P7NA 4R6LA 1NRJA 4F3LA 2JKRI 3PBNA 4Y3IA 5FL3A 2O9BA 3FC7A 4I3JA 4AFIA 1ZHHB 3CAXA 4ME4A 3G6OA 3LIAA 4Y5FA 3TW8A 3CWFA 3E4QA 4BJPA 1TS0A 3E0YA 5AJGA 3LR5A 2H28A 5AVEA 3JVUA 4IJGA 4ETZA 2VV7A 1X0OA 3MMHA 4M4XA 2MJ6A 4EU0A 3EGXC 2XROA 5J7EA 4B9OA 2A24A 5DJUA 1XFQA 5HDCA 2G7UA 4CQHA 1F98A 2V1BA 1T1BA 4EEUA 5LBRA 1P97A 4GS9A 3EQVA 4K08A 2IA2A 5DFYA 3CITA 1YSPA 4CLCE 3LUQA 4Q0HA 2L1MA 3KSGA 1OTIA 3R4KA 1OTBA 4Y2FA 1NLYA 4QPRA 3B47A 2M7VA 3PYPA 4HOIA 2OAQ1 3LIDA 1VHMA 3E4OA 4P6ZM 1TS6A 2B18A 4L9EA 4EUVA 1P9WA 4JGOA 2QJ5A 4ZRRA 2EA9A 4NXEA 4WUJA 3PBOA 3A0SA 3UE6A 3T4KA 2PD8A 3PXPA 4PAUA 4HJ4A 5TBMA 2INWA 5IS1A 2QYBA 4EESA 3VOLA 3NOPC 5KSHA 3TE8A 4GHIA 2B02A 5C5KA 1GSVA 3K3DA 4LPZA 5DJTA 2VZWA 2WKQA 1XJ2A 2PD7A 3LI9A 1LSVA 4G3VA 3E98A 1T1AA 2FZ0A 2JKRM 5F68A 5HSQA 3KYZA 1XJ3A 3BY8A 2VV6A 3HJIA 4GCZA 3LR3A 4NXFA 1VB6A 1OTDA 1XFNA 3UE3A 1MKMA 3HCYA 4DN0A 4I38A 2L0WA 3UB6A 4KQOA 4YNRA 2ZOHA 2HF6A 3IBRA 5HPFA 4FSFA 1TD5A 1XJ4A 4IUKA 1N9NA 3EEAA 3BWLA 3EGDC 2KOIA 3D72A 3F1NA 4PKYA 3PBSA 2D02A 2OAP1 4H6JB 1DP6A 4KUOA 2J80A 4WEKA 5HZHA 1OTAA 1P0ZA 1H8MA 3H9WA 4G3KA 2QHKA 3ICYA 3D3OA 4EETB 3H7WB 5DKLA 3LIBA 5L8MA 2VA0A 2CMNA 3KSIA 1LT0A 1UWPX 3VV4A 3CLOA 3RTYA 5J4EA 4R70A 2WKPA 3FPWA 1ODVA 4LRYC 3IS2B 4I39A 5F5YA 4LRZE 3UB8A 3LR4A 3UMEA 1OTEA 4ARZA 3KYQA 4OOLA 2KX6A 3S7QA 3E4PA 2VEAA 3MQQA 5HDSA 2ZOIA 3OC2A 2XSSA 4CLCC 1NLZA 4O8GA 3JVVA 3OBFA 4LRXC 1H3QA 5F6AA 3VE3A 5DKKA 1MC0A 3F1OB 2NUTC 3LIEA 4DMZA 2DMWA 1EW0A 2JHEA 2ZMVA 3UMDA 1S66L 4Q0IA 1S1ZA 2W0NA 3FG8A 5HD5A 3T4LA 2LB5A 1YAXA 2VV8A 3F1PB 4MN6A 1OPXA 3C30A 3OCLA 4HQAA 3PBRA 3MXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M1C A;  3MR0 A;  5EFW A;  4DJ2 A;  4HJ6 A;  3LIC A;  1UWN X;  1GSW A;  3KX0 X;  3H82 B;  3LYX A;  1LL8 A;  2PHY A;  1DP8 A;  4BBU A;  1DP9 A;  2QJ7 A;  4YWZ A;  3VE4 A;  3ULF A;  4WN5 A;  2R78 A;  2PYR A;  1D7E A;  4XT2 B;  2OWH A;  3PHY A;  4JGP A;  3GEC A;  1NWZ A;  2PR6 A;  3SW1 A;  2OWJ A;  3NOU C;  1KOU A;  1T18 A;  5IU1 A;  4HIA A;  4F3L B;  4HNB A;  2Z6D A;  5KIZ A;  2V0U A;  4DJ3 A;  4GW9 A;  1TS8 A;  2PR5 A;  5AVF A;  2OOL A;  2A24 B;  5I5L A;  4WLA A;  1T19 A;  2D01 A;  4EW7 A;  3NHQ A;  4GS9 B;  1V9Z A;  3T50 A;  4HHD A;  3B33 A;  3LIF A;  1UGU A;  2PDR A;  2GJ3 A;  2L4R A;  4HJ3 A;  2VLG A;  5HDD A;  5HWT A;  2KDK A;  3MQO A;  4WL9 A;  3EEH A;  1S4S A;  3C8C A;  4KUK A;  1XJ6 A;  2ZBB A;  4NXG A;  4I3I A;  3A0R A;  4MN5 A;  1JNU A;  4EQ1 A;  1LSX A;  4RQ9 A;  5TBM B;  4H6J A;  1S67 L;  5A8B A;  2HV1 A;  1OJG A;  4GHI B;  3MJQ A;  3UB7 A;  5HD3 A;  2QKP A;  3LI8 A;  4KQD A;  3H7W A;  5G4Y A;  1T1C A;  4E04 A;  5G4Z A;  1GSX A;  3GDI A;  3IS2 A;  3MFX A;  4EEP A;  1TS7 A;  3BY9 A;  2I9V A;  4I3A A;  4HH3 A;  1D06 A;  1V9Y A;  4L9F A;  1N9O A;  3F1N B;  3F1O A;  2BAS A;  1OT9 A;  1F9I A;  2YKH A;  3HJK A;  2K7S A;  2Z6C A;  1MZU A;  2P7J A;  4HH2 A;  4WF0 A;  4HI4 A;  3F1P A;  4JGQ A;  1N9L A;  5HWV A;  4JGR A;  1G28 A;  2JN7 A;  5J3W A;  4LLO B;  4EXO A;  1BYW A;  2V0W A;  4HP9 A;  1DRM A;  1S4R A;  4BBV A;  1Y28 A;  3OLO A;  3K3C A;  5HWW A;  3H82 A;  2PYP A;  4BBT A;  4R38 A;  3RH8 B;  3ZQ5 A;  1WA9 A;  2V1A A;  4I5S A;  2YKF A;  3A0V A;  2V9A A;  4XT2 A;  1LSW A;  3UB9 A;  4EER A;  3EWK A;  4L9G A;  4HY8 A;  2QWS A;  4R3A A;  5F69 A;  3NOT C;  4PKY G;  4NXB A;  4HP4 A;  3NJA A;  2WKR A;  1S1Y A;  3C2W A;  1OT6 A;  1OJ5 A;  2W27 A;  3P7N A;  4R6L A;  4F3L A;  3FC7 A;  4I3J A;  3CAX A;  3G6O A;  3LIA A;  3CWF A;  3E4Q A;  1TS0 A;  5AVE A;  2H28 A;  2VV7 A;  1X0O A;  4M4X A;  5J7E A;  4B9O A;  2A24 A;  5DJU A;  1XFQ A;  5HDC A;  1F98 A;  2V1B A;  1T1B A;  4EEU A;  1P97 A;  4GS9 A;  4K08 A;  3LUQ A;  2L1M A;  1OTI A;  1OTB A;  3PYP A;  4HOI A;  3LID A;  3E4O A;  1TS6 A;  4L9E A;  4JGO A;  2QJ5 A;  2EA9 A;  4NXE A;  4WUJ A;  3A0S A;  3UE6 A;  2PD8 A;  4HJ4 A;  5TBM A;  2INW A;  5IS1 A;  4EES A;  3VOL A;  3NOP C;  4GHI A;  2B02 A;  1GSV A;  3K3D A;  4LPZ A;  5DJT A;  2WKQ A;  1XJ2 A;  2PD7 A;  3LI9 A;  1LSV A;  1T1A A;  5F68 A;  5HSQ A;  1XJ3 A;  3BY8 A;  2VV6 A;  3HJI A;  4GCZ A;  4NXF A;  1VB6 A;  1OTD A;  1XFN A;  4I38 A;  2L0W A;  3UB6 A;  2ZOH A;  3IBR A;  1XJ4 A;  1N9N A;  3BWL A;  3D72 A;  3F1N A;  4PKY A;  2D02 A;  4H6J B;  1DP6 A;  4KUO A;  2J80 A;  5HZH A;  1OTA A;  1P0Z A;  3H9W A;  2QHK A;  3ICY A;  4EET B;  3H7W B;  5DKL A;  3LIB A;  2CMN A;  1LT0 A;  1UWP X;  3CLO A;  3RTY A;  5J4E A;  4R70 A;  2WKP A;  1ODV A;  4LRY C;  3IS2 B;  4I39 A;  5F5Y A;  4LRZ E;  3UB8 A;  3UME A;  1OTE A;  2KX6 A;  3E4P A;  2VEA A;  3MQQ A;  5HDS A;  2ZOI A;  4LRX C;  5F6A A;  3VE3 A;  5DKK A;  3F1O B;  3LIE A;  1EW0 A;  2JHE A;  3UMD A;  1S66 L;  1S1Z A;  2W0N A;  3FG8 A;  5HD5 A;  2VV8 A;  3F1P B;  4MN6 A;  4HQA A;  3MXQ A; 
#chains in the Genus database with same CATH topology
 5L07 A;  1W8Q A;  2GDN A;  2WZZ A;  2QMI A;  1ES5 A;  5TFQ A;  2WGW B;  1BUL A;  1UWN X;  1I2S A;  2H0Y A;  3LFV A;  1YM1 A;  1YQS A;  3LY4 A;  2FFF B;  4BBU A;  4P85 A;  3HRE A;  2JKT M;  2ZM2 A;  4OPR A;  4OQ0 A;  2HJ9 C;  1SZV A;  3W2Z A;  1WE4 A;  2GZA A;  1FCN A;  1D7E A;  2BG1 A;  3WS5 A;  1MWU A;  4S2J A;  4CLC D;  2ZLY A;  3IBJ A;  4U3T A;  4CPK A;  3UE1 A;  3ZVT A;  3ZNY A;  4MBH A;  2WKH A;  4Y17 A;  3NOU C;  3OCN A;  1KOU A;  3HLF A;  4HIA A;  1XGI A;  2V2F F;  3BEC A;  2Z6D A;  2M7U A;  4ESP A;  1KE4 A;  3T4T A;  1VQQ A;  1Q2Q A;  2XDM A;  1TS8 A;  4MBF A;  2PR5 A;  3MFD A;  3Q1F A;  5HL6 A;  5DF8 A;  3DBA A;  3ZFZ A;  5DTK A;  5MC7 A;  1IYQ A;  2WAF A;  3NHQ A;  1V9Z A;  3LY3 A;  1L0E A;  2A2L A;  2Y55 A;  1YLW A;  4HJ3 A;  1MY8 A;  1XPB A;  1ZG6 A;  2ZMA A;  2ZQ9 A;  3EEH A;  3QHY A;  4ZJ3 A;  3UPO A;  4NXG A;  3MZD A;  3V3S A;  3A3D A;  3A3E A;  4E6W A;  1NYY A;  4U0X A;  4OQG A;  5TBM B;  4H6J A;  1S0W A;  3B3X A;  1S67 L;  5U47 A;  5AQB A;  2V20 A;  5HD3 A;  2JKF A;  3LI8 A;  1TEM A;  3P01 A;  4PM7 A;  5G4Y A;  3DTM A;  1E25 A;  3B42 A;  4JKT A;  1W5D A;  5KSC A;  1U60 A;  3GDI A;  5AQA A;  5CHU A;  4R23 A;  4EEP A;  4WMC D;  2ACG A;  5HPI A;  2XR0 A;  3IHA A;  1G6A A;  5KZH A;  3KSH A;  3E2K A;  3T1R A;  3ZYT A;  4E3L A;  4FOF A;  5E43 A;  1F9I A;  3P98 A;  1KGE A;  1N9B A;  1MZU A;  2P7J A;  1GA0 A;  4HH2 A;  1WYC A;  4KG2 A;  4L0L A;  1EWZ A;  2JN7 A;  2XQZ A;  1ONG A;  5CGW A;  3K2N A;  1BYW A;  2NUP C;  2GNX A;  1K25 A;  4BL2 A;  2WGW A;  3U2A A;  4BLM A;  2P9V A;  3K3C A;  3V3R A;  2VGJ A;  5HAP A;  5HWW A;  5BOH A;  2PYP A;  3L9K A;  4D2O A;  1FIL A;  1YKD A;  3IH8 A;  2EWV A;  3ZNT A;  3TG9 A;  2VK3 A;  1NXY A;  2UWX A;  1AXB A;  1WA9 A;  1K54 C;  2VX8 A;  3WRT A;  3IF5 A;  4I5S A;  4O7D A;  4E3N A;  2Y2N A;  1IYP A;  1HZO A;  1YLT A;  1IFQ A;  5A93 A;  1ACF A;  5HAI A;  3SOI A;  4C6Y A;  3CUE C;  3EWK A;  1YLY A;  3NOT C;  4PKY G;  4HP4 A;  3KYE A;  3NDE A;  3CMZ A;  4LV0 A;  3LR0 A;  2EFX A;  5FAP A;  3PR6 A;  1H5X A;  1EI5 A;  2W27 A;  5JYO A;  1NRJ A;  3VSL A;  2JKR I;  4B88 A;  5HFO A;  3BLS A;  5CEC A;  1ZHH B;  2ZC7 A;  4DDS A;  3LIA A;  3TW8 A;  2ZL1 A;  1J9M A;  4RA7 A;  3AGF A;  1DJC A;  5AJG A;  3LR5 A;  5AVE A;  4YFM A;  2VV7 A;  1X0O A;  2CC1 A;  1LHY A;  3EGX C;  2XRO A;  2Q9M A;  4DXB A;  3E2L A;  1Z6F A;  1FR6 A;  2FFY A;  1F98 A;  1P97 A;  4BL3 A;  2A3U A;  3V5M A;  2IA2 A;  5DFY A;  1VEU A;  3CIT A;  1K6R A;  3IXG A;  4FTX A;  1OTI A;  4WBG A;  5HAR A;  3W8K A;  4QPR A;  1RGZ A;  1CI9 A;  3WS1 A;  1VHM A;  4PPR A;  4RX3 A;  1FIK A;  3IXH A;  3HL9 A;  4KZ3 A;  1S6R A;  4WUJ A;  3DTE A;  3GV9 A;  2Y2M A;  3NDG A;  1W79 A;  5TBM A;  4EES A;  1TDG A;  3QP8 A;  3TE8 A;  1PZO A;  3K3D A;  2WKQ A;  3LI9 A;  2IWB A;  4G3V A;  3UPP A;  1T1A A;  2FZ0 A;  1NRF A;  1YPR A;  3KYZ A;  5EPH A;  5GHX A;  4JXV A;  3LR3 A;  3CG5 A;  2QPN A;  1JVJ A;  2DRW A;  4EWF A;  2HDU A;  3UE3 A;  2ZQ7 A;  4DN0 A;  4YNR A;  2ZOH A;  3W4O A;  2HF6 A;  1YLJ A;  4FSF A;  3EEA A;  2OSU A;  3EGD C;  3QP4 A;  4OQI A;  4LV2 A;  4XXR A;  2D02 A;  4LEN A;  1LI0 A;  5AQ7 A;  4KUO A;  5CHJ A;  3UDX A;  1OTA A;  2Y2L A;  4OH0 A;  4K0W A;  5L8M A;  2VA0 A;  1K56 D;  3VV4 A;  3CLO A;  5J4E A;  4JF4 A;  2WKP A;  1ODV A;  1NZU A;  1BT5 A;  3BFF A;  1L0G A;  3S4X A;  3UME A;  2C5W B;  2V1Z A;  3S7Q A;  5TR7 A;  3G2Y A;  2VEA A;  1K38 A;  3I7J A;  3JPU A;  5EV0 A;  3MSH A;  2XSS A;  4LRX C;  3UPN A;  4PM9 A;  3VE3 A;  3DTI A;  4WMC A;  5CTN A;  1LL5 A;  2NUT C;  3LIE A;  4DMZ A;  3P09 A;  2ZMV A;  4JXW A;  1ONH A;  3FG8 A;  5HD5 A;  3M6H A;  2VV8 A;  5FAQ A;  3UB5 P;  3MXQ A;  1F5M A;  3S7P A;  1YLP A;  3NCK A;  3IT9 A;  2M1C A;  3R7W B;  4KZB A;  3WS4 A;  1XP4 A;  5DF7 A;  4DJ2 A;  4GN2 A;  1K6S A;  1GSW A;  4QHC A;  4BMW A;  3H82 B;  2E8J A;  3LYX A;  2VKS A;  3O88 A;  5FI6 A;  5EM1 A;  2J8Y A;  2ZC5 B;  1GCE A;  4YWZ A;  3VE4 A;  5HX9 A;  5E2E A;  2XRN A;  1PFL A;  4HES A;  4OQH A;  4XT2 B;  3CPT B;  2OWH A;  3NY4 A;  5K5B A;  3HBR A;  5HAQ A;  2HJE A;  2XH9 A;  3IH9 A;  2HP9 A;  3O3V A;  3FYZ A;  3VFH A;  5F82 A;  3PBT A;  4MDZ A;  4EV4 A;  1T18 A;  3SZT A;  5EM0 A;  4HNB A;  4N1H A;  4MBK A;  3Q81 A;  4A5R A;  4OVD A;  1XA1 A;  3IWQ A;  4DJ3 A;  5FAT A;  4GW9 A;  5IHV A;  5GL9 A;  4OP8 A;  3QP6 A;  2G2W A;  2K31 A;  2ZQD A;  4UAA A;  4N92 A;  4GS9 B;  4JLF A;  4FUW A;  1ES4 A;  4HHD A;  5DVA A;  3SH7 A;  3B33 A;  4DE3 A;  1UGU A;  1KGG A;  2GJ3 A;  1XKZ A;  2O9C A;  4N1X A;  1SKF A;  3S7N A;  2JCH A;  4P87 A;  3C7V A;  2W3E A;  2Q0O A;  1YLZ A;  1XA7 A;  3BQA A;  2O0Y A;  5EVI C;  3A0R A;  1W7F A;  2W3D A;  4QWO A;  4O0P A;  4ZBE A;  2P04 A;  3C5A A;  4EQ1 A;  3FZC A;  3CUE A;  4DXC A;  3KSF A;  4MMN A;  1IEL A;  3FWL A;  5JYP A;  3EOI A;  4GHI B;  3MJQ A;  2XLN A;  4DRT A;  2PU4 A;  4X68 A;  4H8R A;  1MBL A;  1Y54 A;  3V67 A;  4OOY A;  1A0K A;  4IHQ A;  1VET B;  3HUM A;  4LFU A;  2H10 A;  5EEC A;  1HD8 A;  4GDB A;  4B93 A;  4HH3 A;  3TRC A;  3PBQ A;  5FQK A;  2EWW A;  4GD6 A;  4WZ5 C;  3SS5 A;  1ZKJ A;  2VGL S;  4ZAM A;  3S22 A;  2BAS A;  3IF6 C;  1OT9 A;  3HJK A;  2K7S A;  2Z6C A;  2EX6 A;  1IYO A;  1ZC2 A;  3MZE A;  4OPZ A;  2DCF A;  5EVI D;  1KE3 A;  3QNB A;  1N9L A;  1G28 A;  5TJJ A;  4DKI A;  2H5S A;  1PNE A;  2XF3 A;  4LLO B;  3R7W A;  1NZO A;  5CXW A;  4HP9 A;  3BFG A;  2O99 A;  1Y28 A;  3CZD A;  4R1G A;  4GLQ A;  3H82 A;  5FSR A;  4X1M A;  3U4L P;  1OME A;  4OLG A;  2XFT A;  4UQI S;  3T1S A;  4R38 A;  5CGX A;  2P08 A;  2Y2Q A;  1PRQ A;  3FKW A;  3M6B A;  3C7U A;  3BW6 A;  1KDW A;  4BWI A;  1MWR A;  2LB9 A;  1KGF A;  4XT2 A;  3TOI A;  4NEE D;  2QWS A;  5M19 A;  3IX4 A;  4II7 A;  4D60 A;  3RFB A;  1BLC A;  4PMA A;  4OLD A;  3HLD A;  4CLC B;  2W3F A;  1WYB A;  4QY6 A;  3ZG7 B;  3C2W A;  5EVI B;  2WGV A;  1OJ5 A;  4XUX A;  3N6I A;  1LL9 A;  4R6L A;  3PBN A;  3SH8 A;  1GHM A;  3FC7 A;  5I94 A;  2I72 A;  2HDS A;  2ZJ9 A;  4Y5F A;  4GKU A;  3GRJ A;  1TS0 A;  2H28 A;  3OPP A;  4IJG A;  3SS4 A;  3MMH A;  2MJ6 A;  3ZG5 A;  4RVA A;  5EOE A;  1XGJ A;  2G7U A;  2Y2H A;  1T1B A;  2X01 A;  4EEU A;  4Z9Q A;  4GS9 A;  3EQV A;  3NEC A;  4S2N C;  3IWI A;  3D4F A;  4X55 A;  3LUQ A;  4E3K A;  1OTB A;  4HBU A;  2V8F A;  3LGO A;  3G35 A;  2IWC A;  4UHU A;  4EUV A;  4JGO A;  3PBO A;  4UA7 A;  3A0S A;  3ZG9 B;  3UE6 A;  2PBD P;  2PU2 A;  1K55 C;  2PD8 A;  4PAU A;  4HJ4 A;  5M1A A;  1SKO B;  2QYB A;  4LV3 A;  2WKE A;  3GQZ A;  4GHI A;  5C5K A;  1H0M A;  5DJT A;  2PD7 A;  1LSV A;  4KQR A;  1XXM A;  5HSQ A;  4NXF A;  3ZG0 A;  1VB6 A;  4R0Q A;  5L09 A;  3AGD A;  1K0K A;  1XFN A;  3Q7V B;  4ZDX A;  1FR1 A;  3M2J A;  2ZQ8 A;  1F2K A;  3VP3 A;  2XD5 A;  3IBR A;  4EBL A;  5HPF A;  1SHV A;  4GNU A;  1XJ4 A;  2V8C A;  1PWD A;  2QZ6 A;  3PBS A;  4QB8 A;  3IXD A;  1P0Z A;  3Q82 A;  3V39 A;  3VOY A;  4FCF A;  3VFF A;  3D3O A;  3HLE A;  4X6T A;  4OON A;  3H7W B;  1MWT A;  1LT0 A;  4UA6 A;  1K57 A;  1NY0 A;  2EXA A;  3IS2 B;  1KDS A;  1N4O A;  3LR4 A;  1YMS A;  3MXR A;  2KX6 A;  4JXS A;  1YMX A;  4ZTK A;  4KZ6 A;  2ZOI A;  2OV5 A;  3VP2 A;  2EFU A;  4R3B A;  3OBF A;  5F6A A;  3F1O B;  5FDH A;  2HP6 A;  2HDQ A;  1S66 L;  4Q0I A;  1ZG4 A;  3T4L A;  1D1J A;  2LB5 A;  1YAX A;  4MN6 A;  4S2K A;  2J3T C;  4EBP A;  1Z09 A;  4CLC A;  5EFW A;  3ZHH A;  4HJ6 A;  2EX9 A;  3LIC A;  1L0F A;  3LEQ A;  3CJM A;  1LL8 A;  3A3F A;  1DP8 A;  4WEJ A;  4Z1W A;  1DP9 A;  3BLM A;  3C4O A;  4HEF A;  1L3L A;  4WN5 A;  2R78 A;  2PYR A;  2HGV A;  3G31 A;  5GLD A;  1DJA A;  3GMW A;  1ESU A;  2W1T B;  3PHY A;  4JGP A;  3GEC A;  2ZM0 A;  3UE0 A;  5FI7 A;  4QJG A;  3SW1 A;  2H0T A;  4KQQ A;  1GA9 A;  1FOF A;  2ZM8 A;  1CI8 A;  4Q8I A;  4KZ5 A;  3ZVW A;  2K2N A;  4WZ4 A;  3A3J A;  1JWP A;  4FD8 A;  4OPY A;  2Y2P A;  4E6X A;  4ARZ B;  2J3T D;  3NC8 A;  1RCJ A;  3BM6 A;  1MWS A;  1PI4 A;  1K4F A;  1FCM A;  3IX3 A;  2Y79 A;  3NI9 A;  2A24 B;  4WLA A;  1SKO A;  4GDN A;  3BJN A;  4KZ8 A;  5EE8 A;  3CHW P;  4EW7 A;  1PWC A;  1BTL A;  3T50 A;  4MEZ A;  1BSG A;  2RL3 A;  4BEN A;  2XEP A;  2PDR A;  2L4R A;  1FCO A;  4QD4 A;  5HDD A;  4S2L A;  5FQQ A;  2KDK A;  3DTK A;  4WL9 A;  4ETX A;  3C8C A;  4KUK A;  1XJ6 A;  2KLI A;  4BD1 A;  3WS0 A;  5HL1 A;  3KO6 A;  1CF0 A;  4PM8 A;  3GR2 A;  2ZC4 B;  3PTE A;  1DJB A;  1LSX A;  4RQ9 A;  1CQA A;  2EX2 A;  2X71 A;  2P74 A;  1OJG A;  5CTM A;  5E2H A;  3VP4 A;  3MKE A;  2VJW A;  4KQD A;  3H7W A;  5A92 A;  4LV1 A;  3HVF A;  3D9Y A;  3W4Q A;  1T1C A;  3S7O A;  4E04 A;  1ESI A;  3IS2 A;  5CER A;  1IEM A;  4OOM A;  1TF1 A;  3GSG A;  3MFX A;  3JYI A;  2Y4A A;  2I9V A;  1O07 A;  3MQ0 A;  4PHT A;  2WUQ A;  4IED A;  2GX5 A;  1RGY A;  1V9Y A;  4L9F A;  4Q0J A;  2BLS A;  4M3K A;  4YOF A;  3F1N B;  1MXO A;  3HLG A;  4LCL A;  3F1O A;  3LO7 A;  2WZX A;  2JE5 A;  3T1Q B;  4KG6 A;  4KZ7 A;  2YKH A;  3N4I A;  3N8R A;  3Q07 A;  2W3H A;  4HI4 A;  1HTZ A;  4JGR A;  4IVI A;  4UEY A;  5J3W A;  2V0W A;  5GLC A;  2PBY A;  1G6O A;  3T4J A;  1S4R A;  5GHY A;  3UDF A;  1FSW A;  4NG2 A;  1KVM A;  3VMA A;  3WWX A;  4CJN A;  3TJZ C;  5FI2 A;  3OPL A;  4BBT A;  3N8S A;  3ZQ5 A;  3NUL A;  2B5R A;  3FPV A;  4S2I A;  5FQM A;  1BLS A;  2YKF A;  3M2K A;  1PI5 A;  2XA7 S;  5CHM A;  3N7W A;  3C38 A;  3MBZ A;  4MN7 A;  1LSW A;  3QP5 A;  5F1F A;  2W1T A;  3DWZ A;  4KEN B;  4L9G A;  4HY8 A;  3MF0 A;  4R3A A;  5F69 A;  3WS2 A;  3VP1 A;  5E2G A;  1RP5 A;  4WM9 A;  2DNS A;  2WKR A;  1K54 A;  5FDS A;  1OT6 A;  4X69 A;  2C6W B;  3P7N A;  1FQG A;  3UN7 A;  4Y0T A;  2O9B A;  1IKG A;  4AFI A;  2G2U A;  4ME4 A;  3G6O A;  3PAE A;  3CWF A;  3E4Q A;  3RXW A;  4BJP A;  4OKP A;  5CED A;  1SCW A;  2ZQA A;  4ETZ A;  1C3B A;  4EU0 A;  3OZH A;  3BYD A;  4NET A;  2A24 A;  2XFS A;  3QP1 A;  1XFQ A;  5HDC A;  3LEZ A;  4B4X A;  4RYE A;  4JPM A;  3ITA A;  4E3O A;  5E2F A;  4K91 A;  3GTC A;  3KSG A;  1TDL A;  3R4K A;  2WKI A;  3B47 A;  2M7V A;  4HOI A;  1IYS A;  2OAQ 1;  3LID A;  3E4O A;  2P9V B;  1TS6 A;  3TSG A;  1P9W A;  2Y91 A;  2QJ5 A;  4NXE A;  3T4K A;  2HDR A;  5IS1 A;  3BEB A;  5KSH A;  3NOP C;  1NJ4 A;  1CK3 A;  2B02 A;  4LPZ A;  2J9P A;  4MNR A;  2VZW A;  3IHB A;  1XJ3 A;  3HJI A;  4GCZ A;  5CRF A;  3UY6 A;  1Y4O A;  3NIA A;  4KZA A;  2B95 A;  1GHI A;  1K56 A;  1MKM A;  1M6K A;  4P0M A;  4I38 A;  3UB6 A;  4FH4 A;  5CGS A;  1TD5 A;  1PIO A;  2J7V A;  3BWL A;  2KOI A;  3D72 A;  3F1N A;  4X53 A;  2ZL1 B;  3SH9 A;  3ZCZ A;  4MLL A;  3CPT A;  5HZH A;  1PZP A;  4BD0 A;  1H8M A;  3H9W A;  4G3K A;  3IQA A;  3G4P A;  3LIB A;  4LCM A;  4R70 A;  4LRY C;  4WYY A;  2JKG A;  1XX2 A;  1VEU B;  2WAD A;  3UB8 A;  1OTE A;  5J8X A;  4OOL A;  3BRM A;  1AWI A;  3ZDJ A;  3HLC A;  1IKI A;  4X25 A;  2Y2J A;  4S2P A;  5F83 A;  1NLZ A;  3JVV A;  4RX2 A;  1LI9 A;  1MC0 A;  1ALQ A;  4Y7P A;  1EW0 A;  2JHE A;  3UMD A;  2HZ5 A;  1S1Z A;  2W0N A;  4Y0U A;  1H8Y A;  2WYX A;  5EOO A;  2HP5 A;  2Z2M B;  3F1P B;  5TGF A;  2PRF A;  4HQA A;  5FQI A;  3G2Z A;  4Y15 A;  3O86 A;  3MR0 A;  1E3U D;  3SS3 A;  4BQM A;  3IF6 B;  3KX0 X;  3HLW A;  2Y8H A;  3OOV A;  2PHY A;  2WK0 A;  3UO9 A;  3AGE A;  3ISG A;  3LCE A;  2QJ7 A;  4DE0 A;  3MS6 A;  3ULF A;  3IXB A;  1M40 A;  5AQ9 A;  3DWK A;  3FKV A;  3BFC A;  5DTS A;  2JC7 A;  3T4Q A;  1BLP A;  2O9A A;  5FEF A;  1VET A;  1O7E A;  3V50 A;  1NWZ A;  2PR6 A;  4KZ9 A;  4P6Z S;  4ZJ1 A;  2XA7 M;  2OWJ A;  2Y2K A;  4X1L A;  4F94 A;  2J3W A;  3G34 A;  4IVK A;  4GB7 A;  3UNW A;  3N8L A;  5IU1 A;  2R9W A;  4F3L B;  4IBX A;  3BQ8 A;  5EUA A;  2HPB A;  1W63 M;  5KIZ A;  3IX8 A;  1ZTU A;  4DE2 A;  2V0U A;  5L10 A;  4S2O A;  2BTF P;  3MXS A;  3HLB A;  1GHP A;  4ZJ2 A;  4K0X A;  5AVF A;  2OOL A;  5DFX A;  5I5L A;  1ES3 A;  1T19 A;  2D01 A;  3WRZ A;  4WEL A;  3CI6 A;  2W1R A;  4P6B A;  1IOU A;  2ZMF A;  1H8Z A;  1W63 Q;  3ZG8 B;  2XGN A;  2ZD8 A;  3LIF A;  4QU3 A;  5F1G A;  4NK3 A;  2VLG A;  5HWT A;  3EQU A;  5IT5 A;  1TVF A;  3MQO A;  5GLA A;  4MCW A;  1S4S A;  1PW8 A;  2ZBB A;  2Y59 A;  4I3I A;  1PWG A;  4KZ4 A;  1STZ A;  2AVX A;  3FV7 A;  4EBN A;  1SDE A;  4B4Z A;  1JWZ A;  4EQI A;  3A3I A;  4MN5 A;  1JNU A;  5FQ9 A;  1JTG A;  3T1X A;  2VGL M;  5A8B A;  2HV1 A;  4R4S A;  4DF6 A;  5HW3 A;  3UB7 A;  5CEB A;  1MPL A;  3T12 B;  2QKP A;  3RJU A;  4GD8 A;  3O5Y A;  5DF9 A;  1ERO A;  5EVI A;  5G4Z A;  1GSX A;  3T4O A;  4IBR A;  4G3W A;  1BUE A;  1TS7 A;  3BY9 A;  1G5U A;  1CJF A;  5M18 A;  3HUN A;  1KVL A;  4S2M A;  4I3A A;  4O01 A;  3ITB A;  1D06 A;  3QP2 A;  2XD1 A;  4GOG A;  1N9O A;  2Q9N A;  2EX8 A;  2OLV A;  5DTT A;  5GLB A;  4UQI M;  3G32 A;  1HVB A;  4WF0 A;  4Y13 A;  2WGI A;  3QNC A;  2X02 A;  5GHZ A;  3F1P A;  4JGQ A;  1J3W A;  2FH5 A;  3T4S A;  4JF6 A;  5HWV A;  3RXX A;  4C75 A;  1P9R A;  4WZ5 A;  4EXO A;  1ES2 A;  1DRM A;  3UDI A;  1YSQ A;  4BBV A;  4NKP A;  3OLO A;  3IF6 A;  2RCX A;  3L7H A;  3VSK A;  4R3J A;  4JXG A;  5G18 A;  2W3G A;  5CX7 A;  4E3M A;  3RH8 B;  1PW1 A;  2V1A A;  2ZC6 B;  3A0V A;  4R4R A;  4OPQ A;  2J9O A;  1NYM A;  4IUH A;  2V9A A;  1CEG A;  4GJ4 A;  3UB9 A;  2PT7 A;  4EER A;  4ID4 A;  2E8I A;  5A90 A;  3DW0 A;  4NXB A;  3NJA A;  1QMF A;  3Q7V A;  2JKT I;  3BFE A;  5KMW A;  1S1Y A;  2OLU A;  5FQJ A;  4GZB A;  1ERM A;  4F3L A;  4Y3I A;  5FL3 A;  1JTD A;  1K4E A;  4I3J A;  3CAX A;  4N9L A;  1E3U A;  3E0Y A;  3NBL A;  3MZF A;  3JVU A;  4M4X A;  5FA7 A;  4PM6 A;  5J7E A;  4JF5 A;  4B9O A;  2ZQC A;  3PAG A;  5DJU A;  1I5Q A;  4CQH A;  1PYY A;  2V1B A;  5LBR A;  4X56 A;  4K08 A;  4QY5 A;  1YSP A;  4CLC E;  4FH2 A;  4Q0H A;  2A49 A;  1Q2P A;  2L1M A;  2IWD A;  5A91 A;  4Y2F A;  1G68 A;  1NLY A;  3PYP A;  4HBT A;  1BZA A;  2VGK A;  3Q7Z A;  3MKF A;  4P6Z M;  3OPH A;  2Y2G A;  2B18 A;  2WAE A;  4L9E A;  4ZRR A;  2EA9 A;  2R9X A;  1JWV A;  4S2N A;  4DDY A;  2Z2L B;  3HUO A;  3PXP A;  2INW A;  3C4P A;  3G30 A;  4Y0O A;  4KG5 A;  3VOL A;  3O87 A;  5FAS A;  1GSV A;  2PAV P;  1XJ2 A;  3E98 A;  2ZC3 B;  2JKR M;  1E4D A;  5F68 A;  1SDN A;  3BY8 A;  2VV6 A;  5FAO A;  5EVL A;  4PM5 A;  3VP0 A;  1CEF A;  4XUZ A;  1OTD A;  4YIN A;  5FEG A;  2Y2I A;  3HCY A;  1K55 A;  3OPR A;  2L0W A;  4KQO A;  4JBF A;  4OP5 A;  1K57 C;  4IUK A;  1N9N A;  1FSY A;  4PKY A;  2OAP 1;  4H6J B;  1DP6 A;  4WEK A;  2J80 A;  3ZGA B;  2QHK A;  1YT4 A;  1VM1 A;  1BLH A;  3ICY A;  4UA9 A;  4EET B;  4LGW A;  1ERQ A;  5DKL A;  4U0T A;  4E3I A;  2CMN A;  4DE1 A;  3KSI A;  1UWP X;  2EXB A;  3RTY A;  3GVB A;  3FPW A;  1L0D A;  4I39 A;  5F5Y A;  2UV0 E;  1QME A;  1HLU P;  4LRZ E;  4EUZ A;  4ARZ A;  4C3Q A;  1I2W A;  3KYQ A;  1DY6 A;  5EVE A;  3E4P A;  3MQQ A;  1KE0 A;  3DAV A;  5HDS A;  3S1Y A;  3BFD A;  3OC2 A;  3IWO A;  2Y2O A;  1W8Y A;  4CLC C;  4O8G A;  1H3Q A;  5DKK A;  1MKI A;  2DMW A;  3W4P A;  1LLB A;  5D3O A;  3VOZ A;  4E3J A;  5L2F A;  1OPX A;  2XK1 A;  3C30 A;  3OCL A;  1L2S A;  3PBR A;  2JBF A;  4N9K A; 
#chains in the Genus database with same CATH homology
 1F5M A;  3S7P A;  2J3T C;  2M1C A;  3R7W B;  4CLC A;  3MR0 A;  5EFW A;  4DJ2 A;  4HJ6 A;  3LIC A;  1UWN X;  1GSW A;  3KX0 X;  2Y8H A;  4BMW A;  3H82 B;  3LYX A;  2VKS A;  3OOV A;  1LL8 A;  2PHY A;  3LFV A;  1DP8 A;  4WEJ A;  4Z1W A;  4BBU A;  1DP9 A;  2QJ7 A;  4YWZ A;  2JKT M;  3VE4 A;  3ULF A;  4WN5 A;  2HJ9 C;  2R78 A;  2XRN A;  2PYR A;  3W2Z A;  2HGV A;  2GZA A;  1D7E A;  3T4Q A;  2O9A A;  4XT2 B;  2OWH A;  2W1T B;  3PHY A;  4JGP A;  3GEC A;  4CLC D;  5K5B A;  1NWZ A;  2HJE A;  2PR6 A;  3IBJ A;  3SW1 A;  4P6Z S;  2XA7 M;  2OWJ A;  2J3W A;  3PBT A;  4MDZ A;  3NOU C;  3OCN A;  1KOU A;  1T18 A;  2K2N A;  5IU1 A;  4HIA A;  4F3L B;  3BQ8 A;  4HNB A;  2Z6D A;  2M7U A;  1W63 M;  5KIZ A;  4ARZ B;  2J3T D;  3T4T A;  1ZTU A;  2V0U A;  4DJ3 A;  4GW9 A;  1TS8 A;  2PR5 A;  5HL6 A;  5AVF A;  2Y79 A;  2OOL A;  2A24 B;  5DFX A;  3DBA A;  5I5L A;  4WLA A;  3BJN A;  1T19 A;  5MC7 A;  2D01 A;  2K31 A;  4WEL A;  4EW7 A;  3CI6 A;  2W1R A;  3NHQ A;  1IOU A;  4GS9 B;  2ZMF A;  1V9Z A;  3T50 A;  1W63 Q;  4HHD A;  3B33 A;  3LIF A;  1UGU A;  2A2L A;  2PDR A;  2GJ3 A;  2L4R A;  4HJ3 A;  2O9C A;  2VLG A;  3S7N A;  5HDD A;  5HWT A;  3EQU A;  2KDK A;  5IT5 A;  3MQO A;  4WL9 A;  3EEH A;  4MCW A;  1S4S A;  4ETX A;  2W3E A;  3C8C A;  4KUK A;  1XJ6 A;  2KLI A;  2ZBB A;  3BQA A;  4NXG A;  2O0Y A;  3KO6 A;  4I3I A;  1STZ A;  3A0R A;  2W3D A;  4O0P A;  2P04 A;  4MN5 A;  1JNU A;  4EQ1 A;  1LSX A;  4RQ9 A;  3CUE A;  3KSF A;  4MMN A;  5TBM B;  4H6J A;  2VGL M;  1S67 L;  5A8B A;  2HV1 A;  1OJG A;  3EOI A;  4GHI B;  3MJQ A;  3UB7 A;  5HD3 A;  2VJW A;  2QKP A;  3LI8 A;  4KQD A;  3P01 A;  3H7W A;  5G4Y A;  3O5Y A;  3B42 A;  5DF9 A;  3V67 A;  1T1C A;  4IHQ A;  3S7O A;  4E04 A;  5G4Z A;  1GSX A;  3GDI A;  3IS2 A;  3T4O A;  4OOM A;  1TF1 A;  4G3W A;  3MFX A;  4EEP A;  1TS7 A;  3BY9 A;  4B93 A;  2I9V A;  3MQ0 A;  4I3A A;  4O01 A;  4PHT A;  4HH3 A;  3TRC A;  1D06 A;  5HPI A;  3PBQ A;  2EWW A;  2GX5 A;  1V9Y A;  3KSH A;  4L9F A;  4Q0J A;  1N9O A;  4YOF A;  3ZYT A;  2VGL S;  3F1N B;  3F1O A;  4FOF A;  2BAS A;  4UQI M;  1OT9 A;  1F9I A;  2YKH A;  3HJK A;  2K7S A;  2Z6C A;  1MZU A;  2P7J A;  4HH2 A;  4WF0 A;  2W3H A;  4HI4 A;  3F1P A;  4JGQ A;  1N9L A;  2FH5 A;  3T4S A;  4L0L A;  5HWV A;  4JGR A;  1G28 A;  2JN7 A;  5TJJ A;  4UEY A;  5J3W A;  1P9R A;  4LLO B;  4EXO A;  3R7W A;  3K2N A;  1BYW A;  2V0W A;  4HP9 A;  1DRM A;  1G6O A;  2NUP C;  2GNX A;  1YSQ A;  3T4J A;  1S4R A;  4BBV A;  2O99 A;  4NKP A;  1Y28 A;  3OLO A;  3U2A A;  3K3C A;  4GLQ A;  5HWW A;  3H82 A;  2PYP A;  3TJZ C;  2W3G A;  1YKD A;  2EWV A;  5CX7 A;  4UQI S;  4BBT A;  4R38 A;  3RH8 B;  3ZQ5 A;  1WA9 A;  2VX8 A;  3FPV A;  2P08 A;  2V1A A;  4I5S A;  3BW6 A;  2YKF A;  3A0V A;  4BWI A;  2XA7 S;  2LB9 A;  4IUH A;  2V9A A;  3C38 A;  4MN7 A;  1IFQ A;  4GJ4 A;  4XT2 A;  1LSW A;  3UB9 A;  4NEE D;  2W1T A;  2PT7 A;  3CUE C;  3EWK A;  4HY8 A;  4L9G A;  2QWS A;  3MF0 A;  4R3A A;  4EER A;  4II7 A;  5F69 A;  3RFB A;  3NOT C;  4PKY G;  4NXB A;  4HP4 A;  3NJA A;  2JKT I;  4CLC B;  2W3F A;  2WKR A;  3LR0 A;  1S1Y A;  3C2W A;  1OT6 A;  3PR6 A;  1OJ5 A;  2W27 A;  3P7N A;  4R6L A;  1NRJ A;  4F3L A;  2JKR I;  3PBN A;  4Y3I A;  5FL3 A;  2O9B A;  3FC7 A;  4I3J A;  4AFI A;  1ZHH B;  3CAX A;  4ME4 A;  3G6O A;  3LIA A;  4Y5F A;  3TW8 A;  3CWF A;  3E4Q A;  4BJP A;  1TS0 A;  3E0Y A;  5AJG A;  3LR5 A;  2H28 A;  5AVE A;  3JVU A;  4IJG A;  4ETZ A;  2VV7 A;  1X0O A;  3MMH A;  4M4X A;  2MJ6 A;  4EU0 A;  3EGX C;  2XRO A;  5J7E A;  4B9O A;  2A24 A;  5DJU A;  1XFQ A;  5HDC A;  2G7U A;  4CQH A;  1F98 A;  2V1B A;  1T1B A;  4EEU A;  5LBR A;  1P97 A;  4GS9 A;  3EQV A;  4K08 A;  2IA2 A;  5DFY A;  3CIT A;  1YSP A;  4CLC E;  3LUQ A;  4Q0H A;  2L1M A;  3KSG A;  1OTI A;  3R4K A;  1OTB A;  4Y2F A;  1NLY A;  4QPR A;  3B47 A;  2M7V A;  3PYP A;  4HOI A;  2OAQ 1;  3LID A;  1VHM A;  3E4O A;  4P6Z M;  1TS6 A;  2B18 A;  4L9E A;  4EUV A;  1P9W A;  4JGO A;  2QJ5 A;  4ZRR A;  2EA9 A;  4NXE A;  4WUJ A;  3PBO A;  3A0S A;  3UE6 A;  3T4K A;  2PD8 A;  3PXP A;  4PAU A;  4HJ4 A;  5TBM A;  2INW A;  5IS1 A;  2QYB A;  4EES A;  3VOL A;  3NOP C;  5KSH A;  3TE8 A;  4GHI A;  2B02 A;  5C5K A;  1GSV A;  3K3D A;  4LPZ A;  5DJT A;  2VZW A;  2WKQ A;  1XJ2 A;  2PD7 A;  3LI9 A;  1LSV A;  4G3V A;  3E98 A;  1T1A A;  2FZ0 A;  2JKR M;  5F68 A;  5HSQ A;  3KYZ A;  1XJ3 A;  3BY8 A;  2VV6 A;  3HJI A;  4GCZ A;  3LR3 A;  4NXF A;  1VB6 A;  1OTD A;  1XFN A;  3UE3 A;  1MKM A;  3HCY A;  4DN0 A;  4I38 A;  2L0W A;  3UB6 A;  4KQO A;  4YNR A;  2ZOH A;  2HF6 A;  3IBR A;  5HPF A;  4FSF A;  1TD5 A;  1XJ4 A;  4IUK A;  1N9N A;  3EEA A;  3BWL A;  3EGD C;  2KOI A;  3D72 A;  3F1N A;  4PKY A;  3PBS A;  2D02 A;  2OAP 1;  4H6J B;  1DP6 A;  4KUO A;  2J80 A;  4WEK A;  5HZH A;  1OTA A;  1P0Z A;  1H8M A;  3H9W A;  4G3K A;  2QHK A;  3ICY A;  3D3O A;  4EET B;  3H7W B;  5DKL A;  3LIB A;  5L8M A;  2VA0 A;  2CMN A;  3KSI A;  1LT0 A;  1UWP X;  3VV4 A;  3CLO A;  3RTY A;  5J4E A;  4R70 A;  2WKP A;  3FPW A;  1ODV A;  4LRY C;  3IS2 B;  4I39 A;  5F5Y A;  4LRZ E;  3UB8 A;  3LR4 A;  3UME A;  1OTE A;  4ARZ A;  3KYQ A;  4OOL A;  2KX6 A;  3S7Q A;  3E4P A;  2VEA A;  3MQQ A;  5HDS A;  2ZOI A;  3OC2 A;  2XSS A;  4CLC C;  1NLZ A;  4O8G A;  3JVV A;  3OBF A;  4LRX C;  1H3Q A;  5F6A A;  3VE3 A;  5DKK A;  1MC0 A;  3F1O B;  2NUT C;  3LIE A;  4DMZ A;  2DMW A;  1EW0 A;  2JHE A;  2ZMV A;  3UMD A;  1S66 L;  4Q0I A;  1S1Z A;  2W0N A;  3FG8 A;  5HD5 A;  3T4L A;  2LB5 A;  1YAX A;  2VV8 A;  3F1P B;  4MN6 A;  1OPX A;  3C30 A;  3OCL A;  4HQA A;  3PBR A;  3MXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...