2QHKA

Crystal structure of methyl-accepting chemotaxis protein from vibrio parahaemolyticus rimd 2210633
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
148
structure length
148
Chain Sequence
AELVRDRQELIDARKKELKAYMMMGVTAIKPLYDSDVNGSNKQAAKEILKAMRFESDGYFFAYDSQGINTLHAIKPSLEGKNLYDLKDENGVAVIAGLIDASQKGDGFLYFSWHKPTINAQAPKLGYAEYLQKWDWVLGTGIYIDDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Methyl-accepting chemotaxis protein
publication title The crystal structure of the methyl-accepting chemotaxis protein from Vibrio parahaemolyticus RIMD 2210633.
rcsb
source organism Vibrio parahaemolyticus
total genus 48
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2007-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17200 sCache_2 Single Cache domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2qhkA00
3NOTC 4GHIA 4EESA 1TS7A 5HZHA 2B02A 2L1MA 2P7JA 3UB6A 5I5LA 3A0RA 1OTBA 3IBRA 1XJ3A 5A8BA 4GS9B 4JGPA 5HD5A 2V0UA 4EERA 3BWLA 2KX6A 4F3LA 3UE6A 3LI8A 4KUOA 3MFXA 3ICYA 4HJ4A 1Y28A 3C2WA 3BY9A 2Z6DA 4HOIA 4LPZA 4I39A 4PKYG 1OTIA 5HDSA 1OJGA 4EEUA 3GECA 2INWA 4GCZA 3LICA 2ZBBA 5IU1A 1XJ6A 2BASA 1WA9A 4HNBA 1P97A 2VEAA 5J7EA 3D72A 2KDKA 4HQAA 2R78A 5HWTA 3LI9A 2PYPA 3VOLA 1T18A 3CWFA 4NXBA 1OT6A 4LRZE 4PKYA 3E4OA 4E04A 4R3AA 4HJ3A 3C8CA 4HH2A 4GHIB 3H7WA 5TBMA 5DKKA 1OT9A 3CLOA 4EQ1A 4BBUA 1EW0A 2D01A 3G6OA 4WLAA 4HI4A 3BY8A 1D7EA 3VE4A 4EEPA 3LYXA 4WL9A 5KIZA 3MQQA 2HV1A 3EEHA 3UB7A 2K7SA 1F9IA 2V1BA 3H9WA 4F3LB 1V9ZA 1LSVA 3LIEA 2ZOHA 4WUJA 5G4ZA 2GJ3A 3PYPA 3MR0A 3F1OA 2PD8A 3OLOA 1KOUA 1S67L 4I3IA 2QJ7A 2JHEA 1S4RA 3FG8A 4HJ6A 2JN7A 1D06A 1S1YA 3PHYA 2VV8A 3F1NA 4KUKA 4L9EA 3UMEA 5HSQA 1OTAA 3A0SA 3KX0X 4WF0A 2OWHA 2VV6A 4EW7A 2W0NA 1JNUA 1UWNX 1N9LA 2EA9A 4DJ2A 5HDDA 2Z6CA 1LSWA 4MN6A 1T1AA 5AVEA 1TS0A 2V9AA 5AVFA 2QJ5A 3E4PA 3T50A 2I9VA 4HIAA 3MXQA 4I3AA 3F1PA 2VV7A 4RQ9A 3GDIA 3CAXA 2WKPA 3IS2A 1OTEA 1TS8A 3H7WB 5TBMB 5F6AA 4LLOB 4EETB 3NJAA 3UB9A 3UMDA 1GSVA 4XT2A 4JGRA 1BYWA 4HY8A 1ODVA 4YWZA 2OOLA 4DJ3A 3UB8A 1TS6A 2L0WA 1F98A 1GSWA 3NHQA 3H82A 4B9OA 5F68A 4R38A 3RTYA 1X0OA 3LIDA 2PR6A 3F1OB 3VE3A 4I38A 3LIBA 4H6JA 1DP9A 4HH3A 4M4XA 5HD3A 4L9GA 1LT0A 4LRXC 5EFWA 3K3DA 2PR5A 2A24A 3P7NA 1S1ZA 4HP9A 5J4EA 3ZQ5A 3LIAA 2M1CA 1G28A 1V9YA 4GW9A 1UGUA 1XFQA 3F1NB 4KQDA 1NWZA 2QKPA 5F69A 5HDCA 2PYRA 4L9FA 2QWSA 1VB6A 4K08A 1DRMA 4BBVA 3K3CA 2D02A 5J3WA 3HJIA 2V1AA 1S66L 1T1CA 1OTDA 2J80A 5HWVA 1T19A 2PDRA 3F1PB 2V0WA 1N9NA 3LUQA 3RH8B 5IS1A 3HJKA 3IS2B 1MZUA 2YKFA 2YKHA 4I5SA 4HHDA 2WKRA 4NXEA 2PD7A 4XT2B 1XFNA 1UWPX 5DJTA 4I3JA 4NXGA 4GS9A 4JGQA 4LRYC 1OJ5A 5G4YA 3FC7A 5DJUA 4JGOA 2W27A 1DP6A 3EWKA 3B33A 2PHYA 3H82B 4HP4A 1S4SA 2OWJA 1DP8A 3ULFA 3LIFA 4BBTA 4H6JB 1LSXA 1T1BA 1LL8A 4NXFA 4R70A 2CMNA 4R6LA 2A24B 2WKQA 3SW1A 3MQOA 2QHKA 3NOPC 4MN5A 4WN5A 1P0ZA 3NOUC 1N9OA 2VLGA 2L4RA 3A0VA 2ZOIA 5F5YA 5HWWA 1XJ4A 5DKLA 2H28A 4EXOA 3E4QA 1XJ2A 1GSXA 3MJQA
chains in the Genus database with same CATH superfamily
3VOYA 4WELA 1KE3A 2XH9A 5HZHA 3S7OA 5AJGA 3Q7VA 4EUZA 3RJUA 1OTBA 3IBRA 1XJ3A 3S7PA 1VEUB 5A8BA 3LR0A 4JGPA 3S7QA 2Q9NA 4ZDXA 4S2PA 2OLUA 4YINA 2PU2A 3VOZA 4S2NC 4FH2A 1K56A 1DY6A 1GA0A 3P09A 1YMSA 3BY9A 2Z6DA 5GLBA 1XA1A 5EOEA 4WBGA 1J3WA 2Y2MA 4DDSA 1FQGA 5FQMA 2ZQ7A 4EEUA 1IEMA 4GCZA 1SCWA 1BT5A 2Y2OA 4K91A 5IU1A 1YLZA 4ZBEA 3QP4A 3N8SA 3S1YA 3NY4A 1IFQA 4JF6A 1K4EA 4HNBA 4EBNA 2OSUA 1ERQA 3AGDA 5J7EA 3D72A 2KDKA 1SKOB 5J8XA 4X55A 4IBRA 2WGWB 3LI9A 5TJJA 1TEMA 4DKIA 4S2OA 2PYPA 1ZTUA 3CWFA 4NXBA 5IT5A 2HP9A 4EQIA 3NECA 2E8JA 4RA7A 4E3MA 5DTSA 2WADA 4Y3IA 3UO9A 3UNWA 4HH2A 3ZG9B 2B95A 4OPZA 5TBMA 3TRCA 4EQ1A 3KYZA 3GMWA 3G4PA 2DCFA 4HI4A 3DTIA 2WZZA 3VP1A 1K54C 3TJZC 4WL9A 5KIZA 3MQQA 2O9AA 5DF8A 3T12B 2IA2A 1JTDA 3UB7A 3HVFA 5FDSA 2K7SA 2V1BA 1H5XA 1RGZA 4F3LB 1BSGA 1LSVA 2G7UA 1S6RA 2ZOHA 1GCEA 4IJGA 3V5MA 4X6TA 4B4XA 4JF5A 3IWQA 3CG5A 3MR0A 5HW3A 3F1OA 4GNUA 1PZPA 3HBRA 3VFFA 3IF6A 4I3IA 1W8YA 5EVIB 2QJ7A 2IWCA 3FG8A 1O7EA 1SHVA 3ZG8B 1OMEA 3BEBA 1GHMA 1I5QA 3BLMA 4G3WA 1D06A 4ZTKA 1HD8A 1S1YA 2R9XA 3F1NA 4RYEA 3C4PA 5GLAA 4L9EA 3HLGA 3DWKA 3Q1FA 4FD8A 4C3QA 1VQQA 5HSQA 3WS0A 3A0SA 4WF0A 4IBXA 4Y2FA 4ARZB 3GV9A 4EW7A 4C75A 1N9LA 2HDRA 2Z6CA 3LR3A 3LFVA 2FFFB 3QHYA 3IF6C 1FILA 1T1AA 5AVFA 1K25A 2Z2MB 3T50A 4OPRA 5EUAA 1YQSA 4HIAA 1LLBA 1TDGA 4F94A 4OH0A 5CGWA 2OV5A 2Q0OA 3T4LA 3IX8A 3SOIA 3H7WB 2PBYA 5F6AA 4H8RA 2XK1A 3NJAA 4PHTA 3UMDA 1GSVA 2Y2GA 3SH8A 1BYWA 5EV0A 4DJ3A 3IXDA 1VETA 4G3KA 1F98A 3DW0A 2P9VB 1ES2A 5FATA 3ZDJA 4MCWA 5TFQA 5EVID 1K57C 4R38A 2NUTC 1NZUA 4I38A 3LIBA 4JXSA 2BTFP 5HD3A 1LT0A 3WWXA 4LRXC 3MZEA 1EWZA 2A24A 4KQOA 1KGGA 1S1ZA 4LV2A 5KMWA 1J9MA 3LIAA 4P0MA 2M1CA 1DJBA 1G28A 1PWDA 1ALQA 4KQDA 4MBKA 4EBLA 1K55C 4LGWA 4BL2A 2FH5A 4UHUA 2D02A 5F83A 3KYQA 5F82A 3LY3A 2M7VA 5FL3A 2V1AA 1S66L 4JXVA 1T1CA 2VX8A 4X68A 3QP6A 5CHMA 3UE3A 1T19A 3FV7A 3DAVA 2VA0A 4G3VA 3D4FA 3HJKA 2EX8A 5G18A 2O99A 2JKRM 2YKHA 4IVKA 3IBJA 4NXEA 3MQ0A 1XFNA 4XT2B 3T1XA 4DE2A 1G6OA 1VEUA 3VP2A 4NXGA 1OJ5A 3PTEA 5JYOA 3C5AA 4IVIA 1WYBA 4HP4A 1S4SA 3MMHA 3A3IA 3BFGA 1U60A 4UQIS 4LCMA 2ZQDA 4KG2A 4S2MA 2ZM8A 1BZAA 2CC1A 4E3IA 1KDWA 4KZ7A 2WKQA 3CHWP 4CLCB 3SW1A 3IWIA 3IX4A 5DTTA 1NJ4A 2W1TB 2KLIA 4O0PA 1CJFA 3MF0A 4O7DA 2L4RA 4PM8A 3A0VA 3HLDA 1N9BA 1S0WA 1SKOA 5HPIA 3I7JA 4E3KA 1A0KA 5E2GA 1BLCA 2Y2JA 2WGWA 4Y7PA 5L10A 2H28A 1BLPA 3OOVA 5EPHA 4EXOA 4QB8A 4WEKA 1XJ2A 1GSXA 4LV0A 1PW8A 5F1FA 1MWRA 3BRMA 3NDEA 1CI8A 4OP5A 3PBSA 1IYPA 2UV0E 3ITBA 3T1SA 2ZJ9A 4GLQA 2L1MA 3ZG7B 2Y2PA 4LV1A 1SDEA 4R0QA 2JKTM 4OQIA 3DTEA 1YLWA 1BLHA 2ZQAA 3A3FA 5HD5A 3ITAA 1TD5A 4XUZA 1JWZA 4R3BA 4E3OA 5GHXA 5E2FA 3BJNA 4XXRA 3BWLA 2KX6A 4F3LA 5TGFA 3UE6A 4Q0HA 3LI8A 3TOIA 4CLCD 3MFXA 3ZVTA 4HJ4A 2A3UA 1RP5A 5EVIA 3V50A 3EQUA 3OPRA 3LR5A 4ZJ1A 3W4PA 3UY6A 4PKYG 2BG1A 3T1QB 5L09A 1OTIA 4UEYA 1P9WA 4AFIA 4P85A 2G2UA 3TG9A 3DTKA 1ZC2A 4EWFA 1KE0A 2BASA 2EX2A 1K4FA 1W63M 1D1JA 4Z9QA 4CLCE 4GKUA 4ARZA 1P97A 4B88A 4X53A 1LI0A 1H8ZA 2R78A 3PBQA 5HL1A 2EWWA 3LY4A 3BFFA 5EOOA 3BQ8A 5EVIC 3VOLA 1T18A 4Y13A 3O86A 5CEBA 2J3TD 3LEZA 3IWOA 5E2HA 3C7UA 4GHIB 2Y2IA 2HPBA 5D3OA 3H7WA 5AQ9A 2BLSA 5DKKA 1EW0A 4WLAA 2NUPC 1H8YA 5GLDA 2XA7M 3BY8A 1D7EA 3UE1A 2HV1A 3WRZA 3EEHA 4JF4A 4S2JA 1F9IA 2P9VA 3KO6A 4WZ5A 3ZG0A 2P74A 3LIEA 3MS6A 2ZQ9A 5FASA 3FKVA 1G68A 3PYPA 1EROA 4MDZA 3HL9A 1I2WA 4N9LA 2J9PA 3RFBA 4OQ0A 2VJWA 1S4RA 1KGFA 3MKFA 5HAPA 4HJ6A 3SS5A 4KZ9A 3C38A 2O9CA 3W4OA 1ESIA 3MKEA 3ZFZA 1PW1A 3DWZA 3KSGA 3C30A 3QNCA 3U2AA 3R4KA 2XFTA 1YKDA 3KX0X 4KZ4A 2V20A 1W79A 2JKFA 1UWNX 3ZHHA 2J8YA 1LSWA 1TS0A 4N9KA 4WZ4A 5CRFA 1KDSA 2B18A 4OONA 2JCHA 3A3DA 4UA9A 2W3FA 1NLZA 2VV7A 3CPTB 2LB9A 3QNBA 2WKPA 4PM5A 1TS8A 4LLOB 3UB9A 2ZM0A 2WAEA 4XT2A 5BOHA 3G35A 1E4DA 3P01A 5FI7A 1ODVA 2WKHA 4JBFA 1W5DA 2OOLA 2EFUA 1YMXA 3UB8A 3N8LA 5EM1A 1TS6A 4QY5A 2HDQA 1GSWA 3IXHA 2ZMVA 4KZAA 4L0LA 4X69A 3OPLA 3NHQA 4E3NA 3PAEA 3IXGA 1X0OA 3LIDA 1MXOA 2PR6A 4BLMA 1W7FA 3JVUA 4KZ8A 1DP9A 4HH3A 4M4XA 3UDIA 1GHIA 3AGEA 4OPYA 5FQQA 3QP1A 4D2OA 3K3DA 1MWTA 2XFSA 4LENA 3MXRA 5J4EA 3ZQ5A 4CLCA 1IYSA 2XEPA 2HGVA 3SH7A 4GW9A 1UGUA 1WYCA 4U0TA 1L0GA 2W1TA 5F69A 5HDCA 2IWDA 4MMNA 2QWSA 1I2SA 1VB6A 4ZAMA 4K08A 3HUMA 5AQBA 3OC2A 5IHVA 4II7A 4KZ3A 1LHYA 4ME4A 2JKRI 3K3CA 4WYYA 2H0YA 1SZVA 3O87A 3G2ZA 1OTDA 2XGNA 1CEGA 2J80A 4S2LA 5HWVA 2PDRA 4DE1A 1SKFA 4ZRRA 3F1PB 2V0WA 3GR2A 2Z2LB 1ES5A 5IS1A 4B93A 4KZ5A 1MZUA 2WAFA 4ID4A 4BENA 4GN2A 2FZ0A 2X01A 4GB7A 2ZC6B 3HLBA 3OPHA 3BFCA 3B42A 3FPVA 3ZNTA 2FFYA 4LV3A 4Y0UA 5U47A 3FC7A 4JGOA 3BYDA 2UWXA 2ZLYA 2VZWA 1O07A 3UDXA 2XR0A 1L3LA 1DP8A 2ZC5B 2VGJA 5AQ7A 3ULFA 1ESUA 1BUEA 3U4LP 4MN7A 2J9OA 2XF3A 5FEGA 1LL8A 4NXFA 5KZHA 2J3TC 3IF5A 4R6LA 5A90A 5DFYA 5HAQA 5MC7A 3NOPC 4MN5A 5HAIA 4DRTA 2W3GA 3UPNA 2DRWA 5I94A 3QP8A 3NOUC 1Q2QA 3KYEA 3SH9A 1K0KA 4N92A 3FYZA 2I72A 3PR6A 5CXWA 1E3UA 3Q07A 3UPOA 4D60A 2JKTI 5HWWA 1XJ4A 3Q7VB 4P6BA 5DKLA 4O01A 5HX9A 4HEFA 3Q81A 3CJMA 5E43A 3PBNA 3T4KA 3OBFA 1IYQA 4MLLA 3S4XA 4PMAA 4GHIA 5DVAA 3A3EA 4EBPA 3G32A 4GDNA 2HP5A 3HUOA 2P7JA 3UB6A 3LR4A 1FR1A 4Q0IA 2DNSA 1DJCA 3EGDC 1L2SA 4GS9B 2XDMA 2ZQ8A 1MY8A 3N4IA 4S2KA 2ZC7A 5GLCA 4R4SA 2DMWA 1L0DA 4KQQA 4YFMA 3ZCZA 4DXCA 2WZXA 4JXGA 4KUOA 3UB5P 1K6SA 4E3JA 4P6ZS 2PAVP 1M40A 1FSWA 3C2WA 4GDBA 3CUEA 3NC8A 4LPZA 3Q7ZA 5HDSA 5EECA 4GD6A 1OJGA 3ZNYA 3GECA 2INWA 3LICA 3MZDA 3IT9A 2ZMAA 1YSQA 4DMZA 1XJ6A 1WA9A 3C7VA 3SS3A 5L07A 3E2LA 4HESA 2VEAA 3IHBA 3T4OA 5L8MA 4KQRA 3M6HA 4HQAA 1XGIA 2WGIA 3VP3A 1OT6A 4LRZE 4PKYA 4DN0A 2G2WA 1Q2PA 3CPTA 3JVVA 4E04A 2P04A 3E0YA 4BJPA 4HJ3A 4E3LA 3C8CA 4CQHA 4X1MA 4R1GA 2Y8HA 3SS4A 1NRJA 3EOIA 3G6OA 1PNEA 2WKIA 1L0EA 3UPPA 3VE4A 4EEPA 4OQGA 2ZD8A 2EX9A 2X71A 3H9WA 1EI5A 3TE8A 3EQVA 2ZC3B 3BQAA 2VKSA 2GJ3A 3IHAA 5G4ZA 4WEJA 3PBRA 3S7NA 3OLOA 1IKIA 3QP2A 5FQIA 1PWCA 1S67L 1IYOA 2MJ6A 5HPFA 5HFOA 2Y55A 4LCLA 1PYYA 3PXPA 1FSYA 4C6YA 3QP5A 3VP0A 1QMEA 2PT7A 5AQAA 3HLCA 1YSPA 5HARA 1ES3A 5CGXA 3MZFA 3M6BA 1JNUA 1C3BA 4DF6A 2EA9A 3WRTA 4DJ2A 3MXSA 4EV4A 5EVEA 1TF1A 3CITA 3M2KA 4HBTA 2QJ5A 5FI6A 5FI2A 2GX5A 3HREA 1MBLA 1K6RA 2PBDP 5FAOA 2R9WA 4Q0JA 1CQAA 3MXQA 1LI9A 5L2FA 4X25A 1TVFA 4I3AA 3F1PA 5FDHA 5FQKA 4RQ9A 5A91A 1PFLA 5DF9A 1YLJA 5FSRA 4P87A 3CAXA 2HDUA 5LBRA 2VGLS 4OOYA 1OTEA 1K38A 1KVMA 1MKMA 5CGSA 1QMFA 2GDNA 2Y59A 2ZMFA 5CERA 5M1AA 3GTCA 3GSGA 1AXBA 1ONHA 1FCNA 4NG2A 4OLGA 4YWZA 3OCNA 1XXMA 2HP6A 4KG6A 4OLDA 3IH8A 3V39A 1HVBA 4ETXA 3RTYA 2Y2QA 3VE3A 4E6XA 1FOFA 2EX6A 1TDLA 4A5RA 4N1HA 4FSFA 1W8QA 2WYXA 2GNXA 3OZHA 3BM6A 1SDNA 4BD0A 4L9GA 2Y2KA 3P7NA 4HP9A 1F2KA 2V2FF 3HLEA 4WMCD 1V9YA 2ACGA 1XFQA 2PYRA 4DE0A 2XROA 2LB5A 2Y91A 4S2NA 1DRMA 4X1LA 4KENB 4BBVA 5J3WA 2V8CA 3KSIA 4Q8IA 3UDFA 4JKTA 5CHJA 5HL6A 1E3UD 4NKPA 4K0WA 3AGFA 4DXBA 2VGKA 4UQIM 1YAXA 4WM9A 4WZ5C 5CTMA 1N9NA 3RH8B 4FCFA 2A49A 1XX2A 3IS2B 3LGOA 2YKFA 1KVLA 3Q82A 4OQHA 1H0MA 4PM7A 4YOFA 4I3JA 3BECA 4GS9A 1WE4A 4MNRA 3IXBA 5G4YA 1BULA 3WS2A 2W27A 1DP6A 2M7UA 3EWKA 1NYMA 2HDSA 2PHYA 3H82B 1YM1A 3VSLA 4QU3A 2RCXA 2OWJA 5CTNA 4ZJ3A 2XRNA 4LFUA 4H6JB 2ZM2A 4OKPA 1GHPA 1KE4A 1NZOA 3VSKA 4JPMA 1T1BA 1JWPA 1IKGA 4R70A 5EVLA 1L0FA 1IELA 4EUVA 4KZBA 1K54A 4PM9A 4UAAA 1FCMA 3MQOA 3V67A 3O3VA 3G2YA 5E2EA 4ZJ2A 2EXBA 4QD4A 3B47A 4QY6A 4WN5A 2W3DA 1VHMA 3CI6A 1N9OA 3RXWA 4Y15A 2VLGA 1G5UA 1HTZA 4IEDA 1ACFA 4QJGA 5A93A 3MBZA 4BMWA 2ZOIA 4HBUA 5CX7A 2H5SA 4DDYA 3VMAA 3WS4A 4Y0OA 4PM6A 1RCJA 1BLSA 3NCKA 3HCYA 3MJQA 3NOTC 3C4OA 3SZTA 4EESA 1TS7A 5M18A 1HLUP 2B02A 4M3KA 3LCEA 1PIOA 5FQJA 3WS1A 1IOUA 5I5LA 1CI9A 4OOLA 3A0RA 4QHCA 4IUHA 4KZ6A 2WK0A 2V0UA 4CLCC 2HZ5A 3KSFA 1YLTA 4R4RA 2JBFA 3G31A 2C6WB 4EERA 2XD1A 2VGLM 5JYPA 2EXAA 1PRQA 5K5BA 2Q9MA 4NEED 4Y17A 2K2NA 3L7HA 1NLYA 1Y54A 3ICYA 1G6AA 1NXYA 2JKGA 2QMIA 1YPRA 2ZL1B 1Y28A 3R7WB 2RL3A 4HOIA 1FCOA 4I39A 1ES4A 2H0TA 5CECA 4UA7A 4NETA 3GRJA 1PZOA 2X02A 2WGVA 1GA9A 4IUKA 2ZBBA 4GJ4A 3PAGA 2QPNA 1K57A 1AWIA 1LL9A 1H3QA 2V8FA 3W2ZA 3JPUA 2OLVA 5KSCA 5CEDA 1ZKJA 3IQAA 1M6KA 1ERMA 4WMCA 3D3OA 3JYIA 1W63Q 5HWTA 3ZYTA 4B4ZA 2W1RA 5M19A 1F5MA 3K2NA 3OCLA 2B5RA 1ZHHB 1MC0A 4RVAA 3O88A 2Y4AA 3ZGAB 3E4OA 3HLFA 4R3AA 2J3WA 3UN7A 1K55A 4EU0A 5A92A 2Y2NA 2O0YA 4FUWA 4DE3A 3W4QA 1OT9A 3CLOA 4BBUA 2D01A 4CJNA 5GL9A 4OPQA 4UA6A 3LYXA 4GD8A 3DTMA 2QZ6A 3NDGA 1V9ZA 2V1ZA 3T1RA 4WUJA 3O5YA 4JXWA 4GOGA 3KSHA 2PD8A 1ZG6A 1KOUA 2H10A 4MBHA 1CF0A 3EGXC 3T4SA 4PPRA 1Y4OA 1P9RA 1KGEA 1PI5A 2JHEA 3IH9A 4E6WA 3E2KA 3HUNA 1OPXA 2JN7A 3NBLA 3MFDA 3FWLA 1XGJA 2ZC4B 1PI4A 2XA7S 2GZAA 3PHYA 2VV8A 2K31A 4KUKA 3UMEA 1OTAA 2VK3A 1MPLA 5GHYA 2OWHA 2VV6A 2W0NA 3T4JA 1XP4A 4XUXA 1JWVA 1PWGA 5HDDA 4MN6A 1N4OA 5AVEA 2E8IA 1JVJA 1YLPA 2V9AA 3E4PA 2I9VA 3G34A 1LL5A 4BQMA 3FZCA 3GVBA 1XA7A 3CZDA 3GDIA 1NY0A 2P08A 3IS2A 4Z1WA 2Y2HA 5EM0A 3A3JA 3BLSA 5TBMB 3L9KA 4EETB 2XQZA 4Y5FA 2IWBA 3CUEC 4JGRA 4HY8A 4KG5A 2C5WB 1XKZA 5EE8A 3ISGA 4CPKA 3T4QA 2KOIA 3D9YA 3NIAA 4N1XA 1E25A 1Z09A 2L0WA 2AVXA 2J7VA 1K56D 3M2JA 4S2IA 4FOFA 1DJAA 3H82A 5F68A 4B9OA 2JC7A 3NI9A 1ONGA 5FEFA 4JLFA 3F1OB 3G30A 3ZVWA 4ETZA 2PRFA 3LO7A 4H6JA 5FAQA 3IF6B 2XLNA 4GZBA 3MSHA 3E98A 5GHZA 5EFWA 5F1GA 3W8KA 3N8RA 2PR5A 1VM1A 4X56A 5FAPA 1XPBA 2OAQ1 5TR7A 4R3JA 5DTKA 5CHUA 4NK3A 3IX3A 5KSHA 3F1NB 3FKWA 1NWZA 2QKPA 3LEQA 4R23A 4L9FA 1BTLA 4IHQA 3BFDA 1CK3A 4RX2A 2HJ9C 3V3SA 4QPRA 3B3XA 1MWUA 4PAUA 3S22A 3RXXA 3VV4A 3T4TA 3HJIA 2PU4A 1NRFA 3FPWA 4FH4A 3OPPA 2WUQA 4RX3A 3PBTA 4BD1A 3LUQA 4U3TA 1MWSA 1CEFA 1Z6FA 4I5SA 4HHDA 1ZG4A 5FQ9A 2WKRA 2PD7A 3PBOA 1UWPX 3WS5A 5DJTA 4O8GA 4JGQA 1NYYA 4MEZA 4LRYC 5DJUA 1YLYA 1VETB 3VFHA 1JTGA 3CMZA 3B33A 5DFXA 2W3EA 3N7WA 2HF6A 3HLWA 4OVDA 4MBFA 2ZQCA 1STZA 3LIFA 3UE0A 2WKEA 4BBTA 1MKIA 5DF7A 2ZL1A 1LSXA 4OOMA 1HZOA 4QWOA 3R7WA 1H8MA 2HJEA 4K0XA 5C5KA 2CMNA 2A24B 1RGYA 4U0XA 3V3RA 3EEAA 4ESPA 2QHKA 1FR6A 2Y2LA 2A2LA 3BFEA 3DBAA 2QYBA 2XSSA 4BWIA 3N6IA 1P0ZA 3ZG5A 3BW6A 2Y79A 3P98A 4FTXA 2W3HA 1YT4A 4OP8A 2EFXA 4YNRA 5F5YA 5FA7A 2JE5A 3GQZA 3TW8A 1FIKA 2OAP1 2XD5A 4Y0TA 3TSGA 3NULA 4BL3A 3E4QA 4P6ZM 3VP4A 2O9BA 2EWVA
chains in the Genus database with same CATH topology
4WELA 3NOTC 4GHIA 4EESA 1TS7A 3PBSA 5HZHA 3S7OA 2B02A 4GLQA 2L1MA 2P7JA 5AJGA 3UB6A 3LR4A 1IOUA 5I5LA 2JKTM 4OOLA 3A0RA 1OTBA 3IBRA 4Q0IA 1XJ3A 3S7PA 5A8BA 3EGDC 4IUHA 4GS9B 3LR0A 4JGPA 5HD5A 3S7QA 2V0UA 4CLCC 1TD5A 3KSFA 3BJNA 2DMWA 4EERA 3BWLA 2KX6A 2VGLM 4F3LA 3UE6A 4Q0HA 5K5BA 3LI8A 4KUOA 4NEED 2K2NA 4CLCD 3MFXA 1NLYA 4P6ZS 3ICYA 4HJ4A 1Y28A 3R7WB 3C2WA 3CUEA 3BY9A 2Z6DA 3EQUA 4HOIA 4LPZA 3LR5A 4I39A 4PKYG 1OTIA 4UEYA 5HDSA 1P9WA 4AFIA 1OJGA 4EEUA 3GECA 2INWA 4GCZA 3LICA 4IUKA 1YSQA 2ZBBA 4GJ4A 5IU1A 4DMZA 1XJ6A 1H3QA 2BASA 1WA9A 3W2ZA 1IFQA 1W63M 4HNBA 4CLCE 4ARZA 1P97A 2VEAA 5J7EA 3T4OA 3D72A 2KDKA 5L8MA 3D3OA 4HQAA 1W63Q 2R78A 3PBQA 5HWTA 3LI9A 2EWWA 5TJJA 3ZYTA 2W1RA 3BQ8A 2PYPA 3VOLA 1T18A 1ZTUA 1F5MA 3CWFA 3K2NA 4NXBA 1OT6A 3OCLA 4LRZE 1ZHHB 4PKYA 4DN0A 5IT5A 1MC0A 2J3TD 3E4OA 4Y3IA 3JVVA 4E04A 2P04A 4R3AA 3E0YA 2J3WA 4HJ3A 4BJPA 3C8CA 4HH2A 4GHIB 4EU0A 4CQHA 3H7WA 2O0YA 5TBMA 2Y8HA 5DKKA 1NRJA 3EOIA 3TRCA 1OT9A 3CLOA 4EQ1A 4BBUA 3KYZA 1EW0A 2D01A 3G6OA 4WLAA 2NUPC 4HI4A 2XA7M 3BY8A 1D7EA 3VE4A 4EEPA 3LYXA 3TJZC 4WL9A 5KIZA 3MQQA 2O9AA 2IA2A 2HV1A 3EEHA 3UB7A 2K7SA 1F9IA 2V1BA 3H9WA 4F3LB 1V9ZA 3KO6A 1LSVA 3TE8A 2G7UA 3EQVA 2ZOHA 3LIEA 3O5YA 4IJGA 4WUJA 5G4ZA 3BQAA 2VKSA 2GJ3A 4WEJA 3PBRA 3MR0A 3PYPA 3F1OA 3KSHA 3S7NA 2PD8A 4MDZA 3OLOA 1KOUA 3EGXC 3T4SA 1S67L 4I3IA 2MJ6A 5HPFA 3RFBA 1P9RA 2QJ7A 2VJWA 2JHEA 1S4RA 3FG8A 3PXPA 4HJ6A 3C38A 1OPXA 2O9CA 4G3WA 2PT7A 2JN7A 1D06A 2XA7S 1S1YA 2GZAA 3PHYA 2VV8A 3F1NA 3KSGA 1YSPA 2K31A 3C30A 4KUKA 4L9EA 3UMEA 5HSQA 1OTAA 3U2AA 3R4KA 1YKDA 3A0SA 3KX0X 4WF0A 2OWHA 4Y2FA 4ARZB 2VV6A 4EW7A 2W0NA 1JNUA 3T4JA 1UWNX 1N9LA 2EA9A 4DJ2A 5HDDA 2Z6CA 3LR3A 3LFVA 1LSWA 4MN6A 1TF1A 1T1AA 5AVEA 1TS0A 3CITA 2V9AA 5AVFA 2QJ5A 3E4PA 3T50A 2I9VA 2B18A 2GX5A 4HIAA 4Q0JA 3MXQA 4I3AA 3F1PA 2W3FA 1NLZA 2VV7A 4RQ9A 2LB9A 3GDIA 5DF9A 2P08A 2WKPA 3CAXA 3T4LA 5LBRA 2VGLS 3IS2A 1OTEA 4Z1WA 1TS8A 3H7WB 1MKMA 5TBMB 5F6AA 2ZMFA 4LLOB 4EETB 3NJAA 4Y5FA 3UB9A 4PHTA 3UMDA 1GSVA 4XT2A 3CUEC 4JGRA 1BYWA 4HY8A 3P01A 1ODVA 4YWZA 2OOLA 3OCNA 4DJ3A 3UB8A 3T4QA 2KOIA 1TS6A 4G3KA 2L0WA 1F98A 1GSWA 2ZMVA 4L0LA 3NHQA 4FOFA 3H82A 4MCWA 5F68A 4B9OA 4R38A 4ETXA 3RTYA 1X0OA 3LIDA 2PR6A 2NUTC 3F1OB 3VE3A 4I38A 3LIBA 4ETZA 3JVUA 4FSFA 4H6JA 1DP9A 2GNXA 4HH3A 4M4XA 5HD3A 4L9GA 1LT0A 4LRXC 3E98A 5EFWA 3K3DA 2PR5A 2A24A 3P7NA 4KQOA 1S1ZA 4HP9A 2OAQ1 5J4EA 3ZQ5A 4CLCA 3LIAA 2M1CA 2HGVA 1G28A 1V9YA 4GW9A 1UGUA 1XFQA 5KSHA 3F1NB 4KQDA 2W1TA 1NWZA 2QKPA 5F69A 5HDCA 2PYRA 4MMNA 4L9FA 2QWSA 1VB6A 4IHQA 2XROA 2LB5A 4K08A 3OC2A 2HJ9C 2FH5A 1DRMA 4QPRA 4II7A 4BBVA 4ME4A 2JKRI 3K3CA 4PAUA 2D02A 5J3WA 3VV4A 3KYQA 3T4TA 3HJIA 3KSIA 2M7VA 5FL3A 2V1AA 1S66L 3FPWA 1T1CA 2VX8A 1OTDA 5HL6A 2J80A 4NKPA 3PBTA 3UE3A 5HWVA 1T19A 2PDRA 4UQIM 4ZRRA 2VA0A 1YAXA 3F1PB 2V0WA 4G3VA 1N9NA 3LUQA 3RH8B 5IS1A 3HJKA 4B93A 3IS2B 1MZUA 2YKFA 2FZ0A 2O99A 2JKRM 2YKHA 4I5SA 4HHDA 2WKRA 3IBJA 4NXEA 2PD7A 3B42A 1XFNA 1UWPX 3MQ0A 3PBOA 4XT2B 3FPVA 4YOFA 5DJTA 1G6OA 4I3JA 4O8GA 4NXGA 4GS9A 4JGQA 4LRYC 1OJ5A 5G4YA 3FC7A 5DJUA 4JGOA 2W27A 1DP6A 2M7UA 3EWKA 3B33A 2VZWA 5DFXA 2W3EA 2PHYA 3H82B 2HF6A 4HP4A 1S4SA 2OWJA 1DP8A 3MMHA 3ULFA 1STZA 2XRNA 3LIFA 4BBTA 4MN7A 4H6JB 4UQIS 1LSXA 4OOMA 1T1BA 1LL8A 4NXFA 3R7WA 4R70A 1H8MA 2HJEA 5C5KA 2J3TC 4EUVA 2CMNA 4R6LA 2A24B 3EEAA 2WKQA 5DFYA 4CLCB 3SW1A 3MQOA 3V67A 5MC7A 2QHKA 3NOPC 4MN5A 2W3GA 3B47A 2A2LA 3DBAA 2QYBA 2W1TB 2W3DA 2XSSA 4WN5A 4BWIA 1P0ZA 1VHMA 2KLIA 3CI6A 3MF0A 1N9OA 3NOUC 4O0PA 3BW6A 2VLGA 2Y79A 2L4RA 3A0VA 2W3HA 3PR6A 4BMWA 5HPIA 2ZOIA 5CX7A 4YNRA 5F5YA 2JKTI 5HWWA 1XJ4A 5DKLA 4O01A 3TW8A 2OAP1 2H28A 3PBNA 3T4KA 3OBFA 3OOVA 4EXOA 4WEKA 3E4QA 4P6ZM 1XJ2A 2O9BA 3HCYA 2EWVA 1GSXA 3MJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NOT C;  4GHI A;  4EES A;  1TS7 A;  5HZH A;  2B02 A;  2L1M A;  2P7J A;  3UB6 A;  5I5L A;  3A0R A;  1OTB A;  3IBR A;  1XJ3 A;  5A8B A;  4GS9 B;  4JGP A;  5HD5 A;  2V0U A;  4EER A;  3BWL A;  2KX6 A;  4F3L A;  3UE6 A;  3LI8 A;  4KUO A;  3MFX A;  3ICY A;  4HJ4 A;  1Y28 A;  3C2W A;  3BY9 A;  2Z6D A;  4HOI A;  4LPZ A;  4I39 A;  4PKY G;  1OTI A;  5HDS A;  1OJG A;  4EEU A;  3GEC A;  2INW A;  4GCZ A;  3LIC A;  2ZBB A;  5IU1 A;  1XJ6 A;  2BAS A;  1WA9 A;  4HNB A;  1P97 A;  2VEA A;  5J7E A;  3D72 A;  2KDK A;  4HQA A;  2R78 A;  5HWT A;  3LI9 A;  2PYP A;  3VOL A;  1T18 A;  3CWF A;  4NXB A;  1OT6 A;  4LRZ E;  4PKY A;  3E4O A;  4E04 A;  4R3A A;  4HJ3 A;  3C8C A;  4HH2 A;  4GHI B;  3H7W A;  5TBM A;  5DKK A;  1OT9 A;  3CLO A;  4EQ1 A;  4BBU A;  1EW0 A;  2D01 A;  3G6O A;  4WLA A;  4HI4 A;  3BY8 A;  1D7E A;  3VE4 A;  4EEP A;  3LYX A;  4WL9 A;  5KIZ A;  3MQQ A;  2HV1 A;  3EEH A;  3UB7 A;  2K7S A;  1F9I A;  2V1B A;  3H9W A;  4F3L B;  1V9Z A;  1LSV A;  3LIE A;  2ZOH A;  4WUJ A;  5G4Z A;  2GJ3 A;  3PYP A;  3MR0 A;  3F1O A;  2PD8 A;  3OLO A;  1KOU A;  1S67 L;  4I3I A;  2QJ7 A;  2JHE A;  1S4R A;  3FG8 A;  4HJ6 A;  2JN7 A;  1D06 A;  1S1Y A;  3PHY A;  2VV8 A;  3F1N A;  4KUK A;  4L9E A;  3UME A;  5HSQ A;  1OTA A;  3A0S A;  3KX0 X;  4WF0 A;  2OWH A;  2VV6 A;  4EW7 A;  2W0N A;  1JNU A;  1UWN X;  1N9L A;  2EA9 A;  4DJ2 A;  5HDD A;  2Z6C A;  1LSW A;  4MN6 A;  1T1A A;  5AVE A;  1TS0 A;  2V9A A;  5AVF A;  2QJ5 A;  3E4P A;  3T50 A;  2I9V A;  4HIA A;  3MXQ A;  4I3A A;  3F1P A;  2VV7 A;  4RQ9 A;  3GDI A;  3CAX A;  2WKP A;  3IS2 A;  1OTE A;  1TS8 A;  3H7W B;  5TBM B;  5F6A A;  4LLO B;  4EET B;  3NJA A;  3UB9 A;  3UMD A;  1GSV A;  4XT2 A;  4JGR A;  1BYW A;  4HY8 A;  1ODV A;  4YWZ A;  2OOL A;  4DJ3 A;  3UB8 A;  1TS6 A;  2L0W A;  1F98 A;  1GSW A;  3NHQ A;  3H82 A;  4B9O A;  5F68 A;  4R38 A;  3RTY A;  1X0O A;  3LID A;  2PR6 A;  3F1O B;  3VE3 A;  4I38 A;  3LIB A;  4H6J A;  1DP9 A;  4HH3 A;  4M4X A;  5HD3 A;  4L9G A;  1LT0 A;  4LRX C;  5EFW A;  3K3D A;  2PR5 A;  2A24 A;  3P7N A;  1S1Z A;  4HP9 A;  5J4E A;  3ZQ5 A;  3LIA A;  2M1C A;  1G28 A;  1V9Y A;  4GW9 A;  1UGU A;  1XFQ A;  3F1N B;  4KQD A;  1NWZ A;  2QKP A;  5F69 A;  5HDC A;  2PYR A;  4L9F A;  2QWS A;  1VB6 A;  4K08 A;  1DRM A;  4BBV A;  3K3C A;  2D02 A;  5J3W A;  3HJI A;  2V1A A;  1S66 L;  1T1C A;  1OTD A;  2J80 A;  5HWV A;  1T19 A;  2PDR A;  3F1P B;  2V0W A;  1N9N A;  3LUQ A;  3RH8 B;  5IS1 A;  3HJK A;  3IS2 B;  1MZU A;  2YKF A;  2YKH A;  4I5S A;  4HHD A;  2WKR A;  4NXE A;  2PD7 A;  4XT2 B;  1XFN A;  1UWP X;  5DJT A;  4I3J A;  4NXG A;  4GS9 A;  4JGQ A;  4LRY C;  1OJ5 A;  5G4Y A;  3FC7 A;  5DJU A;  4JGO A;  2W27 A;  1DP6 A;  3EWK A;  3B33 A;  2PHY A;  3H82 B;  4HP4 A;  1S4S A;  2OWJ A;  1DP8 A;  3ULF A;  3LIF A;  4BBT A;  4H6J B;  1LSX A;  1T1B A;  1LL8 A;  4NXF A;  4R70 A;  2CMN A;  4R6L A;  2A24 B;  2WKQ A;  3SW1 A;  3MQO A;  2QHK A;  3NOP C;  4MN5 A;  4WN5 A;  1P0Z A;  3NOU C;  1N9O A;  2VLG A;  2L4R A;  3A0V A;  2ZOI A;  5F5Y A;  5HWW A;  1XJ4 A;  5DKL A;  2H28 A;  4EXO A;  3E4Q A;  1XJ2 A;  1GSX A;  3MJQ A; 
#chains in the Genus database with same CATH topology
 3VOY A;  4WEL A;  1KE3 A;  2XH9 A;  5HZH A;  3S7O A;  5AJG A;  3Q7V A;  4EUZ A;  3RJU A;  1OTB A;  3IBR A;  1XJ3 A;  3S7P A;  1VEU B;  5A8B A;  3LR0 A;  4JGP A;  3S7Q A;  2Q9N A;  4ZDX A;  4S2P A;  2OLU A;  4YIN A;  2PU2 A;  3VOZ A;  4S2N C;  4FH2 A;  1K56 A;  1DY6 A;  1GA0 A;  3P09 A;  1YMS A;  3BY9 A;  2Z6D A;  5GLB A;  1XA1 A;  5EOE A;  4WBG A;  1J3W A;  2Y2M A;  4DDS A;  1FQG A;  5FQM A;  2ZQ7 A;  4EEU A;  1IEM A;  4GCZ A;  1SCW A;  1BT5 A;  2Y2O A;  4K91 A;  5IU1 A;  1YLZ A;  4ZBE A;  3QP4 A;  3N8S A;  3S1Y A;  3NY4 A;  1IFQ A;  4JF6 A;  1K4E A;  4HNB A;  4EBN A;  2OSU A;  1ERQ A;  3AGD A;  5J7E A;  3D72 A;  2KDK A;  1SKO B;  5J8X A;  4X55 A;  4IBR A;  2WGW B;  3LI9 A;  5TJJ A;  1TEM A;  4DKI A;  4S2O A;  2PYP A;  1ZTU A;  3CWF A;  4NXB A;  5IT5 A;  2HP9 A;  4EQI A;  3NEC A;  2E8J A;  4RA7 A;  4E3M A;  5DTS A;  2WAD A;  4Y3I A;  3UO9 A;  3UNW A;  4HH2 A;  3ZG9 B;  2B95 A;  4OPZ A;  5TBM A;  3TRC A;  4EQ1 A;  3KYZ A;  3GMW A;  3G4P A;  2DCF A;  4HI4 A;  3DTI A;  2WZZ A;  3VP1 A;  1K54 C;  3TJZ C;  4WL9 A;  5KIZ A;  3MQQ A;  2O9A A;  5DF8 A;  3T12 B;  2IA2 A;  1JTD A;  3UB7 A;  3HVF A;  5FDS A;  2K7S A;  2V1B A;  1H5X A;  1RGZ A;  4F3L B;  1BSG A;  1LSV A;  2G7U A;  1S6R A;  2ZOH A;  1GCE A;  4IJG A;  3V5M A;  4X6T A;  4B4X A;  4JF5 A;  3IWQ A;  3CG5 A;  3MR0 A;  5HW3 A;  3F1O A;  4GNU A;  1PZP A;  3HBR A;  3VFF A;  3IF6 A;  4I3I A;  1W8Y A;  5EVI B;  2QJ7 A;  2IWC A;  3FG8 A;  1O7E A;  1SHV A;  3ZG8 B;  1OME A;  3BEB A;  1GHM A;  1I5Q A;  3BLM A;  4G3W A;  1D06 A;  4ZTK A;  1HD8 A;  1S1Y A;  2R9X A;  3F1N A;  4RYE A;  3C4P A;  5GLA A;  4L9E A;  3HLG A;  3DWK A;  3Q1F A;  4FD8 A;  4C3Q A;  1VQQ A;  5HSQ A;  3WS0 A;  3A0S A;  4WF0 A;  4IBX A;  4Y2F A;  4ARZ B;  3GV9 A;  4EW7 A;  4C75 A;  1N9L A;  2HDR A;  2Z6C A;  3LR3 A;  3LFV A;  2FFF B;  3QHY A;  3IF6 C;  1FIL A;  1T1A A;  5AVF A;  1K25 A;  2Z2M B;  3T50 A;  4OPR A;  5EUA A;  1YQS A;  4HIA A;  1LLB A;  1TDG A;  4F94 A;  4OH0 A;  5CGW A;  2OV5 A;  2Q0O A;  3T4L A;  3IX8 A;  3SOI A;  3H7W B;  2PBY A;  5F6A A;  4H8R A;  2XK1 A;  3NJA A;  4PHT A;  3UMD A;  1GSV A;  2Y2G A;  3SH8 A;  1BYW A;  5EV0 A;  4DJ3 A;  3IXD A;  1VET A;  4G3K A;  1F98 A;  3DW0 A;  2P9V B;  1ES2 A;  5FAT A;  3ZDJ A;  4MCW A;  5TFQ A;  5EVI D;  1K57 C;  4R38 A;  2NUT C;  1NZU A;  4I38 A;  3LIB A;  4JXS A;  2BTF P;  5HD3 A;  1LT0 A;  3WWX A;  4LRX C;  3MZE A;  1EWZ A;  2A24 A;  4KQO A;  1KGG A;  1S1Z A;  4LV2 A;  5KMW A;  1J9M A;  3LIA A;  4P0M A;  2M1C A;  1DJB A;  1G28 A;  1PWD A;  1ALQ A;  4KQD A;  4MBK A;  4EBL A;  1K55 C;  4LGW A;  4BL2 A;  2FH5 A;  4UHU A;  2D02 A;  5F83 A;  3KYQ A;  5F82 A;  3LY3 A;  2M7V A;  5FL3 A;  2V1A A;  1S66 L;  4JXV A;  1T1C A;  2VX8 A;  4X68 A;  3QP6 A;  5CHM A;  3UE3 A;  1T19 A;  3FV7 A;  3DAV A;  2VA0 A;  4G3V A;  3D4F A;  3HJK A;  2EX8 A;  5G18 A;  2O99 A;  2JKR M;  2YKH A;  4IVK A;  3IBJ A;  4NXE A;  3MQ0 A;  1XFN A;  4XT2 B;  3T1X A;  4DE2 A;  1G6O A;  1VEU A;  3VP2 A;  4NXG A;  1OJ5 A;  3PTE A;  5JYO A;  3C5A A;  4IVI A;  1WYB A;  4HP4 A;  1S4S A;  3MMH A;  3A3I A;  3BFG A;  1U60 A;  4UQI S;  4LCM A;  2ZQD A;  4KG2 A;  4S2M A;  2ZM8 A;  1BZA A;  2CC1 A;  4E3I A;  1KDW A;  4KZ7 A;  2WKQ A;  3CHW P;  4CLC B;  3SW1 A;  3IWI A;  3IX4 A;  5DTT A;  1NJ4 A;  2W1T B;  2KLI A;  4O0P A;  1CJF A;  3MF0 A;  4O7D A;  2L4R A;  4PM8 A;  3A0V A;  3HLD A;  1N9B A;  1S0W A;  1SKO A;  5HPI A;  3I7J A;  4E3K A;  1A0K A;  5E2G A;  1BLC A;  2Y2J A;  2WGW A;  4Y7P A;  5L10 A;  2H28 A;  1BLP A;  3OOV A;  5EPH A;  4EXO A;  4QB8 A;  4WEK A;  1XJ2 A;  1GSX A;  4LV0 A;  1PW8 A;  5F1F A;  1MWR A;  3BRM A;  3NDE A;  1CI8 A;  4OP5 A;  3PBS A;  1IYP A;  2UV0 E;  3ITB A;  3T1S A;  2ZJ9 A;  4GLQ A;  2L1M A;  3ZG7 B;  2Y2P A;  4LV1 A;  1SDE A;  4R0Q A;  2JKT M;  4OQI A;  3DTE A;  1YLW A;  1BLH A;  2ZQA A;  3A3F A;  5HD5 A;  3ITA A;  1TD5 A;  4XUZ A;  1JWZ A;  4R3B A;  4E3O A;  5GHX A;  5E2F A;  3BJN A;  4XXR A;  3BWL A;  2KX6 A;  4F3L A;  5TGF A;  3UE6 A;  4Q0H A;  3LI8 A;  3TOI A;  4CLC D;  3MFX A;  3ZVT A;  4HJ4 A;  2A3U A;  1RP5 A;  5EVI A;  3V50 A;  3EQU A;  3OPR A;  3LR5 A;  4ZJ1 A;  3W4P A;  3UY6 A;  4PKY G;  2BG1 A;  3T1Q B;  5L09 A;  1OTI A;  4UEY A;  1P9W A;  4AFI A;  4P85 A;  2G2U A;  3TG9 A;  3DTK A;  1ZC2 A;  4EWF A;  1KE0 A;  2BAS A;  2EX2 A;  1K4F A;  1W63 M;  1D1J A;  4Z9Q A;  4CLC E;  4GKU A;  4ARZ A;  1P97 A;  4B88 A;  4X53 A;  1LI0 A;  1H8Z A;  2R78 A;  3PBQ A;  5HL1 A;  2EWW A;  3LY4 A;  3BFF A;  5EOO A;  3BQ8 A;  5EVI C;  3VOL A;  1T18 A;  4Y13 A;  3O86 A;  5CEB A;  2J3T D;  3LEZ A;  3IWO A;  5E2H A;  3C7U A;  4GHI B;  2Y2I A;  2HPB A;  5D3O A;  3H7W A;  5AQ9 A;  2BLS A;  5DKK A;  1EW0 A;  4WLA A;  2NUP C;  1H8Y A;  5GLD A;  2XA7 M;  3BY8 A;  1D7E A;  3UE1 A;  2HV1 A;  3WRZ A;  3EEH A;  4JF4 A;  4S2J A;  1F9I A;  2P9V A;  3KO6 A;  4WZ5 A;  3ZG0 A;  2P74 A;  3LIE A;  3MS6 A;  2ZQ9 A;  5FAS A;  3FKV A;  1G68 A;  3PYP A;  1ERO A;  4MDZ A;  3HL9 A;  1I2W A;  4N9L A;  2J9P A;  3RFB A;  4OQ0 A;  2VJW A;  1S4R A;  1KGF A;  3MKF A;  5HAP A;  4HJ6 A;  3SS5 A;  4KZ9 A;  3C38 A;  2O9C A;  3W4O A;  1ESI A;  3MKE A;  3ZFZ A;  1PW1 A;  3DWZ A;  3KSG A;  3C30 A;  3QNC A;  3U2A A;  3R4K A;  2XFT A;  1YKD A;  3KX0 X;  4KZ4 A;  2V20 A;  1W79 A;  2JKF A;  1UWN X;  3ZHH A;  2J8Y A;  1LSW A;  1TS0 A;  4N9K A;  4WZ4 A;  5CRF A;  1KDS A;  2B18 A;  4OON A;  2JCH A;  3A3D A;  4UA9 A;  2W3F A;  1NLZ A;  2VV7 A;  3CPT B;  2LB9 A;  3QNB A;  2WKP A;  4PM5 A;  1TS8 A;  4LLO B;  3UB9 A;  2ZM0 A;  2WAE A;  4XT2 A;  5BOH A;  3G35 A;  1E4D A;  3P01 A;  5FI7 A;  1ODV A;  2WKH A;  4JBF A;  1W5D A;  2OOL A;  2EFU A;  1YMX A;  3UB8 A;  3N8L A;  5EM1 A;  1TS6 A;  4QY5 A;  2HDQ A;  1GSW A;  3IXH A;  2ZMV A;  4KZA A;  4L0L A;  4X69 A;  3OPL A;  3NHQ A;  4E3N A;  3PAE A;  3IXG A;  1X0O A;  3LID A;  1MXO A;  2PR6 A;  4BLM A;  1W7F A;  3JVU A;  4KZ8 A;  1DP9 A;  4HH3 A;  4M4X A;  3UDI A;  1GHI A;  3AGE A;  4OPY A;  5FQQ A;  3QP1 A;  4D2O A;  3K3D A;  1MWT A;  2XFS A;  4LEN A;  3MXR A;  5J4E A;  3ZQ5 A;  4CLC A;  1IYS A;  2XEP A;  2HGV A;  3SH7 A;  4GW9 A;  1UGU A;  1WYC A;  4U0T A;  1L0G A;  2W1T A;  5F69 A;  5HDC A;  2IWD A;  4MMN A;  2QWS A;  1I2S A;  1VB6 A;  4ZAM A;  4K08 A;  3HUM A;  5AQB A;  3OC2 A;  5IHV A;  4II7 A;  4KZ3 A;  1LHY A;  4ME4 A;  2JKR I;  3K3C A;  4WYY A;  2H0Y A;  1SZV A;  3O87 A;  3G2Z A;  1OTD A;  2XGN A;  1CEG A;  2J80 A;  4S2L A;  5HWV A;  2PDR A;  4DE1 A;  1SKF A;  4ZRR A;  3F1P B;  2V0W A;  3GR2 A;  2Z2L B;  1ES5 A;  5IS1 A;  4B93 A;  4KZ5 A;  1MZU A;  2WAF A;  4ID4 A;  4BEN A;  4GN2 A;  2FZ0 A;  2X01 A;  4GB7 A;  2ZC6 B;  3HLB A;  3OPH A;  3BFC A;  3B42 A;  3FPV A;  3ZNT A;  2FFY A;  4LV3 A;  4Y0U A;  5U47 A;  3FC7 A;  4JGO A;  3BYD A;  2UWX A;  2ZLY A;  2VZW A;  1O07 A;  3UDX A;  2XR0 A;  1L3L A;  1DP8 A;  2ZC5 B;  2VGJ A;  5AQ7 A;  3ULF A;  1ESU A;  1BUE A;  3U4L P;  4MN7 A;  2J9O A;  2XF3 A;  5FEG A;  1LL8 A;  4NXF A;  5KZH A;  2J3T C;  3IF5 A;  4R6L A;  5A90 A;  5DFY A;  5HAQ A;  5MC7 A;  3NOP C;  4MN5 A;  5HAI A;  4DRT A;  2W3G A;  3UPN A;  2DRW A;  5I94 A;  3QP8 A;  3NOU C;  1Q2Q A;  3KYE A;  3SH9 A;  1K0K A;  4N92 A;  3FYZ A;  2I72 A;  3PR6 A;  5CXW A;  1E3U A;  3Q07 A;  3UPO A;  4D60 A;  2JKT I;  5HWW A;  1XJ4 A;  3Q7V B;  4P6B A;  5DKL A;  4O01 A;  5HX9 A;  4HEF A;  3Q81 A;  3CJM A;  5E43 A;  3PBN A;  3T4K A;  3OBF A;  1IYQ A;  4MLL A;  3S4X A;  4PMA A;  4GHI A;  5DVA A;  3A3E A;  4EBP A;  3G32 A;  4GDN A;  2HP5 A;  3HUO A;  2P7J A;  3UB6 A;  3LR4 A;  1FR1 A;  4Q0I A;  2DNS A;  1DJC A;  3EGD C;  1L2S A;  4GS9 B;  2XDM A;  2ZQ8 A;  1MY8 A;  3N4I A;  4S2K A;  2ZC7 A;  5GLC A;  4R4S A;  2DMW A;  1L0D A;  4KQQ A;  4YFM A;  3ZCZ A;  4DXC A;  2WZX A;  4JXG A;  4KUO A;  3UB5 P;  1K6S A;  4E3J A;  4P6Z S;  2PAV P;  1M40 A;  1FSW A;  3C2W A;  4GDB A;  3CUE A;  3NC8 A;  4LPZ A;  3Q7Z A;  5HDS A;  5EEC A;  4GD6 A;  1OJG A;  3ZNY A;  3GEC A;  2INW A;  3LIC A;  3MZD A;  3IT9 A;  2ZMA A;  1YSQ A;  4DMZ A;  1XJ6 A;  1WA9 A;  3C7V A;  3SS3 A;  5L07 A;  3E2L A;  4HES A;  2VEA A;  3IHB A;  3T4O A;  5L8M A;  4KQR A;  3M6H A;  4HQA A;  1XGI A;  2WGI A;  3VP3 A;  1OT6 A;  4LRZ E;  4PKY A;  4DN0 A;  2G2W A;  1Q2P A;  3CPT A;  3JVV A;  4E04 A;  2P04 A;  3E0Y A;  4BJP A;  4HJ3 A;  4E3L A;  3C8C A;  4CQH A;  4X1M A;  4R1G A;  2Y8H A;  3SS4 A;  1NRJ A;  3EOI A;  3G6O A;  1PNE A;  2WKI A;  1L0E A;  3UPP A;  3VE4 A;  4EEP A;  4OQG A;  2ZD8 A;  2EX9 A;  2X71 A;  3H9W A;  1EI5 A;  3TE8 A;  3EQV A;  2ZC3 B;  3BQA A;  2VKS A;  2GJ3 A;  3IHA A;  5G4Z A;  4WEJ A;  3PBR A;  3S7N A;  3OLO A;  1IKI A;  3QP2 A;  5FQI A;  1PWC A;  1S67 L;  1IYO A;  2MJ6 A;  5HPF A;  5HFO A;  2Y55 A;  4LCL A;  1PYY A;  3PXP A;  1FSY A;  4C6Y A;  3QP5 A;  3VP0 A;  1QME A;  2PT7 A;  5AQA A;  3HLC A;  1YSP A;  5HAR A;  1ES3 A;  5CGX A;  3MZF A;  3M6B A;  1JNU A;  1C3B A;  4DF6 A;  2EA9 A;  3WRT A;  4DJ2 A;  3MXS A;  4EV4 A;  5EVE A;  1TF1 A;  3CIT A;  3M2K A;  4HBT A;  2QJ5 A;  5FI6 A;  5FI2 A;  2GX5 A;  3HRE A;  1MBL A;  1K6R A;  2PBD P;  5FAO A;  2R9W A;  4Q0J A;  1CQA A;  3MXQ A;  1LI9 A;  5L2F A;  4X25 A;  1TVF A;  4I3A A;  3F1P A;  5FDH A;  5FQK A;  4RQ9 A;  5A91 A;  1PFL A;  5DF9 A;  1YLJ A;  5FSR A;  4P87 A;  3CAX A;  2HDU A;  5LBR A;  2VGL S;  4OOY A;  1OTE A;  1K38 A;  1KVM A;  1MKM A;  5CGS A;  1QMF A;  2GDN A;  2Y59 A;  2ZMF A;  5CER A;  5M1A A;  3GTC A;  3GSG A;  1AXB A;  1ONH A;  1FCN A;  4NG2 A;  4OLG A;  4YWZ A;  3OCN A;  1XXM A;  2HP6 A;  4KG6 A;  4OLD A;  3IH8 A;  3V39 A;  1HVB A;  4ETX A;  3RTY A;  2Y2Q A;  3VE3 A;  4E6X A;  1FOF A;  2EX6 A;  1TDL A;  4A5R A;  4N1H A;  4FSF A;  1W8Q A;  2WYX A;  2GNX A;  3OZH A;  3BM6 A;  1SDN A;  4BD0 A;  4L9G A;  2Y2K A;  3P7N A;  4HP9 A;  1F2K A;  2V2F F;  3HLE A;  4WMC D;  1V9Y A;  2ACG A;  1XFQ A;  2PYR A;  4DE0 A;  2XRO A;  2LB5 A;  2Y91 A;  4S2N A;  1DRM A;  4X1L A;  4KEN B;  4BBV A;  5J3W A;  2V8C A;  3KSI A;  4Q8I A;  3UDF A;  4JKT A;  5CHJ A;  5HL6 A;  1E3U D;  4NKP A;  4K0W A;  3AGF A;  4DXB A;  2VGK A;  4UQI M;  1YAX A;  4WM9 A;  4WZ5 C;  5CTM A;  1N9N A;  3RH8 B;  4FCF A;  2A49 A;  1XX2 A;  3IS2 B;  3LGO A;  2YKF A;  1KVL A;  3Q82 A;  4OQH A;  1H0M A;  4PM7 A;  4YOF A;  4I3J A;  3BEC A;  4GS9 A;  1WE4 A;  4MNR A;  3IXB A;  5G4Y A;  1BUL A;  3WS2 A;  2W27 A;  1DP6 A;  2M7U A;  3EWK A;  1NYM A;  2HDS A;  2PHY A;  3H82 B;  1YM1 A;  3VSL A;  4QU3 A;  2RCX A;  2OWJ A;  5CTN A;  4ZJ3 A;  2XRN A;  4LFU A;  4H6J B;  2ZM2 A;  4OKP A;  1GHP A;  1KE4 A;  1NZO A;  3VSK A;  4JPM A;  1T1B A;  1JWP A;  1IKG A;  4R70 A;  5EVL A;  1L0F A;  1IEL A;  4EUV A;  4KZB A;  1K54 A;  4PM9 A;  4UAA A;  1FCM A;  3MQO A;  3V67 A;  3O3V A;  3G2Y A;  5E2E A;  4ZJ2 A;  2EXB A;  4QD4 A;  3B47 A;  4QY6 A;  4WN5 A;  2W3D A;  1VHM A;  3CI6 A;  1N9O A;  3RXW A;  4Y15 A;  2VLG A;  1G5U A;  1HTZ A;  4IED A;  1ACF A;  4QJG A;  5A93 A;  3MBZ A;  4BMW A;  2ZOI A;  4HBU A;  5CX7 A;  2H5S A;  4DDY A;  3VMA A;  3WS4 A;  4Y0O A;  4PM6 A;  1RCJ A;  1BLS A;  3NCK A;  3HCY A;  3MJQ A;  3NOT C;  3C4O A;  3SZT A;  4EES A;  1TS7 A;  5M18 A;  1HLU P;  2B02 A;  4M3K A;  3LCE A;  1PIO A;  5FQJ A;  3WS1 A;  1IOU A;  5I5L A;  1CI9 A;  4OOL A;  3A0R A;  4QHC A;  4IUH A;  4KZ6 A;  2WK0 A;  2V0U A;  4CLC C;  2HZ5 A;  3KSF A;  1YLT A;  4R4R A;  2JBF A;  3G31 A;  2C6W B;  4EER A;  2XD1 A;  2VGL M;  5JYP A;  2EXA A;  1PRQ A;  5K5B A;  2Q9M A;  4NEE D;  4Y17 A;  2K2N A;  3L7H A;  1NLY A;  1Y54 A;  3ICY A;  1G6A A;  1NXY A;  2JKG A;  2QMI A;  1YPR A;  2ZL1 B;  1Y28 A;  3R7W B;  2RL3 A;  4HOI A;  1FCO A;  4I39 A;  1ES4 A;  2H0T A;  5CEC A;  4UA7 A;  4NET A;  3GRJ A;  1PZO A;  2X02 A;  2WGV A;  1GA9 A;  4IUK A;  2ZBB A;  4GJ4 A;  3PAG A;  2QPN A;  1K57 A;  1AWI A;  1LL9 A;  1H3Q A;  2V8F A;  3W2Z A;  3JPU A;  2OLV A;  5KSC A;  5CED A;  1ZKJ A;  3IQA A;  1M6K A;  1ERM A;  4WMC A;  3D3O A;  3JYI A;  1W63 Q;  5HWT A;  3ZYT A;  4B4Z A;  2W1R A;  5M19 A;  1F5M A;  3K2N A;  3OCL A;  2B5R A;  1ZHH B;  1MC0 A;  4RVA A;  3O88 A;  2Y4A A;  3ZGA B;  3E4O A;  3HLF A;  4R3A A;  2J3W A;  3UN7 A;  1K55 A;  4EU0 A;  5A92 A;  2Y2N A;  2O0Y A;  4FUW A;  4DE3 A;  3W4Q A;  1OT9 A;  3CLO A;  4BBU A;  2D01 A;  4CJN A;  5GL9 A;  4OPQ A;  4UA6 A;  3LYX A;  4GD8 A;  3DTM A;  2QZ6 A;  3NDG A;  1V9Z A;  2V1Z A;  3T1R A;  4WUJ A;  3O5Y A;  4JXW A;  4GOG A;  3KSH A;  2PD8 A;  1ZG6 A;  1KOU A;  2H10 A;  4MBH A;  1CF0 A;  3EGX C;  3T4S A;  4PPR A;  1Y4O A;  1P9R A;  1KGE A;  1PI5 A;  2JHE A;  3IH9 A;  4E6W A;  3E2K A;  3HUN A;  1OPX A;  2JN7 A;  3NBL A;  3MFD A;  3FWL A;  1XGJ A;  2ZC4 B;  1PI4 A;  2XA7 S;  2GZA A;  3PHY A;  2VV8 A;  2K31 A;  4KUK A;  3UME A;  1OTA A;  2VK3 A;  1MPL A;  5GHY A;  2OWH A;  2VV6 A;  2W0N A;  3T4J A;  1XP4 A;  4XUX A;  1JWV A;  1PWG A;  5HDD A;  4MN6 A;  1N4O A;  5AVE A;  2E8I A;  1JVJ A;  1YLP A;  2V9A A;  3E4P A;  2I9V A;  3G34 A;  1LL5 A;  4BQM A;  3FZC A;  3GVB A;  1XA7 A;  3CZD A;  3GDI A;  1NY0 A;  2P08 A;  3IS2 A;  4Z1W A;  2Y2H A;  5EM0 A;  3A3J A;  3BLS A;  5TBM B;  3L9K A;  4EET B;  2XQZ A;  4Y5F A;  2IWB A;  3CUE C;  4JGR A;  4HY8 A;  4KG5 A;  2C5W B;  1XKZ A;  5EE8 A;  3ISG A;  4CPK A;  3T4Q A;  2KOI A;  3D9Y A;  3NIA A;  4N1X A;  1E25 A;  1Z09 A;  2L0W A;  2AVX A;  2J7V A;  1K56 D;  3M2J A;  4S2I A;  4FOF A;  1DJA A;  3H82 A;  5F68 A;  4B9O A;  2JC7 A;  3NI9 A;  1ONG A;  5FEF A;  4JLF A;  3F1O B;  3G30 A;  3ZVW A;  4ETZ A;  2PRF A;  3LO7 A;  4H6J A;  5FAQ A;  3IF6 B;  2XLN A;  4GZB A;  3MSH A;  3E98 A;  5GHZ A;  5EFW A;  5F1G A;  3W8K A;  3N8R A;  2PR5 A;  1VM1 A;  4X56 A;  5FAP A;  1XPB A;  2OAQ 1;  5TR7 A;  4R3J A;  5DTK A;  5CHU A;  4NK3 A;  3IX3 A;  5KSH A;  3F1N B;  3FKW A;  1NWZ A;  2QKP A;  3LEQ A;  4R23 A;  4L9F A;  1BTL A;  4IHQ A;  3BFD A;  1CK3 A;  4RX2 A;  2HJ9 C;  3V3S A;  4QPR A;  3B3X A;  1MWU A;  4PAU A;  3S22 A;  3RXX A;  3VV4 A;  3T4T A;  3HJI A;  2PU4 A;  1NRF A;  3FPW A;  4FH4 A;  3OPP A;  2WUQ A;  4RX3 A;  3PBT A;  4BD1 A;  3LUQ A;  4U3T A;  1MWS A;  1CEF A;  1Z6F A;  4I5S A;  4HHD A;  1ZG4 A;  5FQ9 A;  2WKR A;  2PD7 A;  3PBO A;  1UWP X;  3WS5 A;  5DJT A;  4O8G A;  4JGQ A;  1NYY A;  4MEZ A;  4LRY C;  5DJU A;  1YLY A;  1VET B;  3VFH A;  1JTG A;  3CMZ A;  3B33 A;  5DFX A;  2W3E A;  3N7W A;  2HF6 A;  3HLW A;  4OVD A;  4MBF A;  2ZQC A;  1STZ A;  3LIF A;  3UE0 A;  2WKE A;  4BBT A;  1MKI A;  5DF7 A;  2ZL1 A;  1LSX A;  4OOM A;  1HZO A;  4QWO A;  3R7W A;  1H8M A;  2HJE A;  4K0X A;  5C5K A;  2CMN A;  2A24 B;  1RGY A;  4U0X A;  3V3R A;  3EEA A;  4ESP A;  2QHK A;  1FR6 A;  2Y2L A;  2A2L A;  3BFE A;  3DBA A;  2QYB A;  2XSS A;  4BWI A;  3N6I A;  1P0Z A;  3ZG5 A;  3BW6 A;  2Y79 A;  3P98 A;  4FTX A;  2W3H A;  1YT4 A;  4OP8 A;  2EFX A;  4YNR A;  5F5Y A;  5FA7 A;  2JE5 A;  3GQZ A;  3TW8 A;  1FIK A;  2OAP 1;  2XD5 A;  4Y0T A;  3TSG A;  3NUL A;  4BL3 A;  3E4Q A;  4P6Z M;  3VP4 A;  2O9B A;  2EWV A; 
#chains in the Genus database with same CATH homology
 4WEL A;  3NOT C;  4GHI A;  4EES A;  1TS7 A;  3PBS A;  5HZH A;  3S7O A;  2B02 A;  4GLQ A;  2L1M A;  2P7J A;  5AJG A;  3UB6 A;  3LR4 A;  1IOU A;  5I5L A;  2JKT M;  4OOL A;  3A0R A;  1OTB A;  3IBR A;  4Q0I A;  1XJ3 A;  3S7P A;  5A8B A;  3EGD C;  4IUH A;  4GS9 B;  3LR0 A;  4JGP A;  5HD5 A;  3S7Q A;  2V0U A;  4CLC C;  1TD5 A;  3KSF A;  3BJN A;  2DMW A;  4EER A;  3BWL A;  2KX6 A;  2VGL M;  4F3L A;  3UE6 A;  4Q0H A;  5K5B A;  3LI8 A;  4KUO A;  4NEE D;  2K2N A;  4CLC D;  3MFX A;  1NLY A;  4P6Z S;  3ICY A;  4HJ4 A;  1Y28 A;  3R7W B;  3C2W A;  3CUE A;  3BY9 A;  2Z6D A;  3EQU A;  4HOI A;  4LPZ A;  3LR5 A;  4I39 A;  4PKY G;  1OTI A;  4UEY A;  5HDS A;  1P9W A;  4AFI A;  1OJG A;  4EEU A;  3GEC A;  2INW A;  4GCZ A;  3LIC A;  4IUK A;  1YSQ A;  2ZBB A;  4GJ4 A;  5IU1 A;  4DMZ A;  1XJ6 A;  1H3Q A;  2BAS A;  1WA9 A;  3W2Z A;  1IFQ A;  1W63 M;  4HNB A;  4CLC E;  4ARZ A;  1P97 A;  2VEA A;  5J7E A;  3T4O A;  3D72 A;  2KDK A;  5L8M A;  3D3O A;  4HQA A;  1W63 Q;  2R78 A;  3PBQ A;  5HWT A;  3LI9 A;  2EWW A;  5TJJ A;  3ZYT A;  2W1R A;  3BQ8 A;  2PYP A;  3VOL A;  1T18 A;  1ZTU A;  1F5M A;  3CWF A;  3K2N A;  4NXB A;  1OT6 A;  3OCL A;  4LRZ E;  1ZHH B;  4PKY A;  4DN0 A;  5IT5 A;  1MC0 A;  2J3T D;  3E4O A;  4Y3I A;  3JVV A;  4E04 A;  2P04 A;  4R3A A;  3E0Y A;  2J3W A;  4HJ3 A;  4BJP A;  3C8C A;  4HH2 A;  4GHI B;  4EU0 A;  4CQH A;  3H7W A;  2O0Y A;  5TBM A;  2Y8H A;  5DKK A;  1NRJ A;  3EOI A;  3TRC A;  1OT9 A;  3CLO A;  4EQ1 A;  4BBU A;  3KYZ A;  1EW0 A;  2D01 A;  3G6O A;  4WLA A;  2NUP C;  4HI4 A;  2XA7 M;  3BY8 A;  1D7E A;  3VE4 A;  4EEP A;  3LYX A;  3TJZ C;  4WL9 A;  5KIZ A;  3MQQ A;  2O9A A;  2IA2 A;  2HV1 A;  3EEH A;  3UB7 A;  2K7S A;  1F9I A;  2V1B A;  3H9W A;  4F3L B;  1V9Z A;  3KO6 A;  1LSV A;  3TE8 A;  2G7U A;  3EQV A;  2ZOH A;  3LIE A;  3O5Y A;  4IJG A;  4WUJ A;  5G4Z A;  3BQA A;  2VKS A;  2GJ3 A;  4WEJ A;  3PBR A;  3MR0 A;  3PYP A;  3F1O A;  3KSH A;  3S7N A;  2PD8 A;  4MDZ A;  3OLO A;  1KOU A;  3EGX C;  3T4S A;  1S67 L;  4I3I A;  2MJ6 A;  5HPF A;  3RFB A;  1P9R A;  2QJ7 A;  2VJW A;  2JHE A;  1S4R A;  3FG8 A;  3PXP A;  4HJ6 A;  3C38 A;  1OPX A;  2O9C A;  4G3W A;  2PT7 A;  2JN7 A;  1D06 A;  2XA7 S;  1S1Y A;  2GZA A;  3PHY A;  2VV8 A;  3F1N A;  3KSG A;  1YSP A;  2K31 A;  3C30 A;  4KUK A;  4L9E A;  3UME A;  5HSQ A;  1OTA A;  3U2A A;  3R4K A;  1YKD A;  3A0S A;  3KX0 X;  4WF0 A;  2OWH A;  4Y2F A;  4ARZ B;  2VV6 A;  4EW7 A;  2W0N A;  1JNU A;  3T4J A;  1UWN X;  1N9L A;  2EA9 A;  4DJ2 A;  5HDD A;  2Z6C A;  3LR3 A;  3LFV A;  1LSW A;  4MN6 A;  1TF1 A;  1T1A A;  5AVE A;  1TS0 A;  3CIT A;  2V9A A;  5AVF A;  2QJ5 A;  3E4P A;  3T50 A;  2I9V A;  2B18 A;  2GX5 A;  4HIA A;  4Q0J A;  3MXQ A;  4I3A A;  3F1P A;  2W3F A;  1NLZ A;  2VV7 A;  4RQ9 A;  2LB9 A;  3GDI A;  5DF9 A;  2P08 A;  2WKP A;  3CAX A;  3T4L A;  5LBR A;  2VGL S;  3IS2 A;  1OTE A;  4Z1W A;  1TS8 A;  3H7W B;  1MKM A;  5TBM B;  5F6A A;  2ZMF A;  4LLO B;  4EET B;  3NJA A;  4Y5F A;  3UB9 A;  4PHT A;  3UMD A;  1GSV A;  4XT2 A;  3CUE C;  4JGR A;  1BYW A;  4HY8 A;  3P01 A;  1ODV A;  4YWZ A;  2OOL A;  3OCN A;  4DJ3 A;  3UB8 A;  3T4Q A;  2KOI A;  1TS6 A;  4G3K A;  2L0W A;  1F98 A;  1GSW A;  2ZMV A;  4L0L A;  3NHQ A;  4FOF A;  3H82 A;  4MCW A;  5F68 A;  4B9O A;  4R38 A;  4ETX A;  3RTY A;  1X0O A;  3LID A;  2PR6 A;  2NUT C;  3F1O B;  3VE3 A;  4I38 A;  3LIB A;  4ETZ A;  3JVU A;  4FSF A;  4H6J A;  1DP9 A;  2GNX A;  4HH3 A;  4M4X A;  5HD3 A;  4L9G A;  1LT0 A;  4LRX C;  3E98 A;  5EFW A;  3K3D A;  2PR5 A;  2A24 A;  3P7N A;  4KQO A;  1S1Z A;  4HP9 A;  2OAQ 1;  5J4E A;  3ZQ5 A;  4CLC A;  3LIA A;  2M1C A;  2HGV A;  1G28 A;  1V9Y A;  4GW9 A;  1UGU A;  1XFQ A;  5KSH A;  3F1N B;  4KQD A;  2W1T A;  1NWZ A;  2QKP A;  5F69 A;  5HDC A;  2PYR A;  4MMN A;  4L9F A;  2QWS A;  1VB6 A;  4IHQ A;  2XRO A;  2LB5 A;  4K08 A;  3OC2 A;  2HJ9 C;  2FH5 A;  1DRM A;  4QPR A;  4II7 A;  4BBV A;  4ME4 A;  2JKR I;  3K3C A;  4PAU A;  2D02 A;  5J3W A;  3VV4 A;  3KYQ A;  3T4T A;  3HJI A;  3KSI A;  2M7V A;  5FL3 A;  2V1A A;  1S66 L;  3FPW A;  1T1C A;  2VX8 A;  1OTD A;  5HL6 A;  2J80 A;  4NKP A;  3PBT A;  3UE3 A;  5HWV A;  1T19 A;  2PDR A;  4UQI M;  4ZRR A;  2VA0 A;  1YAX A;  3F1P B;  2V0W A;  4G3V A;  1N9N A;  3LUQ A;  3RH8 B;  5IS1 A;  3HJK A;  4B93 A;  3IS2 B;  1MZU A;  2YKF A;  2FZ0 A;  2O99 A;  2JKR M;  2YKH A;  4I5S A;  4HHD A;  2WKR A;  3IBJ A;  4NXE A;  2PD7 A;  3B42 A;  1XFN A;  1UWP X;  3MQ0 A;  3PBO A;  4XT2 B;  3FPV A;  4YOF A;  5DJT A;  1G6O A;  4I3J A;  4O8G A;  4NXG A;  4GS9 A;  4JGQ A;  4LRY C;  1OJ5 A;  5G4Y A;  3FC7 A;  5DJU A;  4JGO A;  2W27 A;  1DP6 A;  2M7U A;  3EWK A;  3B33 A;  2VZW A;  5DFX A;  2W3E A;  2PHY A;  3H82 B;  2HF6 A;  4HP4 A;  1S4S A;  2OWJ A;  1DP8 A;  3MMH A;  3ULF A;  1STZ A;  2XRN A;  3LIF A;  4BBT A;  4MN7 A;  4H6J B;  4UQI S;  1LSX A;  4OOM A;  1T1B A;  1LL8 A;  4NXF A;  3R7W A;  4R70 A;  1H8M A;  2HJE A;  5C5K A;  2J3T C;  4EUV A;  2CMN A;  4R6L A;  2A24 B;  3EEA A;  2WKQ A;  5DFY A;  4CLC B;  3SW1 A;  3MQO A;  3V67 A;  5MC7 A;  2QHK A;  3NOP C;  4MN5 A;  2W3G A;  3B47 A;  2A2L A;  3DBA A;  2QYB A;  2W1T B;  2W3D A;  2XSS A;  4WN5 A;  4BWI A;  1P0Z A;  1VHM A;  2KLI A;  3CI6 A;  3MF0 A;  1N9O A;  3NOU C;  4O0P A;  3BW6 A;  2VLG A;  2Y79 A;  2L4R A;  3A0V A;  2W3H A;  3PR6 A;  4BMW A;  5HPI A;  2ZOI A;  5CX7 A;  4YNR A;  5F5Y A;  2JKT I;  5HWW A;  1XJ4 A;  5DKL A;  4O01 A;  3TW8 A;  2OAP 1;  2H28 A;  3PBN A;  3T4K A;  3OBF A;  3OOV A;  4EXO A;  4WEK A;  3E4Q A;  4P6Z M;  1XJ2 A;  2O9B A;  3HCY A;  2EWV A;  1GSX A;  3MJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...