2QHKA

Crystal structure of methyl-accepting chemotaxis protein from vibrio parahaemolyticus rimd 2210633
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
148
structure length
148
Chain Sequence
AELVRDRQELIDARKKELKAYMMMGVTAIKPLYDSDVNGSNKQAAKEILKAMRFESDGYFFAYDSQGINTLHAIKPSLEGKNLYDLKDENGVAVIAGLIDASQKGDGFLYFSWHKPTINAQAPKLGYAEYLQKWDWVLGTGIYIDDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyl-accepting chemotaxis protein
publication title The crystal structure of the methyl-accepting chemotaxis protein from Vibrio parahaemolyticus RIMD 2210633.
rcsb
source organism Vibrio parahaemolyticus
molecule tags Signaling protein
total genus 48
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2007-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17200 sCache_2 Single Cache domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2qhkA00
4EQ1A 4EESA 2VV8A 4LRYC 1XJ3A 2QKPA 4WL9A 2OOLA 3EWKA 3UMEA 2ZOHA 1X0OA 2JN7A 3F1NA 1P97A 4LLOB 2V0UA 3IS2B 1LT0A 4WLAA 1LSXA 4R6LA 2V1BA 4GW9A 1ODVA 2BASA 3OLOA 4LRZE 3H7WA 4R70A 1D7EA 4BBVA 4KQDA 4PKYG 4HH2A 3NJAA 2V1AA 4HH3A 5TBMA 1V9ZA 2OWHA 5IU1A 3MQQA 3SW1A 5J4EA 5J3WA 3BWLA 1GSWA 3MXQA 4R38A 4BBTA 3E4PA 4K08A 3LYXA 3LIAA 1S1ZA 1XJ2A 4JGRA 1TS6A 4GS9B 5HWWA 1VB6A 3GECA 2B02A 4HI4A 3C2WA 3LICA 3G6OA 1S66L 3A0SA 3T50A 1NWZA 1T1BA 4HIAA 4L9FA 4F3LA 2VV6A 4GHIA 4HOIA 1UWNX 2KX6A 2YKHA 4NXBA 3K3CA 3CAXA 5DKKA 3RH8B 4EEUA 3HJIA 5HWVA 1P0ZA 3UB7A 4XT2B 3HJKA 4I3IA 4HJ6A 1OTBA 4JGPA 4I38A 5F6AA 1MZUA 4HJ4A 4WF0A 3F1OB 5G4ZA 5HD3A 4EETB 2VLGA 1T1AA 4I3JA 5HD5A 1XJ6A 3H82A 1UGUA 3LI9A 2A24B 2D02A 3KX0X 2Z6CA 5F68A 3VOLA 1XFQA 1DP9A 2P7JA 3NOUC 4EEPA 2QJ5A 3UB6A 3D72A 3BY8A 2PR5A 3IS2A 3UMDA 5AVFA 1V9YA 2OWJA 3LIBA 1T1CA 4HJ3A 2Z6DA 1WA9A 3F1NB 3LUQA 3A0RA 3CWFA 2INWA 5HZHA 4PKYA 2ZBBA 4NXEA 3NHQA 4EERA 5F5YA 4HNBA 2PHYA 3LIEA 1S67L 5G4YA 3H7WB 2JHEA 1N9LA 3GDIA 1EW0A 3CLOA 1OJ5A 4YWZA 1G28A 5AVEA 5TBMB 5KIZA 4JGQA 4I3AA 1TS7A 1Y28A 2L0WA 4JGOA 4LRXC 1S1YA 3MR0A 3FG8A 5DJTA 5EFWA 2L4RA 3UB8A 1LL8A 3IBRA 4DJ2A 5IS1A 5HWTA 5DJUA 2PR6A 2PYPA 4HP9A 1T18A 2I9VA 5HSQA 1TS0A 3ZQ5A 4NXFA 3BY9A 4F3LB 2R78A 3F1PA 2J80A 4GHIB 2PD8A 3MFXA 2V9AA 1S4RA 2HV1A 5HDDA 4EXOA 1F9IA 4H6JB 4DJ3A 4M4XA 4I39A 3LIDA 1OTIA 3K3DA 3VE3A 1DP8A 4HP4A 4HHDA 1OT9A 2YKFA 3ICYA 4RQ9A 2H28A 1TS8A 1JNUA 5J7EA 3VE4A 4KUKA 4B9OA 1XFNA 4KUOA 3H82B 5I5LA 2QHKA 1DP6A 1D06A 2GJ3A 2D01A 4BBUA 1OTDA 4WN5A 1OT6A 2CMNA 3UE6A 3PHYA 3EEHA 1OTEA 5A8BA 3A0VA 1DRMA 3ULFA 3C8CA 4L9EA 3H9WA 4HY8A 3LI8A 4I5SA 4WUJA 4HQAA 3MJQA 2K7SA 5DKLA 2WKRA 1N9NA 3B33A 1LSVA 3LIFA 2ZOIA 2QWSA 1S4SA 3MQOA 2KDKA 4GS9A 3RTYA 1XJ4A 2QJ7A 1KOUA 2PD7A 2W27A 3E4OA 2VV7A 4MN6A 2VEAA 3E4QA 1UWPX 2WKPA 5HDSA 1T19A 2WKQA 3FC7A 1OJGA 4R3AA 4MN5A 1GSVA 2EA9A 4XT2A 3PYPA 2L1MA 4L9GA 2M1CA 1LSWA 1BYWA 3P7NA 4NXGA 3UB9A 2PYRA 4GCZA 3F1OA 2PDRA 4H6JA 1N9OA 2V0WA 4E04A 1GSXA 5F69A 5HDCA 3F1PB 2W0NA 2A24A 3NOTC 3NOPC 4LPZA 4EW7A 1OTAA 1F98A
chains in the Genus database with same CATH superfamily
4EQ1A 4YINA 3MQ0A 4A5RA 3S7NA 2G7UA 1K6RA 1IYQA 4EQIA 2H10A 2WGVA 1Y4OA 2OAQ1 2XROA 3T4KA 1NZUA 1VETA 4DDYA 2IA2A 4QD4A 4N9KA 1LT0A 1GCEA 4UQIM 1VEUB 1PZOA 3LEZA 3KYZA 4S2NC 2V1BA 1FCMA 1W79A 3IWOA 4GW9A 3BFDA 4FTXA 1RP5A 3DAVA 5FQIA 4BBVA 1CK3A 5CHUA 3IF6C 1TVFA 4X56A 4KQDA 4MNRA 4P0MA 2G2UA 4KZ8A 5TBMA 5CGSA 4R3JA 2UWXA 5DFXA 3LY3A 3MQQA 2RCXA 4ZJ2A 3O86A 3Q07A 1NYMA 3LYXA 4X55A 1XJ2A 1MY8A 4JGRA 4GS9B 2WKIA 1CEFA 3GECA 2B02A 4OLDA 4DMZA 5FQ9A 3UPPA 1BTLA 3CJMA 4ESPA 3G6OA 1I2WA 4EUZA 3A0SA 3V3RA 3PBSA 1XGJA 5EVIA 4DKIA 2VV6A 1L3LA 1LHYA 4ME4A 1E3UA 4EWFA 3A3EA 3K3CA 2DMWA 5DKKA 4P6BA 1YPRA 2W1TB 5HWVA 3JVUA 1XKZA 5EVLA 1H5XA 2EXAA 4E3KA 4XUXA 3TJZC 3T4TA 4EBLA 1RGYA 3U4LP 4WF0A 3F1OB 3BQ8A 4DF6A 2VLGA 1T1AA 3FPVA 4NKPA 4WM9A 2M7UA 4II7A 2E8IA 4Y0TA 3IF6B 2D02A 3SH7A 1H3QA 3K2NA 3IX8A 2IWDA 3ZYTA 2QJ5A 3RXXA 3B42A 3OOVA 4JLFA 1VEUA 3MXRA 3NECA 5J8XA 1TF1A 1T1CA 1IKGA 4HJ3A 3PBTA 3C7UA 2O0YA 1Y54A 3LR5A 4X68A 2EFUA 2J9OA 2HP9A 2H0TA 3LUQA 4CLCE 1FSWA 1AWIA 1C3BA 3CZDA 4JKTA 1IEMA 3HLGA 4JXGA 2Y2LA 2V2FF 4FCFA 4E3OA 4ZRRA 3GRJA 3TW8A 5LBRA 2H0YA 4HNBA 4ETXA 1L0GA 5FASA 5M18A 1K25A 3MZFA 4Q0IA 4OPQA 1NRFA 1G28A 4CLCC 4JGQA 3IHBA 3G31A 3HLFA 5E2GA 3R7WA 2EX9A 4Y13A 3LO7A 4JGOA 1ZHHB 5F82A 4Y2FA 3OPPA 2JKRM 1IYSA 5DJTA 5AQAA 4BWIA 4DDSA 4BENA 2WGIA 2XQZA 3MKFA 5HL6A 2Q0OA 3TRCA 1MWTA 5DJUA 1Q2PA 1EI5A 2FFYA 2DRWA 4IUHA 2Q9MA 4OOMA 2W1TA 2XSSA 2Y4AA 5DTKA 2EXBA 4X53A 3F1PA 4GHIB 5HL1A 5GHYA 3OPLA 1IYPA 3AGEA 4EXOA 3T1SA 2GX5A 2HPBA 2K31A 5KSCA 1BZAA 4H6JB 4M4XA 4GD6A 3WS0A 5L8MA 2IWCA 4KZ6A 3MZEA 3VE3A 4OH0A 5L2FA 5KZHA 1FR6A 2WAFA 5AQ9A 4OONA 4FD8A 5FQJA 1JNUA 4DN0A 3VE4A 1BLSA 4G3VA 4KUOA 3ITAA 3H82B 2EFXA 2QHKA 1XA7A 5F83A 1D06A 3PBNA 1W8QA 4CLCB 1ES5A 1OT6A 2CMNA 4OOYA 3B3XA 3UE6A 5FEFA 1FIKA 3OC2A 3QP5A 2Z2LB 3PHYA 4E6WA 3A0VA 2WGWA 2J9PA 4GOGA 1DRMA 1FCOA 4KQQA 3ULFA 5IHVA 4RA7A 2H5SA 3H9WA 4ZJ1A 2ZC7A 4B88A 3MJQA 4U0TA 4QPRA 3W4PA 3NBLA 4OP5A 3CMZA 1CI8A 3LIFA 2G2WA 1NZOA 4PM5A 1EROA 2ZOIA 3MQOA 3M2KA 2KDKA 1PYYA 3T4QA 1XJ4A 4LV2A 4P87A 1H8MA 4ETZA 3S4XA 2VZWA 2VEAA 4UA6A 4QJGA 5CECA 1UWPX 3WS1A 4BJPA 3NC8A 4C3QA 5GLAA 5AQBA 3FC7A 3LR0A 2DNSA 2EX2A 1DJBA 1MWUA 3IX3A 3GQZA 4MN5A 1GSVA 2Y79A 5DTTA 4GD8A 1LSWA 5CXWA 2P9VA 2JKFA 3MSHA 5CTNA 4H6JA 1K55A 1OPXA 3G4PA 4E04A 3N8RA 1GSXA 5CRFA 5F69A 1BT5A 4PAUA 3NOTC 3DTKA 3NOPC 3UE0A 1JTDA 1MXOA 4CPKA 3PR6A 1JWVA 1NJ4A 3U2AA 4EESA 1YQSA 2Y8HA 3FV7A 3T4SA 1L0FA 1ZTUA 2I72A 2QKPA 1PI4A 4BQMA 4UEYA 3TSGA 5F1FA 4E3IA 3BFEA 1X0OA 4KZ9A 4H8RA 4WMCA 2ZJ9A 4JXSA 4IHQA 3F1NA 5JYOA 3IH8A 1JWZA 3ZVTA 5FI6A 3C7VA 2HP5A 3M6BA 3GMWA 5CEDA 5EVID 3OLOA 3NDEA 3C4OA 5EM1A 1D7EA 4KZBA 5GHZA 1E3UD 1GA0A 2AVXA 4P6ZS 3A3DA 4KZ3A 4PKYG 2V1AA 2OWHA 5FI7A 4ZJ3A 5IU1A 2Y59A 3C4PA 4F94A 4O8GA 5J3WA 3NI9A 4BBTA 4HBUA 4K08A 2Y2HA 1YLTA 3G30A 1JVJA 4QY5A 5HWWA 1VB6A 4BL3A 4HI4A 1YLYA 3MS6A 1BLCA 3WS2A 3UNWA 1FCNA 1YT4A 3L7HA 1IELA 2ZC3B 4Q0HA 4QHCA 3WRZA 1NWZA 3LGOA 2VX8A 4AFIA 2V8CA 4HEFA 5DVAA 3HUOA 4HOIA 4EU0A 1UWNX 4WEJA 1CEGA 1QMFA 1GHPA 5FDSA 3VFHA 4MEZA 2BG1A 1O7EA 1I5QA 1E4DA 3AGDA 4KZ7A 1Z6FA 1I2SA 2J3WA 5TR7A 3UB7A 2OV5A 1YLJA 4HJ6A 2R9WA 5FI2A 1G6OA 4QWOA 4E3LA 2GZAA 4JGPA 5F6AA 1HLUP 1KE3A 2V8FA 2QMIA 2FH5A 4JBFA 3IH9A 4C6YA 4R3BA 1Q2QA 5HD5A 4CJNA 5BOHA 4GNUA 2A24B 5F1GA 4N1XA 1DP9A 1QMEA 3IF5A 3NOUC 3SH9A 3VP4A 4EEPA 4ZTKA 3D72A 3S22A 2PR5A 3UMDA 1W8YA 3LIBA 5TGFA 1H0MA 3I7JA 1OMEA 1W7FA 1XP4A 2PAVP 3NY4A 3SS3A 3CWFA 3BYDA 2J3TC 1SKOA 4K0WA 5HZHA 2Y2IA 3QNCA 3ZHHA 4NXEA 2XEPA 2UV0E 3EQVA 4R4RA 5F5YA 1ZG6A 3HUNA 2Q9NA 4O01A 5EOOA 4FOFA 3H7WB 1N9LA 2Y2JA 1EW0A 5EVEA 3QNBA 3CLOA 3OCLA 4MN7A 2IWBA 3CPTB 4YWZA 5HPFA 4LCLA 4O7DA 4N1HA 1KDSA 3CUEC 4HESA 5KIZA 4S2JA 5FATA 1L0DA 3RFBA 3ZNTA 5G18A 1PNEA 4RX2A 2ZC6B 5D3OA 3KYEA 4QU3A 5A91A 3MR0A 3FG8A 3BW6A 3MMHA 3PAEA 1SDEA 2XK1A 1K57C 4Y3IA 5IS1A 2XF3A 3KO6A 4X25A 5EE8A 1STZA 2PYPA 2WKEA 1KGGA 4UHUA 1D1JA 3RXWA 1S6RA 1T18A 4WZ5C 3VOYA 3WS4A 2EWWA 3BY9A 2XRNA 4F3LB 2ZQ9A 4L0LA 4PM8A 2J80A 4NEED 3ZGAB 3MFXA 4JF4A 3OCNA 2HDSA 5E2EA 3UE1A 2PBYA 4R4SA 5HAPA 1JTGA 3G34A 1NYYA 1SZVA 2EX6A 5EV0A 4MCWA 1H8YA 5DF9A 3EEAA 3W8KA 4JF6A 1DP8A 3HL9A 1OT9A 1FQGA 2YKFA 4Y7PA 2A2LA 1Z09A 3T4LA 2H28A 3WWXA 1H8ZA 2JCHA 1XFNA 4EUVA 2QPNA 3P01A 2D01A 4BBUA 3Q1FA 4WN5A 3P09A 3ZDJA 5KMWA 4LCMA 2ZC5B 4P85A 3EEHA 5L07A 2V20A 4R1GA 4L9EA 4ZBEA 3ZFZA 3LI8A 1ES3A 2OLUA 2PT7A 5CTMA 4WUJA 1K38A 2K7SA 3PBOA 5DKLA 1NXYA 3Q7ZA 2WKRA 1LSVA 3IQAA 1J3WA 3M2JA 3Q81A 1YSPA 3CPTA 2JKTI 5EUAA 2ZL1B 4GS9A 3RTYA 4GN2A 2QJ7A 3FZCA 2ZQDA 5MC7A 3PAGA 4MN6A 1PIOA 2PU4A 3KSHA 5DTSA 2HJEA 2HJ9C 5E2HA 3OPHA 1W5DA 3E4QA 4UAAA 4FH4A 3BQAA 2W3FA 4R0QA 2WKQA 3L9KA 2WAEA 2Y2NA 1OJGA 1MWRA 1NLYA 4R3AA 2JKRI 2K2NA 4WMCD 3R4KA 1KVLA 4L9GA 4OQHA 3BFFA 4S2NA 2ACGA 2ZQAA 3CG5A 3P7NA 4KQOA 4NXGA 2PYRA 4GCZA 3F1OA 2W3EA 3BFCA 1N9OA 1K54C 2XH9A 3UDXA 3IF6A 2W0NA 3MZDA 3MF0A 5A90A 1BLPA 4EW7A 1OTAA 3G32A 4DE0A 1XJ3A 1SHVA 3D3OA 4GKUA 2HDQA 4WL9A 3DWZA 3UMEA 3ZCZA 2ZOHA 3QP8A 4Y0UA 4E3MA 3QP6A 1P97A 1O07A 1HTZA 3FKVA 1VQQA 2E8JA 2EX8A 4ZDXA 1LSXA 2PRFA 4JXVA 3LR3A 2ZQ8A 2KLIA 4NETA 4N92A 2BASA 3E98A 1CQAA 3ZG9B 4B93A 2ZMVA 2MJ6A 2VA0A 4WZ5A 2FFFB 4HH3A 5E2FA 3GSGA 2XD1A 2ZD8A 4WEKA 1W63M 1FSYA 5J4EA 3FYZA 1XPBA 3MXQA 4S2KA 2BTFP 3UE3A 4G3KA 2GNXA 2HDRA 3P98A 1KGFA 1S1ZA 1CI9A 4MBKA 1NY0A 3IWIA 2XFSA 3C2WA 4JPMA 3LICA 1FOFA 3PXPA 5TJJA 2Y2OA 4OKPA 2XA7S 1S66L 3DTMA 1T1BA 3HLEA 2WADA 4HIAA 3UPOA 4GHIA 3W2ZA 4GDNA 5AJGA 2ZLYA 1YAXA 2KX6A 1L2SA 3OZHA 4C75A 4YNRA 2YKHA 3CHWP 2O99A 4K91A 3C30A 5DF8A 3M6HA 3RH8B 3VP0A 4EEUA 1S0WA 4MDZA 1P0ZA 4XT2B 3HJKA 4PHTA 2C5WB 2DCFA 3QHYA 4BLMA 4LENA 3LCEA 3T1XA 1MZUA 2WZZA 3RJUA 5HARA 5FQMA 2XA7M 1ALQA 2ZMFA 5G4ZA 4EETB 2W3HA 3BRMA 4GDBA 1ERMA 1XJ6A 3H82A 3LI9A 3NCKA 4CLCA 2Z6CA 5F68A 4KZ5A 3VOLA 4ID4A 2P7JA 3OBFA 1E25A 1NRJA 1PW1A 4X69A 3UB6A 4DE2A 1YMXA 1AXBA 1SCWA 4IJGA 3ISGA 3BY8A 1HD8A 5AVFA 2VGLS 1PWDA 2Y2KA 2ZQCA 3T4JA 3N8SA 1WA9A 3EQUA 2CC1A 1DJAA 1VETB 3BJNA 3A0RA 1PWGA 3HLBA 4PKYA 4KZAA 2ZBBA 5DF7A 5TFQA 4EERA 3DTIA 3LIEA 5E43A 4PMAA 4N9LA 4D60A 5G4YA 3BFGA 4MBFA 3UY6A 1LI9A 2WKHA 2P04A 2VGLM 3PTEA 1TD5A 3LY4A 1KDWA 4LV1A 4PM6A 2KOIA 5AVEA 3T12B 1XXMA 5TBMB 1K54A 1DJCA 3DWKA 4B4ZA 2XGNA 4I3AA 3VV4A 4Z9QA 3O3VA 4DE1A 5M19A 4P6ZM 4IVIA 5CEBA 1BSGA 4KZ4A 4JF5A 4R23A 1KE0A 1TEMA 4OQGA 1K56D 5U47A 1S1YA 5EFWA 2L4RA 3O88A 5KSHA 3UB8A 3IBRA 1ES2A 1VM1A 3IWQA 4JXWA 1FR1A 4IBRA 1N9BA 4KG2A 2PR6A 3BM6A 4HP9A 4FSFA 5AQ7A 5HSQA 1TS0A 3GTCA 4D2OA 3FPWA 5HW3A 1K4EA 2PD8A 3JVVA 1LLBA 4XUZA 4LV3A 2V9AA 3VSLA 3CITA 2HV1A 5HDDA 1G5UA 2XD5A 4QB8A 3E2KA 4IUKA 4Q8IA 2NUPC 1PWCA 3SS4A 4I39A 1HZOA 2PBDP 3LIDA 3K3DA 3HLCA 2WK0A 4UQIS 3G2ZA 1YLWA 3FKWA 2JC7A 3ICYA 5FAQA 4U3TA 3MFDA 5CGXA 1G68A 5J7EA 4FH2A 1XGIA 4KUKA 2VKSA 5HAIA 2W3DA 2P08A 2R9XA 4G3WA 5HAQA 3WS5A 3E2LA 2XLNA 5FAOA 2GJ3A 3G35A 1LL5A 1A0KA 1OTDA 1M6KA 2QZ6A 1OTEA 5A8BA 3KSIA 3S7OA 3NIAA 3C8CA 1YLZA 4HY8A 3UO9A 2EWVA 3IXDA 2W3GA 3T1RA 2Y2QA 1GA9A 1K0KA 3B33A 2VK3A 3UPNA 4NK3A 3T4OA 3V5MA 3HCYA 3EOIA 1ES4A 2QWSA 1S4SA 1ERQA 4S2MA 4S2OA 3A3JA 3UDFA 4OQ0A 2X01A 3AGFA 5L09A 5EECA 2W27A 3E4OA 3SH8A 2J3TD 3MXSA 4FUWA 3ZVWA 4WZ4A 3HLDA 3QP1A 5HDSA 3VP2A 2BLSA 3R7WB 4BD0A 4YOFA 5M1AA 1K6SA 4CQHA 3VMAA 5CX7A 4Q0JA 2EA9A 4U0XA 1ESIA 2L1MA 5FDHA 5GLDA 3Q7VB 4IEDA 4OPRA 2M1CA 2X71A 1MBLA 4PPRA 3N6IA 4DRTA 5IT5A 3UB9A 2O9BA 2J8YA 4Y15A 3HLWA 4UA7A 2V0WA 1ONGA 5CERA 5CGWA 2HDUA 4DXBA 1MWSA 3F1PB 3N4IA 2A24A 1XA1A 5FSRA 3VP3A 5JYPA 1K56A 1NLZA 2OAP1 1KE4A 4X6TA 2VV8A 3ZG7B 1WE4A 1PI5A 2VJWA 5L10A 4LRYC 2WUQA 2OOLA 2PU2A 2B5RA 3ZG5A 3EWKA 3PBQA 3IHAA 2P74A 2HGVA 3O87A 1W63Q 3Q82A 2JN7A 3JYIA 2XR0A 4LLOB 2V0UA 3IS2B 5A93A 1PW8A 2NUTC 3WRTA 4WLAA 1MC0A 3T1QB 4R6LA 5EM0A 5FQKA 1TDLA 1ODVA 1K55C 4LRZE 2ZM8A 1SDNA 3H7WA 4R70A 2WGWB 1KGEA 5FA7A 5GLCA 2Y91A 3BLMA 3IBJA 3HUMA 1G6AA 2QYBA 4HH2A 3SZTA 3NJAA 3W4QA 2JKTM 4E3NA 1V9ZA 3LR4A 4S2LA 1BULA 4Y5FA 4OPZA 3DW0A 3SW1A 5FL3A 3QP4A 2LB5A 4KQRA 3BWLA 1FILA 2Z2MB 1CJFA 1F2KA 4BL2A 1GSWA 4R38A 5CHJA 3E4PA 3KYQA 2ZMAA 3LIAA 1TS6A 1MKIA 2A3UA 3FWLA 4KG6A 4ARZB 4EV4A 4PM9A 4PM7A 1F5MA 2O9CA 4CLCD 3VFFA 3T50A 4L9FA 4QY6A 4F3LA 5GL9A 3N7WA 3Q7VA 3D9YA 4B4XA 2OLVA 4EBPA 4NXBA 3S1YA 4WELA 3CAXA 1LI0A 3V67A 4XXRA 1YM1A 3HJIA 1GHIA 1ONHA 3IXGA 1EWZA 4I3IA 4OOLA 1OTBA 2XFTA 2JBFA 1HVBA 1KVMA 5HPIA 2C6WB 2FZ0A 4I38A 1DY6A 4HJ4A 2P9VB 2M7VA 1YLPA 5HD3A 3UB5P 4I3JA 3VSKA 2Y55A 4GB7A 1UGUA 3A3FA 4EBNA 1PFLA 3KX0X 1P9RA 2ZQ7A 4OPYA 3V39A 3CUEA 3C5AA 4ZAMA 1ACFA 1XFQA 3EGXC 1SKFA 3O5YA 2OSUA 5EOEA 1IYOA 3IS2A 4DE3A 1V9YA 2OWJA 1XX2A 1U60A 3V3SA 4K0XA 4GJ4A 3CI6A 5GHXA 2Z6DA 1K57A 3F1NB 4LFUA 1MPLA 1YMSA 3VOZA 5FEGA 3D4FA 1JWPA 4RVAA 4RYEA 2INWA 3SS5A 4MBHA 2ZL1A 3C38A 3KSFA 3NHQA 2JE5A 2PHYA 3TE8A 3QP2A 1S67L 1ZC2A 1WYCA 2JHEA 2J7VA 3GDIA 3TG9A 5A92A 4KG5A 3A3IA 3IXHA 1OJ5A 4RX3A 1VHMA 4GZBA 3TOIA 3JPUA 1ZG4A 3S7PA 4ARZA 1TS7A 3V50A 1Y28A 4S2IA 2L0WA 4LGWA 5HFOA 4LRXC 2HP6A 2XDMA 4BMWA 4IBXA 2A49A 1WYBA 3UDIA 3NULA 4X1MA 2HZ5A 4OP8A 3ZNYA 2WYXA 4KENB 1LL8A 4DJ2A 5HWTA 1TDGA 1M40A 2B18A 4HBTA 1ZKJA 3LFVA 3B47A 1IFQA 2ZC4B 4M3KA 2I9VA 1IKIA 2Y2PA 3ZQ5A 4NXFA 4IVKA 4X1LA 1ESUA 2V1ZA 5CHMA 3SOIA 4DXCA 2R78A 5HX9A 3OPRA 5C5KA 2VGJA 1GHMA 1YSQA 4MMNA 2GDNA 1S4RA 1K4FA 1F9IA 5GLBA 4DJ3A 1BLHA 4Z1WA 1OTIA 3DTEA 4HP4A 2HF6A 4HHDA 4WBGA 4RQ9A 3EGDC 1TS8A 2ZM2A 3ITBA 3MBZA 5EVIC 3HREA 4B9OA 1IOUA 2B95A 1RGZA 5I5LA 5EPHA 1DP6A 3DBAA 2WZXA 3BECA 3PBRA 4WYYA 2W1RA 5FQQA 3IX4A 4O0PA 2O9AA 3S7QA 4I5SA 4HQAA 4OLGA 4NG2A 4OQIA 3ZG8B 4E6XA 4E3JA 1N9NA 4BD1A 4MLLA 4S2PA 4Y0OA 3NDGA 4GLQA 3KSGA 1RCJA 2ZM0A 1SKOB 5I94A 4Y17A 4OVDA 1KOUA 2PD7A 3G2YA 1LL9A 2VV7A 1PZPA 1P9WA 2Y2GA 1YKDA 3W4OA 2WKPA 1T19A 3HVFA 4UA9A 1MKMA 3GVBA 2RL3A 2JKGA 3HBRA 2VGKA 2X02A 3ZG0A 3IT9A 4XT2A 1BUEA 3PYPA 1N4OA 2LB9A 3GR2A 5EVIB 4LV0A 2Y2MA 3BLSA 3UN7A 1BYWA 1PRQA 3BEBA 1J9MA 1CF0A 3IXBA 2PDRA 3LEQA 1L0EA 3MKEA 3VP1A 4YFMA 3GV9A 5HDCA 5DFYA 5FAPA 3N8LA 5K5BA 3E0YA 4LPZA 1F98A
chains in the Genus database with same CATH topology
3U2AA 2OAP1 4EQ1A 4EESA 2VV8A 3MQ0A 2Y8HA 2VJWA 3S7NA 4LRYC 1XJ3A 2G7UA 3D3OA 3T4SA 1ZTUA 2QKPA 4WL9A 2OOLA 3EWKA 3UMEA 3PBQA 4UEYA 2ZOHA 2OAQ1 2HGVA 1X0OA 2XROA 3T4KA 1W63Q 2JN7A 4IHQA 3F1NA 2IA2A 1P97A 4LLOB 2V0UA 3IS2B 1LT0A 2NUTC 4UQIM 4WLAA 1MC0A 3KYZA 1LSXA 4R6LA 2V1BA 3LR3A 2KLIA 4GW9A 1ODVA 2BASA 3OLOA 4LRZE 3E98A 3H7WA 4B93A 4R70A 1D7EA 4BBVA 2ZMVA 2MJ6A 4P6ZS 2VA0A 4KQDA 4PKYG 3IBJA 2QYBA 4HH2A 3NJAA 3PR6A 2V1AA 2JKTM 4HH3A 5TBMA 1V9ZA 2OWHA 3LR4A 5IU1A 5DFXA 4Y5FA 4WEKA 1W63M 4O8GA 3MQQA 3SW1A 5FL3A 5J4EA 2LB5A 5J3WA 3BWLA 1GSWA 3MXQA 4R38A 4BBTA 3E4PA 4K08A 3UE3A 4G3KA 2GNXA 3LYXA 3KYQA 3LIAA 1S1ZA 1XJ2A 4JGRA 1TS6A 4GS9B 5HWWA 1VB6A 3GECA 2B02A 4HI4A 4ARZB 4DMZA 3C2WA 1F5MA 2O9CA 3LICA 3PXPA 5TJJA 4CLCD 2XA7S 4Q0HA 3G6OA 1S66L 3A0SA 3PBSA 3T50A 1NWZA 1T1BA 4HIAA 2VX8A 4L9FA 4F3LA 2VV6A 4AFIA 4GHIA 3W2ZA 4HOIA 4EU0A 5AJGA 1UWNX 1YAXA 2KX6A 4WEJA 4ME4A 4YNRA 2YKHA 4NXBA 3K3CA 2DMWA 4WELA 3CAXA 5DKKA 2O99A 3C30A 3RH8B 3V67A 4EEUA 2W1TB 3HJIA 4MDZA 5HWVA 1P0ZA 2J3WA 3UB7A 4XT2B 3HJKA 4PHTA 3JVUA 4I3IA 4HJ6A 4OOLA 1OTBA 1G6OA 2GZAA 5HPIA 3TJZC 4JGPA 2FZ0A 4I38A 5F6AA 3T4TA 1MZUA 4HJ4A 2M7VA 2XA7M 2ZMFA 3F1OB 4WF0A 5G4ZA 2FH5A 3BQ8A 5HD3A 4EETB 2W3HA 2VLGA 1T1AA 3FPVA 4I3JA 5HD5A 4NKPA 2M7UA 1XJ6A 3H82A 1UGUA 3LI9A 4II7A 2A24B 2D02A 3KX0X 1P9RA 4CLCA 1H3QA 2Z6CA 3CUEA 5F68A 3K2NA 3VOLA 1XFQA 1DP9A 2P7JA 3OBFA 1NRJA 3NOUC 4EEPA 3ZYTA 2QJ5A 3EGXC 3UB6A 4IJGA 3D72A 3O5YA 3BY8A 3B42A 2PR5A 3IS2A 3UMDA 3OOVA 5AVFA 1V9YA 2OWJA 2VGLS 3LIBA 1TF1A 1T1CA 4HJ3A 3PBTA 4GJ4A 3CI6A 2O0YA 3LR5A 3T4JA 2Z6DA 1WA9A 3EQUA 3F1NB 3BJNA 3LUQA 3A0RA 4CLCE 3CWFA 2J3TC 2INWA 5HZHA 4PKYA 2ZBBA 3C38A 3KSFA 4NXEA 3NHQA 4ZRRA 3EQVA 4EERA 3TW8A 5LBRA 5F5YA 4HNBA 2PHYA 4ETXA 4O01A 3TE8A 3LIEA 1S67L 4FOFA 5G4YA 3H7WB 2JHEA 1N9LA 3GDIA 1EW0A 3CLOA 2P04A 2VGLM 4Q0IA 3OCLA 4MN7A 1TD5A 1OJ5A 4YWZA 5HPFA 1VHMA 2KOIA 1G28A 4CLCC 5AVEA 3CUEC 5TBMB 5KIZA 4JGQA 3S7PA 3R7WA 4I3AA 3VV4A 3RFBA 4ARZA 1TS7A 4P6ZM 1Y28A 2L0WA 4JGOA 1ZHHB 4LRXC 4BMWA 1S1YA 4Y2FA 3MR0A 2JKRM 3FG8A 3BW6A 5DJTA 3MMHA 5EFWA 2L4RA 4BWIA 5KSHA 3UB8A 1LL8A 3IBRA 4DJ2A 4Y3IA 5IS1A 5HWTA 5HL6A 2B18A 3KO6A 3TRCA 5DJUA 2PR6A 1STZA 2PYPA 3LFVA 4HP9A 3B47A 1IFQA 4IUHA 4FSFA 4OOMA 2W1TA 2XSSA 1T18A 2I9VA 5HSQA 1TS0A 3ZQ5A 4NXFA 2EWWA 3BY9A 2XRNA 4F3LB 4L0LA 2R78A 3FPWA 3F1PA 2J80A 4GHIB 4NEED 5C5KA 2PD8A 3JVVA 3MFXA 3OCNA 1YSQA 4MMNA 2V9AA 3CITA 1S4RA 2HV1A 5HDDA 4EXOA 2GX5A 2K31A 1F9IA 4H6JB 4DJ3A 4IUKA 4M4XA 2NUPC 4I39A 4MCWA 4Z1WA 3LIDA 5DF9A 1OTIA 3EEAA 3K3DA 5L8MA 3VE3A 4UQIS 1DP8A 4HP4A 2HF6A 4HHDA 1OT9A 2YKFA 3ICYA 2A2LA 4RQ9A 3T4LA 2H28A 3EGDC 1TS8A 1JNUA 4DN0A 5J7EA 3VE4A 4KUKA 4B9OA 4G3VA 1XFNA 2VKSA 2W3DA 4KUOA 4EUVA 2P08A 4G3WA 1IOUA 3H82B 5I5LA 2QHKA 1DP6A 3P01A 3DBAA 1D06A 2GJ3A 2D01A 3PBNA 4CLCB 4BBUA 1OTDA 4WN5A 1OT6A 2CMNA 3PBRA 3UE6A 3OC2A 2W1RA 3EEHA 3PHYA 1OTEA 5A8BA 3A0VA 3KSIA 3S7OA 1DRMA 3ULFA 3C8CA 4L9EA 4O0PA 2O9AA 3H9WA 4HY8A 3LI8A 3S7QA 4I5SA 2EWVA 2PT7A 4WUJA 4HQAA 2W3GA 3MJQA 2K7SA 3PBOA 5DKLA 4QPRA 2WKRA 1N9NA 3B33A 1LSVA 4GLQA 3T4OA 3KSGA 3LIFA 1YSPA 2ZOIA 3HCYA 3EOIA 2QWSA 1S4SA 2JKTI 3MQOA 2KDKA 4GS9A 3RTYA 3T4QA 1XJ4A 2QJ7A 5MC7A 1KOUA 2PD7A 2W27A 3E4OA 1H8MA 2J3TD 2VV7A 4ETZA 4MN6A 2VZWA 1P9WA 3KSHA 2VEAA 2HJEA 2HJ9C 1YKDA 3E4QA 1UWPX 4BJPA 2WKPA 3BQAA 2W3FA 1T19A 5HDSA 2WKQA 3R7WB 4YOFA 3FC7A 1MKMA 3LR0A 1OJGA 4CQHA 1NLYA 4R3AA 4MN5A 1GSVA 5CX7A 2Y79A 4Q0JA 2EA9A 4XT2A 2JKRI 2K2NA 3PYPA 3R4KA 2LB9A 2L1MA 4L9GA 2M1CA 1LSWA 5IT5A 1BYWA 3P7NA 4KQOA 4NXGA 2O9BA 3UB9A 2PYRA 4GCZA 3F1OA 2PDRA 2W3EA 4H6JA 1N9OA 2V0WA 1OPXA 4E04A 1GSXA 5F69A 5HDCA 3F1PB 2W0NA 2A24A 4PAUA 5DFYA 3MF0A 5K5BA 3NOTC 3E0YA 3NOPC 4LPZA 4EW7A 1OTAA 1F98A 1NLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQ1 A;  4EES A;  2VV8 A;  4LRY C;  1XJ3 A;  2QKP A;  4WL9 A;  2OOL A;  3EWK A;  3UME A;  2ZOH A;  1X0O A;  2JN7 A;  3F1N A;  1P97 A;  4LLO B;  2V0U A;  3IS2 B;  1LT0 A;  4WLA A;  1LSX A;  4R6L A;  2V1B A;  4GW9 A;  1ODV A;  2BAS A;  3OLO A;  4LRZ E;  3H7W A;  4R70 A;  1D7E A;  4BBV A;  4KQD A;  4PKY G;  4HH2 A;  3NJA A;  2V1A A;  4HH3 A;  5TBM A;  1V9Z A;  2OWH A;  5IU1 A;  3MQQ A;  3SW1 A;  5J4E A;  5J3W A;  3BWL A;  1GSW A;  3MXQ A;  4R38 A;  4BBT A;  3E4P A;  4K08 A;  3LYX A;  3LIA A;  1S1Z A;  1XJ2 A;  4JGR A;  1TS6 A;  4GS9 B;  5HWW A;  1VB6 A;  3GEC A;  2B02 A;  4HI4 A;  3C2W A;  3LIC A;  3G6O A;  1S66 L;  3A0S A;  3T50 A;  1NWZ A;  1T1B A;  4HIA A;  4L9F A;  4F3L A;  2VV6 A;  4GHI A;  4HOI A;  1UWN X;  2KX6 A;  2YKH A;  4NXB A;  3K3C A;  3CAX A;  5DKK A;  3RH8 B;  4EEU A;  3HJI A;  5HWV A;  1P0Z A;  3UB7 A;  4XT2 B;  3HJK A;  4I3I A;  4HJ6 A;  1OTB A;  4JGP A;  4I38 A;  5F6A A;  1MZU A;  4HJ4 A;  4WF0 A;  3F1O B;  5G4Z A;  5HD3 A;  4EET B;  2VLG A;  1T1A A;  4I3J A;  5HD5 A;  1XJ6 A;  3H82 A;  1UGU A;  3LI9 A;  2A24 B;  2D02 A;  3KX0 X;  2Z6C A;  5F68 A;  3VOL A;  1XFQ A;  1DP9 A;  2P7J A;  3NOU C;  4EEP A;  2QJ5 A;  3UB6 A;  3D72 A;  3BY8 A;  2PR5 A;  3IS2 A;  3UMD A;  5AVF A;  1V9Y A;  2OWJ A;  3LIB A;  1T1C A;  4HJ3 A;  2Z6D A;  1WA9 A;  3F1N B;  3LUQ A;  3A0R A;  3CWF A;  2INW A;  5HZH A;  4PKY A;  2ZBB A;  4NXE A;  3NHQ A;  4EER A;  5F5Y A;  4HNB A;  2PHY A;  3LIE A;  1S67 L;  5G4Y A;  3H7W B;  2JHE A;  1N9L A;  3GDI A;  1EW0 A;  3CLO A;  1OJ5 A;  4YWZ A;  1G28 A;  5AVE A;  5TBM B;  5KIZ A;  4JGQ A;  4I3A A;  1TS7 A;  1Y28 A;  2L0W A;  4JGO A;  4LRX C;  1S1Y A;  3MR0 A;  3FG8 A;  5DJT A;  5EFW A;  2L4R A;  3UB8 A;  1LL8 A;  3IBR A;  4DJ2 A;  5IS1 A;  5HWT A;  5DJU A;  2PR6 A;  2PYP A;  4HP9 A;  1T18 A;  2I9V A;  5HSQ A;  1TS0 A;  3ZQ5 A;  4NXF A;  3BY9 A;  4F3L B;  2R78 A;  3F1P A;  2J80 A;  4GHI B;  2PD8 A;  3MFX A;  2V9A A;  1S4R A;  2HV1 A;  5HDD A;  4EXO A;  1F9I A;  4H6J B;  4DJ3 A;  4M4X A;  4I39 A;  3LID A;  1OTI A;  3K3D A;  3VE3 A;  1DP8 A;  4HP4 A;  4HHD A;  1OT9 A;  2YKF A;  3ICY A;  4RQ9 A;  2H28 A;  1TS8 A;  1JNU A;  5J7E A;  3VE4 A;  4KUK A;  4B9O A;  1XFN A;  4KUO A;  3H82 B;  5I5L A;  2QHK A;  1DP6 A;  1D06 A;  2GJ3 A;  2D01 A;  4BBU A;  1OTD A;  4WN5 A;  1OT6 A;  2CMN A;  3UE6 A;  3PHY A;  3EEH A;  1OTE A;  5A8B A;  3A0V A;  1DRM A;  3ULF A;  3C8C A;  4L9E A;  3H9W A;  4HY8 A;  3LI8 A;  4I5S A;  4WUJ A;  4HQA A;  3MJQ A;  2K7S A;  5DKL A;  2WKR A;  1N9N A;  3B33 A;  1LSV A;  3LIF A;  2ZOI A;  2QWS A;  1S4S A;  3MQO A;  2KDK A;  4GS9 A;  3RTY A;  1XJ4 A;  2QJ7 A;  1KOU A;  2PD7 A;  2W27 A;  3E4O A;  2VV7 A;  4MN6 A;  2VEA A;  3E4Q A;  1UWP X;  2WKP A;  5HDS A;  1T19 A;  2WKQ A;  3FC7 A;  1OJG A;  4R3A A;  4MN5 A;  1GSV A;  2EA9 A;  4XT2 A;  3PYP A;  2L1M A;  4L9G A;  2M1C A;  1LSW A;  1BYW A;  3P7N A;  4NXG A;  3UB9 A;  2PYR A;  4GCZ A;  3F1O A;  2PDR A;  4H6J A;  1N9O A;  2V0W A;  4E04 A;  1GSX A;  5F69 A;  5HDC A;  3F1P B;  2W0N A;  2A24 A;  3NOT C;  3NOP C;  4LPZ A;  4EW7 A;  1OTA A;  1F98 A; 
#chains in the Genus database with same CATH topology
 4EQ1 A;  4YIN A;  3MQ0 A;  4A5R A;  3S7N A;  2G7U A;  1K6R A;  1IYQ A;  4EQI A;  2H10 A;  2WGV A;  1Y4O A;  2OAQ 1;  2XRO A;  3T4K A;  1NZU A;  1VET A;  4DDY A;  2IA2 A;  4QD4 A;  4N9K A;  1LT0 A;  1GCE A;  4UQI M;  1VEU B;  1PZO A;  3LEZ A;  3KYZ A;  4S2N C;  2V1B A;  1FCM A;  1W79 A;  3IWO A;  4GW9 A;  3BFD A;  4FTX A;  1RP5 A;  3DAV A;  5FQI A;  4BBV A;  1CK3 A;  5CHU A;  3IF6 C;  1TVF A;  4X56 A;  4KQD A;  4MNR A;  4P0M A;  2G2U A;  4KZ8 A;  5TBM A;  5CGS A;  4R3J A;  2UWX A;  5DFX A;  3LY3 A;  3MQQ A;  2RCX A;  4ZJ2 A;  3O86 A;  3Q07 A;  1NYM A;  3LYX A;  4X55 A;  1XJ2 A;  1MY8 A;  4JGR A;  4GS9 B;  2WKI A;  1CEF A;  3GEC A;  2B02 A;  4OLD A;  4DMZ A;  5FQ9 A;  3UPP A;  1BTL A;  3CJM A;  4ESP A;  3G6O A;  1I2W A;  4EUZ A;  3A0S A;  3V3R A;  3PBS A;  1XGJ A;  5EVI A;  4DKI A;  2VV6 A;  1L3L A;  1LHY A;  4ME4 A;  1E3U A;  4EWF A;  3A3E A;  3K3C A;  2DMW A;  5DKK A;  4P6B A;  1YPR A;  2W1T B;  5HWV A;  3JVU A;  1XKZ A;  5EVL A;  1H5X A;  2EXA A;  4E3K A;  4XUX A;  3TJZ C;  3T4T A;  4EBL A;  1RGY A;  3U4L P;  4WF0 A;  3F1O B;  3BQ8 A;  4DF6 A;  2VLG A;  1T1A A;  3FPV A;  4NKP A;  4WM9 A;  2M7U A;  4II7 A;  2E8I A;  4Y0T A;  3IF6 B;  2D02 A;  3SH7 A;  1H3Q A;  3K2N A;  3IX8 A;  2IWD A;  3ZYT A;  2QJ5 A;  3RXX A;  3B42 A;  3OOV A;  4JLF A;  1VEU A;  3MXR A;  3NEC A;  5J8X A;  1TF1 A;  1T1C A;  1IKG A;  4HJ3 A;  3PBT A;  3C7U A;  2O0Y A;  1Y54 A;  3LR5 A;  4X68 A;  2EFU A;  2J9O A;  2HP9 A;  2H0T A;  3LUQ A;  4CLC E;  1FSW A;  1AWI A;  1C3B A;  3CZD A;  4JKT A;  1IEM A;  3HLG A;  4JXG A;  2Y2L A;  2V2F F;  4FCF A;  4E3O A;  4ZRR A;  3GRJ A;  3TW8 A;  5LBR A;  2H0Y A;  4HNB A;  4ETX A;  1L0G A;  5FAS A;  5M18 A;  1K25 A;  3MZF A;  4Q0I A;  4OPQ A;  1NRF A;  1G28 A;  4CLC C;  4JGQ A;  3IHB A;  3G31 A;  3HLF A;  5E2G A;  3R7W A;  2EX9 A;  4Y13 A;  3LO7 A;  4JGO A;  1ZHH B;  5F82 A;  4Y2F A;  3OPP A;  2JKR M;  1IYS A;  5DJT A;  5AQA A;  4BWI A;  4DDS A;  4BEN A;  2WGI A;  2XQZ A;  3MKF A;  5HL6 A;  2Q0O A;  3TRC A;  1MWT A;  5DJU A;  1Q2P A;  1EI5 A;  2FFY A;  2DRW A;  4IUH A;  2Q9M A;  4OOM A;  2W1T A;  2XSS A;  2Y4A A;  5DTK A;  2EXB A;  4X53 A;  3F1P A;  4GHI B;  5HL1 A;  5GHY A;  3OPL A;  1IYP A;  3AGE A;  4EXO A;  3T1S A;  2GX5 A;  2HPB A;  2K31 A;  5KSC A;  1BZA A;  4H6J B;  4M4X A;  4GD6 A;  3WS0 A;  5L8M A;  2IWC A;  4KZ6 A;  3MZE A;  3VE3 A;  4OH0 A;  5L2F A;  5KZH A;  1FR6 A;  2WAF A;  5AQ9 A;  4OON A;  4FD8 A;  5FQJ A;  1JNU A;  4DN0 A;  3VE4 A;  1BLS A;  4G3V A;  4KUO A;  3ITA A;  3H82 B;  2EFX A;  2QHK A;  1XA7 A;  5F83 A;  1D06 A;  3PBN A;  1W8Q A;  4CLC B;  1ES5 A;  1OT6 A;  2CMN A;  4OOY A;  3B3X A;  3UE6 A;  5FEF A;  1FIK A;  3OC2 A;  3QP5 A;  2Z2L B;  3PHY A;  4E6W A;  3A0V A;  2WGW A;  2J9P A;  4GOG A;  1DRM A;  1FCO A;  4KQQ A;  3ULF A;  5IHV A;  4RA7 A;  2H5S A;  3H9W A;  4ZJ1 A;  2ZC7 A;  4B88 A;  3MJQ A;  4U0T A;  4QPR A;  3W4P A;  3NBL A;  4OP5 A;  3CMZ A;  1CI8 A;  3LIF A;  2G2W A;  1NZO A;  4PM5 A;  1ERO A;  2ZOI A;  3MQO A;  3M2K A;  2KDK A;  1PYY A;  3T4Q A;  1XJ4 A;  4LV2 A;  4P87 A;  1H8M A;  4ETZ A;  3S4X A;  2VZW A;  2VEA A;  4UA6 A;  4QJG A;  5CEC A;  1UWP X;  3WS1 A;  4BJP A;  3NC8 A;  4C3Q A;  5GLA A;  5AQB A;  3FC7 A;  3LR0 A;  2DNS A;  2EX2 A;  1DJB A;  1MWU A;  3IX3 A;  3GQZ A;  4MN5 A;  1GSV A;  2Y79 A;  5DTT A;  4GD8 A;  1LSW A;  5CXW A;  2P9V A;  2JKF A;  3MSH A;  5CTN A;  4H6J A;  1K55 A;  1OPX A;  3G4P A;  4E04 A;  3N8R A;  1GSX A;  5CRF A;  5F69 A;  1BT5 A;  4PAU A;  3NOT C;  3DTK A;  3NOP C;  3UE0 A;  1JTD A;  1MXO A;  4CPK A;  3PR6 A;  1JWV A;  1NJ4 A;  3U2A A;  4EES A;  1YQS A;  2Y8H A;  3FV7 A;  3T4S A;  1L0F A;  1ZTU A;  2I72 A;  2QKP A;  1PI4 A;  4BQM A;  4UEY A;  3TSG A;  5F1F A;  4E3I A;  3BFE A;  1X0O A;  4KZ9 A;  4H8R A;  4WMC A;  2ZJ9 A;  4JXS A;  4IHQ A;  3F1N A;  5JYO A;  3IH8 A;  1JWZ A;  3ZVT A;  5FI6 A;  3C7V A;  2HP5 A;  3M6B A;  3GMW A;  5CED A;  5EVI D;  3OLO A;  3NDE A;  3C4O A;  5EM1 A;  1D7E A;  4KZB A;  5GHZ A;  1E3U D;  1GA0 A;  2AVX A;  4P6Z S;  3A3D A;  4KZ3 A;  4PKY G;  2V1A A;  2OWH A;  5FI7 A;  4ZJ3 A;  5IU1 A;  2Y59 A;  3C4P A;  4F94 A;  4O8G A;  5J3W A;  3NI9 A;  4BBT A;  4HBU A;  4K08 A;  2Y2H A;  1YLT A;  3G30 A;  1JVJ A;  4QY5 A;  5HWW A;  1VB6 A;  4BL3 A;  4HI4 A;  1YLY A;  3MS6 A;  1BLC A;  3WS2 A;  3UNW A;  1FCN A;  1YT4 A;  3L7H A;  1IEL A;  2ZC3 B;  4Q0H A;  4QHC A;  3WRZ A;  1NWZ A;  3LGO A;  2VX8 A;  4AFI A;  2V8C A;  4HEF A;  5DVA A;  3HUO A;  4HOI A;  4EU0 A;  1UWN X;  4WEJ A;  1CEG A;  1QMF A;  1GHP A;  5FDS A;  3VFH A;  4MEZ A;  2BG1 A;  1O7E A;  1I5Q A;  1E4D A;  3AGD A;  4KZ7 A;  1Z6F A;  1I2S A;  2J3W A;  5TR7 A;  3UB7 A;  2OV5 A;  1YLJ A;  4HJ6 A;  2R9W A;  5FI2 A;  1G6O A;  4QWO A;  4E3L A;  2GZA A;  4JGP A;  5F6A A;  1HLU P;  1KE3 A;  2V8F A;  2QMI A;  2FH5 A;  4JBF A;  3IH9 A;  4C6Y A;  4R3B A;  1Q2Q A;  5HD5 A;  4CJN A;  5BOH A;  4GNU A;  2A24 B;  5F1G A;  4N1X A;  1DP9 A;  1QME A;  3IF5 A;  3NOU C;  3SH9 A;  3VP4 A;  4EEP A;  4ZTK A;  3D72 A;  3S22 A;  2PR5 A;  3UMD A;  1W8Y A;  3LIB A;  5TGF A;  1H0M A;  3I7J A;  1OME A;  1W7F A;  1XP4 A;  2PAV P;  3NY4 A;  3SS3 A;  3CWF A;  3BYD A;  2J3T C;  1SKO A;  4K0W A;  5HZH A;  2Y2I A;  3QNC A;  3ZHH A;  4NXE A;  2XEP A;  2UV0 E;  3EQV A;  4R4R A;  5F5Y A;  1ZG6 A;  3HUN A;  2Q9N A;  4O01 A;  5EOO A;  4FOF A;  3H7W B;  1N9L A;  2Y2J A;  1EW0 A;  5EVE A;  3QNB A;  3CLO A;  3OCL A;  4MN7 A;  2IWB A;  3CPT B;  4YWZ A;  5HPF A;  4LCL A;  4O7D A;  4N1H A;  1KDS A;  3CUE C;  4HES A;  5KIZ A;  4S2J A;  5FAT A;  1L0D A;  3RFB A;  3ZNT A;  5G18 A;  1PNE A;  4RX2 A;  2ZC6 B;  5D3O A;  3KYE A;  4QU3 A;  5A91 A;  3MR0 A;  3FG8 A;  3BW6 A;  3MMH A;  3PAE A;  1SDE A;  2XK1 A;  1K57 C;  4Y3I A;  5IS1 A;  2XF3 A;  3KO6 A;  4X25 A;  5EE8 A;  1STZ A;  2PYP A;  2WKE A;  1KGG A;  4UHU A;  1D1J A;  3RXW A;  1S6R A;  1T18 A;  4WZ5 C;  3VOY A;  3WS4 A;  2EWW A;  3BY9 A;  2XRN A;  4F3L B;  2ZQ9 A;  4L0L A;  4PM8 A;  2J80 A;  4NEE D;  3ZGA B;  3MFX A;  4JF4 A;  3OCN A;  2HDS A;  5E2E A;  3UE1 A;  2PBY A;  4R4S A;  5HAP A;  1JTG A;  3G34 A;  1NYY A;  1SZV A;  2EX6 A;  5EV0 A;  4MCW A;  1H8Y A;  5DF9 A;  3EEA A;  3W8K A;  4JF6 A;  1DP8 A;  3HL9 A;  1OT9 A;  1FQG A;  2YKF A;  4Y7P A;  2A2L A;  1Z09 A;  3T4L A;  2H28 A;  3WWX A;  1H8Z A;  2JCH A;  1XFN A;  4EUV A;  2QPN A;  3P01 A;  2D01 A;  4BBU A;  3Q1F A;  4WN5 A;  3P09 A;  3ZDJ A;  5KMW A;  4LCM A;  2ZC5 B;  4P85 A;  3EEH A;  5L07 A;  2V20 A;  4R1G A;  4L9E A;  4ZBE A;  3ZFZ A;  3LI8 A;  1ES3 A;  2OLU A;  2PT7 A;  5CTM A;  4WUJ A;  1K38 A;  2K7S A;  3PBO A;  5DKL A;  1NXY A;  3Q7Z A;  2WKR A;  1LSV A;  3IQA A;  1J3W A;  3M2J A;  3Q81 A;  1YSP A;  3CPT A;  2JKT I;  5EUA A;  2ZL1 B;  4GS9 A;  3RTY A;  4GN2 A;  2QJ7 A;  3FZC A;  2ZQD A;  5MC7 A;  3PAG A;  4MN6 A;  1PIO A;  2PU4 A;  3KSH A;  5DTS A;  2HJE A;  2HJ9 C;  5E2H A;  3OPH A;  1W5D A;  3E4Q A;  4UAA A;  4FH4 A;  3BQA A;  2W3F A;  4R0Q A;  2WKQ A;  3L9K A;  2WAE A;  2Y2N A;  1OJG A;  1MWR A;  1NLY A;  4R3A A;  2JKR I;  2K2N A;  4WMC D;  3R4K A;  1KVL A;  4L9G A;  4OQH A;  3BFF A;  4S2N A;  2ACG A;  2ZQA A;  3CG5 A;  3P7N A;  4KQO A;  4NXG A;  2PYR A;  4GCZ A;  3F1O A;  2W3E A;  3BFC A;  1N9O A;  1K54 C;  2XH9 A;  3UDX A;  3IF6 A;  2W0N A;  3MZD A;  3MF0 A;  5A90 A;  1BLP A;  4EW7 A;  1OTA A;  3G32 A;  4DE0 A;  1XJ3 A;  1SHV A;  3D3O A;  4GKU A;  2HDQ A;  4WL9 A;  3DWZ A;  3UME A;  3ZCZ A;  2ZOH A;  3QP8 A;  4Y0U A;  4E3M A;  3QP6 A;  1P97 A;  1O07 A;  1HTZ A;  3FKV A;  1VQQ A;  2E8J A;  2EX8 A;  4ZDX A;  1LSX A;  2PRF A;  4JXV A;  3LR3 A;  2ZQ8 A;  2KLI A;  4NET A;  4N92 A;  2BAS A;  3E98 A;  1CQA A;  3ZG9 B;  4B93 A;  2ZMV A;  2MJ6 A;  2VA0 A;  4WZ5 A;  2FFF B;  4HH3 A;  5E2F A;  3GSG A;  2XD1 A;  2ZD8 A;  4WEK A;  1W63 M;  1FSY A;  5J4E A;  3FYZ A;  1XPB A;  3MXQ A;  4S2K A;  2BTF P;  3UE3 A;  4G3K A;  2GNX A;  2HDR A;  3P98 A;  1KGF A;  1S1Z A;  1CI9 A;  4MBK A;  1NY0 A;  3IWI A;  2XFS A;  3C2W A;  4JPM A;  3LIC A;  1FOF A;  3PXP A;  5TJJ A;  2Y2O A;  4OKP A;  2XA7 S;  1S66 L;  3DTM A;  1T1B A;  3HLE A;  2WAD A;  4HIA A;  3UPO A;  4GHI A;  3W2Z A;  4GDN A;  5AJG A;  2ZLY A;  1YAX A;  2KX6 A;  1L2S A;  3OZH A;  4C75 A;  4YNR A;  2YKH A;  3CHW P;  2O99 A;  4K91 A;  3C30 A;  5DF8 A;  3M6H A;  3RH8 B;  3VP0 A;  4EEU A;  1S0W A;  4MDZ A;  1P0Z A;  4XT2 B;  3HJK A;  4PHT A;  2C5W B;  2DCF A;  3QHY A;  4BLM A;  4LEN A;  3LCE A;  3T1X A;  1MZU A;  2WZZ A;  3RJU A;  5HAR A;  5FQM A;  2XA7 M;  1ALQ A;  2ZMF A;  5G4Z A;  4EET B;  2W3H A;  3BRM A;  4GDB A;  1ERM A;  1XJ6 A;  3H82 A;  3LI9 A;  3NCK A;  4CLC A;  2Z6C A;  5F68 A;  4KZ5 A;  3VOL A;  4ID4 A;  2P7J A;  3OBF A;  1E25 A;  1NRJ A;  1PW1 A;  4X69 A;  3UB6 A;  4DE2 A;  1YMX A;  1AXB A;  1SCW A;  4IJG A;  3ISG A;  3BY8 A;  1HD8 A;  5AVF A;  2VGL S;  1PWD A;  2Y2K A;  2ZQC A;  3T4J A;  3N8S A;  1WA9 A;  3EQU A;  2CC1 A;  1DJA A;  1VET B;  3BJN A;  3A0R A;  1PWG A;  3HLB A;  4PKY A;  4KZA A;  2ZBB A;  5DF7 A;  5TFQ A;  4EER A;  3DTI A;  3LIE A;  5E43 A;  4PMA A;  4N9L A;  4D60 A;  5G4Y A;  3BFG A;  4MBF A;  3UY6 A;  1LI9 A;  2WKH A;  2P04 A;  2VGL M;  3PTE A;  1TD5 A;  3LY4 A;  1KDW A;  4LV1 A;  4PM6 A;  2KOI A;  5AVE A;  3T12 B;  1XXM A;  5TBM B;  1K54 A;  1DJC A;  3DWK A;  4B4Z A;  2XGN A;  4I3A A;  3VV4 A;  4Z9Q A;  3O3V A;  4DE1 A;  5M19 A;  4P6Z M;  4IVI A;  5CEB A;  1BSG A;  4KZ4 A;  4JF5 A;  4R23 A;  1KE0 A;  1TEM A;  4OQG A;  1K56 D;  5U47 A;  1S1Y A;  5EFW A;  2L4R A;  3O88 A;  5KSH A;  3UB8 A;  3IBR A;  1ES2 A;  1VM1 A;  3IWQ A;  4JXW A;  1FR1 A;  4IBR A;  1N9B A;  4KG2 A;  2PR6 A;  3BM6 A;  4HP9 A;  4FSF A;  5AQ7 A;  5HSQ A;  1TS0 A;  3GTC A;  4D2O A;  3FPW A;  5HW3 A;  1K4E A;  2PD8 A;  3JVV A;  1LLB A;  4XUZ A;  4LV3 A;  2V9A A;  3VSL A;  3CIT A;  2HV1 A;  5HDD A;  1G5U A;  2XD5 A;  4QB8 A;  3E2K A;  4IUK A;  4Q8I A;  2NUP C;  1PWC A;  3SS4 A;  4I39 A;  1HZO A;  2PBD P;  3LID A;  3K3D A;  3HLC A;  2WK0 A;  4UQI S;  3G2Z A;  1YLW A;  3FKW A;  2JC7 A;  3ICY A;  5FAQ A;  4U3T A;  3MFD A;  5CGX A;  1G68 A;  5J7E A;  4FH2 A;  1XGI A;  4KUK A;  2VKS A;  5HAI A;  2W3D A;  2P08 A;  2R9X A;  4G3W A;  5HAQ A;  3WS5 A;  3E2L A;  2XLN A;  5FAO A;  2GJ3 A;  3G35 A;  1LL5 A;  1A0K A;  1OTD A;  1M6K A;  2QZ6 A;  1OTE A;  5A8B A;  3KSI A;  3S7O A;  3NIA A;  3C8C A;  1YLZ A;  4HY8 A;  3UO9 A;  2EWV A;  3IXD A;  2W3G A;  3T1R A;  2Y2Q A;  1GA9 A;  1K0K A;  3B33 A;  2VK3 A;  3UPN A;  4NK3 A;  3T4O A;  3V5M A;  3HCY A;  3EOI A;  1ES4 A;  2QWS A;  1S4S A;  1ERQ A;  4S2M A;  4S2O A;  3A3J A;  3UDF A;  4OQ0 A;  2X01 A;  3AGF A;  5L09 A;  5EEC A;  2W27 A;  3E4O A;  3SH8 A;  2J3T D;  3MXS A;  4FUW A;  3ZVW A;  4WZ4 A;  3HLD A;  3QP1 A;  5HDS A;  3VP2 A;  2BLS A;  3R7W B;  4BD0 A;  4YOF A;  5M1A A;  1K6S A;  4CQH A;  3VMA A;  5CX7 A;  4Q0J A;  2EA9 A;  4U0X A;  1ESI A;  2L1M A;  5FDH A;  5GLD A;  3Q7V B;  4IED A;  4OPR A;  2M1C A;  2X71 A;  1MBL A;  4PPR A;  3N6I A;  4DRT A;  5IT5 A;  3UB9 A;  2O9B A;  2J8Y A;  4Y15 A;  3HLW A;  4UA7 A;  2V0W A;  1ONG A;  5CER A;  5CGW A;  2HDU A;  4DXB A;  1MWS A;  3F1P B;  3N4I A;  2A24 A;  1XA1 A;  5FSR A;  3VP3 A;  5JYP A;  1K56 A;  1NLZ A;  2OAP 1;  1KE4 A;  4X6T A;  2VV8 A;  3ZG7 B;  1WE4 A;  1PI5 A;  2VJW A;  5L10 A;  4LRY C;  2WUQ A;  2OOL A;  2PU2 A;  2B5R A;  3ZG5 A;  3EWK A;  3PBQ A;  3IHA A;  2P74 A;  2HGV A;  3O87 A;  1W63 Q;  3Q82 A;  2JN7 A;  3JYI A;  2XR0 A;  4LLO B;  2V0U A;  3IS2 B;  5A93 A;  1PW8 A;  2NUT C;  3WRT A;  4WLA A;  1MC0 A;  3T1Q B;  4R6L A;  5EM0 A;  5FQK A;  1TDL A;  1ODV A;  1K55 C;  4LRZ E;  2ZM8 A;  1SDN A;  3H7W A;  4R70 A;  2WGW B;  1KGE A;  5FA7 A;  5GLC A;  2Y91 A;  3BLM A;  3IBJ A;  3HUM A;  1G6A A;  2QYB A;  4HH2 A;  3SZT A;  3NJA A;  3W4Q A;  2JKT M;  4E3N A;  1V9Z A;  3LR4 A;  4S2L A;  1BUL A;  4Y5F A;  4OPZ A;  3DW0 A;  3SW1 A;  5FL3 A;  3QP4 A;  2LB5 A;  4KQR A;  3BWL A;  1FIL A;  2Z2M B;  1CJF A;  1F2K A;  4BL2 A;  1GSW A;  4R38 A;  5CHJ A;  3E4P A;  3KYQ A;  2ZMA A;  3LIA A;  1TS6 A;  1MKI A;  2A3U A;  3FWL A;  4KG6 A;  4ARZ B;  4EV4 A;  4PM9 A;  4PM7 A;  1F5M A;  2O9C A;  4CLC D;  3VFF A;  3T50 A;  4L9F A;  4QY6 A;  4F3L A;  5GL9 A;  3N7W A;  3Q7V A;  3D9Y A;  4B4X A;  2OLV A;  4EBP A;  4NXB A;  3S1Y A;  4WEL A;  3CAX A;  1LI0 A;  3V67 A;  4XXR A;  1YM1 A;  3HJI A;  1GHI A;  1ONH A;  3IXG A;  1EWZ A;  4I3I A;  4OOL A;  1OTB A;  2XFT A;  2JBF A;  1HVB A;  1KVM A;  5HPI A;  2C6W B;  2FZ0 A;  4I38 A;  1DY6 A;  4HJ4 A;  2P9V B;  2M7V A;  1YLP A;  5HD3 A;  3UB5 P;  4I3J A;  3VSK A;  2Y55 A;  4GB7 A;  1UGU A;  3A3F A;  4EBN A;  1PFL A;  3KX0 X;  1P9R A;  2ZQ7 A;  4OPY A;  3V39 A;  3CUE A;  3C5A A;  4ZAM A;  1ACF A;  1XFQ A;  3EGX C;  1SKF A;  3O5Y A;  2OSU A;  5EOE A;  1IYO A;  3IS2 A;  4DE3 A;  1V9Y A;  2OWJ A;  1XX2 A;  1U60 A;  3V3S A;  4K0X A;  4GJ4 A;  3CI6 A;  5GHX A;  2Z6D A;  1K57 A;  3F1N B;  4LFU A;  1MPL A;  1YMS A;  3VOZ A;  5FEG A;  3D4F A;  1JWP A;  4RVA A;  4RYE A;  2INW A;  3SS5 A;  4MBH A;  2ZL1 A;  3C38 A;  3KSF A;  3NHQ A;  2JE5 A;  2PHY A;  3TE8 A;  3QP2 A;  1S67 L;  1ZC2 A;  1WYC A;  2JHE A;  2J7V A;  3GDI A;  3TG9 A;  5A92 A;  4KG5 A;  3A3I A;  3IXH A;  1OJ5 A;  4RX3 A;  1VHM A;  4GZB A;  3TOI A;  3JPU A;  1ZG4 A;  3S7P A;  4ARZ A;  1TS7 A;  3V50 A;  1Y28 A;  4S2I A;  2L0W A;  4LGW A;  5HFO A;  4LRX C;  2HP6 A;  2XDM A;  4BMW A;  4IBX A;  2A49 A;  1WYB A;  3UDI A;  3NUL A;  4X1M A;  2HZ5 A;  4OP8 A;  3ZNY A;  2WYX A;  4KEN B;  1LL8 A;  4DJ2 A;  5HWT A;  1TDG A;  1M40 A;  2B18 A;  4HBT A;  1ZKJ A;  3LFV A;  3B47 A;  1IFQ A;  2ZC4 B;  4M3K A;  2I9V A;  1IKI A;  2Y2P A;  3ZQ5 A;  4NXF A;  4IVK A;  4X1L A;  1ESU A;  2V1Z A;  5CHM A;  3SOI A;  4DXC A;  2R78 A;  5HX9 A;  3OPR A;  5C5K A;  2VGJ A;  1GHM A;  1YSQ A;  4MMN A;  2GDN A;  1S4R A;  1K4F A;  1F9I A;  5GLB A;  4DJ3 A;  1BLH A;  4Z1W A;  1OTI A;  3DTE A;  4HP4 A;  2HF6 A;  4HHD A;  4WBG A;  4RQ9 A;  3EGD C;  1TS8 A;  2ZM2 A;  3ITB A;  3MBZ A;  5EVI C;  3HRE A;  4B9O A;  1IOU A;  2B95 A;  1RGZ A;  5I5L A;  5EPH A;  1DP6 A;  3DBA A;  2WZX A;  3BEC A;  3PBR A;  4WYY A;  2W1R A;  5FQQ A;  3IX4 A;  4O0P A;  2O9A A;  3S7Q A;  4I5S A;  4HQA A;  4OLG A;  4NG2 A;  4OQI A;  3ZG8 B;  4E6X A;  4E3J A;  1N9N A;  4BD1 A;  4MLL A;  4S2P A;  4Y0O A;  3NDG A;  4GLQ A;  3KSG A;  1RCJ A;  2ZM0 A;  1SKO B;  5I94 A;  4Y17 A;  4OVD A;  1KOU A;  2PD7 A;  3G2Y A;  1LL9 A;  2VV7 A;  1PZP A;  1P9W A;  2Y2G A;  1YKD A;  3W4O A;  2WKP A;  1T19 A;  3HVF A;  4UA9 A;  1MKM A;  3GVB A;  2RL3 A;  2JKG A;  3HBR A;  2VGK A;  2X02 A;  3ZG0 A;  3IT9 A;  4XT2 A;  1BUE A;  3PYP A;  1N4O A;  2LB9 A;  3GR2 A;  5EVI B;  4LV0 A;  2Y2M A;  3BLS A;  3UN7 A;  1BYW A;  1PRQ A;  3BEB A;  1J9M A;  1CF0 A;  3IXB A;  2PDR A;  3LEQ A;  1L0E A;  3MKE A;  3VP1 A;  4YFM A;  3GV9 A;  5HDC A;  5DFY A;  5FAP A;  3N8L A;  5K5B A;  3E0Y A;  4LPZ A;  1F98 A; 
#chains in the Genus database with same CATH homology
 3U2A A;  2OAP 1;  4EQ1 A;  4EES A;  2VV8 A;  3MQ0 A;  2Y8H A;  2VJW A;  3S7N A;  4LRY C;  1XJ3 A;  2G7U A;  3D3O A;  3T4S A;  1ZTU A;  2QKP A;  4WL9 A;  2OOL A;  3EWK A;  3UME A;  3PBQ A;  4UEY A;  2ZOH A;  2OAQ 1;  2HGV A;  1X0O A;  2XRO A;  3T4K A;  1W63 Q;  2JN7 A;  4IHQ A;  3F1N A;  2IA2 A;  1P97 A;  4LLO B;  2V0U A;  3IS2 B;  1LT0 A;  2NUT C;  4UQI M;  4WLA A;  1MC0 A;  3KYZ A;  1LSX A;  4R6L A;  2V1B A;  3LR3 A;  2KLI A;  4GW9 A;  1ODV A;  2BAS A;  3OLO A;  4LRZ E;  3E98 A;  3H7W A;  4B93 A;  4R70 A;  1D7E A;  4BBV A;  2ZMV A;  2MJ6 A;  4P6Z S;  2VA0 A;  4KQD A;  4PKY G;  3IBJ A;  2QYB A;  4HH2 A;  3NJA A;  3PR6 A;  2V1A A;  2JKT M;  4HH3 A;  5TBM A;  1V9Z A;  2OWH A;  3LR4 A;  5IU1 A;  5DFX A;  4Y5F A;  4WEK A;  1W63 M;  4O8G A;  3MQQ A;  3SW1 A;  5FL3 A;  5J4E A;  2LB5 A;  5J3W A;  3BWL A;  1GSW A;  3MXQ A;  4R38 A;  4BBT A;  3E4P A;  4K08 A;  3UE3 A;  4G3K A;  2GNX A;  3LYX A;  3KYQ A;  3LIA A;  1S1Z A;  1XJ2 A;  4JGR A;  1TS6 A;  4GS9 B;  5HWW A;  1VB6 A;  3GEC A;  2B02 A;  4HI4 A;  4ARZ B;  4DMZ A;  3C2W A;  1F5M A;  2O9C A;  3LIC A;  3PXP A;  5TJJ A;  4CLC D;  2XA7 S;  4Q0H A;  3G6O A;  1S66 L;  3A0S A;  3PBS A;  3T50 A;  1NWZ A;  1T1B A;  4HIA A;  2VX8 A;  4L9F A;  4F3L A;  2VV6 A;  4AFI A;  4GHI A;  3W2Z A;  4HOI A;  4EU0 A;  5AJG A;  1UWN X;  1YAX A;  2KX6 A;  4WEJ A;  4ME4 A;  4YNR A;  2YKH A;  4NXB A;  3K3C A;  2DMW A;  4WEL A;  3CAX A;  5DKK A;  2O99 A;  3C30 A;  3RH8 B;  3V67 A;  4EEU A;  2W1T B;  3HJI A;  4MDZ A;  5HWV A;  1P0Z A;  2J3W A;  3UB7 A;  4XT2 B;  3HJK A;  4PHT A;  3JVU A;  4I3I A;  4HJ6 A;  4OOL A;  1OTB A;  1G6O A;  2GZA A;  5HPI A;  3TJZ C;  4JGP A;  2FZ0 A;  4I38 A;  5F6A A;  3T4T A;  1MZU A;  4HJ4 A;  2M7V A;  2XA7 M;  2ZMF A;  3F1O B;  4WF0 A;  5G4Z A;  2FH5 A;  3BQ8 A;  5HD3 A;  4EET B;  2W3H A;  2VLG A;  1T1A A;  3FPV A;  4I3J A;  5HD5 A;  4NKP A;  2M7U A;  1XJ6 A;  3H82 A;  1UGU A;  3LI9 A;  4II7 A;  2A24 B;  2D02 A;  3KX0 X;  1P9R A;  4CLC A;  1H3Q A;  2Z6C A;  3CUE A;  5F68 A;  3K2N A;  3VOL A;  1XFQ A;  1DP9 A;  2P7J A;  3OBF A;  1NRJ A;  3NOU C;  4EEP A;  3ZYT A;  2QJ5 A;  3EGX C;  3UB6 A;  4IJG A;  3D72 A;  3O5Y A;  3BY8 A;  3B42 A;  2PR5 A;  3IS2 A;  3UMD A;  3OOV A;  5AVF A;  1V9Y A;  2OWJ A;  2VGL S;  3LIB A;  1TF1 A;  1T1C A;  4HJ3 A;  3PBT A;  4GJ4 A;  3CI6 A;  2O0Y A;  3LR5 A;  3T4J A;  2Z6D A;  1WA9 A;  3EQU A;  3F1N B;  3BJN A;  3LUQ A;  3A0R A;  4CLC E;  3CWF A;  2J3T C;  2INW A;  5HZH A;  4PKY A;  2ZBB A;  3C38 A;  3KSF A;  4NXE A;  3NHQ A;  4ZRR A;  3EQV A;  4EER A;  3TW8 A;  5LBR A;  5F5Y A;  4HNB A;  2PHY A;  4ETX A;  4O01 A;  3TE8 A;  3LIE A;  1S67 L;  4FOF A;  5G4Y A;  3H7W B;  2JHE A;  1N9L A;  3GDI A;  1EW0 A;  3CLO A;  2P04 A;  2VGL M;  4Q0I A;  3OCL A;  4MN7 A;  1TD5 A;  1OJ5 A;  4YWZ A;  5HPF A;  1VHM A;  2KOI A;  1G28 A;  4CLC C;  5AVE A;  3CUE C;  5TBM B;  5KIZ A;  4JGQ A;  3S7P A;  3R7W A;  4I3A A;  3VV4 A;  3RFB A;  4ARZ A;  1TS7 A;  4P6Z M;  1Y28 A;  2L0W A;  4JGO A;  1ZHH B;  4LRX C;  4BMW A;  1S1Y A;  4Y2F A;  3MR0 A;  2JKR M;  3FG8 A;  3BW6 A;  5DJT A;  3MMH A;  5EFW A;  2L4R A;  4BWI A;  5KSH A;  3UB8 A;  1LL8 A;  3IBR A;  4DJ2 A;  4Y3I A;  5IS1 A;  5HWT A;  5HL6 A;  2B18 A;  3KO6 A;  3TRC A;  5DJU A;  2PR6 A;  1STZ A;  2PYP A;  3LFV A;  4HP9 A;  3B47 A;  1IFQ A;  4IUH A;  4FSF A;  4OOM A;  2W1T A;  2XSS A;  1T18 A;  2I9V A;  5HSQ A;  1TS0 A;  3ZQ5 A;  4NXF A;  2EWW A;  3BY9 A;  2XRN A;  4F3L B;  4L0L A;  2R78 A;  3FPW A;  3F1P A;  2J80 A;  4GHI B;  4NEE D;  5C5K A;  2PD8 A;  3JVV A;  3MFX A;  3OCN A;  1YSQ A;  4MMN A;  2V9A A;  3CIT A;  1S4R A;  2HV1 A;  5HDD A;  4EXO A;  2GX5 A;  2K31 A;  1F9I A;  4H6J B;  4DJ3 A;  4IUK A;  4M4X A;  2NUP C;  4I39 A;  4MCW A;  4Z1W A;  3LID A;  5DF9 A;  1OTI A;  3EEA A;  3K3D A;  5L8M A;  3VE3 A;  4UQI S;  1DP8 A;  4HP4 A;  2HF6 A;  4HHD A;  1OT9 A;  2YKF A;  3ICY A;  2A2L A;  4RQ9 A;  3T4L A;  2H28 A;  3EGD C;  1TS8 A;  1JNU A;  4DN0 A;  5J7E A;  3VE4 A;  4KUK A;  4B9O A;  4G3V A;  1XFN A;  2VKS A;  2W3D A;  4KUO A;  4EUV A;  2P08 A;  4G3W A;  1IOU A;  3H82 B;  5I5L A;  2QHK A;  1DP6 A;  3P01 A;  3DBA A;  1D06 A;  2GJ3 A;  2D01 A;  3PBN A;  4CLC B;  4BBU A;  1OTD A;  4WN5 A;  1OT6 A;  2CMN A;  3PBR A;  3UE6 A;  3OC2 A;  2W1R A;  3EEH A;  3PHY A;  1OTE A;  5A8B A;  3A0V A;  3KSI A;  3S7O A;  1DRM A;  3ULF A;  3C8C A;  4L9E A;  4O0P A;  2O9A A;  3H9W A;  4HY8 A;  3LI8 A;  3S7Q A;  4I5S A;  2EWV A;  2PT7 A;  4WUJ A;  4HQA A;  2W3G A;  3MJQ A;  2K7S A;  3PBO A;  5DKL A;  4QPR A;  2WKR A;  1N9N A;  3B33 A;  1LSV A;  4GLQ A;  3T4O A;  3KSG A;  3LIF A;  1YSP A;  2ZOI A;  3HCY A;  3EOI A;  2QWS A;  1S4S A;  2JKT I;  3MQO A;  2KDK A;  4GS9 A;  3RTY A;  3T4Q A;  1XJ4 A;  2QJ7 A;  5MC7 A;  1KOU A;  2PD7 A;  2W27 A;  3E4O A;  1H8M A;  2J3T D;  2VV7 A;  4ETZ A;  4MN6 A;  2VZW A;  1P9W A;  3KSH A;  2VEA A;  2HJE A;  2HJ9 C;  1YKD A;  3E4Q A;  1UWP X;  4BJP A;  2WKP A;  3BQA A;  2W3F A;  1T19 A;  5HDS A;  2WKQ A;  3R7W B;  4YOF A;  3FC7 A;  1MKM A;  3LR0 A;  1OJG A;  4CQH A;  1NLY A;  4R3A A;  4MN5 A;  1GSV A;  5CX7 A;  2Y79 A;  4Q0J A;  2EA9 A;  4XT2 A;  2JKR I;  2K2N A;  3PYP A;  3R4K A;  2LB9 A;  2L1M A;  4L9G A;  2M1C A;  1LSW A;  5IT5 A;  1BYW A;  3P7N A;  4KQO A;  4NXG A;  2O9B A;  3UB9 A;  2PYR A;  4GCZ A;  3F1O A;  2PDR A;  2W3E A;  4H6J A;  1N9O A;  2V0W A;  1OPX A;  4E04 A;  1GSX A;  5F69 A;  5HDC A;  3F1P B;  2W0N A;  2A24 A;  4PAU A;  5DFY A;  3MF0 A;  5K5B A;  3NOT C;  3E0Y A;  3NOP C;  4LPZ A;  4EW7 A;  1OTA A;  1F98 A;  1NLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...