5FQQA

Last common ancestor of gram-negative bacteria (gnca4) beta-lactamase class a
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
262
structure length
262
Chain Sequence
b'AALSEQLAELEKRSGGRLGVAVLDTATGRRFGYRGDERFPMCSTFKALLAAAVLARVDQGKENLDRRITYGKEDLVDYSPVTEKHVGDGMTVAELCEAAITYSDNTAANLLLEALGGPAALTAFLRSIGDNVTRLDRWEPELNTAAPGDPRDTTTPAAMAATLRTLLLGDVLSPASRQQLVDWLIANKTGDKRLRAGLPADWRVGDKTGTGEHGTTNDIAVIWPPNRAPILVAVYLTESQVDADARDAVIAEVARLVVAAFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GNCA4 LACTAMASE
publication title De novo active sites for resurrected Precambrian enzymes.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Hydrolase
total genus 95
structure length 262
sequence length 262
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5fqqA00
5F82A 4PPRA 3TG9A 5GHXA 2V20A 1K25A 3GR2A 1YLYA 3WS1A 4CPKA 5L2FA 2V2FF 4JXGA 5HW3A 2BG1A 4WBGA 2C5WB 5KSHA 1I2WA 5KZHA 4LV0A 1BTLA 3TOIA 1E25A 2EX9A 4EQIA 3IF6C 3MKFA 4K0XA 5FDHA 2B5RA 1IEMA 1L0GA 3HUOA 4S2JA 2EXAA 2Y4AA 4OQGA 1NY0A 1LI9A 4WELA 3OPHA 1K4FA 2OSUA 4HBUA 3SS5A 3ZVWA 4EBPA 3GMWA 5EVIA 4NETA 4N9KA 3SS4A 1GA0A 4DE3A 3P98A 4RVAA 4JXSA 3ITBA 2WKHA 4QHCA 4JXWA 4S2LA 3UN7A 3ZVTA 4Y0UA 2VGJA 3S4XA 1ESIA 4PM6A 3BLMA 4LV3A 1BULA 3O87A 1YMXA 3OCLA 3VP1A 3IXHA 4GD6A 3W4QA 4OOYA 1FCMA 1K55A 4E3IA 1TDGA 2Z2LB 2Y2MA 3M2KA 5CEBA 1DJBA 1FSWA 1GA9A 3MXRA 3RXXA 1H5XA 5DTSA 3HLBA 5KSCA 1ES2A 3VSLA 1YM1A 2QZ6A 5EUAA 5EVLA 3GVBA 3MKEA 3WS0A 1PWGA 1H8YA 1S6RA 1YLTA 5CTMA 3C7VA 4RX2A 5HAPA 1CEFA 2ZQ8A 5KMWA 3ZNYA 2VGKA 1S0WA 2EX8A 5FI2A 3UO9A 2XF3A 1J9MA 1PYYA 5FQQA 5EVIC 5HX9A 1SCWA 4UA6A 1L0EA 1JTDA 3WS2A 2WKEA 3C5AA 4S2KA 5FQKA 3WRTA 1QMEA 3BFFA 4EUZA 4GD8A 4GNUA 5CHMA 3IHAA 1FSYA 4OP5A 1ES5A 2RL3A 1L0DA 3DWKA 2HP6A 3Q7VB 3I7JA 3G34A 1H8ZA 4S2IA 4A5RA 5EECA 3SH7A 2ZM8A 3G35A 4MNRA 1TEMA 5DTTA 2XD5A 2JCHA 3WS4A 1K55C 4WMCA 2ZJ9A 2G2WA 5DF9A 5FI7A 3VP0A 3VSKA 2XEPA 4DDYA 1KE3A 1VQQA 2XQZA 5GLBA 5GLDA 1NXYA 1IYQA 4GN2A 4ZTKA 5J8XA 1W79A 3OPPA 4DXBA 4H8RA 2JC7A 1FR6A 4RA7A 3ZG5A 1KVLA 1BT5A 2G2UA 2ZLYA 3ISGA 4QB8A 4LV2A 2GDNA 2HP9A 4KZ5A 2ZM0A 1NYMA 3IF6B 1K38A 3UNWA 4S2OA 4WZ4A 1PWDA 4Q8IA 2HDRA 4BLMA 3A3IA 1N4OA 1YQSA 1SHVA 3VP3A 1NJ4A 2HDQA 2WGWA 3M6BA 4IBRA 3WRZA 1MWSA 3V5MA 5HARA 3IQAA 3IH9A 3VOZA 4MBFA 1NZOA 2J9PA 3V3SA 4ZBEA 4GDBA 4LENA 3IT9A 1WYCA 2Y2HA 2ZM2A 4QJGA 3ZHHA 3QNBA 4JF5A 3NIAA 3O3VA 4R1GA 5CXWA 3VFFA 1HVBA 2XDMA 1BLPA 1W8YA 4K91A 3S1YA 1U60A 2P9VA 4L0LA 4OLGA 5GHZA 2HDUA 5A91A 3FKWA 2X02A 2EX6A 3D4FA 3LCEA 4OKPA 1ALQA 1CI8A 5EOEA 4ZAMA 2IWDA 3MXSA 3NI9A 4E3NA 4N1HA 4S2NA 4D2OA 1K6RA 1FR1A 3N8SA 4PM5A 1JWVA 2X71A 1XA7A 5FAPA 2ZD8A 5F83A 4OONA 1LI0A 3V50A 1PZOA 4ZJ1A 1MY8A 3NCKA 4O7DA 3UE1A 2WYXA 4B4ZA 1CI9A 4QD4A 4Y0OA 1YT4A 3FV7A 1BUEA 2WAEA 4OOMA 3A3FA 1CK3A 3S22A 5E43A 3V3RA 1FOFA 1K4EA 3UPPA 1PIOA 2ZC6B 1ZG6A 4EBLA 4N92A 1NZUA 2QMIA 3C4PA 2DCFA 4IVIA 1M6KA 3OCNA 4KG6A 4B88A 2DNSA 4XUXA 2PU4A 5EVIB 2Y55A 1LL5A 2WADA 3G32A 1PI4A 1JWZA 2I72A 2ZC5B 3ZG0A 4BD0A 1ES3A 4PM8A 5AQAA 3IWOA 5G18A 2Q9MA 5A92A 4FD8A 3HLWA 4IVKA 4GDNA 1XKZA 3ZG7B 4QY6A 5CERA 5DF8A 2FFYA 1ERQA 2OLUA 5HAQA 3CG5A 3N8LA 4BD1A 5BOHA 3W4PA 4U0XA 4JKTA 4JPMA 3DTMA 4KZ8A 4S2NC 2EFXA 1XGIA 2XFTA 5FQIA 3SH9A 5GLAA 3BFDA 2ZMAA 3MZDA 5CTNA 3M2JA 4P6BA 5TGFA 4ZJ2A 1XX2A 2RCXA 1KDWA 4OQHA 4WEKA 5EVID 4R4RA 3AGDA 2HDSA 5E2GA 3ZDJA 4U3TA 4LCLA 3PBQA 3Q7ZA 4B4XA 3HLGA 4KZ6A 1IKGA 4JLFA 1Q2QA 2H10A 1KGFA 2WKIA 1G6AA 4JBFA 4OLDA 3MZEA 1E3UA 4DDSA 4JXVA 3N8RA 1K57A 4DE2A 4GB7A 1HZOA 3PBSA 3LO7A 3N7WA 1K54A 5AQBA 4KENB 2H0TA 2Y2JA 3G4PA 2Y2NA 1MWUA 3DWZA 3ZGAB 1IYSA 4XXRA 3FKVA 1BLHA 3NC8A 3NY4A 3HVFA 4ZDXA 5CGSA 4WM9A 3QHYA 4E3OA 1JVJA 5TR7A 5FAOA 3O86A 1ERMA 1I5QA 3MFDA 4E6XA 1ES4A 3AGEA 4DXCA 1E3UD 1BLSA 4FSFA 4ID4A 4E3MA 4DF6A 3SH8A 4GZBA 2WK0A 1L2SA 4PM7A 1XP4A 2EXBA 1KDSA 2WGVA 4BJPA 5U47A 5JYPA 2HP5A 2JE5A 1DJAA 5E2FA 4P87A 4FH4A 4OH0A 5HFOA 4E3JA 3BYDA 1L0FA 3BM6A 2WUQA 4OPRA 4OPZA 4X53A 3ZG9B 2XK1A 3GTCA 5FAQA 4KZ9A 3HLFA 4YINA 1ZKJA 2C6WB 2WGWB 4RX3A 1EROA 1YLZA 2V1ZA 3GQZA 3RJUA 2EFUA 2EX2A 1K57C 4RYEA 3WWXA 5FQJA 4WMCD 1KGGA 4JF6A 2H0YA 4HBTA 3A3DA 1K54C 3W4OA 5M18A 2J7VA 1GHPA 1PI5A 5F1FA 1MPLA 3UPOA 3P09A 3VFHA 4KZ7A 4WEJA 2P9VB 3Q07A 3O88A 4E6WA 2A3UA 1PW8A 5CHUA 5CGWA 3CZDA 4MEZA 4HEFA 1HD8A 3HUMA 3IH8A 1LHYA 1SDNA 3N6IA 3Q1FA 4KG5A 5D3OA 4X55A 3BECA 4DRTA 3VOYA 1RP5A 2OV5A 1VM1A 2XD1A 1IKIA 4P85A 4EV4A 2ZC7A 1YMSA 1W5DA 2ZC4B 3GRJA 3LEZA 5FA7A 4EWFA 4Z9QA 4E3LA 4E3KA 3BRMA 4UHUA 1MBLA 2Y59A 3IXGA 3Q81A 1OMEA 4KZ4A 4MLLA 2JBFA 4DE0A 4UAAA 5CEDA 2R9XA 2ZQ7A 4QU3A 2Y2IA 4R3BA 1YLPA 3G2ZA 4BL2A 1SKFA 2WGIA 2ZQ9A 4BL3A 3A3JA 1MXOA 4CJNA 5FASA 2WAFA 2Y2LA 4F94A 1LLBA 1LL9A 3A3EA 2XH9A 3BEBA 5TFQA 1XXMA 1BZAA 3MZFA 3PBOA 4KZAA 4LCMA 1I2SA 1TVFA 3MBZA 1Y54A 1DJCA 1WE4A 2Y91A 3HL9A 4GKUA 3BFGA 1AXBA 2FFFB 1Z6FA 3OPLA 3RXWA 3Q82A 3ITAA 4R23A 5GLCA 3M6HA 5HAIA 2OLVA 3FZCA 2DRWA 1GCEA 1JWPA 2WZZA 3HLEA 4EBNA 4X6TA 3EQUA 2Y2PA 1IELA 1EI5A 3QNCA 3VP2A 1FCNA 5AQ7A 4DKIA 3V39A 5FATA 3W8KA 1GHIA 4BQMA 4KQQA 2J8YA 4PMAA 1WYBA 3UDIA 4U0TA 5E2EA 2XR0A 4UA9A 2Y2OA 3OC2A 1IYPA 3IHBA 4KZBA 2Y2GA 3AGFA 3BLSA 4OVDA 3IXBA 5EPHA 4R3JA 1O7EA 5FQ9A 1FCOA 2IWCA 1XPBA 1NRFA 4KG2A 3CJMA 2R9WA 4PM9A 4ZJ3A 3WS5A 4QY5A 1RGZA 3DW0A 4WZ5A 5DF7A 1ONHA 2UWXA 4XUZA 1RCJA 2Q9NA 3OZHA 1PW1A 4KZ3A 3PAEA 3PBNA 4Y0TA 2IWBA 5FSRA 4KQRA 4YFMA 1PWCA 3NDGA 5CGXA 4R4SA 3GSGA 3G2YA 5HL1A 1BSGA 3HLCA 1MWTA 3UPNA 1QMFA 3PTEA 3IXDA 4C6YA 1N9BA 3ZFZA 2X01A 3ZCZA 4JF4A 1C3BA 1Q2PA 5EOOA 4IBXA 4DE1A 3VP4A 1G68A 5I94A 1KE4A 1XGJA 1PZPA 3UY6A 4LV1A 4M3KA 1ONGA 2Y2QA 1O07A 4X56A 1YLWA 2Z2MB 4MBHA 1ZG4A 3IWIA 3OPRA 3SOIA 3BFCA 5CHJA 3PBTA 4MBKA 3CMZA 2XFSA 1CEGA 4N9LA 1GHMA 3HREA 1KGEA 4UA7A 3IF5A 2PBYA 4S2MA 1KE0A 3FYZA 5CECA 1HTZA 1W7FA 3E2KA 3Q7VA 4OPYA 4WZ5C 1NYYA 3LY4A 1KVMA 1TDLA 4Y7PA 5M19A 2Y2KA 4WYYA 2ZQAA 2P74A 1SDEA 4KQOA 1MWRA 5DVAA 4GOGA 1K6SA 4HESA 4C75A 5AQ9A 2H5SA 4P0MA 1MKIA 1BLCA 1ZC2A 4OPQA 4FH2A 2CC1A 3HLDA 3UE3A 1K56A 1M40A 3TSGA 3PAGA 5EE8A 3SS3A 2HPBA 3JYIA 1DY6A 2BLSA 5FI6A 3FWLA 3E2LA 3HBRA 4S2PA 1IYOA 3IF6A 4OQIA 3B3XA 3VMAA 5A90A 3C4OA 5JYOA 2A49A 4K0WA 5CRFA 3EQVA 3UDXA 3UDFA 3IWQA 5DTKA 1ESUA 4X68A 2XLNA 4BENA 3HUNA 3PBRA 1JTGA 2ZC3B 5F1GA 4FCFA 5GHYA 4X69A 4OP8A 5IHVA 1RGYA 4R0QA 1YLJA 4C3QA 4OQ0A 4NK3A 3GV9A 3NDEA 1K56D 1W8QA 5GL9A 3ZNTA 3UE0A 2WZXA 1XA1A 2PU2A 3C7UA 5A93A 2QPNA 4OOLA 5FQMA 1FQGA 3NBLA 4N1XA 2J9OA 2XGNA 1EWZA 2ZQDA 2ZQCA 5M1AA 3ZG8B 1E4DA 3LY3A 5E2HA 3G31A 3G30A 2E8IA 3N4IA 4IEDA 3BFEA
chains in the Genus database with same CATH superfamily
1D1JA 4GW9A 5L2FA 2HJEA 5KSHA 2C5WB 5HZHA 1Y28A 4I3AA 3IF6C 3C30A 1IEMA 3KO6A 3HUOA 4OQGA 3OPHA 1K4FA 4HBUA 3ZVWA 5AVFA 4YNRA 4RVAA 3ITBA 4QHCA 4GS9A 1T1AA 3ZVTA 4Y0UA 2VGJA 1P9RA 4EUVA 1LSWA 4JGQA 2JKFA 3LICA 4PM6A 3UE6A 1BULA 3OCLA 4LFUA 3IXHA 4UEYA 1TDGA 2Y79A 2PYPA 5CEBA 5TBMA 1XFQA 5DTSA 3LIAA 4EETB 1YM1A 3MKEA 1PWGA 4CLCC 3KYEA 1S6RA 3CUEA 1YLTA 3C7VA 3LIEA 3OOVA 4ETZA 2VZWA 1J9MA 5FQQA 3H9WA 3TJZC 3WS2A 3BFFA 4GNUA 4D60A 1ES5A 3TRCA 3Q7VB 4R6LA 3G34A 1G6OA 3NECA 1YAXA 5EECA 2NUPC 2ZM8A 1TEMA 1Z09A 2ACGA 1K55C 4R70A 2XEPA 1KE3A 4LGWA 1FR6A 3ZG5A 1S4SA 2GJ3A 2HP9A 3IF6B 1K38A 4WZ4A 4EXOA 1N4OA 3H82A 3M6BA 3V5MA 4MBFA 2J9PA 3V3SA 1F9IA 1WYCA 3ZHHA 3QNBA 2OAP1 4Y5FA 1HVBA 2XDMA 1BLPA 5FEFA 4H6JB 4L0LA 4OLGA 5A91A 4X1MA 1P9WA 1SKOA 4OKPA 1ALQA 5EOEA 4ZAMA 2IWDA 4N1HA 4HOIA 2ZOHA 4ZJ1A 3UE1A 4O7DA 4CLCB 2WAEA 3A3FA 5E43A 3UPPA 1ZG6A 1NZUA 1M6KA 4KG6A 1IOUA 4B88A 5HWVA 2DNSA 4XUXA 2PU4A 2L0WA 2WADA 2V1AA 2ZC5B 3ZG0A 4BD0A 1ES3A 4PM8A 5AQAA 3IWOA 3QP1A 3HLWA 5CERA 2W3GA 2XRNA 5DF8A 2VJWA 5HAQA 4DMZA 3W4PA 4U0XA 4JKTA 4JPMA 4S2NC 5FQIA 3T1QB 4P6BA 4GCZA 1XX2A 4IUHA 1P97A 4R4RA 5L10A 4DJ2A 4U3TA 3S7OA 3KSIA 4KZ6A 4I3JA 1Q2QA 3K3CA 1KGFA 5HD5A 1G6AA 4JBFA 2P04A 3MZEA 4G3WA 1OTBA 4GB7A 3ZQ5A 1HZOA 4HJ6A 2Y2NA 1K0KA 1MWUA 3ZGAB 1VETA 1BLHA 3NC8A 3QHYA 1OTDA 4K08A 5KIZA 2INWA 4E3MA 4DF6A 3BQ8A 1KDSA 2HP5A 2MJ6A 1DJAA 5E2FA 4OH0A 4KUOA 3MXQA 4ESPA 2C6WB 2WGWB 4RX3A 4NXGA 3GQZA 3RJUA 5FQJA 2OWHA 1K54C 3LUQA 1PFLA 2VV7A 3P09A 3CLOA 4EEPA 2J3TC 3O88A 4E6WA 4HP4A 5CGWA 3L7HA 3CZDA 4MEZA 3N6IA 1SDNA 4KG5A 4ZRRA 2XD1A 4P85A 1W5DA 4GHIB 4Z9QA 4E3LA 5HPIA 3Q81A 4KZ4A 2ZQ7A 4QU3A 4R3BA 4MN5A 2YKFA 1SKFA 1T18A 1G28A 5J7EA 1MXOA 5EV0A 2WAFA 2Y2LA 1LL9A 3A3EA 2XH9A 4LCMA 3PBOA 4JGRA 1I2SA 2ZMFA 3NJAA 2Y91A 4EESA 1LSXA 1LT0A 1OJGA 4JGPA 2HGVA 3D9YA 1JWPA 4EBNA 4GJ4A 3EQUA 2D01A 1FCNA 1D06A 5DKKA 3W8KA 5EVEA 4BQMA 4CQHA 4U0TA 5E2EA 2XR0A 1ZHHB 2Y2OA 3MJQA 1S1YA 5J3WA 4R3JA 2IWCA 1NRFA 3QP4A 2W1TB 4KG2A 4PM9A 1RGZA 1ONHA 2UWXA 4XUZA 1F5MA 3PAEA 3PBNA 4YFMA 1PWCA 4R4SA 5HL1A 3G2YA 3HLCA 1D7EA 2PBDP 3ZCZA 4JF4A 2AVXA 4ARZA 2ZL1A 2L1MA 3VP4A 1G68A 1XGJA 1PZPA 3UY6A 4M3KA 1CJFA 3R4KA 3PBTA 3PR6A 4MBKA 4BBTA 3VV4A 4UA7A 5F68A 1OTAA 2M7VA 1W63Q 1TDLA 2Y2KA 4C75A 1K6SA 3F1OA 4Q0IA 1V9YA 1MKIA 3TSGA 5EE8A 3JYIA 2BLSA 3FWLA 4S2PA 1IYOA 3B3XA 3E98A 4PAUA 5A90A 4K0WA 4IHQA 3UDXA 3NHQA 3KSGA 5DTKA 4BENA 3T4QA 3HUNA 4OP8A 1YKDA 3GV9A 3ZNTA 3UE0A 5FDSA 3LIDA 3UMEA 2J9OA 1EWZA 2ZQCA 5M1AA 3FPWA 3N4IA 3DTKA 3CITA 3GR2A 5HW3A 2BG1A 4WBGA 4ETXA 1I2WA 5KZHA 4LV0A 1BTLA 3MKFA 5FDHA 1LL8A 1L0GA 2Y4AA 1G5UA 2WKQA 4WELA 4NXEA 1L3LA 1J3WA 2OSUA 3SS5A 4NETA 1V9ZA 2WKHA 1YSQA 1TS7A 4JXWA 3BQAA 3JVVA 2B18A 3BLMA 4LV3A 3O87A 3VP1A 2V0UA 3W4QA 4OOYA 1FCMA 4HQAA 2Z2LB 3M2KA 4I39A 5F5YA 2V8FA 4WN5A 3RXXA 3HLBA 5KSCA 2OAQ1 5EVLA 3B33A 1FIKA 3UB5P 2V1BA 3ULFA 2ZQ8A 2PYRA 3ZNYA 2VGKA 2EX8A 5FI2A 5G4YA 1PYYA 4HJ4A 1JTDA 2WKEA 4S2KA 5FQKA 3EOIA 4Z1WA 3IHAA 1H8ZA 3SH7A 3G35A 4MNRA 3E4PA 3WS4A 4HNBA 1BYWA 2XA7M 2ZJ9A 5FI7A 3VSKA 4DDYA 2XQZA 1IYQA 1W79A 3OPPA 4H8RA 1PNEA 3RH8B 1DP6A 5I5LA 1H0MA 2ZLYA 1GSVA 2ZM0A 1OJ5A 1NYMA 3UNWA 3CUEC 4BLMA 3A3IA 4EEUA 3S7PA 3E4OA 3VOZA 5EM1A 3IBRA 2Y2HA 3IT9A 3PXPA 4JF5A 4R1GA 5CXWA 3VFFA 3B47A 1W8YA 4K91A 5TJJA 3CPTA 4XT2B 2EX6A 3D4FA 3LCEA 3NI9A 2PR5A 4E3NA 4YWZA 3PYPA 1JWVA 2X71A 2W0NA 1XA7A 4OONA 3V50A 1PZOA 1F98A 2B02A 4B4ZA 2VEAA 1BUEA 3R7WA 3NULA 2PT7A 3DTEA 1PIOA 2ZC6B 3FPVA 4N92A 2QJ7A 4G3VA 3OCNA 5HPFA 1LL5A 4Y3IA 1FILA 5K5BA 1JWZA 2PD8A 4GS9B 5G18A 2Q9MA 4IUKA 4IVKA 1EW0A 1XKZA 4QY6A 2FFYA 1XJ3A 2OLUA 4KQDA 5BOHA 2W3EA 2XFTA 1DP9A 5TBMB 5GLAA 3BFDA 3MZDA 5CTNA 4ZJ2A 4R38A 2O99A 1KDWA 4OQHA 2B95A 1OPXA 5EVID 3SW1A 5E2GA 3ZDJA 4LCLA 2XA7S 4B4XA 3HLGA 4JLFA 2H10A 2WKIA 1E3UA 4JXVA 1K57A 4DE2A 2CMNA 3NOPC 4RQ9A 3DWZA 4XXRA 3QP6A 3HJKA 1MZUA 5FAOA 1XJ6A 4FSFA 4GZBA 1S67L 4PM7A 3JVUA 3O5YA 4BJPA 1NRJA 4P87A 4E3JA 4BBVA 1L0FA 2WUQA 4OPZA 3S7QA 4X25A 3BW6A 3H82B 1ZKJA 1YLZA 2EFUA 4WMCD 4LRZE 2H0YA 4HBTA 2J7VA 1PI5A 3H7WA 1MPLA 2GZAA 4KUKA 3Q07A 2E8JA 1SKOB 1PW8A 3LGOA 3Q1FA 1LHYA 2JKTM 5D3OA 4BMWA 4DRTA 1VM1A 2ZC7A 3GRJA 3KSHA 2LB9A 4EWFA 3IXGA 2Y59A 1OMEA 5CEDA 1CQAA 2Y2IA 1YLPA 4BL2A 3CWFA 3A0VA 5MC7A 1UWNX 1Y54A 4GKUA 1WE4A 4MN6A 2UV0E 3DTIA 3T4TA 3OPLA 5GLCA 3M6HA 2DRWA 2WZZA 4X6TA 1VHMA 5F6AA 5G4ZA 4WL9A 1NWZA 5IU1A 4DKIA 3UB7A 1TF1A 5AJGA 5FATA 4PKYA 2J8YA 4HI4A 4PMAA 4UA9A 2KX6A 3F1NA 4KZBA 4LRYC 3K3DA 4LRXC 5FQ9A 5EFWA 2R9WA 4QY5A 4WZ5A 5DF7A 1RCJA 1A0KA 3UMDA 4KZ3A 3K2NA 3VE4A 2IWBA 1GSWA 4I3IA 5CGXA 1MWTA 1VETB 5CX7A 5F69A 3PTEA 2X01A 4DE1A 4LV1A 3SZTA 2Y2QA 1O07A 3T4LA 3OPRA 5CHJA 1N9OA 1T1BA 3HREA 4IJGA 1OTEA 1HTZA 3LFVA 1LSVA 1KVMA 5M19A 4WYYA 2P74A 4KQOA 3DAVA 2JKTI 2CC1A 3HLDA 1K56A 1M40A 4NXBA 3T50A 3PAGA 3U2AA 3E2LA 3RTYA 1N9LA 4OQIA 3C4OA 5JYOA 5CRFA 3EQVA 1ESUA 4UQIM 1T1CA 5GHYA 4FCFA 3DBAA 4X69A 5IHVA 5L8MA 4C3QA 2WZXA 1YSPA 1XA1A 2QPNA 5FQMA 1AWIA 3LR4A 3VE3A 3LY3A 3RFBA 3MQOA 3C38A 5E2HA 3G30A 2E8IA 2H28A 3BFEA 4WLAA 2KLIA 5F82A 3TG9A 4L9EA 2V20A 3BY9A 1K25A 1YLYA 3WS1A 4CPKA 4JXGA 3A0SA 1E25A 4K0XA 4DJ3A 2PRFA 4S2JA 5HL6A 3T1RA 3GDIA 1NY0A 1YPRA 2O9AA 1S1ZA 5EVIA 1GA0A 2Z6CA 4DE3A 3W2ZA 3S4XA 1ESIA 1MC0A 1YMXA 3C2WA 4GD6A 2IA2A 1H8MA 3P7NA 3F1PA 4E3IA 2Y2MA 1VEUA 5L07A 2QZ6A 5EUAA 4ARZB 2ZL1B 5CTMA 1CEFA 5KMWA 3BY8A 4HY8A 2XF3A 4I38A 3U4LP 2ZMVA 5HX9A 1SCWA 4UA6A 3LI9A 2KDKA 3ICYA 1QMEA 4GD8A 5CHMA 4OP5A 4UQIS 1HLUP 4A5RA 2XD5A 2JCHA 4WMCA 3F1OB 3VP0A 5HWWA 1VQQA 1NXYA 4ZTKA 4GN2A 4DXBA 2JC7A 2A2LA 4RA7A 1KVLA 4HIAA 2G2UA 2GDNA 4KZ5A 3OBFA 1PRQA 3T12B 2VGLM 2W1RA 3IS2A 1PWDA 1YQSA 3VP3A 2EWWA 2HDQA 3WRZA 3IQAA 3IH9A 4GDBA 4LENA 3T1XA 2L4RA 3O3VA 2O9CA 3E0YA 3S1YA 1U60A 2P9VA 5GHZA 5HWTA 4ME4A 1CI8A 2EWVA 2Z6DA 1K6RA 3EGXC 5FAPA 2ZD8A 5F83A 1DP8A 3OLOA 1MY8A 2VX8A 2WYXA 2PDRA 2WKPA 3L9KA 4NEED 4Y0OA 1YT4A 3FV7A 4WF0A 4OOMA 4P6ZM 1CK3A 3S22A 3V3RA 1K4EA 2KOIA 4DN0A 2DCFA 4IVIA 3EEAA 2Y55A 3G32A 2EA9A 3MS6A 5A92A 5HSQA 3ZG7B 2W27A 3KSFA 4B93A 4CLCD 3CG5A 4BD1A 4Q0JA 3DTMA 4KZ8A 4O0PA 2ZMAA 5TGFA 4WEKA 4M4XA 3AGDA 2Q0OA 1IKGA 4EQ1A 3MMHA 1X0OA 4DDSA 3N8RA 2ZOIA 3LO7A 3N7WA 4KENB 3CAXA 3G4PA 2Y2JA 4FUWA 1TS6A 3FKVA 3NY4A 4NKPA 4ZDXA 4WM9A 4E3OA 4HH2A 3O86A 3JPUA 1I5QA 3G6OA 4E6XA 2QWSA 1ES4A 3AGEA 4DXCA 1BLSA 3SH8A 3V67A 2WK0A 5DJUA 3CI6A 2JHEA 5JYPA 4FH4A 3BM6A 4OPRA 4X53A 4LLOB 3ZG9B 3GTCA 5FAQA 2V1ZA 2EX2A 1K57C 4PKYG 3T4KA 4P6ZS 3A3DA 2J3WA 3NOTC 1GHPA 3UPOA 3T4SA 4EERA 3TE8A 5J4EA 4KZ7A 3CPTB 4JGOA 2A3UA 2W3DA 5CHUA 4HEFA 3IH8A 1XFNA 3EGDC 1RP5A 4FTXA 2ZC4B 3LEZA 5FA7A 3C8CA 4E3KA 4UHUA 2WKRA 4MLLA 4DE0A 2JBFA 4UAAA 3R7WB 1UWPX 2A24A 4BL3A 1OT9A 5FASA 3BEBA 1XXMA 3MZFA 4G3KA 1TVFA 1DJCA 3BFGA 2FFFB 1Z6FA 4F3LA 2VV8A 3RXWA 3MQ0A 1STZA 4R23A 2PD7A 2OLVA 1GCEA 2QYBA 4E04A 2Y2PA 1EI5A 3QNCA 3VP2A 3BJNA 5AQ7A 3V39A 4KQQA 1WYBA 3UDIA 2BASA 3OC2A 1IYPA 3IHBA 3AGFA 3BLSA 3LIBA 3IXBA 1O7EA 1XPBA 3QP2A 4X1LA 4ZJ3A 1UGUA 3DW0A 3UB9A 2YKHA 2Q9NA 3OZHA 1PW1A 4L9FA 5FSRA 4KQRA 3NDGA 3IX4A 3UPNA 1QMFA 1TD5A 2V8CA 3ZFZA 2OOLA 1C3BA 4O01A 5I94A 3LEQA 4X56A 1YLWA 2Z2MB 4MBHA 3IWIA 4YOFA 3BFCA 3CMZA 1CEGA 4N9LA 1GHMA 2VLGA 1KGEA 2PBYA 1OT6A 3FYZA 2V9AA 3Q7VA 2J3TD 4WZ5C 4Y13A 4Y7PA 2ZQAA 1SDEA 4MDZA 3MR0A 1SZVA 4GOGA 4HESA 3H7WB 4P0MA 2HV1A 2K7SA 3SS3A 2HPBA 1DY6A 5FI6A 3IF6A 3VMAA 2K2NA 2A49A 5L09A 3UDFA 3IWQA 2XLNA 4MCWA 4QPRA 5F1GA 4EW7A 1RGYA 4HHDA 4R0QA 1YLJA 4OQ0A 4NK3A 3NDEA 1W8QA 5GL9A 2PU2A 5A93A 4OOLA 4N1XA 2XGNA 4H6JA 1ODVA 3LR5A 1E4DA 3ZG8B 3CHWP 3G31A 4PHTA 4IEDA 3T1SA 3UB8A 4PPRA 5GHXA 4R3AA 2K31A 2V2FF 2QHKA 4GLQA 3TOIA 2EX9A 4CLCA 4EQIA 5FEGA 2B5RA 2NUTC 2O0YA 2EXAA 1LI9A 3IBJA 4EBPA 3GMWA 3F1NB 4BWIA 4N9KA 3SS4A 4FOFA 3P98A 2Y8HA 4JXSA 4Y17A 1VB6A 4S2LA 3UN7A 5A8BA 2J80A 4HH3A 1XJ2A 1P0ZA 3QP8A 4L9GA 1K55A 1DJBA 1FSWA 1GA9A 3MXRA 1H5XA 2PHYA 3PHYA 1ES2A 3VSLA 3GVBA 3WS0A 1H8YA 2HF6A 5AVEA 3T4OA 5HDCA 2PR6A 1MKMA 4RX2A 5HAPA 2XROA 2VK3A 4BBUA 1S0WA 3UO9A 3QP5A 5EVIC 2M7UA 1L0EA 3C5AA 3WRTA 4EUZA 1FSYA 5FL3A 2RL3A 1L0DA 3DWKA 2HP6A 3I7JA 4Y15A 3HJIA 4S2IA 5DTTA 1S66L 5DF9A 2G2WA 2HJ9C 3D3OA 5GLBA 5GLDA 5J8XA 4I5SA 1IFQA 1BT5A 3ISGA 4QB8A 4LV2A 5IT5A 3LIFA 2JKRM 4S2OA 2XSSA 4Q8IA 2HDRA 3E4QA 1SHVA 1ZTUA 1NJ4A 2LB5A 1OTIA 2WGWA 4IBRA 4NG2A 1MWSA 4QWOA 5HARA 1NZOA 4ZBEA 2VA0A 5DFXA 2ZM2A 4QJGA 3NIAA 2P7JA 2FZ0A 5C5KA 2HDUA 3FKWA 2X02A 3MXSA 4S2NA 4D2OA 1FR1A 3N8SA 4PM5A 2OWJA 1LI0A 5HDSA 3NCKA 4GHIA 1CI9A 4QD4A 5DJTA 1FOFA 3LR3A 4EBLA 2W3HA 2QMIA 3C4PA 3UB6A 3EWKA 1KOUA 5EVIB 1PI4A 2I72A 5HD3A 4FD8A 4GDNA 4Q0HA 3KX0X 1ERQA 3N8LA 3F1PB 3B42A 2EFXA 1XGIA 3SH9A 1VEUB 3EEHA 5LBRA 3M2JA 3KYZA 2RCXA 3FC7A 2VKSA 2HDSA 3PBQA 3T4JA 3Q7ZA 3A0RA 2W3FA 4OLDA 2W1TA 3MF0A 3S7NA 3PBSA 1K54A 5AQBA 2H0TA 5HDDA 5IS1A 1IYSA 3P01A 3IX3A 3HVFA 5CGSA 3KYQA 1JVJA 5TR7A 1H3QA 1ERMA 3MFDA 1XJ4A 1E3UD 4HP9A 4ID4A 2JKRI 2G7UA 4EU0A 1L2SA 1TS8A 3LR0A 1XP4A 2EXBA 2WGVA 5U47A 3LYXA 2JE5A 3MQQA 4MN7A 2D02A 5HFOA 3BYDA 3IS2B 4WUJA 4CLCE 4Y2FA 1F2KA 2XK1A 4KZ9A 3HLFA 4YINA 4AFIA 1EROA 1NLYA 3FG8A 4RYEA 3WWXA 1KGGA 4JF6A 3W4OA 5M18A 2DMWA 5F1FA 4NXFA 5DFYA 3VFHA 4WEJA 4HJ3A 2P9VB 3MFXA 1HD8A 3HUMA 4X55A 1JNUA 3BECA 3VOYA 2OV5A 1IKIA 4EV4A 1YMSA 4MMNA 3BRMA 2I9VA 1MBLA 2R9XA 4O8GA 3G2ZA 1ACFA 2BTFP 2WGIA 2ZQ9A 3A3JA 4CJNA 4F94A 1LLBA 5TFQA 1BZAA 4KZAA 2QJ5A 3MBZA 3HL9A 1AXBA 3Q82A 3ITAA 5HAIA 3FZCA 3HLEA 1DRMA 1IELA 1TS0A 2JKGA 3ZYTA 1GHIA 2HZ5A 1Y4OA 2R78A 2GX5A 2Y2GA 4OVDA 3D72A 1NLZA 5EPHA 1FCOA 4II7A 3CJMA 3WS5A 4LPZA 4Y0TA 1S4RA 2VGLS 3GSGA 1BSGA 2V0WA 2FH5A 4C6YA 3IXDA 1N9BA 1CF0A 1Q2PA 5EOOA 4IBXA 3TW8A 1KE4A 1ONGA 1ZG4A 3SOIA 1GSXA 2XFSA 3IF5A 3GECA 4S2MA 1KE0A 5CECA 1W7FA 3E2KA 3LI8A 4OPYA 1NYYA 3LY4A 3HCYA 1MWRA 4B9OA 5DVAA 2QKPA 5AQ9A 2H5SA 1N9NA 1BLCA 3VOLA 5DKLA 1ZC2A 4OPQA 4FH2A 3UE3A 3HBRA 2O9BA 3IX8A 2VV6A 3BWLA 4X68A 3PBRA 1WA9A 1JTGA 2ZC3B 1T19A 2PAVP 1W63M 2A24B 3MSHA 1K56D 2ZBBA 2M1CA 3C7UA 2GNXA 1FQGA 3NBLA 2P08A 2JN7A 2ZQDA 3NOUC 4XT2A 4F3LB 5EM0A
chains in the Genus database with same CATH topology
5F82A 4PPRA 3TG9A 5GHXA 2V20A 1K25A 3GR2A 1YLYA 3WS1A 4CPKA 5L2FA 2V2FF 4JXGA 5HW3A 2BG1A 4WBGA 2C5WB 5KSHA 1I2WA 5KZHA 4LV0A 1BTLA 3TOIA 1E25A 2EX9A 4EQIA 3IF6C 3MKFA 4K0XA 5FDHA 2B5RA 1IEMA 1L0GA 3HUOA 4S2JA 2EXAA 2Y4AA 4OQGA 1NY0A 1LI9A 4WELA 3OPHA 1K4FA 2OSUA 4HBUA 3SS5A 3ZVWA 4EBPA 3GMWA 5EVIA 4NETA 4N9KA 3SS4A 1GA0A 4DE3A 3P98A 4RVAA 4JXSA 3ITBA 2WKHA 4QHCA 4JXWA 4S2LA 3UN7A 3ZVTA 4Y0UA 2VGJA 3S4XA 1ESIA 4PM6A 3BLMA 4LV3A 1BULA 3O87A 1YMXA 3OCLA 3VP1A 3IXHA 4GD6A 3W4QA 4OOYA 1FCMA 1K55A 4E3IA 1TDGA 2Z2LB 2Y2MA 3M2KA 5CEBA 1DJBA 1FSWA 1GA9A 3MXRA 3RXXA 1H5XA 5DTSA 3HLBA 5KSCA 1ES2A 3VSLA 1YM1A 2QZ6A 5EUAA 5EVLA 3GVBA 3MKEA 3WS0A 1PWGA 1H8YA 1S6RA 1YLTA 5CTMA 3C7VA 4RX2A 5HAPA 1CEFA 2ZQ8A 5KMWA 3ZNYA 2VGKA 1S0WA 2EX8A 5FI2A 3UO9A 2XF3A 1J9MA 1PYYA 5FQQA 5EVIC 5HX9A 1SCWA 4UA6A 1L0EA 1JTDA 3WS2A 2WKEA 3C5AA 4S2KA 5FQKA 3WRTA 1QMEA 3BFFA 4EUZA 4GD8A 4GNUA 5CHMA 3IHAA 1FSYA 4OP5A 1ES5A 2RL3A 1L0DA 3DWKA 2HP6A 3Q7VB 3I7JA 3G34A 1H8ZA 4S2IA 4A5RA 5EECA 3SH7A 2ZM8A 3G35A 4MNRA 1TEMA 5DTTA 2XD5A 2JCHA 3WS4A 1K55C 4WMCA 2ZJ9A 2G2WA 5DF9A 5FI7A 3VP0A 3VSKA 2XEPA 4DDYA 1KE3A 1VQQA 2XQZA 5GLBA 5GLDA 1NXYA 1IYQA 4GN2A 4ZTKA 5J8XA 1W79A 3OPPA 4DXBA 4H8RA 2JC7A 1FR6A 4RA7A 3ZG5A 1KVLA 1BT5A 2G2UA 2ZLYA 3ISGA 4QB8A 4LV2A 2GDNA 2HP9A 4KZ5A 2ZM0A 1NYMA 3IF6B 1K38A 3UNWA 4S2OA 4WZ4A 1PWDA 4Q8IA 2HDRA 4BLMA 3A3IA 1N4OA 1YQSA 1SHVA 3VP3A 1NJ4A 2HDQA 2WGWA 3M6BA 4IBRA 3WRZA 1MWSA 3V5MA 5HARA 3IQAA 3IH9A 3VOZA 4MBFA 1NZOA 2J9PA 3V3SA 4ZBEA 4GDBA 4LENA 3IT9A 1WYCA 2Y2HA 2ZM2A 4QJGA 3ZHHA 3QNBA 4JF5A 3NIAA 3O3VA 4R1GA 5CXWA 3VFFA 1HVBA 2XDMA 1BLPA 1W8YA 4K91A 3S1YA 1U60A 2P9VA 4L0LA 4OLGA 5GHZA 2HDUA 5A91A 3FKWA 2X02A 2EX6A 3D4FA 3LCEA 4OKPA 1ALQA 1CI8A 5EOEA 4ZAMA 2IWDA 3MXSA 3NI9A 4E3NA 4N1HA 4S2NA 4D2OA 1K6RA 1FR1A 3N8SA 4PM5A 1JWVA 2X71A 1XA7A 5FAPA 2ZD8A 5F83A 4OONA 1LI0A 3V50A 1PZOA 4ZJ1A 1MY8A 3NCKA 4O7DA 3UE1A 2WYXA 4B4ZA 1CI9A 4QD4A 4Y0OA 1YT4A 3FV7A 1BUEA 2WAEA 4OOMA 3A3FA 1CK3A 3S22A 5E43A 3V3RA 1FOFA 1K4EA 3UPPA 1PIOA 2ZC6B 1ZG6A 4EBLA 4N92A 1NZUA 2QMIA 3C4PA 2DCFA 4IVIA 1M6KA 3OCNA 4KG6A 4B88A 2DNSA 4XUXA 2PU4A 5EVIB 2Y55A 1LL5A 2WADA 3G32A 1PI4A 1JWZA 2I72A 2ZC5B 3ZG0A 4BD0A 1ES3A 4PM8A 5AQAA 3IWOA 5G18A 2Q9MA 5A92A 4FD8A 3HLWA 4IVKA 4GDNA 1XKZA 3ZG7B 4QY6A 5CERA 5DF8A 2FFYA 1ERQA 2OLUA 5HAQA 3CG5A 3N8LA 4BD1A 5BOHA 3W4PA 4U0XA 4JKTA 4JPMA 3DTMA 4KZ8A 4S2NC 2EFXA 1XGIA 2XFTA 5FQIA 3SH9A 5GLAA 3BFDA 2ZMAA 3MZDA 5CTNA 3M2JA 4P6BA 5TGFA 4ZJ2A 1XX2A 2RCXA 1KDWA 4OQHA 4WEKA 5EVID 4R4RA 3AGDA 2HDSA 5E2GA 3ZDJA 4U3TA 4LCLA 3PBQA 3Q7ZA 4B4XA 3HLGA 4KZ6A 1IKGA 4JLFA 1Q2QA 2H10A 1KGFA 2WKIA 1G6AA 4JBFA 4OLDA 3MZEA 1E3UA 4DDSA 4JXVA 3N8RA 1K57A 4DE2A 4GB7A 1HZOA 3PBSA 3LO7A 3N7WA 1K54A 5AQBA 4KENB 2H0TA 2Y2JA 3G4PA 2Y2NA 1MWUA 3DWZA 3ZGAB 1IYSA 4XXRA 3FKVA 1BLHA 3NC8A 3NY4A 3HVFA 4ZDXA 5CGSA 4WM9A 3QHYA 4E3OA 1JVJA 5TR7A 5FAOA 3O86A 1ERMA 1I5QA 3MFDA 4E6XA 1ES4A 3AGEA 4DXCA 1E3UD 1BLSA 4FSFA 4ID4A 4E3MA 4DF6A 3SH8A 4GZBA 2WK0A 1L2SA 4PM7A 1XP4A 2EXBA 1KDSA 2WGVA 4BJPA 5U47A 5JYPA 2HP5A 2JE5A 1DJAA 5E2FA 4P87A 4FH4A 4OH0A 5HFOA 4E3JA 3BYDA 1L0FA 3BM6A 2WUQA 4OPRA 4OPZA 4X53A 3ZG9B 2XK1A 3GTCA 5FAQA 4KZ9A 3HLFA 4YINA 1ZKJA 2C6WB 2WGWB 4RX3A 1EROA 1YLZA 2V1ZA 3GQZA 3RJUA 2EFUA 2EX2A 1K57C 4RYEA 3WWXA 5FQJA 4WMCD 1KGGA 4JF6A 2H0YA 4HBTA 3A3DA 1K54C 3W4OA 5M18A 2J7VA 1GHPA 1PI5A 5F1FA 1MPLA 3UPOA 3P09A 3VFHA 4KZ7A 4WEJA 2P9VB 3Q07A 3O88A 4E6WA 2A3UA 1PW8A 5CHUA 5CGWA 3CZDA 4MEZA 4HEFA 1HD8A 3HUMA 3IH8A 1LHYA 1SDNA 3N6IA 3Q1FA 4KG5A 5D3OA 4X55A 3BECA 4DRTA 3VOYA 1RP5A 2OV5A 1VM1A 2XD1A 1IKIA 4P85A 4EV4A 2ZC7A 1YMSA 1W5DA 2ZC4B 3GRJA 3LEZA 5FA7A 4EWFA 4Z9QA 4E3LA 4E3KA 3BRMA 4UHUA 1MBLA 2Y59A 3IXGA 3Q81A 1OMEA 4KZ4A 4MLLA 2JBFA 4DE0A 4UAAA 5CEDA 2R9XA 2ZQ7A 4QU3A 2Y2IA 4R3BA 1YLPA 3G2ZA 4BL2A 1SKFA 2WGIA 2ZQ9A 4BL3A 3A3JA 1MXOA 4CJNA 5FASA 2WAFA 2Y2LA 4F94A 1LLBA 1LL9A 3A3EA 2XH9A 3BEBA 5TFQA 1XXMA 1BZAA 3MZFA 3PBOA 4KZAA 4LCMA 1I2SA 1TVFA 3MBZA 1Y54A 1DJCA 1WE4A 2Y91A 3HL9A 4GKUA 3BFGA 1AXBA 2FFFB 1Z6FA 3OPLA 3RXWA 3Q82A 3ITAA 4R23A 5GLCA 3M6HA 5HAIA 2OLVA 3FZCA 2DRWA 1GCEA 1JWPA 2WZZA 3HLEA 4EBNA 4X6TA 3EQUA 2Y2PA 1IELA 1EI5A 3QNCA 3VP2A 1FCNA 5AQ7A 4DKIA 3V39A 5FATA 3W8KA 1GHIA 4BQMA 4KQQA 2J8YA 4PMAA 1WYBA 3UDIA 4U0TA 5E2EA 2XR0A 4UA9A 2Y2OA 3OC2A 1IYPA 3IHBA 4KZBA 2Y2GA 3AGFA 3BLSA 4OVDA 3IXBA 5EPHA 4R3JA 1O7EA 5FQ9A 1FCOA 2IWCA 1XPBA 1NRFA 4KG2A 3CJMA 2R9WA 4PM9A 4ZJ3A 3WS5A 4QY5A 1RGZA 3DW0A 4WZ5A 5DF7A 1ONHA 2UWXA 4XUZA 1RCJA 2Q9NA 3OZHA 1PW1A 4KZ3A 3PAEA 3PBNA 4Y0TA 2IWBA 5FSRA 4KQRA 4YFMA 1PWCA 3NDGA 5CGXA 4R4SA 3GSGA 3G2YA 5HL1A 1BSGA 3HLCA 1MWTA 3UPNA 1QMFA 3PTEA 3IXDA 4C6YA 1N9BA 3ZFZA 2X01A 3ZCZA 4JF4A 1C3BA 1Q2PA 5EOOA 4IBXA 4DE1A 3VP4A 1G68A 5I94A 1KE4A 1XGJA 1PZPA 3UY6A 4LV1A 4M3KA 1ONGA 2Y2QA 1O07A 4X56A 1YLWA 2Z2MB 4MBHA 1ZG4A 3IWIA 3OPRA 3SOIA 3BFCA 5CHJA 3PBTA 4MBKA 3CMZA 2XFSA 1CEGA 4N9LA 1GHMA 3HREA 1KGEA 4UA7A 3IF5A 2PBYA 4S2MA 1KE0A 3FYZA 5CECA 1HTZA 1W7FA 3E2KA 3Q7VA 4OPYA 4WZ5C 1NYYA 3LY4A 1KVMA 1TDLA 4Y7PA 5M19A 2Y2KA 4WYYA 2ZQAA 2P74A 1SDEA 4KQOA 1MWRA 5DVAA 4GOGA 1K6SA 4HESA 4C75A 5AQ9A 2H5SA 4P0MA 1MKIA 1BLCA 1ZC2A 4OPQA 4FH2A 2CC1A 3HLDA 3UE3A 1K56A 1M40A 3TSGA 3PAGA 5EE8A 3SS3A 2HPBA 3JYIA 1DY6A 2BLSA 5FI6A 3FWLA 3E2LA 3HBRA 4S2PA 1IYOA 3IF6A 4OQIA 3B3XA 3VMAA 5A90A 3C4OA 5JYOA 2A49A 4K0WA 5CRFA 3EQVA 3UDXA 3UDFA 3IWQA 5DTKA 1ESUA 4X68A 2XLNA 4BENA 3HUNA 3PBRA 1JTGA 2ZC3B 5F1GA 4FCFA 5GHYA 4X69A 4OP8A 5IHVA 1RGYA 4R0QA 1YLJA 4C3QA 4OQ0A 4NK3A 3GV9A 3NDEA 1K56D 1W8QA 5GL9A 3ZNTA 3UE0A 2WZXA 1XA1A 2PU2A 3C7UA 5A93A 2QPNA 4OOLA 5FQMA 1FQGA 3NBLA 4N1XA 2J9OA 2XGNA 1EWZA 2ZQDA 2ZQCA 5M1AA 3ZG8B 1E4DA 3LY3A 5E2HA 3G31A 3G30A 2E8IA 3N4IA 4IEDA 3BFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F82 A;  4PPR A;  3TG9 A;  5GHX A;  2V20 A;  1K25 A;  3GR2 A;  1YLY A;  3WS1 A;  4CPK A;  5L2F A;  2V2F F;  4JXG A;  5HW3 A;  2BG1 A;  4WBG A;  2C5W B;  5KSH A;  1I2W A;  5KZH A;  4LV0 A;  1BTL A;  3TOI A;  1E25 A;  2EX9 A;  4EQI A;  3IF6 C;  3MKF A;  4K0X A;  5FDH A;  2B5R A;  1IEM A;  1L0G A;  3HUO A;  4S2J A;  2EXA A;  2Y4A A;  4OQG A;  1NY0 A;  1LI9 A;  4WEL A;  3OPH A;  1K4F A;  2OSU A;  4HBU A;  3SS5 A;  3ZVW A;  4EBP A;  3GMW A;  5EVI A;  4NET A;  4N9K A;  3SS4 A;  1GA0 A;  4DE3 A;  3P98 A;  4RVA A;  4JXS A;  3ITB A;  2WKH A;  4QHC A;  4JXW A;  4S2L A;  3UN7 A;  3ZVT A;  4Y0U A;  2VGJ A;  3S4X A;  1ESI A;  4PM6 A;  3BLM A;  4LV3 A;  1BUL A;  3O87 A;  1YMX A;  3OCL A;  3VP1 A;  3IXH A;  4GD6 A;  3W4Q A;  4OOY A;  1FCM A;  1K55 A;  4E3I A;  1TDG A;  2Z2L B;  2Y2M A;  3M2K A;  5CEB A;  1DJB A;  1FSW A;  1GA9 A;  3MXR A;  3RXX A;  1H5X A;  5DTS A;  3HLB A;  5KSC A;  1ES2 A;  3VSL A;  1YM1 A;  2QZ6 A;  5EUA A;  5EVL A;  3GVB A;  3MKE A;  3WS0 A;  1PWG A;  1H8Y A;  1S6R A;  1YLT A;  5CTM A;  3C7V A;  4RX2 A;  5HAP A;  1CEF A;  2ZQ8 A;  5KMW A;  3ZNY A;  2VGK A;  1S0W A;  2EX8 A;  5FI2 A;  3UO9 A;  2XF3 A;  1J9M A;  1PYY A;  5FQQ A;  5EVI C;  5HX9 A;  1SCW A;  4UA6 A;  1L0E A;  1JTD A;  3WS2 A;  2WKE A;  3C5A A;  4S2K A;  5FQK A;  3WRT A;  1QME A;  3BFF A;  4EUZ A;  4GD8 A;  4GNU A;  5CHM A;  3IHA A;  1FSY A;  4OP5 A;  1ES5 A;  2RL3 A;  1L0D A;  3DWK A;  2HP6 A;  3Q7V B;  3I7J A;  3G34 A;  1H8Z A;  4S2I A;  4A5R A;  5EEC A;  3SH7 A;  2ZM8 A;  3G35 A;  4MNR A;  1TEM A;  5DTT A;  2XD5 A;  2JCH A;  3WS4 A;  1K55 C;  4WMC A;  2ZJ9 A;  2G2W A;  5DF9 A;  5FI7 A;  3VP0 A;  3VSK A;  2XEP A;  4DDY A;  1KE3 A;  1VQQ A;  2XQZ A;  5GLB A;  5GLD A;  1NXY A;  1IYQ A;  4GN2 A;  4ZTK A;  5J8X A;  1W79 A;  3OPP A;  4DXB A;  4H8R A;  2JC7 A;  1FR6 A;  4RA7 A;  3ZG5 A;  1KVL A;  1BT5 A;  2G2U A;  2ZLY A;  3ISG A;  4QB8 A;  4LV2 A;  2GDN A;  2HP9 A;  4KZ5 A;  2ZM0 A;  1NYM A;  3IF6 B;  1K38 A;  3UNW A;  4S2O A;  4WZ4 A;  1PWD A;  4Q8I A;  2HDR A;  4BLM A;  3A3I A;  1N4O A;  1YQS A;  1SHV A;  3VP3 A;  1NJ4 A;  2HDQ A;  2WGW A;  3M6B A;  4IBR A;  3WRZ A;  1MWS A;  3V5M A;  5HAR A;  3IQA A;  3IH9 A;  3VOZ A;  4MBF A;  1NZO A;  2J9P A;  3V3S A;  4ZBE A;  4GDB A;  4LEN A;  3IT9 A;  1WYC A;  2Y2H A;  2ZM2 A;  4QJG A;  3ZHH A;  3QNB A;  4JF5 A;  3NIA A;  3O3V A;  4R1G A;  5CXW A;  3VFF A;  1HVB A;  2XDM A;  1BLP A;  1W8Y A;  4K91 A;  3S1Y A;  1U60 A;  2P9V A;  4L0L A;  4OLG A;  5GHZ A;  2HDU A;  5A91 A;  3FKW A;  2X02 A;  2EX6 A;  3D4F A;  3LCE A;  4OKP A;  1ALQ A;  1CI8 A;  5EOE A;  4ZAM A;  2IWD A;  3MXS A;  3NI9 A;  4E3N A;  4N1H A;  4S2N A;  4D2O A;  1K6R A;  1FR1 A;  3N8S A;  4PM5 A;  1JWV A;  2X71 A;  1XA7 A;  5FAP A;  2ZD8 A;  5F83 A;  4OON A;  1LI0 A;  3V50 A;  1PZO A;  4ZJ1 A;  1MY8 A;  3NCK A;  4O7D A;  3UE1 A;  2WYX A;  4B4Z A;  1CI9 A;  4QD4 A;  4Y0O A;  1YT4 A;  3FV7 A;  1BUE A;  2WAE A;  4OOM A;  3A3F A;  1CK3 A;  3S22 A;  5E43 A;  3V3R A;  1FOF A;  1K4E A;  3UPP A;  1PIO A;  2ZC6 B;  1ZG6 A;  4EBL A;  4N92 A;  1NZU A;  2QMI A;  3C4P A;  2DCF A;  4IVI A;  1M6K A;  3OCN A;  4KG6 A;  4B88 A;  2DNS A;  4XUX A;  2PU4 A;  5EVI B;  2Y55 A;  1LL5 A;  2WAD A;  3G32 A;  1PI4 A;  1JWZ A;  2I72 A;  2ZC5 B;  3ZG0 A;  4BD0 A;  1ES3 A;  4PM8 A;  5AQA A;  3IWO A;  5G18 A;  2Q9M A;  5A92 A;  4FD8 A;  3HLW A;  4IVK A;  4GDN A;  1XKZ A;  3ZG7 B;  4QY6 A;  5CER A;  5DF8 A;  2FFY A;  1ERQ A;  2OLU A;  5HAQ A;  3CG5 A;  3N8L A;  4BD1 A;  5BOH A;  3W4P A;  4U0X A;  4JKT A;  4JPM A;  3DTM A;  4KZ8 A;  4S2N C;  2EFX A;  1XGI A;  2XFT A;  5FQI A;  3SH9 A;  5GLA A;  3BFD A;  2ZMA A;  3MZD A;  5CTN A;  3M2J A;  4P6B A;  5TGF A;  4ZJ2 A;  1XX2 A;  2RCX A;  1KDW A;  4OQH A;  4WEK A;  5EVI D;  4R4R A;  3AGD A;  2HDS A;  5E2G A;  3ZDJ A;  4U3T A;  4LCL A;  3PBQ A;  3Q7Z A;  4B4X A;  3HLG A;  4KZ6 A;  1IKG A;  4JLF A;  1Q2Q A;  2H10 A;  1KGF A;  2WKI A;  1G6A A;  4JBF A;  4OLD A;  3MZE A;  1E3U A;  4DDS A;  4JXV A;  3N8R A;  1K57 A;  4DE2 A;  4GB7 A;  1HZO A;  3PBS A;  3LO7 A;  3N7W A;  1K54 A;  5AQB A;  4KEN B;  2H0T A;  2Y2J A;  3G4P A;  2Y2N A;  1MWU A;  3DWZ A;  3ZGA B;  1IYS A;  4XXR A;  3FKV A;  1BLH A;  3NC8 A;  3NY4 A;  3HVF A;  4ZDX A;  5CGS A;  4WM9 A;  3QHY A;  4E3O A;  1JVJ A;  5TR7 A;  5FAO A;  3O86 A;  1ERM A;  1I5Q A;  3MFD A;  4E6X A;  1ES4 A;  3AGE A;  4DXC A;  1E3U D;  1BLS A;  4FSF A;  4ID4 A;  4E3M A;  4DF6 A;  3SH8 A;  4GZB A;  2WK0 A;  1L2S A;  4PM7 A;  1XP4 A;  2EXB A;  1KDS A;  2WGV A;  4BJP A;  5U47 A;  5JYP A;  2HP5 A;  2JE5 A;  1DJA A;  5E2F A;  4P87 A;  4FH4 A;  4OH0 A;  5HFO A;  4E3J A;  3BYD A;  1L0F A;  3BM6 A;  2WUQ A;  4OPR A;  4OPZ A;  4X53 A;  3ZG9 B;  2XK1 A;  3GTC A;  5FAQ A;  4KZ9 A;  3HLF A;  4YIN A;  1ZKJ A;  2C6W B;  2WGW B;  4RX3 A;  1ERO A;  1YLZ A;  2V1Z A;  3GQZ A;  3RJU A;  2EFU A;  2EX2 A;  1K57 C;  4RYE A;  3WWX A;  5FQJ A;  4WMC D;  1KGG A;  4JF6 A;  2H0Y A;  4HBT A;  3A3D A;  1K54 C;  3W4O A;  5M18 A;  2J7V A;  1GHP A;  1PI5 A;  5F1F A;  1MPL A;  3UPO A;  3P09 A;  3VFH A;  4KZ7 A;  4WEJ A;  2P9V B;  3Q07 A;  3O88 A;  4E6W A;  2A3U A;  1PW8 A;  5CHU A;  5CGW A;  3CZD A;  4MEZ A;  4HEF A;  1HD8 A;  3HUM A;  3IH8 A;  1LHY A;  1SDN A;  3N6I A;  3Q1F A;  4KG5 A;  5D3O A;  4X55 A;  3BEC A;  4DRT A;  3VOY A;  1RP5 A;  2OV5 A;  1VM1 A;  2XD1 A;  1IKI A;  4P85 A;  4EV4 A;  2ZC7 A;  1YMS A;  1W5D A;  2ZC4 B;  3GRJ A;  3LEZ A;  5FA7 A;  4EWF A;  4Z9Q A;  4E3L A;  4E3K A;  3BRM A;  4UHU A;  1MBL A;  2Y59 A;  3IXG A;  3Q81 A;  1OME A;  4KZ4 A;  4MLL A;  2JBF A;  4DE0 A;  4UAA A;  5CED A;  2R9X A;  2ZQ7 A;  4QU3 A;  2Y2I A;  4R3B A;  1YLP A;  3G2Z A;  4BL2 A;  1SKF A;  2WGI A;  2ZQ9 A;  4BL3 A;  3A3J A;  1MXO A;  4CJN A;  5FAS A;  2WAF A;  2Y2L A;  4F94 A;  1LLB A;  1LL9 A;  3A3E A;  2XH9 A;  3BEB A;  5TFQ A;  1XXM A;  1BZA A;  3MZF A;  3PBO A;  4KZA A;  4LCM A;  1I2S A;  1TVF A;  3MBZ A;  1Y54 A;  1DJC A;  1WE4 A;  2Y91 A;  3HL9 A;  4GKU A;  3BFG A;  1AXB A;  2FFF B;  1Z6F A;  3OPL A;  3RXW A;  3Q82 A;  3ITA A;  4R23 A;  5GLC A;  3M6H A;  5HAI A;  2OLV A;  3FZC A;  2DRW A;  1GCE A;  1JWP A;  2WZZ A;  3HLE A;  4EBN A;  4X6T A;  3EQU A;  2Y2P A;  1IEL A;  1EI5 A;  3QNC A;  3VP2 A;  1FCN A;  5AQ7 A;  4DKI A;  3V39 A;  5FAT A;  3W8K A;  1GHI A;  4BQM A;  4KQQ A;  2J8Y A;  4PMA A;  1WYB A;  3UDI A;  4U0T A;  5E2E A;  2XR0 A;  4UA9 A;  2Y2O A;  3OC2 A;  1IYP A;  3IHB A;  4KZB A;  2Y2G A;  3AGF A;  3BLS A;  4OVD A;  3IXB A;  5EPH A;  4R3J A;  1O7E A;  5FQ9 A;  1FCO A;  2IWC A;  1XPB A;  1NRF A;  4KG2 A;  3CJM A;  2R9W A;  4PM9 A;  4ZJ3 A;  3WS5 A;  4QY5 A;  1RGZ A;  3DW0 A;  4WZ5 A;  5DF7 A;  1ONH A;  2UWX A;  4XUZ A;  1RCJ A;  2Q9N A;  3OZH A;  1PW1 A;  4KZ3 A;  3PAE A;  3PBN A;  4Y0T A;  2IWB A;  5FSR A;  4KQR A;  4YFM A;  1PWC A;  3NDG A;  5CGX A;  4R4S A;  3GSG A;  3G2Y A;  5HL1 A;  1BSG A;  3HLC A;  1MWT A;  3UPN A;  1QMF A;  3PTE A;  3IXD A;  4C6Y A;  1N9B A;  3ZFZ A;  2X01 A;  3ZCZ A;  4JF4 A;  1C3B A;  1Q2P A;  5EOO A;  4IBX A;  4DE1 A;  3VP4 A;  1G68 A;  5I94 A;  1KE4 A;  1XGJ A;  1PZP A;  3UY6 A;  4LV1 A;  4M3K A;  1ONG A;  2Y2Q A;  1O07 A;  4X56 A;  1YLW A;  2Z2M B;  4MBH A;  1ZG4 A;  3IWI A;  3OPR A;  3SOI A;  3BFC A;  5CHJ A;  3PBT A;  4MBK A;  3CMZ A;  2XFS A;  1CEG A;  4N9L A;  1GHM A;  3HRE A;  1KGE A;  4UA7 A;  3IF5 A;  2PBY A;  4S2M A;  1KE0 A;  3FYZ A;  5CEC A;  1HTZ A;  1W7F A;  3E2K A;  3Q7V A;  4OPY A;  4WZ5 C;  1NYY A;  3LY4 A;  1KVM A;  1TDL A;  4Y7P A;  5M19 A;  2Y2K A;  4WYY A;  2ZQA A;  2P74 A;  1SDE A;  4KQO A;  1MWR A;  5DVA A;  4GOG A;  1K6S A;  4HES A;  4C75 A;  5AQ9 A;  2H5S A;  4P0M A;  1MKI A;  1BLC A;  1ZC2 A;  4OPQ A;  4FH2 A;  2CC1 A;  3HLD A;  3UE3 A;  1K56 A;  1M40 A;  3TSG A;  3PAG A;  5EE8 A;  3SS3 A;  2HPB A;  3JYI A;  1DY6 A;  2BLS A;  5FI6 A;  3FWL A;  3E2L A;  3HBR A;  4S2P A;  1IYO A;  3IF6 A;  4OQI A;  3B3X A;  3VMA A;  5A90 A;  3C4O A;  5JYO A;  2A49 A;  4K0W A;  5CRF A;  3EQV A;  3UDX A;  3UDF A;  3IWQ A;  5DTK A;  1ESU A;  4X68 A;  2XLN A;  4BEN A;  3HUN A;  3PBR A;  1JTG A;  2ZC3 B;  5F1G A;  4FCF A;  5GHY A;  4X69 A;  4OP8 A;  5IHV A;  1RGY A;  4R0Q A;  1YLJ A;  4C3Q A;  4OQ0 A;  4NK3 A;  3GV9 A;  3NDE A;  1K56 D;  1W8Q A;  5GL9 A;  3ZNT A;  3UE0 A;  2WZX A;  1XA1 A;  2PU2 A;  3C7U A;  5A93 A;  2QPN A;  4OOL A;  5FQM A;  1FQG A;  3NBL A;  4N1X A;  2J9O A;  2XGN A;  1EWZ A;  2ZQD A;  2ZQC A;  5M1A A;  3ZG8 B;  1E4D A;  3LY3 A;  5E2H A;  3G31 A;  3G30 A;  2E8I A;  3N4I A;  4IED A;  3BFE A; 
#chains in the Genus database with same CATH topology
 1D1J A;  4GW9 A;  5L2F A;  2HJE A;  5KSH A;  2C5W B;  5HZH A;  1Y28 A;  4I3A A;  3IF6 C;  3C30 A;  1IEM A;  3KO6 A;  3HUO A;  4OQG A;  3OPH A;  1K4F A;  4HBU A;  3ZVW A;  5AVF A;  4YNR A;  4RVA A;  3ITB A;  4QHC A;  4GS9 A;  1T1A A;  3ZVT A;  4Y0U A;  2VGJ A;  1P9R A;  4EUV A;  1LSW A;  4JGQ A;  2JKF A;  3LIC A;  4PM6 A;  3UE6 A;  1BUL A;  3OCL A;  4LFU A;  3IXH A;  4UEY A;  1TDG A;  2Y79 A;  2PYP A;  5CEB A;  5TBM A;  1XFQ A;  5DTS A;  3LIA A;  4EET B;  1YM1 A;  3MKE A;  1PWG A;  4CLC C;  3KYE A;  1S6R A;  3CUE A;  1YLT A;  3C7V A;  3LIE A;  3OOV A;  4ETZ A;  2VZW A;  1J9M A;  5FQQ A;  3H9W A;  3TJZ C;  3WS2 A;  3BFF A;  4GNU A;  4D60 A;  1ES5 A;  3TRC A;  3Q7V B;  4R6L A;  3G34 A;  1G6O A;  3NEC A;  1YAX A;  5EEC A;  2NUP C;  2ZM8 A;  1TEM A;  1Z09 A;  2ACG A;  1K55 C;  4R70 A;  2XEP A;  1KE3 A;  4LGW A;  1FR6 A;  3ZG5 A;  1S4S A;  2GJ3 A;  2HP9 A;  3IF6 B;  1K38 A;  4WZ4 A;  4EXO A;  1N4O A;  3H82 A;  3M6B A;  3V5M A;  4MBF A;  2J9P A;  3V3S A;  1F9I A;  1WYC A;  3ZHH A;  3QNB A;  2OAP 1;  4Y5F A;  1HVB A;  2XDM A;  1BLP A;  5FEF A;  4H6J B;  4L0L A;  4OLG A;  5A91 A;  4X1M A;  1P9W A;  1SKO A;  4OKP A;  1ALQ A;  5EOE A;  4ZAM A;  2IWD A;  4N1H A;  4HOI A;  2ZOH A;  4ZJ1 A;  3UE1 A;  4O7D A;  4CLC B;  2WAE A;  3A3F A;  5E43 A;  3UPP A;  1ZG6 A;  1NZU A;  1M6K A;  4KG6 A;  1IOU A;  4B88 A;  5HWV A;  2DNS A;  4XUX A;  2PU4 A;  2L0W A;  2WAD A;  2V1A A;  2ZC5 B;  3ZG0 A;  4BD0 A;  1ES3 A;  4PM8 A;  5AQA A;  3IWO A;  3QP1 A;  3HLW A;  5CER A;  2W3G A;  2XRN A;  5DF8 A;  2VJW A;  5HAQ A;  4DMZ A;  3W4P A;  4U0X A;  4JKT A;  4JPM A;  4S2N C;  5FQI A;  3T1Q B;  4P6B A;  4GCZ A;  1XX2 A;  4IUH A;  1P97 A;  4R4R A;  5L10 A;  4DJ2 A;  4U3T A;  3S7O A;  3KSI A;  4KZ6 A;  4I3J A;  1Q2Q A;  3K3C A;  1KGF A;  5HD5 A;  1G6A A;  4JBF A;  2P04 A;  3MZE A;  4G3W A;  1OTB A;  4GB7 A;  3ZQ5 A;  1HZO A;  4HJ6 A;  2Y2N A;  1K0K A;  1MWU A;  3ZGA B;  1VET A;  1BLH A;  3NC8 A;  3QHY A;  1OTD A;  4K08 A;  5KIZ A;  2INW A;  4E3M A;  4DF6 A;  3BQ8 A;  1KDS A;  2HP5 A;  2MJ6 A;  1DJA A;  5E2F A;  4OH0 A;  4KUO A;  3MXQ A;  4ESP A;  2C6W B;  2WGW B;  4RX3 A;  4NXG A;  3GQZ A;  3RJU A;  5FQJ A;  2OWH A;  1K54 C;  3LUQ A;  1PFL A;  2VV7 A;  3P09 A;  3CLO A;  4EEP A;  2J3T C;  3O88 A;  4E6W A;  4HP4 A;  5CGW A;  3L7H A;  3CZD A;  4MEZ A;  3N6I A;  1SDN A;  4KG5 A;  4ZRR A;  2XD1 A;  4P85 A;  1W5D A;  4GHI B;  4Z9Q A;  4E3L A;  5HPI A;  3Q81 A;  4KZ4 A;  2ZQ7 A;  4QU3 A;  4R3B A;  4MN5 A;  2YKF A;  1SKF A;  1T18 A;  1G28 A;  5J7E A;  1MXO A;  5EV0 A;  2WAF A;  2Y2L A;  1LL9 A;  3A3E A;  2XH9 A;  4LCM A;  3PBO A;  4JGR A;  1I2S A;  2ZMF A;  3NJA A;  2Y91 A;  4EES A;  1LSX A;  1LT0 A;  1OJG A;  4JGP A;  2HGV A;  3D9Y A;  1JWP A;  4EBN A;  4GJ4 A;  3EQU A;  2D01 A;  1FCN A;  1D06 A;  5DKK A;  3W8K A;  5EVE A;  4BQM A;  4CQH A;  4U0T A;  5E2E A;  2XR0 A;  1ZHH B;  2Y2O A;  3MJQ A;  1S1Y A;  5J3W A;  4R3J A;  2IWC A;  1NRF A;  3QP4 A;  2W1T B;  4KG2 A;  4PM9 A;  1RGZ A;  1ONH A;  2UWX A;  4XUZ A;  1F5M A;  3PAE A;  3PBN A;  4YFM A;  1PWC A;  4R4S A;  5HL1 A;  3G2Y A;  3HLC A;  1D7E A;  2PBD P;  3ZCZ A;  4JF4 A;  2AVX A;  4ARZ A;  2ZL1 A;  2L1M A;  3VP4 A;  1G68 A;  1XGJ A;  1PZP A;  3UY6 A;  4M3K A;  1CJF A;  3R4K A;  3PBT A;  3PR6 A;  4MBK A;  4BBT A;  3VV4 A;  4UA7 A;  5F68 A;  1OTA A;  2M7V A;  1W63 Q;  1TDL A;  2Y2K A;  4C75 A;  1K6S A;  3F1O A;  4Q0I A;  1V9Y A;  1MKI A;  3TSG A;  5EE8 A;  3JYI A;  2BLS A;  3FWL A;  4S2P A;  1IYO A;  3B3X A;  3E98 A;  4PAU A;  5A90 A;  4K0W A;  4IHQ A;  3UDX A;  3NHQ A;  3KSG A;  5DTK A;  4BEN A;  3T4Q A;  3HUN A;  4OP8 A;  1YKD A;  3GV9 A;  3ZNT A;  3UE0 A;  5FDS A;  3LID A;  3UME A;  2J9O A;  1EWZ A;  2ZQC A;  5M1A A;  3FPW A;  3N4I A;  3DTK A;  3CIT A;  3GR2 A;  5HW3 A;  2BG1 A;  4WBG A;  4ETX A;  1I2W A;  5KZH A;  4LV0 A;  1BTL A;  3MKF A;  5FDH A;  1LL8 A;  1L0G A;  2Y4A A;  1G5U A;  2WKQ A;  4WEL A;  4NXE A;  1L3L A;  1J3W A;  2OSU A;  3SS5 A;  4NET A;  1V9Z A;  2WKH A;  1YSQ A;  1TS7 A;  4JXW A;  3BQA A;  3JVV A;  2B18 A;  3BLM A;  4LV3 A;  3O87 A;  3VP1 A;  2V0U A;  3W4Q A;  4OOY A;  1FCM A;  4HQA A;  2Z2L B;  3M2K A;  4I39 A;  5F5Y A;  2V8F A;  4WN5 A;  3RXX A;  3HLB A;  5KSC A;  2OAQ 1;  5EVL A;  3B33 A;  1FIK A;  3UB5 P;  2V1B A;  3ULF A;  2ZQ8 A;  2PYR A;  3ZNY A;  2VGK A;  2EX8 A;  5FI2 A;  5G4Y A;  1PYY A;  4HJ4 A;  1JTD A;  2WKE A;  4S2K A;  5FQK A;  3EOI A;  4Z1W A;  3IHA A;  1H8Z A;  3SH7 A;  3G35 A;  4MNR A;  3E4P A;  3WS4 A;  4HNB A;  1BYW A;  2XA7 M;  2ZJ9 A;  5FI7 A;  3VSK A;  4DDY A;  2XQZ A;  1IYQ A;  1W79 A;  3OPP A;  4H8R A;  1PNE A;  3RH8 B;  1DP6 A;  5I5L A;  1H0M A;  2ZLY A;  1GSV A;  2ZM0 A;  1OJ5 A;  1NYM A;  3UNW A;  3CUE C;  4BLM A;  3A3I A;  4EEU A;  3S7P A;  3E4O A;  3VOZ A;  5EM1 A;  3IBR A;  2Y2H A;  3IT9 A;  3PXP A;  4JF5 A;  4R1G A;  5CXW A;  3VFF A;  3B47 A;  1W8Y A;  4K91 A;  5TJJ A;  3CPT A;  4XT2 B;  2EX6 A;  3D4F A;  3LCE A;  3NI9 A;  2PR5 A;  4E3N A;  4YWZ A;  3PYP A;  1JWV A;  2X71 A;  2W0N A;  1XA7 A;  4OON A;  3V50 A;  1PZO A;  1F98 A;  2B02 A;  4B4Z A;  2VEA A;  1BUE A;  3R7W A;  3NUL A;  2PT7 A;  3DTE A;  1PIO A;  2ZC6 B;  3FPV A;  4N92 A;  2QJ7 A;  4G3V A;  3OCN A;  5HPF A;  1LL5 A;  4Y3I A;  1FIL A;  5K5B A;  1JWZ A;  2PD8 A;  4GS9 B;  5G18 A;  2Q9M A;  4IUK A;  4IVK A;  1EW0 A;  1XKZ A;  4QY6 A;  2FFY A;  1XJ3 A;  2OLU A;  4KQD A;  5BOH A;  2W3E A;  2XFT A;  1DP9 A;  5TBM B;  5GLA A;  3BFD A;  3MZD A;  5CTN A;  4ZJ2 A;  4R38 A;  2O99 A;  1KDW A;  4OQH A;  2B95 A;  1OPX A;  5EVI D;  3SW1 A;  5E2G A;  3ZDJ A;  4LCL A;  2XA7 S;  4B4X A;  3HLG A;  4JLF A;  2H10 A;  2WKI A;  1E3U A;  4JXV A;  1K57 A;  4DE2 A;  2CMN A;  3NOP C;  4RQ9 A;  3DWZ A;  4XXR A;  3QP6 A;  3HJK A;  1MZU A;  5FAO A;  1XJ6 A;  4FSF A;  4GZB A;  1S67 L;  4PM7 A;  3JVU A;  3O5Y A;  4BJP A;  1NRJ A;  4P87 A;  4E3J A;  4BBV A;  1L0F A;  2WUQ A;  4OPZ A;  3S7Q A;  4X25 A;  3BW6 A;  3H82 B;  1ZKJ A;  1YLZ A;  2EFU A;  4WMC D;  4LRZ E;  2H0Y A;  4HBT A;  2J7V A;  1PI5 A;  3H7W A;  1MPL A;  2GZA A;  4KUK A;  3Q07 A;  2E8J A;  1SKO B;  1PW8 A;  3LGO A;  3Q1F A;  1LHY A;  2JKT M;  5D3O A;  4BMW A;  4DRT A;  1VM1 A;  2ZC7 A;  3GRJ A;  3KSH A;  2LB9 A;  4EWF A;  3IXG A;  2Y59 A;  1OME A;  5CED A;  1CQA A;  2Y2I A;  1YLP A;  4BL2 A;  3CWF A;  3A0V A;  5MC7 A;  1UWN X;  1Y54 A;  4GKU A;  1WE4 A;  4MN6 A;  2UV0 E;  3DTI A;  3T4T A;  3OPL A;  5GLC A;  3M6H A;  2DRW A;  2WZZ A;  4X6T A;  1VHM A;  5F6A A;  5G4Z A;  4WL9 A;  1NWZ A;  5IU1 A;  4DKI A;  3UB7 A;  1TF1 A;  5AJG A;  5FAT A;  4PKY A;  2J8Y A;  4HI4 A;  4PMA A;  4UA9 A;  2KX6 A;  3F1N A;  4KZB A;  4LRY C;  3K3D A;  4LRX C;  5FQ9 A;  5EFW A;  2R9W A;  4QY5 A;  4WZ5 A;  5DF7 A;  1RCJ A;  1A0K A;  3UMD A;  4KZ3 A;  3K2N A;  3VE4 A;  2IWB A;  1GSW A;  4I3I A;  5CGX A;  1MWT A;  1VET B;  5CX7 A;  5F69 A;  3PTE A;  2X01 A;  4DE1 A;  4LV1 A;  3SZT A;  2Y2Q A;  1O07 A;  3T4L A;  3OPR A;  5CHJ A;  1N9O A;  1T1B A;  3HRE A;  4IJG A;  1OTE A;  1HTZ A;  3LFV A;  1LSV A;  1KVM A;  5M19 A;  4WYY A;  2P74 A;  4KQO A;  3DAV A;  2JKT I;  2CC1 A;  3HLD A;  1K56 A;  1M40 A;  4NXB A;  3T50 A;  3PAG A;  3U2A A;  3E2L A;  3RTY A;  1N9L A;  4OQI A;  3C4O A;  5JYO A;  5CRF A;  3EQV A;  1ESU A;  4UQI M;  1T1C A;  5GHY A;  4FCF A;  3DBA A;  4X69 A;  5IHV A;  5L8M A;  4C3Q A;  2WZX A;  1YSP A;  1XA1 A;  2QPN A;  5FQM A;  1AWI A;  3LR4 A;  3VE3 A;  3LY3 A;  3RFB A;  3MQO A;  3C38 A;  5E2H A;  3G30 A;  2E8I A;  2H28 A;  3BFE A;  4WLA A;  2KLI A;  5F82 A;  3TG9 A;  4L9E A;  2V20 A;  3BY9 A;  1K25 A;  1YLY A;  3WS1 A;  4CPK A;  4JXG A;  3A0S A;  1E25 A;  4K0X A;  4DJ3 A;  2PRF A;  4S2J A;  5HL6 A;  3T1R A;  3GDI A;  1NY0 A;  1YPR A;  2O9A A;  1S1Z A;  5EVI A;  1GA0 A;  2Z6C A;  4DE3 A;  3W2Z A;  3S4X A;  1ESI A;  1MC0 A;  1YMX A;  3C2W A;  4GD6 A;  2IA2 A;  1H8M A;  3P7N A;  3F1P A;  4E3I A;  2Y2M A;  1VEU A;  5L07 A;  2QZ6 A;  5EUA A;  4ARZ B;  2ZL1 B;  5CTM A;  1CEF A;  5KMW A;  3BY8 A;  4HY8 A;  2XF3 A;  4I38 A;  3U4L P;  2ZMV A;  5HX9 A;  1SCW A;  4UA6 A;  3LI9 A;  2KDK A;  3ICY A;  1QME A;  4GD8 A;  5CHM A;  4OP5 A;  4UQI S;  1HLU P;  4A5R A;  2XD5 A;  2JCH A;  4WMC A;  3F1O B;  3VP0 A;  5HWW A;  1VQQ A;  1NXY A;  4ZTK A;  4GN2 A;  4DXB A;  2JC7 A;  2A2L A;  4RA7 A;  1KVL A;  4HIA A;  2G2U A;  2GDN A;  4KZ5 A;  3OBF A;  1PRQ A;  3T12 B;  2VGL M;  2W1R A;  3IS2 A;  1PWD A;  1YQS A;  3VP3 A;  2EWW A;  2HDQ A;  3WRZ A;  3IQA A;  3IH9 A;  4GDB A;  4LEN A;  3T1X A;  2L4R A;  3O3V A;  2O9C A;  3E0Y A;  3S1Y A;  1U60 A;  2P9V A;  5GHZ A;  5HWT A;  4ME4 A;  1CI8 A;  2EWV A;  2Z6D A;  1K6R A;  3EGX C;  5FAP A;  2ZD8 A;  5F83 A;  1DP8 A;  3OLO A;  1MY8 A;  2VX8 A;  2WYX A;  2PDR A;  2WKP A;  3L9K A;  4NEE D;  4Y0O A;  1YT4 A;  3FV7 A;  4WF0 A;  4OOM A;  4P6Z M;  1CK3 A;  3S22 A;  3V3R A;  1K4E A;  2KOI A;  4DN0 A;  2DCF A;  4IVI A;  3EEA A;  2Y55 A;  3G32 A;  2EA9 A;  3MS6 A;  5A92 A;  5HSQ A;  3ZG7 B;  2W27 A;  3KSF A;  4B93 A;  4CLC D;  3CG5 A;  4BD1 A;  4Q0J A;  3DTM A;  4KZ8 A;  4O0P A;  2ZMA A;  5TGF A;  4WEK A;  4M4X A;  3AGD A;  2Q0O A;  1IKG A;  4EQ1 A;  3MMH A;  1X0O A;  4DDS A;  3N8R A;  2ZOI A;  3LO7 A;  3N7W A;  4KEN B;  3CAX A;  3G4P A;  2Y2J A;  4FUW A;  1TS6 A;  3FKV A;  3NY4 A;  4NKP A;  4ZDX A;  4WM9 A;  4E3O A;  4HH2 A;  3O86 A;  3JPU A;  1I5Q A;  3G6O A;  4E6X A;  2QWS A;  1ES4 A;  3AGE A;  4DXC A;  1BLS A;  3SH8 A;  3V67 A;  2WK0 A;  5DJU A;  3CI6 A;  2JHE A;  5JYP A;  4FH4 A;  3BM6 A;  4OPR A;  4X53 A;  4LLO B;  3ZG9 B;  3GTC A;  5FAQ A;  2V1Z A;  2EX2 A;  1K57 C;  4PKY G;  3T4K A;  4P6Z S;  3A3D A;  2J3W A;  3NOT C;  1GHP A;  3UPO A;  3T4S A;  4EER A;  3TE8 A;  5J4E A;  4KZ7 A;  3CPT B;  4JGO A;  2A3U A;  2W3D A;  5CHU A;  4HEF A;  3IH8 A;  1XFN A;  3EGD C;  1RP5 A;  4FTX A;  2ZC4 B;  3LEZ A;  5FA7 A;  3C8C A;  4E3K A;  4UHU A;  2WKR A;  4MLL A;  4DE0 A;  2JBF A;  4UAA A;  3R7W B;  1UWP X;  2A24 A;  4BL3 A;  1OT9 A;  5FAS A;  3BEB A;  1XXM A;  3MZF A;  4G3K A;  1TVF A;  1DJC A;  3BFG A;  2FFF B;  1Z6F A;  4F3L A;  2VV8 A;  3RXW A;  3MQ0 A;  1STZ A;  4R23 A;  2PD7 A;  2OLV A;  1GCE A;  2QYB A;  4E04 A;  2Y2P A;  1EI5 A;  3QNC A;  3VP2 A;  3BJN A;  5AQ7 A;  3V39 A;  4KQQ A;  1WYB A;  3UDI A;  2BAS A;  3OC2 A;  1IYP A;  3IHB A;  3AGF A;  3BLS A;  3LIB A;  3IXB A;  1O7E A;  1XPB A;  3QP2 A;  4X1L A;  4ZJ3 A;  1UGU A;  3DW0 A;  3UB9 A;  2YKH A;  2Q9N A;  3OZH A;  1PW1 A;  4L9F A;  5FSR A;  4KQR A;  3NDG A;  3IX4 A;  3UPN A;  1QMF A;  1TD5 A;  2V8C A;  3ZFZ A;  2OOL A;  1C3B A;  4O01 A;  5I94 A;  3LEQ A;  4X56 A;  1YLW A;  2Z2M B;  4MBH A;  3IWI A;  4YOF A;  3BFC A;  3CMZ A;  1CEG A;  4N9L A;  1GHM A;  2VLG A;  1KGE A;  2PBY A;  1OT6 A;  3FYZ A;  2V9A A;  3Q7V A;  2J3T D;  4WZ5 C;  4Y13 A;  4Y7P A;  2ZQA A;  1SDE A;  4MDZ A;  3MR0 A;  1SZV A;  4GOG A;  4HES A;  3H7W B;  4P0M A;  2HV1 A;  2K7S A;  3SS3 A;  2HPB A;  1DY6 A;  5FI6 A;  3IF6 A;  3VMA A;  2K2N A;  2A49 A;  5L09 A;  3UDF A;  3IWQ A;  2XLN A;  4MCW A;  4QPR A;  5F1G A;  4EW7 A;  1RGY A;  4HHD A;  4R0Q A;  1YLJ A;  4OQ0 A;  4NK3 A;  3NDE A;  1W8Q A;  5GL9 A;  2PU2 A;  5A93 A;  4OOL A;  4N1X A;  2XGN A;  4H6J A;  1ODV A;  3LR5 A;  1E4D A;  3ZG8 B;  3CHW P;  3G31 A;  4PHT A;  4IED A;  3T1S A;  3UB8 A;  4PPR A;  5GHX A;  4R3A A;  2K31 A;  2V2F F;  2QHK A;  4GLQ A;  3TOI A;  2EX9 A;  4CLC A;  4EQI A;  5FEG A;  2B5R A;  2NUT C;  2O0Y A;  2EXA A;  1LI9 A;  3IBJ A;  4EBP A;  3GMW A;  3F1N B;  4BWI A;  4N9K A;  3SS4 A;  4FOF A;  3P98 A;  2Y8H A;  4JXS A;  4Y17 A;  1VB6 A;  4S2L A;  3UN7 A;  5A8B A;  2J80 A;  4HH3 A;  1XJ2 A;  1P0Z A;  3QP8 A;  4L9G A;  1K55 A;  1DJB A;  1FSW A;  1GA9 A;  3MXR A;  1H5X A;  2PHY A;  3PHY A;  1ES2 A;  3VSL A;  3GVB A;  3WS0 A;  1H8Y A;  2HF6 A;  5AVE A;  3T4O A;  5HDC A;  2PR6 A;  1MKM A;  4RX2 A;  5HAP A;  2XRO A;  2VK3 A;  4BBU A;  1S0W A;  3UO9 A;  3QP5 A;  5EVI C;  2M7U A;  1L0E A;  3C5A A;  3WRT A;  4EUZ A;  1FSY A;  5FL3 A;  2RL3 A;  1L0D A;  3DWK A;  2HP6 A;  3I7J A;  4Y15 A;  3HJI A;  4S2I A;  5DTT A;  1S66 L;  5DF9 A;  2G2W A;  2HJ9 C;  3D3O A;  5GLB A;  5GLD A;  5J8X A;  4I5S A;  1IFQ A;  1BT5 A;  3ISG A;  4QB8 A;  4LV2 A;  5IT5 A;  3LIF A;  2JKR M;  4S2O A;  2XSS A;  4Q8I A;  2HDR A;  3E4Q A;  1SHV A;  1ZTU A;  1NJ4 A;  2LB5 A;  1OTI A;  2WGW A;  4IBR A;  4NG2 A;  1MWS A;  4QWO A;  5HAR A;  1NZO A;  4ZBE A;  2VA0 A;  5DFX A;  2ZM2 A;  4QJG A;  3NIA A;  2P7J A;  2FZ0 A;  5C5K A;  2HDU A;  3FKW A;  2X02 A;  3MXS A;  4S2N A;  4D2O A;  1FR1 A;  3N8S A;  4PM5 A;  2OWJ A;  1LI0 A;  5HDS A;  3NCK A;  4GHI A;  1CI9 A;  4QD4 A;  5DJT A;  1FOF A;  3LR3 A;  4EBL A;  2W3H A;  2QMI A;  3C4P A;  3UB6 A;  3EWK A;  1KOU A;  5EVI B;  1PI4 A;  2I72 A;  5HD3 A;  4FD8 A;  4GDN A;  4Q0H A;  3KX0 X;  1ERQ A;  3N8L A;  3F1P B;  3B42 A;  2EFX A;  1XGI A;  3SH9 A;  1VEU B;  3EEH A;  5LBR A;  3M2J A;  3KYZ A;  2RCX A;  3FC7 A;  2VKS A;  2HDS A;  3PBQ A;  3T4J A;  3Q7Z A;  3A0R A;  2W3F A;  4OLD A;  2W1T A;  3MF0 A;  3S7N A;  3PBS A;  1K54 A;  5AQB A;  2H0T A;  5HDD A;  5IS1 A;  1IYS A;  3P01 A;  3IX3 A;  3HVF A;  5CGS A;  3KYQ A;  1JVJ A;  5TR7 A;  1H3Q A;  1ERM A;  3MFD A;  1XJ4 A;  1E3U D;  4HP9 A;  4ID4 A;  2JKR I;  2G7U A;  4EU0 A;  1L2S A;  1TS8 A;  3LR0 A;  1XP4 A;  2EXB A;  2WGV A;  5U47 A;  3LYX A;  2JE5 A;  3MQQ A;  4MN7 A;  2D02 A;  5HFO A;  3BYD A;  3IS2 B;  4WUJ A;  4CLC E;  4Y2F A;  1F2K A;  2XK1 A;  4KZ9 A;  3HLF A;  4YIN A;  4AFI A;  1ERO A;  1NLY A;  3FG8 A;  4RYE A;  3WWX A;  1KGG A;  4JF6 A;  3W4O A;  5M18 A;  2DMW A;  5F1F A;  4NXF A;  5DFY A;  3VFH A;  4WEJ A;  4HJ3 A;  2P9V B;  3MFX A;  1HD8 A;  3HUM A;  4X55 A;  1JNU A;  3BEC A;  3VOY A;  2OV5 A;  1IKI A;  4EV4 A;  1YMS A;  4MMN A;  3BRM A;  2I9V A;  1MBL A;  2R9X A;  4O8G A;  3G2Z A;  1ACF A;  2BTF P;  2WGI A;  2ZQ9 A;  3A3J A;  4CJN A;  4F94 A;  1LLB A;  5TFQ A;  1BZA A;  4KZA A;  2QJ5 A;  3MBZ A;  3HL9 A;  1AXB A;  3Q82 A;  3ITA A;  5HAI A;  3FZC A;  3HLE A;  1DRM A;  1IEL A;  1TS0 A;  2JKG A;  3ZYT A;  1GHI A;  2HZ5 A;  1Y4O A;  2R78 A;  2GX5 A;  2Y2G A;  4OVD A;  3D72 A;  1NLZ A;  5EPH A;  1FCO A;  4II7 A;  3CJM A;  3WS5 A;  4LPZ A;  4Y0T A;  1S4R A;  2VGL S;  3GSG A;  1BSG A;  2V0W A;  2FH5 A;  4C6Y A;  3IXD A;  1N9B A;  1CF0 A;  1Q2P A;  5EOO A;  4IBX A;  3TW8 A;  1KE4 A;  1ONG A;  1ZG4 A;  3SOI A;  1GSX A;  2XFS A;  3IF5 A;  3GEC A;  4S2M A;  1KE0 A;  5CEC A;  1W7F A;  3E2K A;  3LI8 A;  4OPY A;  1NYY A;  3LY4 A;  3HCY A;  1MWR A;  4B9O A;  5DVA A;  2QKP A;  5AQ9 A;  2H5S A;  1N9N A;  1BLC A;  3VOL A;  5DKL A;  1ZC2 A;  4OPQ A;  4FH2 A;  3UE3 A;  3HBR A;  2O9B A;  3IX8 A;  2VV6 A;  3BWL A;  4X68 A;  3PBR A;  1WA9 A;  1JTG A;  2ZC3 B;  1T19 A;  2PAV P;  1W63 M;  2A24 B;  3MSH A;  1K56 D;  2ZBB A;  2M1C A;  3C7U A;  2GNX A;  1FQG A;  3NBL A;  2P08 A;  2JN7 A;  2ZQD A;  3NOU C;  4XT2 A;  4F3L B;  5EM0 A; 
#chains in the Genus database with same CATH homology
 5F82 A;  4PPR A;  3TG9 A;  5GHX A;  2V20 A;  1K25 A;  3GR2 A;  1YLY A;  3WS1 A;  4CPK A;  5L2F A;  2V2F F;  4JXG A;  5HW3 A;  2BG1 A;  4WBG A;  2C5W B;  5KSH A;  1I2W A;  5KZH A;  4LV0 A;  1BTL A;  3TOI A;  1E25 A;  2EX9 A;  4EQI A;  3IF6 C;  3MKF A;  4K0X A;  5FDH A;  2B5R A;  1IEM A;  1L0G A;  3HUO A;  4S2J A;  2EXA A;  2Y4A A;  4OQG A;  1NY0 A;  1LI9 A;  4WEL A;  3OPH A;  1K4F A;  2OSU A;  4HBU A;  3SS5 A;  3ZVW A;  4EBP A;  3GMW A;  5EVI A;  4NET A;  4N9K A;  3SS4 A;  1GA0 A;  4DE3 A;  3P98 A;  4RVA A;  4JXS A;  3ITB A;  2WKH A;  4QHC A;  4JXW A;  4S2L A;  3UN7 A;  3ZVT A;  4Y0U A;  2VGJ A;  3S4X A;  1ESI A;  4PM6 A;  3BLM A;  4LV3 A;  1BUL A;  3O87 A;  1YMX A;  3OCL A;  3VP1 A;  3IXH A;  4GD6 A;  3W4Q A;  4OOY A;  1FCM A;  1K55 A;  4E3I A;  1TDG A;  2Z2L B;  2Y2M A;  3M2K A;  5CEB A;  1DJB A;  1FSW A;  1GA9 A;  3MXR A;  3RXX A;  1H5X A;  5DTS A;  3HLB A;  5KSC A;  1ES2 A;  3VSL A;  1YM1 A;  2QZ6 A;  5EUA A;  5EVL A;  3GVB A;  3MKE A;  3WS0 A;  1PWG A;  1H8Y A;  1S6R A;  1YLT A;  5CTM A;  3C7V A;  4RX2 A;  5HAP A;  1CEF A;  2ZQ8 A;  5KMW A;  3ZNY A;  2VGK A;  1S0W A;  2EX8 A;  5FI2 A;  3UO9 A;  2XF3 A;  1J9M A;  1PYY A;  5FQQ A;  5EVI C;  5HX9 A;  1SCW A;  4UA6 A;  1L0E A;  1JTD A;  3WS2 A;  2WKE A;  3C5A A;  4S2K A;  5FQK A;  3WRT A;  1QME A;  3BFF A;  4EUZ A;  4GD8 A;  4GNU A;  5CHM A;  3IHA A;  1FSY A;  4OP5 A;  1ES5 A;  2RL3 A;  1L0D A;  3DWK A;  2HP6 A;  3Q7V B;  3I7J A;  3G34 A;  1H8Z A;  4S2I A;  4A5R A;  5EEC A;  3SH7 A;  2ZM8 A;  3G35 A;  4MNR A;  1TEM A;  5DTT A;  2XD5 A;  2JCH A;  3WS4 A;  1K55 C;  4WMC A;  2ZJ9 A;  2G2W A;  5DF9 A;  5FI7 A;  3VP0 A;  3VSK A;  2XEP A;  4DDY A;  1KE3 A;  1VQQ A;  2XQZ A;  5GLB A;  5GLD A;  1NXY A;  1IYQ A;  4GN2 A;  4ZTK A;  5J8X A;  1W79 A;  3OPP A;  4DXB A;  4H8R A;  2JC7 A;  1FR6 A;  4RA7 A;  3ZG5 A;  1KVL A;  1BT5 A;  2G2U A;  2ZLY A;  3ISG A;  4QB8 A;  4LV2 A;  2GDN A;  2HP9 A;  4KZ5 A;  2ZM0 A;  1NYM A;  3IF6 B;  1K38 A;  3UNW A;  4S2O A;  4WZ4 A;  1PWD A;  4Q8I A;  2HDR A;  4BLM A;  3A3I A;  1N4O A;  1YQS A;  1SHV A;  3VP3 A;  1NJ4 A;  2HDQ A;  2WGW A;  3M6B A;  4IBR A;  3WRZ A;  1MWS A;  3V5M A;  5HAR A;  3IQA A;  3IH9 A;  3VOZ A;  4MBF A;  1NZO A;  2J9P A;  3V3S A;  4ZBE A;  4GDB A;  4LEN A;  3IT9 A;  1WYC A;  2Y2H A;  2ZM2 A;  4QJG A;  3ZHH A;  3QNB A;  4JF5 A;  3NIA A;  3O3V A;  4R1G A;  5CXW A;  3VFF A;  1HVB A;  2XDM A;  1BLP A;  1W8Y A;  4K91 A;  3S1Y A;  1U60 A;  2P9V A;  4L0L A;  4OLG A;  5GHZ A;  2HDU A;  5A91 A;  3FKW A;  2X02 A;  2EX6 A;  3D4F A;  3LCE A;  4OKP A;  1ALQ A;  1CI8 A;  5EOE A;  4ZAM A;  2IWD A;  3MXS A;  3NI9 A;  4E3N A;  4N1H A;  4S2N A;  4D2O A;  1K6R A;  1FR1 A;  3N8S A;  4PM5 A;  1JWV A;  2X71 A;  1XA7 A;  5FAP A;  2ZD8 A;  5F83 A;  4OON A;  1LI0 A;  3V50 A;  1PZO A;  4ZJ1 A;  1MY8 A;  3NCK A;  4O7D A;  3UE1 A;  2WYX A;  4B4Z A;  1CI9 A;  4QD4 A;  4Y0O A;  1YT4 A;  3FV7 A;  1BUE A;  2WAE A;  4OOM A;  3A3F A;  1CK3 A;  3S22 A;  5E43 A;  3V3R A;  1FOF A;  1K4E A;  3UPP A;  1PIO A;  2ZC6 B;  1ZG6 A;  4EBL A;  4N92 A;  1NZU A;  2QMI A;  3C4P A;  2DCF A;  4IVI A;  1M6K A;  3OCN A;  4KG6 A;  4B88 A;  2DNS A;  4XUX A;  2PU4 A;  5EVI B;  2Y55 A;  1LL5 A;  2WAD A;  3G32 A;  1PI4 A;  1JWZ A;  2I72 A;  2ZC5 B;  3ZG0 A;  4BD0 A;  1ES3 A;  4PM8 A;  5AQA A;  3IWO A;  5G18 A;  2Q9M A;  5A92 A;  4FD8 A;  3HLW A;  4IVK A;  4GDN A;  1XKZ A;  3ZG7 B;  4QY6 A;  5CER A;  5DF8 A;  2FFY A;  1ERQ A;  2OLU A;  5HAQ A;  3CG5 A;  3N8L A;  4BD1 A;  5BOH A;  3W4P A;  4U0X A;  4JKT A;  4JPM A;  3DTM A;  4KZ8 A;  4S2N C;  2EFX A;  1XGI A;  2XFT A;  5FQI A;  3SH9 A;  5GLA A;  3BFD A;  2ZMA A;  3MZD A;  5CTN A;  3M2J A;  4P6B A;  5TGF A;  4ZJ2 A;  1XX2 A;  2RCX A;  1KDW A;  4OQH A;  4WEK A;  5EVI D;  4R4R A;  3AGD A;  2HDS A;  5E2G A;  3ZDJ A;  4U3T A;  4LCL A;  3PBQ A;  3Q7Z A;  4B4X A;  3HLG A;  4KZ6 A;  1IKG A;  4JLF A;  1Q2Q A;  2H10 A;  1KGF A;  2WKI A;  1G6A A;  4JBF A;  4OLD A;  3MZE A;  1E3U A;  4DDS A;  4JXV A;  3N8R A;  1K57 A;  4DE2 A;  4GB7 A;  1HZO A;  3PBS A;  3LO7 A;  3N7W A;  1K54 A;  5AQB A;  4KEN B;  2H0T A;  2Y2J A;  3G4P A;  2Y2N A;  1MWU A;  3DWZ A;  3ZGA B;  1IYS A;  4XXR A;  3FKV A;  1BLH A;  3NC8 A;  3NY4 A;  3HVF A;  4ZDX A;  5CGS A;  4WM9 A;  3QHY A;  4E3O A;  1JVJ A;  5TR7 A;  5FAO A;  3O86 A;  1ERM A;  1I5Q A;  3MFD A;  4E6X A;  1ES4 A;  3AGE A;  4DXC A;  1E3U D;  1BLS A;  4FSF A;  4ID4 A;  4E3M A;  4DF6 A;  3SH8 A;  4GZB A;  2WK0 A;  1L2S A;  4PM7 A;  1XP4 A;  2EXB A;  1KDS A;  2WGV A;  4BJP A;  5U47 A;  5JYP A;  2HP5 A;  2JE5 A;  1DJA A;  5E2F A;  4P87 A;  4FH4 A;  4OH0 A;  5HFO A;  4E3J A;  3BYD A;  1L0F A;  3BM6 A;  2WUQ A;  4OPR A;  4OPZ A;  4X53 A;  3ZG9 B;  2XK1 A;  3GTC A;  5FAQ A;  4KZ9 A;  3HLF A;  4YIN A;  1ZKJ A;  2C6W B;  2WGW B;  4RX3 A;  1ERO A;  1YLZ A;  2V1Z A;  3GQZ A;  3RJU A;  2EFU A;  2EX2 A;  1K57 C;  4RYE A;  3WWX A;  5FQJ A;  4WMC D;  1KGG A;  4JF6 A;  2H0Y A;  4HBT A;  3A3D A;  1K54 C;  3W4O A;  5M18 A;  2J7V A;  1GHP A;  1PI5 A;  5F1F A;  1MPL A;  3UPO A;  3P09 A;  3VFH A;  4KZ7 A;  4WEJ A;  2P9V B;  3Q07 A;  3O88 A;  4E6W A;  2A3U A;  1PW8 A;  5CHU A;  5CGW A;  3CZD A;  4MEZ A;  4HEF A;  1HD8 A;  3HUM A;  3IH8 A;  1LHY A;  1SDN A;  3N6I A;  3Q1F A;  4KG5 A;  5D3O A;  4X55 A;  3BEC A;  4DRT A;  3VOY A;  1RP5 A;  2OV5 A;  1VM1 A;  2XD1 A;  1IKI A;  4P85 A;  4EV4 A;  2ZC7 A;  1YMS A;  1W5D A;  2ZC4 B;  3GRJ A;  3LEZ A;  5FA7 A;  4EWF A;  4Z9Q A;  4E3L A;  4E3K A;  3BRM A;  4UHU A;  1MBL A;  2Y59 A;  3IXG A;  3Q81 A;  1OME A;  4KZ4 A;  4MLL A;  2JBF A;  4DE0 A;  4UAA A;  5CED A;  2R9X A;  2ZQ7 A;  4QU3 A;  2Y2I A;  4R3B A;  1YLP A;  3G2Z A;  4BL2 A;  1SKF A;  2WGI A;  2ZQ9 A;  4BL3 A;  3A3J A;  1MXO A;  4CJN A;  5FAS A;  2WAF A;  2Y2L A;  4F94 A;  1LLB A;  1LL9 A;  3A3E A;  2XH9 A;  3BEB A;  5TFQ A;  1XXM A;  1BZA A;  3MZF A;  3PBO A;  4KZA A;  4LCM A;  1I2S A;  1TVF A;  3MBZ A;  1Y54 A;  1DJC A;  1WE4 A;  2Y91 A;  3HL9 A;  4GKU A;  3BFG A;  1AXB A;  2FFF B;  1Z6F A;  3OPL A;  3RXW A;  3Q82 A;  3ITA A;  4R23 A;  5GLC A;  3M6H A;  5HAI A;  2OLV A;  3FZC A;  2DRW A;  1GCE A;  1JWP A;  2WZZ A;  3HLE A;  4EBN A;  4X6T A;  3EQU A;  2Y2P A;  1IEL A;  1EI5 A;  3QNC A;  3VP2 A;  1FCN A;  5AQ7 A;  4DKI A;  3V39 A;  5FAT A;  3W8K A;  1GHI A;  4BQM A;  4KQQ A;  2J8Y A;  4PMA A;  1WYB A;  3UDI A;  4U0T A;  5E2E A;  2XR0 A;  4UA9 A;  2Y2O A;  3OC2 A;  1IYP A;  3IHB A;  4KZB A;  2Y2G A;  3AGF A;  3BLS A;  4OVD A;  3IXB A;  5EPH A;  4R3J A;  1O7E A;  5FQ9 A;  1FCO A;  2IWC A;  1XPB A;  1NRF A;  4KG2 A;  3CJM A;  2R9W A;  4PM9 A;  4ZJ3 A;  3WS5 A;  4QY5 A;  1RGZ A;  3DW0 A;  4WZ5 A;  5DF7 A;  1ONH A;  2UWX A;  4XUZ A;  1RCJ A;  2Q9N A;  3OZH A;  1PW1 A;  4KZ3 A;  3PAE A;  3PBN A;  4Y0T A;  2IWB A;  5FSR A;  4KQR A;  4YFM A;  1PWC A;  3NDG A;  5CGX A;  4R4S A;  3GSG A;  3G2Y A;  5HL1 A;  1BSG A;  3HLC A;  1MWT A;  3UPN A;  1QMF A;  3PTE A;  3IXD A;  4C6Y A;  1N9B A;  3ZFZ A;  2X01 A;  3ZCZ A;  4JF4 A;  1C3B A;  1Q2P A;  5EOO A;  4IBX A;  4DE1 A;  3VP4 A;  1G68 A;  5I94 A;  1KE4 A;  1XGJ A;  1PZP A;  3UY6 A;  4LV1 A;  4M3K A;  1ONG A;  2Y2Q A;  1O07 A;  4X56 A;  1YLW A;  2Z2M B;  4MBH A;  1ZG4 A;  3IWI A;  3OPR A;  3SOI A;  3BFC A;  5CHJ A;  3PBT A;  4MBK A;  3CMZ A;  2XFS A;  1CEG A;  4N9L A;  1GHM A;  3HRE A;  1KGE A;  4UA7 A;  3IF5 A;  2PBY A;  4S2M A;  1KE0 A;  3FYZ A;  5CEC A;  1HTZ A;  1W7F A;  3E2K A;  3Q7V A;  4OPY A;  4WZ5 C;  1NYY A;  3LY4 A;  1KVM A;  1TDL A;  4Y7P A;  5M19 A;  2Y2K A;  4WYY A;  2ZQA A;  2P74 A;  1SDE A;  4KQO A;  1MWR A;  5DVA A;  4GOG A;  1K6S A;  4HES A;  4C75 A;  5AQ9 A;  2H5S A;  4P0M A;  1MKI A;  1BLC A;  1ZC2 A;  4OPQ A;  4FH2 A;  2CC1 A;  3HLD A;  3UE3 A;  1K56 A;  1M40 A;  3TSG A;  3PAG A;  5EE8 A;  3SS3 A;  2HPB A;  3JYI A;  1DY6 A;  2BLS A;  5FI6 A;  3FWL A;  3E2L A;  3HBR A;  4S2P A;  1IYO A;  3IF6 A;  4OQI A;  3B3X A;  3VMA A;  5A90 A;  3C4O A;  5JYO A;  2A49 A;  4K0W A;  5CRF A;  3EQV A;  3UDX A;  3UDF A;  3IWQ A;  5DTK A;  1ESU A;  4X68 A;  2XLN A;  4BEN A;  3HUN A;  3PBR A;  1JTG A;  2ZC3 B;  5F1G A;  4FCF A;  5GHY A;  4X69 A;  4OP8 A;  5IHV A;  1RGY A;  4R0Q A;  1YLJ A;  4C3Q A;  4OQ0 A;  4NK3 A;  3GV9 A;  3NDE A;  1K56 D;  1W8Q A;  5GL9 A;  3ZNT A;  3UE0 A;  2WZX A;  1XA1 A;  2PU2 A;  3C7U A;  5A93 A;  2QPN A;  4OOL A;  5FQM A;  1FQG A;  3NBL A;  4N1X A;  2J9O A;  2XGN A;  1EWZ A;  2ZQD A;  2ZQC A;  5M1A A;  3ZG8 B;  1E4D A;  3LY3 A;  5E2H A;  3G31 A;  3G30 A;  2E8I A;  3N4I A;  4IED A;  3BFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...