5FQQA

Last common ancestor of gram-negative bacteria (gnca4) beta-lactamase class a
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
262
structure length
262
Chain Sequence
AALSEQLAELEKRSGGRLGVAVLDTATGRRFGYRGDERFPMCSTFKALLAAAVLARVDQGKENLDRRITYGKEDLVDYSPVTEKHVGDGMTVAELCEAAITYSDNTAANLLLEALGGPAALTAFLRSIGDNVTRLDRWEPELNTAAPGDPRDTTTPAAMAATLRTLLLGDVLSPASRQQLVDWLIANKTGDKRLRAGLPADWRVGDKTGTGEHGTTNDIAVIWPPNRAPILVAVYLTESQVDADARDAVIAEVARLVVAAFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GNCA4 LACTAMASE
publication title De novo active sites for resurrected Precambrian enzymes.
pubmed doi rcsb
source organism Synthetic construct
total genus 95
structure length 262
sequence length 262
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5fqqA00
1ZG6A 1S6RA 2ZC7A 2ZMAA 3IWQA 2Q9MA 1LLBA 5KMWA 4HESA 4RA7A 3C7VA 1LHYA 1N9BA 4RVAA 5AQ9A 4LV2A 1XGJA 3IHBA 3W8KA 4E3IA 2ZJ9A 3N6IA 3WS1A 4DE2A 4S2NC 3HREA 3QNCA 5GL9A 1E25A 1FCOA 5CECA 3HBRA 2Y2QA 1ONHA 3PBSA 4KZ3A 1ES3A 2EXAA 3BYDA 3IF6A 4PM9A 1MWUA 4OP8A 2Y2PA 3QNBA 1K56D 1SDEA 3MXSA 3PBOA 4FH2A 5CERA 1L0GA 1PWCA 3P98A 2ZQDA 3G34A 4U3TA 4LCLA 3VP2A 5FQQA 1BLSA 1YMSA 1ONGA 4BENA 3O87A 3EQUA 4JBFA 3GV9A 4ZAMA 2OV5A 4MLLA 1H5XA 5EECA 1MY8A 3LY3A 4RX2A 4E3KA 5EOEA 5CGSA 1ZG4A 2C5WB 4R23A 3A3DA 2OLUA 1IYPA 1EROA 5HW3A 5E43A 2Y55A 2A49A 1NXYA 1TDGA 5HL1A 1GHPA 2P74A 4DF6A 1JTGA 2R9WA 1BTLA 3RJUA 2WKHA 3C4PA 1HTZA 4JF4A 4OH0A 3IXDA 2ZQ8A 3IH9A 1FR1A 1CEGA 2ZC5B 5GLDA 4N9LA 5DF7A 4EBPA 1YM1A 1GA9A 3M2JA 5L2FA 3OPRA 5F1GA 1NYMA 3ZG9B 5HFOA 3N7WA 3WS4A 2R9XA 1KE3A 1LI9A 5AQAA 2ZQ9A 5E2FA 1K6RA 5HAIA 2IWBA 3OZHA 4C75A 3NBLA 5IHVA 2H10A 4U0XA 4E6WA 5HAPA 4JPMA 3N8RA 2X02A 3OPLA 4JKTA 5FAQA 5HARA 2WZXA 3FKWA 4P87A 4KG2A 5EOOA 1K4FA 2Y2GA 3PBRA 2G2WA 1K57A 3UPPA 4OLDA 2VGKA 3W4QA 1FCMA 1L0DA 3VSLA 4DDYA 2FFFB 1BSGA 4FH4A 1MWTA 5EPHA 2WADA 1CI8A 3BFFA 3VP3A 3Q1FA 1QMEA 2Y2NA 2OSUA 3NY4A 4OQ0A 3LO7A 5EE8A 3HUNA 4EV4A 2B5RA 2Y2KA 4GN2A 2DCFA 3ZG7B 3ZFZA 1U60A 1PIOA 4S2OA 5CGWA 1KGFA 4DE1A 1KE4A 2OLVA 2WKEA 2XEPA 4UA6A 4B88A 3ZNYA 2X01A 3UNWA 1Q2PA 4QU3A 4MBFA 3IXHA 5F1FA 1K6SA 5F83A 2QZ6A 2ZC3B 4MNRA 3GTCA 3UE1A 2JC7A 3BRMA 3AGDA 4JLFA 5I94A 2JBFA 2HDQA 5EVLA 4IVIA 3V3RA 1WYBA 4S2NA 5FAPA 1K56A 2ZQCA 3G31A 4X6TA 1VQQA 1YLZA 2Y2MA 3A3FA 2RL3A 5E2GA 3V3SA 3N8LA 3NCKA 4S2KA 1PI5A 1K54A 3MZFA 4OQHA 2EX2A 2XK1A 4X69A 4ZJ2A 3SS4A 4CJNA 1O7EA 4ZTKA 3MFDA 4NK3A 2XD1A 3GVBA 1WYCA 4Y0OA 2HDRA 3Q7ZA 1L2SA 3PBTA 3DTMA 3S1YA 1K55C 4IVKA 4GD8A 1JVJA 3BFCA 2XGNA 3UDIA 1O07A 2Y4AA 3MZDA 3GR2A 4OONA 1XA1A 5GHZA 1ERMA 3HUMA 1G6AA 4WMCD 1TEMA 4KZ8A 3DWKA 3SH7A 3BFDA 3B3XA 3D4FA 4QHCA 5U47A 5GHXA 3G4PA 4QJGA 4Q8IA 3Q81A 1QMFA 1ZC2A 3MXRA 2A3UA 4PPRA 3QHYA 1GCEA 3IWIA 5AQBA 1BUEA 3HL9A 1KGEA 2WYXA 4X68A 4S2IA 4XUZA 1FSYA 4N1HA 3UE3A 3ZCZA 3SOIA 3UN7A 2Y59A 4OPZA 1MWSA 1Y54A 4QY6A 1TDLA 4U0TA 1IYOA 1SDNA 4MEZA 4JXWA 4OPYA 4O7DA 3Q07A 3TG9A 4LV1A 4R4SA 1FOFA 1JWZA 3G35A 2JCHA 5F82A 1PWGA 4E3JA 1ALQA 3IXBA 3ZVTA 1IKIA 1S0WA 1YMXA 1XX2A 2EX6A 4UA9A 5FAOA 3C5AA 3IH8A 3MBZA 4JF5A 1IYQA 4OLGA 5EUAA 1DJAA 1Z6FA 2ZM8A 4WYYA 1CEFA 5FDHA 3BFEA 3V50A 2V2FF 5DTTA 5DF9A 4R4RA 3ZG5A 3IT9A 1AXBA 3OCNA 4GNUA 5FQKA 3N4IA 1YLYA 3S4XA 1FSWA 3SH9A 3G30A 2ZM0A 3ZNTA 4E3LA 4E3OA 1IEMA 3DWZA 4IEDA 2EXBA 3Q82A 1YQSA 3FKVA 1ES2A 2XH9A 4OOYA 5M18A 3WS5A 2XFSA 4P6BA 2WUQA 3UDFA 3VMAA 5CHMA 2XF3A 4OOMA 3HLCA 3AGEA 4LV3A 4EBNA 1C3BA 5CEDA 5FA7A 3E2KA 3O86A 4YFMA 2WGVA 1IKGA 4K0WA 4UAAA 4E6XA 4EUZA 4ID4A 1ES5A 5HAQA 4FSFA 1ES4A 5E2EA 4KZ4A 3UY6A 3OPHA 3VFFA 1W7FA 2DNSA 1VM1A 3FV7A 3CMZA 5CTNA 1GA0A 2XLNA 2Q9NA 3N8SA 3IF6C 2E8IA 2ZC4B 2Y2JA 3Q7VA 3VFHA 3SS3A 3BECA 4KENB 1HVBA 1GHMA 2PBYA 4RX3A 3HLBA 3MKFA 2J7VA 4A5RA 4N9KA 4BL3A 5DVAA 5FASA 4WMCA 3PTEA 4HBTA 2WAFA 4KQRA 3UO9A 1BT5A 4R0QA 3W4PA 4NETA 4OPRA 2BLSA 3ZG8B 3ZG0A 3PBQA 2XD5A 1H8YA 4X55A 1EI5A 1K25A 2XDMA 3FYZA 4MBHA 5DF8A 5FATA 3ZVWA 4CPKA 4P85A 5CEBA 1SHVA 4YINA 3WWXA 5A92A 2HPBA 3G2YA 5CHJA 5CXWA 5M19A 1FQGA 4DDSA 5GHYA 4DXBA 3Q7VB 3BFGA 5FQMA 4Y7PA 1PYYA 1PZPA 4JXGA 1M6KA 1BULA 3IWOA 3E2LA 3O88A 4R3JA 1KDWA 3ITAA 4KZ5A 1ESUA 1XA7A 3NDGA 2EFUA 3HLEA 4OOLA 3WS2A 5M1AA 5KSCA 3G32A 3LEZA 2ZQ7A 4C3QA 4KZ7A 5TGFA 3M6BA 4PM7A 1W8YA 3SS5A 4QD4A 4P0MA 4B4ZA 5FQ9A 3UPOA 2EX9A 4GB7A 3GSGA 4KZ6A 1PW8A 4BL2A 4R3BA 1MWRA 1SKFA 4DE3A 2C6WB 3NC8A 5BOHA 1Q2QA 1YLPA 3WRZA 4K91A 5FSRA 1H8ZA 1WE4A 3S22A 4OKPA 1W79A 4Y0TA 3IF5A 1PW1A 3NDEA 4DE0A 1CK3A 4KZAA 1NZUA 4WEKA 5FQJA 3BLSA 2DRWA 2H0YA 2ZM2A 4OPQA 4IBRA 1LI0A 2Y2OA 5EVIC 4PM6A 1J9MA 3VSKA 5JYPA 5FQIA 2Z2MB 3HLFA 4X56A 4ZBEA 2IWCA 4IBXA 4DXCA 5J8XA 2J9OA 4S2PA 2Y91A 4GZBA 4LENA 3WS0A 5EVID 1XGIA 2H0TA 3CG5A 1W8QA 1LL9A 5G18A 3VP1A 4GDBA 1ERQA 2WZZA 3A3EA 2V20A 4GD6A 2I72A 2ZLYA 3NIAA 4LCMA 1SCWA 2PU4A 2UWXA 3A3IA 1RP5A 5CTMA 4BLMA 3JYIA 5GLCA 2XR0A 4R1GA 1XPBA 1PWDA 5AQ7A 3FWLA 1K54C 4BD1A 3M6HA 2EFXA 2Y2LA 2ZQAA 4OP5A 1K4EA 3TSGA 4ZDXA 3PAEA 3UDXA 3AGFA 1BLHA 4GOGA 2P9VA 1E3UD 4S2MA 5DTSA 4BJPA 4GKUA 3LCEA 4X53A 4WZ5C 2QMIA 1I2WA 5A90A 4HBUA 1PI4A 1IELA 4HEFA 1JWPA 1N4OA 5D3OA 1L0FA 3BLMA 1KDSA 2HDUA 4KZ9A 1KVLA 3HLWA 2FFYA 3OPPA 3P09A 4D2OA 1MKIA 3DW0A 3ITBA 3IF6B 3V5MA 1MBLA 1DJCA 4S2JA 5FI6A 4JXSA 4KQQA 3CJMA 3MZEA 2IWDA 4BD0A 5KSHA 5TR7A 1NRFA 3EQVA 1KE0A 4Z9QA 2QPNA 1BZAA 4XUXA 4OQIA 2P9VB 4L0LA 2HDSA 2Y2HA 3UE0A 3VOYA 3W4OA 3ZDJA 4E3MA 2XQZA 4PM8A 5TFQA 3ZHHA 5FI7A 1XP4A 4KG5A 4BQMA 5HX9A 2WAEA 1RGYA 3OCLA 4OQGA 4OVDA 2J8YA 4WBGA 3SH8A 4QY5A 3HLDA 2Y2IA 2HP6A 1NJ4A 1YLJA 1TVFA 5CHUA 3UPNA 4MBKA 4DRTA 3HLGA 1K55A 5JYOA 1YLTA 2XFTA 2WK0A 4WZ4A 1BLPA 5CRFA 4EBLA 1RGZA 1MPLA 4JXVA 4FCFA 4M3KA 3VP0A 5E2HA 2EX8A 1EWZA 4EWFA 1I5QA 1BLCA 4RYEA 4PM5A 3PBNA 3CZDA 3FZCA 3LY4A 3RXXA 1CI9A 2PU2A 3HVFA 3WRTA 1I2SA 3GQZA 3O3VA 4PMAA 1YT4A 1MXOA 1G68A 1NZOA 2Z2LB 3BM6A 3RXWA 2V1ZA 4DKIA 4GDNA 2WKIA 1NY0A 4KZBA 4S2LA 4E3NA 1NYYA 4N92A 3I7JA 3IQAA 4B4XA 5GLBA 1W5DA 2RCXA 4LV0A 3ISGA 1FCNA 3MKEA 5EVIA 5FI2A 1JTDA 1OMEA 4WM9A 4H8RA 1E4DA 1HZOA 2X71A 2GDNA 3A3JA 4N1XA 4Y0UA 4XXRA 3G2ZA 4FD8A 5DTKA 4ZJ3A 2VGJA 1L0EA 4F94A 3NI9A 1FR6A 2HP9A 3TOIA 2CC1A 5GLAA 4KG6A 3VP4A 2HP5A 2WGWA 4UA7A 1LL5A 2JE5A 2H5SA 1YLWA 2G2UA 3GMWA 3PAGA 1K57C 1M40A 2ZD8A 1E3UA 1IYSA 3BEBA 3M2KA 1JWVA 3C4OA 3OC2A 5KZHA 1ESIA 1HD8A 4K0XA 4UHUA 4EQIA 1XXMA 4ZJ1A 5CGXA 3C7UA 4WEJA 5EVIB 3IHAA 4WELA 1KGGA 3HUOA 1DY6A 2ZC6B 1PZOA 2BG1A 1XKZA 2WGIA 4QB8A 4KQOA 4WZ5A 3IXGA 3VOZA 3ZGAB 1GHIA 1ZKJA 4JF6A 5A91A 1RCJA 3GRJA 4C6YA 1DJBA 1K38A 5A93A 2WGWB 2J9PA 3V39A 1KVMA
chains in the Genus database with same CATH superfamily
1S6RA 2ZC7A 2ZMAA 4HESA 4RA7A 3TJZC 1LHYA 1N9BA 4LV2A 1XGJA 2O0YA 3QNCA 1TD5A 5CECA 5HSQA 3PBSA 3IF6A 3BYDA 5L09A 4KQDA 3MXSA 1FILA 4U3TA 5FQQA 3MFXA 3T1XA 1BLSA 2I9VA 4JBFA 2QHKA 2OV5A 1H5XA 4RX2A 5EOEA 5CGSA 1ZG4A 3B42A 5HW3A 4DJ2A 2Y55A 2A49A 3H7WA 5HL1A 2V0WA 2VA0A 4MCWA 1GSXA 4JF4A 4OH0A 1GSWA 2KX6A 4ESPA 3M2JA 4PKYG 3OPRA 3N7WA 2R9XA 1KE3A 5AQAA 5E2FA 1K6RA 2Z6CA 3K3CA 4O8GA 4E6WA 4EEPA 4JPMA 2X02A 3OPLA 1OJ5A 4KG2A 3BWLA 5EOOA 2VGKA 3BY8A 4NG2A 1L0DA 1UWNX 5HDDA 5EPHA 3BFFA 2OSUA 1P97A 3HUNA 4EV4A 4GN2A 1U60A 1PIOA 4S2OA 2QWSA 5CGWA 1KE4A 4B88A 4UA6A 2NUPC 4YWZA 3ZNYA 3UNWA 4IJGA 4MBFA 4QU3A 3KSGA 3IXHA 5F1FA 2QZ6A 5DFXA 3UE1A 4L9EA 2JBFA 2HDQA 2E8JA 1K56A 3G31A 4X6TA 2Y2MA 3N8LA 3MZFA 4OQHA 4ZJ2A 4CJNA 1OPXA 3MFDA 4UQIS 3Q7ZA 1L2SA 1LSWA 2OAQ1 3S1YA 1VHMA 4HIAA 2XROA 4CLCD 2Y4AA 4I38A 3MZDA 4OONA 3PXPA 1TEMA 3DWKA 3SH7A 3G6OA 5GHXA 1DP6A 1QMFA 3MXRA 3NOUC 2A3UA 2NUTC 3QHYA 3UB5P 4X68A 4XUZA 4MDZA 3UB9A 5EV0A 3UE3A 2OWHA 5HPIA 3UMEA 4DJ3A 1SDNA 2ZMVA 4MEZA 4JXWA 3UB8A 3Q07A 3MS6A 4X1MA 2JCHA 3QP5A 4E3JA 1ALQA 2JKRM 1OTEA 2A24A 3IH8A 5EUAA 1DJAA 1Z6FA 5FDHA 3V50A 2V2FF 3ZG5A 3OCNA 4B9OA 3S4XA 2ZM0A 3BW6A 4IEDA 1YQSA 2OWJA 1P9WA 5M18A 4HP4A 3UDFA 5TBMA 3E2KA 3O86A 2WGVA 4K0WA 4UAAA 1K0KA 4I3AA 4ID4A 1ES5A 2W1RA 4FSFA 5E2EA 1G5UA 3FV7A 5CTNA 2O99A 3F1OB 3N8SA 2ZC4B 3Q7VA 3VFHA 2PBYA 4RX3A 3EEAA 3KSFA 1YKDA 4WMCA 4HBTA 2WAFA 4KQRA 3PBQA 1VEUA 1EI5A 5G4ZA 2HPBA 5CHJA 5FEFA 3BFGA 4Y7PA 4JXGA 1M6KA 1PNEA 3E2LA 4R3JA 3V67A 1XA7A 2JKFA 3FG8A 2EFUA 2EWWA 4OOLA 2ZQ7A 4C3QA 4AFIA 5TGFA 3M6BA 1Y28A 3U4LP 4O0PA 4O01A 4CQHA 1EW0A 2EX9A 3GSGA 1PW8A 4BL2A 4R3BA 1MWRA 4DE3A 3NC8A 1YLPA 1H8ZA 4Y0TA 3IF5A 4GHIA 3NDEA 4DE0A 2W1TB 2DMWA 2EWVA 4IBRA 1LI0A 5EVIC 4PM6A 1J9MA 4X56A 2JHEA 3T1QB 5J8XA 2OOLA 4LENA 3WS0A 1LL9A 3MR0A 3DTEA 3VP1A 1LT0A 3KYQA 5L07A 2J80A 2B02A 4G3VA 2XR0A 4R1GA 2GNXA 5HDSA 2Y2LA 4ZDXA 1DP9A 3PAEA 2PDRA 1BLHA 4GOGA 4MN5A 4DN0A 4FUWA 2W27A 4X53A 2QMIA 5A90A 1PI4A 1IELA 1XJ2A 3UMDA 1KDSA 4JGPA 4YNRA 3HLWA 3OPPA 4BBUA 1TS6A 3DW0A 3ITBA 3IF6B 3V5MA 1DJCA 3T50A 1F9IA 3LICA 5KSHA 3EQVA 1KE0A 3DTIA 1BZAA 4XUXA 4OQIA 3W4OA 4NXGA 4E3MA 2GJ3A 3ZHHA 2WAEA 1RGYA 3OCLA 4OQGA 4OVDA 1OT6A 4NXFA 3HLDA 2VX8A 2Y2IA 4MN6A 1T1AA 1K55A 1BLPA 4BWIA 1MPLA 4EWFA 4PM5A 3PBNA 4NEED 3HVFA 1OTAA 1YT4A 4LRYC 1NZOA 2WKIA 4E3NA 4N92A 3P01A 4HOIA 5GLBA 1FCNA 5EVIA 5FI2A 1JTDA 1IOUA 1OMEA 2P08A 1E4DA 4Y0UA 4XXRA 3G2ZA 5DTKA 2VGJA 3LI8A 1L0EA 1XJ6A 4F94A 3NI9A 1S4RA 4WLAA 2HP9A 3TOIA 2CC1A 4KG6A 2WGWA 2JKGA 1LL5A 2G2UA 3S7QA 2XSSA 4I3JA 3GMWA 5C5KA 3UB7A 3PAGA 1Z09A 2ZOHA 1K57C 1M40A 1E3UA 4PHTA 3OC2A 3C4OA 1DP8A 1HD8A 4UHUA 3IHAA 1SKOB 4WELA 1KGGA 3JPUA 2BG1A 1S4SA 3F1PB 4KUKA 5DKLA 1TS7A 1ZKJA 1RCJA 2L1MA 1DJBA 5MC7A 2J9PA 2Q9MA 2R78A 2PRFA 3PYPA 2VKSA 4E3IA 3N6IA 2JKTM 1FCOA 2L0WA 5F69A 2Y2QA 1ONHA 3E0YA 4XT2B 2VLGA 4YOFA 4PM9A 4OP8A 5L10A 3QNBA 1K56D 3CLOA 1SDEA 4FH2A 3G34A 4ETZA 4BENA 3GV9A 4MLLA 3IS2A 3LY3A 3A3DA 2OLUA 1IYPA 4Q0HA 1ZTUA 1CQAA 1NXYA 4DF6A 1JTGA 3C4PA 1HTZA 3R4KA 3IXDA 3C8CA 2ZC5B 1VB6A 4R38A 1GA9A 5L2FA 2A24B 1NYMA 3WS4A 5HAIA 3OZHA 1OT9A 3PHYA 4LPZA 3NBLA 3C2WA 4U0XA 5IHVA 5HAPA 5FAQA 5HARA 4Q0JA 1K4FA 3LYXA 2Y2GA 2PT7A 2G2WA 1K57A 1FCMA 4DDYA 1KOUA 4ME4A 4FH4A 1MWTA 2WADA 5TBMB 1QMEA 3NY4A 3IX8A 3LO7A 5EE8A 3T1RA 1KGFA 2WKEA 2XEPA 4MNRA 3BRMA 5I94A 4IVIA 1G28A 1VQQA 3A3FA 5E2GA 3NCKA 2EX2A 4PAUA 1O7EA 5LBRA 4NK3A 1VEUB 2Q0OA 1WYCA 3CHWP 1H0MA 3PBTA 2B95A 3E4OA 4GD8A 2ZL1A 1JVJA 2YKHA 2XGNA 3LIBA 1YAXA 4WMCD 2J3TD 3H9WA 3OBFA 4GS9B 4KZ8A 1LSXA 3B3XA 5J4EA 3VE3A 3Q81A 1D7EA 1GCEA 1ODVA 2WYXA 2FZ0A 4N1HA 3SOIA 3UN7A 1MWSA 4R3AA 2G7UA 4OPYA 2V9AA 5F82A 1PWGA 1Y4OA 2ZBBA 4LLOB 3IXBA 1VETA 5FAOA 1IYQA 2UV0E 4OLGA 3T12B 5DTTA 3RFBA 5DJUA 3IT9A 4GNUA 4E3LA 3G30A 3ZNTA 3DWZA 2CMNA 1FIKA 5AVEA 4OOYA 3WS5A 2VV8A 1MKMA 2WUQA 3IBRA 3VMAA 4LV3A 4YFMA 5L8MA 1IKGA 1W7FA 2DNSA 1VM1A 3CMZA 1GA0A 4R6LA 2XLNA 4EERA 3BECA 4KENB 2O9AA 2PYPA 2JN7A 5FASA 3PTEA 3UO9A 1BT5A 4NETA 2BLSA 3ZG8B 2Z6DA 1H8YA 2XDMA 1K25A 5FATA 5DF8A 4P85A 4ETXA 4YINA 3CPTB 5A92A 3A0SA 1FQGA 4DDSA 2PYRA 5GHYA 5FQMA 1PYYA 4CLCB 1BULA 3IWOA 1NLYA 3O88A 3ITAA 4Y13A 1UGUA 1ESUA 3FPWA 3NDGA 3WS2A 3ICYA 4PM7A 4P0MA 4B4ZA 3NULA 3UPOA 4GB7A 4KZ6A 1WE4A 4OKPA 4ZRRA 1CK3A 1D06A 1NZUA 4WEKA 5FQJA 4BMWA 3BLSA 1OTBA 2H0YA 5FQIA 1XFQA 3IX4A 2IWCA 2J9OA 3QP1A 2QKPA 5EVID 2WZZA 4GD6A 2ZLYA 4X25A 3C38A 4M4XA 2UWXA 3A3IA 1XPBA 3QP2A 1PWDA 1K54C 4BD1A 4L9GA 1K4EA 3AGFA 1NRJA 4FOFA 1E3UD 4LRXC 4GKUA 1I2WA 4HBUA 4II7A 4QPRA 1JWPA 3BLMA 3ZYTA 3P09A 4HHDA 2BASA 4EUVA 4F3LB 5FI6A 4NKPA 2IWDA 4HQAA 4Z9QA 3UE0A 2P9VB 3VOYA 2XQZA 4PM8A 1S1YA 5TFQA 4ARZA 5FI7A 1XP4A 4KG5A 1OTDA 3SH8A 3TW8A 2J8YA 1NJ4A 1YLJA 2J3WA 4Q0IA 3LIFA 2ZOIA 5JYOA 4I5SA 1YLTA 1NLZA 2XFTA 4GJ4A 3LR3A 4EEUA 1EWZA 2INWA 1BLCA 1G6OA 1CI9A 2PU2A 4Z1WA 1I2SA 2WKPA 3O3VA 5K5BA 1G68A 3RXWA 1L3LA 4GDNA 1NY0A 4S2LA 3I7JA 4MN7A 1IFQA 1W5DA 4LV0A 1OTIA 3MKEA 5HPFA 2X71A 1T18A 1FR6A 2VV6A 3VP4A 3D72A 4UA7A 1YLWA 2ZD8A 1IYSA 3BEBA 1JWVA 1ESIA 4GLQA 4EQIA 4ZJ1A 3C7UA 3H82B 3HUOA 1DY6A 3EWKA 1PZOA 1XKZA 3IXGA 2GX5A 2B18A 3QP6A 5A91A 3IWQA 1LLBA 5IU1A 5KMWA 3C7VA 5AQ9A 4RVAA 3GECA 1HLUP 3IHBA 4HJ4A 3W8KA 2ZJ9A 3WS1A 4DE2A 4S2NC 1TS0A 5GL9A 1E25A 2A2LA 4Y2FA 3CITA 1ES3A 3HCYA 1MWUA 4X1LA 1L0GA 4GW9A 3P98A 4LCLA 3VP2A 4HJ3A 3LFVA 4Y5FA 1F5MA 1ONGA 4ZAMA 2AVXA 2O9CA 4K08A 4R23A 2V0UA 3T4QA 1TDGA 1GHPA 2P74A 4IUHA 3RJUA 2WKHA 3SZTA 3IH9A 3R7WA 3TE8A 1PFLA 1FR1A 4BBVA 5G4YA 5GLDA 5DF7A 4EBPA 5HFOA 1H3QA 2ZQ9A 2IWBA 4C75A 3H7WB 3MQQA 4JKTA 3FKWA 2KOIA 5EFWA 4OLDA 5EM0A 1LL8A 2PR6A 3VSLA 4H6JA 2FFFB 2Y8HA 1BSGA 2W3FA 3VP3A 5HD3A 4OQ0A 3NOPC 1XFNA 3L9KA 2B5RA 2DCFA 3ZFZA 5TJJA 4G3KA 2QJ5A 4DE1A 1N9NA 2OLVA 1YPRA 1MC0A 3LI9A 2ZC3B 4HNBA 4EW7A 3GTCA 2JC7A 3AGDA 3CUEC 4LGWA 1WYBA 4S2NA 5FAPA 3DTKA 1PRQA 1PI5A 2XK1A 4ZTKA 4Y0OA 3DTMA 2YKFA 3MXQA 4I39A 2KDKA 3FC7A 3UDIA 5HDCA 4IUKA 3GR2A 5F6AA 1XA1A 1ERMA 3HUMA 1G6AA 3T4KA 3D4FA 4QHCA 5U47A 4QJGA 1J3WA 4Q8IA 4DMZA 1TS8A 1ZC2A 5AQBA 1BUEA 3HL9A 3K3DA 1MZUA 2V8FA 4QY6A 1Y54A 4HY8A 1TDLA 3LIAA 5HD5A 3TG9A 4LV1A 4R4SA 3G35A 5HWTA 3QP8A 1XX2A 4JF5A 3MBZA 1CEFA 5DF9A 1AXBA 5FQKA 2V8CA 3N4IA 2PR5A 3TRCA 4E3OA 3F1OA 3NECA 3BQAA 3Q82A 3FKVA 5AJGA 1AWIA 2V1AA 2XH9A 4P6BA 5CHMA 2XF3A 3AGEA 5CEDA 3BQ8A 4E6XA 4EUZA 5HAQA 1ES4A 3UY6A 4KZ4A 3CUEA 3OPHA 2OAP1 2Y79A 3IF6C 2GZAA 2Y2JA 2W3DA 2VGLM 3SS3A 1GHMA 5DVAA 3W4PA 4OPRA 3JVVA 3ZG0A 3D9YA 3T4LA 3FYZA 4MBHA 1YSPA 5DJTA 4CPKA 5CEBA 1SHVA 3G2YA 3QP4A 5M19A 4ARZB 4DXBA 3Q7VB 5I5LA 3OOVA 3LR5A 2PBDP 1KDWA 2K31A 3HLEA 2W1TA 5KSCA 1T1BA 3F1NA 2ZMFA 4E04A 1W8YA 2VEAA 2HGVA 2EA9A 5EM1A 2JKTI 3BJNA 3E4QA 1GSVA 1Q2QA 4RQ9A 4K91A 5FSRA 4EQ1A 2PD8A 1PW1A 4JGQA 2QJ7A 1F2KA 2DRWA 2ZM2A 4OPQA 2Y2OA 1T1CA 3VSKA 5JYPA 2Z2MB 3HLFA 4ZBEA 2M7UA 4DXCA 2Y91A 4GZBA 2H0TA 3CG5A 3BY9A 1W8QA 5IT5A 4GDBA 3A3EA 4LCMA 2I72A 1NWZA 2LB9A 1RP5A 4BLMA 5GLCA 4Y3IA 4GHIB 5HWVA 5AQ7A 3FWLA 2ZQAA 3MJQA 4WF0A 3T4OA 1WA9A 3UDXA 4P6ZM 3LR4A 4S2MA 5DTSA 2W3GA 1BYWA 3MQOA 3KSHA 3ZQ5A 4D60A 3PR6A 1MBLA 4S2JA 3CJMA 3MZEA 4BD0A 3MMHA 2QPNA 3ZDJA 3KO6A 4BQMA 4WBGA 4GCZA 4I3IA 2HP6A 1TVFA 3HJIA 5CHUA 2HZ5A 4DRTA 5CRFA 2KLIA 4WZ4A 1RGZA 4M3KA 3VP0A 5E2HA 4RYEA 4Y17A 3CZDA 3FZCA 3R7WB 5F68A 2PAVP 3WRTA 3NOTC 4PMAA 3A0VA 1MXOA 2Z2LB 2V1ZA 4DKIA 3VV4A 2RCXA 1SKOA 4WM9A 3A3JA 4ZJ3A 3F1PA 4FD8A 4HH3A 1P0ZA 1H8MA 4MMNA 5GLAA 2JE5A 2H5SA 4H6JB 5J7EA 2ACGA 5KZHA 4K0XA 4KUOA 4WEJA 5EVIB 4XT2A 2J3TC 5CX7A 4QB8A 4KQOA 3OLOA 3VOZA 2M1CA 1GHIA 4JF6A 5A93A 2WGWB 3V39A 1ZG6A 4LRZE 2VGLS 2V1BA 1CF0A 3HREA 2W3HA 3HBRA 4KZ3A 5HWWA 2EXAA 2Y2PA 5CERA 3PBOA 3B33A 1PWCA 2ZQDA 2HF6A 1CJFA 1YMSA 4HI4A 5AVFA 3O87A 3EQUA 5EECA 1MY8A 4E3KA 2C5WB 2FH5A 1V9ZA 1EROA 1T19A 3C30A 5HL6A 5E43A 5F5YA 2R9WA 1BTLA 1F98A 4EESA 3JVUA 3E4PA 2P04A 2ZQ8A 1CEGA 4N9LA 1YM1A 1D1JA 5F1GA 3EGDC 3ZG9B 3IS2B 3K2NA 1LI9A 3KYEA 4Y15A 1XJ4A 3U2AA 2H10A 3N8RA 5EVEA 1W63Q 3S7OA 2WZXA 1XJ3A 4P87A 2L4RA 3NHQA 4HP9A 3PBRA 3UPPA 3LR0A 3W4QA 5IS1A 1N9OA 1CI8A 3Q1FA 2Y2NA 2M7VA 3ULFA 2Y2KA 3ZG7B 4L9FA 3VE4A 2X01A 1Q2PA 4B93A 3IBJA 3D3OA 1K6SA 5F83A 1DRMA 4JLFA 4P6ZS 5EVLA 4GS9A 3V3RA 2PHYA 2ZQCA 1YLZA 2RL3A 3V3SA 4S2KA 1S1ZA 3SS4A 1K54A 4X69A 2XD1A 4CLCC 3GVBA 2HDRA 1ZHHB 1K55C 4IVKA 3CWFA 3BFCA 1O07A 2JKRI 5GHZA 3CI6A 3LEQA 3BFDA 3G4PA 3W2ZA 1YSQA 4PPRA 3IWIA 1KGEA 4WUJA 4WL9A 4S2IA 3O5YA 1FSYA 3ZCZA 2Y59A 4OPZA 4G3WA 3EOIA 2VK3A 2XA7M 1W63M 3F1NB 4U0TA 3T1SA 3HJKA 2ZL1B 1IYOA 4O7DA 4JGOA 2BTFP 2PD7A 1FOFA 1JWZA 4JGRA 5DFYA 3ZVTA 4EU0A 1IKIA 3T4JA 1S0WA 1YMXA 2EX6A 4UA9A 3C5AA 2IA2A 2W3EA 2ZM8A 4WYYA 3BFEA 4R4RA 2WKQA 1YLYA 1FSWA 3SH9A 1IEMA 3S7NA 4NXEA 2EXBA 2D02A 4CLCE 1ES2A 2HV1A 2XFSA 1VETB 5KIZA 4OOMA 3HLCA 4EBNA 1N9LA 1C3BA 5FA7A 4QWOA 3L7HA 3VFFA 3B47A 2Q9NA 3CPTA 3S7PA 2VZWA 2E8IA 4HJ6A 2K7SA 3RH8B 4LFUA 1HVBA 3HLBA 4CLCA 3MKFA 2J7VA 4A5RA 4N9KA 4BL3A 1SZVA 4PKYA 4R0QA 2H28A 1OJGA 1ACFA 2XD5A 4X55A 3KSIA 3ZVWA 4NXBA 5A8BA 3WWXA 3DAVA 5CXWA 4WN5A 4UEYA 2WKRA 1PZPA 2QYBA 2VJWA 3LIEA 3A0RA 4KZ5A 1S66L 3E98A 3MQ0A 5FDSA 3MF0A 5M1AA 1V9YA 2LB5A 3G32A 3LEZA 4KZ7A 3T4TA 3SW1A 3SS5A 4QD4A 5DKKA 3UB6A 3KX0X 3EGXC 5FEGA 5FQ9A 1SKFA 2O9BA 2C6WB 4BBTA 5BOHA 3WRZA 4EETB 3S22A 1W79A 3KYZA 2HJEA 4KZAA 1A0KA 3IX3A 4IBXA 4S2PA 2VV7A 3NJAA 1XGIA 5G18A 1ERQA 2V20A 3NIAA 1LSVA 1SCWA 2PU4A 5CTMA 4R70A 3JYIA 4F3LA 3M6HA 2EFXA 4OP5A 3TSGA 4EXOA 2P9VA 4BJPA 3LCEA 4WZ5C 1STZA 2XRNA 2HJ9C 4HEFA 1N4OA 5D3OA 3EEHA 1L0FA 3UE6A 2HDUA 4KZ9A 4UQIM 1KVLA 2FFYA 5FL3A 2W0NA 3DBAA 4D2OA 1MKIA 2MJ6A 4FTXA 4JXSA 4KQQA 2P7JA 3MSHA 1NRFA 5TR7A 4L0LA 2HDSA 2Y2HA 5HX9A 4QY5A 3UPNA 4MBKA 2K2NA 3HLGA 3CAXA 4EBLA 2WK0A 4IHQA 4JXVA 4FCFA 5J3WA 1X0OA 2EX8A 1I5QA 4HH2A 2XA7S 3LY4A 3RXXA 3LUQA 3GQZA 2D01A 3GDIA 3BM6A 4KZBA 1NYYA 3FPVA 3IQAA 4B4XA 3H82A 3ISGA 3LGOA 4H8RA 1HZOA 2GDNA 4N1XA 1TF1A 3P7NA 3RTYA 2HP5A 3M2KA 5HZHA 1P9RA 1XXMA 5CGXA 3LIDA 2ZC6B 1S67L 2WGIA 1UWPX 4WZ5A 3ZGAB 3T4SA 3GRJA 1JNUA 4C6YA 3VOLA 1K38A 1KVMA
chains in the Genus database with same CATH topology
1ZG6A 1S6RA 2ZC7A 2ZMAA 3IWQA 2Q9MA 1LLBA 5KMWA 4HESA 4RA7A 3C7VA 1LHYA 1N9BA 4RVAA 5AQ9A 4LV2A 1XGJA 3IHBA 3W8KA 4E3IA 2ZJ9A 3N6IA 3WS1A 4DE2A 4S2NC 3HREA 3QNCA 5GL9A 1E25A 1FCOA 5CECA 3HBRA 2Y2QA 1ONHA 3PBSA 4KZ3A 1ES3A 2EXAA 3BYDA 3IF6A 4PM9A 1MWUA 4OP8A 2Y2PA 3QNBA 1K56D 1SDEA 3MXSA 3PBOA 4FH2A 5CERA 1L0GA 1PWCA 3P98A 2ZQDA 3G34A 4U3TA 4LCLA 3VP2A 5FQQA 1BLSA 1YMSA 1ONGA 4BENA 3O87A 3EQUA 4JBFA 3GV9A 4ZAMA 2OV5A 4MLLA 1H5XA 5EECA 1MY8A 3LY3A 4RX2A 4E3KA 5EOEA 5CGSA 1ZG4A 2C5WB 4R23A 3A3DA 2OLUA 1IYPA 1EROA 5HW3A 5E43A 2Y55A 2A49A 1NXYA 1TDGA 5HL1A 1GHPA 2P74A 4DF6A 1JTGA 2R9WA 1BTLA 3RJUA 2WKHA 3C4PA 1HTZA 4JF4A 4OH0A 3IXDA 2ZQ8A 3IH9A 1FR1A 1CEGA 2ZC5B 5GLDA 4N9LA 5DF7A 4EBPA 1YM1A 1GA9A 3M2JA 5L2FA 3OPRA 5F1GA 1NYMA 3ZG9B 5HFOA 3N7WA 3WS4A 2R9XA 1KE3A 1LI9A 5AQAA 2ZQ9A 5E2FA 1K6RA 5HAIA 2IWBA 3OZHA 4C75A 3NBLA 5IHVA 2H10A 4U0XA 4E6WA 5HAPA 4JPMA 3N8RA 2X02A 3OPLA 4JKTA 5FAQA 5HARA 2WZXA 3FKWA 4P87A 4KG2A 5EOOA 1K4FA 2Y2GA 3PBRA 2G2WA 1K57A 3UPPA 4OLDA 2VGKA 3W4QA 1FCMA 1L0DA 3VSLA 4DDYA 2FFFB 1BSGA 4FH4A 1MWTA 5EPHA 2WADA 1CI8A 3BFFA 3VP3A 3Q1FA 1QMEA 2Y2NA 2OSUA 3NY4A 4OQ0A 3LO7A 5EE8A 3HUNA 4EV4A 2B5RA 2Y2KA 4GN2A 2DCFA 3ZG7B 3ZFZA 1U60A 1PIOA 4S2OA 5CGWA 1KGFA 4DE1A 1KE4A 2OLVA 2WKEA 2XEPA 4UA6A 4B88A 3ZNYA 2X01A 3UNWA 1Q2PA 4QU3A 4MBFA 3IXHA 5F1FA 1K6SA 5F83A 2QZ6A 2ZC3B 4MNRA 3GTCA 3UE1A 2JC7A 3BRMA 3AGDA 4JLFA 5I94A 2JBFA 2HDQA 5EVLA 4IVIA 3V3RA 1WYBA 4S2NA 5FAPA 1K56A 2ZQCA 3G31A 4X6TA 1VQQA 1YLZA 2Y2MA 3A3FA 2RL3A 5E2GA 3V3SA 3N8LA 3NCKA 4S2KA 1PI5A 1K54A 3MZFA 4OQHA 2EX2A 2XK1A 4X69A 4ZJ2A 3SS4A 4CJNA 1O7EA 4ZTKA 3MFDA 4NK3A 2XD1A 3GVBA 1WYCA 4Y0OA 2HDRA 3Q7ZA 1L2SA 3PBTA 3DTMA 3S1YA 1K55C 4IVKA 4GD8A 1JVJA 3BFCA 2XGNA 3UDIA 1O07A 2Y4AA 3MZDA 3GR2A 4OONA 1XA1A 5GHZA 1ERMA 3HUMA 1G6AA 4WMCD 1TEMA 4KZ8A 3DWKA 3SH7A 3BFDA 3B3XA 3D4FA 4QHCA 5U47A 5GHXA 3G4PA 4QJGA 4Q8IA 3Q81A 1QMFA 1ZC2A 3MXRA 2A3UA 4PPRA 3QHYA 1GCEA 3IWIA 5AQBA 1BUEA 3HL9A 1KGEA 2WYXA 4X68A 4S2IA 4XUZA 1FSYA 4N1HA 3UE3A 3ZCZA 3SOIA 3UN7A 2Y59A 4OPZA 1MWSA 1Y54A 4QY6A 1TDLA 4U0TA 1IYOA 1SDNA 4MEZA 4JXWA 4OPYA 4O7DA 3Q07A 3TG9A 4LV1A 4R4SA 1FOFA 1JWZA 3G35A 2JCHA 5F82A 1PWGA 4E3JA 1ALQA 3IXBA 3ZVTA 1IKIA 1S0WA 1YMXA 1XX2A 2EX6A 4UA9A 5FAOA 3C5AA 3IH8A 3MBZA 4JF5A 1IYQA 4OLGA 5EUAA 1DJAA 1Z6FA 2ZM8A 4WYYA 1CEFA 5FDHA 3BFEA 3V50A 2V2FF 5DTTA 5DF9A 4R4RA 3ZG5A 3IT9A 1AXBA 3OCNA 4GNUA 5FQKA 3N4IA 1YLYA 3S4XA 1FSWA 3SH9A 3G30A 2ZM0A 3ZNTA 4E3LA 4E3OA 1IEMA 3DWZA 4IEDA 2EXBA 3Q82A 1YQSA 3FKVA 1ES2A 2XH9A 4OOYA 5M18A 3WS5A 2XFSA 4P6BA 2WUQA 3UDFA 3VMAA 5CHMA 2XF3A 4OOMA 3HLCA 3AGEA 4LV3A 4EBNA 1C3BA 5CEDA 5FA7A 3E2KA 3O86A 4YFMA 2WGVA 1IKGA 4K0WA 4UAAA 4E6XA 4EUZA 4ID4A 1ES5A 5HAQA 4FSFA 1ES4A 5E2EA 4KZ4A 3UY6A 3OPHA 3VFFA 1W7FA 2DNSA 1VM1A 3FV7A 3CMZA 5CTNA 1GA0A 2XLNA 2Q9NA 3N8SA 3IF6C 2E8IA 2ZC4B 2Y2JA 3Q7VA 3VFHA 3SS3A 3BECA 4KENB 1HVBA 1GHMA 2PBYA 4RX3A 3HLBA 3MKFA 2J7VA 4A5RA 4N9KA 4BL3A 5DVAA 5FASA 4WMCA 3PTEA 4HBTA 2WAFA 4KQRA 3UO9A 1BT5A 4R0QA 3W4PA 4NETA 4OPRA 2BLSA 3ZG8B 3ZG0A 3PBQA 2XD5A 1H8YA 4X55A 1EI5A 1K25A 2XDMA 3FYZA 4MBHA 5DF8A 5FATA 3ZVWA 4CPKA 4P85A 5CEBA 1SHVA 4YINA 3WWXA 5A92A 2HPBA 3G2YA 5CHJA 5CXWA 5M19A 1FQGA 4DDSA 5GHYA 4DXBA 3Q7VB 3BFGA 5FQMA 4Y7PA 1PYYA 1PZPA 4JXGA 1M6KA 1BULA 3IWOA 3E2LA 3O88A 4R3JA 1KDWA 3ITAA 4KZ5A 1ESUA 1XA7A 3NDGA 2EFUA 3HLEA 4OOLA 3WS2A 5M1AA 5KSCA 3G32A 3LEZA 2ZQ7A 4C3QA 4KZ7A 5TGFA 3M6BA 4PM7A 1W8YA 3SS5A 4QD4A 4P0MA 4B4ZA 5FQ9A 3UPOA 2EX9A 4GB7A 3GSGA 4KZ6A 1PW8A 4BL2A 4R3BA 1MWRA 1SKFA 4DE3A 2C6WB 3NC8A 5BOHA 1Q2QA 1YLPA 3WRZA 4K91A 5FSRA 1H8ZA 1WE4A 3S22A 4OKPA 1W79A 4Y0TA 3IF5A 1PW1A 3NDEA 4DE0A 1CK3A 4KZAA 1NZUA 4WEKA 5FQJA 3BLSA 2DRWA 2H0YA 2ZM2A 4OPQA 4IBRA 1LI0A 2Y2OA 5EVIC 4PM6A 1J9MA 3VSKA 5JYPA 5FQIA 2Z2MB 3HLFA 4X56A 4ZBEA 2IWCA 4IBXA 4DXCA 5J8XA 2J9OA 4S2PA 2Y91A 4GZBA 4LENA 3WS0A 5EVID 1XGIA 2H0TA 3CG5A 1W8QA 1LL9A 5G18A 3VP1A 4GDBA 1ERQA 2WZZA 3A3EA 2V20A 4GD6A 2I72A 2ZLYA 3NIAA 4LCMA 1SCWA 2PU4A 2UWXA 3A3IA 1RP5A 5CTMA 4BLMA 3JYIA 5GLCA 2XR0A 4R1GA 1XPBA 1PWDA 5AQ7A 3FWLA 1K54C 4BD1A 3M6HA 2EFXA 2Y2LA 2ZQAA 4OP5A 1K4EA 3TSGA 4ZDXA 3PAEA 3UDXA 3AGFA 1BLHA 4GOGA 2P9VA 1E3UD 4S2MA 5DTSA 4BJPA 4GKUA 3LCEA 4X53A 4WZ5C 2QMIA 1I2WA 5A90A 4HBUA 1PI4A 1IELA 4HEFA 1JWPA 1N4OA 5D3OA 1L0FA 3BLMA 1KDSA 2HDUA 4KZ9A 1KVLA 3HLWA 2FFYA 3OPPA 3P09A 4D2OA 1MKIA 3DW0A 3ITBA 3IF6B 3V5MA 1MBLA 1DJCA 4S2JA 5FI6A 4JXSA 4KQQA 3CJMA 3MZEA 2IWDA 4BD0A 5KSHA 5TR7A 1NRFA 3EQVA 1KE0A 4Z9QA 2QPNA 1BZAA 4XUXA 4OQIA 2P9VB 4L0LA 2HDSA 2Y2HA 3UE0A 3VOYA 3W4OA 3ZDJA 4E3MA 2XQZA 4PM8A 5TFQA 3ZHHA 5FI7A 1XP4A 4KG5A 4BQMA 5HX9A 2WAEA 1RGYA 3OCLA 4OQGA 4OVDA 2J8YA 4WBGA 3SH8A 4QY5A 3HLDA 2Y2IA 2HP6A 1NJ4A 1YLJA 1TVFA 5CHUA 3UPNA 4MBKA 4DRTA 3HLGA 1K55A 5JYOA 1YLTA 2XFTA 2WK0A 4WZ4A 1BLPA 5CRFA 4EBLA 1RGZA 1MPLA 4JXVA 4FCFA 4M3KA 3VP0A 5E2HA 2EX8A 1EWZA 4EWFA 1I5QA 1BLCA 4RYEA 4PM5A 3PBNA 3CZDA 3FZCA 3LY4A 3RXXA 1CI9A 2PU2A 3HVFA 3WRTA 1I2SA 3GQZA 3O3VA 4PMAA 1YT4A 1MXOA 1G68A 1NZOA 2Z2LB 3BM6A 3RXWA 2V1ZA 4DKIA 4GDNA 2WKIA 1NY0A 4KZBA 4S2LA 4E3NA 1NYYA 4N92A 3I7JA 3IQAA 4B4XA 5GLBA 1W5DA 2RCXA 4LV0A 3ISGA 1FCNA 3MKEA 5EVIA 5FI2A 1JTDA 1OMEA 4WM9A 4H8RA 1E4DA 1HZOA 2X71A 2GDNA 3A3JA 4N1XA 4Y0UA 4XXRA 3G2ZA 4FD8A 5DTKA 4ZJ3A 2VGJA 1L0EA 4F94A 3NI9A 1FR6A 2HP9A 3TOIA 2CC1A 5GLAA 4KG6A 3VP4A 2HP5A 2WGWA 4UA7A 1LL5A 2JE5A 2H5SA 1YLWA 2G2UA 3GMWA 3PAGA 1K57C 1M40A 2ZD8A 1E3UA 1IYSA 3BEBA 3M2KA 1JWVA 3C4OA 3OC2A 5KZHA 1ESIA 1HD8A 4K0XA 4UHUA 4EQIA 1XXMA 4ZJ1A 5CGXA 3C7UA 4WEJA 5EVIB 3IHAA 4WELA 1KGGA 3HUOA 1DY6A 2ZC6B 1PZOA 2BG1A 1XKZA 2WGIA 4QB8A 4KQOA 4WZ5A 3IXGA 3VOZA 3ZGAB 1GHIA 1ZKJA 4JF6A 5A91A 1RCJA 3GRJA 4C6YA 1DJBA 1K38A 5A93A 2WGWB 2J9PA 3V39A 1KVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZG6 A;  1S6R A;  2ZC7 A;  2ZMA A;  3IWQ A;  2Q9M A;  1LLB A;  5KMW A;  4HES A;  4RA7 A;  3C7V A;  1LHY A;  1N9B A;  4RVA A;  5AQ9 A;  4LV2 A;  1XGJ A;  3IHB A;  3W8K A;  4E3I A;  2ZJ9 A;  3N6I A;  3WS1 A;  4DE2 A;  4S2N C;  3HRE A;  3QNC A;  5GL9 A;  1E25 A;  1FCO A;  5CEC A;  3HBR A;  2Y2Q A;  1ONH A;  3PBS A;  4KZ3 A;  1ES3 A;  2EXA A;  3BYD A;  3IF6 A;  4PM9 A;  1MWU A;  4OP8 A;  2Y2P A;  3QNB A;  1K56 D;  1SDE A;  3MXS A;  3PBO A;  4FH2 A;  5CER A;  1L0G A;  1PWC A;  3P98 A;  2ZQD A;  3G34 A;  4U3T A;  4LCL A;  3VP2 A;  5FQQ A;  1BLS A;  1YMS A;  1ONG A;  4BEN A;  3O87 A;  3EQU A;  4JBF A;  3GV9 A;  4ZAM A;  2OV5 A;  4MLL A;  1H5X A;  5EEC A;  1MY8 A;  3LY3 A;  4RX2 A;  4E3K A;  5EOE A;  5CGS A;  1ZG4 A;  2C5W B;  4R23 A;  3A3D A;  2OLU A;  1IYP A;  1ERO A;  5HW3 A;  5E43 A;  2Y55 A;  2A49 A;  1NXY A;  1TDG A;  5HL1 A;  1GHP A;  2P74 A;  4DF6 A;  1JTG A;  2R9W A;  1BTL A;  3RJU A;  2WKH A;  3C4P A;  1HTZ A;  4JF4 A;  4OH0 A;  3IXD A;  2ZQ8 A;  3IH9 A;  1FR1 A;  1CEG A;  2ZC5 B;  5GLD A;  4N9L A;  5DF7 A;  4EBP A;  1YM1 A;  1GA9 A;  3M2J A;  5L2F A;  3OPR A;  5F1G A;  1NYM A;  3ZG9 B;  5HFO A;  3N7W A;  3WS4 A;  2R9X A;  1KE3 A;  1LI9 A;  5AQA A;  2ZQ9 A;  5E2F A;  1K6R A;  5HAI A;  2IWB A;  3OZH A;  4C75 A;  3NBL A;  5IHV A;  2H10 A;  4U0X A;  4E6W A;  5HAP A;  4JPM A;  3N8R A;  2X02 A;  3OPL A;  4JKT A;  5FAQ A;  5HAR A;  2WZX A;  3FKW A;  4P87 A;  4KG2 A;  5EOO A;  1K4F A;  2Y2G A;  3PBR A;  2G2W A;  1K57 A;  3UPP A;  4OLD A;  2VGK A;  3W4Q A;  1FCM A;  1L0D A;  3VSL A;  4DDY A;  2FFF B;  1BSG A;  4FH4 A;  1MWT A;  5EPH A;  2WAD A;  1CI8 A;  3BFF A;  3VP3 A;  3Q1F A;  1QME A;  2Y2N A;  2OSU A;  3NY4 A;  4OQ0 A;  3LO7 A;  5EE8 A;  3HUN A;  4EV4 A;  2B5R A;  2Y2K A;  4GN2 A;  2DCF A;  3ZG7 B;  3ZFZ A;  1U60 A;  1PIO A;  4S2O A;  5CGW A;  1KGF A;  4DE1 A;  1KE4 A;  2OLV A;  2WKE A;  2XEP A;  4UA6 A;  4B88 A;  3ZNY A;  2X01 A;  3UNW A;  1Q2P A;  4QU3 A;  4MBF A;  3IXH A;  5F1F A;  1K6S A;  5F83 A;  2QZ6 A;  2ZC3 B;  4MNR A;  3GTC A;  3UE1 A;  2JC7 A;  3BRM A;  3AGD A;  4JLF A;  5I94 A;  2JBF A;  2HDQ A;  5EVL A;  4IVI A;  3V3R A;  1WYB A;  4S2N A;  5FAP A;  1K56 A;  2ZQC A;  3G31 A;  4X6T A;  1VQQ A;  1YLZ A;  2Y2M A;  3A3F A;  2RL3 A;  5E2G A;  3V3S A;  3N8L A;  3NCK A;  4S2K A;  1PI5 A;  1K54 A;  3MZF A;  4OQH A;  2EX2 A;  2XK1 A;  4X69 A;  4ZJ2 A;  3SS4 A;  4CJN A;  1O7E A;  4ZTK A;  3MFD A;  4NK3 A;  2XD1 A;  3GVB A;  1WYC A;  4Y0O A;  2HDR A;  3Q7Z A;  1L2S A;  3PBT A;  3DTM A;  3S1Y A;  1K55 C;  4IVK A;  4GD8 A;  1JVJ A;  3BFC A;  2XGN A;  3UDI A;  1O07 A;  2Y4A A;  3MZD A;  3GR2 A;  4OON A;  1XA1 A;  5GHZ A;  1ERM A;  3HUM A;  1G6A A;  4WMC D;  1TEM A;  4KZ8 A;  3DWK A;  3SH7 A;  3BFD A;  3B3X A;  3D4F A;  4QHC A;  5U47 A;  5GHX A;  3G4P A;  4QJG A;  4Q8I A;  3Q81 A;  1QMF A;  1ZC2 A;  3MXR A;  2A3U A;  4PPR A;  3QHY A;  1GCE A;  3IWI A;  5AQB A;  1BUE A;  3HL9 A;  1KGE A;  2WYX A;  4X68 A;  4S2I A;  4XUZ A;  1FSY A;  4N1H A;  3UE3 A;  3ZCZ A;  3SOI A;  3UN7 A;  2Y59 A;  4OPZ A;  1MWS A;  1Y54 A;  4QY6 A;  1TDL A;  4U0T A;  1IYO A;  1SDN A;  4MEZ A;  4JXW A;  4OPY A;  4O7D A;  3Q07 A;  3TG9 A;  4LV1 A;  4R4S A;  1FOF A;  1JWZ A;  3G35 A;  2JCH A;  5F82 A;  1PWG A;  4E3J A;  1ALQ A;  3IXB A;  3ZVT A;  1IKI A;  1S0W A;  1YMX A;  1XX2 A;  2EX6 A;  4UA9 A;  5FAO A;  3C5A A;  3IH8 A;  3MBZ A;  4JF5 A;  1IYQ A;  4OLG A;  5EUA A;  1DJA A;  1Z6F A;  2ZM8 A;  4WYY A;  1CEF A;  5FDH A;  3BFE A;  3V50 A;  2V2F F;  5DTT A;  5DF9 A;  4R4R A;  3ZG5 A;  3IT9 A;  1AXB A;  3OCN A;  4GNU A;  5FQK A;  3N4I A;  1YLY A;  3S4X A;  1FSW A;  3SH9 A;  3G30 A;  2ZM0 A;  3ZNT A;  4E3L A;  4E3O A;  1IEM A;  3DWZ A;  4IED A;  2EXB A;  3Q82 A;  1YQS A;  3FKV A;  1ES2 A;  2XH9 A;  4OOY A;  5M18 A;  3WS5 A;  2XFS A;  4P6B A;  2WUQ A;  3UDF A;  3VMA A;  5CHM A;  2XF3 A;  4OOM A;  3HLC A;  3AGE A;  4LV3 A;  4EBN A;  1C3B A;  5CED A;  5FA7 A;  3E2K A;  3O86 A;  4YFM A;  2WGV A;  1IKG A;  4K0W A;  4UAA A;  4E6X A;  4EUZ A;  4ID4 A;  1ES5 A;  5HAQ A;  4FSF A;  1ES4 A;  5E2E A;  4KZ4 A;  3UY6 A;  3OPH A;  3VFF A;  1W7F A;  2DNS A;  1VM1 A;  3FV7 A;  3CMZ A;  5CTN A;  1GA0 A;  2XLN A;  2Q9N A;  3N8S A;  3IF6 C;  2E8I A;  2ZC4 B;  2Y2J A;  3Q7V A;  3VFH A;  3SS3 A;  3BEC A;  4KEN B;  1HVB A;  1GHM A;  2PBY A;  4RX3 A;  3HLB A;  3MKF A;  2J7V A;  4A5R A;  4N9K A;  4BL3 A;  5DVA A;  5FAS A;  4WMC A;  3PTE A;  4HBT A;  2WAF A;  4KQR A;  3UO9 A;  1BT5 A;  4R0Q A;  3W4P A;  4NET A;  4OPR A;  2BLS A;  3ZG8 B;  3ZG0 A;  3PBQ A;  2XD5 A;  1H8Y A;  4X55 A;  1EI5 A;  1K25 A;  2XDM A;  3FYZ A;  4MBH A;  5DF8 A;  5FAT A;  3ZVW A;  4CPK A;  4P85 A;  5CEB A;  1SHV A;  4YIN A;  3WWX A;  5A92 A;  2HPB A;  3G2Y A;  5CHJ A;  5CXW A;  5M19 A;  1FQG A;  4DDS A;  5GHY A;  4DXB A;  3Q7V B;  3BFG A;  5FQM A;  4Y7P A;  1PYY A;  1PZP A;  4JXG A;  1M6K A;  1BUL A;  3IWO A;  3E2L A;  3O88 A;  4R3J A;  1KDW A;  3ITA A;  4KZ5 A;  1ESU A;  1XA7 A;  3NDG A;  2EFU A;  3HLE A;  4OOL A;  3WS2 A;  5M1A A;  5KSC A;  3G32 A;  3LEZ A;  2ZQ7 A;  4C3Q A;  4KZ7 A;  5TGF A;  3M6B A;  4PM7 A;  1W8Y A;  3SS5 A;  4QD4 A;  4P0M A;  4B4Z A;  5FQ9 A;  3UPO A;  2EX9 A;  4GB7 A;  3GSG A;  4KZ6 A;  1PW8 A;  4BL2 A;  4R3B A;  1MWR A;  1SKF A;  4DE3 A;  2C6W B;  3NC8 A;  5BOH A;  1Q2Q A;  1YLP A;  3WRZ A;  4K91 A;  5FSR A;  1H8Z A;  1WE4 A;  3S22 A;  4OKP A;  1W79 A;  4Y0T A;  3IF5 A;  1PW1 A;  3NDE A;  4DE0 A;  1CK3 A;  4KZA A;  1NZU A;  4WEK A;  5FQJ A;  3BLS A;  2DRW A;  2H0Y A;  2ZM2 A;  4OPQ A;  4IBR A;  1LI0 A;  2Y2O A;  5EVI C;  4PM6 A;  1J9M A;  3VSK A;  5JYP A;  5FQI A;  2Z2M B;  3HLF A;  4X56 A;  4ZBE A;  2IWC A;  4IBX A;  4DXC A;  5J8X A;  2J9O A;  4S2P A;  2Y91 A;  4GZB A;  4LEN A;  3WS0 A;  5EVI D;  1XGI A;  2H0T A;  3CG5 A;  1W8Q A;  1LL9 A;  5G18 A;  3VP1 A;  4GDB A;  1ERQ A;  2WZZ A;  3A3E A;  2V20 A;  4GD6 A;  2I72 A;  2ZLY A;  3NIA A;  4LCM A;  1SCW A;  2PU4 A;  2UWX A;  3A3I A;  1RP5 A;  5CTM A;  4BLM A;  3JYI A;  5GLC A;  2XR0 A;  4R1G A;  1XPB A;  1PWD A;  5AQ7 A;  3FWL A;  1K54 C;  4BD1 A;  3M6H A;  2EFX A;  2Y2L A;  2ZQA A;  4OP5 A;  1K4E A;  3TSG A;  4ZDX A;  3PAE A;  3UDX A;  3AGF A;  1BLH A;  4GOG A;  2P9V A;  1E3U D;  4S2M A;  5DTS A;  4BJP A;  4GKU A;  3LCE A;  4X53 A;  4WZ5 C;  2QMI A;  1I2W A;  5A90 A;  4HBU A;  1PI4 A;  1IEL A;  4HEF A;  1JWP A;  1N4O A;  5D3O A;  1L0F A;  3BLM A;  1KDS A;  2HDU A;  4KZ9 A;  1KVL A;  3HLW A;  2FFY A;  3OPP A;  3P09 A;  4D2O A;  1MKI A;  3DW0 A;  3ITB A;  3IF6 B;  3V5M A;  1MBL A;  1DJC A;  4S2J A;  5FI6 A;  4JXS A;  4KQQ A;  3CJM A;  3MZE A;  2IWD A;  4BD0 A;  5KSH A;  5TR7 A;  1NRF A;  3EQV A;  1KE0 A;  4Z9Q A;  2QPN A;  1BZA A;  4XUX A;  4OQI A;  2P9V B;  4L0L A;  2HDS A;  2Y2H A;  3UE0 A;  3VOY A;  3W4O A;  3ZDJ A;  4E3M A;  2XQZ A;  4PM8 A;  5TFQ A;  3ZHH A;  5FI7 A;  1XP4 A;  4KG5 A;  4BQM A;  5HX9 A;  2WAE A;  1RGY A;  3OCL A;  4OQG A;  4OVD A;  2J8Y A;  4WBG A;  3SH8 A;  4QY5 A;  3HLD A;  2Y2I A;  2HP6 A;  1NJ4 A;  1YLJ A;  1TVF A;  5CHU A;  3UPN A;  4MBK A;  4DRT A;  3HLG A;  1K55 A;  5JYO A;  1YLT A;  2XFT A;  2WK0 A;  4WZ4 A;  1BLP A;  5CRF A;  4EBL A;  1RGZ A;  1MPL A;  4JXV A;  4FCF A;  4M3K A;  3VP0 A;  5E2H A;  2EX8 A;  1EWZ A;  4EWF A;  1I5Q A;  1BLC A;  4RYE A;  4PM5 A;  3PBN A;  3CZD A;  3FZC A;  3LY4 A;  3RXX A;  1CI9 A;  2PU2 A;  3HVF A;  3WRT A;  1I2S A;  3GQZ A;  3O3V A;  4PMA A;  1YT4 A;  1MXO A;  1G68 A;  1NZO A;  2Z2L B;  3BM6 A;  3RXW A;  2V1Z A;  4DKI A;  4GDN A;  2WKI A;  1NY0 A;  4KZB A;  4S2L A;  4E3N A;  1NYY A;  4N92 A;  3I7J A;  3IQA A;  4B4X A;  5GLB A;  1W5D A;  2RCX A;  4LV0 A;  3ISG A;  1FCN A;  3MKE A;  5EVI A;  5FI2 A;  1JTD A;  1OME A;  4WM9 A;  4H8R A;  1E4D A;  1HZO A;  2X71 A;  2GDN A;  3A3J A;  4N1X A;  4Y0U A;  4XXR A;  3G2Z A;  4FD8 A;  5DTK A;  4ZJ3 A;  2VGJ A;  1L0E A;  4F94 A;  3NI9 A;  1FR6 A;  2HP9 A;  3TOI A;  2CC1 A;  5GLA A;  4KG6 A;  3VP4 A;  2HP5 A;  2WGW A;  4UA7 A;  1LL5 A;  2JE5 A;  2H5S A;  1YLW A;  2G2U A;  3GMW A;  3PAG A;  1K57 C;  1M40 A;  2ZD8 A;  1E3U A;  1IYS A;  3BEB A;  3M2K A;  1JWV A;  3C4O A;  3OC2 A;  5KZH A;  1ESI A;  1HD8 A;  4K0X A;  4UHU A;  4EQI A;  1XXM A;  4ZJ1 A;  5CGX A;  3C7U A;  4WEJ A;  5EVI B;  3IHA A;  4WEL A;  1KGG A;  3HUO A;  1DY6 A;  2ZC6 B;  1PZO A;  2BG1 A;  1XKZ A;  2WGI A;  4QB8 A;  4KQO A;  4WZ5 A;  3IXG A;  3VOZ A;  3ZGA B;  1GHI A;  1ZKJ A;  4JF6 A;  5A91 A;  1RCJ A;  3GRJ A;  4C6Y A;  1DJB A;  1K38 A;  5A93 A;  2WGW B;  2J9P A;  3V39 A;  1KVM A; 
#chains in the Genus database with same CATH topology
 1S6R A;  2ZC7 A;  2ZMA A;  4HES A;  4RA7 A;  3TJZ C;  1LHY A;  1N9B A;  4LV2 A;  1XGJ A;  2O0Y A;  3QNC A;  1TD5 A;  5CEC A;  5HSQ A;  3PBS A;  3IF6 A;  3BYD A;  5L09 A;  4KQD A;  3MXS A;  1FIL A;  4U3T A;  5FQQ A;  3MFX A;  3T1X A;  1BLS A;  2I9V A;  4JBF A;  2QHK A;  2OV5 A;  1H5X A;  4RX2 A;  5EOE A;  5CGS A;  1ZG4 A;  3B42 A;  5HW3 A;  4DJ2 A;  2Y55 A;  2A49 A;  3H7W A;  5HL1 A;  2V0W A;  2VA0 A;  4MCW A;  1GSX A;  4JF4 A;  4OH0 A;  1GSW A;  2KX6 A;  4ESP A;  3M2J A;  4PKY G;  3OPR A;  3N7W A;  2R9X A;  1KE3 A;  5AQA A;  5E2F A;  1K6R A;  2Z6C A;  3K3C A;  4O8G A;  4E6W A;  4EEP A;  4JPM A;  2X02 A;  3OPL A;  1OJ5 A;  4KG2 A;  3BWL A;  5EOO A;  2VGK A;  3BY8 A;  4NG2 A;  1L0D A;  1UWN X;  5HDD A;  5EPH A;  3BFF A;  2OSU A;  1P97 A;  3HUN A;  4EV4 A;  4GN2 A;  1U60 A;  1PIO A;  4S2O A;  2QWS A;  5CGW A;  1KE4 A;  4B88 A;  4UA6 A;  2NUP C;  4YWZ A;  3ZNY A;  3UNW A;  4IJG A;  4MBF A;  4QU3 A;  3KSG A;  3IXH A;  5F1F A;  2QZ6 A;  5DFX A;  3UE1 A;  4L9E A;  2JBF A;  2HDQ A;  2E8J A;  1K56 A;  3G31 A;  4X6T A;  2Y2M A;  3N8L A;  3MZF A;  4OQH A;  4ZJ2 A;  4CJN A;  1OPX A;  3MFD A;  4UQI S;  3Q7Z A;  1L2S A;  1LSW A;  2OAQ 1;  3S1Y A;  1VHM A;  4HIA A;  2XRO A;  4CLC D;  2Y4A A;  4I38 A;  3MZD A;  4OON A;  3PXP A;  1TEM A;  3DWK A;  3SH7 A;  3G6O A;  5GHX A;  1DP6 A;  1QMF A;  3MXR A;  3NOU C;  2A3U A;  2NUT C;  3QHY A;  3UB5 P;  4X68 A;  4XUZ A;  4MDZ A;  3UB9 A;  5EV0 A;  3UE3 A;  2OWH A;  5HPI A;  3UME A;  4DJ3 A;  1SDN A;  2ZMV A;  4MEZ A;  4JXW A;  3UB8 A;  3Q07 A;  3MS6 A;  4X1M A;  2JCH A;  3QP5 A;  4E3J A;  1ALQ A;  2JKR M;  1OTE A;  2A24 A;  3IH8 A;  5EUA A;  1DJA A;  1Z6F A;  5FDH A;  3V50 A;  2V2F F;  3ZG5 A;  3OCN A;  4B9O A;  3S4X A;  2ZM0 A;  3BW6 A;  4IED A;  1YQS A;  2OWJ A;  1P9W A;  5M18 A;  4HP4 A;  3UDF A;  5TBM A;  3E2K A;  3O86 A;  2WGV A;  4K0W A;  4UAA A;  1K0K A;  4I3A A;  4ID4 A;  1ES5 A;  2W1R A;  4FSF A;  5E2E A;  1G5U A;  3FV7 A;  5CTN A;  2O99 A;  3F1O B;  3N8S A;  2ZC4 B;  3Q7V A;  3VFH A;  2PBY A;  4RX3 A;  3EEA A;  3KSF A;  1YKD A;  4WMC A;  4HBT A;  2WAF A;  4KQR A;  3PBQ A;  1VEU A;  1EI5 A;  5G4Z A;  2HPB A;  5CHJ A;  5FEF A;  3BFG A;  4Y7P A;  4JXG A;  1M6K A;  1PNE A;  3E2L A;  4R3J A;  3V67 A;  1XA7 A;  2JKF A;  3FG8 A;  2EFU A;  2EWW A;  4OOL A;  2ZQ7 A;  4C3Q A;  4AFI A;  5TGF A;  3M6B A;  1Y28 A;  3U4L P;  4O0P A;  4O01 A;  4CQH A;  1EW0 A;  2EX9 A;  3GSG A;  1PW8 A;  4BL2 A;  4R3B A;  1MWR A;  4DE3 A;  3NC8 A;  1YLP A;  1H8Z A;  4Y0T A;  3IF5 A;  4GHI A;  3NDE A;  4DE0 A;  2W1T B;  2DMW A;  2EWV A;  4IBR A;  1LI0 A;  5EVI C;  4PM6 A;  1J9M A;  4X56 A;  2JHE A;  3T1Q B;  5J8X A;  2OOL A;  4LEN A;  3WS0 A;  1LL9 A;  3MR0 A;  3DTE A;  3VP1 A;  1LT0 A;  3KYQ A;  5L07 A;  2J80 A;  2B02 A;  4G3V A;  2XR0 A;  4R1G A;  2GNX A;  5HDS A;  2Y2L A;  4ZDX A;  1DP9 A;  3PAE A;  2PDR A;  1BLH A;  4GOG A;  4MN5 A;  4DN0 A;  4FUW A;  2W27 A;  4X53 A;  2QMI A;  5A90 A;  1PI4 A;  1IEL A;  1XJ2 A;  3UMD A;  1KDS A;  4JGP A;  4YNR A;  3HLW A;  3OPP A;  4BBU A;  1TS6 A;  3DW0 A;  3ITB A;  3IF6 B;  3V5M A;  1DJC A;  3T50 A;  1F9I A;  3LIC A;  5KSH A;  3EQV A;  1KE0 A;  3DTI A;  1BZA A;  4XUX A;  4OQI A;  3W4O A;  4NXG A;  4E3M A;  2GJ3 A;  3ZHH A;  2WAE A;  1RGY A;  3OCL A;  4OQG A;  4OVD A;  1OT6 A;  4NXF A;  3HLD A;  2VX8 A;  2Y2I A;  4MN6 A;  1T1A A;  1K55 A;  1BLP A;  4BWI A;  1MPL A;  4EWF A;  4PM5 A;  3PBN A;  4NEE D;  3HVF A;  1OTA A;  1YT4 A;  4LRY C;  1NZO A;  2WKI A;  4E3N A;  4N92 A;  3P01 A;  4HOI A;  5GLB A;  1FCN A;  5EVI A;  5FI2 A;  1JTD A;  1IOU A;  1OME A;  2P08 A;  1E4D A;  4Y0U A;  4XXR A;  3G2Z A;  5DTK A;  2VGJ A;  3LI8 A;  1L0E A;  1XJ6 A;  4F94 A;  3NI9 A;  1S4R A;  4WLA A;  2HP9 A;  3TOI A;  2CC1 A;  4KG6 A;  2WGW A;  2JKG A;  1LL5 A;  2G2U A;  3S7Q A;  2XSS A;  4I3J A;  3GMW A;  5C5K A;  3UB7 A;  3PAG A;  1Z09 A;  2ZOH A;  1K57 C;  1M40 A;  1E3U A;  4PHT A;  3OC2 A;  3C4O A;  1DP8 A;  1HD8 A;  4UHU A;  3IHA A;  1SKO B;  4WEL A;  1KGG A;  3JPU A;  2BG1 A;  1S4S A;  3F1P B;  4KUK A;  5DKL A;  1TS7 A;  1ZKJ A;  1RCJ A;  2L1M A;  1DJB A;  5MC7 A;  2J9P A;  2Q9M A;  2R78 A;  2PRF A;  3PYP A;  2VKS A;  4E3I A;  3N6I A;  2JKT M;  1FCO A;  2L0W A;  5F69 A;  2Y2Q A;  1ONH A;  3E0Y A;  4XT2 B;  2VLG A;  4YOF A;  4PM9 A;  4OP8 A;  5L10 A;  3QNB A;  1K56 D;  3CLO A;  1SDE A;  4FH2 A;  3G34 A;  4ETZ A;  4BEN A;  3GV9 A;  4MLL A;  3IS2 A;  3LY3 A;  3A3D A;  2OLU A;  1IYP A;  4Q0H A;  1ZTU A;  1CQA A;  1NXY A;  4DF6 A;  1JTG A;  3C4P A;  1HTZ A;  3R4K A;  3IXD A;  3C8C A;  2ZC5 B;  1VB6 A;  4R38 A;  1GA9 A;  5L2F A;  2A24 B;  1NYM A;  3WS4 A;  5HAI A;  3OZH A;  1OT9 A;  3PHY A;  4LPZ A;  3NBL A;  3C2W A;  4U0X A;  5IHV A;  5HAP A;  5FAQ A;  5HAR A;  4Q0J A;  1K4F A;  3LYX A;  2Y2G A;  2PT7 A;  2G2W A;  1K57 A;  1FCM A;  4DDY A;  1KOU A;  4ME4 A;  4FH4 A;  1MWT A;  2WAD A;  5TBM B;  1QME A;  3NY4 A;  3IX8 A;  3LO7 A;  5EE8 A;  3T1R A;  1KGF A;  2WKE A;  2XEP A;  4MNR A;  3BRM A;  5I94 A;  4IVI A;  1G28 A;  1VQQ A;  3A3F A;  5E2G A;  3NCK A;  2EX2 A;  4PAU A;  1O7E A;  5LBR A;  4NK3 A;  1VEU B;  2Q0O A;  1WYC A;  3CHW P;  1H0M A;  3PBT A;  2B95 A;  3E4O A;  4GD8 A;  2ZL1 A;  1JVJ A;  2YKH A;  2XGN A;  3LIB A;  1YAX A;  4WMC D;  2J3T D;  3H9W A;  3OBF A;  4GS9 B;  4KZ8 A;  1LSX A;  3B3X A;  5J4E A;  3VE3 A;  3Q81 A;  1D7E A;  1GCE A;  1ODV A;  2WYX A;  2FZ0 A;  4N1H A;  3SOI A;  3UN7 A;  1MWS A;  4R3A A;  2G7U A;  4OPY A;  2V9A A;  5F82 A;  1PWG A;  1Y4O A;  2ZBB A;  4LLO B;  3IXB A;  1VET A;  5FAO A;  1IYQ A;  2UV0 E;  4OLG A;  3T12 B;  5DTT A;  3RFB A;  5DJU A;  3IT9 A;  4GNU A;  4E3L A;  3G30 A;  3ZNT A;  3DWZ A;  2CMN A;  1FIK A;  5AVE A;  4OOY A;  3WS5 A;  2VV8 A;  1MKM A;  2WUQ A;  3IBR A;  3VMA A;  4LV3 A;  4YFM A;  5L8M A;  1IKG A;  1W7F A;  2DNS A;  1VM1 A;  3CMZ A;  1GA0 A;  4R6L A;  2XLN A;  4EER A;  3BEC A;  4KEN B;  2O9A A;  2PYP A;  2JN7 A;  5FAS A;  3PTE A;  3UO9 A;  1BT5 A;  4NET A;  2BLS A;  3ZG8 B;  2Z6D A;  1H8Y A;  2XDM A;  1K25 A;  5FAT A;  5DF8 A;  4P85 A;  4ETX A;  4YIN A;  3CPT B;  5A92 A;  3A0S A;  1FQG A;  4DDS A;  2PYR A;  5GHY A;  5FQM A;  1PYY A;  4CLC B;  1BUL A;  3IWO A;  1NLY A;  3O88 A;  3ITA A;  4Y13 A;  1UGU A;  1ESU A;  3FPW A;  3NDG A;  3WS2 A;  3ICY A;  4PM7 A;  4P0M A;  4B4Z A;  3NUL A;  3UPO A;  4GB7 A;  4KZ6 A;  1WE4 A;  4OKP A;  4ZRR A;  1CK3 A;  1D06 A;  1NZU A;  4WEK A;  5FQJ A;  4BMW A;  3BLS A;  1OTB A;  2H0Y A;  5FQI A;  1XFQ A;  3IX4 A;  2IWC A;  2J9O A;  3QP1 A;  2QKP A;  5EVI D;  2WZZ A;  4GD6 A;  2ZLY A;  4X25 A;  3C38 A;  4M4X A;  2UWX A;  3A3I A;  1XPB A;  3QP2 A;  1PWD A;  1K54 C;  4BD1 A;  4L9G A;  1K4E A;  3AGF A;  1NRJ A;  4FOF A;  1E3U D;  4LRX C;  4GKU A;  1I2W A;  4HBU A;  4II7 A;  4QPR A;  1JWP A;  3BLM A;  3ZYT A;  3P09 A;  4HHD A;  2BAS A;  4EUV A;  4F3L B;  5FI6 A;  4NKP A;  2IWD A;  4HQA A;  4Z9Q A;  3UE0 A;  2P9V B;  3VOY A;  2XQZ A;  4PM8 A;  1S1Y A;  5TFQ A;  4ARZ A;  5FI7 A;  1XP4 A;  4KG5 A;  1OTD A;  3SH8 A;  3TW8 A;  2J8Y A;  1NJ4 A;  1YLJ A;  2J3W A;  4Q0I A;  3LIF A;  2ZOI A;  5JYO A;  4I5S A;  1YLT A;  1NLZ A;  2XFT A;  4GJ4 A;  3LR3 A;  4EEU A;  1EWZ A;  2INW A;  1BLC A;  1G6O A;  1CI9 A;  2PU2 A;  4Z1W A;  1I2S A;  2WKP A;  3O3V A;  5K5B A;  1G68 A;  3RXW A;  1L3L A;  4GDN A;  1NY0 A;  4S2L A;  3I7J A;  4MN7 A;  1IFQ A;  1W5D A;  4LV0 A;  1OTI A;  3MKE A;  5HPF A;  2X71 A;  1T18 A;  1FR6 A;  2VV6 A;  3VP4 A;  3D72 A;  4UA7 A;  1YLW A;  2ZD8 A;  1IYS A;  3BEB A;  1JWV A;  1ESI A;  4GLQ A;  4EQI A;  4ZJ1 A;  3C7U A;  3H82 B;  3HUO A;  1DY6 A;  3EWK A;  1PZO A;  1XKZ A;  3IXG A;  2GX5 A;  2B18 A;  3QP6 A;  5A91 A;  3IWQ A;  1LLB A;  5IU1 A;  5KMW A;  3C7V A;  5AQ9 A;  4RVA A;  3GEC A;  1HLU P;  3IHB A;  4HJ4 A;  3W8K A;  2ZJ9 A;  3WS1 A;  4DE2 A;  4S2N C;  1TS0 A;  5GL9 A;  1E25 A;  2A2L A;  4Y2F A;  3CIT A;  1ES3 A;  3HCY A;  1MWU A;  4X1L A;  1L0G A;  4GW9 A;  3P98 A;  4LCL A;  3VP2 A;  4HJ3 A;  3LFV A;  4Y5F A;  1F5M A;  1ONG A;  4ZAM A;  2AVX A;  2O9C A;  4K08 A;  4R23 A;  2V0U A;  3T4Q A;  1TDG A;  1GHP A;  2P74 A;  4IUH A;  3RJU A;  2WKH A;  3SZT A;  3IH9 A;  3R7W A;  3TE8 A;  1PFL A;  1FR1 A;  4BBV A;  5G4Y A;  5GLD A;  5DF7 A;  4EBP A;  5HFO A;  1H3Q A;  2ZQ9 A;  2IWB A;  4C75 A;  3H7W B;  3MQQ A;  4JKT A;  3FKW A;  2KOI A;  5EFW A;  4OLD A;  5EM0 A;  1LL8 A;  2PR6 A;  3VSL A;  4H6J A;  2FFF B;  2Y8H A;  1BSG A;  2W3F A;  3VP3 A;  5HD3 A;  4OQ0 A;  3NOP C;  1XFN A;  3L9K A;  2B5R A;  2DCF A;  3ZFZ A;  5TJJ A;  4G3K A;  2QJ5 A;  4DE1 A;  1N9N A;  2OLV A;  1YPR A;  1MC0 A;  3LI9 A;  2ZC3 B;  4HNB A;  4EW7 A;  3GTC A;  2JC7 A;  3AGD A;  3CUE C;  4LGW A;  1WYB A;  4S2N A;  5FAP A;  3DTK A;  1PRQ A;  1PI5 A;  2XK1 A;  4ZTK A;  4Y0O A;  3DTM A;  2YKF A;  3MXQ A;  4I39 A;  2KDK A;  3FC7 A;  3UDI A;  5HDC A;  4IUK A;  3GR2 A;  5F6A A;  1XA1 A;  1ERM A;  3HUM A;  1G6A A;  3T4K A;  3D4F A;  4QHC A;  5U47 A;  4QJG A;  1J3W A;  4Q8I A;  4DMZ A;  1TS8 A;  1ZC2 A;  5AQB A;  1BUE A;  3HL9 A;  3K3D A;  1MZU A;  2V8F A;  4QY6 A;  1Y54 A;  4HY8 A;  1TDL A;  3LIA A;  5HD5 A;  3TG9 A;  4LV1 A;  4R4S A;  3G35 A;  5HWT A;  3QP8 A;  1XX2 A;  4JF5 A;  3MBZ A;  1CEF A;  5DF9 A;  1AXB A;  5FQK A;  2V8C A;  3N4I A;  2PR5 A;  3TRC A;  4E3O A;  3F1O A;  3NEC A;  3BQA A;  3Q82 A;  3FKV A;  5AJG A;  1AWI A;  2V1A A;  2XH9 A;  4P6B A;  5CHM A;  2XF3 A;  3AGE A;  5CED A;  3BQ8 A;  4E6X A;  4EUZ A;  5HAQ A;  1ES4 A;  3UY6 A;  4KZ4 A;  3CUE A;  3OPH A;  2OAP 1;  2Y79 A;  3IF6 C;  2GZA A;  2Y2J A;  2W3D A;  2VGL M;  3SS3 A;  1GHM A;  5DVA A;  3W4P A;  4OPR A;  3JVV A;  3ZG0 A;  3D9Y A;  3T4L A;  3FYZ A;  4MBH A;  1YSP A;  5DJT A;  4CPK A;  5CEB A;  1SHV A;  3G2Y A;  3QP4 A;  5M19 A;  4ARZ B;  4DXB A;  3Q7V B;  5I5L A;  3OOV A;  3LR5 A;  2PBD P;  1KDW A;  2K31 A;  3HLE A;  2W1T A;  5KSC A;  1T1B A;  3F1N A;  2ZMF A;  4E04 A;  1W8Y A;  2VEA A;  2HGV A;  2EA9 A;  5EM1 A;  2JKT I;  3BJN A;  3E4Q A;  1GSV A;  1Q2Q A;  4RQ9 A;  4K91 A;  5FSR A;  4EQ1 A;  2PD8 A;  1PW1 A;  4JGQ A;  2QJ7 A;  1F2K A;  2DRW A;  2ZM2 A;  4OPQ A;  2Y2O A;  1T1C A;  3VSK A;  5JYP A;  2Z2M B;  3HLF A;  4ZBE A;  2M7U A;  4DXC A;  2Y91 A;  4GZB A;  2H0T A;  3CG5 A;  3BY9 A;  1W8Q A;  5IT5 A;  4GDB A;  3A3E A;  4LCM A;  2I72 A;  1NWZ A;  2LB9 A;  1RP5 A;  4BLM A;  5GLC A;  4Y3I A;  4GHI B;  5HWV A;  5AQ7 A;  3FWL A;  2ZQA A;  3MJQ A;  4WF0 A;  3T4O A;  1WA9 A;  3UDX A;  4P6Z M;  3LR4 A;  4S2M A;  5DTS A;  2W3G A;  1BYW A;  3MQO A;  3KSH A;  3ZQ5 A;  4D60 A;  3PR6 A;  1MBL A;  4S2J A;  3CJM A;  3MZE A;  4BD0 A;  3MMH A;  2QPN A;  3ZDJ A;  3KO6 A;  4BQM A;  4WBG A;  4GCZ A;  4I3I A;  2HP6 A;  1TVF A;  3HJI A;  5CHU A;  2HZ5 A;  4DRT A;  5CRF A;  2KLI A;  4WZ4 A;  1RGZ A;  4M3K A;  3VP0 A;  5E2H A;  4RYE A;  4Y17 A;  3CZD A;  3FZC A;  3R7W B;  5F68 A;  2PAV P;  3WRT A;  3NOT C;  4PMA A;  3A0V A;  1MXO A;  2Z2L B;  2V1Z A;  4DKI A;  3VV4 A;  2RCX A;  1SKO A;  4WM9 A;  3A3J A;  4ZJ3 A;  3F1P A;  4FD8 A;  4HH3 A;  1P0Z A;  1H8M A;  4MMN A;  5GLA A;  2JE5 A;  2H5S A;  4H6J B;  5J7E A;  2ACG A;  5KZH A;  4K0X A;  4KUO A;  4WEJ A;  5EVI B;  4XT2 A;  2J3T C;  5CX7 A;  4QB8 A;  4KQO A;  3OLO A;  3VOZ A;  2M1C A;  1GHI A;  4JF6 A;  5A93 A;  2WGW B;  3V39 A;  1ZG6 A;  4LRZ E;  2VGL S;  2V1B A;  1CF0 A;  3HRE A;  2W3H A;  3HBR A;  4KZ3 A;  5HWW A;  2EXA A;  2Y2P A;  5CER A;  3PBO A;  3B33 A;  1PWC A;  2ZQD A;  2HF6 A;  1CJF A;  1YMS A;  4HI4 A;  5AVF A;  3O87 A;  3EQU A;  5EEC A;  1MY8 A;  4E3K A;  2C5W B;  2FH5 A;  1V9Z A;  1ERO A;  1T19 A;  3C30 A;  5HL6 A;  5E43 A;  5F5Y A;  2R9W A;  1BTL A;  1F98 A;  4EES A;  3JVU A;  3E4P A;  2P04 A;  2ZQ8 A;  1CEG A;  4N9L A;  1YM1 A;  1D1J A;  5F1G A;  3EGD C;  3ZG9 B;  3IS2 B;  3K2N A;  1LI9 A;  3KYE A;  4Y15 A;  1XJ4 A;  3U2A A;  2H10 A;  3N8R A;  5EVE A;  1W63 Q;  3S7O A;  2WZX A;  1XJ3 A;  4P87 A;  2L4R A;  3NHQ A;  4HP9 A;  3PBR A;  3UPP A;  3LR0 A;  3W4Q A;  5IS1 A;  1N9O A;  1CI8 A;  3Q1F A;  2Y2N A;  2M7V A;  3ULF A;  2Y2K A;  3ZG7 B;  4L9F A;  3VE4 A;  2X01 A;  1Q2P A;  4B93 A;  3IBJ A;  3D3O A;  1K6S A;  5F83 A;  1DRM A;  4JLF A;  4P6Z S;  5EVL A;  4GS9 A;  3V3R A;  2PHY A;  2ZQC A;  1YLZ A;  2RL3 A;  3V3S A;  4S2K A;  1S1Z A;  3SS4 A;  1K54 A;  4X69 A;  2XD1 A;  4CLC C;  3GVB A;  2HDR A;  1ZHH B;  1K55 C;  4IVK A;  3CWF A;  3BFC A;  1O07 A;  2JKR I;  5GHZ A;  3CI6 A;  3LEQ A;  3BFD A;  3G4P A;  3W2Z A;  1YSQ A;  4PPR A;  3IWI A;  1KGE A;  4WUJ A;  4WL9 A;  4S2I A;  3O5Y A;  1FSY A;  3ZCZ A;  2Y59 A;  4OPZ A;  4G3W A;  3EOI A;  2VK3 A;  2XA7 M;  1W63 M;  3F1N B;  4U0T A;  3T1S A;  3HJK A;  2ZL1 B;  1IYO A;  4O7D A;  4JGO A;  2BTF P;  2PD7 A;  1FOF A;  1JWZ A;  4JGR A;  5DFY A;  3ZVT A;  4EU0 A;  1IKI A;  3T4J A;  1S0W A;  1YMX A;  2EX6 A;  4UA9 A;  3C5A A;  2IA2 A;  2W3E A;  2ZM8 A;  4WYY A;  3BFE A;  4R4R A;  2WKQ A;  1YLY A;  1FSW A;  3SH9 A;  1IEM A;  3S7N A;  4NXE A;  2EXB A;  2D02 A;  4CLC E;  1ES2 A;  2HV1 A;  2XFS A;  1VET B;  5KIZ A;  4OOM A;  3HLC A;  4EBN A;  1N9L A;  1C3B A;  5FA7 A;  4QWO A;  3L7H A;  3VFF A;  3B47 A;  2Q9N A;  3CPT A;  3S7P A;  2VZW A;  2E8I A;  4HJ6 A;  2K7S A;  3RH8 B;  4LFU A;  1HVB A;  3HLB A;  4CLC A;  3MKF A;  2J7V A;  4A5R A;  4N9K A;  4BL3 A;  1SZV A;  4PKY A;  4R0Q A;  2H28 A;  1OJG A;  1ACF A;  2XD5 A;  4X55 A;  3KSI A;  3ZVW A;  4NXB A;  5A8B A;  3WWX A;  3DAV A;  5CXW A;  4WN5 A;  4UEY A;  2WKR A;  1PZP A;  2QYB A;  2VJW A;  3LIE A;  3A0R A;  4KZ5 A;  1S66 L;  3E98 A;  3MQ0 A;  5FDS A;  3MF0 A;  5M1A A;  1V9Y A;  2LB5 A;  3G32 A;  3LEZ A;  4KZ7 A;  3T4T A;  3SW1 A;  3SS5 A;  4QD4 A;  5DKK A;  3UB6 A;  3KX0 X;  3EGX C;  5FEG A;  5FQ9 A;  1SKF A;  2O9B A;  2C6W B;  4BBT A;  5BOH A;  3WRZ A;  4EET B;  3S22 A;  1W79 A;  3KYZ A;  2HJE A;  4KZA A;  1A0K A;  3IX3 A;  4IBX A;  4S2P A;  2VV7 A;  3NJA A;  1XGI A;  5G18 A;  1ERQ A;  2V20 A;  3NIA A;  1LSV A;  1SCW A;  2PU4 A;  5CTM A;  4R70 A;  3JYI A;  4F3L A;  3M6H A;  2EFX A;  4OP5 A;  3TSG A;  4EXO A;  2P9V A;  4BJP A;  3LCE A;  4WZ5 C;  1STZ A;  2XRN A;  2HJ9 C;  4HEF A;  1N4O A;  5D3O A;  3EEH A;  1L0F A;  3UE6 A;  2HDU A;  4KZ9 A;  4UQI M;  1KVL A;  2FFY A;  5FL3 A;  2W0N A;  3DBA A;  4D2O A;  1MKI A;  2MJ6 A;  4FTX A;  4JXS A;  4KQQ A;  2P7J A;  3MSH A;  1NRF A;  5TR7 A;  4L0L A;  2HDS A;  2Y2H A;  5HX9 A;  4QY5 A;  3UPN A;  4MBK A;  2K2N A;  3HLG A;  3CAX A;  4EBL A;  2WK0 A;  4IHQ A;  4JXV A;  4FCF A;  5J3W A;  1X0O A;  2EX8 A;  1I5Q A;  4HH2 A;  2XA7 S;  3LY4 A;  3RXX A;  3LUQ A;  3GQZ A;  2D01 A;  3GDI A;  3BM6 A;  4KZB A;  1NYY A;  3FPV A;  3IQA A;  4B4X A;  3H82 A;  3ISG A;  3LGO A;  4H8R A;  1HZO A;  2GDN A;  4N1X A;  1TF1 A;  3P7N A;  3RTY A;  2HP5 A;  3M2K A;  5HZH A;  1P9R A;  1XXM A;  5CGX A;  3LID A;  2ZC6 B;  1S67 L;  2WGI A;  1UWP X;  4WZ5 A;  3ZGA B;  3T4S A;  3GRJ A;  1JNU A;  4C6Y A;  3VOL A;  1K38 A;  1KVM A; 
#chains in the Genus database with same CATH homology
 1ZG6 A;  1S6R A;  2ZC7 A;  2ZMA A;  3IWQ A;  2Q9M A;  1LLB A;  5KMW A;  4HES A;  4RA7 A;  3C7V A;  1LHY A;  1N9B A;  4RVA A;  5AQ9 A;  4LV2 A;  1XGJ A;  3IHB A;  3W8K A;  4E3I A;  2ZJ9 A;  3N6I A;  3WS1 A;  4DE2 A;  4S2N C;  3HRE A;  3QNC A;  5GL9 A;  1E25 A;  1FCO A;  5CEC A;  3HBR A;  2Y2Q A;  1ONH A;  3PBS A;  4KZ3 A;  1ES3 A;  2EXA A;  3BYD A;  3IF6 A;  4PM9 A;  1MWU A;  4OP8 A;  2Y2P A;  3QNB A;  1K56 D;  1SDE A;  3MXS A;  3PBO A;  4FH2 A;  5CER A;  1L0G A;  1PWC A;  3P98 A;  2ZQD A;  3G34 A;  4U3T A;  4LCL A;  3VP2 A;  5FQQ A;  1BLS A;  1YMS A;  1ONG A;  4BEN A;  3O87 A;  3EQU A;  4JBF A;  3GV9 A;  4ZAM A;  2OV5 A;  4MLL A;  1H5X A;  5EEC A;  1MY8 A;  3LY3 A;  4RX2 A;  4E3K A;  5EOE A;  5CGS A;  1ZG4 A;  2C5W B;  4R23 A;  3A3D A;  2OLU A;  1IYP A;  1ERO A;  5HW3 A;  5E43 A;  2Y55 A;  2A49 A;  1NXY A;  1TDG A;  5HL1 A;  1GHP A;  2P74 A;  4DF6 A;  1JTG A;  2R9W A;  1BTL A;  3RJU A;  2WKH A;  3C4P A;  1HTZ A;  4JF4 A;  4OH0 A;  3IXD A;  2ZQ8 A;  3IH9 A;  1FR1 A;  1CEG A;  2ZC5 B;  5GLD A;  4N9L A;  5DF7 A;  4EBP A;  1YM1 A;  1GA9 A;  3M2J A;  5L2F A;  3OPR A;  5F1G A;  1NYM A;  3ZG9 B;  5HFO A;  3N7W A;  3WS4 A;  2R9X A;  1KE3 A;  1LI9 A;  5AQA A;  2ZQ9 A;  5E2F A;  1K6R A;  5HAI A;  2IWB A;  3OZH A;  4C75 A;  3NBL A;  5IHV A;  2H10 A;  4U0X A;  4E6W A;  5HAP A;  4JPM A;  3N8R A;  2X02 A;  3OPL A;  4JKT A;  5FAQ A;  5HAR A;  2WZX A;  3FKW A;  4P87 A;  4KG2 A;  5EOO A;  1K4F A;  2Y2G A;  3PBR A;  2G2W A;  1K57 A;  3UPP A;  4OLD A;  2VGK A;  3W4Q A;  1FCM A;  1L0D A;  3VSL A;  4DDY A;  2FFF B;  1BSG A;  4FH4 A;  1MWT A;  5EPH A;  2WAD A;  1CI8 A;  3BFF A;  3VP3 A;  3Q1F A;  1QME A;  2Y2N A;  2OSU A;  3NY4 A;  4OQ0 A;  3LO7 A;  5EE8 A;  3HUN A;  4EV4 A;  2B5R A;  2Y2K A;  4GN2 A;  2DCF A;  3ZG7 B;  3ZFZ A;  1U60 A;  1PIO A;  4S2O A;  5CGW A;  1KGF A;  4DE1 A;  1KE4 A;  2OLV A;  2WKE A;  2XEP A;  4UA6 A;  4B88 A;  3ZNY A;  2X01 A;  3UNW A;  1Q2P A;  4QU3 A;  4MBF A;  3IXH A;  5F1F A;  1K6S A;  5F83 A;  2QZ6 A;  2ZC3 B;  4MNR A;  3GTC A;  3UE1 A;  2JC7 A;  3BRM A;  3AGD A;  4JLF A;  5I94 A;  2JBF A;  2HDQ A;  5EVL A;  4IVI A;  3V3R A;  1WYB A;  4S2N A;  5FAP A;  1K56 A;  2ZQC A;  3G31 A;  4X6T A;  1VQQ A;  1YLZ A;  2Y2M A;  3A3F A;  2RL3 A;  5E2G A;  3V3S A;  3N8L A;  3NCK A;  4S2K A;  1PI5 A;  1K54 A;  3MZF A;  4OQH A;  2EX2 A;  2XK1 A;  4X69 A;  4ZJ2 A;  3SS4 A;  4CJN A;  1O7E A;  4ZTK A;  3MFD A;  4NK3 A;  2XD1 A;  3GVB A;  1WYC A;  4Y0O A;  2HDR A;  3Q7Z A;  1L2S A;  3PBT A;  3DTM A;  3S1Y A;  1K55 C;  4IVK A;  4GD8 A;  1JVJ A;  3BFC A;  2XGN A;  3UDI A;  1O07 A;  2Y4A A;  3MZD A;  3GR2 A;  4OON A;  1XA1 A;  5GHZ A;  1ERM A;  3HUM A;  1G6A A;  4WMC D;  1TEM A;  4KZ8 A;  3DWK A;  3SH7 A;  3BFD A;  3B3X A;  3D4F A;  4QHC A;  5U47 A;  5GHX A;  3G4P A;  4QJG A;  4Q8I A;  3Q81 A;  1QMF A;  1ZC2 A;  3MXR A;  2A3U A;  4PPR A;  3QHY A;  1GCE A;  3IWI A;  5AQB A;  1BUE A;  3HL9 A;  1KGE A;  2WYX A;  4X68 A;  4S2I A;  4XUZ A;  1FSY A;  4N1H A;  3UE3 A;  3ZCZ A;  3SOI A;  3UN7 A;  2Y59 A;  4OPZ A;  1MWS A;  1Y54 A;  4QY6 A;  1TDL A;  4U0T A;  1IYO A;  1SDN A;  4MEZ A;  4JXW A;  4OPY A;  4O7D A;  3Q07 A;  3TG9 A;  4LV1 A;  4R4S A;  1FOF A;  1JWZ A;  3G35 A;  2JCH A;  5F82 A;  1PWG A;  4E3J A;  1ALQ A;  3IXB A;  3ZVT A;  1IKI A;  1S0W A;  1YMX A;  1XX2 A;  2EX6 A;  4UA9 A;  5FAO A;  3C5A A;  3IH8 A;  3MBZ A;  4JF5 A;  1IYQ A;  4OLG A;  5EUA A;  1DJA A;  1Z6F A;  2ZM8 A;  4WYY A;  1CEF A;  5FDH A;  3BFE A;  3V50 A;  2V2F F;  5DTT A;  5DF9 A;  4R4R A;  3ZG5 A;  3IT9 A;  1AXB A;  3OCN A;  4GNU A;  5FQK A;  3N4I A;  1YLY A;  3S4X A;  1FSW A;  3SH9 A;  3G30 A;  2ZM0 A;  3ZNT A;  4E3L A;  4E3O A;  1IEM A;  3DWZ A;  4IED A;  2EXB A;  3Q82 A;  1YQS A;  3FKV A;  1ES2 A;  2XH9 A;  4OOY A;  5M18 A;  3WS5 A;  2XFS A;  4P6B A;  2WUQ A;  3UDF A;  3VMA A;  5CHM A;  2XF3 A;  4OOM A;  3HLC A;  3AGE A;  4LV3 A;  4EBN A;  1C3B A;  5CED A;  5FA7 A;  3E2K A;  3O86 A;  4YFM A;  2WGV A;  1IKG A;  4K0W A;  4UAA A;  4E6X A;  4EUZ A;  4ID4 A;  1ES5 A;  5HAQ A;  4FSF A;  1ES4 A;  5E2E A;  4KZ4 A;  3UY6 A;  3OPH A;  3VFF A;  1W7F A;  2DNS A;  1VM1 A;  3FV7 A;  3CMZ A;  5CTN A;  1GA0 A;  2XLN A;  2Q9N A;  3N8S A;  3IF6 C;  2E8I A;  2ZC4 B;  2Y2J A;  3Q7V A;  3VFH A;  3SS3 A;  3BEC A;  4KEN B;  1HVB A;  1GHM A;  2PBY A;  4RX3 A;  3HLB A;  3MKF A;  2J7V A;  4A5R A;  4N9K A;  4BL3 A;  5DVA A;  5FAS A;  4WMC A;  3PTE A;  4HBT A;  2WAF A;  4KQR A;  3UO9 A;  1BT5 A;  4R0Q A;  3W4P A;  4NET A;  4OPR A;  2BLS A;  3ZG8 B;  3ZG0 A;  3PBQ A;  2XD5 A;  1H8Y A;  4X55 A;  1EI5 A;  1K25 A;  2XDM A;  3FYZ A;  4MBH A;  5DF8 A;  5FAT A;  3ZVW A;  4CPK A;  4P85 A;  5CEB A;  1SHV A;  4YIN A;  3WWX A;  5A92 A;  2HPB A;  3G2Y A;  5CHJ A;  5CXW A;  5M19 A;  1FQG A;  4DDS A;  5GHY A;  4DXB A;  3Q7V B;  3BFG A;  5FQM A;  4Y7P A;  1PYY A;  1PZP A;  4JXG A;  1M6K A;  1BUL A;  3IWO A;  3E2L A;  3O88 A;  4R3J A;  1KDW A;  3ITA A;  4KZ5 A;  1ESU A;  1XA7 A;  3NDG A;  2EFU A;  3HLE A;  4OOL A;  3WS2 A;  5M1A A;  5KSC A;  3G32 A;  3LEZ A;  2ZQ7 A;  4C3Q A;  4KZ7 A;  5TGF A;  3M6B A;  4PM7 A;  1W8Y A;  3SS5 A;  4QD4 A;  4P0M A;  4B4Z A;  5FQ9 A;  3UPO A;  2EX9 A;  4GB7 A;  3GSG A;  4KZ6 A;  1PW8 A;  4BL2 A;  4R3B A;  1MWR A;  1SKF A;  4DE3 A;  2C6W B;  3NC8 A;  5BOH A;  1Q2Q A;  1YLP A;  3WRZ A;  4K91 A;  5FSR A;  1H8Z A;  1WE4 A;  3S22 A;  4OKP A;  1W79 A;  4Y0T A;  3IF5 A;  1PW1 A;  3NDE A;  4DE0 A;  1CK3 A;  4KZA A;  1NZU A;  4WEK A;  5FQJ A;  3BLS A;  2DRW A;  2H0Y A;  2ZM2 A;  4OPQ A;  4IBR A;  1LI0 A;  2Y2O A;  5EVI C;  4PM6 A;  1J9M A;  3VSK A;  5JYP A;  5FQI A;  2Z2M B;  3HLF A;  4X56 A;  4ZBE A;  2IWC A;  4IBX A;  4DXC A;  5J8X A;  2J9O A;  4S2P A;  2Y91 A;  4GZB A;  4LEN A;  3WS0 A;  5EVI D;  1XGI A;  2H0T A;  3CG5 A;  1W8Q A;  1LL9 A;  5G18 A;  3VP1 A;  4GDB A;  1ERQ A;  2WZZ A;  3A3E A;  2V20 A;  4GD6 A;  2I72 A;  2ZLY A;  3NIA A;  4LCM A;  1SCW A;  2PU4 A;  2UWX A;  3A3I A;  1RP5 A;  5CTM A;  4BLM A;  3JYI A;  5GLC A;  2XR0 A;  4R1G A;  1XPB A;  1PWD A;  5AQ7 A;  3FWL A;  1K54 C;  4BD1 A;  3M6H A;  2EFX A;  2Y2L A;  2ZQA A;  4OP5 A;  1K4E A;  3TSG A;  4ZDX A;  3PAE A;  3UDX A;  3AGF A;  1BLH A;  4GOG A;  2P9V A;  1E3U D;  4S2M A;  5DTS A;  4BJP A;  4GKU A;  3LCE A;  4X53 A;  4WZ5 C;  2QMI A;  1I2W A;  5A90 A;  4HBU A;  1PI4 A;  1IEL A;  4HEF A;  1JWP A;  1N4O A;  5D3O A;  1L0F A;  3BLM A;  1KDS A;  2HDU A;  4KZ9 A;  1KVL A;  3HLW A;  2FFY A;  3OPP A;  3P09 A;  4D2O A;  1MKI A;  3DW0 A;  3ITB A;  3IF6 B;  3V5M A;  1MBL A;  1DJC A;  4S2J A;  5FI6 A;  4JXS A;  4KQQ A;  3CJM A;  3MZE A;  2IWD A;  4BD0 A;  5KSH A;  5TR7 A;  1NRF A;  3EQV A;  1KE0 A;  4Z9Q A;  2QPN A;  1BZA A;  4XUX A;  4OQI A;  2P9V B;  4L0L A;  2HDS A;  2Y2H A;  3UE0 A;  3VOY A;  3W4O A;  3ZDJ A;  4E3M A;  2XQZ A;  4PM8 A;  5TFQ A;  3ZHH A;  5FI7 A;  1XP4 A;  4KG5 A;  4BQM A;  5HX9 A;  2WAE A;  1RGY A;  3OCL A;  4OQG A;  4OVD A;  2J8Y A;  4WBG A;  3SH8 A;  4QY5 A;  3HLD A;  2Y2I A;  2HP6 A;  1NJ4 A;  1YLJ A;  1TVF A;  5CHU A;  3UPN A;  4MBK A;  4DRT A;  3HLG A;  1K55 A;  5JYO A;  1YLT A;  2XFT A;  2WK0 A;  4WZ4 A;  1BLP A;  5CRF A;  4EBL A;  1RGZ A;  1MPL A;  4JXV A;  4FCF A;  4M3K A;  3VP0 A;  5E2H A;  2EX8 A;  1EWZ A;  4EWF A;  1I5Q A;  1BLC A;  4RYE A;  4PM5 A;  3PBN A;  3CZD A;  3FZC A;  3LY4 A;  3RXX A;  1CI9 A;  2PU2 A;  3HVF A;  3WRT A;  1I2S A;  3GQZ A;  3O3V A;  4PMA A;  1YT4 A;  1MXO A;  1G68 A;  1NZO A;  2Z2L B;  3BM6 A;  3RXW A;  2V1Z A;  4DKI A;  4GDN A;  2WKI A;  1NY0 A;  4KZB A;  4S2L A;  4E3N A;  1NYY A;  4N92 A;  3I7J A;  3IQA A;  4B4X A;  5GLB A;  1W5D A;  2RCX A;  4LV0 A;  3ISG A;  1FCN A;  3MKE A;  5EVI A;  5FI2 A;  1JTD A;  1OME A;  4WM9 A;  4H8R A;  1E4D A;  1HZO A;  2X71 A;  2GDN A;  3A3J A;  4N1X A;  4Y0U A;  4XXR A;  3G2Z A;  4FD8 A;  5DTK A;  4ZJ3 A;  2VGJ A;  1L0E A;  4F94 A;  3NI9 A;  1FR6 A;  2HP9 A;  3TOI A;  2CC1 A;  5GLA A;  4KG6 A;  3VP4 A;  2HP5 A;  2WGW A;  4UA7 A;  1LL5 A;  2JE5 A;  2H5S A;  1YLW A;  2G2U A;  3GMW A;  3PAG A;  1K57 C;  1M40 A;  2ZD8 A;  1E3U A;  1IYS A;  3BEB A;  3M2K A;  1JWV A;  3C4O A;  3OC2 A;  5KZH A;  1ESI A;  1HD8 A;  4K0X A;  4UHU A;  4EQI A;  1XXM A;  4ZJ1 A;  5CGX A;  3C7U A;  4WEJ A;  5EVI B;  3IHA A;  4WEL A;  1KGG A;  3HUO A;  1DY6 A;  2ZC6 B;  1PZO A;  2BG1 A;  1XKZ A;  2WGI A;  4QB8 A;  4KQO A;  4WZ5 A;  3IXG A;  3VOZ A;  3ZGA B;  1GHI A;  1ZKJ A;  4JF6 A;  5A91 A;  1RCJ A;  3GRJ A;  4C6Y A;  1DJB A;  1K38 A;  5A93 A;  2WGW B;  2J9P A;  3V39 A;  1KVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...