5FQQA

Last common ancestor of gram-negative bacteria (gnca4) beta-lactamase class a
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
262
structure length
262
Chain Sequence
AALSEQLAELEKRSGGRLGVAVLDTATGRRFGYRGDERFPMCSTFKALLAAAVLARVDQGKENLDRRITYGKEDLVDYSPVTEKHVGDGMTVAELCEAAITYSDNTAANLLLEALGGPAALTAFLRSIGDNVTRLDRWEPELNTAAPGDPRDTTTPAAMAATLRTLLLGDVLSPASRQQLVDWLIANKTGDKRLRAGLPADWRVGDKTGTGEHGTTNDIAVIWPPNRAPILVAVYLTESQVDADARDAVIAEVARLVVAAFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GNCA4 LACTAMASE
publication title De novo active sites for resurrected Precambrian enzymes.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Hydrolase
total genus 95
structure length 262
sequence length 262
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5fqqA00
5A92A 4LCMA 2H5SA 1K4FA 3HLWA 1GHPA 4OKPA 3UPNA 4PPRA 4DKIA 3UO9A 3WS5A 2XFSA 4U3TA 5HAQA 2XLNA 1L0GA 3G2YA 4RVAA 3C7UA 3IWOA 5CHJA 3C5AA 1W8QA 4XXRA 5HAIA 1XP4A 3G30A 3Q7VA 3Q82A 4OPQA 2WZZA 4JPMA 3CZDA 3PBNA 4GZBA 5CGSA 5DF9A 1ERMA 2BLSA 3HREA 4EBLA 1RCJA 1EROA 2X02A 3IXHA 1NYYA 3LCEA 4OPRA 1MWRA 1L0DA 2RL3A 1XX2A 3GR2A 5CGXA 4E3OA 1EI5A 1ES5A 2G2UA 3IF6A 4QY6A 3A3EA 3MKEA 2WADA 2Y2KA 1RGYA 4P0MA 3DWKA 1ERQA 1K56A 3WS0A 4FH4A 1BLHA 1IYPA 1E3UD 1W7FA 2P74A 2WKHA 3V50A 4S2PA 2DNSA 1S0WA 3PBTA 3SH8A 5F1FA 5M1AA 2XH9A 1BUEA 1YMSA 4R1GA 2HDQA 1LLBA 4KENB 4ZJ2A 2WUQA 4S2KA 4WELA 2H0TA 4WZ5A 4PMAA 1HVBA 2Y2JA 3PAGA 1JWZA 4X6TA 5BOHA 2WKEA 2XDMA 3VP3A 4JKTA 5EVLA 2OV5A 2BG1A 4X69A 3TG9A 3ZCZA 1AXBA 3VP0A 2JE5A 3BYDA 5M18A 1K55A 5EE8A 2ZQCA 1K38A 5D3OA 2DRWA 4K0XA 1KE3A 2ZQ7A 3EQVA 4KZAA 4S2JA 4YINA 3WS2A 3OPPA 4S2MA 3S22A 5A91A 3NBLA 3QHYA 3AGEA 3ITAA 5F1GA 3UDXA 4EBPA 4KZ5A 1OMEA 2EX8A 3PTEA 5CXWA 1YMXA 2J9OA 2Y2PA 5E2EA 2ZM0A 5E2GA 3HLDA 3LEZA 4ID4A 3E2KA 3C4OA 3HLFA 3UDIA 1KGEA 5EOEA 1ZG4A 2XEPA 1YLPA 1BLPA 2EX6A 3IH9A 4IVKA 3NI9A 3VFHA 4R3BA 4KZ9A 4JXGA 4S2NC 4OH0A 1MPLA 3HUOA 5A93A 5FI2A 1ONGA 3UPPA 4N92A 1YLWA 1CEFA 5E43A 2UWXA 2ZC4B 3A3DA 4X56A 3HBRA 5GHYA 1GA0A 1M6KA 2QPNA 3A3FA 4KQOA 1K56D 2R9WA 5AQ9A 3ZG0A 2DCFA 4GKUA 2X01A 5L2FA 2RCXA 3BECA 1GHIA 2FFYA 4EBNA 4OLDA 1PW1A 1KE0A 4GDNA 1I2SA 1NZUA 2EXAA 4R4SA 4OLGA 3LY3A 1XPBA 4MLLA 2WKIA 3HUMA 4QY5A 3NIAA 4ZJ3A 1YLJA 3PBSA 4H8RA 2HP9A 3IXDA 1PZPA 5EVIA 1JWPA 2CC1A 2I72A 2HDRA 4GD6A 5FQKA 4U0XA 3OZHA 3IF6C 3B3XA 1JWVA 4O7DA 3V3SA 4IBRA 2VGJA 1I5QA 3N8SA 5CEBA 4EQIA 3OPRA 2ZD8A 1YT4A 3BFGA 2OLUA 5FATA 4F94A 1TEMA 2B5RA 3SS3A 4HBTA 5HL1A 1MWTA 1IKIA 1L0EA 1YLTA 3VMAA 1TDLA 3A3IA 4E6XA 4PM8A 3UE0A 4OONA 3ZNTA 4OVDA 4KG5A 1VM1A 1YM1A 5TGFA 2A3UA 3C4PA 4WZ5C 4OOYA 1IKGA 1XGIA 1W5DA 2Z2LB 3HLCA 3HLEA 4EWFA 3GQZA 2C5WB 4GNUA 4OPYA 4X68A 4ZTKA 1H8ZA 3ZGAB 1K55C 2J8YA 3VP1A 4MEZA 1CK3A 1VQQA 4KZ6A 1DY6A 1BZAA 4WYYA 3ITBA 5GL9A 2HP6A 3HVFA 2ZM2A 3BLMA 3AGFA 5CTMA 4QB8A 3S1YA 1C3BA 1O07A 1N9BA 2ZC7A 2EFUA 3E2LA 2XK1A 4Z9QA 1MBLA 3OC2A 1U60A 5JYPA 4N1HA 3N4IA 4BJPA 4L0LA 3ZNYA 4A5RA 3RXWA 5FI7A 5EVID 4LV3A 1RP5A 4GOGA 5TFQA 5E2FA 3EQUA 1PW8A 3FWLA 4N9LA 1IELA 3GSGA 2WGVA 2WGWA 2Y2OA 4UAAA 1E4DA 3OCNA 1EWZA 3G4PA 3C7VA 4RA7A 1FR6A 4DE0A 2P9VA 4NETA 3DWZA 3NDGA 3Q7VB 1K6RA 4DE1A 4HESA 3FYZA 4BL3A 4PM5A 1NY0A 3W8KA 4QJGA 1TVFA 3V5MA 3WRZA 1MKIA 1BLSA 5EVIC 5EUAA 3MKFA 3FKVA 2G2WA 1J9MA 5FAQA 2QZ6A 4R23A 1K57C 3IF6B 4JF4A 4Y0TA 1PYYA 1PI5A 2A49A 4GDBA 3UE3A 2J9PA 2ZQDA 2XGNA 3OPLA 3QNBA 4N9KA 3GRJA 4P6BA 2Y2MA 1WYCA 1L2SA 2IWCA 4P87A 3DTMA 5HFOA 3ZVTA 1IYSA 4KQRA 1G68A 2WAFA 3GMWA 4KZ7A 1WE4A 3LO7A 5GLCA 1ZC2A 4JF6A 3UN7A 1LI9A 4BENA 3QNCA 5CTNA 2Y2NA 2Y4AA 4ZDXA 3PBOA 4DDSA 1HD8A 5J8XA 1KDWA 3PAEA 3RXXA 3WS1A 4M3KA 4LV0A 3W4OA 3IHAA 5IHVA 3W4PA 4WMCA 4KQQA 2Y2GA 1SKFA 3UDFA 4D2OA 3TOIA 3BLSA 1DJBA 3MXRA 3VOZA 3SS4A 3M6HA 2ZQ8A 3V39A 2JC7A 2ZM8A 4OPZA 4CJNA 4PM9A 3FKWA 5HW3A 4KZ3A 4RX2A 4QD4A 4WZ4A 1Z6FA 2PBYA 3SS5A 2H10A 1LHYA 1MWUA 4OQHA 4LV2A 5EPHA 4B88A 1CI8A 1FSWA 2XD1A 2Z2MB 4KG2A 2C6WB 4GN2A 4LENA 4ZAMA 3Q1FA 1IYQA 2WYXA 5FQJA 4S2IA 2Y2QA 4Y0UA 1KVLA 3IWIA 4MBFA 4S2LA 5EECA 3G34A 1H8YA 4E3KA 3VOYA 5FQ9A 1K57A 3PBRA 1N4OA 4E3JA 2ZQ9A 1H5XA 2ZC6B 4PM6A 5FQQA 2JCHA 4X53A 4C3QA 1PIOA 3G2ZA 4XUXA 1MY8A 3RJUA 4BD0A 4QHCA 3MXSA 4FCFA 1XKZA 4YFMA 1FCMA 3BFCA 5EVIB 3WRTA 5M19A 4K0WA 1JVJA 1PWDA 4E3IA 5GLDA 3UY6A 5FAOA 4IEDA 2XD5A 4C6YA 3SH9A 1WYBA 5CHMA 2EFXA 4WMCD 5FDHA 3CJMA 3D4FA 4HBUA 4P85A 3MZFA 4IVIA 1E25A 4OP5A 3CMZA 1ESUA 1K54A 3G31A 1GA9A 3Q7ZA 1PZOA 3IHBA 5G18A 1FSYA 4DE2A 3IQAA 3ZG7B 2EX9A 5HX9A 1MXOA 3FV7A 5E2HA 3JYIA 5KSCA 4GB7A 1FQGA 3IWQA 5FSRA 2ZQAA 3CG5A 3VSLA 2HDUA 1JTGA 5CRFA 1ES3A 3IXGA 4Y7PA 1LL5A 5CECA 2Y2LA 2JBFA 2EXBA 2OSUA 1KGGA 5GLBA 4Q8IA 2ZC3B 1ES2A 5DVAA 5FI6A 2HDSA 1XGJA 3V3RA 3O87A 4R4RA 5TR7A 4HEFA 1PI4A 1GHMA 3ZFZA 1NXYA 3Q07A 3G32A 3BRMA 4WEKA 3DW0A 2XQZA 4DXCA 4FH2A 3IXBA 3NC8A 5AQAA 1QMEA 2ZMAA 3GVBA 2WGIA 5FAPA 4BD1A 5A90A 2J7VA 2H0YA 4RYEA 3Q81A 4DF6A 4KZBA 3SH7A 5GHXA 3M6BA 1CEGA 3P98A 4UA9A 2WGWB 3VFFA 2P9VB 3FZCA 2VGKA 1FCOA 1GCEA 2EX2A 3HUNA 3N7WA 5AQBA 5KZHA 1SDEA 2WK0A 1CI9A 4E3MA 1L0FA 1FOFA 3GTCA 1HTZA 2Q9NA 3MBZA 5CGWA 4ZBEA 2FFFB 3VSKA 4LCLA 1W8YA 4PM7A 4RX3A 4U0TA 3UNWA 4UA7A 4X55A 5AQ7A 5GLAA 2V2FF 2WZXA 3A3JA 5DTKA 3BFDA 2WAEA 1NYMA 4C75A 4B4XA 1XA1A 2GDNA 3S4XA 3UE1A 1ES4A 5KMWA 4E3NA 3HLGA 1YLZA 5FASA 4JXWA 4WEJA 4GD8A 1I2WA 5F82A 4R0QA 1K54C 3HL9A 4MNRA 4UHUA 5FA7A 2IWDA 4N1XA 3UPOA 3BFFA 3BM6A 4JBFA 4E3LA 4JF5A 4EUZA 5HARA 1DJCA 1LL9A 5F83A 1FCNA 4BQMA 3MZEA 5FQIA 1NRFA 3HLBA 3VP2A 4DXBA 1KGFA 2Y91A 1O7EA 3M2KA 3N8LA 5FQMA 3GV9A 1YLYA 1BSGA 1KVMA 4KZ4A 2E8IA 3O3VA 4DRTA 1SDNA 3IH8A 3W4QA 1G6AA 1MWSA 5DTTA 1K25A 3M2JA 1TDGA 3NDEA 4B4ZA 4LV1A 5I94A 5DTSA 1KE4A 2Y59A 2PU4A 3N6IA 3I7JA 3VP4A 3TSGA 2OLVA 3ZG8B 1ESIA 5HAPA 4IBXA 2XR0A 4JXVA 2HPBA 3G35A 3SOIA 4ZJ1A 3OPHA 5CEDA 3BFEA 2Y2IA 5EOOA 4XUZA 3WS4A 1JTDA 1Y54A 1KDSA 2HP5A 2PU2A 2V20A 5CHUA 3ZG5A 3O86A 5JYOA 2ZJ9A 1ALQA 1QMFA 3MFDA 4KG6A 4QU3A 5DF8A 3OCLA 3ZG9B 3O88A 4OQIA 1PWCA 4MBHA 2XF3A 5U47A 3ZVWA 4BLMA 1FR1A 2R9XA 1DJAA 3WWXA 5GHZA 1Q2PA 4NK3A 1BTLA 5KSHA 1K4EA 1M40A 4OQ0A 4OOMA 4Y0OA 3AGDA 2ZLYA 2Y55A 1IEMA 3N8RA 2XFTA 3NCKA 4K91A 4KZ8A 4DDYA 4OOLA 3BEBA 2IWBA 3ZHHA 1W79A 5CERA 1E3UA 3NY4A 3LY4A 1S6RA 4JLFA 4JXSA 1HZOA 1Q2QA 1XA7A 4EV4A 1ZKJA 1RGZA 3IT9A 1NZOA 2V1ZA 4MBKA 1SHVA 4OQGA 1ONHA 1YQSA 2X71A 3IF5A 3ZDJA 1IYOA 1BULA 1PWGA 4R3JA 4S2OA 4BL2A 1SCWA 4DE3A 3PBQA 3MZDA 4FD8A 4E6WA 1NJ4A 2Y2HA 1BT5A 4FSFA 1XXMA 4WBGA 4CPKA 4OP8A 4S2NA 4WM9A 2Q9MA 1BLCA 2ZC5B 1ZG6A 1LI0A 2QMIA 4UA6A 3ISGA 3P09A 1K6SA 5DF7A
chains in the Genus database with same CATH superfamily
3HLWA 1GHPA 3IX3A 1NWZA 4DKIA 3WS5A 2XLNA 3G2YA 1W8QA 5HAIA 3Q7VA 3CZDA 1HLUP 2BLSA 3HREA 4MMNA 1RCJA 3LCEA 1L0DA 2RL3A 3F1PA 1AWIA 4QY6A 3MKEA 2Y2KA 1RGYA 4P0MA 5HDDA 3DWKA 2PYPA 2VV6A 1ERQA 3WS0A 2J3WA 4F3LA 1IYPA 1E3UD 4X25A 3G6OA 3V50A 3EEAA 3SH8A 2XH9A 4JGPA 1LLBA 2WUQA 4WELA 3EWKA 4PMAA 3JPUA 1HVBA 4UEYA 5BOHA 3RH8B 3TG9A 1NRJA 1AXBA 3VP0A 2JE5A 3BYDA 4L9EA 5M18A 1UWNX 3LI8A 2ZQCA 5D3OA 2DRWA 1KE3A 4YINA 2W1TB 3AGEA 5F1GA 5FDSA 1OT6A 4EBPA 4I3IA 5CXWA 4EESA 5E2EA 2Y2PA 5E2GA 5DKLA 4IJGA 3IH9A 4IVKA 3NI9A 4KZ9A 3HUOA 1ONGA 4N92A 3R7WA 4DJ2A 3ULFA 2XSSA 3HBRA 5GHYA 4EBNA 1KE0A 3LIFA 2EXAA 3OBFA 2WKIA 3NECA 5EVIA 3RTYA 2I72A 2HDRA 3V3SA 3OZHA 4O7DA 2QWSA 5F68A 3MMHA 1MWTA 3VMAA 4E6XA 2J3TC 3E98A 5TGFA 4CQHA 4HY8A 1XGIA 5HWWA 2Z2LB 3HLCA 1OTAA 4PKYA 3MS6A 4X68A 4ZTKA 1H8ZA 4MEZA 1BZAA 3IBJA 3QP6A 2PT7A 3OOVA 5J3WA 2JKRM 5CTMA 4JGOA 3HJIA 3IS2A 4HJ6A 2VK3A 1U60A 5JYPA 1G28A 3N4IA 4L0LA 3LR0A 5EVID 4LV3A 5FEFA 3EQUA 1ODVA 1D7EA 3B33A 4YOFA 5DFYA 4DE0A 4NETA 4P6ZS 4HESA 3W8KA 3WRZA 1MKIA 3MKFA 2B02A 3K2NA 4R23A 4UQIS 3QNBA 3GRJA 1MZUA 2Y2MA 5J7EA 4JGQA 2IWCA 4P87A 4KQRA 1G68A 4UQIM 4KZ7A 3LO7A 3JVUA 1LI9A 2Y2NA 5J8XA 3LEQA 4KUOA 3W4OA 4KQQA 4WLAA 4MCWA 3BLSA 4HP9A 3EGDC 3VOZA 4OPZA 4KZ3A 2PBYA 2H10A 4LV2A 1CI8A 2Z2MB 3JVVA 4ZAMA 3Q1FA 4AFIA 1P97A 4Y15A 3TE8A 5FQJA 3KYQA 2Y2QA 3CUEC 3T4QA 5F69A 1H8YA 4E3KA 1N4OA 4E3JA 2ZQ9A 1P9WA 1S4SA 3LR4A 4XUXA 4QHCA 2OWHA 4I3JA 1FCMA 2CMNA 1LSXA 3WRTA 4K0WA 2XD5A 5FDHA 2MJ6A 2KLIA 4IVIA 4OP5A 4HQAA 1GSXA 4R38A 3IQAA 3ZG7B 2NUPC 1MXOA 3FV7A 3JYIA 4GB7A 3T4JA 5FSRA 5CRFA 3IXGA 4ARZB 2JBFA 4BWIA 3CHWP 4L9FA 4GHIB 3GECA 3CITA 2ZC3B 4H6JA 1UWPX 1XGJA 1PI4A 1GHMA 5MC7A 4NEED 4WEKA 4WUJA 1TS7A 3NC8A 1T1BA 3GVBA 5HSQA 1K0KA 1F2KA 2VKSA 4DF6A 2O0YA 3W2ZA 4KZBA 3SH7A 5LBRA 5GHXA 2JKTM 4GS9B 1S1YA 2WGWB 3S7PA 3EOIA 2XA7M 1FCOA 5KZHA 2WK0A 1CI9A 1HTZA 3MBZA 3S7QA 3VSKA 3LR5A 4RX3A 4UA7A 5TBMA 2WAEA 1NYMA 4IUHA 5DFXA 5KMWA 3HLGA 4ME4A 1MC0A 2BTFP 5FASA 5HZHA 3HJKA 5F82A 4N1XA 3BM6A 4JBFA 2Y8HA 3BJNA 2V8CA 1DJCA 1LL9A 4O8GA 1FCNA 3MZEA 3U4LP 4DXBA 3BQAA 3N8LA 5FQMA 2FZ0A 3LICA 3S7OA 2PR5A 3ZG8B 2HPBA 3G35A 3SOIA 3VOLA 5CEDA 1SKOB 4HP4A 5K5BA 1S66L 2PU2A 4B93A 4WF0A 3T1SA 1QMFA 3DTEA 1XJ2A 5U47A 5G4ZA 4KQDA 4OQ0A 3NCKA 4DDYA 4OOLA 2O99A 3F1OB 4GCZA 4EV4A 1ZKJA 4HOIA 3IT9A 2V1ZA 4OQGA 5HPFA 1YQSA 4ESPA 3IF5A 3H82B 3TRCA 1PWGA 4S2OA 4FD8A 4E6WA 1NJ4A 1XXMA 3V67A 4OP8A 4S2NA 1BLCA 1LI0A 4XT2B 3ISGA 2Z6DA 4LCMA 1K4FA 2OAQ1 4RVAA 3C5AA 2P04A 2H28A 3B42A 3G30A 1VETB 4OPQA 5A8BA 4O0PA 3A0VA 2A2LA 4OPRA 3ICYA 1EI5A 2WADA 2FH5A 1A0KA 4K08A 1K56A 2L1MA 1W7FA 3R4KA 1S0WA 3PBTA 5M1AA 1BUEA 1YMSA 2HDQA 3CPTA 2W27A 4WZ5A 4HH3A 4LPZA 4JKTA 1T1AA 4S2JA 1XJ3A 3S22A 3NBLA 3QHYA 4KZ5A 2W3DA 3LEZA 4ID4A 3C4OA 1DP9A 3UDIA 5EOEA 1YLPA 1BLPA 5FI2A 4ETZA 1NLZA 1CEFA 3CLOA 5E43A 2UWXA 2ZC4B 3MSHA 4X56A 1GA0A 1M6KA 3A3FA 2V1AA 1K56D 2R9WA 3BY8A 4GKUA 5L2FA 4EXOA 5IT5A 1PW1A 4LRYC 3LY3A 4ZJ3A 3NIAA 3PBSA 2HP9A 1PZPA 2ZOHA 1G5UA 1Y4OA 4GD6A 5FQKA 3WWXA 4U0XA 3IF6C 3B3XA 3CI6A 2VGJA 3N8SA 5CEBA 2ZD8A 4F94A 3SS3A 4HBTA 1L0EA 1TDLA 3A3IA 2VEAA 3ZNTA 1VM1A 4OOYA 1IKGA 1W5DA 3GQZA 2C5WB 4GNUA 1P0ZA 1K55C 2J8YA 3T4KA 1NLYA 5AJGA 5GL9A 2HP6A 4EW7A 1N9BA 2XK1A 1MBLA 3OC2A 1TS8A 2JKGA 3T50A 2WKRA 2PD8A 4A5RA 4GOGA 3TW8A 4BMWA 3GSGA 4UAAA 3OCNA 3LIDA 2P9VA 3DWZA 3NDGA 1K6RA 4BL3A 4PM5A 1VEUA 1NY0A 2ACGA 1TVFA 1BLSA 5EUAA 1EW0A 2GNXA 3L7HA 3IF6B 4WN5A 2A49A 4GDBA 4NXEA 3T4SA 2J9PA 2XGNA 3OPLA 1XFNA 5HFOA 2WAFA 2ZL1A 3KYEA 1ZC2A 4JF6A 4BENA 5CTNA 3H9WA 4FOFA 1YSQA 3RXXA 3NOPC 2Y79A 4HNBA 5L8MA 2GJ3A 2Y2GA 4LRXC 3T12B 1DJBA 3MXRA 3M6HA 2IA2A 3V39A 2ZM8A 4PM9A 4QD4A 3NULA 4ZRRA 3SS5A 4HH2A 2XD1A 4EEUA 3S7NA 2WYXA 2WKPA 1XJ4A 5EECA 4S2LA 3T4TA 5FQ9A 1K57A 4Q0IA 4EQ1A 2HJ9C 5FQQA 3GDIA 4ETXA 2J80A 5DKKA 3MXSA 2JKTI 4YFMA 5EFWA 4MN5A 3PXPA 5F5YA 1VHMA 5M19A 2ZBBA 1JVJA 1PWDA 3UY6A 5FAOA 4C6YA 3SH9A 3C30A 3D4FA 4GW9A 2G7UA 1PZOA 1MKMA 4DE2A 4CLCA 5KSCA 3IBRA 2NUTC 4Y2FA 3IWQA 2HDUA 5TJJA 5CECA 1LL5A 2Y2LA 2HDSA 3V3RA 4I39A 4R4RA 5TR7A 4HEFA 1DP8A 3ZFZA 3G32A 3MXQA 2XQZA 3K3CA 4DXCA 3IXBA 5AQAA 2ZMAA 5FAPA 4H6JB 3UE6A 2H0YA 4P6ZM 3VFFA 4DN0A 1GCEA 3HUNA 1FOFA 4ZBEA 3NOTC 2FFFB 1ZHHB 4LCLA 4CLCD 4M4XA 4U0TA 4X55A 1W63M 2V2FF 2WZXA 3A3JA 2W1TA 2AVXA 3BFDA 4C75A 3UE1A 1H0MA 3EGXC 1YLZA 2O9CA 1I2WA 5FEGA 4I38A 1IOUA 5EM1A 1K54C 4MNRA 3MF0A 4EETB 4E3LA 3EEHA 4EUZA 4BQMA 5FQIA 5TBMB 5EVEA 2W3FA 1O7EA 1H3QA 4KZ4A 3O3VA 4DRTA 1SDNA 3QP2A 5DTTA 3NDEA 1TDGA 3E4PA 2Y59A 5HDCA 3N6IA 4PHTA 3TSGA 5HAPA 1PNEA 3LIBA 2Y2IA 5EOOA 1Y54A 2LB9A 1KDSA 2HP5A 5CHUA 3ZG5A 3O86A 3VV4A 5JYOA 1TF1A 2W1RA 3ZVWA 4BLMA 1FR1A 3IX4A 4NK3A 5KSHA 4Y0OA 2ZLYA 1N9NA 3ZHHA 3LUQA 1HZOA 4LFUA 1YAXA 4Q0JA 2KX6A 4YNRA 4DE3A 1Z09A 4X1MA 4FSFA 4EUVA 2Q9MA 3L9KA 1ZG6A 2INWA 2QMIA 2EWWA 3H7WB 5A92A 4KUKA 1GSVA 3UPNA 2XFSA 1L0GA 3C7UA 1XP4A 3Q82A 4FTXA 4JPMA 3PBNA 5CGSA 1ERMA 4LLOB 2K31A 3IXHA 2OAP1 2P08A 1MWRA 2VX8A 5CGXA 1XX2A 1ES5A 2G2UA 3A3EA 3HCYA 2YKHA 3F1NB 2A24B 5L09A 1BLHA 1FILA 4S2PA 3A0SA 2DNSA 5F1FA 3KX0X 1N9OA 4I3AA 5F6AA 2PAVP 4R1GA 4ZJ2A 2H0TA 2Y2JA 3NOUC 3PAGA 4X6TA 2WKEA 3VP3A 5EVLA 2OV5A 4X69A 3DBAA 3ZCZA 5EE8A 3KSIA 4K0XA 2ZQ7A 4S2MA 4NG2A 5A91A 2QHKA 3ITAA 3UDXA 1OMEA 1BYWA 1FIKA 3PTEA 2ZM0A 1OTIA 3HLFA 5G4YA 3UB6A 4EU0A 3E0YA 4JXGA 4OH0A 1YLWA 5DJTA 3FC7A 4KQOA 5AQ9A 2DCFA 4GDNA 1I2SA 1NZUA 4QY5A 1YLJA 1G6OA 2K7SA 4H8RA 4Y3IA 4EQIA 3PHYA 3OPRA 1YT4A 2OLUA 1TEMA 1YPRA 2B5RA 5HL1A 4I5SA 3UE0A 4OONA 2GZAA 3D3OA 2ZMVA 4LRZE 2M7UA 1YM1A 2A3UA 4DJ3A 5HPIA 3C4PA 4BBVA 2W3HA 2QJ7A 3ZGAB 3VP1A 1CK3A 2VA0A 4ARZA 3ITBA 3TJZC 2ZM2A 3AGFA 4QB8A 1O07A 2W3EA 2ZC7A 2EFUA 3E2LA 1F5MA 3FPVA 4BJPA 4HHDA 3KSFA 3RXWA 5FI7A 1RP5A 2VGLS 5TFQA 3CUEA 1PW8A 3FWLA 4GS9A 2WGVA 2WGWA 1E4DA 2GX5A 3BW6A 1EWZA 3C7VA 3Q7VB 4MDZA 3T1QB 4DE1A 4Z1WA 2VGLM 2Q0OA 4HI4A 1F98A 1CJFA 3V5MA 2UV0E 5EVIC 2G2WA 3F1PB 1J9MA 1K57C 4JF4A 4Y0TA 1PYYA 3ZQ5A 5HL6A 3UE3A 4F3LB 2ZQDA 4P6BA 5EM0A 1OTEA 1WYCA 3DTMA 5DJUA 1IYSA 1WE4A 5GLCA 4NXFA 3QNCA 2Y4AA 3BY9A 1HD8A 1S1ZA 3PAEA 4M3KA 2Z6CA 4LV0A 4E04A 1X0OA 4WMCA 1SKFA 4D2OA 3TOIA 3T4LA 2JKRI 3SS4A 1J3WA 3FPWA 4O01A 4CJNA 5HW3A 1UGUA 4WZ4A 1Z6FA 4G3WA 2PYRA 4BBTA 2E8JA 1FSWA 3E4OA 2C6WB 4GN2A 4LENA 1SKOA 3LYXA 1IYQA 2PD7A 2DMWA 3MJQA 4S2IA 3U2AA 3DAVA 3R7WB 4Y0UA 2YKFA 3IWIA 4G3KA 3ZYTA 4NXBA 4IUKA 5HWVA 3PBRA 2I9VA 1STZA 2V0WA 4X53A 4C3QA 1PIOA 1MY8A 4FCFA 1XKZA 3BFCA 5EVIB 3F1OA 4E3IA 5GLDA 1CF0A 4IEDA 1WYBA 4CLCE 4WMCD 4HBUA 4P85A 2P7JA 3H82A 1JNUA 1P9RA 3PR6A 3CMZA 1ESUA 3G31A 1GA9A 3Q7ZA 3IHBA 3B47A 1FSYA 5G18A 3PYPA 3VE4A 2M1CA 4XT2A 1T1CA 5EV0A 1KOUA 2ZQAA 4WL9A 5AVEA 1JTGA 4Y7PA 2EXBA 2OSUA 1KGGA 1VETA 5FI6A 3IS2B 3O87A 1CQAA 2D02A 4FH2A 1IFQA 2HGVA 4RYEA 3Q81A 3M6BA 3P98A 3KSGA 2EA9A 3FZCA 4BBUA 2O9AA 5AQBA 3N7WA 1SDEA 1TS6A 1T19A 4E3MA 2BASA 3GTCA 1W8YA 5KIZA 3UNWA 2EWVA 1LSWA 1ZTUA 5DTKA 3UMDA 4B4XA 3S4XA 1SZVA 4HJ3A 1ES4A 4E3NA 2PHYA 4WEJA 2B95A 4R0QA 3HL9A 4UHUA 2IWDA 3BFFA 5CX7A 1NRFA 3LIEA 3HLBA 3M2KA 3GV9A 1YLYA 5J4EA 2E8IA 3IH8A 1MWSA 2K2NA 1K25A 3M2JA 4B4ZA 5I94A 1KE4A 1LSVA 3T4OA 3C8CA 4JXVA 4ZJ1A 3OPHA 3BFEA 4XUZA 1JTDA 4NKPA 4HJ4A 2L0WA 4Q0HA 1T18A 3A0RA 2ZJ9A 3MFDA 4HIAA 5IU1A 1TD5A 5DF8A 3OCLA 3ZG9B 3LFVA 3O88A 4OQIA 4MBHA 2XF3A 4QWOA 2R9XA 2PBDP 1BTLA 1D1JA 3AGDA 1IEMA 2XFTA 4PKYG 1W79A 2WKQA 3NY4A 3LY4A 2JHEA 1S6RA 4JLFA 4JXSA 1Q2QA 1ACFA 1XA7A 4II7A 2VLGA 2VZWA 1IYOA 4R3JA 4BL2A 1SCWA 3PBQA 3MZDA 5HDSA 4WBGA 4CPKA 1OTBA 4WM9A 3OLOA 2ZC5B 3SW1A 3NJAA 1K6SA 5DF7A 2H5SA 4OKPA 4PPRA 1YKDA 3UO9A 4U3TA 5HAQA 3IWOA 5CHJA 4XXRA 3LI9A 3CAXA 2WZZA 3MQQA 4GZBA 5DF9A 4EBLA 1EROA 2LB5A 2X02A 1NYYA 3GR2A 2B18A 4MN7A 4E3OA 3IF6A 3NHQA 2V9AA 4FH4A 4Y13A 2P74A 3MQOA 2KOIA 2WKHA 3RFBA 4KENB 4S2KA 1JWZA 5C5KA 2XDMA 3T1RA 2XROA 4R70A 2BG1A 3LR3A 1K55A 3SZTA 1K38A 4MN6A 3EQVA 4KZAA 3WS2A 2PR6A 3OPPA 3UB7A 2EX8A 1YMXA 2J9OA 1OPXA 3BQ8A 3HLDA 3E2KA 1KGEA 1ZG4A 2XEPA 2EX6A 2W0NA 3VFHA 4R3BA 2OWJA 4S2NC 2V1BA 1L3LA 1MPLA 5A93A 3UB5P 3UPPA 1V9ZA 4EEPA 3MR0A 3A3DA 5I5LA 2QPNA 1LT0A 3ZG0A 2R78A 2X01A 2O9BA 2RCXA 1GHIA 3BECA 3C2WA 2FFYA 4OLDA 4R4SA 4OLGA 1XPBA 4MLLA 3HUMA 2HV1A 3IXDA 1JWPA 2CC1A 4Y5FA 1JWVA 3P7NA 4IBRA 1I5QA 3D72A 1DP6A 2VV8A 3BFGA 5FATA 2PDRA 1IKIA 1YLTA 2VJWA 4PM8A 4OVDA 4NXGA 4KG5A 4WZ5C 4R3AA 3T1XA 4EWFA 3HLEA 4OPYA 3IX8A 3KSHA 1VQQA 4KZ6A 1DY6A 4WYYA 1OTDA 3E4QA 3HVFA 3VE3A 3BLMA 3S1YA 1C3BA 4Z9QA 3FG8A 2QYBA 4N1HA 4D60A 3ZNYA 5AVFA 3C38A 1OJGA 3UB8A 5E2FA 1WA9A 4N9LA 4B9OA 1IELA 2Y2OA 4RA7A 3G4PA 1FR6A 3FYZA 1S67L 2XA7S 4QJGA 4PAUA 3FKVA 5FAQA 3O5YA 2QZ6A 2QKPA 1PI5A 5L07A 1OT9A 4N9KA 4LGWA 1L2SA 3ZVTA 3MFXA 3GMWA 3CPTB 3UN7A 4ZDXA 3PBOA 3QP5A 4DDSA 1KDWA 3WS1A 2HF6A 3IHAA 5IHVA 3W4PA 3P01A 3UDFA 2XRNA 2ZQ8A 1N9LA 2JC7A 3FKWA 4RX2A 1LHYA 1MWUA 4OQHA 5EPHA 4B88A 4KG2A 2J3TD 2ZOIA 4GJ4A 3QP4A 1KVLA 1PRQA 4MBFA 3G34A 3VOYA 3K3DA 2OOLA 1H5XA 2ZC6B 4PM6A 2JCHA 3KYZA 3G2ZA 5HWTA 3RJUA 4BD0A 2HZ5A 1VB6A 1PFLA 3D9YA 1H8MA 3LIAA 5CHMA 2EFXA 3DTKA 3CJMA 3MZFA 1E25A 1K54A 4GHIA 2EX9A 5HX9A 5E2HA 1FQGA 3CG5A 3H7WA 2HJEA 3VSLA 1ES3A 5GLBA 4YWZA 4Q8IA 1ES2A 5DVAA 2V8FA 1OJ5A 1LL8A 2JN7A 4G3VA 1NXYA 3Q07A 3BRMA 3DW0A 3QP8A 1QMEA 3F1NA 2A24A 2WGIA 2ZMFA 4BD1A 5A90A 2J7VA 2JKFA 1CEGA 4UA9A 2P9VB 2VGKA 1YSPA 2EX2A 1XJ6A 1D06A 1L0FA 1VEUB 4Y17A 3BWLA 2Q9NA 5CGWA 4PM7A 3CWFA 5AQ7A 5GLAA 4IHQA 4JGRA 3DTIA 1XA1A 1Y28A 2GDNA 4JXWA 4GD8A 5FA7A 3UPOA 2ZL1B 2D01A 2KDKA 1XFQA 4JF5A 3UMEA 4CLCC 4L9GA 5HARA 5F83A 4GLQA 3VP2A 4R6LA 1KGFA 2Y91A 5L10A 1BSGA 1KVMA 1GSWA 3MQ0A 3W4QA 1G6AA 4DMZA 2L4RA 4LV1A 5DTSA 2PU4A 3I7JA 3VP4A 2OLVA 1ESIA 4IBXA 4EERA 1W63Q 2XR0A 5HD3A 3UB9A 4FUWA 5FL3A 3WS4A 2V20A 4RQ9A 1ALQA 4KG6A 4QU3A 3KO6A 1PWCA 5IS1A 1TS0A 1DRMA 3LGOA 1DJAA 5GHZA 1Q2PA 4QPRA 2M7VA 1K4EA 1M40A 4OOMA 2Y55A 3N8RA 4K91A 4KZ8A 5HD5A 3BEBA 2IWBA 5CERA 1E3UA 2PRFA 1F9IA 3QP1A 1RGZA 1NZOA 1V9YA 4MBKA 1SHVA 4X1LA 1S4RA 2W3GA 2QJ5A 1ONHA 2X71A 3ZDJA 1BULA 2Y2HA 1BT5A 4CLCB 4UA6A 2VV7A 3P09A 2V0UA
chains in the Genus database with same CATH topology
5A92A 4LCMA 2H5SA 1K4FA 3HLWA 1GHPA 4OKPA 3UPNA 4PPRA 4DKIA 3UO9A 3WS5A 2XFSA 4U3TA 5HAQA 2XLNA 1L0GA 3G2YA 4RVAA 3C7UA 3IWOA 5CHJA 3C5AA 1W8QA 4XXRA 5HAIA 1XP4A 3G30A 3Q7VA 3Q82A 4OPQA 2WZZA 4JPMA 3CZDA 3PBNA 4GZBA 5CGSA 5DF9A 1ERMA 2BLSA 3HREA 4EBLA 1RCJA 1EROA 2X02A 3IXHA 1NYYA 3LCEA 4OPRA 1MWRA 1L0DA 2RL3A 1XX2A 3GR2A 5CGXA 4E3OA 1EI5A 1ES5A 2G2UA 3IF6A 4QY6A 3A3EA 3MKEA 2WADA 2Y2KA 1RGYA 4P0MA 3DWKA 1ERQA 1K56A 3WS0A 4FH4A 1BLHA 1IYPA 1E3UD 1W7FA 2P74A 2WKHA 3V50A 4S2PA 2DNSA 1S0WA 3PBTA 3SH8A 5F1FA 5M1AA 2XH9A 1BUEA 1YMSA 4R1GA 2HDQA 1LLBA 4KENB 4ZJ2A 2WUQA 4S2KA 4WELA 2H0TA 4WZ5A 4PMAA 1HVBA 2Y2JA 3PAGA 1JWZA 4X6TA 5BOHA 2WKEA 2XDMA 3VP3A 4JKTA 5EVLA 2OV5A 2BG1A 4X69A 3TG9A 3ZCZA 1AXBA 3VP0A 2JE5A 3BYDA 5M18A 1K55A 5EE8A 2ZQCA 1K38A 5D3OA 2DRWA 4K0XA 1KE3A 2ZQ7A 3EQVA 4KZAA 4S2JA 4YINA 3WS2A 3OPPA 4S2MA 3S22A 5A91A 3NBLA 3QHYA 3AGEA 3ITAA 5F1GA 3UDXA 4EBPA 4KZ5A 1OMEA 2EX8A 3PTEA 5CXWA 1YMXA 2J9OA 2Y2PA 5E2EA 2ZM0A 5E2GA 3HLDA 3LEZA 4ID4A 3E2KA 3C4OA 3HLFA 3UDIA 1KGEA 5EOEA 1ZG4A 2XEPA 1YLPA 1BLPA 2EX6A 3IH9A 4IVKA 3NI9A 3VFHA 4R3BA 4KZ9A 4JXGA 4S2NC 4OH0A 1MPLA 3HUOA 5A93A 5FI2A 1ONGA 3UPPA 4N92A 1YLWA 1CEFA 5E43A 2UWXA 2ZC4B 3A3DA 4X56A 3HBRA 5GHYA 1GA0A 1M6KA 2QPNA 3A3FA 4KQOA 1K56D 2R9WA 5AQ9A 3ZG0A 2DCFA 4GKUA 2X01A 5L2FA 2RCXA 3BECA 1GHIA 2FFYA 4EBNA 4OLDA 1PW1A 1KE0A 4GDNA 1I2SA 1NZUA 2EXAA 4R4SA 4OLGA 3LY3A 1XPBA 4MLLA 2WKIA 3HUMA 4QY5A 3NIAA 4ZJ3A 1YLJA 3PBSA 4H8RA 2HP9A 3IXDA 1PZPA 5EVIA 1JWPA 2CC1A 2I72A 2HDRA 4GD6A 5FQKA 4U0XA 3OZHA 3IF6C 3B3XA 1JWVA 4O7DA 3V3SA 4IBRA 2VGJA 1I5QA 3N8SA 5CEBA 4EQIA 3OPRA 2ZD8A 1YT4A 3BFGA 2OLUA 5FATA 4F94A 1TEMA 2B5RA 3SS3A 4HBTA 5HL1A 1MWTA 1IKIA 1L0EA 1YLTA 3VMAA 1TDLA 3A3IA 4E6XA 4PM8A 3UE0A 4OONA 3ZNTA 4OVDA 4KG5A 1VM1A 1YM1A 5TGFA 2A3UA 3C4PA 4WZ5C 4OOYA 1IKGA 1XGIA 1W5DA 2Z2LB 3HLCA 3HLEA 4EWFA 3GQZA 2C5WB 4GNUA 4OPYA 4X68A 4ZTKA 1H8ZA 3ZGAB 1K55C 2J8YA 3VP1A 4MEZA 1CK3A 1VQQA 4KZ6A 1DY6A 1BZAA 4WYYA 3ITBA 5GL9A 2HP6A 3HVFA 2ZM2A 3BLMA 3AGFA 5CTMA 4QB8A 3S1YA 1C3BA 1O07A 1N9BA 2ZC7A 2EFUA 3E2LA 2XK1A 4Z9QA 1MBLA 3OC2A 1U60A 5JYPA 4N1HA 3N4IA 4BJPA 4L0LA 3ZNYA 4A5RA 3RXWA 5FI7A 5EVID 4LV3A 1RP5A 4GOGA 5TFQA 5E2FA 3EQUA 1PW8A 3FWLA 4N9LA 1IELA 3GSGA 2WGVA 2WGWA 2Y2OA 4UAAA 1E4DA 3OCNA 1EWZA 3G4PA 3C7VA 4RA7A 1FR6A 4DE0A 2P9VA 4NETA 3DWZA 3NDGA 3Q7VB 1K6RA 4DE1A 4HESA 3FYZA 4BL3A 4PM5A 1NY0A 3W8KA 4QJGA 1TVFA 3V5MA 3WRZA 1MKIA 1BLSA 5EVIC 5EUAA 3MKFA 3FKVA 2G2WA 1J9MA 5FAQA 2QZ6A 4R23A 1K57C 3IF6B 4JF4A 4Y0TA 1PYYA 1PI5A 2A49A 4GDBA 3UE3A 2J9PA 2ZQDA 2XGNA 3OPLA 3QNBA 4N9KA 3GRJA 4P6BA 2Y2MA 1WYCA 1L2SA 2IWCA 4P87A 3DTMA 5HFOA 3ZVTA 1IYSA 4KQRA 1G68A 2WAFA 3GMWA 4KZ7A 1WE4A 3LO7A 5GLCA 1ZC2A 4JF6A 3UN7A 1LI9A 4BENA 3QNCA 5CTNA 2Y2NA 2Y4AA 4ZDXA 3PBOA 4DDSA 1HD8A 5J8XA 1KDWA 3PAEA 3RXXA 3WS1A 4M3KA 4LV0A 3W4OA 3IHAA 5IHVA 3W4PA 4WMCA 4KQQA 2Y2GA 1SKFA 3UDFA 4D2OA 3TOIA 3BLSA 1DJBA 3MXRA 3VOZA 3SS4A 3M6HA 2ZQ8A 3V39A 2JC7A 2ZM8A 4OPZA 4CJNA 4PM9A 3FKWA 5HW3A 4KZ3A 4RX2A 4QD4A 4WZ4A 1Z6FA 2PBYA 3SS5A 2H10A 1LHYA 1MWUA 4OQHA 4LV2A 5EPHA 4B88A 1CI8A 1FSWA 2XD1A 2Z2MB 4KG2A 2C6WB 4GN2A 4LENA 4ZAMA 3Q1FA 1IYQA 2WYXA 5FQJA 4S2IA 2Y2QA 4Y0UA 1KVLA 3IWIA 4MBFA 4S2LA 5EECA 3G34A 1H8YA 4E3KA 3VOYA 5FQ9A 1K57A 3PBRA 1N4OA 4E3JA 2ZQ9A 1H5XA 2ZC6B 4PM6A 5FQQA 2JCHA 4X53A 4C3QA 1PIOA 3G2ZA 4XUXA 1MY8A 3RJUA 4BD0A 4QHCA 3MXSA 4FCFA 1XKZA 4YFMA 1FCMA 3BFCA 5EVIB 3WRTA 5M19A 4K0WA 1JVJA 1PWDA 4E3IA 5GLDA 3UY6A 5FAOA 4IEDA 2XD5A 4C6YA 3SH9A 1WYBA 5CHMA 2EFXA 4WMCD 5FDHA 3CJMA 3D4FA 4HBUA 4P85A 3MZFA 4IVIA 1E25A 4OP5A 3CMZA 1ESUA 1K54A 3G31A 1GA9A 3Q7ZA 1PZOA 3IHBA 5G18A 1FSYA 4DE2A 3IQAA 3ZG7B 2EX9A 5HX9A 1MXOA 3FV7A 5E2HA 3JYIA 5KSCA 4GB7A 1FQGA 3IWQA 5FSRA 2ZQAA 3CG5A 3VSLA 2HDUA 1JTGA 5CRFA 1ES3A 3IXGA 4Y7PA 1LL5A 5CECA 2Y2LA 2JBFA 2EXBA 2OSUA 1KGGA 5GLBA 4Q8IA 2ZC3B 1ES2A 5DVAA 5FI6A 2HDSA 1XGJA 3V3RA 3O87A 4R4RA 5TR7A 4HEFA 1PI4A 1GHMA 3ZFZA 1NXYA 3Q07A 3G32A 3BRMA 4WEKA 3DW0A 2XQZA 4DXCA 4FH2A 3IXBA 3NC8A 5AQAA 1QMEA 2ZMAA 3GVBA 2WGIA 5FAPA 4BD1A 5A90A 2J7VA 2H0YA 4RYEA 3Q81A 4DF6A 4KZBA 3SH7A 5GHXA 3M6BA 1CEGA 3P98A 4UA9A 2WGWB 3VFFA 2P9VB 3FZCA 2VGKA 1FCOA 1GCEA 2EX2A 3HUNA 3N7WA 5AQBA 5KZHA 1SDEA 2WK0A 1CI9A 4E3MA 1L0FA 1FOFA 3GTCA 1HTZA 2Q9NA 3MBZA 5CGWA 4ZBEA 2FFFB 3VSKA 4LCLA 1W8YA 4PM7A 4RX3A 4U0TA 3UNWA 4UA7A 4X55A 5AQ7A 5GLAA 2V2FF 2WZXA 3A3JA 5DTKA 3BFDA 2WAEA 1NYMA 4C75A 4B4XA 1XA1A 2GDNA 3S4XA 3UE1A 1ES4A 5KMWA 4E3NA 3HLGA 1YLZA 5FASA 4JXWA 4WEJA 4GD8A 1I2WA 5F82A 4R0QA 1K54C 3HL9A 4MNRA 4UHUA 5FA7A 2IWDA 4N1XA 3UPOA 3BFFA 3BM6A 4JBFA 4E3LA 4JF5A 4EUZA 5HARA 1DJCA 1LL9A 5F83A 1FCNA 4BQMA 3MZEA 5FQIA 1NRFA 3HLBA 3VP2A 4DXBA 1KGFA 2Y91A 1O7EA 3M2KA 3N8LA 5FQMA 3GV9A 1YLYA 1BSGA 1KVMA 4KZ4A 2E8IA 3O3VA 4DRTA 1SDNA 3IH8A 3W4QA 1G6AA 1MWSA 5DTTA 1K25A 3M2JA 1TDGA 3NDEA 4B4ZA 4LV1A 5I94A 5DTSA 1KE4A 2Y59A 2PU4A 3N6IA 3I7JA 3VP4A 3TSGA 2OLVA 3ZG8B 1ESIA 5HAPA 4IBXA 2XR0A 4JXVA 2HPBA 3G35A 3SOIA 4ZJ1A 3OPHA 5CEDA 3BFEA 2Y2IA 5EOOA 4XUZA 3WS4A 1JTDA 1Y54A 1KDSA 2HP5A 2PU2A 2V20A 5CHUA 3ZG5A 3O86A 5JYOA 2ZJ9A 1ALQA 1QMFA 3MFDA 4KG6A 4QU3A 5DF8A 3OCLA 3ZG9B 3O88A 4OQIA 1PWCA 4MBHA 2XF3A 5U47A 3ZVWA 4BLMA 1FR1A 2R9XA 1DJAA 3WWXA 5GHZA 1Q2PA 4NK3A 1BTLA 5KSHA 1K4EA 1M40A 4OQ0A 4OOMA 4Y0OA 3AGDA 2ZLYA 2Y55A 1IEMA 3N8RA 2XFTA 3NCKA 4K91A 4KZ8A 4DDYA 4OOLA 3BEBA 2IWBA 3ZHHA 1W79A 5CERA 1E3UA 3NY4A 3LY4A 1S6RA 4JLFA 4JXSA 1HZOA 1Q2QA 1XA7A 4EV4A 1ZKJA 1RGZA 3IT9A 1NZOA 2V1ZA 4MBKA 1SHVA 4OQGA 1ONHA 1YQSA 2X71A 3IF5A 3ZDJA 1IYOA 1BULA 1PWGA 4R3JA 4S2OA 4BL2A 1SCWA 4DE3A 3PBQA 3MZDA 4FD8A 4E6WA 1NJ4A 2Y2HA 1BT5A 4FSFA 1XXMA 4WBGA 4CPKA 4OP8A 4S2NA 4WM9A 2Q9MA 1BLCA 2ZC5B 1ZG6A 1LI0A 2QMIA 4UA6A 3ISGA 3P09A 1K6SA 5DF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A92 A;  4LCM A;  2H5S A;  1K4F A;  3HLW A;  1GHP A;  4OKP A;  3UPN A;  4PPR A;  4DKI A;  3UO9 A;  3WS5 A;  2XFS A;  4U3T A;  5HAQ A;  2XLN A;  1L0G A;  3G2Y A;  4RVA A;  3C7U A;  3IWO A;  5CHJ A;  3C5A A;  1W8Q A;  4XXR A;  5HAI A;  1XP4 A;  3G30 A;  3Q7V A;  3Q82 A;  4OPQ A;  2WZZ A;  4JPM A;  3CZD A;  3PBN A;  4GZB A;  5CGS A;  5DF9 A;  1ERM A;  2BLS A;  3HRE A;  4EBL A;  1RCJ A;  1ERO A;  2X02 A;  3IXH A;  1NYY A;  3LCE A;  4OPR A;  1MWR A;  1L0D A;  2RL3 A;  1XX2 A;  3GR2 A;  5CGX A;  4E3O A;  1EI5 A;  1ES5 A;  2G2U A;  3IF6 A;  4QY6 A;  3A3E A;  3MKE A;  2WAD A;  2Y2K A;  1RGY A;  4P0M A;  3DWK A;  1ERQ A;  1K56 A;  3WS0 A;  4FH4 A;  1BLH A;  1IYP A;  1E3U D;  1W7F A;  2P74 A;  2WKH A;  3V50 A;  4S2P A;  2DNS A;  1S0W A;  3PBT A;  3SH8 A;  5F1F A;  5M1A A;  2XH9 A;  1BUE A;  1YMS A;  4R1G A;  2HDQ A;  1LLB A;  4KEN B;  4ZJ2 A;  2WUQ A;  4S2K A;  4WEL A;  2H0T A;  4WZ5 A;  4PMA A;  1HVB A;  2Y2J A;  3PAG A;  1JWZ A;  4X6T A;  5BOH A;  2WKE A;  2XDM A;  3VP3 A;  4JKT A;  5EVL A;  2OV5 A;  2BG1 A;  4X69 A;  3TG9 A;  3ZCZ A;  1AXB A;  3VP0 A;  2JE5 A;  3BYD A;  5M18 A;  1K55 A;  5EE8 A;  2ZQC A;  1K38 A;  5D3O A;  2DRW A;  4K0X A;  1KE3 A;  2ZQ7 A;  3EQV A;  4KZA A;  4S2J A;  4YIN A;  3WS2 A;  3OPP A;  4S2M A;  3S22 A;  5A91 A;  3NBL A;  3QHY A;  3AGE A;  3ITA A;  5F1G A;  3UDX A;  4EBP A;  4KZ5 A;  1OME A;  2EX8 A;  3PTE A;  5CXW A;  1YMX A;  2J9O A;  2Y2P A;  5E2E A;  2ZM0 A;  5E2G A;  3HLD A;  3LEZ A;  4ID4 A;  3E2K A;  3C4O A;  3HLF A;  3UDI A;  1KGE A;  5EOE A;  1ZG4 A;  2XEP A;  1YLP A;  1BLP A;  2EX6 A;  3IH9 A;  4IVK A;  3NI9 A;  3VFH A;  4R3B A;  4KZ9 A;  4JXG A;  4S2N C;  4OH0 A;  1MPL A;  3HUO A;  5A93 A;  5FI2 A;  1ONG A;  3UPP A;  4N92 A;  1YLW A;  1CEF A;  5E43 A;  2UWX A;  2ZC4 B;  3A3D A;  4X56 A;  3HBR A;  5GHY A;  1GA0 A;  1M6K A;  2QPN A;  3A3F A;  4KQO A;  1K56 D;  2R9W A;  5AQ9 A;  3ZG0 A;  2DCF A;  4GKU A;  2X01 A;  5L2F A;  2RCX A;  3BEC A;  1GHI A;  2FFY A;  4EBN A;  4OLD A;  1PW1 A;  1KE0 A;  4GDN A;  1I2S A;  1NZU A;  2EXA A;  4R4S A;  4OLG A;  3LY3 A;  1XPB A;  4MLL A;  2WKI A;  3HUM A;  4QY5 A;  3NIA A;  4ZJ3 A;  1YLJ A;  3PBS A;  4H8R A;  2HP9 A;  3IXD A;  1PZP A;  5EVI A;  1JWP A;  2CC1 A;  2I72 A;  2HDR A;  4GD6 A;  5FQK A;  4U0X A;  3OZH A;  3IF6 C;  3B3X A;  1JWV A;  4O7D A;  3V3S A;  4IBR A;  2VGJ A;  1I5Q A;  3N8S A;  5CEB A;  4EQI A;  3OPR A;  2ZD8 A;  1YT4 A;  3BFG A;  2OLU A;  5FAT A;  4F94 A;  1TEM A;  2B5R A;  3SS3 A;  4HBT A;  5HL1 A;  1MWT A;  1IKI A;  1L0E A;  1YLT A;  3VMA A;  1TDL A;  3A3I A;  4E6X A;  4PM8 A;  3UE0 A;  4OON A;  3ZNT A;  4OVD A;  4KG5 A;  1VM1 A;  1YM1 A;  5TGF A;  2A3U A;  3C4P A;  4WZ5 C;  4OOY A;  1IKG A;  1XGI A;  1W5D A;  2Z2L B;  3HLC A;  3HLE A;  4EWF A;  3GQZ A;  2C5W B;  4GNU A;  4OPY A;  4X68 A;  4ZTK A;  1H8Z A;  3ZGA B;  1K55 C;  2J8Y A;  3VP1 A;  4MEZ A;  1CK3 A;  1VQQ A;  4KZ6 A;  1DY6 A;  1BZA A;  4WYY A;  3ITB A;  5GL9 A;  2HP6 A;  3HVF A;  2ZM2 A;  3BLM A;  3AGF A;  5CTM A;  4QB8 A;  3S1Y A;  1C3B A;  1O07 A;  1N9B A;  2ZC7 A;  2EFU A;  3E2L A;  2XK1 A;  4Z9Q A;  1MBL A;  3OC2 A;  1U60 A;  5JYP A;  4N1H A;  3N4I A;  4BJP A;  4L0L A;  3ZNY A;  4A5R A;  3RXW A;  5FI7 A;  5EVI D;  4LV3 A;  1RP5 A;  4GOG A;  5TFQ A;  5E2F A;  3EQU A;  1PW8 A;  3FWL A;  4N9L A;  1IEL A;  3GSG A;  2WGV A;  2WGW A;  2Y2O A;  4UAA A;  1E4D A;  3OCN A;  1EWZ A;  3G4P A;  3C7V A;  4RA7 A;  1FR6 A;  4DE0 A;  2P9V A;  4NET A;  3DWZ A;  3NDG A;  3Q7V B;  1K6R A;  4DE1 A;  4HES A;  3FYZ A;  4BL3 A;  4PM5 A;  1NY0 A;  3W8K A;  4QJG A;  1TVF A;  3V5M A;  3WRZ A;  1MKI A;  1BLS A;  5EVI C;  5EUA A;  3MKF A;  3FKV A;  2G2W A;  1J9M A;  5FAQ A;  2QZ6 A;  4R23 A;  1K57 C;  3IF6 B;  4JF4 A;  4Y0T A;  1PYY A;  1PI5 A;  2A49 A;  4GDB A;  3UE3 A;  2J9P A;  2ZQD A;  2XGN A;  3OPL A;  3QNB A;  4N9K A;  3GRJ A;  4P6B A;  2Y2M A;  1WYC A;  1L2S A;  2IWC A;  4P87 A;  3DTM A;  5HFO A;  3ZVT A;  1IYS A;  4KQR A;  1G68 A;  2WAF A;  3GMW A;  4KZ7 A;  1WE4 A;  3LO7 A;  5GLC A;  1ZC2 A;  4JF6 A;  3UN7 A;  1LI9 A;  4BEN A;  3QNC A;  5CTN A;  2Y2N A;  2Y4A A;  4ZDX A;  3PBO A;  4DDS A;  1HD8 A;  5J8X A;  1KDW A;  3PAE A;  3RXX A;  3WS1 A;  4M3K A;  4LV0 A;  3W4O A;  3IHA A;  5IHV A;  3W4P A;  4WMC A;  4KQQ A;  2Y2G A;  1SKF A;  3UDF A;  4D2O A;  3TOI A;  3BLS A;  1DJB A;  3MXR A;  3VOZ A;  3SS4 A;  3M6H A;  2ZQ8 A;  3V39 A;  2JC7 A;  2ZM8 A;  4OPZ A;  4CJN A;  4PM9 A;  3FKW A;  5HW3 A;  4KZ3 A;  4RX2 A;  4QD4 A;  4WZ4 A;  1Z6F A;  2PBY A;  3SS5 A;  2H10 A;  1LHY A;  1MWU A;  4OQH A;  4LV2 A;  5EPH A;  4B88 A;  1CI8 A;  1FSW A;  2XD1 A;  2Z2M B;  4KG2 A;  2C6W B;  4GN2 A;  4LEN A;  4ZAM A;  3Q1F A;  1IYQ A;  2WYX A;  5FQJ A;  4S2I A;  2Y2Q A;  4Y0U A;  1KVL A;  3IWI A;  4MBF A;  4S2L A;  5EEC A;  3G34 A;  1H8Y A;  4E3K A;  3VOY A;  5FQ9 A;  1K57 A;  3PBR A;  1N4O A;  4E3J A;  2ZQ9 A;  1H5X A;  2ZC6 B;  4PM6 A;  5FQQ A;  2JCH A;  4X53 A;  4C3Q A;  1PIO A;  3G2Z A;  4XUX A;  1MY8 A;  3RJU A;  4BD0 A;  4QHC A;  3MXS A;  4FCF A;  1XKZ A;  4YFM A;  1FCM A;  3BFC A;  5EVI B;  3WRT A;  5M19 A;  4K0W A;  1JVJ A;  1PWD A;  4E3I A;  5GLD A;  3UY6 A;  5FAO A;  4IED A;  2XD5 A;  4C6Y A;  3SH9 A;  1WYB A;  5CHM A;  2EFX A;  4WMC D;  5FDH A;  3CJM A;  3D4F A;  4HBU A;  4P85 A;  3MZF A;  4IVI A;  1E25 A;  4OP5 A;  3CMZ A;  1ESU A;  1K54 A;  3G31 A;  1GA9 A;  3Q7Z A;  1PZO A;  3IHB A;  5G18 A;  1FSY A;  4DE2 A;  3IQA A;  3ZG7 B;  2EX9 A;  5HX9 A;  1MXO A;  3FV7 A;  5E2H A;  3JYI A;  5KSC A;  4GB7 A;  1FQG A;  3IWQ A;  5FSR A;  2ZQA A;  3CG5 A;  3VSL A;  2HDU A;  1JTG A;  5CRF A;  1ES3 A;  3IXG A;  4Y7P A;  1LL5 A;  5CEC A;  2Y2L A;  2JBF A;  2EXB A;  2OSU A;  1KGG A;  5GLB A;  4Q8I A;  2ZC3 B;  1ES2 A;  5DVA A;  5FI6 A;  2HDS A;  1XGJ A;  3V3R A;  3O87 A;  4R4R A;  5TR7 A;  4HEF A;  1PI4 A;  1GHM A;  3ZFZ A;  1NXY A;  3Q07 A;  3G32 A;  3BRM A;  4WEK A;  3DW0 A;  2XQZ A;  4DXC A;  4FH2 A;  3IXB A;  3NC8 A;  5AQA A;  1QME A;  2ZMA A;  3GVB A;  2WGI A;  5FAP A;  4BD1 A;  5A90 A;  2J7V A;  2H0Y A;  4RYE A;  3Q81 A;  4DF6 A;  4KZB A;  3SH7 A;  5GHX A;  3M6B A;  1CEG A;  3P98 A;  4UA9 A;  2WGW B;  3VFF A;  2P9V B;  3FZC A;  2VGK A;  1FCO A;  1GCE A;  2EX2 A;  3HUN A;  3N7W A;  5AQB A;  5KZH A;  1SDE A;  2WK0 A;  1CI9 A;  4E3M A;  1L0F A;  1FOF A;  3GTC A;  1HTZ A;  2Q9N A;  3MBZ A;  5CGW A;  4ZBE A;  2FFF B;  3VSK A;  4LCL A;  1W8Y A;  4PM7 A;  4RX3 A;  4U0T A;  3UNW A;  4UA7 A;  4X55 A;  5AQ7 A;  5GLA A;  2V2F F;  2WZX A;  3A3J A;  5DTK A;  3BFD A;  2WAE A;  1NYM A;  4C75 A;  4B4X A;  1XA1 A;  2GDN A;  3S4X A;  3UE1 A;  1ES4 A;  5KMW A;  4E3N A;  3HLG A;  1YLZ A;  5FAS A;  4JXW A;  4WEJ A;  4GD8 A;  1I2W A;  5F82 A;  4R0Q A;  1K54 C;  3HL9 A;  4MNR A;  4UHU A;  5FA7 A;  2IWD A;  4N1X A;  3UPO A;  3BFF A;  3BM6 A;  4JBF A;  4E3L A;  4JF5 A;  4EUZ A;  5HAR A;  1DJC A;  1LL9 A;  5F83 A;  1FCN A;  4BQM A;  3MZE A;  5FQI A;  1NRF A;  3HLB A;  3VP2 A;  4DXB A;  1KGF A;  2Y91 A;  1O7E A;  3M2K A;  3N8L A;  5FQM A;  3GV9 A;  1YLY A;  1BSG A;  1KVM A;  4KZ4 A;  2E8I A;  3O3V A;  4DRT A;  1SDN A;  3IH8 A;  3W4Q A;  1G6A A;  1MWS A;  5DTT A;  1K25 A;  3M2J A;  1TDG A;  3NDE A;  4B4Z A;  4LV1 A;  5I94 A;  5DTS A;  1KE4 A;  2Y59 A;  2PU4 A;  3N6I A;  3I7J A;  3VP4 A;  3TSG A;  2OLV A;  3ZG8 B;  1ESI A;  5HAP A;  4IBX A;  2XR0 A;  4JXV A;  2HPB A;  3G35 A;  3SOI A;  4ZJ1 A;  3OPH A;  5CED A;  3BFE A;  2Y2I A;  5EOO A;  4XUZ A;  3WS4 A;  1JTD A;  1Y54 A;  1KDS A;  2HP5 A;  2PU2 A;  2V20 A;  5CHU A;  3ZG5 A;  3O86 A;  5JYO A;  2ZJ9 A;  1ALQ A;  1QMF A;  3MFD A;  4KG6 A;  4QU3 A;  5DF8 A;  3OCL A;  3ZG9 B;  3O88 A;  4OQI A;  1PWC A;  4MBH A;  2XF3 A;  5U47 A;  3ZVW A;  4BLM A;  1FR1 A;  2R9X A;  1DJA A;  3WWX A;  5GHZ A;  1Q2P A;  4NK3 A;  1BTL A;  5KSH A;  1K4E A;  1M40 A;  4OQ0 A;  4OOM A;  4Y0O A;  3AGD A;  2ZLY A;  2Y55 A;  1IEM A;  3N8R A;  2XFT A;  3NCK A;  4K91 A;  4KZ8 A;  4DDY A;  4OOL A;  3BEB A;  2IWB A;  3ZHH A;  1W79 A;  5CER A;  1E3U A;  3NY4 A;  3LY4 A;  1S6R A;  4JLF A;  4JXS A;  1HZO A;  1Q2Q A;  1XA7 A;  4EV4 A;  1ZKJ A;  1RGZ A;  3IT9 A;  1NZO A;  2V1Z A;  4MBK A;  1SHV A;  4OQG A;  1ONH A;  1YQS A;  2X71 A;  3IF5 A;  3ZDJ A;  1IYO A;  1BUL A;  1PWG A;  4R3J A;  4S2O A;  4BL2 A;  1SCW A;  4DE3 A;  3PBQ A;  3MZD A;  4FD8 A;  4E6W A;  1NJ4 A;  2Y2H A;  1BT5 A;  4FSF A;  1XXM A;  4WBG A;  4CPK A;  4OP8 A;  4S2N A;  4WM9 A;  2Q9M A;  1BLC A;  2ZC5 B;  1ZG6 A;  1LI0 A;  2QMI A;  4UA6 A;  3ISG A;  3P09 A;  1K6S A;  5DF7 A; 
#chains in the Genus database with same CATH topology
 3HLW A;  1GHP A;  3IX3 A;  1NWZ A;  4DKI A;  3WS5 A;  2XLN A;  3G2Y A;  1W8Q A;  5HAI A;  3Q7V A;  3CZD A;  1HLU P;  2BLS A;  3HRE A;  4MMN A;  1RCJ A;  3LCE A;  1L0D A;  2RL3 A;  3F1P A;  1AWI A;  4QY6 A;  3MKE A;  2Y2K A;  1RGY A;  4P0M A;  5HDD A;  3DWK A;  2PYP A;  2VV6 A;  1ERQ A;  3WS0 A;  2J3W A;  4F3L A;  1IYP A;  1E3U D;  4X25 A;  3G6O A;  3V50 A;  3EEA A;  3SH8 A;  2XH9 A;  4JGP A;  1LLB A;  2WUQ A;  4WEL A;  3EWK A;  4PMA A;  3JPU A;  1HVB A;  4UEY A;  5BOH A;  3RH8 B;  3TG9 A;  1NRJ A;  1AXB A;  3VP0 A;  2JE5 A;  3BYD A;  4L9E A;  5M18 A;  1UWN X;  3LI8 A;  2ZQC A;  5D3O A;  2DRW A;  1KE3 A;  4YIN A;  2W1T B;  3AGE A;  5F1G A;  5FDS A;  1OT6 A;  4EBP A;  4I3I A;  5CXW A;  4EES A;  5E2E A;  2Y2P A;  5E2G A;  5DKL A;  4IJG A;  3IH9 A;  4IVK A;  3NI9 A;  4KZ9 A;  3HUO A;  1ONG A;  4N92 A;  3R7W A;  4DJ2 A;  3ULF A;  2XSS A;  3HBR A;  5GHY A;  4EBN A;  1KE0 A;  3LIF A;  2EXA A;  3OBF A;  2WKI A;  3NEC A;  5EVI A;  3RTY A;  2I72 A;  2HDR A;  3V3S A;  3OZH A;  4O7D A;  2QWS A;  5F68 A;  3MMH A;  1MWT A;  3VMA A;  4E6X A;  2J3T C;  3E98 A;  5TGF A;  4CQH A;  4HY8 A;  1XGI A;  5HWW A;  2Z2L B;  3HLC A;  1OTA A;  4PKY A;  3MS6 A;  4X68 A;  4ZTK A;  1H8Z A;  4MEZ A;  1BZA A;  3IBJ A;  3QP6 A;  2PT7 A;  3OOV A;  5J3W A;  2JKR M;  5CTM A;  4JGO A;  3HJI A;  3IS2 A;  4HJ6 A;  2VK3 A;  1U60 A;  5JYP A;  1G28 A;  3N4I A;  4L0L A;  3LR0 A;  5EVI D;  4LV3 A;  5FEF A;  3EQU A;  1ODV A;  1D7E A;  3B33 A;  4YOF A;  5DFY A;  4DE0 A;  4NET A;  4P6Z S;  4HES A;  3W8K A;  3WRZ A;  1MKI A;  3MKF A;  2B02 A;  3K2N A;  4R23 A;  4UQI S;  3QNB A;  3GRJ A;  1MZU A;  2Y2M A;  5J7E A;  4JGQ A;  2IWC A;  4P87 A;  4KQR A;  1G68 A;  4UQI M;  4KZ7 A;  3LO7 A;  3JVU A;  1LI9 A;  2Y2N A;  5J8X A;  3LEQ A;  4KUO A;  3W4O A;  4KQQ A;  4WLA A;  4MCW A;  3BLS A;  4HP9 A;  3EGD C;  3VOZ A;  4OPZ A;  4KZ3 A;  2PBY A;  2H10 A;  4LV2 A;  1CI8 A;  2Z2M B;  3JVV A;  4ZAM A;  3Q1F A;  4AFI A;  1P97 A;  4Y15 A;  3TE8 A;  5FQJ A;  3KYQ A;  2Y2Q A;  3CUE C;  3T4Q A;  5F69 A;  1H8Y A;  4E3K A;  1N4O A;  4E3J A;  2ZQ9 A;  1P9W A;  1S4S A;  3LR4 A;  4XUX A;  4QHC A;  2OWH A;  4I3J A;  1FCM A;  2CMN A;  1LSX A;  3WRT A;  4K0W A;  2XD5 A;  5FDH A;  2MJ6 A;  2KLI A;  4IVI A;  4OP5 A;  4HQA A;  1GSX A;  4R38 A;  3IQA A;  3ZG7 B;  2NUP C;  1MXO A;  3FV7 A;  3JYI A;  4GB7 A;  3T4J A;  5FSR A;  5CRF A;  3IXG A;  4ARZ B;  2JBF A;  4BWI A;  3CHW P;  4L9F A;  4GHI B;  3GEC A;  3CIT A;  2ZC3 B;  4H6J A;  1UWP X;  1XGJ A;  1PI4 A;  1GHM A;  5MC7 A;  4NEE D;  4WEK A;  4WUJ A;  1TS7 A;  3NC8 A;  1T1B A;  3GVB A;  5HSQ A;  1K0K A;  1F2K A;  2VKS A;  4DF6 A;  2O0Y A;  3W2Z A;  4KZB A;  3SH7 A;  5LBR A;  5GHX A;  2JKT M;  4GS9 B;  1S1Y A;  2WGW B;  3S7P A;  3EOI A;  2XA7 M;  1FCO A;  5KZH A;  2WK0 A;  1CI9 A;  1HTZ A;  3MBZ A;  3S7Q A;  3VSK A;  3LR5 A;  4RX3 A;  4UA7 A;  5TBM A;  2WAE A;  1NYM A;  4IUH A;  5DFX A;  5KMW A;  3HLG A;  4ME4 A;  1MC0 A;  2BTF P;  5FAS A;  5HZH A;  3HJK A;  5F82 A;  4N1X A;  3BM6 A;  4JBF A;  2Y8H A;  3BJN A;  2V8C A;  1DJC A;  1LL9 A;  4O8G A;  1FCN A;  3MZE A;  3U4L P;  4DXB A;  3BQA A;  3N8L A;  5FQM A;  2FZ0 A;  3LIC A;  3S7O A;  2PR5 A;  3ZG8 B;  2HPB A;  3G35 A;  3SOI A;  3VOL A;  5CED A;  1SKO B;  4HP4 A;  5K5B A;  1S66 L;  2PU2 A;  4B93 A;  4WF0 A;  3T1S A;  1QMF A;  3DTE A;  1XJ2 A;  5U47 A;  5G4Z A;  4KQD A;  4OQ0 A;  3NCK A;  4DDY A;  4OOL A;  2O99 A;  3F1O B;  4GCZ A;  4EV4 A;  1ZKJ A;  4HOI A;  3IT9 A;  2V1Z A;  4OQG A;  5HPF A;  1YQS A;  4ESP A;  3IF5 A;  3H82 B;  3TRC A;  1PWG A;  4S2O A;  4FD8 A;  4E6W A;  1NJ4 A;  1XXM A;  3V67 A;  4OP8 A;  4S2N A;  1BLC A;  1LI0 A;  4XT2 B;  3ISG A;  2Z6D A;  4LCM A;  1K4F A;  2OAQ 1;  4RVA A;  3C5A A;  2P04 A;  2H28 A;  3B42 A;  3G30 A;  1VET B;  4OPQ A;  5A8B A;  4O0P A;  3A0V A;  2A2L A;  4OPR A;  3ICY A;  1EI5 A;  2WAD A;  2FH5 A;  1A0K A;  4K08 A;  1K56 A;  2L1M A;  1W7F A;  3R4K A;  1S0W A;  3PBT A;  5M1A A;  1BUE A;  1YMS A;  2HDQ A;  3CPT A;  2W27 A;  4WZ5 A;  4HH3 A;  4LPZ A;  4JKT A;  1T1A A;  4S2J A;  1XJ3 A;  3S22 A;  3NBL A;  3QHY A;  4KZ5 A;  2W3D A;  3LEZ A;  4ID4 A;  3C4O A;  1DP9 A;  3UDI A;  5EOE A;  1YLP A;  1BLP A;  5FI2 A;  4ETZ A;  1NLZ A;  1CEF A;  3CLO A;  5E43 A;  2UWX A;  2ZC4 B;  3MSH A;  4X56 A;  1GA0 A;  1M6K A;  3A3F A;  2V1A A;  1K56 D;  2R9W A;  3BY8 A;  4GKU A;  5L2F A;  4EXO A;  5IT5 A;  1PW1 A;  4LRY C;  3LY3 A;  4ZJ3 A;  3NIA A;  3PBS A;  2HP9 A;  1PZP A;  2ZOH A;  1G5U A;  1Y4O A;  4GD6 A;  5FQK A;  3WWX A;  4U0X A;  3IF6 C;  3B3X A;  3CI6 A;  2VGJ A;  3N8S A;  5CEB A;  2ZD8 A;  4F94 A;  3SS3 A;  4HBT A;  1L0E A;  1TDL A;  3A3I A;  2VEA A;  3ZNT A;  1VM1 A;  4OOY A;  1IKG A;  1W5D A;  3GQZ A;  2C5W B;  4GNU A;  1P0Z A;  1K55 C;  2J8Y A;  3T4K A;  1NLY A;  5AJG A;  5GL9 A;  2HP6 A;  4EW7 A;  1N9B A;  2XK1 A;  1MBL A;  3OC2 A;  1TS8 A;  2JKG A;  3T50 A;  2WKR A;  2PD8 A;  4A5R A;  4GOG A;  3TW8 A;  4BMW A;  3GSG A;  4UAA A;  3OCN A;  3LID A;  2P9V A;  3DWZ A;  3NDG A;  1K6R A;  4BL3 A;  4PM5 A;  1VEU A;  1NY0 A;  2ACG A;  1TVF A;  1BLS A;  5EUA A;  1EW0 A;  2GNX A;  3L7H A;  3IF6 B;  4WN5 A;  2A49 A;  4GDB A;  4NXE A;  3T4S A;  2J9P A;  2XGN A;  3OPL A;  1XFN A;  5HFO A;  2WAF A;  2ZL1 A;  3KYE A;  1ZC2 A;  4JF6 A;  4BEN A;  5CTN A;  3H9W A;  4FOF A;  1YSQ A;  3RXX A;  3NOP C;  2Y79 A;  4HNB A;  5L8M A;  2GJ3 A;  2Y2G A;  4LRX C;  3T12 B;  1DJB A;  3MXR A;  3M6H A;  2IA2 A;  3V39 A;  2ZM8 A;  4PM9 A;  4QD4 A;  3NUL A;  4ZRR A;  3SS5 A;  4HH2 A;  2XD1 A;  4EEU A;  3S7N A;  2WYX A;  2WKP A;  1XJ4 A;  5EEC A;  4S2L A;  3T4T A;  5FQ9 A;  1K57 A;  4Q0I A;  4EQ1 A;  2HJ9 C;  5FQQ A;  3GDI A;  4ETX A;  2J80 A;  5DKK A;  3MXS A;  2JKT I;  4YFM A;  5EFW A;  4MN5 A;  3PXP A;  5F5Y A;  1VHM A;  5M19 A;  2ZBB A;  1JVJ A;  1PWD A;  3UY6 A;  5FAO A;  4C6Y A;  3SH9 A;  3C30 A;  3D4F A;  4GW9 A;  2G7U A;  1PZO A;  1MKM A;  4DE2 A;  4CLC A;  5KSC A;  3IBR A;  2NUT C;  4Y2F A;  3IWQ A;  2HDU A;  5TJJ A;  5CEC A;  1LL5 A;  2Y2L A;  2HDS A;  3V3R A;  4I39 A;  4R4R A;  5TR7 A;  4HEF A;  1DP8 A;  3ZFZ A;  3G32 A;  3MXQ A;  2XQZ A;  3K3C A;  4DXC A;  3IXB A;  5AQA A;  2ZMA A;  5FAP A;  4H6J B;  3UE6 A;  2H0Y A;  4P6Z M;  3VFF A;  4DN0 A;  1GCE A;  3HUN A;  1FOF A;  4ZBE A;  3NOT C;  2FFF B;  1ZHH B;  4LCL A;  4CLC D;  4M4X A;  4U0T A;  4X55 A;  1W63 M;  2V2F F;  2WZX A;  3A3J A;  2W1T A;  2AVX A;  3BFD A;  4C75 A;  3UE1 A;  1H0M A;  3EGX C;  1YLZ A;  2O9C A;  1I2W A;  5FEG A;  4I38 A;  1IOU A;  5EM1 A;  1K54 C;  4MNR A;  3MF0 A;  4EET B;  4E3L A;  3EEH A;  4EUZ A;  4BQM A;  5FQI A;  5TBM B;  5EVE A;  2W3F A;  1O7E A;  1H3Q A;  4KZ4 A;  3O3V A;  4DRT A;  1SDN A;  3QP2 A;  5DTT A;  3NDE A;  1TDG A;  3E4P A;  2Y59 A;  5HDC A;  3N6I A;  4PHT A;  3TSG A;  5HAP A;  1PNE A;  3LIB A;  2Y2I A;  5EOO A;  1Y54 A;  2LB9 A;  1KDS A;  2HP5 A;  5CHU A;  3ZG5 A;  3O86 A;  3VV4 A;  5JYO A;  1TF1 A;  2W1R A;  3ZVW A;  4BLM A;  1FR1 A;  3IX4 A;  4NK3 A;  5KSH A;  4Y0O A;  2ZLY A;  1N9N A;  3ZHH A;  3LUQ A;  1HZO A;  4LFU A;  1YAX A;  4Q0J A;  2KX6 A;  4YNR A;  4DE3 A;  1Z09 A;  4X1M A;  4FSF A;  4EUV A;  2Q9M A;  3L9K A;  1ZG6 A;  2INW A;  2QMI A;  2EWW A;  3H7W B;  5A92 A;  4KUK A;  1GSV A;  3UPN A;  2XFS A;  1L0G A;  3C7U A;  1XP4 A;  3Q82 A;  4FTX A;  4JPM A;  3PBN A;  5CGS A;  1ERM A;  4LLO B;  2K31 A;  3IXH A;  2OAP 1;  2P08 A;  1MWR A;  2VX8 A;  5CGX A;  1XX2 A;  1ES5 A;  2G2U A;  3A3E A;  3HCY A;  2YKH A;  3F1N B;  2A24 B;  5L09 A;  1BLH A;  1FIL A;  4S2P A;  3A0S A;  2DNS A;  5F1F A;  3KX0 X;  1N9O A;  4I3A A;  5F6A A;  2PAV P;  4R1G A;  4ZJ2 A;  2H0T A;  2Y2J A;  3NOU C;  3PAG A;  4X6T A;  2WKE A;  3VP3 A;  5EVL A;  2OV5 A;  4X69 A;  3DBA A;  3ZCZ A;  5EE8 A;  3KSI A;  4K0X A;  2ZQ7 A;  4S2M A;  4NG2 A;  5A91 A;  2QHK A;  3ITA A;  3UDX A;  1OME A;  1BYW A;  1FIK A;  3PTE A;  2ZM0 A;  1OTI A;  3HLF A;  5G4Y A;  3UB6 A;  4EU0 A;  3E0Y A;  4JXG A;  4OH0 A;  1YLW A;  5DJT A;  3FC7 A;  4KQO A;  5AQ9 A;  2DCF A;  4GDN A;  1I2S A;  1NZU A;  4QY5 A;  1YLJ A;  1G6O A;  2K7S A;  4H8R A;  4Y3I A;  4EQI A;  3PHY A;  3OPR A;  1YT4 A;  2OLU A;  1TEM A;  1YPR A;  2B5R A;  5HL1 A;  4I5S A;  3UE0 A;  4OON A;  2GZA A;  3D3O A;  2ZMV A;  4LRZ E;  2M7U A;  1YM1 A;  2A3U A;  4DJ3 A;  5HPI A;  3C4P A;  4BBV A;  2W3H A;  2QJ7 A;  3ZGA B;  3VP1 A;  1CK3 A;  2VA0 A;  4ARZ A;  3ITB A;  3TJZ C;  2ZM2 A;  3AGF A;  4QB8 A;  1O07 A;  2W3E A;  2ZC7 A;  2EFU A;  3E2L A;  1F5M A;  3FPV A;  4BJP A;  4HHD A;  3KSF A;  3RXW A;  5FI7 A;  1RP5 A;  2VGL S;  5TFQ A;  3CUE A;  1PW8 A;  3FWL A;  4GS9 A;  2WGV A;  2WGW A;  1E4D A;  2GX5 A;  3BW6 A;  1EWZ A;  3C7V A;  3Q7V B;  4MDZ A;  3T1Q B;  4DE1 A;  4Z1W A;  2VGL M;  2Q0O A;  4HI4 A;  1F98 A;  1CJF A;  3V5M A;  2UV0 E;  5EVI C;  2G2W A;  3F1P B;  1J9M A;  1K57 C;  4JF4 A;  4Y0T A;  1PYY A;  3ZQ5 A;  5HL6 A;  3UE3 A;  4F3L B;  2ZQD A;  4P6B A;  5EM0 A;  1OTE A;  1WYC A;  3DTM A;  5DJU A;  1IYS A;  1WE4 A;  5GLC A;  4NXF A;  3QNC A;  2Y4A A;  3BY9 A;  1HD8 A;  1S1Z A;  3PAE A;  4M3K A;  2Z6C A;  4LV0 A;  4E04 A;  1X0O A;  4WMC A;  1SKF A;  4D2O A;  3TOI A;  3T4L A;  2JKR I;  3SS4 A;  1J3W A;  3FPW A;  4O01 A;  4CJN A;  5HW3 A;  1UGU A;  4WZ4 A;  1Z6F A;  4G3W A;  2PYR A;  4BBT A;  2E8J A;  1FSW A;  3E4O A;  2C6W B;  4GN2 A;  4LEN A;  1SKO A;  3LYX A;  1IYQ A;  2PD7 A;  2DMW A;  3MJQ A;  4S2I A;  3U2A A;  3DAV A;  3R7W B;  4Y0U A;  2YKF A;  3IWI A;  4G3K A;  3ZYT A;  4NXB A;  4IUK A;  5HWV A;  3PBR A;  2I9V A;  1STZ A;  2V0W A;  4X53 A;  4C3Q A;  1PIO A;  1MY8 A;  4FCF A;  1XKZ A;  3BFC A;  5EVI B;  3F1O A;  4E3I A;  5GLD A;  1CF0 A;  4IED A;  1WYB A;  4CLC E;  4WMC D;  4HBU A;  4P85 A;  2P7J A;  3H82 A;  1JNU A;  1P9R A;  3PR6 A;  3CMZ A;  1ESU A;  3G31 A;  1GA9 A;  3Q7Z A;  3IHB A;  3B47 A;  1FSY A;  5G18 A;  3PYP A;  3VE4 A;  2M1C A;  4XT2 A;  1T1C A;  5EV0 A;  1KOU A;  2ZQA A;  4WL9 A;  5AVE A;  1JTG A;  4Y7P A;  2EXB A;  2OSU A;  1KGG A;  1VET A;  5FI6 A;  3IS2 B;  3O87 A;  1CQA A;  2D02 A;  4FH2 A;  1IFQ A;  2HGV A;  4RYE A;  3Q81 A;  3M6B A;  3P98 A;  3KSG A;  2EA9 A;  3FZC A;  4BBU A;  2O9A A;  5AQB A;  3N7W A;  1SDE A;  1TS6 A;  1T19 A;  4E3M A;  2BAS A;  3GTC A;  1W8Y A;  5KIZ A;  3UNW A;  2EWV A;  1LSW A;  1ZTU A;  5DTK A;  3UMD A;  4B4X A;  3S4X A;  1SZV A;  4HJ3 A;  1ES4 A;  4E3N A;  2PHY A;  4WEJ A;  2B95 A;  4R0Q A;  3HL9 A;  4UHU A;  2IWD A;  3BFF A;  5CX7 A;  1NRF A;  3LIE A;  3HLB A;  3M2K A;  3GV9 A;  1YLY A;  5J4E A;  2E8I A;  3IH8 A;  1MWS A;  2K2N A;  1K25 A;  3M2J A;  4B4Z A;  5I94 A;  1KE4 A;  1LSV A;  3T4O A;  3C8C A;  4JXV A;  4ZJ1 A;  3OPH A;  3BFE A;  4XUZ A;  1JTD A;  4NKP A;  4HJ4 A;  2L0W A;  4Q0H A;  1T18 A;  3A0R A;  2ZJ9 A;  3MFD A;  4HIA A;  5IU1 A;  1TD5 A;  5DF8 A;  3OCL A;  3ZG9 B;  3LFV A;  3O88 A;  4OQI A;  4MBH A;  2XF3 A;  4QWO A;  2R9X A;  2PBD P;  1BTL A;  1D1J A;  3AGD A;  1IEM A;  2XFT A;  4PKY G;  1W79 A;  2WKQ A;  3NY4 A;  3LY4 A;  2JHE A;  1S6R A;  4JLF A;  4JXS A;  1Q2Q A;  1ACF A;  1XA7 A;  4II7 A;  2VLG A;  2VZW A;  1IYO A;  4R3J A;  4BL2 A;  1SCW A;  3PBQ A;  3MZD A;  5HDS A;  4WBG A;  4CPK A;  1OTB A;  4WM9 A;  3OLO A;  2ZC5 B;  3SW1 A;  3NJA A;  1K6S A;  5DF7 A;  2H5S A;  4OKP A;  4PPR A;  1YKD A;  3UO9 A;  4U3T A;  5HAQ A;  3IWO A;  5CHJ A;  4XXR A;  3LI9 A;  3CAX A;  2WZZ A;  3MQQ A;  4GZB A;  5DF9 A;  4EBL A;  1ERO A;  2LB5 A;  2X02 A;  1NYY A;  3GR2 A;  2B18 A;  4MN7 A;  4E3O A;  3IF6 A;  3NHQ A;  2V9A A;  4FH4 A;  4Y13 A;  2P74 A;  3MQO A;  2KOI A;  2WKH A;  3RFB A;  4KEN B;  4S2K A;  1JWZ A;  5C5K A;  2XDM A;  3T1R A;  2XRO A;  4R70 A;  2BG1 A;  3LR3 A;  1K55 A;  3SZT A;  1K38 A;  4MN6 A;  3EQV A;  4KZA A;  3WS2 A;  2PR6 A;  3OPP A;  3UB7 A;  2EX8 A;  1YMX A;  2J9O A;  1OPX A;  3BQ8 A;  3HLD A;  3E2K A;  1KGE A;  1ZG4 A;  2XEP A;  2EX6 A;  2W0N A;  3VFH A;  4R3B A;  2OWJ A;  4S2N C;  2V1B A;  1L3L A;  1MPL A;  5A93 A;  3UB5 P;  3UPP A;  1V9Z A;  4EEP A;  3MR0 A;  3A3D A;  5I5L A;  2QPN A;  1LT0 A;  3ZG0 A;  2R78 A;  2X01 A;  2O9B A;  2RCX A;  1GHI A;  3BEC A;  3C2W A;  2FFY A;  4OLD A;  4R4S A;  4OLG A;  1XPB A;  4MLL A;  3HUM A;  2HV1 A;  3IXD A;  1JWP A;  2CC1 A;  4Y5F A;  1JWV A;  3P7N A;  4IBR A;  1I5Q A;  3D72 A;  1DP6 A;  2VV8 A;  3BFG A;  5FAT A;  2PDR A;  1IKI A;  1YLT A;  2VJW A;  4PM8 A;  4OVD A;  4NXG A;  4KG5 A;  4WZ5 C;  4R3A A;  3T1X A;  4EWF A;  3HLE A;  4OPY A;  3IX8 A;  3KSH A;  1VQQ A;  4KZ6 A;  1DY6 A;  4WYY A;  1OTD A;  3E4Q A;  3HVF A;  3VE3 A;  3BLM A;  3S1Y A;  1C3B A;  4Z9Q A;  3FG8 A;  2QYB A;  4N1H A;  4D60 A;  3ZNY A;  5AVF A;  3C38 A;  1OJG A;  3UB8 A;  5E2F A;  1WA9 A;  4N9L A;  4B9O A;  1IEL A;  2Y2O A;  4RA7 A;  3G4P A;  1FR6 A;  3FYZ A;  1S67 L;  2XA7 S;  4QJG A;  4PAU A;  3FKV A;  5FAQ A;  3O5Y A;  2QZ6 A;  2QKP A;  1PI5 A;  5L07 A;  1OT9 A;  4N9K A;  4LGW A;  1L2S A;  3ZVT A;  3MFX A;  3GMW A;  3CPT B;  3UN7 A;  4ZDX A;  3PBO A;  3QP5 A;  4DDS A;  1KDW A;  3WS1 A;  2HF6 A;  3IHA A;  5IHV A;  3W4P A;  3P01 A;  3UDF A;  2XRN A;  2ZQ8 A;  1N9L A;  2JC7 A;  3FKW A;  4RX2 A;  1LHY A;  1MWU A;  4OQH A;  5EPH A;  4B88 A;  4KG2 A;  2J3T D;  2ZOI A;  4GJ4 A;  3QP4 A;  1KVL A;  1PRQ A;  4MBF A;  3G34 A;  3VOY A;  3K3D A;  2OOL A;  1H5X A;  2ZC6 B;  4PM6 A;  2JCH A;  3KYZ A;  3G2Z A;  5HWT A;  3RJU A;  4BD0 A;  2HZ5 A;  1VB6 A;  1PFL A;  3D9Y A;  1H8M A;  3LIA A;  5CHM A;  2EFX A;  3DTK A;  3CJM A;  3MZF A;  1E25 A;  1K54 A;  4GHI A;  2EX9 A;  5HX9 A;  5E2H A;  1FQG A;  3CG5 A;  3H7W A;  2HJE A;  3VSL A;  1ES3 A;  5GLB A;  4YWZ A;  4Q8I A;  1ES2 A;  5DVA A;  2V8F A;  1OJ5 A;  1LL8 A;  2JN7 A;  4G3V A;  1NXY A;  3Q07 A;  3BRM A;  3DW0 A;  3QP8 A;  1QME A;  3F1N A;  2A24 A;  2WGI A;  2ZMF A;  4BD1 A;  5A90 A;  2J7V A;  2JKF A;  1CEG A;  4UA9 A;  2P9V B;  2VGK A;  1YSP A;  2EX2 A;  1XJ6 A;  1D06 A;  1L0F A;  1VEU B;  4Y17 A;  3BWL A;  2Q9N A;  5CGW A;  4PM7 A;  3CWF A;  5AQ7 A;  5GLA A;  4IHQ A;  4JGR A;  3DTI A;  1XA1 A;  1Y28 A;  2GDN A;  4JXW A;  4GD8 A;  5FA7 A;  3UPO A;  2ZL1 B;  2D01 A;  2KDK A;  1XFQ A;  4JF5 A;  3UME A;  4CLC C;  4L9G A;  5HAR A;  5F83 A;  4GLQ A;  3VP2 A;  4R6L A;  1KGF A;  2Y91 A;  5L10 A;  1BSG A;  1KVM A;  1GSW A;  3MQ0 A;  3W4Q A;  1G6A A;  4DMZ A;  2L4R A;  4LV1 A;  5DTS A;  2PU4 A;  3I7J A;  3VP4 A;  2OLV A;  1ESI A;  4IBX A;  4EER A;  1W63 Q;  2XR0 A;  5HD3 A;  3UB9 A;  4FUW A;  5FL3 A;  3WS4 A;  2V20 A;  4RQ9 A;  1ALQ A;  4KG6 A;  4QU3 A;  3KO6 A;  1PWC A;  5IS1 A;  1TS0 A;  1DRM A;  3LGO A;  1DJA A;  5GHZ A;  1Q2P A;  4QPR A;  2M7V A;  1K4E A;  1M40 A;  4OOM A;  2Y55 A;  3N8R A;  4K91 A;  4KZ8 A;  5HD5 A;  3BEB A;  2IWB A;  5CER A;  1E3U A;  2PRF A;  1F9I A;  3QP1 A;  1RGZ A;  1NZO A;  1V9Y A;  4MBK A;  1SHV A;  4X1L A;  1S4R A;  2W3G A;  2QJ5 A;  1ONH A;  2X71 A;  3ZDJ A;  1BUL A;  2Y2H A;  1BT5 A;  4CLC B;  4UA6 A;  2VV7 A;  3P09 A;  2V0U A; 
#chains in the Genus database with same CATH homology
 5A92 A;  4LCM A;  2H5S A;  1K4F A;  3HLW A;  1GHP A;  4OKP A;  3UPN A;  4PPR A;  4DKI A;  3UO9 A;  3WS5 A;  2XFS A;  4U3T A;  5HAQ A;  2XLN A;  1L0G A;  3G2Y A;  4RVA A;  3C7U A;  3IWO A;  5CHJ A;  3C5A A;  1W8Q A;  4XXR A;  5HAI A;  1XP4 A;  3G30 A;  3Q7V A;  3Q82 A;  4OPQ A;  2WZZ A;  4JPM A;  3CZD A;  3PBN A;  4GZB A;  5CGS A;  5DF9 A;  1ERM A;  2BLS A;  3HRE A;  4EBL A;  1RCJ A;  1ERO A;  2X02 A;  3IXH A;  1NYY A;  3LCE A;  4OPR A;  1MWR A;  1L0D A;  2RL3 A;  1XX2 A;  3GR2 A;  5CGX A;  4E3O A;  1EI5 A;  1ES5 A;  2G2U A;  3IF6 A;  4QY6 A;  3A3E A;  3MKE A;  2WAD A;  2Y2K A;  1RGY A;  4P0M A;  3DWK A;  1ERQ A;  1K56 A;  3WS0 A;  4FH4 A;  1BLH A;  1IYP A;  1E3U D;  1W7F A;  2P74 A;  2WKH A;  3V50 A;  4S2P A;  2DNS A;  1S0W A;  3PBT A;  3SH8 A;  5F1F A;  5M1A A;  2XH9 A;  1BUE A;  1YMS A;  4R1G A;  2HDQ A;  1LLB A;  4KEN B;  4ZJ2 A;  2WUQ A;  4S2K A;  4WEL A;  2H0T A;  4WZ5 A;  4PMA A;  1HVB A;  2Y2J A;  3PAG A;  1JWZ A;  4X6T A;  5BOH A;  2WKE A;  2XDM A;  3VP3 A;  4JKT A;  5EVL A;  2OV5 A;  2BG1 A;  4X69 A;  3TG9 A;  3ZCZ A;  1AXB A;  3VP0 A;  2JE5 A;  3BYD A;  5M18 A;  1K55 A;  5EE8 A;  2ZQC A;  1K38 A;  5D3O A;  2DRW A;  4K0X A;  1KE3 A;  2ZQ7 A;  3EQV A;  4KZA A;  4S2J A;  4YIN A;  3WS2 A;  3OPP A;  4S2M A;  3S22 A;  5A91 A;  3NBL A;  3QHY A;  3AGE A;  3ITA A;  5F1G A;  3UDX A;  4EBP A;  4KZ5 A;  1OME A;  2EX8 A;  3PTE A;  5CXW A;  1YMX A;  2J9O A;  2Y2P A;  5E2E A;  2ZM0 A;  5E2G A;  3HLD A;  3LEZ A;  4ID4 A;  3E2K A;  3C4O A;  3HLF A;  3UDI A;  1KGE A;  5EOE A;  1ZG4 A;  2XEP A;  1YLP A;  1BLP A;  2EX6 A;  3IH9 A;  4IVK A;  3NI9 A;  3VFH A;  4R3B A;  4KZ9 A;  4JXG A;  4S2N C;  4OH0 A;  1MPL A;  3HUO A;  5A93 A;  5FI2 A;  1ONG A;  3UPP A;  4N92 A;  1YLW A;  1CEF A;  5E43 A;  2UWX A;  2ZC4 B;  3A3D A;  4X56 A;  3HBR A;  5GHY A;  1GA0 A;  1M6K A;  2QPN A;  3A3F A;  4KQO A;  1K56 D;  2R9W A;  5AQ9 A;  3ZG0 A;  2DCF A;  4GKU A;  2X01 A;  5L2F A;  2RCX A;  3BEC A;  1GHI A;  2FFY A;  4EBN A;  4OLD A;  1PW1 A;  1KE0 A;  4GDN A;  1I2S A;  1NZU A;  2EXA A;  4R4S A;  4OLG A;  3LY3 A;  1XPB A;  4MLL A;  2WKI A;  3HUM A;  4QY5 A;  3NIA A;  4ZJ3 A;  1YLJ A;  3PBS A;  4H8R A;  2HP9 A;  3IXD A;  1PZP A;  5EVI A;  1JWP A;  2CC1 A;  2I72 A;  2HDR A;  4GD6 A;  5FQK A;  4U0X A;  3OZH A;  3IF6 C;  3B3X A;  1JWV A;  4O7D A;  3V3S A;  4IBR A;  2VGJ A;  1I5Q A;  3N8S A;  5CEB A;  4EQI A;  3OPR A;  2ZD8 A;  1YT4 A;  3BFG A;  2OLU A;  5FAT A;  4F94 A;  1TEM A;  2B5R A;  3SS3 A;  4HBT A;  5HL1 A;  1MWT A;  1IKI A;  1L0E A;  1YLT A;  3VMA A;  1TDL A;  3A3I A;  4E6X A;  4PM8 A;  3UE0 A;  4OON A;  3ZNT A;  4OVD A;  4KG5 A;  1VM1 A;  1YM1 A;  5TGF A;  2A3U A;  3C4P A;  4WZ5 C;  4OOY A;  1IKG A;  1XGI A;  1W5D A;  2Z2L B;  3HLC A;  3HLE A;  4EWF A;  3GQZ A;  2C5W B;  4GNU A;  4OPY A;  4X68 A;  4ZTK A;  1H8Z A;  3ZGA B;  1K55 C;  2J8Y A;  3VP1 A;  4MEZ A;  1CK3 A;  1VQQ A;  4KZ6 A;  1DY6 A;  1BZA A;  4WYY A;  3ITB A;  5GL9 A;  2HP6 A;  3HVF A;  2ZM2 A;  3BLM A;  3AGF A;  5CTM A;  4QB8 A;  3S1Y A;  1C3B A;  1O07 A;  1N9B A;  2ZC7 A;  2EFU A;  3E2L A;  2XK1 A;  4Z9Q A;  1MBL A;  3OC2 A;  1U60 A;  5JYP A;  4N1H A;  3N4I A;  4BJP A;  4L0L A;  3ZNY A;  4A5R A;  3RXW A;  5FI7 A;  5EVI D;  4LV3 A;  1RP5 A;  4GOG A;  5TFQ A;  5E2F A;  3EQU A;  1PW8 A;  3FWL A;  4N9L A;  1IEL A;  3GSG A;  2WGV A;  2WGW A;  2Y2O A;  4UAA A;  1E4D A;  3OCN A;  1EWZ A;  3G4P A;  3C7V A;  4RA7 A;  1FR6 A;  4DE0 A;  2P9V A;  4NET A;  3DWZ A;  3NDG A;  3Q7V B;  1K6R A;  4DE1 A;  4HES A;  3FYZ A;  4BL3 A;  4PM5 A;  1NY0 A;  3W8K A;  4QJG A;  1TVF A;  3V5M A;  3WRZ A;  1MKI A;  1BLS A;  5EVI C;  5EUA A;  3MKF A;  3FKV A;  2G2W A;  1J9M A;  5FAQ A;  2QZ6 A;  4R23 A;  1K57 C;  3IF6 B;  4JF4 A;  4Y0T A;  1PYY A;  1PI5 A;  2A49 A;  4GDB A;  3UE3 A;  2J9P A;  2ZQD A;  2XGN A;  3OPL A;  3QNB A;  4N9K A;  3GRJ A;  4P6B A;  2Y2M A;  1WYC A;  1L2S A;  2IWC A;  4P87 A;  3DTM A;  5HFO A;  3ZVT A;  1IYS A;  4KQR A;  1G68 A;  2WAF A;  3GMW A;  4KZ7 A;  1WE4 A;  3LO7 A;  5GLC A;  1ZC2 A;  4JF6 A;  3UN7 A;  1LI9 A;  4BEN A;  3QNC A;  5CTN A;  2Y2N A;  2Y4A A;  4ZDX A;  3PBO A;  4DDS A;  1HD8 A;  5J8X A;  1KDW A;  3PAE A;  3RXX A;  3WS1 A;  4M3K A;  4LV0 A;  3W4O A;  3IHA A;  5IHV A;  3W4P A;  4WMC A;  4KQQ A;  2Y2G A;  1SKF A;  3UDF A;  4D2O A;  3TOI A;  3BLS A;  1DJB A;  3MXR A;  3VOZ A;  3SS4 A;  3M6H A;  2ZQ8 A;  3V39 A;  2JC7 A;  2ZM8 A;  4OPZ A;  4CJN A;  4PM9 A;  3FKW A;  5HW3 A;  4KZ3 A;  4RX2 A;  4QD4 A;  4WZ4 A;  1Z6F A;  2PBY A;  3SS5 A;  2H10 A;  1LHY A;  1MWU A;  4OQH A;  4LV2 A;  5EPH A;  4B88 A;  1CI8 A;  1FSW A;  2XD1 A;  2Z2M B;  4KG2 A;  2C6W B;  4GN2 A;  4LEN A;  4ZAM A;  3Q1F A;  1IYQ A;  2WYX A;  5FQJ A;  4S2I A;  2Y2Q A;  4Y0U A;  1KVL A;  3IWI A;  4MBF A;  4S2L A;  5EEC A;  3G34 A;  1H8Y A;  4E3K A;  3VOY A;  5FQ9 A;  1K57 A;  3PBR A;  1N4O A;  4E3J A;  2ZQ9 A;  1H5X A;  2ZC6 B;  4PM6 A;  5FQQ A;  2JCH A;  4X53 A;  4C3Q A;  1PIO A;  3G2Z A;  4XUX A;  1MY8 A;  3RJU A;  4BD0 A;  4QHC A;  3MXS A;  4FCF A;  1XKZ A;  4YFM A;  1FCM A;  3BFC A;  5EVI B;  3WRT A;  5M19 A;  4K0W A;  1JVJ A;  1PWD A;  4E3I A;  5GLD A;  3UY6 A;  5FAO A;  4IED A;  2XD5 A;  4C6Y A;  3SH9 A;  1WYB A;  5CHM A;  2EFX A;  4WMC D;  5FDH A;  3CJM A;  3D4F A;  4HBU A;  4P85 A;  3MZF A;  4IVI A;  1E25 A;  4OP5 A;  3CMZ A;  1ESU A;  1K54 A;  3G31 A;  1GA9 A;  3Q7Z A;  1PZO A;  3IHB A;  5G18 A;  1FSY A;  4DE2 A;  3IQA A;  3ZG7 B;  2EX9 A;  5HX9 A;  1MXO A;  3FV7 A;  5E2H A;  3JYI A;  5KSC A;  4GB7 A;  1FQG A;  3IWQ A;  5FSR A;  2ZQA A;  3CG5 A;  3VSL A;  2HDU A;  1JTG A;  5CRF A;  1ES3 A;  3IXG A;  4Y7P A;  1LL5 A;  5CEC A;  2Y2L A;  2JBF A;  2EXB A;  2OSU A;  1KGG A;  5GLB A;  4Q8I A;  2ZC3 B;  1ES2 A;  5DVA A;  5FI6 A;  2HDS A;  1XGJ A;  3V3R A;  3O87 A;  4R4R A;  5TR7 A;  4HEF A;  1PI4 A;  1GHM A;  3ZFZ A;  1NXY A;  3Q07 A;  3G32 A;  3BRM A;  4WEK A;  3DW0 A;  2XQZ A;  4DXC A;  4FH2 A;  3IXB A;  3NC8 A;  5AQA A;  1QME A;  2ZMA A;  3GVB A;  2WGI A;  5FAP A;  4BD1 A;  5A90 A;  2J7V A;  2H0Y A;  4RYE A;  3Q81 A;  4DF6 A;  4KZB A;  3SH7 A;  5GHX A;  3M6B A;  1CEG A;  3P98 A;  4UA9 A;  2WGW B;  3VFF A;  2P9V B;  3FZC A;  2VGK A;  1FCO A;  1GCE A;  2EX2 A;  3HUN A;  3N7W A;  5AQB A;  5KZH A;  1SDE A;  2WK0 A;  1CI9 A;  4E3M A;  1L0F A;  1FOF A;  3GTC A;  1HTZ A;  2Q9N A;  3MBZ A;  5CGW A;  4ZBE A;  2FFF B;  3VSK A;  4LCL A;  1W8Y A;  4PM7 A;  4RX3 A;  4U0T A;  3UNW A;  4UA7 A;  4X55 A;  5AQ7 A;  5GLA A;  2V2F F;  2WZX A;  3A3J A;  5DTK A;  3BFD A;  2WAE A;  1NYM A;  4C75 A;  4B4X A;  1XA1 A;  2GDN A;  3S4X A;  3UE1 A;  1ES4 A;  5KMW A;  4E3N A;  3HLG A;  1YLZ A;  5FAS A;  4JXW A;  4WEJ A;  4GD8 A;  1I2W A;  5F82 A;  4R0Q A;  1K54 C;  3HL9 A;  4MNR A;  4UHU A;  5FA7 A;  2IWD A;  4N1X A;  3UPO A;  3BFF A;  3BM6 A;  4JBF A;  4E3L A;  4JF5 A;  4EUZ A;  5HAR A;  1DJC A;  1LL9 A;  5F83 A;  1FCN A;  4BQM A;  3MZE A;  5FQI A;  1NRF A;  3HLB A;  3VP2 A;  4DXB A;  1KGF A;  2Y91 A;  1O7E A;  3M2K A;  3N8L A;  5FQM A;  3GV9 A;  1YLY A;  1BSG A;  1KVM A;  4KZ4 A;  2E8I A;  3O3V A;  4DRT A;  1SDN A;  3IH8 A;  3W4Q A;  1G6A A;  1MWS A;  5DTT A;  1K25 A;  3M2J A;  1TDG A;  3NDE A;  4B4Z A;  4LV1 A;  5I94 A;  5DTS A;  1KE4 A;  2Y59 A;  2PU4 A;  3N6I A;  3I7J A;  3VP4 A;  3TSG A;  2OLV A;  3ZG8 B;  1ESI A;  5HAP A;  4IBX A;  2XR0 A;  4JXV A;  2HPB A;  3G35 A;  3SOI A;  4ZJ1 A;  3OPH A;  5CED A;  3BFE A;  2Y2I A;  5EOO A;  4XUZ A;  3WS4 A;  1JTD A;  1Y54 A;  1KDS A;  2HP5 A;  2PU2 A;  2V20 A;  5CHU A;  3ZG5 A;  3O86 A;  5JYO A;  2ZJ9 A;  1ALQ A;  1QMF A;  3MFD A;  4KG6 A;  4QU3 A;  5DF8 A;  3OCL A;  3ZG9 B;  3O88 A;  4OQI A;  1PWC A;  4MBH A;  2XF3 A;  5U47 A;  3ZVW A;  4BLM A;  1FR1 A;  2R9X A;  1DJA A;  3WWX A;  5GHZ A;  1Q2P A;  4NK3 A;  1BTL A;  5KSH A;  1K4E A;  1M40 A;  4OQ0 A;  4OOM A;  4Y0O A;  3AGD A;  2ZLY A;  2Y55 A;  1IEM A;  3N8R A;  2XFT A;  3NCK A;  4K91 A;  4KZ8 A;  4DDY A;  4OOL A;  3BEB A;  2IWB A;  3ZHH A;  1W79 A;  5CER A;  1E3U A;  3NY4 A;  3LY4 A;  1S6R A;  4JLF A;  4JXS A;  1HZO A;  1Q2Q A;  1XA7 A;  4EV4 A;  1ZKJ A;  1RGZ A;  3IT9 A;  1NZO A;  2V1Z A;  4MBK A;  1SHV A;  4OQG A;  1ONH A;  1YQS A;  2X71 A;  3IF5 A;  3ZDJ A;  1IYO A;  1BUL A;  1PWG A;  4R3J A;  4S2O A;  4BL2 A;  1SCW A;  4DE3 A;  3PBQ A;  3MZD A;  4FD8 A;  4E6W A;  1NJ4 A;  2Y2H A;  1BT5 A;  4FSF A;  1XXM A;  4WBG A;  4CPK A;  4OP8 A;  4S2N A;  4WM9 A;  2Q9M A;  1BLC A;  2ZC5 B;  1ZG6 A;  1LI0 A;  2QMI A;  4UA6 A;  3ISG A;  3P09 A;  1K6S A;  5DF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...