1G6AA

Pse-4 carbenicillinase, r234k mutant
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
266
structure length
266
Chain Sequence
SKFQQVEQDVKAIEVSLSARIGVSVLDTQNGEYWDYNGNQRFPLTSTFKTIACAKLLYDAEQGKVNPNSTVEIKKADLVTYSPVIEKQVGQAITLDDACFATMTTSDNTAANIILSAVGGPKGVTDFLRQIGDKETRLDRIEPDLNEGKLGDLRDTTTPKAIASTLNKFLFGSALSEMNQKKLESWMVNNQVTGNLLRSVLPAGWNIADKSGAGGFGARSITAVVWSEHQAPIIVSIYLAQTQASMEERNDAIVKIGHSIFDVYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE PSE-4
publication title Insights into the molecular basis for the carbenicillinase activity of PSE-4 beta-lactamase from crystallographic and kinetic studies.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 98
structure length 266
sequence length 266
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1g6aA00
1YT4A 1LI0A 1M6KA 1K4FA 1YLTA 2ZC7A 2H10A 3LO7A 3MBZA 3MKEA 3G2YA 2WZXA 1L0FA 3S1YA 4OPRA 4BENA 3BLMA 1ZC2A 3BLSA 3CJMA 1PWDA 2B5RA 3BFCA 5A93A 4GOGA 1FQGA 1H5XA 1O7EA 3CZDA 3IXHA 2XGNA 2IWCA 2BG1A 2Y2HA 3MZDA 4C6YA 3Q07A 3GQZA 1KGEA 3IF5A 3Q7VA 5HAIA 2EXAA 1PWCA 4P6BA 3HBRA 3VMAA 4LV3A 1H8YA 1E3UA 4PMAA 4X6TA 4P87A 5HX9A 4K0XA 3VOZA 4OOMA 1KDSA 4Z9QA 4IEDA 4FH2A 2Y4AA 2DNSA 3GTCA 3BFEA 3MKFA 4BLMA 2ZQ8A 4UA6A 5E2FA 4N1HA 2EFUA 2WKHA 3O86A 4P85A 4HESA 4X56A 2C6WB 2ZQ7A 3CMZA 5AQBA 4KQRA 3WS2A 1BUEA 4EBNA 4KZ6A 4H8RA 5CGWA 1IELA 4LV0A 4KZAA 5D3OA 2CC1A 3C4PA 4OPYA 2VGJA 3PTEA 4S2KA 5TFQA 1PIOA 1BULA 5CEBA 3FWLA 3NDGA 3UPOA 3A3JA 5FSRA 4QY6A 4HBTA 3W4QA 1DJBA 4R23A 4E3IA 2J9PA 1FCNA 3IHBA 2JE5A 2Y2QA 4CJNA 3IF6C 2Q9MA 3OPRA 1NYYA 2Y2PA 4ZTKA 2V2FF 1DY6A 1K38A 4S2JA 5EVIB 1SCWA 3VP0A 5TGFA 3HLDA 5GLDA 3V5MA 4R0QA 4WZ5A 5FDHA 2PU2A 3B3XA 4WM9A 3C7VA 1K4EA 5FQ9A 3IXGA 1PW8A 1JTGA 4X69A 1BLHA 1TVFA 5L2FA 2HDSA 2XR0A 1ESUA 2ZC4B 5EUAA 1MPLA 5EVLA 4BJPA 2V1ZA 5HARA 3N8SA 2IWDA 3VP2A 4O7DA 1KE4A 2RL3A 4P0MA 2Y59A 3IWQA 5KSCA 2ZD8A 1KGGA 2EXBA 1YLZA 4E3JA 4BL3A 2UWXA 5GHZA 4PM6A 1OMEA 4GN2A 4R3JA 3NY4A 3IH8A 2XFTA 5AQ7A 3TOIA 4E3OA 3Q81A 1K25A 4KZ7A 3P98A 1CEFA 2WAEA 3OCLA 4OVDA 2WYXA 1O07A 1MWRA 3CG5A 3FKWA 3G32A 5HAQA 5HW3A 1C3BA 3A3FA 4DE0A 2JC7A 4OP8A 2DCFA 2I72A 5FATA 3G2ZA 1KGFA 1JWVA 2H0TA 1KE0A 4KG5A 1ES4A 2VGKA 4L0LA 2R9WA 4N9KA 3ZG7B 3OPLA 2XK1A 2WKEA 4GD6A 3NDEA 5EVIA 2GDNA 3UE3A 4FCFA 3S22A 5FAOA 4KZ5A 2J9OA 1VQQA 4ZJ1A 4DDSA 5DTSA 1PW1A 5J8XA 2EX9A 3S4XA 4EWFA 1L2SA 2XQZA 1S0WA 1W7FA 3EQUA 1KDWA 4S2NC 3BRMA 4UA7A 1E3UD 1NJ4A 4S2LA 4Y7PA 3ZG5A 5KMWA 1IYOA 2JBFA 1BLPA 4JF6A 4PPRA 3NCKA 4E3MA 3TG9A 1IYSA 1JWPA 2Y2NA 4PM9A 1GA0A 1SDEA 1Z6FA 1CK3A 1Q2PA 2V20A 3RJUA 4JXWA 1NRFA 2WGVA 5GHYA 5CECA 3PBRA 1HD8A 1XX2A 4IBXA 4EBPA 5CERA 2XFSA 4OQ0A 2Y2IA 4OPZA 3LY3A 2Y91A 4WMCA 2HP5A 3HLWA 2EX8A 5E2HA 4JBFA 3BFGA 5GHXA 3SH9A 2XDMA 3PAEA 1PZPA 1N4OA 5F1FA 3ZGAB 5HFOA 2ZLYA 1KE3A 1NZOA 4FH4A 4R4SA 3BFDA 1JVJA 1ZG6A 3HLCA 3UPNA 2ZQCA 1IKGA 3P09A 3WS1A 2C5WB 4E3KA 3M6HA 4EV4A 1ESIA 4KG6A 1RGYA 3OPPA 1XPBA 5DVAA 4E3LA 3BEBA 4RX3A 3HLGA 3ZHHA 1HZOA 2WUQA 1CI9A 4FSFA 4R4RA 1ZG4A 2FFYA 1DJAA 3IXDA 3PBTA 4QB8A 2ZMAA 1K56D 4R1GA 2PBYA 3WS4A 3I7JA 3G30A 1BLSA 1PWGA 1I2WA 1K57A 1EROA 4QU3A 3PBNA 5CTNA 5E2GA 3NIAA 3LEZA 4B4XA 3ZG0A 5M18A 2HP9A 4B88A 4JPMA 4GKUA 5FI2A 4QHCA 5KSHA 4RVAA 4WZ4A 3ITAA 1IKIA 4Y0OA 2DRWA 1ALQA 2EX2A 4DE2A 4UA9A 3UE1A 5DF7A 4JXVA 2FFFB 3AGDA 3EQVA 2QZ6A 5F83A 3GSGA 4GDBA 1KVMA 3O87A 4EQIA 3UNWA 3FKVA 5CHUA 1MKIA 5GL9A 2HPBA 3VP3A 2XH9A 3JYIA 1H8ZA 3HREA 4GNUA 3HLBA 1MWTA 3QNBA 5CTMA 4E6XA 2XLNA 2Y2LA 2ZQ9A 3WRTA 5FASA 1RGZA 4S2OA 3OPHA 2HDQA 1IYQA 3W4PA 4DF6A 1J9MA 3MXRA 1MXOA 4ZBEA 4IBRA 5F1GA 5EVID 1I2SA 3NI9A 4DDYA 1GHMA 5EPHA 5U47A 2J7VA 1AXBA 4MLLA 2Y2OA 3SOIA 2XD1A 4WELA 4KZBA 5CHJA 2A3UA 1QMEA 3LCEA 4NK3A 3RXWA 3PBSA 1EI5A 4LENA 1K55A 1YMXA 3SS5A 3ITBA 1W8QA 3IT9A 1NXYA 1MBLA 2G2WA 4DE3A 4XUZA 1K6RA 4BD0A 4ZJ2A 5A91A 1XGIA 3TSGA 4MBHA 1PYYA 1LL5A 3N4IA 2X01A 4WZ5C 2WZZA 1E4DA 1FR6A 3GRJA 3OC2A 1N9BA 1XA1A 3V50A 3PBOA 2ZC3B 1CI8A 4WMCD 1XA7A 5GLAA 3WRZA 3UDFA 4JF4A 1ES3A 2Y2MA 1EWZA 4KQQA 5BOHA 2OSUA 1E25A 1ONGA 1YLJA 3QNCA 5GLBA 3ZCZA 5CEDA 1FSWA 1M40A 4JKTA 4R3BA 1MY8A 4DE1A 1YMSA 3M2JA 2IWBA 4KQOA 3UDXA 5FQMA 4OOLA 3W8KA 1W79A 5IHVA 3IHAA 4GZBA 3ZNYA 2Y55A 3ZDJA 2ZM0A 3IQAA 3VFHA 4HEFA 2P9VB 1FCOA 4PM7A 1YLYA 3ZVWA 3FV7A 3ZVTA 4B4ZA 3HLFA 4MBKA 2RCXA 2G2UA 2Y2GA 3W4OA 1L0DA 3G31A 2Z2LB 2ZJ9A 1K54A 1IYPA 1U60A 3NC8A 1MWSA 2J8YA 3HVFA 5CRFA 3Q1FA 3IF6B 3A3IA 4JXGA 5EVIC 1NZUA 5FQIA 1ES2A 5KZHA 1GHPA 3ISGA 2X02A 4GD8A 2WK0A 3N8LA 1LL9A 5DTKA 3DW0A 5E2EA 3VSKA 1DJCA 1IEMA 2ZM2A 3LY4A 3AGFA 4N1XA 2R9XA 4MEZA 2HDUA 4JLFA 2Z2MB 3HUOA 3UPPA 1YLWA 3A3EA 3WWXA 1ES5A 4X68A 2E8IA 3DTMA 3HUNA 1ERMA 1ERQA 3SH7A 5AQAA 4PM8A 5DF9A 5EE8A 5CXWA 4LCMA 5I94A 1LHYA 3V3RA 1RP5A 2P9VA 3VP1A 4OH0A 4KZ3A 5G18A 1RCJA 4K91A 4YINA 4IVIA 3VOYA 3WS0A 2HDRA 3UO9A 4RX2A 3VP4A 5CGSA 4DXCA 2XEPA 5AQ9A 1SDNA 3IH9A 1PI5A 2ZM8A 4CPKA 4S2MA 4RA7A 4OKPA 4BL2A 2WGIA 4M3KA 4F94A 3IXBA 3O88A 3BFFA 4GB7A 4C75A 3HUMA 2JCHA 3AGEA 3FZCA 5CGXA 3OCNA 3IF6A 3MFDA 3SH8A 4ZDXA 3QHYA 1Q2QA 1CEGA 4WEJA 3GVBA 4UAAA 3GV9A 3ZFZA 1LI9A 2PU4A 3C4OA 4OOYA 3BECA 3PBQA 2XF3A 1K57C 1I5QA 3PAGA 4DXBA 1YM1A 4QY5A 3V3SA 5FQQA 2OLVA 3G34A 4LCLA 4PM5A 2ZC6B 5E43A 4KZ4A 4U0TA 1BLCA 4X53A 5GLCA 2WKIA 4HBUA 1FSYA 1JWZA 4MBFA 2A49A 4N92A 4OQGA 1GCEA 1YQSA 4BQMA 4KZ9A 5A92A 1GA9A 4ID4A 1W8YA 1WYBA 5HAPA 1QMFA 4OLGA 3UDIA 2Y2JA 1G6AA 4KENB 4GDNA 1TEMA 2OLUA 2WGWB 3FYZA 1TDGA 3IWOA 3ZG9B 4ZJ3A 4U3TA 2BLSA 1XGJA 4OONA 4WEKA 1W5DA 3UY6A 1ZKJA 5A90A 4QJGA 1XKZA 3N6IA 4ZAMA 1K56A 4OLDA 1HTZA 2QMIA 4LV2A 4Y0UA 3HLEA 2H5SA 2ZQDA 3G4PA 1VM1A 4C3QA 1BZAA 3A3DA 4XUXA 4XXRA 4KZ8A 2Q9NA 5FQKA 1KVLA 3N8RA 1NYMA 3VFFA 5TR7A 1L0EA 2OV5A 4WYYA 1FCMA 1FR1A 1Y54A 2EX6A 4OQIA 2X71A 3WS5A 4E6WA 1LLBA 4A5RA 3DWZA 4OPQA 3HL9A 3C7UA 4UHUA 4YFMA 1ONHA 4FD8A 4U0XA 5DTTA 4OP5A 3UE0A 4JXSA 4NETA 1MWUA 1K55C 2ZQAA 1YLPA 3E2KA 3BYDA 3IWIA 5FAQA 3D4FA 2P74A 2H0YA 2QPNA 2WADA 3M2KA 3V39A 1XXMA 5F82A 4S2NA 5FQJA 5EOEA 1G68A 1FOFA 3DWKA 3ZG8B 3NBLA 4RYEA 4E3NA 5JYOA 1WYCA 4MNRA 5EOOA 3SS4A 2HP6A 5FI7A 5EECA 3MZFA 2WGWA 3Q7VB 1BSGA 2XD5A 2Y2KA 4EUZA 4WBGA 3C5AA 4X55A 5M19A 3MZEA 5FAPA 4OQHA 2EFXA 5FA7A 5DF8A 4S2PA 4Y0TA 5CHMA 1TDLA 3Q82A 1GHIA 1PI4A 1K6SA 2ZC5B 3O3VA 5M1AA 3RXXA 4EBLA 3GR2A 1WE4A 1PZOA 4Q8IA 3UN7A 3GMWA 5JYPA 3M6BA 3E2LA 3MXSA 3N7WA 4D2OA 4QD4A 1SKFA 2WAFA 3G35A 1JTDA 3Q7ZA 4K0WA 1BT5A 1L0GA 4KG2A 4N9LA 5HL1A 4LV1A 3VSLA 3ZNTA 1HVBA 1S6RA 1XP4A 4DKIA 4DRTA 4S2IA 1BTLA 3BM6A 3OZHA 5FI6A 4JF5A 3SS3A 4BD1A 1SHVA 4IVKA 1K54C 1NY0A
chains in the Genus database with same CATH superfamily
1LI0A 1M6KA 1YLTA 2ZC7A 4NXBA 2H10A 3MF0A 2WKRA 3MKEA 3S1YA 4OPRA 3S7QA 4BENA 3BLMA 2M1CA 4R70A 2B5RA 1H5XA 1O7EA 3IXHA 3MZDA 4C6YA 3OLOA 3Q07A 1KGEA 5DKKA 5HDSA 1E3UA 2EWWA 4OOMA 1KDSA 4IEDA 2VK3A 3MKFA 2W0NA 4N1HA 4P85A 2ZQ7A 1ZHHB 4KQRA 3KYEA 4KZ6A 4ESPA 4H8RA 5CGWA 3IS2A 5IS1A 3CWFA 5CEBA 4JGQA 3NDGA 3U2AA 3W4QA 4R23A 3CUEC 2Y2PA 4ZTKA 1K38A 3H9WA 4R0QA 3C7VA 1PW8A 1T1AA 1ESUA 1YAXA 5EVLA 1MPLA 2Y59A 4FOFA 1MKMA 2EXBA 4BL3A 5GHZA 4GW9A 1OMEA 5I5LA 1OTAA 4GN2A 3NY4A 2PR5A 5AQ7A 3R4KA 1TS7A 1K25A 4KZ7A 1S1ZA 5FL3A 3H7WB 1MWRA 3FKWA 1C3BA 4DE0A 2ZOIA 3E4PA 5FATA 3G2ZA 2H0TA 1KE0A 2VGKA 3F1PB 1S1YA 2J9OA 4GS9B 1OTDA 5DTSA 5J8XA 5IU1A 2XQZA 1S0WA 3KSFA 5J3WA 4UA7A 1E3UD 1NJ4A 3BW6A 4PPRA 4E3MA 2W1TB 4PM9A 1GA0A 1Z6FA 3RJUA 2WGVA 3PBRA 3IX4A 2W3HA 2XFSA 4WMCA 5GHXA 2O9BA 5F1FA 1N4OA 3ZGAB 5HFOA 4R4SA 1ZG6A 3HLCA 4YOFA 3P09A 3M6HA 1ESIA 1VHMA 3H82A 4RX3A 3HLGA 2WUQA 4LRYC 3QP5A 4R4RA 4R1GA 4AFIA 1BLSA 1EROA 1J3WA 2BASA 4GKUA 2DRWA 2MJ6A 2W1RA 2KOIA 1N9OA 3O87A 3FKVA 5DFXA 2E8JA 1H8ZA 4Q0JA 4GNUA 5CTMA 1MWTA 3QNBA 1RGZA 3OPHA 4DF6A 2VA0A 1UWNX 1N9LA 3RTYA 4ZBEA 4IBRA 4HNBA 4CLCC 1XJ6A 1AXBA 4MLLA 2Y2OA 2A3UA 1F9IA 1QMEA 3LCEA 4NK3A 1EI5A 1YMXA 3ITBA 4DE3A 1K6RA 4BD0A 5A91A 2IA2A 2ZMVA 3TSGA 4WZ5C 1TD5A 3OC2A 5K5BA 3PBOA 2EWVA 1XFNA 4WMCD 1XA7A 3UDFA 4JF4A 2QYBA 5BOHA 2OSUA 5GLBA 2GX5A 4JKTA 4XT2A 1D7EA 1YMSA 4KQOA 3W8KA 2QJ5A 2Y55A 3T4LA 4WF0A 4MBKA 3T50A 4EW7A 1K54A 1U60A 3NC8A 2J8YA 2GNXA 2KX6A 3IF6B 3UB8A 1CQAA 3NJAA 5FQIA 1ES2A 4X1LA 2X02A 2K7SA 4L9FA 1DJCA 3EOIA 1Z09A 3AGFA 4O8GA 4MEZA 3R7WA 1LL8A 2D01A 3MS6A 3IBRA 1ERMA 1ERQA 2HJ9C 4HHDA 2D02A 4LCMA 5F69A 1LHYA 2ZL1A 3T1RA 4K91A 4IVIA 5CGSA 3IH9A 2ZM8A 4EERA 4S2MA 4JGRA 4BL2A 2WGIA 5DFYA 3O88A 4HIAA 4C75A 1KOUA 4MCWA 2V8FA 3LIDA 3CUEA 1Q2QA 5HDDA 3LIBA 2PU4A 3C4OA 3PBQA 4GJ4A 2XF3A 1I5QA 4IHQA 2OLVA 3G34A 5E43A 3C8CA 4U0TA 2WKIA 4HBUA 1JWZA 1GCEA 4KZ9A 1GA9A 4ID4A 3BY8A 1L3LA 4OLGA 2Y2JA 1OT9A 4KENB 4GDNA 2WGWB 4U3TA 2BLSA 4OONA 4WEKA 1W5DA 1ZKJA 5A90A 1XKZA 4FTXA 5DKLA 2ZQDA 1BZAA 2ZOHA 1FIKA 1KVLA 1FR1A 1Y54A 4E6WA 2P7JA 3K3DA 1ONHA 3S7PA 3LR5A 1K55C 3MMHA 2W3FA 2H0YA 5EOEA 5L10A 4RYEA 4HH3A 5FI7A 2J3TC 5EECA 2XD5A 1F98A 3C5AA 2EFXA 5FA7A 4S2PA 3JVUA 4R38A 3VE4A 1GHIA 3GR2A 3CLOA 3GMWA 3M6BA 1VETA 3E2LA 3MXSA 3N7WA 4D2OA 4EEUA 2XSSA 2WAFA 3F1NA 3ZYTA 3LEQA 2VEAA 4PKYG 3VSLA 3ZNTA 4JF5A 2QKPA 1DP8A 1NY0A 4I5SA 4I3JA 2WZXA 1PWDA 1FQGA 3CZDA 2IWCA 4IUKA 2BG1A 2XA7M 3GQZA 5HDCA 4RQ9A 2EXAA 1H8YA 4PMAA 5HX9A 4K0XA 2Y4AA 3GTCA 4H6JA 5E2FA 2EFUA 2C6WB 3NHQA 1S66L 4NXGA 5LBRA 3T1QB 2A24A 3DTEA 3DAVA 4KZAA 5D3OA 3CI6A 2PYRA 2VGJA 4WL9A 4CLCA 4O01A 5IT5A 3UPOA 4QY6A 4E3IA 2J9PA 2JE5A 2Y2QA 4Y3IA 3LYXA 2INWA 2O9AA 5EVIB 1SCWA 3CHWP 2XRNA 2PRFA 4WZ5A 4MN7A 4GCZA 2PU2A 4WM9A 3MSHA 1K4EA 2HDSA 1N9NA 3VE3A 3N8SA 2IWDA 3LR4A 1KE4A 4P0MA 3IWQA 4E3JA 2UWXA 4PM6A 2VV8A 4R3JA 4BBTA 4X1MA 3P98A 3PYPA 5L09A 1CEFA 2WAEA 2WYXA 5HW3A 3G32A 1ES4A 4L0LA 4N9KA 1P0ZA 2XK1A 2WKEA 4EESA 4GD6A 5KIZA 4II7A 4EXOA 5FAOA 3IX8A 1SKOA 2UV0E 4LRXC 1S4RA 5HPIA 2A2LA 4HOIA 1W7FA 5A8BA 5KMWA 3BRMA 1TF1A 2GJ3A 3ZG5A 1IYOA 4JF6A 1CF0A 1F2KA 1JWPA 2Y2NA 1SDEA 5F5YA 5HPFA 1Q2PA 2JKRI 5CECA 4MMNA 4HP4A 1HD8A 1XX2A 3G6OA 5L8MA 2KLIA 5G4YA 2PD7A 2EX8A 3L7HA 3SH9A 2XDMA 1VB6A 3PAEA 1KE3A 5EV0A 2Z6DA 2VGLS 4FH4A 4CLCD 3BFDA 3BJNA 4NKPA 2JKTI 3UPNA 1G28A 4E04A 3WS1A 4CQHA 4F3LB 4E3KA 3E4OA 4EV4A 1XPBA 3FPWA 4P6ZS 3PR6A 5EM0A 1ZG4A 2FFYA 1DJAA 2ZMAA 2PBYA 5TBMB 3LEZA 2HP9A 4B88A 4RVAA 4WZ4A 3ITAA 4GHIA 2EX2A 4DE2A 3UE1A 4JXVA 2QZ6A 3GSGA 1KVMA 4HJ4A 3LIEA 2Y8HA 3VP3A 1BYWA 1D1JA 2XLNA 2ZQ9A 2VKSA 2HDQA 1IYQA 3W4PA 1J9MA 3MXRA 4M4XA 4ETXA 2OAQ1 5F1GA 1I2SA 1GHMA 5EPHA 4NXEA 5L07A 2OOLA 2XD1A 2QHKA 3RXWA 3PBSA 5HZHA 1K55A 3SS5A 1NXYA 1MBLA 2G2WA 4ZJ2A 1PYYA 4IJGA 1LL5A 2X01A 2WZZA 2WKPA 1N9BA 4YWZA 1UWPX 3K3CA 4G3WA 4EUVA 4EQ1A 1YLJA 1M40A 4DE1A 2PR6A 5F68A 2IWBA 3ZNYA 2ZM0A 3IQAA 2FZ0A 2P9VB 4KQDA 3FV7A 3ZVTA 2RCXA 3T4TA 3W4OA 5G4ZA 2Z2LB 2ZJ9A 1GSVA 1MWSA 4QWOA 3HVFA 5CRFA 1VEUA 4JXGA 3E98A 3B33A 3BQ8A 2WK0A 5E2EA 5DTKA 2ZM2A 3MQQA 4FUWA 1D06A 3NOPC 2R9XA 5AVEA 4JLFA 1YLWA 4X68A 3MXQA 1XJ3A 2R78A 2E8IA 3HUNA 4UQIM 4B93A 5J7EA 5CXWA 5I94A 1HLUP 1RP5A 4OH0A 4KZ3A 3WS0A 1RCJA 4BBUA 5FEGA 3VOYA 5AQ9A 2VZWA 4CPKA 1H8MA 2PHYA 4F94A 3HUMA 2JCHA 3AGEA 3QHYA 3CPTB 4WEJA 3GVBA 4UAAA 1OPXA 1LI9A 3BECA 4DXBA 2W27A 4QY5A 5FQQA 4PM5A 4KZ4A 1JNUA 3P01A 4X53A 5GLCA 4KUOA 1FSYA 4MBFA 4EEPA 4N92A 5A92A 3LIFA 2AVXA 3UDIA 1XFQA 1LSVA 1TEMA 5EFWA 5HWVA 3IWOA 3RH8B 1AWIA 3K2NA 4ARZA 5AJGA 1K56A 2QMIA 4Y0UA 2M7UA 2H5SA 4XUXA 4XXRA 4Z1WA 2Q9NA 3DTIA 3N8RA 1NYMA 4ETZA 2OV5A 3KYQA 4WYYA 1S4SA 2EX6A 2X71A 3HCYA 3DWZA 3HL9A 2L0WA 2FH5A 3MR0A 3VOLA 4U0XA 5DTTA 4OP5A 2Q0OA 1H0MA 5TJJA 3V39A 2WADA 4Y17A 5F82A 3DBAA 2V8CA 3NBLA 2NUTC 4MNRA 2HJEA 2HP6A 3S7OA 1BSGA 2Y2KA 5FAPA 3TE8A 3SZTA 1STZA 1K6SA 5M1AA 3O3VA 3T4OA 5HWWA 2EA9A 3NULA 3UN7A 3UMEA 2JHEA 2CMNA 1PNEA 4QD4A 1CJFA 4KUKA 1JTDA 3Q7ZA 1L0GA 1HVBA 1S6RA 1XP4A 4DKIA 2J3WA 3IS2B 4S2IA 3BM6A 4GLQA 4MN5A 1K4FA 3F1OA 3LO7A 1YPRA 3G2YA 4PAUA 1L0FA 3BLSA 3CJMA 5A93A 4GOGA 5EVEA 4D60A 3PXPA 2Y2HA 3Q7VA 1OJGA 3IF5A 3OBFA 1F5MA 1PWCA 3HBRA 3IX3A 4P87A 4I39A 4Z9QA 2DNSA 3BFEA 1YKDA 2WKHA 3O86A 1G6OA 1YSPA 3WS2A 4BMWA 4G3VA 4LFUA 2CC1A 3C4PA 4OPYA 5AVFA 3PTEA 4S2KA 1PIOA 3FWLA 3A3JA 5FSRA 2L4RA 1FCNA 2WKQA 3DTKA 3IF6C 2YKFA 1DY6A 4S2JA 4CLCE 3VP0A 5TGFA 3HLDA 3V5MA 5FDHA 5FQ9A 4IUHA 1JTGA 1BLHA 1TVFA 2XR0A 5EUAA 2V1ZA 2V0UA 5HARA 2I9VA 4O7DA 2DMWA 3KYZA 5KSCA 2ZD8A 1KGGA 1YLZA 4DMZA 2XROA 3IH8A 1Y4OA 2XFTA 4E3OA 4OVDA 3A3FA 1PFLA 4OP8A 2I72A 1JWVA 4KG5A 3A0SA 2R9WA 3ZG7B 3OPLA 2V1AA 3H82B 4Y2FA 3UE3A 4FCFA 3S22A 1VQQA 3OOVA 4ZJ1A 4DDSA 1PW1A 2EX9A 4EWFA 3EQUA 1KDWA 4S2NC 2JBFA 1BLPA 1H3QA 1CK3A 4JXWA 1NRFA 1ODVA 3TRCA 4EBPA 5CERA 2ACGA 1P9WA 2Y2IA 4HQAA 3LY3A 4OPZA 2Y91A 3BFGA 4I3IA 3H7WA 1PZPA 3EWKA 1NZOA 4HJ6A 3ICYA 1JVJA 3QP2A 1IKGA 1W63M 1RGYA 3OPPA 1ACFA 3ZHHA 3F1PA 3D3OA 1CI9A 4FSFA 4QB8A 3IXDA 4GS9A 3IBJA 4NXFA 3G30A 4HY8A 1I2WA 3PBNA 3NIAA 2ZMFA 4JPMA 3CAXA 2W1TA 4Y0OA 1ALQA 4B9OA 3LR3A 3AGDA 3EQVA 2O0YA 4UEYA 1IOUA 3UNWA 5CHUA 2HPBA 4LLOB 2XH9A 2K2NA 3JYIA 3HREA 1P9RA 2Y2LA 3WRTA 5FASA 4S2OA 2OWHA 4XT2B 1IFQA 3UB7A 3KO6A 1G5UA 4R3AA 4DDYA 2J7VA 3SOIA 5CHJA 4LENA 1W8QA 3IT9A 4XUZA 1NRJA 1WA9A 4MBHA 3T4QA 2Z6CA 1XA1A 3QP6A 2ZC3B 4EETB 1CI8A 2Y79A 2O9CA 1ES3A 1EWZA 3R7WB 3ZCZA 1FSWA 4R3BA 2W3GA 4Y13A 3M2JA 2O99A 1OTEA 5IHVA 2HGVA 3ZDJA 2ZL1B 4HEFA 4PM7A 3T4JA 3G31A 4R6LA 4Y15A 1XJ4A 4K08A 3C38A 5HD5A 2KDKA 1DP9A 3Q1FA 3ULFA 5EVIC 5KZHA 1GHPA 3P7NA 4GD8A 2OWJA 1LL9A 3DW0A 3VSKA 4O0PA 3LY4A 3D72A 1PRQA 2HDUA 3TW8A 3HUOA 3A3EA 4HP9A 3DTMA 4PM8A 2NUPC 3LUQA 2PBDP 3JVVA 2GZAA 5G18A 4YINA 2HDRA 3VP4A 2XEPA 1PI5A 4M3KA 3IXBA 3BFFA 5DJUA 1LT0A 3FZCA 5CGXA 3OCNA 3IF6A 5FEFA 4ZRRA 4JGPA 4Y5FA 3GV9A 4Q0IA 2YKHA 1K57C 3PAGA 1YM1A 3V3SA 4LCLA 2ZC6B 1LSXA 1BLCA 3E0YA 1A0KA 5EM1A 4OQGA 1YQSA 4BQMA 1W8YA 1WYBA 3C2WA 1QMFA 1OJ5A 1G6AA 3FYZA 1GSWA 1NWZA 3ZG9B 3HJKA 4ZJ3A 3B47A 4ZAMA 4OLDA 1HTZA 3RFBA 3HLEA 3G4PA 4C3QA 3A3DA 2G7UA 1VETB 2XA7S 1L0EA 3F1NB 3LIAA 4OQIA 3WS5A 1LLBA 1TS0A 4A5RA 3C7UA 3UE0A 4WUJA 4NETA 3FPVA 2ZQAA 1YLPA 3IWIA 3BYDA 2V9AA 3D4FA 4QPRA 2P74A 5FAQA 3M2KA 1FILA 1XXMA 3LGOA 4S2NA 2LB9A 5FQJA 3UMDA 4BWIA 3KX0X 1G68A 3ZG8B 2B02A 4E3NA 3S7NA 5EOOA 3SS4A 3U4LP 2V0WA 2WGWA 3MZFA 4EUZA 4WBGA 4X55A 5M19A 4OQHA 1W63Q 4MN6A 3HJIA 4Y0TA 3BY9A 4HH2A 1TDLA 4EBLA 3NECA 1PZOA 1DP6A 4PKYA 4PHTA 4H6JB 4Q8IA 3MFXA 3A0VA 4HI4A 3ZQ5A 5JYPA 3B42A 3V67A 1SKFA 5HD3A 2L1MA 2A24B 1BT5A 4G3KA 5HL1A 4LV1A 3GECA 4DRTA 1BTLA 5FI6A 3OZHA 5HWTA 4CLCB 4BD1A 1SHVA 4IVKA 1YT4A 3MBZA 3MQ0A 1ZC2A 3BFCA 4YNRA 2XGNA 2PT7A 5HAIA 4P6BA 3VMAA 2J80A 4LV3A 3TJZC 5DJTA 2JKRM 4X6TA 4NEED 3VOZA 1MC0A 4FH2A 4BLMA 2ZQ8A 4UA6A 1UGUA 4HESA 4X56A 3CMZA 5AQBA 2J3TD 1BUEA 4EBNA 1IELA 1SZVA 4LV0A 2JKTM 5HSQA 5TFQA 1BULA 1NLYA 4HBTA 1DJBA 2VJWA 3IHBA 4BBVA 4CJNA 2Q9MA 3OPRA 1NYYA 3E4QA 3UE6A 2V2FF 2QJ7A 3BQAA 1T18A 2VX8A 3MQOA 3SW1A 5GLDA 1SKOB 3L9KA 3B3XA 1T1CA 2VV6A 1MZUA 3IXGA 3UB9A 3GDIA 4X69A 1TS6A 4JGOA 5L2FA 5MC7A 2HV1A 2ZC4B 3LI8A 2B95A 4BJPA 3VP2A 2RL3A 4WLAA 3TOIA 4DN0A 2QWSA 3NOTC 3Q81A 1T19A 3OCLA 2BTFP 1O07A 3CG5A 5HAQA 2PD8A 3NOUC 2JC7A 2DCFA 1KGFA 4WN5A 1P97A 1Y28A 3NDEA 2W3EA 5EVIA 2GDNA 4KZ5A 2M7VA 3EEAA 3KSIA 3S4XA 4DJ3A 1L2SA 4S2LA 3KSHA 4Y7PA 1S67L 3NCKA 1LSWA 3TG9A 1IYSA 4GHIB 3T1SA 2V20A 5GHYA 3T4SA 4IBXA 4OQ0A 1OTBA 2HP5A 3HLWA 5E2HA 4JBFA 2K31A 1V9YA 3EGDC 2ZLYA 2JKGA 2ZQCA 4L9GA 2C5WB 4KG6A 2OAP1 5DVAA 4E3LA 3BEBA 3CITA 1HZOA 3PBTA 1K56D 3WS4A 1X0OA 3I7JA 3UB5P 1PWGA 2VLGA 1K57A 4QU3A 5CTNA 5E2GA 4B4XA 3ZG0A 5M18A 5FI2A 4QHCA 5KSHA 1IKIA 2P04A 3FC7A 4UA9A 5DF7A 2FFFB 5F83A 4GDBA 4EQIA 5GL9A 1MKIA 4I3AA 1ZTUA 3LICA 3HLBA 4E6XA 3BWLA 4F3LA 4NG2A 1MXOA 1OTIA 5EVID 3NI9A 5U47A 5TBMA 4WELA 4I38A 4KZBA 4UQIS 2ZBBA 2VGLM 4Q0HA 1VEUB 1XGIA 4LPZA 2H28A 3MJQA 3N4IA 1E4DA 1FR6A 3GRJA 2V1BA 3QP8A 3V50A 4P6ZM 5GLAA 2HF6A 3WRZA 1XJ2A 4KQQA 2Y2MA 1E25A 1ONGA 3QNCA 3EEHA 5CEDA 1MY8A 2PDRA 3LI9A 3UDXA 5FQMA 4OOLA 2HZ5A 1W79A 4EU0A 3IHAA 4GZBA 3T1XA 3VFHA 1EW0A 1FCOA 1YLYA 3ZVWA 4B4ZA 3HLFA 2G2UA 2Y2GA 1L0DA 2B18A 3QP1A 1IYPA 3A3IA 1NZUA 3ISGA 3LFVA 4L9EA 3VV4A 3A0RA 3KSGA 3N8LA 3W2ZA 1IEMA 4N1XA 2Z2MB 3UPPA 3WWXA 1ES5A 4LGWA 2PAVP 1V9ZA 3SH7A 5AQAA 5C5KA 5DF9A 5EE8A 3FG8A 4MDZA 3V3RA 3VP1A 2P9VA 4ARZB 4DXCA 4HJ3A 3UO9A 4RX2A 1SDNA 4RA7A 4OKPA 4GB7A 3UB6A 5F6AA 3MFDA 3SH8A 4ZDXA 1CEGA 3ZFZA 2P08A 2PYPA 1K0KA 5J4EA 2W3DA 4OOYA 3PHYA 1NLZA 3D9YA 2A49A 2JN7A 5HAPA 2OLUA 1TDGA 1XGJA 3UY6A 4QJGA 3N6IA 1TS8A 4LV2A 1VM1A 1YSQA 4KZ8A 1DRMA 5FQKA 3VFFA 5TR7A 1FCMA 3CPTA 5CX7A 4OPQA 4DJ2A 4UHUA 4YFMA 4FD8A 3C30A 3EGXC 3QP4A 4JXSA 1MWUA 3E2KA 2QPNA 3F1OB 3JPUA 1FOFA 3DWKA 3T4KA 1WYCA 5JYOA 1OT6A 5HL6A 3Q7VB 3MZEA 5FDSA 5DF8A 2VV7A 5CHMA 3O5YA 3Q82A 4X25A 1PI4A 2ZC5B 3RXXA 1T1BA 3LR0A 1WE4A 3T12B 4ME4A 1GSXA 3G35A 4LRZE 2LB5A 4K0WA 4KG2A 4N9LA 2JKFA 3SS3A 1K54C
chains in the Genus database with same CATH topology
1YT4A 1LI0A 1M6KA 1K4FA 1YLTA 2ZC7A 2H10A 3LO7A 3MBZA 3MKEA 3G2YA 2WZXA 1L0FA 3S1YA 4OPRA 4BENA 3BLMA 1ZC2A 3BLSA 3CJMA 1PWDA 2B5RA 3BFCA 5A93A 4GOGA 1FQGA 1H5XA 1O7EA 3CZDA 3IXHA 2XGNA 2IWCA 2BG1A 2Y2HA 3MZDA 4C6YA 3Q07A 3GQZA 1KGEA 3IF5A 3Q7VA 5HAIA 2EXAA 1PWCA 4P6BA 3HBRA 3VMAA 4LV3A 1H8YA 1E3UA 4PMAA 4X6TA 4P87A 5HX9A 4K0XA 3VOZA 4OOMA 1KDSA 4Z9QA 4IEDA 4FH2A 2Y4AA 2DNSA 3GTCA 3BFEA 3MKFA 4BLMA 2ZQ8A 4UA6A 5E2FA 4N1HA 2EFUA 2WKHA 3O86A 4P85A 4HESA 4X56A 2C6WB 2ZQ7A 3CMZA 5AQBA 4KQRA 3WS2A 1BUEA 4EBNA 4KZ6A 4H8RA 5CGWA 1IELA 4LV0A 4KZAA 5D3OA 2CC1A 3C4PA 4OPYA 2VGJA 3PTEA 4S2KA 5TFQA 1PIOA 1BULA 5CEBA 3FWLA 3NDGA 3UPOA 3A3JA 5FSRA 4QY6A 4HBTA 3W4QA 1DJBA 4R23A 4E3IA 2J9PA 1FCNA 3IHBA 2JE5A 2Y2QA 4CJNA 3IF6C 2Q9MA 3OPRA 1NYYA 2Y2PA 4ZTKA 2V2FF 1DY6A 1K38A 4S2JA 5EVIB 1SCWA 3VP0A 5TGFA 3HLDA 5GLDA 3V5MA 4R0QA 4WZ5A 5FDHA 2PU2A 3B3XA 4WM9A 3C7VA 1K4EA 5FQ9A 3IXGA 1PW8A 1JTGA 4X69A 1BLHA 1TVFA 5L2FA 2HDSA 2XR0A 1ESUA 2ZC4B 5EUAA 1MPLA 5EVLA 4BJPA 2V1ZA 5HARA 3N8SA 2IWDA 3VP2A 4O7DA 1KE4A 2RL3A 4P0MA 2Y59A 3IWQA 5KSCA 2ZD8A 1KGGA 2EXBA 1YLZA 4E3JA 4BL3A 2UWXA 5GHZA 4PM6A 1OMEA 4GN2A 4R3JA 3NY4A 3IH8A 2XFTA 5AQ7A 3TOIA 4E3OA 3Q81A 1K25A 4KZ7A 3P98A 1CEFA 2WAEA 3OCLA 4OVDA 2WYXA 1O07A 1MWRA 3CG5A 3FKWA 3G32A 5HAQA 5HW3A 1C3BA 3A3FA 4DE0A 2JC7A 4OP8A 2DCFA 2I72A 5FATA 3G2ZA 1KGFA 1JWVA 2H0TA 1KE0A 4KG5A 1ES4A 2VGKA 4L0LA 2R9WA 4N9KA 3ZG7B 3OPLA 2XK1A 2WKEA 4GD6A 3NDEA 5EVIA 2GDNA 3UE3A 4FCFA 3S22A 5FAOA 4KZ5A 2J9OA 1VQQA 4ZJ1A 4DDSA 5DTSA 1PW1A 5J8XA 2EX9A 3S4XA 4EWFA 1L2SA 2XQZA 1S0WA 1W7FA 3EQUA 1KDWA 4S2NC 3BRMA 4UA7A 1E3UD 1NJ4A 4S2LA 4Y7PA 3ZG5A 5KMWA 1IYOA 2JBFA 1BLPA 4JF6A 4PPRA 3NCKA 4E3MA 3TG9A 1IYSA 1JWPA 2Y2NA 4PM9A 1GA0A 1SDEA 1Z6FA 1CK3A 1Q2PA 2V20A 3RJUA 4JXWA 1NRFA 2WGVA 5GHYA 5CECA 3PBRA 1HD8A 1XX2A 4IBXA 4EBPA 5CERA 2XFSA 4OQ0A 2Y2IA 4OPZA 3LY3A 2Y91A 4WMCA 2HP5A 3HLWA 2EX8A 5E2HA 4JBFA 3BFGA 5GHXA 3SH9A 2XDMA 3PAEA 1PZPA 1N4OA 5F1FA 3ZGAB 5HFOA 2ZLYA 1KE3A 1NZOA 4FH4A 4R4SA 3BFDA 1JVJA 1ZG6A 3HLCA 3UPNA 2ZQCA 1IKGA 3P09A 3WS1A 2C5WB 4E3KA 3M6HA 4EV4A 1ESIA 4KG6A 1RGYA 3OPPA 1XPBA 5DVAA 4E3LA 3BEBA 4RX3A 3HLGA 3ZHHA 1HZOA 2WUQA 1CI9A 4FSFA 4R4RA 1ZG4A 2FFYA 1DJAA 3IXDA 3PBTA 4QB8A 2ZMAA 1K56D 4R1GA 2PBYA 3WS4A 3I7JA 3G30A 1BLSA 1PWGA 1I2WA 1K57A 1EROA 4QU3A 3PBNA 5CTNA 5E2GA 3NIAA 3LEZA 4B4XA 3ZG0A 5M18A 2HP9A 4B88A 4JPMA 4GKUA 5FI2A 4QHCA 5KSHA 4RVAA 4WZ4A 3ITAA 1IKIA 4Y0OA 2DRWA 1ALQA 2EX2A 4DE2A 4UA9A 3UE1A 5DF7A 4JXVA 2FFFB 3AGDA 3EQVA 2QZ6A 5F83A 3GSGA 4GDBA 1KVMA 3O87A 4EQIA 3UNWA 3FKVA 5CHUA 1MKIA 5GL9A 2HPBA 3VP3A 2XH9A 3JYIA 1H8ZA 3HREA 4GNUA 3HLBA 1MWTA 3QNBA 5CTMA 4E6XA 2XLNA 2Y2LA 2ZQ9A 3WRTA 5FASA 1RGZA 4S2OA 3OPHA 2HDQA 1IYQA 3W4PA 4DF6A 1J9MA 3MXRA 1MXOA 4ZBEA 4IBRA 5F1GA 5EVID 1I2SA 3NI9A 4DDYA 1GHMA 5EPHA 5U47A 2J7VA 1AXBA 4MLLA 2Y2OA 3SOIA 2XD1A 4WELA 4KZBA 5CHJA 2A3UA 1QMEA 3LCEA 4NK3A 3RXWA 3PBSA 1EI5A 4LENA 1K55A 1YMXA 3SS5A 3ITBA 1W8QA 3IT9A 1NXYA 1MBLA 2G2WA 4DE3A 4XUZA 1K6RA 4BD0A 4ZJ2A 5A91A 1XGIA 3TSGA 4MBHA 1PYYA 1LL5A 3N4IA 2X01A 4WZ5C 2WZZA 1E4DA 1FR6A 3GRJA 3OC2A 1N9BA 1XA1A 3V50A 3PBOA 2ZC3B 1CI8A 4WMCD 1XA7A 5GLAA 3WRZA 3UDFA 4JF4A 1ES3A 2Y2MA 1EWZA 4KQQA 5BOHA 2OSUA 1E25A 1ONGA 1YLJA 3QNCA 5GLBA 3ZCZA 5CEDA 1FSWA 1M40A 4JKTA 4R3BA 1MY8A 4DE1A 1YMSA 3M2JA 2IWBA 4KQOA 3UDXA 5FQMA 4OOLA 3W8KA 1W79A 5IHVA 3IHAA 4GZBA 3ZNYA 2Y55A 3ZDJA 2ZM0A 3IQAA 3VFHA 4HEFA 2P9VB 1FCOA 4PM7A 1YLYA 3ZVWA 3FV7A 3ZVTA 4B4ZA 3HLFA 4MBKA 2RCXA 2G2UA 2Y2GA 3W4OA 1L0DA 3G31A 2Z2LB 2ZJ9A 1K54A 1IYPA 1U60A 3NC8A 1MWSA 2J8YA 3HVFA 5CRFA 3Q1FA 3IF6B 3A3IA 4JXGA 5EVIC 1NZUA 5FQIA 1ES2A 5KZHA 1GHPA 3ISGA 2X02A 4GD8A 2WK0A 3N8LA 1LL9A 5DTKA 3DW0A 5E2EA 3VSKA 1DJCA 1IEMA 2ZM2A 3LY4A 3AGFA 4N1XA 2R9XA 4MEZA 2HDUA 4JLFA 2Z2MB 3HUOA 3UPPA 1YLWA 3A3EA 3WWXA 1ES5A 4X68A 2E8IA 3DTMA 3HUNA 1ERMA 1ERQA 3SH7A 5AQAA 4PM8A 5DF9A 5EE8A 5CXWA 4LCMA 5I94A 1LHYA 3V3RA 1RP5A 2P9VA 3VP1A 4OH0A 4KZ3A 5G18A 1RCJA 4K91A 4YINA 4IVIA 3VOYA 3WS0A 2HDRA 3UO9A 4RX2A 3VP4A 5CGSA 4DXCA 2XEPA 5AQ9A 1SDNA 3IH9A 1PI5A 2ZM8A 4CPKA 4S2MA 4RA7A 4OKPA 4BL2A 2WGIA 4M3KA 4F94A 3IXBA 3O88A 3BFFA 4GB7A 4C75A 3HUMA 2JCHA 3AGEA 3FZCA 5CGXA 3OCNA 3IF6A 3MFDA 3SH8A 4ZDXA 3QHYA 1Q2QA 1CEGA 4WEJA 3GVBA 4UAAA 3GV9A 3ZFZA 1LI9A 2PU4A 3C4OA 4OOYA 3BECA 3PBQA 2XF3A 1K57C 1I5QA 3PAGA 4DXBA 1YM1A 4QY5A 3V3SA 5FQQA 2OLVA 3G34A 4LCLA 4PM5A 2ZC6B 5E43A 4KZ4A 4U0TA 1BLCA 4X53A 5GLCA 2WKIA 4HBUA 1FSYA 1JWZA 4MBFA 2A49A 4N92A 4OQGA 1GCEA 1YQSA 4BQMA 4KZ9A 5A92A 1GA9A 4ID4A 1W8YA 1WYBA 5HAPA 1QMFA 4OLGA 3UDIA 2Y2JA 1G6AA 4KENB 4GDNA 1TEMA 2OLUA 2WGWB 3FYZA 1TDGA 3IWOA 3ZG9B 4ZJ3A 4U3TA 2BLSA 1XGJA 4OONA 4WEKA 1W5DA 3UY6A 1ZKJA 5A90A 4QJGA 1XKZA 3N6IA 4ZAMA 1K56A 4OLDA 1HTZA 2QMIA 4LV2A 4Y0UA 3HLEA 2H5SA 2ZQDA 3G4PA 1VM1A 4C3QA 1BZAA 3A3DA 4XUXA 4XXRA 4KZ8A 2Q9NA 5FQKA 1KVLA 3N8RA 1NYMA 3VFFA 5TR7A 1L0EA 2OV5A 4WYYA 1FCMA 1FR1A 1Y54A 2EX6A 4OQIA 2X71A 3WS5A 4E6WA 1LLBA 4A5RA 3DWZA 4OPQA 3HL9A 3C7UA 4UHUA 4YFMA 1ONHA 4FD8A 4U0XA 5DTTA 4OP5A 3UE0A 4JXSA 4NETA 1MWUA 1K55C 2ZQAA 1YLPA 3E2KA 3BYDA 3IWIA 5FAQA 3D4FA 2P74A 2H0YA 2QPNA 2WADA 3M2KA 3V39A 1XXMA 5F82A 4S2NA 5FQJA 5EOEA 1G68A 1FOFA 3DWKA 3ZG8B 3NBLA 4RYEA 4E3NA 5JYOA 1WYCA 4MNRA 5EOOA 3SS4A 2HP6A 5FI7A 5EECA 3MZFA 2WGWA 3Q7VB 1BSGA 2XD5A 2Y2KA 4EUZA 4WBGA 3C5AA 4X55A 5M19A 3MZEA 5FAPA 4OQHA 2EFXA 5FA7A 5DF8A 4S2PA 4Y0TA 5CHMA 1TDLA 3Q82A 1GHIA 1PI4A 1K6SA 2ZC5B 3O3VA 5M1AA 3RXXA 4EBLA 3GR2A 1WE4A 1PZOA 4Q8IA 3UN7A 3GMWA 5JYPA 3M6BA 3E2LA 3MXSA 3N7WA 4D2OA 4QD4A 1SKFA 2WAFA 3G35A 1JTDA 3Q7ZA 4K0WA 1BT5A 1L0GA 4KG2A 4N9LA 5HL1A 4LV1A 3VSLA 3ZNTA 1HVBA 1S6RA 1XP4A 4DKIA 4DRTA 4S2IA 1BTLA 3BM6A 3OZHA 5FI6A 4JF5A 3SS3A 4BD1A 1SHVA 4IVKA 1K54C 1NY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YT4 A;  1LI0 A;  1M6K A;  1K4F A;  1YLT A;  2ZC7 A;  2H10 A;  3LO7 A;  3MBZ A;  3MKE A;  3G2Y A;  2WZX A;  1L0F A;  3S1Y A;  4OPR A;  4BEN A;  3BLM A;  1ZC2 A;  3BLS A;  3CJM A;  1PWD A;  2B5R A;  3BFC A;  5A93 A;  4GOG A;  1FQG A;  1H5X A;  1O7E A;  3CZD A;  3IXH A;  2XGN A;  2IWC A;  2BG1 A;  2Y2H A;  3MZD A;  4C6Y A;  3Q07 A;  3GQZ A;  1KGE A;  3IF5 A;  3Q7V A;  5HAI A;  2EXA A;  1PWC A;  4P6B A;  3HBR A;  3VMA A;  4LV3 A;  1H8Y A;  1E3U A;  4PMA A;  4X6T A;  4P87 A;  5HX9 A;  4K0X A;  3VOZ A;  4OOM A;  1KDS A;  4Z9Q A;  4IED A;  4FH2 A;  2Y4A A;  2DNS A;  3GTC A;  3BFE A;  3MKF A;  4BLM A;  2ZQ8 A;  4UA6 A;  5E2F A;  4N1H A;  2EFU A;  2WKH A;  3O86 A;  4P85 A;  4HES A;  4X56 A;  2C6W B;  2ZQ7 A;  3CMZ A;  5AQB A;  4KQR A;  3WS2 A;  1BUE A;  4EBN A;  4KZ6 A;  4H8R A;  5CGW A;  1IEL A;  4LV0 A;  4KZA A;  5D3O A;  2CC1 A;  3C4P A;  4OPY A;  2VGJ A;  3PTE A;  4S2K A;  5TFQ A;  1PIO A;  1BUL A;  5CEB A;  3FWL A;  3NDG A;  3UPO A;  3A3J A;  5FSR A;  4QY6 A;  4HBT A;  3W4Q A;  1DJB A;  4R23 A;  4E3I A;  2J9P A;  1FCN A;  3IHB A;  2JE5 A;  2Y2Q A;  4CJN A;  3IF6 C;  2Q9M A;  3OPR A;  1NYY A;  2Y2P A;  4ZTK A;  2V2F F;  1DY6 A;  1K38 A;  4S2J A;  5EVI B;  1SCW A;  3VP0 A;  5TGF A;  3HLD A;  5GLD A;  3V5M A;  4R0Q A;  4WZ5 A;  5FDH A;  2PU2 A;  3B3X A;  4WM9 A;  3C7V A;  1K4E A;  5FQ9 A;  3IXG A;  1PW8 A;  1JTG A;  4X69 A;  1BLH A;  1TVF A;  5L2F A;  2HDS A;  2XR0 A;  1ESU A;  2ZC4 B;  5EUA A;  1MPL A;  5EVL A;  4BJP A;  2V1Z A;  5HAR A;  3N8S A;  2IWD A;  3VP2 A;  4O7D A;  1KE4 A;  2RL3 A;  4P0M A;  2Y59 A;  3IWQ A;  5KSC A;  2ZD8 A;  1KGG A;  2EXB A;  1YLZ A;  4E3J A;  4BL3 A;  2UWX A;  5GHZ A;  4PM6 A;  1OME A;  4GN2 A;  4R3J A;  3NY4 A;  3IH8 A;  2XFT A;  5AQ7 A;  3TOI A;  4E3O A;  3Q81 A;  1K25 A;  4KZ7 A;  3P98 A;  1CEF A;  2WAE A;  3OCL A;  4OVD A;  2WYX A;  1O07 A;  1MWR A;  3CG5 A;  3FKW A;  3G32 A;  5HAQ A;  5HW3 A;  1C3B A;  3A3F A;  4DE0 A;  2JC7 A;  4OP8 A;  2DCF A;  2I72 A;  5FAT A;  3G2Z A;  1KGF A;  1JWV A;  2H0T A;  1KE0 A;  4KG5 A;  1ES4 A;  2VGK A;  4L0L A;  2R9W A;  4N9K A;  3ZG7 B;  3OPL A;  2XK1 A;  2WKE A;  4GD6 A;  3NDE A;  5EVI A;  2GDN A;  3UE3 A;  4FCF A;  3S22 A;  5FAO A;  4KZ5 A;  2J9O A;  1VQQ A;  4ZJ1 A;  4DDS A;  5DTS A;  1PW1 A;  5J8X A;  2EX9 A;  3S4X A;  4EWF A;  1L2S A;  2XQZ A;  1S0W A;  1W7F A;  3EQU A;  1KDW A;  4S2N C;  3BRM A;  4UA7 A;  1E3U D;  1NJ4 A;  4S2L A;  4Y7P A;  3ZG5 A;  5KMW A;  1IYO A;  2JBF A;  1BLP A;  4JF6 A;  4PPR A;  3NCK A;  4E3M A;  3TG9 A;  1IYS A;  1JWP A;  2Y2N A;  4PM9 A;  1GA0 A;  1SDE A;  1Z6F A;  1CK3 A;  1Q2P A;  2V20 A;  3RJU A;  4JXW A;  1NRF A;  2WGV A;  5GHY A;  5CEC A;  3PBR A;  1HD8 A;  1XX2 A;  4IBX A;  4EBP A;  5CER A;  2XFS A;  4OQ0 A;  2Y2I A;  4OPZ A;  3LY3 A;  2Y91 A;  4WMC A;  2HP5 A;  3HLW A;  2EX8 A;  5E2H A;  4JBF A;  3BFG A;  5GHX A;  3SH9 A;  2XDM A;  3PAE A;  1PZP A;  1N4O A;  5F1F A;  3ZGA B;  5HFO A;  2ZLY A;  1KE3 A;  1NZO A;  4FH4 A;  4R4S A;  3BFD A;  1JVJ A;  1ZG6 A;  3HLC A;  3UPN A;  2ZQC A;  1IKG A;  3P09 A;  3WS1 A;  2C5W B;  4E3K A;  3M6H A;  4EV4 A;  1ESI A;  4KG6 A;  1RGY A;  3OPP A;  1XPB A;  5DVA A;  4E3L A;  3BEB A;  4RX3 A;  3HLG A;  3ZHH A;  1HZO A;  2WUQ A;  1CI9 A;  4FSF A;  4R4R A;  1ZG4 A;  2FFY A;  1DJA A;  3IXD A;  3PBT A;  4QB8 A;  2ZMA A;  1K56 D;  4R1G A;  2PBY A;  3WS4 A;  3I7J A;  3G30 A;  1BLS A;  1PWG A;  1I2W A;  1K57 A;  1ERO A;  4QU3 A;  3PBN A;  5CTN A;  5E2G A;  3NIA A;  3LEZ A;  4B4X A;  3ZG0 A;  5M18 A;  2HP9 A;  4B88 A;  4JPM A;  4GKU A;  5FI2 A;  4QHC A;  5KSH A;  4RVA A;  4WZ4 A;  3ITA A;  1IKI A;  4Y0O A;  2DRW A;  1ALQ A;  2EX2 A;  4DE2 A;  4UA9 A;  3UE1 A;  5DF7 A;  4JXV A;  2FFF B;  3AGD A;  3EQV A;  2QZ6 A;  5F83 A;  3GSG A;  4GDB A;  1KVM A;  3O87 A;  4EQI A;  3UNW A;  3FKV A;  5CHU A;  1MKI A;  5GL9 A;  2HPB A;  3VP3 A;  2XH9 A;  3JYI A;  1H8Z A;  3HRE A;  4GNU A;  3HLB A;  1MWT A;  3QNB A;  5CTM A;  4E6X A;  2XLN A;  2Y2L A;  2ZQ9 A;  3WRT A;  5FAS A;  1RGZ A;  4S2O A;  3OPH A;  2HDQ A;  1IYQ A;  3W4P A;  4DF6 A;  1J9M A;  3MXR A;  1MXO A;  4ZBE A;  4IBR A;  5F1G A;  5EVI D;  1I2S A;  3NI9 A;  4DDY A;  1GHM A;  5EPH A;  5U47 A;  2J7V A;  1AXB A;  4MLL A;  2Y2O A;  3SOI A;  2XD1 A;  4WEL A;  4KZB A;  5CHJ A;  2A3U A;  1QME A;  3LCE A;  4NK3 A;  3RXW A;  3PBS A;  1EI5 A;  4LEN A;  1K55 A;  1YMX A;  3SS5 A;  3ITB A;  1W8Q A;  3IT9 A;  1NXY A;  1MBL A;  2G2W A;  4DE3 A;  4XUZ A;  1K6R A;  4BD0 A;  4ZJ2 A;  5A91 A;  1XGI A;  3TSG A;  4MBH A;  1PYY A;  1LL5 A;  3N4I A;  2X01 A;  4WZ5 C;  2WZZ A;  1E4D A;  1FR6 A;  3GRJ A;  3OC2 A;  1N9B A;  1XA1 A;  3V50 A;  3PBO A;  2ZC3 B;  1CI8 A;  4WMC D;  1XA7 A;  5GLA A;  3WRZ A;  3UDF A;  4JF4 A;  1ES3 A;  2Y2M A;  1EWZ A;  4KQQ A;  5BOH A;  2OSU A;  1E25 A;  1ONG A;  1YLJ A;  3QNC A;  5GLB A;  3ZCZ A;  5CED A;  1FSW A;  1M40 A;  4JKT A;  4R3B A;  1MY8 A;  4DE1 A;  1YMS A;  3M2J A;  2IWB A;  4KQO A;  3UDX A;  5FQM A;  4OOL A;  3W8K A;  1W79 A;  5IHV A;  3IHA A;  4GZB A;  3ZNY A;  2Y55 A;  3ZDJ A;  2ZM0 A;  3IQA A;  3VFH A;  4HEF A;  2P9V B;  1FCO A;  4PM7 A;  1YLY A;  3ZVW A;  3FV7 A;  3ZVT A;  4B4Z A;  3HLF A;  4MBK A;  2RCX A;  2G2U A;  2Y2G A;  3W4O A;  1L0D A;  3G31 A;  2Z2L B;  2ZJ9 A;  1K54 A;  1IYP A;  1U60 A;  3NC8 A;  1MWS A;  2J8Y A;  3HVF A;  5CRF A;  3Q1F A;  3IF6 B;  3A3I A;  4JXG A;  5EVI C;  1NZU A;  5FQI A;  1ES2 A;  5KZH A;  1GHP A;  3ISG A;  2X02 A;  4GD8 A;  2WK0 A;  3N8L A;  1LL9 A;  5DTK A;  3DW0 A;  5E2E A;  3VSK A;  1DJC A;  1IEM A;  2ZM2 A;  3LY4 A;  3AGF A;  4N1X A;  2R9X A;  4MEZ A;  2HDU A;  4JLF A;  2Z2M B;  3HUO A;  3UPP A;  1YLW A;  3A3E A;  3WWX A;  1ES5 A;  4X68 A;  2E8I A;  3DTM A;  3HUN A;  1ERM A;  1ERQ A;  3SH7 A;  5AQA A;  4PM8 A;  5DF9 A;  5EE8 A;  5CXW A;  4LCM A;  5I94 A;  1LHY A;  3V3R A;  1RP5 A;  2P9V A;  3VP1 A;  4OH0 A;  4KZ3 A;  5G18 A;  1RCJ A;  4K91 A;  4YIN A;  4IVI A;  3VOY A;  3WS0 A;  2HDR A;  3UO9 A;  4RX2 A;  3VP4 A;  5CGS A;  4DXC A;  2XEP A;  5AQ9 A;  1SDN A;  3IH9 A;  1PI5 A;  2ZM8 A;  4CPK A;  4S2M A;  4RA7 A;  4OKP A;  4BL2 A;  2WGI A;  4M3K A;  4F94 A;  3IXB A;  3O88 A;  3BFF A;  4GB7 A;  4C75 A;  3HUM A;  2JCH A;  3AGE A;  3FZC A;  5CGX A;  3OCN A;  3IF6 A;  3MFD A;  3SH8 A;  4ZDX A;  3QHY A;  1Q2Q A;  1CEG A;  4WEJ A;  3GVB A;  4UAA A;  3GV9 A;  3ZFZ A;  1LI9 A;  2PU4 A;  3C4O A;  4OOY A;  3BEC A;  3PBQ A;  2XF3 A;  1K57 C;  1I5Q A;  3PAG A;  4DXB A;  1YM1 A;  4QY5 A;  3V3S A;  5FQQ A;  2OLV A;  3G34 A;  4LCL A;  4PM5 A;  2ZC6 B;  5E43 A;  4KZ4 A;  4U0T A;  1BLC A;  4X53 A;  5GLC A;  2WKI A;  4HBU A;  1FSY A;  1JWZ A;  4MBF A;  2A49 A;  4N92 A;  4OQG A;  1GCE A;  1YQS A;  4BQM A;  4KZ9 A;  5A92 A;  1GA9 A;  4ID4 A;  1W8Y A;  1WYB A;  5HAP A;  1QMF A;  4OLG A;  3UDI A;  2Y2J A;  1G6A A;  4KEN B;  4GDN A;  1TEM A;  2OLU A;  2WGW B;  3FYZ A;  1TDG A;  3IWO A;  3ZG9 B;  4ZJ3 A;  4U3T A;  2BLS A;  1XGJ A;  4OON A;  4WEK A;  1W5D A;  3UY6 A;  1ZKJ A;  5A90 A;  4QJG A;  1XKZ A;  3N6I A;  4ZAM A;  1K56 A;  4OLD A;  1HTZ A;  2QMI A;  4LV2 A;  4Y0U A;  3HLE A;  2H5S A;  2ZQD A;  3G4P A;  1VM1 A;  4C3Q A;  1BZA A;  3A3D A;  4XUX A;  4XXR A;  4KZ8 A;  2Q9N A;  5FQK A;  1KVL A;  3N8R A;  1NYM A;  3VFF A;  5TR7 A;  1L0E A;  2OV5 A;  4WYY A;  1FCM A;  1FR1 A;  1Y54 A;  2EX6 A;  4OQI A;  2X71 A;  3WS5 A;  4E6W A;  1LLB A;  4A5R A;  3DWZ A;  4OPQ A;  3HL9 A;  3C7U A;  4UHU A;  4YFM A;  1ONH A;  4FD8 A;  4U0X A;  5DTT A;  4OP5 A;  3UE0 A;  4JXS A;  4NET A;  1MWU A;  1K55 C;  2ZQA A;  1YLP A;  3E2K A;  3BYD A;  3IWI A;  5FAQ A;  3D4F A;  2P74 A;  2H0Y A;  2QPN A;  2WAD A;  3M2K A;  3V39 A;  1XXM A;  5F82 A;  4S2N A;  5FQJ A;  5EOE A;  1G68 A;  1FOF A;  3DWK A;  3ZG8 B;  3NBL A;  4RYE A;  4E3N A;  5JYO A;  1WYC A;  4MNR A;  5EOO A;  3SS4 A;  2HP6 A;  5FI7 A;  5EEC A;  3MZF A;  2WGW A;  3Q7V B;  1BSG A;  2XD5 A;  2Y2K A;  4EUZ A;  4WBG A;  3C5A A;  4X55 A;  5M19 A;  3MZE A;  5FAP A;  4OQH A;  2EFX A;  5FA7 A;  5DF8 A;  4S2P A;  4Y0T A;  5CHM A;  1TDL A;  3Q82 A;  1GHI A;  1PI4 A;  1K6S A;  2ZC5 B;  3O3V A;  5M1A A;  3RXX A;  4EBL A;  3GR2 A;  1WE4 A;  1PZO A;  4Q8I A;  3UN7 A;  3GMW A;  5JYP A;  3M6B A;  3E2L A;  3MXS A;  3N7W A;  4D2O A;  4QD4 A;  1SKF A;  2WAF A;  3G35 A;  1JTD A;  3Q7Z A;  4K0W A;  1BT5 A;  1L0G A;  4KG2 A;  4N9L A;  5HL1 A;  4LV1 A;  3VSL A;  3ZNT A;  1HVB A;  1S6R A;  1XP4 A;  4DKI A;  4DRT A;  4S2I A;  1BTL A;  3BM6 A;  3OZH A;  5FI6 A;  4JF5 A;  3SS3 A;  4BD1 A;  1SHV A;  4IVK A;  1K54 C;  1NY0 A; 
#chains in the Genus database with same CATH topology
 1LI0 A;  1M6K A;  1YLT A;  2ZC7 A;  4NXB A;  2H10 A;  3MF0 A;  2WKR A;  3MKE A;  3S1Y A;  4OPR A;  3S7Q A;  4BEN A;  3BLM A;  2M1C A;  4R70 A;  2B5R A;  1H5X A;  1O7E A;  3IXH A;  3MZD A;  4C6Y A;  3OLO A;  3Q07 A;  1KGE A;  5DKK A;  5HDS A;  1E3U A;  2EWW A;  4OOM A;  1KDS A;  4IED A;  2VK3 A;  3MKF A;  2W0N A;  4N1H A;  4P85 A;  2ZQ7 A;  1ZHH B;  4KQR A;  3KYE A;  4KZ6 A;  4ESP A;  4H8R A;  5CGW A;  3IS2 A;  5IS1 A;  3CWF A;  5CEB A;  4JGQ A;  3NDG A;  3U2A A;  3W4Q A;  4R23 A;  3CUE C;  2Y2P A;  4ZTK A;  1K38 A;  3H9W A;  4R0Q A;  3C7V A;  1PW8 A;  1T1A A;  1ESU A;  1YAX A;  5EVL A;  1MPL A;  2Y59 A;  4FOF A;  1MKM A;  2EXB A;  4BL3 A;  5GHZ A;  4GW9 A;  1OME A;  5I5L A;  1OTA A;  4GN2 A;  3NY4 A;  2PR5 A;  5AQ7 A;  3R4K A;  1TS7 A;  1K25 A;  4KZ7 A;  1S1Z A;  5FL3 A;  3H7W B;  1MWR A;  3FKW A;  1C3B A;  4DE0 A;  2ZOI A;  3E4P A;  5FAT A;  3G2Z A;  2H0T A;  1KE0 A;  2VGK A;  3F1P B;  1S1Y A;  2J9O A;  4GS9 B;  1OTD A;  5DTS A;  5J8X A;  5IU1 A;  2XQZ A;  1S0W A;  3KSF A;  5J3W A;  4UA7 A;  1E3U D;  1NJ4 A;  3BW6 A;  4PPR A;  4E3M A;  2W1T B;  4PM9 A;  1GA0 A;  1Z6F A;  3RJU A;  2WGV A;  3PBR A;  3IX4 A;  2W3H A;  2XFS A;  4WMC A;  5GHX A;  2O9B A;  5F1F A;  1N4O A;  3ZGA B;  5HFO A;  4R4S A;  1ZG6 A;  3HLC A;  4YOF A;  3P09 A;  3M6H A;  1ESI A;  1VHM A;  3H82 A;  4RX3 A;  3HLG A;  2WUQ A;  4LRY C;  3QP5 A;  4R4R A;  4R1G A;  4AFI A;  1BLS A;  1ERO A;  1J3W A;  2BAS A;  4GKU A;  2DRW A;  2MJ6 A;  2W1R A;  2KOI A;  1N9O A;  3O87 A;  3FKV A;  5DFX A;  2E8J A;  1H8Z A;  4Q0J A;  4GNU A;  5CTM A;  1MWT A;  3QNB A;  1RGZ A;  3OPH A;  4DF6 A;  2VA0 A;  1UWN X;  1N9L A;  3RTY A;  4ZBE A;  4IBR A;  4HNB A;  4CLC C;  1XJ6 A;  1AXB A;  4MLL A;  2Y2O A;  2A3U A;  1F9I A;  1QME A;  3LCE A;  4NK3 A;  1EI5 A;  1YMX A;  3ITB A;  4DE3 A;  1K6R A;  4BD0 A;  5A91 A;  2IA2 A;  2ZMV A;  3TSG A;  4WZ5 C;  1TD5 A;  3OC2 A;  5K5B A;  3PBO A;  2EWV A;  1XFN A;  4WMC D;  1XA7 A;  3UDF A;  4JF4 A;  2QYB A;  5BOH A;  2OSU A;  5GLB A;  2GX5 A;  4JKT A;  4XT2 A;  1D7E A;  1YMS A;  4KQO A;  3W8K A;  2QJ5 A;  2Y55 A;  3T4L A;  4WF0 A;  4MBK A;  3T50 A;  4EW7 A;  1K54 A;  1U60 A;  3NC8 A;  2J8Y A;  2GNX A;  2KX6 A;  3IF6 B;  3UB8 A;  1CQA A;  3NJA A;  5FQI A;  1ES2 A;  4X1L A;  2X02 A;  2K7S A;  4L9F A;  1DJC A;  3EOI A;  1Z09 A;  3AGF A;  4O8G A;  4MEZ A;  3R7W A;  1LL8 A;  2D01 A;  3MS6 A;  3IBR A;  1ERM A;  1ERQ A;  2HJ9 C;  4HHD A;  2D02 A;  4LCM A;  5F69 A;  1LHY A;  2ZL1 A;  3T1R A;  4K91 A;  4IVI A;  5CGS A;  3IH9 A;  2ZM8 A;  4EER A;  4S2M A;  4JGR A;  4BL2 A;  2WGI A;  5DFY A;  3O88 A;  4HIA A;  4C75 A;  1KOU A;  4MCW A;  2V8F A;  3LID A;  3CUE A;  1Q2Q A;  5HDD A;  3LIB A;  2PU4 A;  3C4O A;  3PBQ A;  4GJ4 A;  2XF3 A;  1I5Q A;  4IHQ A;  2OLV A;  3G34 A;  5E43 A;  3C8C A;  4U0T A;  2WKI A;  4HBU A;  1JWZ A;  1GCE A;  4KZ9 A;  1GA9 A;  4ID4 A;  3BY8 A;  1L3L A;  4OLG A;  2Y2J A;  1OT9 A;  4KEN B;  4GDN A;  2WGW B;  4U3T A;  2BLS A;  4OON A;  4WEK A;  1W5D A;  1ZKJ A;  5A90 A;  1XKZ A;  4FTX A;  5DKL A;  2ZQD A;  1BZA A;  2ZOH A;  1FIK A;  1KVL A;  1FR1 A;  1Y54 A;  4E6W A;  2P7J A;  3K3D A;  1ONH A;  3S7P A;  3LR5 A;  1K55 C;  3MMH A;  2W3F A;  2H0Y A;  5EOE A;  5L10 A;  4RYE A;  4HH3 A;  5FI7 A;  2J3T C;  5EEC A;  2XD5 A;  1F98 A;  3C5A A;  2EFX A;  5FA7 A;  4S2P A;  3JVU A;  4R38 A;  3VE4 A;  1GHI A;  3GR2 A;  3CLO A;  3GMW A;  3M6B A;  1VET A;  3E2L A;  3MXS A;  3N7W A;  4D2O A;  4EEU A;  2XSS A;  2WAF A;  3F1N A;  3ZYT A;  3LEQ A;  2VEA A;  4PKY G;  3VSL A;  3ZNT A;  4JF5 A;  2QKP A;  1DP8 A;  1NY0 A;  4I5S A;  4I3J A;  2WZX A;  1PWD A;  1FQG A;  3CZD A;  2IWC A;  4IUK A;  2BG1 A;  2XA7 M;  3GQZ A;  5HDC A;  4RQ9 A;  2EXA A;  1H8Y A;  4PMA A;  5HX9 A;  4K0X A;  2Y4A A;  3GTC A;  4H6J A;  5E2F A;  2EFU A;  2C6W B;  3NHQ A;  1S66 L;  4NXG A;  5LBR A;  3T1Q B;  2A24 A;  3DTE A;  3DAV A;  4KZA A;  5D3O A;  3CI6 A;  2PYR A;  2VGJ A;  4WL9 A;  4CLC A;  4O01 A;  5IT5 A;  3UPO A;  4QY6 A;  4E3I A;  2J9P A;  2JE5 A;  2Y2Q A;  4Y3I A;  3LYX A;  2INW A;  2O9A A;  5EVI B;  1SCW A;  3CHW P;  2XRN A;  2PRF A;  4WZ5 A;  4MN7 A;  4GCZ A;  2PU2 A;  4WM9 A;  3MSH A;  1K4E A;  2HDS A;  1N9N A;  3VE3 A;  3N8S A;  2IWD A;  3LR4 A;  1KE4 A;  4P0M A;  3IWQ A;  4E3J A;  2UWX A;  4PM6 A;  2VV8 A;  4R3J A;  4BBT A;  4X1M A;  3P98 A;  3PYP A;  5L09 A;  1CEF A;  2WAE A;  2WYX A;  5HW3 A;  3G32 A;  1ES4 A;  4L0L A;  4N9K A;  1P0Z A;  2XK1 A;  2WKE A;  4EES A;  4GD6 A;  5KIZ A;  4II7 A;  4EXO A;  5FAO A;  3IX8 A;  1SKO A;  2UV0 E;  4LRX C;  1S4R A;  5HPI A;  2A2L A;  4HOI A;  1W7F A;  5A8B A;  5KMW A;  3BRM A;  1TF1 A;  2GJ3 A;  3ZG5 A;  1IYO A;  4JF6 A;  1CF0 A;  1F2K A;  1JWP A;  2Y2N A;  1SDE A;  5F5Y A;  5HPF A;  1Q2P A;  2JKR I;  5CEC A;  4MMN A;  4HP4 A;  1HD8 A;  1XX2 A;  3G6O A;  5L8M A;  2KLI A;  5G4Y A;  2PD7 A;  2EX8 A;  3L7H A;  3SH9 A;  2XDM A;  1VB6 A;  3PAE A;  1KE3 A;  5EV0 A;  2Z6D A;  2VGL S;  4FH4 A;  4CLC D;  3BFD A;  3BJN A;  4NKP A;  2JKT I;  3UPN A;  1G28 A;  4E04 A;  3WS1 A;  4CQH A;  4F3L B;  4E3K A;  3E4O A;  4EV4 A;  1XPB A;  3FPW A;  4P6Z S;  3PR6 A;  5EM0 A;  1ZG4 A;  2FFY A;  1DJA A;  2ZMA A;  2PBY A;  5TBM B;  3LEZ A;  2HP9 A;  4B88 A;  4RVA A;  4WZ4 A;  3ITA A;  4GHI A;  2EX2 A;  4DE2 A;  3UE1 A;  4JXV A;  2QZ6 A;  3GSG A;  1KVM A;  4HJ4 A;  3LIE A;  2Y8H A;  3VP3 A;  1BYW A;  1D1J A;  2XLN A;  2ZQ9 A;  2VKS A;  2HDQ A;  1IYQ A;  3W4P A;  1J9M A;  3MXR A;  4M4X A;  4ETX A;  2OAQ 1;  5F1G A;  1I2S A;  1GHM A;  5EPH A;  4NXE A;  5L07 A;  2OOL A;  2XD1 A;  2QHK A;  3RXW A;  3PBS A;  5HZH A;  1K55 A;  3SS5 A;  1NXY A;  1MBL A;  2G2W A;  4ZJ2 A;  1PYY A;  4IJG A;  1LL5 A;  2X01 A;  2WZZ A;  2WKP A;  1N9B A;  4YWZ A;  1UWP X;  3K3C A;  4G3W A;  4EUV A;  4EQ1 A;  1YLJ A;  1M40 A;  4DE1 A;  2PR6 A;  5F68 A;  2IWB A;  3ZNY A;  2ZM0 A;  3IQA A;  2FZ0 A;  2P9V B;  4KQD A;  3FV7 A;  3ZVT A;  2RCX A;  3T4T A;  3W4O A;  5G4Z A;  2Z2L B;  2ZJ9 A;  1GSV A;  1MWS A;  4QWO A;  3HVF A;  5CRF A;  1VEU A;  4JXG A;  3E98 A;  3B33 A;  3BQ8 A;  2WK0 A;  5E2E A;  5DTK A;  2ZM2 A;  3MQQ A;  4FUW A;  1D06 A;  3NOP C;  2R9X A;  5AVE A;  4JLF A;  1YLW A;  4X68 A;  3MXQ A;  1XJ3 A;  2R78 A;  2E8I A;  3HUN A;  4UQI M;  4B93 A;  5J7E A;  5CXW A;  5I94 A;  1HLU P;  1RP5 A;  4OH0 A;  4KZ3 A;  3WS0 A;  1RCJ A;  4BBU A;  5FEG A;  3VOY A;  5AQ9 A;  2VZW A;  4CPK A;  1H8M A;  2PHY A;  4F94 A;  3HUM A;  2JCH A;  3AGE A;  3QHY A;  3CPT B;  4WEJ A;  3GVB A;  4UAA A;  1OPX A;  1LI9 A;  3BEC A;  4DXB A;  2W27 A;  4QY5 A;  5FQQ A;  4PM5 A;  4KZ4 A;  1JNU A;  3P01 A;  4X53 A;  5GLC A;  4KUO A;  1FSY A;  4MBF A;  4EEP A;  4N92 A;  5A92 A;  3LIF A;  2AVX A;  3UDI A;  1XFQ A;  1LSV A;  1TEM A;  5EFW A;  5HWV A;  3IWO A;  3RH8 B;  1AWI A;  3K2N A;  4ARZ A;  5AJG A;  1K56 A;  2QMI A;  4Y0U A;  2M7U A;  2H5S A;  4XUX A;  4XXR A;  4Z1W A;  2Q9N A;  3DTI A;  3N8R A;  1NYM A;  4ETZ A;  2OV5 A;  3KYQ A;  4WYY A;  1S4S A;  2EX6 A;  2X71 A;  3HCY A;  3DWZ A;  3HL9 A;  2L0W A;  2FH5 A;  3MR0 A;  3VOL A;  4U0X A;  5DTT A;  4OP5 A;  2Q0O A;  1H0M A;  5TJJ A;  3V39 A;  2WAD A;  4Y17 A;  5F82 A;  3DBA A;  2V8C A;  3NBL A;  2NUT C;  4MNR A;  2HJE A;  2HP6 A;  3S7O A;  1BSG A;  2Y2K A;  5FAP A;  3TE8 A;  3SZT A;  1STZ A;  1K6S A;  5M1A A;  3O3V A;  3T4O A;  5HWW A;  2EA9 A;  3NUL A;  3UN7 A;  3UME A;  2JHE A;  2CMN A;  1PNE A;  4QD4 A;  1CJF A;  4KUK A;  1JTD A;  3Q7Z A;  1L0G A;  1HVB A;  1S6R A;  1XP4 A;  4DKI A;  2J3W A;  3IS2 B;  4S2I A;  3BM6 A;  4GLQ A;  4MN5 A;  1K4F A;  3F1O A;  3LO7 A;  1YPR A;  3G2Y A;  4PAU A;  1L0F A;  3BLS A;  3CJM A;  5A93 A;  4GOG A;  5EVE A;  4D60 A;  3PXP A;  2Y2H A;  3Q7V A;  1OJG A;  3IF5 A;  3OBF A;  1F5M A;  1PWC A;  3HBR A;  3IX3 A;  4P87 A;  4I39 A;  4Z9Q A;  2DNS A;  3BFE A;  1YKD A;  2WKH A;  3O86 A;  1G6O A;  1YSP A;  3WS2 A;  4BMW A;  4G3V A;  4LFU A;  2CC1 A;  3C4P A;  4OPY A;  5AVF A;  3PTE A;  4S2K A;  1PIO A;  3FWL A;  3A3J A;  5FSR A;  2L4R A;  1FCN A;  2WKQ A;  3DTK A;  3IF6 C;  2YKF A;  1DY6 A;  4S2J A;  4CLC E;  3VP0 A;  5TGF A;  3HLD A;  3V5M A;  5FDH A;  5FQ9 A;  4IUH A;  1JTG A;  1BLH A;  1TVF A;  2XR0 A;  5EUA A;  2V1Z A;  2V0U A;  5HAR A;  2I9V A;  4O7D A;  2DMW A;  3KYZ A;  5KSC A;  2ZD8 A;  1KGG A;  1YLZ A;  4DMZ A;  2XRO A;  3IH8 A;  1Y4O A;  2XFT A;  4E3O A;  4OVD A;  3A3F A;  1PFL A;  4OP8 A;  2I72 A;  1JWV A;  4KG5 A;  3A0S A;  2R9W A;  3ZG7 B;  3OPL A;  2V1A A;  3H82 B;  4Y2F A;  3UE3 A;  4FCF A;  3S22 A;  1VQQ A;  3OOV A;  4ZJ1 A;  4DDS A;  1PW1 A;  2EX9 A;  4EWF A;  3EQU A;  1KDW A;  4S2N C;  2JBF A;  1BLP A;  1H3Q A;  1CK3 A;  4JXW A;  1NRF A;  1ODV A;  3TRC A;  4EBP A;  5CER A;  2ACG A;  1P9W A;  2Y2I A;  4HQA A;  3LY3 A;  4OPZ A;  2Y91 A;  3BFG A;  4I3I A;  3H7W A;  1PZP A;  3EWK A;  1NZO A;  4HJ6 A;  3ICY A;  1JVJ A;  3QP2 A;  1IKG A;  1W63 M;  1RGY A;  3OPP A;  1ACF A;  3ZHH A;  3F1P A;  3D3O A;  1CI9 A;  4FSF A;  4QB8 A;  3IXD A;  4GS9 A;  3IBJ A;  4NXF A;  3G30 A;  4HY8 A;  1I2W A;  3PBN A;  3NIA A;  2ZMF A;  4JPM A;  3CAX A;  2W1T A;  4Y0O A;  1ALQ A;  4B9O A;  3LR3 A;  3AGD A;  3EQV A;  2O0Y A;  4UEY A;  1IOU A;  3UNW A;  5CHU A;  2HPB A;  4LLO B;  2XH9 A;  2K2N A;  3JYI A;  3HRE A;  1P9R A;  2Y2L A;  3WRT A;  5FAS A;  4S2O A;  2OWH A;  4XT2 B;  1IFQ A;  3UB7 A;  3KO6 A;  1G5U A;  4R3A A;  4DDY A;  2J7V A;  3SOI A;  5CHJ A;  4LEN A;  1W8Q A;  3IT9 A;  4XUZ A;  1NRJ A;  1WA9 A;  4MBH A;  3T4Q A;  2Z6C A;  1XA1 A;  3QP6 A;  2ZC3 B;  4EET B;  1CI8 A;  2Y79 A;  2O9C A;  1ES3 A;  1EWZ A;  3R7W B;  3ZCZ A;  1FSW A;  4R3B A;  2W3G A;  4Y13 A;  3M2J A;  2O99 A;  1OTE A;  5IHV A;  2HGV A;  3ZDJ A;  2ZL1 B;  4HEF A;  4PM7 A;  3T4J A;  3G31 A;  4R6L A;  4Y15 A;  1XJ4 A;  4K08 A;  3C38 A;  5HD5 A;  2KDK A;  1DP9 A;  3Q1F A;  3ULF A;  5EVI C;  5KZH A;  1GHP A;  3P7N A;  4GD8 A;  2OWJ A;  1LL9 A;  3DW0 A;  3VSK A;  4O0P A;  3LY4 A;  3D72 A;  1PRQ A;  2HDU A;  3TW8 A;  3HUO A;  3A3E A;  4HP9 A;  3DTM A;  4PM8 A;  2NUP C;  3LUQ A;  2PBD P;  3JVV A;  2GZA A;  5G18 A;  4YIN A;  2HDR A;  3VP4 A;  2XEP A;  1PI5 A;  4M3K A;  3IXB A;  3BFF A;  5DJU A;  1LT0 A;  3FZC A;  5CGX A;  3OCN A;  3IF6 A;  5FEF A;  4ZRR A;  4JGP A;  4Y5F A;  3GV9 A;  4Q0I A;  2YKH A;  1K57 C;  3PAG A;  1YM1 A;  3V3S A;  4LCL A;  2ZC6 B;  1LSX A;  1BLC A;  3E0Y A;  1A0K A;  5EM1 A;  4OQG A;  1YQS A;  4BQM A;  1W8Y A;  1WYB A;  3C2W A;  1QMF A;  1OJ5 A;  1G6A A;  3FYZ A;  1GSW A;  1NWZ A;  3ZG9 B;  3HJK A;  4ZJ3 A;  3B47 A;  4ZAM A;  4OLD A;  1HTZ A;  3RFB A;  3HLE A;  3G4P A;  4C3Q A;  3A3D A;  2G7U A;  1VET B;  2XA7 S;  1L0E A;  3F1N B;  3LIA A;  4OQI A;  3WS5 A;  1LLB A;  1TS0 A;  4A5R A;  3C7U A;  3UE0 A;  4WUJ A;  4NET A;  3FPV A;  2ZQA A;  1YLP A;  3IWI A;  3BYD A;  2V9A A;  3D4F A;  4QPR A;  2P74 A;  5FAQ A;  3M2K A;  1FIL A;  1XXM A;  3LGO A;  4S2N A;  2LB9 A;  5FQJ A;  3UMD A;  4BWI A;  3KX0 X;  1G68 A;  3ZG8 B;  2B02 A;  4E3N A;  3S7N A;  5EOO A;  3SS4 A;  3U4L P;  2V0W A;  2WGW A;  3MZF A;  4EUZ A;  4WBG A;  4X55 A;  5M19 A;  4OQH A;  1W63 Q;  4MN6 A;  3HJI A;  4Y0T A;  3BY9 A;  4HH2 A;  1TDL A;  4EBL A;  3NEC A;  1PZO A;  1DP6 A;  4PKY A;  4PHT A;  4H6J B;  4Q8I A;  3MFX A;  3A0V A;  4HI4 A;  3ZQ5 A;  5JYP A;  3B42 A;  3V67 A;  1SKF A;  5HD3 A;  2L1M A;  2A24 B;  1BT5 A;  4G3K A;  5HL1 A;  4LV1 A;  3GEC A;  4DRT A;  1BTL A;  5FI6 A;  3OZH A;  5HWT A;  4CLC B;  4BD1 A;  1SHV A;  4IVK A;  1YT4 A;  3MBZ A;  3MQ0 A;  1ZC2 A;  3BFC A;  4YNR A;  2XGN A;  2PT7 A;  5HAI A;  4P6B A;  3VMA A;  2J80 A;  4LV3 A;  3TJZ C;  5DJT A;  2JKR M;  4X6T A;  4NEE D;  3VOZ A;  1MC0 A;  4FH2 A;  4BLM A;  2ZQ8 A;  4UA6 A;  1UGU A;  4HES A;  4X56 A;  3CMZ A;  5AQB A;  2J3T D;  1BUE A;  4EBN A;  1IEL A;  1SZV A;  4LV0 A;  2JKT M;  5HSQ A;  5TFQ A;  1BUL A;  1NLY A;  4HBT A;  1DJB A;  2VJW A;  3IHB A;  4BBV A;  4CJN A;  2Q9M A;  3OPR A;  1NYY A;  3E4Q A;  3UE6 A;  2V2F F;  2QJ7 A;  3BQA A;  1T18 A;  2VX8 A;  3MQO A;  3SW1 A;  5GLD A;  1SKO B;  3L9K A;  3B3X A;  1T1C A;  2VV6 A;  1MZU A;  3IXG A;  3UB9 A;  3GDI A;  4X69 A;  1TS6 A;  4JGO A;  5L2F A;  5MC7 A;  2HV1 A;  2ZC4 B;  3LI8 A;  2B95 A;  4BJP A;  3VP2 A;  2RL3 A;  4WLA A;  3TOI A;  4DN0 A;  2QWS A;  3NOT C;  3Q81 A;  1T19 A;  3OCL A;  2BTF P;  1O07 A;  3CG5 A;  5HAQ A;  2PD8 A;  3NOU C;  2JC7 A;  2DCF A;  1KGF A;  4WN5 A;  1P97 A;  1Y28 A;  3NDE A;  2W3E A;  5EVI A;  2GDN A;  4KZ5 A;  2M7V A;  3EEA A;  3KSI A;  3S4X A;  4DJ3 A;  1L2S A;  4S2L A;  3KSH A;  4Y7P A;  1S67 L;  3NCK A;  1LSW A;  3TG9 A;  1IYS A;  4GHI B;  3T1S A;  2V20 A;  5GHY A;  3T4S A;  4IBX A;  4OQ0 A;  1OTB A;  2HP5 A;  3HLW A;  5E2H A;  4JBF A;  2K31 A;  1V9Y A;  3EGD C;  2ZLY A;  2JKG A;  2ZQC A;  4L9G A;  2C5W B;  4KG6 A;  2OAP 1;  5DVA A;  4E3L A;  3BEB A;  3CIT A;  1HZO A;  3PBT A;  1K56 D;  3WS4 A;  1X0O A;  3I7J A;  3UB5 P;  1PWG A;  2VLG A;  1K57 A;  4QU3 A;  5CTN A;  5E2G A;  4B4X A;  3ZG0 A;  5M18 A;  5FI2 A;  4QHC A;  5KSH A;  1IKI A;  2P04 A;  3FC7 A;  4UA9 A;  5DF7 A;  2FFF B;  5F83 A;  4GDB A;  4EQI A;  5GL9 A;  1MKI A;  4I3A A;  1ZTU A;  3LIC A;  3HLB A;  4E6X A;  3BWL A;  4F3L A;  4NG2 A;  1MXO A;  1OTI A;  5EVI D;  3NI9 A;  5U47 A;  5TBM A;  4WEL A;  4I38 A;  4KZB A;  4UQI S;  2ZBB A;  2VGL M;  4Q0H A;  1VEU B;  1XGI A;  4LPZ A;  2H28 A;  3MJQ A;  3N4I A;  1E4D A;  1FR6 A;  3GRJ A;  2V1B A;  3QP8 A;  3V50 A;  4P6Z M;  5GLA A;  2HF6 A;  3WRZ A;  1XJ2 A;  4KQQ A;  2Y2M A;  1E25 A;  1ONG A;  3QNC A;  3EEH A;  5CED A;  1MY8 A;  2PDR A;  3LI9 A;  3UDX A;  5FQM A;  4OOL A;  2HZ5 A;  1W79 A;  4EU0 A;  3IHA A;  4GZB A;  3T1X A;  3VFH A;  1EW0 A;  1FCO A;  1YLY A;  3ZVW A;  4B4Z A;  3HLF A;  2G2U A;  2Y2G A;  1L0D A;  2B18 A;  3QP1 A;  1IYP A;  3A3I A;  1NZU A;  3ISG A;  3LFV A;  4L9E A;  3VV4 A;  3A0R A;  3KSG A;  3N8L A;  3W2Z A;  1IEM A;  4N1X A;  2Z2M B;  3UPP A;  3WWX A;  1ES5 A;  4LGW A;  2PAV P;  1V9Z A;  3SH7 A;  5AQA A;  5C5K A;  5DF9 A;  5EE8 A;  3FG8 A;  4MDZ A;  3V3R A;  3VP1 A;  2P9V A;  4ARZ B;  4DXC A;  4HJ3 A;  3UO9 A;  4RX2 A;  1SDN A;  4RA7 A;  4OKP A;  4GB7 A;  3UB6 A;  5F6A A;  3MFD A;  3SH8 A;  4ZDX A;  1CEG A;  3ZFZ A;  2P08 A;  2PYP A;  1K0K A;  5J4E A;  2W3D A;  4OOY A;  3PHY A;  1NLZ A;  3D9Y A;  2A49 A;  2JN7 A;  5HAP A;  2OLU A;  1TDG A;  1XGJ A;  3UY6 A;  4QJG A;  3N6I A;  1TS8 A;  4LV2 A;  1VM1 A;  1YSQ A;  4KZ8 A;  1DRM A;  5FQK A;  3VFF A;  5TR7 A;  1FCM A;  3CPT A;  5CX7 A;  4OPQ A;  4DJ2 A;  4UHU A;  4YFM A;  4FD8 A;  3C30 A;  3EGX C;  3QP4 A;  4JXS A;  1MWU A;  3E2K A;  2QPN A;  3F1O B;  3JPU A;  1FOF A;  3DWK A;  3T4K A;  1WYC A;  5JYO A;  1OT6 A;  5HL6 A;  3Q7V B;  3MZE A;  5FDS A;  5DF8 A;  2VV7 A;  5CHM A;  3O5Y A;  3Q82 A;  4X25 A;  1PI4 A;  2ZC5 B;  3RXX A;  1T1B A;  3LR0 A;  1WE4 A;  3T12 B;  4ME4 A;  1GSX A;  3G35 A;  4LRZ E;  2LB5 A;  4K0W A;  4KG2 A;  4N9L A;  2JKF A;  3SS3 A;  1K54 C; 
#chains in the Genus database with same CATH homology
 1YT4 A;  1LI0 A;  1M6K A;  1K4F A;  1YLT A;  2ZC7 A;  2H10 A;  3LO7 A;  3MBZ A;  3MKE A;  3G2Y A;  2WZX A;  1L0F A;  3S1Y A;  4OPR A;  4BEN A;  3BLM A;  1ZC2 A;  3BLS A;  3CJM A;  1PWD A;  2B5R A;  3BFC A;  5A93 A;  4GOG A;  1FQG A;  1H5X A;  1O7E A;  3CZD A;  3IXH A;  2XGN A;  2IWC A;  2BG1 A;  2Y2H A;  3MZD A;  4C6Y A;  3Q07 A;  3GQZ A;  1KGE A;  3IF5 A;  3Q7V A;  5HAI A;  2EXA A;  1PWC A;  4P6B A;  3HBR A;  3VMA A;  4LV3 A;  1H8Y A;  1E3U A;  4PMA A;  4X6T A;  4P87 A;  5HX9 A;  4K0X A;  3VOZ A;  4OOM A;  1KDS A;  4Z9Q A;  4IED A;  4FH2 A;  2Y4A A;  2DNS A;  3GTC A;  3BFE A;  3MKF A;  4BLM A;  2ZQ8 A;  4UA6 A;  5E2F A;  4N1H A;  2EFU A;  2WKH A;  3O86 A;  4P85 A;  4HES A;  4X56 A;  2C6W B;  2ZQ7 A;  3CMZ A;  5AQB A;  4KQR A;  3WS2 A;  1BUE A;  4EBN A;  4KZ6 A;  4H8R A;  5CGW A;  1IEL A;  4LV0 A;  4KZA A;  5D3O A;  2CC1 A;  3C4P A;  4OPY A;  2VGJ A;  3PTE A;  4S2K A;  5TFQ A;  1PIO A;  1BUL A;  5CEB A;  3FWL A;  3NDG A;  3UPO A;  3A3J A;  5FSR A;  4QY6 A;  4HBT A;  3W4Q A;  1DJB A;  4R23 A;  4E3I A;  2J9P A;  1FCN A;  3IHB A;  2JE5 A;  2Y2Q A;  4CJN A;  3IF6 C;  2Q9M A;  3OPR A;  1NYY A;  2Y2P A;  4ZTK A;  2V2F F;  1DY6 A;  1K38 A;  4S2J A;  5EVI B;  1SCW A;  3VP0 A;  5TGF A;  3HLD A;  5GLD A;  3V5M A;  4R0Q A;  4WZ5 A;  5FDH A;  2PU2 A;  3B3X A;  4WM9 A;  3C7V A;  1K4E A;  5FQ9 A;  3IXG A;  1PW8 A;  1JTG A;  4X69 A;  1BLH A;  1TVF A;  5L2F A;  2HDS A;  2XR0 A;  1ESU A;  2ZC4 B;  5EUA A;  1MPL A;  5EVL A;  4BJP A;  2V1Z A;  5HAR A;  3N8S A;  2IWD A;  3VP2 A;  4O7D A;  1KE4 A;  2RL3 A;  4P0M A;  2Y59 A;  3IWQ A;  5KSC A;  2ZD8 A;  1KGG A;  2EXB A;  1YLZ A;  4E3J A;  4BL3 A;  2UWX A;  5GHZ A;  4PM6 A;  1OME A;  4GN2 A;  4R3J A;  3NY4 A;  3IH8 A;  2XFT A;  5AQ7 A;  3TOI A;  4E3O A;  3Q81 A;  1K25 A;  4KZ7 A;  3P98 A;  1CEF A;  2WAE A;  3OCL A;  4OVD A;  2WYX A;  1O07 A;  1MWR A;  3CG5 A;  3FKW A;  3G32 A;  5HAQ A;  5HW3 A;  1C3B A;  3A3F A;  4DE0 A;  2JC7 A;  4OP8 A;  2DCF A;  2I72 A;  5FAT A;  3G2Z A;  1KGF A;  1JWV A;  2H0T A;  1KE0 A;  4KG5 A;  1ES4 A;  2VGK A;  4L0L A;  2R9W A;  4N9K A;  3ZG7 B;  3OPL A;  2XK1 A;  2WKE A;  4GD6 A;  3NDE A;  5EVI A;  2GDN A;  3UE3 A;  4FCF A;  3S22 A;  5FAO A;  4KZ5 A;  2J9O A;  1VQQ A;  4ZJ1 A;  4DDS A;  5DTS A;  1PW1 A;  5J8X A;  2EX9 A;  3S4X A;  4EWF A;  1L2S A;  2XQZ A;  1S0W A;  1W7F A;  3EQU A;  1KDW A;  4S2N C;  3BRM A;  4UA7 A;  1E3U D;  1NJ4 A;  4S2L A;  4Y7P A;  3ZG5 A;  5KMW A;  1IYO A;  2JBF A;  1BLP A;  4JF6 A;  4PPR A;  3NCK A;  4E3M A;  3TG9 A;  1IYS A;  1JWP A;  2Y2N A;  4PM9 A;  1GA0 A;  1SDE A;  1Z6F A;  1CK3 A;  1Q2P A;  2V20 A;  3RJU A;  4JXW A;  1NRF A;  2WGV A;  5GHY A;  5CEC A;  3PBR A;  1HD8 A;  1XX2 A;  4IBX A;  4EBP A;  5CER A;  2XFS A;  4OQ0 A;  2Y2I A;  4OPZ A;  3LY3 A;  2Y91 A;  4WMC A;  2HP5 A;  3HLW A;  2EX8 A;  5E2H A;  4JBF A;  3BFG A;  5GHX A;  3SH9 A;  2XDM A;  3PAE A;  1PZP A;  1N4O A;  5F1F A;  3ZGA B;  5HFO A;  2ZLY A;  1KE3 A;  1NZO A;  4FH4 A;  4R4S A;  3BFD A;  1JVJ A;  1ZG6 A;  3HLC A;  3UPN A;  2ZQC A;  1IKG A;  3P09 A;  3WS1 A;  2C5W B;  4E3K A;  3M6H A;  4EV4 A;  1ESI A;  4KG6 A;  1RGY A;  3OPP A;  1XPB A;  5DVA A;  4E3L A;  3BEB A;  4RX3 A;  3HLG A;  3ZHH A;  1HZO A;  2WUQ A;  1CI9 A;  4FSF A;  4R4R A;  1ZG4 A;  2FFY A;  1DJA A;  3IXD A;  3PBT A;  4QB8 A;  2ZMA A;  1K56 D;  4R1G A;  2PBY A;  3WS4 A;  3I7J A;  3G30 A;  1BLS A;  1PWG A;  1I2W A;  1K57 A;  1ERO A;  4QU3 A;  3PBN A;  5CTN A;  5E2G A;  3NIA A;  3LEZ A;  4B4X A;  3ZG0 A;  5M18 A;  2HP9 A;  4B88 A;  4JPM A;  4GKU A;  5FI2 A;  4QHC A;  5KSH A;  4RVA A;  4WZ4 A;  3ITA A;  1IKI A;  4Y0O A;  2DRW A;  1ALQ A;  2EX2 A;  4DE2 A;  4UA9 A;  3UE1 A;  5DF7 A;  4JXV A;  2FFF B;  3AGD A;  3EQV A;  2QZ6 A;  5F83 A;  3GSG A;  4GDB A;  1KVM A;  3O87 A;  4EQI A;  3UNW A;  3FKV A;  5CHU A;  1MKI A;  5GL9 A;  2HPB A;  3VP3 A;  2XH9 A;  3JYI A;  1H8Z A;  3HRE A;  4GNU A;  3HLB A;  1MWT A;  3QNB A;  5CTM A;  4E6X A;  2XLN A;  2Y2L A;  2ZQ9 A;  3WRT A;  5FAS A;  1RGZ A;  4S2O A;  3OPH A;  2HDQ A;  1IYQ A;  3W4P A;  4DF6 A;  1J9M A;  3MXR A;  1MXO A;  4ZBE A;  4IBR A;  5F1G A;  5EVI D;  1I2S A;  3NI9 A;  4DDY A;  1GHM A;  5EPH A;  5U47 A;  2J7V A;  1AXB A;  4MLL A;  2Y2O A;  3SOI A;  2XD1 A;  4WEL A;  4KZB A;  5CHJ A;  2A3U A;  1QME A;  3LCE A;  4NK3 A;  3RXW A;  3PBS A;  1EI5 A;  4LEN A;  1K55 A;  1YMX A;  3SS5 A;  3ITB A;  1W8Q A;  3IT9 A;  1NXY A;  1MBL A;  2G2W A;  4DE3 A;  4XUZ A;  1K6R A;  4BD0 A;  4ZJ2 A;  5A91 A;  1XGI A;  3TSG A;  4MBH A;  1PYY A;  1LL5 A;  3N4I A;  2X01 A;  4WZ5 C;  2WZZ A;  1E4D A;  1FR6 A;  3GRJ A;  3OC2 A;  1N9B A;  1XA1 A;  3V50 A;  3PBO A;  2ZC3 B;  1CI8 A;  4WMC D;  1XA7 A;  5GLA A;  3WRZ A;  3UDF A;  4JF4 A;  1ES3 A;  2Y2M A;  1EWZ A;  4KQQ A;  5BOH A;  2OSU A;  1E25 A;  1ONG A;  1YLJ A;  3QNC A;  5GLB A;  3ZCZ A;  5CED A;  1FSW A;  1M40 A;  4JKT A;  4R3B A;  1MY8 A;  4DE1 A;  1YMS A;  3M2J A;  2IWB A;  4KQO A;  3UDX A;  5FQM A;  4OOL A;  3W8K A;  1W79 A;  5IHV A;  3IHA A;  4GZB A;  3ZNY A;  2Y55 A;  3ZDJ A;  2ZM0 A;  3IQA A;  3VFH A;  4HEF A;  2P9V B;  1FCO A;  4PM7 A;  1YLY A;  3ZVW A;  3FV7 A;  3ZVT A;  4B4Z A;  3HLF A;  4MBK A;  2RCX A;  2G2U A;  2Y2G A;  3W4O A;  1L0D A;  3G31 A;  2Z2L B;  2ZJ9 A;  1K54 A;  1IYP A;  1U60 A;  3NC8 A;  1MWS A;  2J8Y A;  3HVF A;  5CRF A;  3Q1F A;  3IF6 B;  3A3I A;  4JXG A;  5EVI C;  1NZU A;  5FQI A;  1ES2 A;  5KZH A;  1GHP A;  3ISG A;  2X02 A;  4GD8 A;  2WK0 A;  3N8L A;  1LL9 A;  5DTK A;  3DW0 A;  5E2E A;  3VSK A;  1DJC A;  1IEM A;  2ZM2 A;  3LY4 A;  3AGF A;  4N1X A;  2R9X A;  4MEZ A;  2HDU A;  4JLF A;  2Z2M B;  3HUO A;  3UPP A;  1YLW A;  3A3E A;  3WWX A;  1ES5 A;  4X68 A;  2E8I A;  3DTM A;  3HUN A;  1ERM A;  1ERQ A;  3SH7 A;  5AQA A;  4PM8 A;  5DF9 A;  5EE8 A;  5CXW A;  4LCM A;  5I94 A;  1LHY A;  3V3R A;  1RP5 A;  2P9V A;  3VP1 A;  4OH0 A;  4KZ3 A;  5G18 A;  1RCJ A;  4K91 A;  4YIN A;  4IVI A;  3VOY A;  3WS0 A;  2HDR A;  3UO9 A;  4RX2 A;  3VP4 A;  5CGS A;  4DXC A;  2XEP A;  5AQ9 A;  1SDN A;  3IH9 A;  1PI5 A;  2ZM8 A;  4CPK A;  4S2M A;  4RA7 A;  4OKP A;  4BL2 A;  2WGI A;  4M3K A;  4F94 A;  3IXB A;  3O88 A;  3BFF A;  4GB7 A;  4C75 A;  3HUM A;  2JCH A;  3AGE A;  3FZC A;  5CGX A;  3OCN A;  3IF6 A;  3MFD A;  3SH8 A;  4ZDX A;  3QHY A;  1Q2Q A;  1CEG A;  4WEJ A;  3GVB A;  4UAA A;  3GV9 A;  3ZFZ A;  1LI9 A;  2PU4 A;  3C4O A;  4OOY A;  3BEC A;  3PBQ A;  2XF3 A;  1K57 C;  1I5Q A;  3PAG A;  4DXB A;  1YM1 A;  4QY5 A;  3V3S A;  5FQQ A;  2OLV A;  3G34 A;  4LCL A;  4PM5 A;  2ZC6 B;  5E43 A;  4KZ4 A;  4U0T A;  1BLC A;  4X53 A;  5GLC A;  2WKI A;  4HBU A;  1FSY A;  1JWZ A;  4MBF A;  2A49 A;  4N92 A;  4OQG A;  1GCE A;  1YQS A;  4BQM A;  4KZ9 A;  5A92 A;  1GA9 A;  4ID4 A;  1W8Y A;  1WYB A;  5HAP A;  1QMF A;  4OLG A;  3UDI A;  2Y2J A;  1G6A A;  4KEN B;  4GDN A;  1TEM A;  2OLU A;  2WGW B;  3FYZ A;  1TDG A;  3IWO A;  3ZG9 B;  4ZJ3 A;  4U3T A;  2BLS A;  1XGJ A;  4OON A;  4WEK A;  1W5D A;  3UY6 A;  1ZKJ A;  5A90 A;  4QJG A;  1XKZ A;  3N6I A;  4ZAM A;  1K56 A;  4OLD A;  1HTZ A;  2QMI A;  4LV2 A;  4Y0U A;  3HLE A;  2H5S A;  2ZQD A;  3G4P A;  1VM1 A;  4C3Q A;  1BZA A;  3A3D A;  4XUX A;  4XXR A;  4KZ8 A;  2Q9N A;  5FQK A;  1KVL A;  3N8R A;  1NYM A;  3VFF A;  5TR7 A;  1L0E A;  2OV5 A;  4WYY A;  1FCM A;  1FR1 A;  1Y54 A;  2EX6 A;  4OQI A;  2X71 A;  3WS5 A;  4E6W A;  1LLB A;  4A5R A;  3DWZ A;  4OPQ A;  3HL9 A;  3C7U A;  4UHU A;  4YFM A;  1ONH A;  4FD8 A;  4U0X A;  5DTT A;  4OP5 A;  3UE0 A;  4JXS A;  4NET A;  1MWU A;  1K55 C;  2ZQA A;  1YLP A;  3E2K A;  3BYD A;  3IWI A;  5FAQ A;  3D4F A;  2P74 A;  2H0Y A;  2QPN A;  2WAD A;  3M2K A;  3V39 A;  1XXM A;  5F82 A;  4S2N A;  5FQJ A;  5EOE A;  1G68 A;  1FOF A;  3DWK A;  3ZG8 B;  3NBL A;  4RYE A;  4E3N A;  5JYO A;  1WYC A;  4MNR A;  5EOO A;  3SS4 A;  2HP6 A;  5FI7 A;  5EEC A;  3MZF A;  2WGW A;  3Q7V B;  1BSG A;  2XD5 A;  2Y2K A;  4EUZ A;  4WBG A;  3C5A A;  4X55 A;  5M19 A;  3MZE A;  5FAP A;  4OQH A;  2EFX A;  5FA7 A;  5DF8 A;  4S2P A;  4Y0T A;  5CHM A;  1TDL A;  3Q82 A;  1GHI A;  1PI4 A;  1K6S A;  2ZC5 B;  3O3V A;  5M1A A;  3RXX A;  4EBL A;  3GR2 A;  1WE4 A;  1PZO A;  4Q8I A;  3UN7 A;  3GMW A;  5JYP A;  3M6B A;  3E2L A;  3MXS A;  3N7W A;  4D2O A;  4QD4 A;  1SKF A;  2WAF A;  3G35 A;  1JTD A;  3Q7Z A;  4K0W A;  1BT5 A;  1L0G A;  4KG2 A;  4N9L A;  5HL1 A;  4LV1 A;  3VSL A;  3ZNT A;  1HVB A;  1S6R A;  1XP4 A;  4DKI A;  4DRT A;  4S2I A;  1BTL A;  3BM6 A;  3OZH A;  5FI6 A;  4JF5 A;  3SS3 A;  4BD1 A;  1SHV A;  4IVK A;  1K54 C;  1NY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...