1G6AA

Pse-4 carbenicillinase, r234k mutant
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
266
structure length
266
Chain Sequence
SKFQQVEQDVKAIEVSLSARIGVSVLDTQNGEYWDYNGNQRFPLTSTFKTIACAKLLYDAEQGKVNPNSTVEIKKADLVTYSPVIEKQVGQAITLDDACFATMTTSDNTAANIILSAVGGPKGVTDFLRQIGDKETRLDRIEPDLNEGKLGDLRDTTTPKAIASTLNKFLFGSALSEMNQKKLESWMVNNQVTGNLLRSVLPAGWNIADKSGAGGFGARSITAVVWSEHQAPIIVSIYLAQTQASMEERNDAIVKIGHSIFDVYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE PSE-4
publication title Insights into the molecular basis for the carbenicillinase activity of PSE-4 beta-lactamase from crystallographic and kinetic studies.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 98
structure length 266
sequence length 266
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1g6aA00
1FCOA 1FSWA 5AQAA 5FQQA 5D3OA 5HW3A 4OQHA 3WS4A 5CEBA 3NIAA 2Q9MA 2JE5A 3PBSA 3RXXA 2VGJA 3SOIA 3GV9A 1K55A 3UPPA 1E3UA 1CEGA 1QMFA 1NY0A 3IH9A 3W4QA 2FFYA 3EQVA 2EXBA 1TVFA 2Y2HA 3LY3A 4KZ7A 4XUXA 2OLUA 3VOZA 2ZMAA 1L0FA 1ESIA 5AQBA 1IELA 4DF6A 3IQAA 4OVDA 1QMEA 4OOYA 4BQMA 4UAAA 2Y2NA 3OC2A 1E3UD 5F1FA 1LI0A 4KZBA 3CG5A 3MBZA 3GSGA 4XXRA 3WS2A 3M2KA 1ESUA 1ERQA 3N4IA 3LEZA 4LENA 2OV5A 2Y2PA 5CHJA 1MWUA 4ID4A 4KQOA 4OP5A 4UHUA 5FI7A 1YLZA 4CJNA 1IEMA 5I94A 2ZC6B 3V5MA 4ZDXA 2J7VA 5CGXA 1CI8A 2E8IA 4E6WA 2IWCA 4LV1A 5KSCA 2BG1A 2IWDA 3Q1FA 4IEDA 1BLHA 5HAQA 4CPKA 3HLBA 3NI9A 3O88A 3QHYA 4L0LA 2RCXA 3E2LA 4S2NC 3IHBA 2ZM8A 5GLAA 2Y4AA 4E3OA 4DXBA 4LCLA 2A3UA 3VP3A 1BZAA 3EQUA 3W8KA 5FDHA 2Z2LB 4S2JA 1NZOA 1XXMA 1NYYA 1TDGA 4R1GA 2V1ZA 1IYQA 3PAGA 2ZC3B 4GD6A 1BT5A 4HEFA 1GA0A 2VGKA 2Y2JA 3HUNA 4KZ3A 4N1XA 2EX6A 1RCJA 2B5RA 1HZOA 1CEFA 3B3XA 3A3EA 1KE4A 4JXSA 1Q2QA 4IBRA 5A93A 4R4RA 4JXGA 1YLPA 3FV7A 4FSFA 2ZM0A 4MBHA 2WGWB 1SDNA 2Y59A 3OCLA 5GLBA 5DVAA 5F1GA 1ALQA 4X69A 3RXWA 4HBUA 2ZQCA 3RJUA 5FAPA 3HLFA 3P98A 4B4ZA 3AGEA 4X55A 1ZG4A 1LI9A 4OPZA 1WE4A 5G18A 2DRWA 5GHYA 2BLSA 1BLSA 3ZFZA 3BEBA 1MPLA 3OPPA 4M3KA 3C5AA 4X53A 2XEPA 3Q81A 3C4OA 1IYOA 4X68A 4BJPA 2PBYA 3BFDA 3N8SA 4Y0TA 3UE3A 1L0EA 3ZG5A 3N6IA 4OLDA 3BRMA 4KZ8A 1JTDA 1VQQA 2J9OA 3IF5A 1KE3A 5DTSA 5EVIA 1ES5A 5L2FA 3ITAA 3V3RA 3HL9A 1YLWA 1FR1A 5IHVA 1MXOA 1U60A 3GRJA 4N92A 4S2KA 1VM1A 4WZ5C 4R3JA 3VSLA 3CZDA 5EPHA 2IWBA 3BFGA 2Y2QA 2G2WA 4OQ0A 3LCEA 4H8RA 5E43A 5FAOA 4BLMA 5A90A 1JWPA 3PBNA 4QB8A 1M6KA 5A91A 2QZ6A 3HLDA 4LV0A 5CTNA 5EVID 3LY4A 4OLGA 4C75A 1FQGA 3N8RA 3SS3A 2Y55A 5FQ9A 1DJBA 3ZG9B 2DCFA 1XKZA 1EROA 2ZC7A 4P6BA 3IHAA 4GD8A 4DKIA 1K54C 3FKWA 5AQ7A 3V50A 1MBLA 3PAEA 1KDSA 1RP5A 4KENB 3UPNA 5M1AA 2WUQA 4X6TA 2WKEA 4ZTKA 3TG9A 2ZQAA 1PW1A 2X71A 3C7UA 3UDFA 2J9PA 4WMCA 3ZG8B 4BL2A 3NDGA 5GLCA 3S4XA 1XP4A 1C3BA 3HUOA 4N1HA 4KG5A 1ZG6A 4GKUA 2CC1A 4RX3A 5E2HA 1EWZA 3PBRA 4Z9QA 1MY8A 5KZHA 3PTEA 3S22A 1PI5A 3BYDA 1NXYA 4ZBEA 3UDXA 1MWRA 5GLDA 2EX9A 1CK3A 2P9VA 2ZD8A 1YLYA 4OQGA 2HDUA 1BLPA 4MEZA 4JXWA 1W8YA 1Y54A 3O3VA 3VFHA 3UO9A 4PMAA 4NK3A 3HLCA 5EOOA 1XGIA 1M40A 4S2IA 1S0WA 5U47A 2HP5A 4ZJ3A 2WYXA 4Q8IA 3SH7A 3UNWA 4WEJA 2WK0A 5TR7A 1L0GA 2UWXA 1G6AA 1I2SA 3HLGA 2HP6A 2ZLYA 5EVIB 5HL1A 5JYOA 3WWXA 3WRZA 4YFMA 4U3TA 2EFUA 1DJCA 5FAQA 5HX9A 4EBLA 4EWFA 1OMEA 4B88A 4N9KA 4PM6A 5FQKA 1KDWA 4OONA 4IVIA 3VP0A 3PBOA 1RGYA 2R9XA 5CRFA 3DWZA 4BENA 4WEKA 1KGGA 3ZGAB 4DDSA 1O07A 4QJGA 3NDEA 2V2FF 4OPRA 3G2YA 2OLVA 2ZC5B 2Y2MA 3Q7VA 5EOEA 2EFXA 1KE0A 1FR6A 2WAFA 4QHCA 1N9BA 3ZG0A 3HLWA 4PM9A 4S2OA 1KGFA 1TEMA 4MLLA 3UDIA 3IF6B 2Y91A 3A3JA 4Y0OA 2QPNA 3CMZA 4NETA 5DF7A 4EBNA 1RGZA 2XFTA 4YINA 5CEDA 3UE1A 2HP9A 1S6RA 1W5DA 2GDNA 4F94A 3N8LA 5CHMA 5M19A 4KZ4A 4JPMA 1PW8A 3GQZA 1LLBA 1NZUA 3MXRA 1N4OA 1BTLA 3FKVA 2OSUA 4HESA 4S2NA 3OZHA 4EQIA 5KSHA 2Z2MB 1GHIA 3FYZA 1YLTA 1XX2A 5FI2A 3MFDA 3SH9A 4WYYA 3MKEA 1Q2PA 4A5RA 1FOFA 3O87A 1MWSA 2ZM2A 3O86A 3BECA 3DW0A 4RX2A 2P74A 4RYEA 3GTCA 4QU3A 2ZJ9A 2XLNA 1XGJA 2WADA 4P87A 1I5QA 1IYSA 4JF5A 5CXWA 3NY4A 3A3FA 4WM9A 1JWZA 4K0WA 1K25A 3V39A 1PIOA 1O7EA 3A3IA 3WS1A 4U0XA 4BL3A 1FSYA 2XR0A 3W4PA 3UY6A 5FATA 5HAIA 5GHXA 3VSKA 5EECA 3HLEA 4GNUA 1BLCA 3M2JA 3QNBA 1NJ4A 1AXBA 4P85A 2EX8A 2WKHA 5AQ9A 3ITBA 3IWQA 1ZKJA 2PU4A 5CGSA 3VP1A 4GDBA 4OP8A 4K0XA 4UA7A 2Y2IA 3MXSA 2C6WB 1IKGA 2H5SA 2XDMA 2H10A 1DJAA 5FQJA 3GVBA 4E3NA 4N9LA 3IF6C 4R4SA 2ZQDA 5GHZA 4C3QA 5FSRA 5CERA 1K57C 3OPRA 2Q9NA 4PM7A 4QD4A 5DF8A 3GR2A 1GHPA 4OOMA 4P0MA 5DTTA 1PWGA 1J9MA 3W4OA 4FH4A 4JBFA 5F83A 4X56A 4OOLA 4WZ5A 3HVFA 4KG6A 2EXAA 4OQIA 4WZ4A 5F82A 3IWIA 5E2EA 2PU2A 3UE0A 1LHYA 1E25A 4DE3A 1YMSA 4S2LA 5CTMA 2XGNA 4RA7A 5EUAA 2EX2A 4E3IA 3DTMA 4JF4A 1K55C 4BD0A 4PM5A 1KVLA 1XA7A 2G2UA 3VP4A 4WELA 1NRFA 4KQQA 4WMCD 2WGIA 1PWDA 4XUZA 3ZVTA 1K54A 4FCFA 2V20A 4UA6A 2WZXA 1E4DA 1WYCA 4GDNA 1WYBA 2Y2KA 1JVJA 1K4EA 4K91A 3WS5A 3MZDA 5EVLA 1YQSA 4EUZA 1DY6A 3Q82A 3SS5A 1I2WA 3ZNYA 5HFOA 1CI9A 4O7DA 2WGWA 4GN2A 1K6SA 4S2MA 3PBQA 3WS0A 4DE1A 4OPQA 5J8XA 3G2ZA 2I72A 3IXDA 1PYYA 1W8QA 3OPLA 4MNRA 4ZAMA 3UPOA 4DXCA 5FQMA 1PI4A 4QY6A 3VP2A 1YM1A 1NYMA 1GA9A 2Y2GA 4KQRA 3A3DA 1K4FA 2Y2OA 2XF3A 4UA9A 3G31A 3E2KA 3HREA 3P09A 1XA1A 3D4FA 3BFCA 3IXHA 3ZDJA 3ZHHA 4S2PA 5E2FA 3QNCA 5M18A 3IXGA 4DRTA 1GCEA 1GHMA 2ZQ8A 2XD1A 3C7VA 3WRTA 5JYPA 4FH2A 4ZJ2A 1ZC2A 3M6HA 2QMIA 4R3BA 3TOIA 5E2GA 1HTZA 2ZQ9A 1H8YA 3N7WA 4RVAA 3BFEA 3VMAA 1SHVA 2ZQ7A 5DTKA 5HAPA 3HBRA 1W7FA 1HVBA 4LCMA 5HARA 3MZFA 1ES4A 1SDEA 4Y0UA 5TFQA 2XFSA 3IXBA 3SS4A 5EE8A 2FFFB 3IH8A 1ES2A 4LV3A 4DE2A 2DNSA 3MKFA 1H8ZA 5BOHA 3NCKA 4KZAA 1PWCA 4JKTA 1MKIA 2P9VB 1EI5A 4KZ5A 1FCNA 1BULA 3IT9A 3DWKA 3S1YA 2Y2LA 2RL3A 5CHUA 4GB7A 1K6RA 3LO7A 3BM6A 3IWOA 3OPHA 5FA7A 2X02A 2J8YA 3FZCA 1MWTA 3CJMA 3G34A 2XH9A 4KG2A 3AGFA 3Q7ZA 3TSGA 5EVIC 1SKFA 1XPBA 1L2SA 1ERMA 4OH0A 4JLFA 5FASA 1YLJA 3I7JA 1JTGA 1YT4A 5A92A 3BFFA 4FD8A 3SH8A 3JYIA 1JWVA 2XD5A 3GMWA 4Y7PA 4E3MA 4EV4A 1SCWA 3V3SA 4OPYA 2WGVA 4E3KA 2H0YA 3AGDA 3ZCZA 4E6XA 3MZEA 4MBKA 1YMXA 3M6BA 3ZVWA 2HDQA 4QY5A 4PPRA 5GL9A 4DDYA 4R23A 1ONGA 2XQZA 2WZZA 4E3LA 5CGWA 3NBLA 4KZ6A 3ISGA 1BSGA 5CECA 1H5XA 3Q7VB 3OCNA 2ZC4B 3VFFA 1G68A 1HD8A 1K56A 4JF6A 2A49A 4DE0A 2WAEA 4LV2A 1PZPA 4HBTA 2JC7A 5FQIA 1FCMA 1W79A 2HDSA 3C4PA 3UN7A 4OKPA 4EBPA 2X01A 4D2OA 4WBGA 1KGEA 2HDRA 4C6YA 2WKIA 1LL9A 1K56D 2JBFA 2XK1A 3PBTA 3VOYA 3FWLA 4E3JA 2H0TA 1IKIA 1LL5A 2HPBA 2C5WB 3G30A 1TDLA 3IF6A 3NC8A 4KZ9A 1ES3A 3G32A 1L0DA 5TGFA 1K57A 5FI6A 2JCHA 3BLMA 3HUMA 4R0QA 4BD1A 2R9WA 1KVMA 3Q07A 1ONHA 1K38A 4GOGA 4U0TA 4IVKA 3ZG7B 3G35A 1Z6FA 5KMWA 4PM8A 4ZJ1A 1IYPA 3G4PA 4MBFA 3ZNTA 4B4XA 3BLSA 1PZOA 4IBXA 5DF9A 4JXVA 4GZBA 1BUEA
chains in the Genus database with same CATH superfamily
4G3WA 4O8GA 1P0ZA 1TD5A 3UPPA 1NY0A 3EQVA 4KZ7A 1L0FA 1IELA 1QMEA 3DTKA 3CUEA 2PHYA 1LI0A 4KZBA 3F1NA 3WS2A 1ESUA 1ERQA 3LEZA 1T1BA 4R3AA 4UHUA 1YLZA 4CJNA 5HPIA 2ZC6B 4ZDXA 4E6WA 2BG1A 2KLIA 1BLHA 4F3LA 2ZM8A 3F1OB 4LCLA 3VE3A 5FDHA 3UMDA 2HJ9C 3UB6A 5HZHA 1GA0A 3RTYA 3C8CA 1RCJA 2B5RA 1CEFA 3B3XA 1YLPA 3FV7A 4FSFA 2ZM0A 3OBFA 5GLBA 2INWA 2ZBBA 3RJUA 5FAPA 4CQHA 3HLFA 4B4ZA 4IUKA 1LI9A 4OPZA 5G18A 3BEBA 3OPPA 4O0PA 4X68A 3N8SA 5MC7A 3N6IA 3BJNA 1KE3A 5L2FA 3B47A 3VSLA 2IWBA 3BFGA 4H8RA 3PBNA 2FZ0A 4AFIA 2GJ3A 4OLGA 1FQGA 2Y55A 3ZG9B 2ZC7A 1TS8A 5HL6A 3IHAA 5FEFA 3FKWA 4LRXC 3PAEA 2V0UA 3LFVA 1KDSA 1S1ZA 3UPNA 1STZA 5M1AA 2WUQA 4ZTKA 3UDFA 2X71A 4WMCA 2E8JA 3L9KA 1ZG6A 4RX3A 1W63M 5E2HA 2HJEA 3PTEA 3S22A 5HWVA 4E04A 4ZBEA 1NXYA 1MWRA 1VEUA 2EX9A 2P9VA 1Y54A 2M7UA 3UO9A 1SKOA 3FC7A 3F1PB 1TS6A 4ZJ3A 4Q8IA 1UWNX 3EEHA 3UNWA 4WEJA 3LIFA 1G6AA 1I2SA 5FDSA 5EVIB 5JYOA 3LI9A 3JVUA 2ZOHA 4MDZA 2GZAA 5FAQA 4EBLA 5J4EA 1XJ4A 4PM6A 5FQKA 4OONA 3VP0A 4Q0IA 1JNUA 3PBOA 3T12B 1LSWA 2XRNA 3GDIA 1DRMA 1BYWA 5TBMB 3G2YA 2OLVA 3Q7VA 3ZG0A 5LBRA 1N9BA 4P6ZS 2Y91A 2QPNA 4NETA 4EBNA 2XFTA 4UQIM 2CMNA 2HP9A 1S6RA 2GDNA 4F94A 3N8LA 5CHMA 5M19A 3P01A 1YSPA 3GQZA 1LLBA 3MXRA 1BTLA 3FKVA 4HESA 1G6OA 4EQIA 2PRFA 3SH9A 4WYYA 1OPXA 1VETA 1FOFA 1OTAA 3BECA 2WKPA 3DW0A 4RX2A 1NRJA 3GTCA 2ZJ9A 4P87A 1XGJA 4Y3IA 3NY4A 4MN5A 4Q0HA 2VJWA 1JWZA 3F1NB 2QKPA 5HAIA 5GHXA 3HLEA 1BLCA 4GHIB 4P85A 3QNBA 3H7WA 3IWQA 2KX6A 1ZKJA 5CGSA 4GDBA 4K0XA 2C6WB 2H10A 4F3LB 3IF6C 4NKPA 5CERA 4PM7A 3VOLA 2VK3A 5DTTA 4WZ5A 4YWZA 2EXAA 4WZ4A 2PU2A 1YMSA 4S2LA 5CTMA 5EUAA 2EX2A 2FH5A 3DTMA 4PM5A 1K55C 3VP4A 4KQQA 1NLYA 2V20A 1WYBA 2Y2KA 3MZDA 4ESPA 3ZNYA 3OOVA 2EWVA 2I72A 3IXDA 5HDDA 3OPLA 1YM1A 5FEGA 2Y2GA 3A3DA 1T1AA 3E2KA 1FIKA 3DTEA 3T1XA 3D4FA 3IXHA 3IX4A 3IXGA 5HWWA 2ACGA 2JHEA 2XD1A 3C7VA 3T1SA 2WKQA 1X0OA 1HTZA 2PYPA 2ZQ9A 3N7WA 4RVAA 4HY8A 5KIZA 5HAPA 1W7FA 1HVBA 5HARA 4Y0UA 3T50A 3LIBA 4LV3A 4DE2A 2DNSA 3EEAA 4ETXA 3NCKA 4KZAA 1PWCA 1VEUB 2P9VB 1FCNA 3QP2A 4GB7A 1K6RA 1SKOB 3FZCA 3CJMA 3MR0A 4KQDA 1KOUA 1L2SA 2VV7A 1SZVA 5FASA 5EM1A 1JTGA 3BFFA 3MQQA 3JYIA 4E3MA 4EV4A 4OPYA 2WGVA 3FPVA 3M6BA 4PPRA 4R23A 2XQZA 2WZZA 4E3LA 4KZ6A 5DJUA 3Q7VB 3OCNA 4GJ4A 1HD8A 1K56A 1LL8A 2VKSA 4JF6A 1W63Q 2WAEA 4EERA 1PZPA 4ME4A 2JC7A 3LR5A 1W79A 3C4PA 4Y5FA 3BWLA 2JBFA 3FWLA 3CPTA 2XA7S 1ES3A 3G32A 5TGFA 1MZUA 3HUMA 1VETB 1KVMA 1H0MA 1ONHA 4GOGA 3NULA 1Z6FA 4DMZA 4PM8A 3BLSA 4IBXA 5DF9A 4GZBA 1BUEA 1FSWA 5AQAA 5FQQA 5HW3A 5CEBA 2VGJA 3IH9A 2FFYA 1F98A 4B93A 1TVFA 3RFBA 2Y2HA 3LY3A 3H7WB 1ESIA 4DF6A 2ZOIA 4WN5A 4G3VA 4BQMA 4Y2FA 2Y2NA 3IX3A 3OC2A 5F1FA 3N4IA 5CHJA 1MWUA 5FI7A 4OP5A 2L1MA 2W3HA 4HIAA 3V5MA 1CI8A 5KSCA 2IWDA 4HH3A 1CQAA 1GSWA 4E3OA 2Y4AA 1BZAA 3EQUA 3W8KA 3QP6A 4NG2A 1TDGA 3K2NA 3PAGA 2ZC3B 4GD6A 4HEFA 2VGKA 4N1XA 2A2LA 1CJFA 1N9LA 1Q2QA 4JXSA 1VB6A 5HWTA 4R4RA 4JXGA 1ZHHB 1SDNA 2Y59A 2Y8HA 1ALQA 4X69A 4I3JA 5HSQA 1S4RA 4HBUA 2A24B 4MCWA 2P08A 5GHYA 2BLSA 1BLSA 3Q81A 1L0EA 3V67A 4OLDA 4KZ8A 1VQQA 2J9OA 5EVIA 2P7JA 1XFQA 3KO6A 3V3RA 1YLWA 1FR1A 5IHVA 4PKYA 3GRJA 1VM1A 3PYPA 3UMEA 2G2WA 4OQ0A 3LCEA 3MJQA 4QB8A 3HLDA 2J80A 5CTNA 4C75A 3S7NA 2HGVA 2PD7A 3SS3A 5EV0A 2DCFA 4X25A 4MN7A 1K54C 4QWOA 5AQ7A 3V50A 1MBLA 1RP5A 2Q0OA 4CLCA 4X6TA 2WKEA 2ZQAA 1PW1A 3ZG8B 5GLCA 1LSVA 3HUOA 4YOFA 1EWZA 1MY8A 4FUWA 4NEED 3BYDA 5GLDA 1YLYA 4OQGA 1BLPA 1W8YA 4PMAA 2JKGA 3S7PA 2HP5A 3SH7A 4FOFA 3T4SA 2UWXA 3DTIA 3HLGA 3UB8A 4EXOA 3JPUA 1UGUA 3WRZA 4YFMA 1DJCA 4GHIA 5HX9A 4EWFA 4N9KA 3LIEA 4IVIA 2M1CA 5CRFA 4R70A 3DWZA 5IS1A 3P7NA 4BENA 3ZGAB 1O07A 3NDEA 2V2FF 3KSIA 2WAFA 2JKRI 3CPTB 4PM9A 4S2OA 1TEMA 2K7SA 4Y0OA 3CMZA 1LSXA 1P9RA 5HD5A 1RGZA 5CEDA 3C38A 4ARZB 3MQ0A 3R7WB 1PW8A 3H9WA 4S2NA 4X1MA 3MKEA 3S7OA 2ZMVA 3O86A 1I5QA 2W3GA 4EU0A 5DFYA 3CI6A 1PIOA 2BTFP 4U0XA 2UV0E 1FSYA 5FATA 3VSKA 3M2JA 5AQ9A 2EX8A 3ITBA 2PU4A 3VP1A 2Y2IA 2XDMA 4E3NA 5GHZA 4C3QA 1K57C 3OPRA 2Q9NA 4I5SA 4QD4A 4GS9B 3OLOA 1PWGA 4FH4A 5EFWA 5F83A 3SW1A 2PAVP 2K2NA 4M4XA 4OQIA 5F82A 4DE3A 4RA7A 1OJGA 1KVLA 1PWDA 4XUZA 3ZVTA 4GDNA 3CUEC 1JVJA 3MF0A 4R6LA 4K91A 4EUZA 3U2AA 1I2WA 3PHYA 4S2MA 1K6SA 4DE1A 5J8XA 4OPQA 3G2ZA 4JGQA 1PYYA 4ZAMA 5FQMA 4QY6A 3VP2A 4UA9A 3HREA 3P09A 4S2PA 3NOPC 1OTDA 3QNCA 2W27A 5J3WA 4DRTA 1GCEA 5JYPA 4ZJ2A 1ZC2A 3M6HA 3RH8B 3E4OA 4CLCB 2ZQ7A 3GECA 3SS4A 5EE8A 2JKRM 3IH8A 3NHQA 5BOHA 4KZ5A 1EI5A 1BULA 3IT9A 4BMWA 2Y2LA 5DKLA 1DP9A 3IWOA 2X02A 2J8YA 1YKDA 1A0KA 1XPBA 2GX5A 1YT4A 3SH8A 2XD5A 3GMWA 3IS2A 2H0YA 4IHQA 4MBKA 1YMXA 3ZVWA 2HDQA 4QY5A 4DDYA 2V8CA 2QHKA 1ONGA 2V1AA 3KYZA 4X1LA 5CGWA 3NBLA 1XJ6A 2PR5A 4IUHA 1BSGA 3KSHA 3UB9A 5TJJA 1G68A 1OTEA 2B18A 2A49A 3T4LA 4EQ1A 4HBTA 5FQIA 2VLGA 3UN7A 2X01A 4WBGA 1KGEA 2HDRA 2PYRA 2V0WA 1LL9A 1K56D 1XJ3A 2PT7A 2H0TA 3G30A 4KZ9A 5FI6A 2VEAA 4R0QA 4BD1A 3NOUC 4U0TA 3G35A 4ZJ1A 1IYPA 3G4PA 2JKTI 3TJZC 4JXVA 4I3IA 3IX8A 2Q9MA 3RXXA 3SOIA 1E3UA 1QMFA 2A24A 2EXBA 4OVDA 3LICA 4OOYA 4UQIS 2VX8A 1F5MA 5G4ZA 4UAAA 3CG5A 3DAVA 2J3TD 1TF1A 4XXRA 3M2KA 3BW6A 4GW9A 4LENA 1T1CA 2Y2PA 4ID4A 4KQOA 4WUJA 1T19A 4HJ4A 2IWCA 4LV1A 4Y13A 4IEDA 5HAQA 1S67L 3MS6A 4CPKA 3O88A 4L0LA 3E2LA 5L07A 2A3UA 3VP3A 4I38A 3T4KA 4XT2A 3DBAA 1XXMA 4LLOB 2V1ZA 3BY9A 3E98A 3HUNA 4KZ3A 2EX6A 1KE4A 3D9YA 5A93A 2XSSA 3FPWA 3OCLA 1V9ZA 3HJIA 5F1GA 3RXWA 2ZQCA 3P98A 4X55A 2KDKA 3S7QA 4HQAA 4BWIA 4RQ9A 4R38A 2VV6A 4M3KA 3C5AA 4X53A 2PBYA 3BFDA 4LGWA 4Y0TA 3ZG5A 3B33A 3BRMA 3H82B 1ES5A 4HJ3A 3ITAA 5L10A 1MXOA 4WF0A 4WZ5C 2PD8A 2Y2QA 5E43A 5FAOA 4BLMA 1JWPA 2QZ6A 4LV0A 4LRZE 5EVID 3LY4A 3N8RA 5FQ9A 1DJBA 1XKZA 1EROA 4P6BA 1DP8A 4GD8A 5FL3A 3TG9A 2W1RA 2M7VA 4HP9A 5I5LA 4ARZA 3R7WA 1S1YA 4KG5A 4GKUA 3U4LP 4NXBA 1PI5A 2ZD8A 1OTIA 2HDUA 4L9GA 4II7A 4JXWA 4MEZA 3IS2B 3KYQA 3O3VA 4NK3A 3HLCA 2JKTM 5EOOA 1XGIA 3T4TA 2WYXA 2QWSA 4FTXA 5TR7A 1L0GA 2EWWA 2L4RA 4JGRA 2ZLYA 5CX7A 3CAXA 2EFUA 1YSQA 4B88A 1KDWA 4D60A 4EESA 4YNRA 3CITA 5EM0A 2R9XA 3JVVA 4WEKA 1KGGA 3UB5P 4OPRA 2Y2MA 1H3QA 4QHCA 3HLWA 4GS9A 5AVFA 3UDIA 4HJ6A 4ETZA 1Z09A 4YINA 1W5DA 2V8FA 4H6JA 4JPMA 1NZUA 1N4OA 5KSHA 2Z2MB 1GHIA 3FYZA 3G6OA 4HOIA 1XX2A 5FI2A 1WA9A 3MFDA 3O87A 1MWSA 2ZM2A 3MSHA 3PXPA 2WADA 1IYSA 4JF5A 5CXWA 2VV8A 4WM9A 3V39A 3LGOA 1O7EA 3KSFA 3WS1A 5L09A 1D06A 2XR0A 1NJ4A 2NUTC 3R4KA 3BQAA 3MFXA 2VGLS 4UA7A 4BBTA 1IKGA 2H5SA 1DJAA 5FQJA 3GVBA 2ZQDA 5FSRA 4L9FA 4XT2B 2JN7A 3MXQA 1HLUP 1GHPA 1J9MA 3W4OA 2Z6DA 4X56A 2D02A 4KG6A 5E2EA 1LHYA 4IJGA 3A0RA 3W2ZA 4JF4A 2G2UA 1NRFA 4LRYC 4LPZA 4WMCD 2J3TC 2O9BA 2WGIA 3PR6A 2V1BA 4FCFA 2W0NA 4I39A 4UA6A 4LFUA 1E4DA 1WYCA 5IU1A 3WS5A 5EVLA 3Q82A 3SS5A 4PHTA 5HFOA 4O7DA 2WGWA 3WS0A 3PBQA 2I9VA 4EEUA 1W8QA 3UPOA 3CLOA 1YPRA 4DXCA 2HZ5A 1PI4A 1YAXA 3T4JA 1NYMA 1K4FA 2Y2OA 3ZHHA 3QP5A 3ZDJA 5M18A 4G3KA 3CWFA 3LI8A 1MKMA 1GHMA 2ZQ8A 3WRTA 2DMWA 2JKFA 2QMIA 3TOIA 2HF6A 1H8YA 3QP8A 3BFEA 3VMAA 3KX0X 2O9CA 5DTKA 4LCMA 2OWJA 2OOLA 3MZFA 1ES4A 1Y28A 2MJ6A 4BBVA 5TFQA 3IXBA 1D7EA 2W1TA 1ODVA 4WLAA 4JKTA 1ACFA 1MKIA 3IBJA 3EOIA 1PFLA 4KUKA 3DWKA 3S1YA 5CHUA 3LO7A 3BM6A 3OPHA 2B95A 5FA7A 1MWTA 2XH9A 3AGFA 5EVIC 4UEYA 1SKFA 2NUPC 4P6ZM 5K5BA 1UWPX 1ERMA 3EWKA 4OH0A 5A92A 4FD8A 3D72A 2AVXA 5F5YA 3UB7A 3AGDA 4E6XA 3MZEA 1P9WA 5GL9A 1CF0A 5CECA 3VFFA 2ZC4B 3ULFA 3MQOA 4CLCC 4JGOA 3TRCA 3HCYA 2W3EA 3LIDA 4LV2A 3EGXC 1PRQA 4OKPA 4EBPA 3LUQA 4H6JB 3LEQA 2LB9A 2VA0A 1IKIA 1LL5A 2HPBA 2C5WB 1TDLA 3IF6A 3NC8A 4PKYG 1L0DA 3ICYA 2JCHA 2R9WA 3Q07A 5KMWA 3ZNTA 4B4XA 4NXGA 2Y79A 3IF5A 1FCOA 5D3OA 4OQHA 3WS4A 3NIAA 2JE5A 3PBSA 4ZRRA 3GV9A 1K55A 1EW0A 1CEGA 2W3FA 3W4QA 3LR3A 4XUXA 2OLUA 3VOZA 2ZMAA 3MMHA 5AQBA 5DKKA 3EGDC 3IQAA 2BASA 3IBRA 1FILA 3A0VA 1E3UD 3H82A 3MBZA 3GSGA 1XFNA 2OV5A 5A8BA 1IEMA 5I94A 2J7VA 5CGXA 2E8IA 3Q1FA 2YKFA 3HLBA 1OT9A 3NI9A 3QHYA 4HI4A 2OAP1 2RCXA 4S2NC 2V9AA 5DFXA 3IHBA 5GLAA 4DXBA 2XROA 4WL9A 2Z2LB 4S2JA 3L7HA 1NZOA 5J7EA 1NYYA 3K3CA 4R1GA 4EEPA 1IYQA 1BT5A 3BY8A 2Y2JA 5F68A 4NXEA 3LYXA 1HZOA 3A3EA 4IBRA 2QJ5A 4MBHA 2WGWB 2PDRA 5DVAA 2YKHA 3AGEA 4CLCE 1ZG4A 1WE4A 2DRWA 3ZFZA 1MPLA 2XEPA 3C4OA 1IYOA 4BJPA 2OAQ1 2ZL1A 3KYEA 3UE3A 4GLQA 1JTDA 3TE8A 1AWIA 5DTSA 3T4OA 1IOUA 3HL9A 1F2KA 1G5UA 1U60A 4N92A 4S2KA 3T4QA 4R3JA 3CZDA 1OTBA 5EPHA 5A90A 5A91A 1M6KA 2L0WA 4DJ3A 2G7UA 4NXFA 1Y4OA 4DKIA 4MN6A 2W1TB 3CHWP 4KENB 4O01A 4BL2A 3C7UA 5L8MA 1GSXA 2J9PA 3NDGA 3S4XA 1XP4A 1C3BA 4N1HA 2CC1A 3B42A 3T1QB 4Z9QA 3PBRA 5KZHA 5F6AA 3ZQ5A 3UDXA 1CK3A 3VFHA 3NECA 3FG8A 2ZMFA 4QPRA 1M40A 1L3LA 4Z1WA 4S2IA 1S0WA 5U47A 2XA7M 1N9NA 2IA2A 3UE6A 2WK0A 3NOTC 2HP6A 2H28A 1K0KA 5HL1A 2B02A 3WWXA 4U3TA 1OMEA 3A0SA 4KUOA 2P04A 1RGYA 1TS0A 2EA9A 2J3WA 3K3DA 3VV4A 2O0YA 4EW7A 4DDSA 4QJGA 2D01A 2ZC5B 5EOEA 2EFXA 1KE0A 1FR6A 3C30A 2QJ7A 1KGFA 4MLLA 3IF6B 3A3JA 5DF7A 3UE1A 4KZ4A 2OSUA 3E4PA 4Y15A 3OZHA 5HPFA 1YLTA 2PR6A 4MMNA 2QYBA 2PBDP 1Q2PA 1F9IA 2O9AA 4A5RA 5HD3A 3NJAA 4RYEA 2P74A 2WKRA 4QU3A 2XLNA 3A3FA 4K0WA 1K25A 3A3IA 2R78A 3BQ8A 4BL3A 3W4PA 3UY6A 5EECA 1GSVA 4GNUA 5HDSA 1AXBA 2WKHA 1D1JA 4OP8A 3MXSA 4N9LA 4R4SA 4BBUA 3VE4A 2K31A 5DF8A 1XJ2A 3GR2A 1NWZA 4OOMA 4P0MA 4JBFA 4HNBA 2KOIA 4OOLA 3HVFA 1S4SA 3IWIA 3UE0A 1E25A 3F1OA 2XGNA 1OT6A 4E3IA 4CLCD 4BD0A 1XA7A 4WELA 3QP4A 4HH2A 1K54A 3KSGA 4HHDA 2VGLM 2WZXA 5C5KA 1K4EA 1YQSA 1P97A 1DY6A 1LT0A 2ZL1B 1CI9A 4JGPA 4GN2A 3LR4A 2LB5A 4MNRA 1N9OA 1GA9A 4KQRA 2HV1A 1DP6A 2XF3A 2VZWA 3G31A 5G4YA 1NLZA 1XA1A 1V9YA 1IFQA 3BFCA 5E2FA 3SZTA 3D3OA 4EUVA 4FH2A 3LIAA 2OWHA 4R3BA 5E2GA 3HJKA 1SHVA 1MC0A 3HBRA 2GNXA 1SDEA 2XFSA 2FFFB 1ES2A 3MKFA 1H8ZA 4DN0A 4Y17A 3E4QA 2RL3A 5AJGA 5HDCA 4K08A 4PAUA 3LR0A 3G34A 3O5YA 4KG2A 3Q7ZA 3TSGA 4JLFA 1YLJA 3I7JA 3C2WA 1JWVA 3TW8A 4Y7PA 1SCWA 3V3SA 4L9EA 1OJ5A 4E3KA 1H8MA 4B9OA 3F1PA 3ZCZA 3ZYTA 4EETB 5DJTA 3ISGA 4Q0JA 1H5XA 1ZTUA 4DE0A 4HP4A 1FCMA 2Z6CA 3QP1A 5AVEA 2HDSA 4D2OA 4C6YA 4DJ2A 2WKIA 5TBMA 2XK1A 2W3DA 3PBTA 3VOYA 4E3JA 5EVEA 1PNEA 5F69A 1K57A 3T1RA 3BLMA 1VHMA 3E0YA 1G28A 1T18A 5IT5A 1K38A 4IVKA 3ZG7B 2O99A 1TS7A 1S66L 4MBFA 1PZOA 4I3AA 4GCZA 1J3WA
chains in the Genus database with same CATH topology
1FCOA 1FSWA 5AQAA 5FQQA 5D3OA 5HW3A 4OQHA 3WS4A 5CEBA 3NIAA 2Q9MA 2JE5A 3PBSA 3RXXA 2VGJA 3SOIA 3GV9A 1K55A 3UPPA 1E3UA 1CEGA 1QMFA 1NY0A 3IH9A 3W4QA 2FFYA 3EQVA 2EXBA 1TVFA 2Y2HA 3LY3A 4KZ7A 4XUXA 2OLUA 3VOZA 2ZMAA 1L0FA 1ESIA 5AQBA 1IELA 4DF6A 3IQAA 4OVDA 1QMEA 4OOYA 4BQMA 4UAAA 2Y2NA 3OC2A 1E3UD 5F1FA 1LI0A 4KZBA 3CG5A 3MBZA 3GSGA 4XXRA 3WS2A 3M2KA 1ESUA 1ERQA 3N4IA 3LEZA 4LENA 2OV5A 2Y2PA 5CHJA 1MWUA 4ID4A 4KQOA 4OP5A 4UHUA 5FI7A 1YLZA 4CJNA 1IEMA 5I94A 2ZC6B 3V5MA 4ZDXA 2J7VA 5CGXA 1CI8A 2E8IA 4E6WA 2IWCA 4LV1A 5KSCA 2BG1A 2IWDA 3Q1FA 4IEDA 1BLHA 5HAQA 4CPKA 3HLBA 3NI9A 3O88A 3QHYA 4L0LA 2RCXA 3E2LA 4S2NC 3IHBA 2ZM8A 5GLAA 2Y4AA 4E3OA 4DXBA 4LCLA 2A3UA 3VP3A 1BZAA 3EQUA 3W8KA 5FDHA 2Z2LB 4S2JA 1NZOA 1XXMA 1NYYA 1TDGA 4R1GA 2V1ZA 1IYQA 3PAGA 2ZC3B 4GD6A 1BT5A 4HEFA 1GA0A 2VGKA 2Y2JA 3HUNA 4KZ3A 4N1XA 2EX6A 1RCJA 2B5RA 1HZOA 1CEFA 3B3XA 3A3EA 1KE4A 4JXSA 1Q2QA 4IBRA 5A93A 4R4RA 4JXGA 1YLPA 3FV7A 4FSFA 2ZM0A 4MBHA 2WGWB 1SDNA 2Y59A 3OCLA 5GLBA 5DVAA 5F1GA 1ALQA 4X69A 3RXWA 4HBUA 2ZQCA 3RJUA 5FAPA 3HLFA 3P98A 4B4ZA 3AGEA 4X55A 1ZG4A 1LI9A 4OPZA 1WE4A 5G18A 2DRWA 5GHYA 2BLSA 1BLSA 3ZFZA 3BEBA 1MPLA 3OPPA 4M3KA 3C5AA 4X53A 2XEPA 3Q81A 3C4OA 1IYOA 4X68A 4BJPA 2PBYA 3BFDA 3N8SA 4Y0TA 3UE3A 1L0EA 3ZG5A 3N6IA 4OLDA 3BRMA 4KZ8A 1JTDA 1VQQA 2J9OA 3IF5A 1KE3A 5DTSA 5EVIA 1ES5A 5L2FA 3ITAA 3V3RA 3HL9A 1YLWA 1FR1A 5IHVA 1MXOA 1U60A 3GRJA 4N92A 4S2KA 1VM1A 4WZ5C 4R3JA 3VSLA 3CZDA 5EPHA 2IWBA 3BFGA 2Y2QA 2G2WA 4OQ0A 3LCEA 4H8RA 5E43A 5FAOA 4BLMA 5A90A 1JWPA 3PBNA 4QB8A 1M6KA 5A91A 2QZ6A 3HLDA 4LV0A 5CTNA 5EVID 3LY4A 4OLGA 4C75A 1FQGA 3N8RA 3SS3A 2Y55A 5FQ9A 1DJBA 3ZG9B 2DCFA 1XKZA 1EROA 2ZC7A 4P6BA 3IHAA 4GD8A 4DKIA 1K54C 3FKWA 5AQ7A 3V50A 1MBLA 3PAEA 1KDSA 1RP5A 4KENB 3UPNA 5M1AA 2WUQA 4X6TA 2WKEA 4ZTKA 3TG9A 2ZQAA 1PW1A 2X71A 3C7UA 3UDFA 2J9PA 4WMCA 3ZG8B 4BL2A 3NDGA 5GLCA 3S4XA 1XP4A 1C3BA 3HUOA 4N1HA 4KG5A 1ZG6A 4GKUA 2CC1A 4RX3A 5E2HA 1EWZA 3PBRA 4Z9QA 1MY8A 5KZHA 3PTEA 3S22A 1PI5A 3BYDA 1NXYA 4ZBEA 3UDXA 1MWRA 5GLDA 2EX9A 1CK3A 2P9VA 2ZD8A 1YLYA 4OQGA 2HDUA 1BLPA 4MEZA 4JXWA 1W8YA 1Y54A 3O3VA 3VFHA 3UO9A 4PMAA 4NK3A 3HLCA 5EOOA 1XGIA 1M40A 4S2IA 1S0WA 5U47A 2HP5A 4ZJ3A 2WYXA 4Q8IA 3SH7A 3UNWA 4WEJA 2WK0A 5TR7A 1L0GA 2UWXA 1G6AA 1I2SA 3HLGA 2HP6A 2ZLYA 5EVIB 5HL1A 5JYOA 3WWXA 3WRZA 4YFMA 4U3TA 2EFUA 1DJCA 5FAQA 5HX9A 4EBLA 4EWFA 1OMEA 4B88A 4N9KA 4PM6A 5FQKA 1KDWA 4OONA 4IVIA 3VP0A 3PBOA 1RGYA 2R9XA 5CRFA 3DWZA 4BENA 4WEKA 1KGGA 3ZGAB 4DDSA 1O07A 4QJGA 3NDEA 2V2FF 4OPRA 3G2YA 2OLVA 2ZC5B 2Y2MA 3Q7VA 5EOEA 2EFXA 1KE0A 1FR6A 2WAFA 4QHCA 1N9BA 3ZG0A 3HLWA 4PM9A 4S2OA 1KGFA 1TEMA 4MLLA 3UDIA 3IF6B 2Y91A 3A3JA 4Y0OA 2QPNA 3CMZA 4NETA 5DF7A 4EBNA 1RGZA 2XFTA 4YINA 5CEDA 3UE1A 2HP9A 1S6RA 1W5DA 2GDNA 4F94A 3N8LA 5CHMA 5M19A 4KZ4A 4JPMA 1PW8A 3GQZA 1LLBA 1NZUA 3MXRA 1N4OA 1BTLA 3FKVA 2OSUA 4HESA 4S2NA 3OZHA 4EQIA 5KSHA 2Z2MB 1GHIA 3FYZA 1YLTA 1XX2A 5FI2A 3MFDA 3SH9A 4WYYA 3MKEA 1Q2PA 4A5RA 1FOFA 3O87A 1MWSA 2ZM2A 3O86A 3BECA 3DW0A 4RX2A 2P74A 4RYEA 3GTCA 4QU3A 2ZJ9A 2XLNA 1XGJA 2WADA 4P87A 1I5QA 1IYSA 4JF5A 5CXWA 3NY4A 3A3FA 4WM9A 1JWZA 4K0WA 1K25A 3V39A 1PIOA 1O7EA 3A3IA 3WS1A 4U0XA 4BL3A 1FSYA 2XR0A 3W4PA 3UY6A 5FATA 5HAIA 5GHXA 3VSKA 5EECA 3HLEA 4GNUA 1BLCA 3M2JA 3QNBA 1NJ4A 1AXBA 4P85A 2EX8A 2WKHA 5AQ9A 3ITBA 3IWQA 1ZKJA 2PU4A 5CGSA 3VP1A 4GDBA 4OP8A 4K0XA 4UA7A 2Y2IA 3MXSA 2C6WB 1IKGA 2H5SA 2XDMA 2H10A 1DJAA 5FQJA 3GVBA 4E3NA 4N9LA 3IF6C 4R4SA 2ZQDA 5GHZA 4C3QA 5FSRA 5CERA 1K57C 3OPRA 2Q9NA 4PM7A 4QD4A 5DF8A 3GR2A 1GHPA 4OOMA 4P0MA 5DTTA 1PWGA 1J9MA 3W4OA 4FH4A 4JBFA 5F83A 4X56A 4OOLA 4WZ5A 3HVFA 4KG6A 2EXAA 4OQIA 4WZ4A 5F82A 3IWIA 5E2EA 2PU2A 3UE0A 1LHYA 1E25A 4DE3A 1YMSA 4S2LA 5CTMA 2XGNA 4RA7A 5EUAA 2EX2A 4E3IA 3DTMA 4JF4A 1K55C 4BD0A 4PM5A 1KVLA 1XA7A 2G2UA 3VP4A 4WELA 1NRFA 4KQQA 4WMCD 2WGIA 1PWDA 4XUZA 3ZVTA 1K54A 4FCFA 2V20A 4UA6A 2WZXA 1E4DA 1WYCA 4GDNA 1WYBA 2Y2KA 1JVJA 1K4EA 4K91A 3WS5A 3MZDA 5EVLA 1YQSA 4EUZA 1DY6A 3Q82A 3SS5A 1I2WA 3ZNYA 5HFOA 1CI9A 4O7DA 2WGWA 4GN2A 1K6SA 4S2MA 3PBQA 3WS0A 4DE1A 4OPQA 5J8XA 3G2ZA 2I72A 3IXDA 1PYYA 1W8QA 3OPLA 4MNRA 4ZAMA 3UPOA 4DXCA 5FQMA 1PI4A 4QY6A 3VP2A 1YM1A 1NYMA 1GA9A 2Y2GA 4KQRA 3A3DA 1K4FA 2Y2OA 2XF3A 4UA9A 3G31A 3E2KA 3HREA 3P09A 1XA1A 3D4FA 3BFCA 3IXHA 3ZDJA 3ZHHA 4S2PA 5E2FA 3QNCA 5M18A 3IXGA 4DRTA 1GCEA 1GHMA 2ZQ8A 2XD1A 3C7VA 3WRTA 5JYPA 4FH2A 4ZJ2A 1ZC2A 3M6HA 2QMIA 4R3BA 3TOIA 5E2GA 1HTZA 2ZQ9A 1H8YA 3N7WA 4RVAA 3BFEA 3VMAA 1SHVA 2ZQ7A 5DTKA 5HAPA 3HBRA 1W7FA 1HVBA 4LCMA 5HARA 3MZFA 1ES4A 1SDEA 4Y0UA 5TFQA 2XFSA 3IXBA 3SS4A 5EE8A 2FFFB 3IH8A 1ES2A 4LV3A 4DE2A 2DNSA 3MKFA 1H8ZA 5BOHA 3NCKA 4KZAA 1PWCA 4JKTA 1MKIA 2P9VB 1EI5A 4KZ5A 1FCNA 1BULA 3IT9A 3DWKA 3S1YA 2Y2LA 2RL3A 5CHUA 4GB7A 1K6RA 3LO7A 3BM6A 3IWOA 3OPHA 5FA7A 2X02A 2J8YA 3FZCA 1MWTA 3CJMA 3G34A 2XH9A 4KG2A 3AGFA 3Q7ZA 3TSGA 5EVIC 1SKFA 1XPBA 1L2SA 1ERMA 4OH0A 4JLFA 5FASA 1YLJA 3I7JA 1JTGA 1YT4A 5A92A 3BFFA 4FD8A 3SH8A 3JYIA 1JWVA 2XD5A 3GMWA 4Y7PA 4E3MA 4EV4A 1SCWA 3V3SA 4OPYA 2WGVA 4E3KA 2H0YA 3AGDA 3ZCZA 4E6XA 3MZEA 4MBKA 1YMXA 3M6BA 3ZVWA 2HDQA 4QY5A 4PPRA 5GL9A 4DDYA 4R23A 1ONGA 2XQZA 2WZZA 4E3LA 5CGWA 3NBLA 4KZ6A 3ISGA 1BSGA 5CECA 1H5XA 3Q7VB 3OCNA 2ZC4B 3VFFA 1G68A 1HD8A 1K56A 4JF6A 2A49A 4DE0A 2WAEA 4LV2A 1PZPA 4HBTA 2JC7A 5FQIA 1FCMA 1W79A 2HDSA 3C4PA 3UN7A 4OKPA 4EBPA 2X01A 4D2OA 4WBGA 1KGEA 2HDRA 4C6YA 2WKIA 1LL9A 1K56D 2JBFA 2XK1A 3PBTA 3VOYA 3FWLA 4E3JA 2H0TA 1IKIA 1LL5A 2HPBA 2C5WB 3G30A 1TDLA 3IF6A 3NC8A 4KZ9A 1ES3A 3G32A 1L0DA 5TGFA 1K57A 5FI6A 2JCHA 3BLMA 3HUMA 4R0QA 4BD1A 2R9WA 1KVMA 3Q07A 1ONHA 1K38A 4GOGA 4U0TA 4IVKA 3ZG7B 3G35A 1Z6FA 5KMWA 4PM8A 4ZJ1A 1IYPA 3G4PA 4MBFA 3ZNTA 4B4XA 3BLSA 1PZOA 4IBXA 5DF9A 4JXVA 4GZBA 1BUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FCO A;  1FSW A;  5AQA A;  5FQQ A;  5D3O A;  5HW3 A;  4OQH A;  3WS4 A;  5CEB A;  3NIA A;  2Q9M A;  2JE5 A;  3PBS A;  3RXX A;  2VGJ A;  3SOI A;  3GV9 A;  1K55 A;  3UPP A;  1E3U A;  1CEG A;  1QMF A;  1NY0 A;  3IH9 A;  3W4Q A;  2FFY A;  3EQV A;  2EXB A;  1TVF A;  2Y2H A;  3LY3 A;  4KZ7 A;  4XUX A;  2OLU A;  3VOZ A;  2ZMA A;  1L0F A;  1ESI A;  5AQB A;  1IEL A;  4DF6 A;  3IQA A;  4OVD A;  1QME A;  4OOY A;  4BQM A;  4UAA A;  2Y2N A;  3OC2 A;  1E3U D;  5F1F A;  1LI0 A;  4KZB A;  3CG5 A;  3MBZ A;  3GSG A;  4XXR A;  3WS2 A;  3M2K A;  1ESU A;  1ERQ A;  3N4I A;  3LEZ A;  4LEN A;  2OV5 A;  2Y2P A;  5CHJ A;  1MWU A;  4ID4 A;  4KQO A;  4OP5 A;  4UHU A;  5FI7 A;  1YLZ A;  4CJN A;  1IEM A;  5I94 A;  2ZC6 B;  3V5M A;  4ZDX A;  2J7V A;  5CGX A;  1CI8 A;  2E8I A;  4E6W A;  2IWC A;  4LV1 A;  5KSC A;  2BG1 A;  2IWD A;  3Q1F A;  4IED A;  1BLH A;  5HAQ A;  4CPK A;  3HLB A;  3NI9 A;  3O88 A;  3QHY A;  4L0L A;  2RCX A;  3E2L A;  4S2N C;  3IHB A;  2ZM8 A;  5GLA A;  2Y4A A;  4E3O A;  4DXB A;  4LCL A;  2A3U A;  3VP3 A;  1BZA A;  3EQU A;  3W8K A;  5FDH A;  2Z2L B;  4S2J A;  1NZO A;  1XXM A;  1NYY A;  1TDG A;  4R1G A;  2V1Z A;  1IYQ A;  3PAG A;  2ZC3 B;  4GD6 A;  1BT5 A;  4HEF A;  1GA0 A;  2VGK A;  2Y2J A;  3HUN A;  4KZ3 A;  4N1X A;  2EX6 A;  1RCJ A;  2B5R A;  1HZO A;  1CEF A;  3B3X A;  3A3E A;  1KE4 A;  4JXS A;  1Q2Q A;  4IBR A;  5A93 A;  4R4R A;  4JXG A;  1YLP A;  3FV7 A;  4FSF A;  2ZM0 A;  4MBH A;  2WGW B;  1SDN A;  2Y59 A;  3OCL A;  5GLB A;  5DVA A;  5F1G A;  1ALQ A;  4X69 A;  3RXW A;  4HBU A;  2ZQC A;  3RJU A;  5FAP A;  3HLF A;  3P98 A;  4B4Z A;  3AGE A;  4X55 A;  1ZG4 A;  1LI9 A;  4OPZ A;  1WE4 A;  5G18 A;  2DRW A;  5GHY A;  2BLS A;  1BLS A;  3ZFZ A;  3BEB A;  1MPL A;  3OPP A;  4M3K A;  3C5A A;  4X53 A;  2XEP A;  3Q81 A;  3C4O A;  1IYO A;  4X68 A;  4BJP A;  2PBY A;  3BFD A;  3N8S A;  4Y0T A;  3UE3 A;  1L0E A;  3ZG5 A;  3N6I A;  4OLD A;  3BRM A;  4KZ8 A;  1JTD A;  1VQQ A;  2J9O A;  3IF5 A;  1KE3 A;  5DTS A;  5EVI A;  1ES5 A;  5L2F A;  3ITA A;  3V3R A;  3HL9 A;  1YLW A;  1FR1 A;  5IHV A;  1MXO A;  1U60 A;  3GRJ A;  4N92 A;  4S2K A;  1VM1 A;  4WZ5 C;  4R3J A;  3VSL A;  3CZD A;  5EPH A;  2IWB A;  3BFG A;  2Y2Q A;  2G2W A;  4OQ0 A;  3LCE A;  4H8R A;  5E43 A;  5FAO A;  4BLM A;  5A90 A;  1JWP A;  3PBN A;  4QB8 A;  1M6K A;  5A91 A;  2QZ6 A;  3HLD A;  4LV0 A;  5CTN A;  5EVI D;  3LY4 A;  4OLG A;  4C75 A;  1FQG A;  3N8R A;  3SS3 A;  2Y55 A;  5FQ9 A;  1DJB A;  3ZG9 B;  2DCF A;  1XKZ A;  1ERO A;  2ZC7 A;  4P6B A;  3IHA A;  4GD8 A;  4DKI A;  1K54 C;  3FKW A;  5AQ7 A;  3V50 A;  1MBL A;  3PAE A;  1KDS A;  1RP5 A;  4KEN B;  3UPN A;  5M1A A;  2WUQ A;  4X6T A;  2WKE A;  4ZTK A;  3TG9 A;  2ZQA A;  1PW1 A;  2X71 A;  3C7U A;  3UDF A;  2J9P A;  4WMC A;  3ZG8 B;  4BL2 A;  3NDG A;  5GLC A;  3S4X A;  1XP4 A;  1C3B A;  3HUO A;  4N1H A;  4KG5 A;  1ZG6 A;  4GKU A;  2CC1 A;  4RX3 A;  5E2H A;  1EWZ A;  3PBR A;  4Z9Q A;  1MY8 A;  5KZH A;  3PTE A;  3S22 A;  1PI5 A;  3BYD A;  1NXY A;  4ZBE A;  3UDX A;  1MWR A;  5GLD A;  2EX9 A;  1CK3 A;  2P9V A;  2ZD8 A;  1YLY A;  4OQG A;  2HDU A;  1BLP A;  4MEZ A;  4JXW A;  1W8Y A;  1Y54 A;  3O3V A;  3VFH A;  3UO9 A;  4PMA A;  4NK3 A;  3HLC A;  5EOO A;  1XGI A;  1M40 A;  4S2I A;  1S0W A;  5U47 A;  2HP5 A;  4ZJ3 A;  2WYX A;  4Q8I A;  3SH7 A;  3UNW A;  4WEJ A;  2WK0 A;  5TR7 A;  1L0G A;  2UWX A;  1G6A A;  1I2S A;  3HLG A;  2HP6 A;  2ZLY A;  5EVI B;  5HL1 A;  5JYO A;  3WWX A;  3WRZ A;  4YFM A;  4U3T A;  2EFU A;  1DJC A;  5FAQ A;  5HX9 A;  4EBL A;  4EWF A;  1OME A;  4B88 A;  4N9K A;  4PM6 A;  5FQK A;  1KDW A;  4OON A;  4IVI A;  3VP0 A;  3PBO A;  1RGY A;  2R9X A;  5CRF A;  3DWZ A;  4BEN A;  4WEK A;  1KGG A;  3ZGA B;  4DDS A;  1O07 A;  4QJG A;  3NDE A;  2V2F F;  4OPR A;  3G2Y A;  2OLV A;  2ZC5 B;  2Y2M A;  3Q7V A;  5EOE A;  2EFX A;  1KE0 A;  1FR6 A;  2WAF A;  4QHC A;  1N9B A;  3ZG0 A;  3HLW A;  4PM9 A;  4S2O A;  1KGF A;  1TEM A;  4MLL A;  3UDI A;  3IF6 B;  2Y91 A;  3A3J A;  4Y0O A;  2QPN A;  3CMZ A;  4NET A;  5DF7 A;  4EBN A;  1RGZ A;  2XFT A;  4YIN A;  5CED A;  3UE1 A;  2HP9 A;  1S6R A;  1W5D A;  2GDN A;  4F94 A;  3N8L A;  5CHM A;  5M19 A;  4KZ4 A;  4JPM A;  1PW8 A;  3GQZ A;  1LLB A;  1NZU A;  3MXR A;  1N4O A;  1BTL A;  3FKV A;  2OSU A;  4HES A;  4S2N A;  3OZH A;  4EQI A;  5KSH A;  2Z2M B;  1GHI A;  3FYZ A;  1YLT A;  1XX2 A;  5FI2 A;  3MFD A;  3SH9 A;  4WYY A;  3MKE A;  1Q2P A;  4A5R A;  1FOF A;  3O87 A;  1MWS A;  2ZM2 A;  3O86 A;  3BEC A;  3DW0 A;  4RX2 A;  2P74 A;  4RYE A;  3GTC A;  4QU3 A;  2ZJ9 A;  2XLN A;  1XGJ A;  2WAD A;  4P87 A;  1I5Q A;  1IYS A;  4JF5 A;  5CXW A;  3NY4 A;  3A3F A;  4WM9 A;  1JWZ A;  4K0W A;  1K25 A;  3V39 A;  1PIO A;  1O7E A;  3A3I A;  3WS1 A;  4U0X A;  4BL3 A;  1FSY A;  2XR0 A;  3W4P A;  3UY6 A;  5FAT A;  5HAI A;  5GHX A;  3VSK A;  5EEC A;  3HLE A;  4GNU A;  1BLC A;  3M2J A;  3QNB A;  1NJ4 A;  1AXB A;  4P85 A;  2EX8 A;  2WKH A;  5AQ9 A;  3ITB A;  3IWQ A;  1ZKJ A;  2PU4 A;  5CGS A;  3VP1 A;  4GDB A;  4OP8 A;  4K0X A;  4UA7 A;  2Y2I A;  3MXS A;  2C6W B;  1IKG A;  2H5S A;  2XDM A;  2H10 A;  1DJA A;  5FQJ A;  3GVB A;  4E3N A;  4N9L A;  3IF6 C;  4R4S A;  2ZQD A;  5GHZ A;  4C3Q A;  5FSR A;  5CER A;  1K57 C;  3OPR A;  2Q9N A;  4PM7 A;  4QD4 A;  5DF8 A;  3GR2 A;  1GHP A;  4OOM A;  4P0M A;  5DTT A;  1PWG A;  1J9M A;  3W4O A;  4FH4 A;  4JBF A;  5F83 A;  4X56 A;  4OOL A;  4WZ5 A;  3HVF A;  4KG6 A;  2EXA A;  4OQI A;  4WZ4 A;  5F82 A;  3IWI A;  5E2E A;  2PU2 A;  3UE0 A;  1LHY A;  1E25 A;  4DE3 A;  1YMS A;  4S2L A;  5CTM A;  2XGN A;  4RA7 A;  5EUA A;  2EX2 A;  4E3I A;  3DTM A;  4JF4 A;  1K55 C;  4BD0 A;  4PM5 A;  1KVL A;  1XA7 A;  2G2U A;  3VP4 A;  4WEL A;  1NRF A;  4KQQ A;  4WMC D;  2WGI A;  1PWD A;  4XUZ A;  3ZVT A;  1K54 A;  4FCF A;  2V20 A;  4UA6 A;  2WZX A;  1E4D A;  1WYC A;  4GDN A;  1WYB A;  2Y2K A;  1JVJ A;  1K4E A;  4K91 A;  3WS5 A;  3MZD A;  5EVL A;  1YQS A;  4EUZ A;  1DY6 A;  3Q82 A;  3SS5 A;  1I2W A;  3ZNY A;  5HFO A;  1CI9 A;  4O7D A;  2WGW A;  4GN2 A;  1K6S A;  4S2M A;  3PBQ A;  3WS0 A;  4DE1 A;  4OPQ A;  5J8X A;  3G2Z A;  2I72 A;  3IXD A;  1PYY A;  1W8Q A;  3OPL A;  4MNR A;  4ZAM A;  3UPO A;  4DXC A;  5FQM A;  1PI4 A;  4QY6 A;  3VP2 A;  1YM1 A;  1NYM A;  1GA9 A;  2Y2G A;  4KQR A;  3A3D A;  1K4F A;  2Y2O A;  2XF3 A;  4UA9 A;  3G31 A;  3E2K A;  3HRE A;  3P09 A;  1XA1 A;  3D4F A;  3BFC A;  3IXH A;  3ZDJ A;  3ZHH A;  4S2P A;  5E2F A;  3QNC A;  5M18 A;  3IXG A;  4DRT A;  1GCE A;  1GHM A;  2ZQ8 A;  2XD1 A;  3C7V A;  3WRT A;  5JYP A;  4FH2 A;  4ZJ2 A;  1ZC2 A;  3M6H A;  2QMI A;  4R3B A;  3TOI A;  5E2G A;  1HTZ A;  2ZQ9 A;  1H8Y A;  3N7W A;  4RVA A;  3BFE A;  3VMA A;  1SHV A;  2ZQ7 A;  5DTK A;  5HAP A;  3HBR A;  1W7F A;  1HVB A;  4LCM A;  5HAR A;  3MZF A;  1ES4 A;  1SDE A;  4Y0U A;  5TFQ A;  2XFS A;  3IXB A;  3SS4 A;  5EE8 A;  2FFF B;  3IH8 A;  1ES2 A;  4LV3 A;  4DE2 A;  2DNS A;  3MKF A;  1H8Z A;  5BOH A;  3NCK A;  4KZA A;  1PWC A;  4JKT A;  1MKI A;  2P9V B;  1EI5 A;  4KZ5 A;  1FCN A;  1BUL A;  3IT9 A;  3DWK A;  3S1Y A;  2Y2L A;  2RL3 A;  5CHU A;  4GB7 A;  1K6R A;  3LO7 A;  3BM6 A;  3IWO A;  3OPH A;  5FA7 A;  2X02 A;  2J8Y A;  3FZC A;  1MWT A;  3CJM A;  3G34 A;  2XH9 A;  4KG2 A;  3AGF A;  3Q7Z A;  3TSG A;  5EVI C;  1SKF A;  1XPB A;  1L2S A;  1ERM A;  4OH0 A;  4JLF A;  5FAS A;  1YLJ A;  3I7J A;  1JTG A;  1YT4 A;  5A92 A;  3BFF A;  4FD8 A;  3SH8 A;  3JYI A;  1JWV A;  2XD5 A;  3GMW A;  4Y7P A;  4E3M A;  4EV4 A;  1SCW A;  3V3S A;  4OPY A;  2WGV A;  4E3K A;  2H0Y A;  3AGD A;  3ZCZ A;  4E6X A;  3MZE A;  4MBK A;  1YMX A;  3M6B A;  3ZVW A;  2HDQ A;  4QY5 A;  4PPR A;  5GL9 A;  4DDY A;  4R23 A;  1ONG A;  2XQZ A;  2WZZ A;  4E3L A;  5CGW A;  3NBL A;  4KZ6 A;  3ISG A;  1BSG A;  5CEC A;  1H5X A;  3Q7V B;  3OCN A;  2ZC4 B;  3VFF A;  1G68 A;  1HD8 A;  1K56 A;  4JF6 A;  2A49 A;  4DE0 A;  2WAE A;  4LV2 A;  1PZP A;  4HBT A;  2JC7 A;  5FQI A;  1FCM A;  1W79 A;  2HDS A;  3C4P A;  3UN7 A;  4OKP A;  4EBP A;  2X01 A;  4D2O A;  4WBG A;  1KGE A;  2HDR A;  4C6Y A;  2WKI A;  1LL9 A;  1K56 D;  2JBF A;  2XK1 A;  3PBT A;  3VOY A;  3FWL A;  4E3J A;  2H0T A;  1IKI A;  1LL5 A;  2HPB A;  2C5W B;  3G30 A;  1TDL A;  3IF6 A;  3NC8 A;  4KZ9 A;  1ES3 A;  3G32 A;  1L0D A;  5TGF A;  1K57 A;  5FI6 A;  2JCH A;  3BLM A;  3HUM A;  4R0Q A;  4BD1 A;  2R9W A;  1KVM A;  3Q07 A;  1ONH A;  1K38 A;  4GOG A;  4U0T A;  4IVK A;  3ZG7 B;  3G35 A;  1Z6F A;  5KMW A;  4PM8 A;  4ZJ1 A;  1IYP A;  3G4P A;  4MBF A;  3ZNT A;  4B4X A;  3BLS A;  1PZO A;  4IBX A;  5DF9 A;  4JXV A;  4GZB A;  1BUE A; 
#chains in the Genus database with same CATH topology
 4G3W A;  4O8G A;  1P0Z A;  1TD5 A;  3UPP A;  1NY0 A;  3EQV A;  4KZ7 A;  1L0F A;  1IEL A;  1QME A;  3DTK A;  3CUE A;  2PHY A;  1LI0 A;  4KZB A;  3F1N A;  3WS2 A;  1ESU A;  1ERQ A;  3LEZ A;  1T1B A;  4R3A A;  4UHU A;  1YLZ A;  4CJN A;  5HPI A;  2ZC6 B;  4ZDX A;  4E6W A;  2BG1 A;  2KLI A;  1BLH A;  4F3L A;  2ZM8 A;  3F1O B;  4LCL A;  3VE3 A;  5FDH A;  3UMD A;  2HJ9 C;  3UB6 A;  5HZH A;  1GA0 A;  3RTY A;  3C8C A;  1RCJ A;  2B5R A;  1CEF A;  3B3X A;  1YLP A;  3FV7 A;  4FSF A;  2ZM0 A;  3OBF A;  5GLB A;  2INW A;  2ZBB A;  3RJU A;  5FAP A;  4CQH A;  3HLF A;  4B4Z A;  4IUK A;  1LI9 A;  4OPZ A;  5G18 A;  3BEB A;  3OPP A;  4O0P A;  4X68 A;  3N8S A;  5MC7 A;  3N6I A;  3BJN A;  1KE3 A;  5L2F A;  3B47 A;  3VSL A;  2IWB A;  3BFG A;  4H8R A;  3PBN A;  2FZ0 A;  4AFI A;  2GJ3 A;  4OLG A;  1FQG A;  2Y55 A;  3ZG9 B;  2ZC7 A;  1TS8 A;  5HL6 A;  3IHA A;  5FEF A;  3FKW A;  4LRX C;  3PAE A;  2V0U A;  3LFV A;  1KDS A;  1S1Z A;  3UPN A;  1STZ A;  5M1A A;  2WUQ A;  4ZTK A;  3UDF A;  2X71 A;  4WMC A;  2E8J A;  3L9K A;  1ZG6 A;  4RX3 A;  1W63 M;  5E2H A;  2HJE A;  3PTE A;  3S22 A;  5HWV A;  4E04 A;  4ZBE A;  1NXY A;  1MWR A;  1VEU A;  2EX9 A;  2P9V A;  1Y54 A;  2M7U A;  3UO9 A;  1SKO A;  3FC7 A;  3F1P B;  1TS6 A;  4ZJ3 A;  4Q8I A;  1UWN X;  3EEH A;  3UNW A;  4WEJ A;  3LIF A;  1G6A A;  1I2S A;  5FDS A;  5EVI B;  5JYO A;  3LI9 A;  3JVU A;  2ZOH A;  4MDZ A;  2GZA A;  5FAQ A;  4EBL A;  5J4E A;  1XJ4 A;  4PM6 A;  5FQK A;  4OON A;  3VP0 A;  4Q0I A;  1JNU A;  3PBO A;  3T12 B;  1LSW A;  2XRN A;  3GDI A;  1DRM A;  1BYW A;  5TBM B;  3G2Y A;  2OLV A;  3Q7V A;  3ZG0 A;  5LBR A;  1N9B A;  4P6Z S;  2Y91 A;  2QPN A;  4NET A;  4EBN A;  2XFT A;  4UQI M;  2CMN A;  2HP9 A;  1S6R A;  2GDN A;  4F94 A;  3N8L A;  5CHM A;  5M19 A;  3P01 A;  1YSP A;  3GQZ A;  1LLB A;  3MXR A;  1BTL A;  3FKV A;  4HES A;  1G6O A;  4EQI A;  2PRF A;  3SH9 A;  4WYY A;  1OPX A;  1VET A;  1FOF A;  1OTA A;  3BEC A;  2WKP A;  3DW0 A;  4RX2 A;  1NRJ A;  3GTC A;  2ZJ9 A;  4P87 A;  1XGJ A;  4Y3I A;  3NY4 A;  4MN5 A;  4Q0H A;  2VJW A;  1JWZ A;  3F1N B;  2QKP A;  5HAI A;  5GHX A;  3HLE A;  1BLC A;  4GHI B;  4P85 A;  3QNB A;  3H7W A;  3IWQ A;  2KX6 A;  1ZKJ A;  5CGS A;  4GDB A;  4K0X A;  2C6W B;  2H10 A;  4F3L B;  3IF6 C;  4NKP A;  5CER A;  4PM7 A;  3VOL A;  2VK3 A;  5DTT A;  4WZ5 A;  4YWZ A;  2EXA A;  4WZ4 A;  2PU2 A;  1YMS A;  4S2L A;  5CTM A;  5EUA A;  2EX2 A;  2FH5 A;  3DTM A;  4PM5 A;  1K55 C;  3VP4 A;  4KQQ A;  1NLY A;  2V20 A;  1WYB A;  2Y2K A;  3MZD A;  4ESP A;  3ZNY A;  3OOV A;  2EWV A;  2I72 A;  3IXD A;  5HDD A;  3OPL A;  1YM1 A;  5FEG A;  2Y2G A;  3A3D A;  1T1A A;  3E2K A;  1FIK A;  3DTE A;  3T1X A;  3D4F A;  3IXH A;  3IX4 A;  3IXG A;  5HWW A;  2ACG A;  2JHE A;  2XD1 A;  3C7V A;  3T1S A;  2WKQ A;  1X0O A;  1HTZ A;  2PYP A;  2ZQ9 A;  3N7W A;  4RVA A;  4HY8 A;  5KIZ A;  5HAP A;  1W7F A;  1HVB A;  5HAR A;  4Y0U A;  3T50 A;  3LIB A;  4LV3 A;  4DE2 A;  2DNS A;  3EEA A;  4ETX A;  3NCK A;  4KZA A;  1PWC A;  1VEU B;  2P9V B;  1FCN A;  3QP2 A;  4GB7 A;  1K6R A;  1SKO B;  3FZC A;  3CJM A;  3MR0 A;  4KQD A;  1KOU A;  1L2S A;  2VV7 A;  1SZV A;  5FAS A;  5EM1 A;  1JTG A;  3BFF A;  3MQQ A;  3JYI A;  4E3M A;  4EV4 A;  4OPY A;  2WGV A;  3FPV A;  3M6B A;  4PPR A;  4R23 A;  2XQZ A;  2WZZ A;  4E3L A;  4KZ6 A;  5DJU A;  3Q7V B;  3OCN A;  4GJ4 A;  1HD8 A;  1K56 A;  1LL8 A;  2VKS A;  4JF6 A;  1W63 Q;  2WAE A;  4EER A;  1PZP A;  4ME4 A;  2JC7 A;  3LR5 A;  1W79 A;  3C4P A;  4Y5F A;  3BWL A;  2JBF A;  3FWL A;  3CPT A;  2XA7 S;  1ES3 A;  3G32 A;  5TGF A;  1MZU A;  3HUM A;  1VET B;  1KVM A;  1H0M A;  1ONH A;  4GOG A;  3NUL A;  1Z6F A;  4DMZ A;  4PM8 A;  3BLS A;  4IBX A;  5DF9 A;  4GZB A;  1BUE A;  1FSW A;  5AQA A;  5FQQ A;  5HW3 A;  5CEB A;  2VGJ A;  3IH9 A;  2FFY A;  1F98 A;  4B93 A;  1TVF A;  3RFB A;  2Y2H A;  3LY3 A;  3H7W B;  1ESI A;  4DF6 A;  2ZOI A;  4WN5 A;  4G3V A;  4BQM A;  4Y2F A;  2Y2N A;  3IX3 A;  3OC2 A;  5F1F A;  3N4I A;  5CHJ A;  1MWU A;  5FI7 A;  4OP5 A;  2L1M A;  2W3H A;  4HIA A;  3V5M A;  1CI8 A;  5KSC A;  2IWD A;  4HH3 A;  1CQA A;  1GSW A;  4E3O A;  2Y4A A;  1BZA A;  3EQU A;  3W8K A;  3QP6 A;  4NG2 A;  1TDG A;  3K2N A;  3PAG A;  2ZC3 B;  4GD6 A;  4HEF A;  2VGK A;  4N1X A;  2A2L A;  1CJF A;  1N9L A;  1Q2Q A;  4JXS A;  1VB6 A;  5HWT A;  4R4R A;  4JXG A;  1ZHH B;  1SDN A;  2Y59 A;  2Y8H A;  1ALQ A;  4X69 A;  4I3J A;  5HSQ A;  1S4R A;  4HBU A;  2A24 B;  4MCW A;  2P08 A;  5GHY A;  2BLS A;  1BLS A;  3Q81 A;  1L0E A;  3V67 A;  4OLD A;  4KZ8 A;  1VQQ A;  2J9O A;  5EVI A;  2P7J A;  1XFQ A;  3KO6 A;  3V3R A;  1YLW A;  1FR1 A;  5IHV A;  4PKY A;  3GRJ A;  1VM1 A;  3PYP A;  3UME A;  2G2W A;  4OQ0 A;  3LCE A;  3MJQ A;  4QB8 A;  3HLD A;  2J80 A;  5CTN A;  4C75 A;  3S7N A;  2HGV A;  2PD7 A;  3SS3 A;  5EV0 A;  2DCF A;  4X25 A;  4MN7 A;  1K54 C;  4QWO A;  5AQ7 A;  3V50 A;  1MBL A;  1RP5 A;  2Q0O A;  4CLC A;  4X6T A;  2WKE A;  2ZQA A;  1PW1 A;  3ZG8 B;  5GLC A;  1LSV A;  3HUO A;  4YOF A;  1EWZ A;  1MY8 A;  4FUW A;  4NEE D;  3BYD A;  5GLD A;  1YLY A;  4OQG A;  1BLP A;  1W8Y A;  4PMA A;  2JKG A;  3S7P A;  2HP5 A;  3SH7 A;  4FOF A;  3T4S A;  2UWX A;  3DTI A;  3HLG A;  3UB8 A;  4EXO A;  3JPU A;  1UGU A;  3WRZ A;  4YFM A;  1DJC A;  4GHI A;  5HX9 A;  4EWF A;  4N9K A;  3LIE A;  4IVI A;  2M1C A;  5CRF A;  4R70 A;  3DWZ A;  5IS1 A;  3P7N A;  4BEN A;  3ZGA B;  1O07 A;  3NDE A;  2V2F F;  3KSI A;  2WAF A;  2JKR I;  3CPT B;  4PM9 A;  4S2O A;  1TEM A;  2K7S A;  4Y0O A;  3CMZ A;  1LSX A;  1P9R A;  5HD5 A;  1RGZ A;  5CED A;  3C38 A;  4ARZ B;  3MQ0 A;  3R7W B;  1PW8 A;  3H9W A;  4S2N A;  4X1M A;  3MKE A;  3S7O A;  2ZMV A;  3O86 A;  1I5Q A;  2W3G A;  4EU0 A;  5DFY A;  3CI6 A;  1PIO A;  2BTF P;  4U0X A;  2UV0 E;  1FSY A;  5FAT A;  3VSK A;  3M2J A;  5AQ9 A;  2EX8 A;  3ITB A;  2PU4 A;  3VP1 A;  2Y2I A;  2XDM A;  4E3N A;  5GHZ A;  4C3Q A;  1K57 C;  3OPR A;  2Q9N A;  4I5S A;  4QD4 A;  4GS9 B;  3OLO A;  1PWG A;  4FH4 A;  5EFW A;  5F83 A;  3SW1 A;  2PAV P;  2K2N A;  4M4X A;  4OQI A;  5F82 A;  4DE3 A;  4RA7 A;  1OJG A;  1KVL A;  1PWD A;  4XUZ A;  3ZVT A;  4GDN A;  3CUE C;  1JVJ A;  3MF0 A;  4R6L A;  4K91 A;  4EUZ A;  3U2A A;  1I2W A;  3PHY A;  4S2M A;  1K6S A;  4DE1 A;  5J8X A;  4OPQ A;  3G2Z A;  4JGQ A;  1PYY A;  4ZAM A;  5FQM A;  4QY6 A;  3VP2 A;  4UA9 A;  3HRE A;  3P09 A;  4S2P A;  3NOP C;  1OTD A;  3QNC A;  2W27 A;  5J3W A;  4DRT A;  1GCE A;  5JYP A;  4ZJ2 A;  1ZC2 A;  3M6H A;  3RH8 B;  3E4O A;  4CLC B;  2ZQ7 A;  3GEC A;  3SS4 A;  5EE8 A;  2JKR M;  3IH8 A;  3NHQ A;  5BOH A;  4KZ5 A;  1EI5 A;  1BUL A;  3IT9 A;  4BMW A;  2Y2L A;  5DKL A;  1DP9 A;  3IWO A;  2X02 A;  2J8Y A;  1YKD A;  1A0K A;  1XPB A;  2GX5 A;  1YT4 A;  3SH8 A;  2XD5 A;  3GMW A;  3IS2 A;  2H0Y A;  4IHQ A;  4MBK A;  1YMX A;  3ZVW A;  2HDQ A;  4QY5 A;  4DDY A;  2V8C A;  2QHK A;  1ONG A;  2V1A A;  3KYZ A;  4X1L A;  5CGW A;  3NBL A;  1XJ6 A;  2PR5 A;  4IUH A;  1BSG A;  3KSH A;  3UB9 A;  5TJJ A;  1G68 A;  1OTE A;  2B18 A;  2A49 A;  3T4L A;  4EQ1 A;  4HBT A;  5FQI A;  2VLG A;  3UN7 A;  2X01 A;  4WBG A;  1KGE A;  2HDR A;  2PYR A;  2V0W A;  1LL9 A;  1K56 D;  1XJ3 A;  2PT7 A;  2H0T A;  3G30 A;  4KZ9 A;  5FI6 A;  2VEA A;  4R0Q A;  4BD1 A;  3NOU C;  4U0T A;  3G35 A;  4ZJ1 A;  1IYP A;  3G4P A;  2JKT I;  3TJZ C;  4JXV A;  4I3I A;  3IX8 A;  2Q9M A;  3RXX A;  3SOI A;  1E3U A;  1QMF A;  2A24 A;  2EXB A;  4OVD A;  3LIC A;  4OOY A;  4UQI S;  2VX8 A;  1F5M A;  5G4Z A;  4UAA A;  3CG5 A;  3DAV A;  2J3T D;  1TF1 A;  4XXR A;  3M2K A;  3BW6 A;  4GW9 A;  4LEN A;  1T1C A;  2Y2P A;  4ID4 A;  4KQO A;  4WUJ A;  1T19 A;  4HJ4 A;  2IWC A;  4LV1 A;  4Y13 A;  4IED A;  5HAQ A;  1S67 L;  3MS6 A;  4CPK A;  3O88 A;  4L0L A;  3E2L A;  5L07 A;  2A3U A;  3VP3 A;  4I38 A;  3T4K A;  4XT2 A;  3DBA A;  1XXM A;  4LLO B;  2V1Z A;  3BY9 A;  3E98 A;  3HUN A;  4KZ3 A;  2EX6 A;  1KE4 A;  3D9Y A;  5A93 A;  2XSS A;  3FPW A;  3OCL A;  1V9Z A;  3HJI A;  5F1G A;  3RXW A;  2ZQC A;  3P98 A;  4X55 A;  2KDK A;  3S7Q A;  4HQA A;  4BWI A;  4RQ9 A;  4R38 A;  2VV6 A;  4M3K A;  3C5A A;  4X53 A;  2PBY A;  3BFD A;  4LGW A;  4Y0T A;  3ZG5 A;  3B33 A;  3BRM A;  3H82 B;  1ES5 A;  4HJ3 A;  3ITA A;  5L10 A;  1MXO A;  4WF0 A;  4WZ5 C;  2PD8 A;  2Y2Q A;  5E43 A;  5FAO A;  4BLM A;  1JWP A;  2QZ6 A;  4LV0 A;  4LRZ E;  5EVI D;  3LY4 A;  3N8R A;  5FQ9 A;  1DJB A;  1XKZ A;  1ERO A;  4P6B A;  1DP8 A;  4GD8 A;  5FL3 A;  3TG9 A;  2W1R A;  2M7V A;  4HP9 A;  5I5L A;  4ARZ A;  3R7W A;  1S1Y A;  4KG5 A;  4GKU A;  3U4L P;  4NXB A;  1PI5 A;  2ZD8 A;  1OTI A;  2HDU A;  4L9G A;  4II7 A;  4JXW A;  4MEZ A;  3IS2 B;  3KYQ A;  3O3V A;  4NK3 A;  3HLC A;  2JKT M;  5EOO A;  1XGI A;  3T4T A;  2WYX A;  2QWS A;  4FTX A;  5TR7 A;  1L0G A;  2EWW A;  2L4R A;  4JGR A;  2ZLY A;  5CX7 A;  3CAX A;  2EFU A;  1YSQ A;  4B88 A;  1KDW A;  4D60 A;  4EES A;  4YNR A;  3CIT A;  5EM0 A;  2R9X A;  3JVV A;  4WEK A;  1KGG A;  3UB5 P;  4OPR A;  2Y2M A;  1H3Q A;  4QHC A;  3HLW A;  4GS9 A;  5AVF A;  3UDI A;  4HJ6 A;  4ETZ A;  1Z09 A;  4YIN A;  1W5D A;  2V8F A;  4H6J A;  4JPM A;  1NZU A;  1N4O A;  5KSH A;  2Z2M B;  1GHI A;  3FYZ A;  3G6O A;  4HOI A;  1XX2 A;  5FI2 A;  1WA9 A;  3MFD A;  3O87 A;  1MWS A;  2ZM2 A;  3MSH A;  3PXP A;  2WAD A;  1IYS A;  4JF5 A;  5CXW A;  2VV8 A;  4WM9 A;  3V39 A;  3LGO A;  1O7E A;  3KSF A;  3WS1 A;  5L09 A;  1D06 A;  2XR0 A;  1NJ4 A;  2NUT C;  3R4K A;  3BQA A;  3MFX A;  2VGL S;  4UA7 A;  4BBT A;  1IKG A;  2H5S A;  1DJA A;  5FQJ A;  3GVB A;  2ZQD A;  5FSR A;  4L9F A;  4XT2 B;  2JN7 A;  3MXQ A;  1HLU P;  1GHP A;  1J9M A;  3W4O A;  2Z6D A;  4X56 A;  2D02 A;  4KG6 A;  5E2E A;  1LHY A;  4IJG A;  3A0R A;  3W2Z A;  4JF4 A;  2G2U A;  1NRF A;  4LRY C;  4LPZ A;  4WMC D;  2J3T C;  2O9B A;  2WGI A;  3PR6 A;  2V1B A;  4FCF A;  2W0N A;  4I39 A;  4UA6 A;  4LFU A;  1E4D A;  1WYC A;  5IU1 A;  3WS5 A;  5EVL A;  3Q82 A;  3SS5 A;  4PHT A;  5HFO A;  4O7D A;  2WGW A;  3WS0 A;  3PBQ A;  2I9V A;  4EEU A;  1W8Q A;  3UPO A;  3CLO A;  1YPR A;  4DXC A;  2HZ5 A;  1PI4 A;  1YAX A;  3T4J A;  1NYM A;  1K4F A;  2Y2O A;  3ZHH A;  3QP5 A;  3ZDJ A;  5M18 A;  4G3K A;  3CWF A;  3LI8 A;  1MKM A;  1GHM A;  2ZQ8 A;  3WRT A;  2DMW A;  2JKF A;  2QMI A;  3TOI A;  2HF6 A;  1H8Y A;  3QP8 A;  3BFE A;  3VMA A;  3KX0 X;  2O9C A;  5DTK A;  4LCM A;  2OWJ A;  2OOL A;  3MZF A;  1ES4 A;  1Y28 A;  2MJ6 A;  4BBV A;  5TFQ A;  3IXB A;  1D7E A;  2W1T A;  1ODV A;  4WLA A;  4JKT A;  1ACF A;  1MKI A;  3IBJ A;  3EOI A;  1PFL A;  4KUK A;  3DWK A;  3S1Y A;  5CHU A;  3LO7 A;  3BM6 A;  3OPH A;  2B95 A;  5FA7 A;  1MWT A;  2XH9 A;  3AGF A;  5EVI C;  4UEY A;  1SKF A;  2NUP C;  4P6Z M;  5K5B A;  1UWP X;  1ERM A;  3EWK A;  4OH0 A;  5A92 A;  4FD8 A;  3D72 A;  2AVX A;  5F5Y A;  3UB7 A;  3AGD A;  4E6X A;  3MZE A;  1P9W A;  5GL9 A;  1CF0 A;  5CEC A;  3VFF A;  2ZC4 B;  3ULF A;  3MQO A;  4CLC C;  4JGO A;  3TRC A;  3HCY A;  2W3E A;  3LID A;  4LV2 A;  3EGX C;  1PRQ A;  4OKP A;  4EBP A;  3LUQ A;  4H6J B;  3LEQ A;  2LB9 A;  2VA0 A;  1IKI A;  1LL5 A;  2HPB A;  2C5W B;  1TDL A;  3IF6 A;  3NC8 A;  4PKY G;  1L0D A;  3ICY A;  2JCH A;  2R9W A;  3Q07 A;  5KMW A;  3ZNT A;  4B4X A;  4NXG A;  2Y79 A;  3IF5 A;  1FCO A;  5D3O A;  4OQH A;  3WS4 A;  3NIA A;  2JE5 A;  3PBS A;  4ZRR A;  3GV9 A;  1K55 A;  1EW0 A;  1CEG A;  2W3F A;  3W4Q A;  3LR3 A;  4XUX A;  2OLU A;  3VOZ A;  2ZMA A;  3MMH A;  5AQB A;  5DKK A;  3EGD C;  3IQA A;  2BAS A;  3IBR A;  1FIL A;  3A0V A;  1E3U D;  3H82 A;  3MBZ A;  3GSG A;  1XFN A;  2OV5 A;  5A8B A;  1IEM A;  5I94 A;  2J7V A;  5CGX A;  2E8I A;  3Q1F A;  2YKF A;  3HLB A;  1OT9 A;  3NI9 A;  3QHY A;  4HI4 A;  2OAP 1;  2RCX A;  4S2N C;  2V9A A;  5DFX A;  3IHB A;  5GLA A;  4DXB A;  2XRO A;  4WL9 A;  2Z2L B;  4S2J A;  3L7H A;  1NZO A;  5J7E A;  1NYY A;  3K3C A;  4R1G A;  4EEP A;  1IYQ A;  1BT5 A;  3BY8 A;  2Y2J A;  5F68 A;  4NXE A;  3LYX A;  1HZO A;  3A3E A;  4IBR A;  2QJ5 A;  4MBH A;  2WGW B;  2PDR A;  5DVA A;  2YKH A;  3AGE A;  4CLC E;  1ZG4 A;  1WE4 A;  2DRW A;  3ZFZ A;  1MPL A;  2XEP A;  3C4O A;  1IYO A;  4BJP A;  2OAQ 1;  2ZL1 A;  3KYE A;  3UE3 A;  4GLQ A;  1JTD A;  3TE8 A;  1AWI A;  5DTS A;  3T4O A;  1IOU A;  3HL9 A;  1F2K A;  1G5U A;  1U60 A;  4N92 A;  4S2K A;  3T4Q A;  4R3J A;  3CZD A;  1OTB A;  5EPH A;  5A90 A;  5A91 A;  1M6K A;  2L0W A;  4DJ3 A;  2G7U A;  4NXF A;  1Y4O A;  4DKI A;  4MN6 A;  2W1T B;  3CHW P;  4KEN B;  4O01 A;  4BL2 A;  3C7U A;  5L8M A;  1GSX A;  2J9P A;  3NDG A;  3S4X A;  1XP4 A;  1C3B A;  4N1H A;  2CC1 A;  3B42 A;  3T1Q B;  4Z9Q A;  3PBR A;  5KZH A;  5F6A A;  3ZQ5 A;  3UDX A;  1CK3 A;  3VFH A;  3NEC A;  3FG8 A;  2ZMF A;  4QPR A;  1M40 A;  1L3L A;  4Z1W A;  4S2I A;  1S0W A;  5U47 A;  2XA7 M;  1N9N A;  2IA2 A;  3UE6 A;  2WK0 A;  3NOT C;  2HP6 A;  2H28 A;  1K0K A;  5HL1 A;  2B02 A;  3WWX A;  4U3T A;  1OME A;  3A0S A;  4KUO A;  2P04 A;  1RGY A;  1TS0 A;  2EA9 A;  2J3W A;  3K3D A;  3VV4 A;  2O0Y A;  4EW7 A;  4DDS A;  4QJG A;  2D01 A;  2ZC5 B;  5EOE A;  2EFX A;  1KE0 A;  1FR6 A;  3C30 A;  2QJ7 A;  1KGF A;  4MLL A;  3IF6 B;  3A3J A;  5DF7 A;  3UE1 A;  4KZ4 A;  2OSU A;  3E4P A;  4Y15 A;  3OZH A;  5HPF A;  1YLT A;  2PR6 A;  4MMN A;  2QYB A;  2PBD P;  1Q2P A;  1F9I A;  2O9A A;  4A5R A;  5HD3 A;  3NJA A;  4RYE A;  2P74 A;  2WKR A;  4QU3 A;  2XLN A;  3A3F A;  4K0W A;  1K25 A;  3A3I A;  2R78 A;  3BQ8 A;  4BL3 A;  3W4P A;  3UY6 A;  5EEC A;  1GSV A;  4GNU A;  5HDS A;  1AXB A;  2WKH A;  1D1J A;  4OP8 A;  3MXS A;  4N9L A;  4R4S A;  4BBU A;  3VE4 A;  2K31 A;  5DF8 A;  1XJ2 A;  3GR2 A;  1NWZ A;  4OOM A;  4P0M A;  4JBF A;  4HNB A;  2KOI A;  4OOL A;  3HVF A;  1S4S A;  3IWI A;  3UE0 A;  1E25 A;  3F1O A;  2XGN A;  1OT6 A;  4E3I A;  4CLC D;  4BD0 A;  1XA7 A;  4WEL A;  3QP4 A;  4HH2 A;  1K54 A;  3KSG A;  4HHD A;  2VGL M;  2WZX A;  5C5K A;  1K4E A;  1YQS A;  1P97 A;  1DY6 A;  1LT0 A;  2ZL1 B;  1CI9 A;  4JGP A;  4GN2 A;  3LR4 A;  2LB5 A;  4MNR A;  1N9O A;  1GA9 A;  4KQR A;  2HV1 A;  1DP6 A;  2XF3 A;  2VZW A;  3G31 A;  5G4Y A;  1NLZ A;  1XA1 A;  1V9Y A;  1IFQ A;  3BFC A;  5E2F A;  3SZT A;  3D3O A;  4EUV A;  4FH2 A;  3LIA A;  2OWH A;  4R3B A;  5E2G A;  3HJK A;  1SHV A;  1MC0 A;  3HBR A;  2GNX A;  1SDE A;  2XFS A;  2FFF B;  1ES2 A;  3MKF A;  1H8Z A;  4DN0 A;  4Y17 A;  3E4Q A;  2RL3 A;  5AJG A;  5HDC A;  4K08 A;  4PAU A;  3LR0 A;  3G34 A;  3O5Y A;  4KG2 A;  3Q7Z A;  3TSG A;  4JLF A;  1YLJ A;  3I7J A;  3C2W A;  1JWV A;  3TW8 A;  4Y7P A;  1SCW A;  3V3S A;  4L9E A;  1OJ5 A;  4E3K A;  1H8M A;  4B9O A;  3F1P A;  3ZCZ A;  3ZYT A;  4EET B;  5DJT A;  3ISG A;  4Q0J A;  1H5X A;  1ZTU A;  4DE0 A;  4HP4 A;  1FCM A;  2Z6C A;  3QP1 A;  5AVE A;  2HDS A;  4D2O A;  4C6Y A;  4DJ2 A;  2WKI A;  5TBM A;  2XK1 A;  2W3D A;  3PBT A;  3VOY A;  4E3J A;  5EVE A;  1PNE A;  5F69 A;  1K57 A;  3T1R A;  3BLM A;  1VHM A;  3E0Y A;  1G28 A;  1T18 A;  5IT5 A;  1K38 A;  4IVK A;  3ZG7 B;  2O99 A;  1TS7 A;  1S66 L;  4MBF A;  1PZO A;  4I3A A;  4GCZ A;  1J3W A; 
#chains in the Genus database with same CATH homology
 1FCO A;  1FSW A;  5AQA A;  5FQQ A;  5D3O A;  5HW3 A;  4OQH A;  3WS4 A;  5CEB A;  3NIA A;  2Q9M A;  2JE5 A;  3PBS A;  3RXX A;  2VGJ A;  3SOI A;  3GV9 A;  1K55 A;  3UPP A;  1E3U A;  1CEG A;  1QMF A;  1NY0 A;  3IH9 A;  3W4Q A;  2FFY A;  3EQV A;  2EXB A;  1TVF A;  2Y2H A;  3LY3 A;  4KZ7 A;  4XUX A;  2OLU A;  3VOZ A;  2ZMA A;  1L0F A;  1ESI A;  5AQB A;  1IEL A;  4DF6 A;  3IQA A;  4OVD A;  1QME A;  4OOY A;  4BQM A;  4UAA A;  2Y2N A;  3OC2 A;  1E3U D;  5F1F A;  1LI0 A;  4KZB A;  3CG5 A;  3MBZ A;  3GSG A;  4XXR A;  3WS2 A;  3M2K A;  1ESU A;  1ERQ A;  3N4I A;  3LEZ A;  4LEN A;  2OV5 A;  2Y2P A;  5CHJ A;  1MWU A;  4ID4 A;  4KQO A;  4OP5 A;  4UHU A;  5FI7 A;  1YLZ A;  4CJN A;  1IEM A;  5I94 A;  2ZC6 B;  3V5M A;  4ZDX A;  2J7V A;  5CGX A;  1CI8 A;  2E8I A;  4E6W A;  2IWC A;  4LV1 A;  5KSC A;  2BG1 A;  2IWD A;  3Q1F A;  4IED A;  1BLH A;  5HAQ A;  4CPK A;  3HLB A;  3NI9 A;  3O88 A;  3QHY A;  4L0L A;  2RCX A;  3E2L A;  4S2N C;  3IHB A;  2ZM8 A;  5GLA A;  2Y4A A;  4E3O A;  4DXB A;  4LCL A;  2A3U A;  3VP3 A;  1BZA A;  3EQU A;  3W8K A;  5FDH A;  2Z2L B;  4S2J A;  1NZO A;  1XXM A;  1NYY A;  1TDG A;  4R1G A;  2V1Z A;  1IYQ A;  3PAG A;  2ZC3 B;  4GD6 A;  1BT5 A;  4HEF A;  1GA0 A;  2VGK A;  2Y2J A;  3HUN A;  4KZ3 A;  4N1X A;  2EX6 A;  1RCJ A;  2B5R A;  1HZO A;  1CEF A;  3B3X A;  3A3E A;  1KE4 A;  4JXS A;  1Q2Q A;  4IBR A;  5A93 A;  4R4R A;  4JXG A;  1YLP A;  3FV7 A;  4FSF A;  2ZM0 A;  4MBH A;  2WGW B;  1SDN A;  2Y59 A;  3OCL A;  5GLB A;  5DVA A;  5F1G A;  1ALQ A;  4X69 A;  3RXW A;  4HBU A;  2ZQC A;  3RJU A;  5FAP A;  3HLF A;  3P98 A;  4B4Z A;  3AGE A;  4X55 A;  1ZG4 A;  1LI9 A;  4OPZ A;  1WE4 A;  5G18 A;  2DRW A;  5GHY A;  2BLS A;  1BLS A;  3ZFZ A;  3BEB A;  1MPL A;  3OPP A;  4M3K A;  3C5A A;  4X53 A;  2XEP A;  3Q81 A;  3C4O A;  1IYO A;  4X68 A;  4BJP A;  2PBY A;  3BFD A;  3N8S A;  4Y0T A;  3UE3 A;  1L0E A;  3ZG5 A;  3N6I A;  4OLD A;  3BRM A;  4KZ8 A;  1JTD A;  1VQQ A;  2J9O A;  3IF5 A;  1KE3 A;  5DTS A;  5EVI A;  1ES5 A;  5L2F A;  3ITA A;  3V3R A;  3HL9 A;  1YLW A;  1FR1 A;  5IHV A;  1MXO A;  1U60 A;  3GRJ A;  4N92 A;  4S2K A;  1VM1 A;  4WZ5 C;  4R3J A;  3VSL A;  3CZD A;  5EPH A;  2IWB A;  3BFG A;  2Y2Q A;  2G2W A;  4OQ0 A;  3LCE A;  4H8R A;  5E43 A;  5FAO A;  4BLM A;  5A90 A;  1JWP A;  3PBN A;  4QB8 A;  1M6K A;  5A91 A;  2QZ6 A;  3HLD A;  4LV0 A;  5CTN A;  5EVI D;  3LY4 A;  4OLG A;  4C75 A;  1FQG A;  3N8R A;  3SS3 A;  2Y55 A;  5FQ9 A;  1DJB A;  3ZG9 B;  2DCF A;  1XKZ A;  1ERO A;  2ZC7 A;  4P6B A;  3IHA A;  4GD8 A;  4DKI A;  1K54 C;  3FKW A;  5AQ7 A;  3V50 A;  1MBL A;  3PAE A;  1KDS A;  1RP5 A;  4KEN B;  3UPN A;  5M1A A;  2WUQ A;  4X6T A;  2WKE A;  4ZTK A;  3TG9 A;  2ZQA A;  1PW1 A;  2X71 A;  3C7U A;  3UDF A;  2J9P A;  4WMC A;  3ZG8 B;  4BL2 A;  3NDG A;  5GLC A;  3S4X A;  1XP4 A;  1C3B A;  3HUO A;  4N1H A;  4KG5 A;  1ZG6 A;  4GKU A;  2CC1 A;  4RX3 A;  5E2H A;  1EWZ A;  3PBR A;  4Z9Q A;  1MY8 A;  5KZH A;  3PTE A;  3S22 A;  1PI5 A;  3BYD A;  1NXY A;  4ZBE A;  3UDX A;  1MWR A;  5GLD A;  2EX9 A;  1CK3 A;  2P9V A;  2ZD8 A;  1YLY A;  4OQG A;  2HDU A;  1BLP A;  4MEZ A;  4JXW A;  1W8Y A;  1Y54 A;  3O3V A;  3VFH A;  3UO9 A;  4PMA A;  4NK3 A;  3HLC A;  5EOO A;  1XGI A;  1M40 A;  4S2I A;  1S0W A;  5U47 A;  2HP5 A;  4ZJ3 A;  2WYX A;  4Q8I A;  3SH7 A;  3UNW A;  4WEJ A;  2WK0 A;  5TR7 A;  1L0G A;  2UWX A;  1G6A A;  1I2S A;  3HLG A;  2HP6 A;  2ZLY A;  5EVI B;  5HL1 A;  5JYO A;  3WWX A;  3WRZ A;  4YFM A;  4U3T A;  2EFU A;  1DJC A;  5FAQ A;  5HX9 A;  4EBL A;  4EWF A;  1OME A;  4B88 A;  4N9K A;  4PM6 A;  5FQK A;  1KDW A;  4OON A;  4IVI A;  3VP0 A;  3PBO A;  1RGY A;  2R9X A;  5CRF A;  3DWZ A;  4BEN A;  4WEK A;  1KGG A;  3ZGA B;  4DDS A;  1O07 A;  4QJG A;  3NDE A;  2V2F F;  4OPR A;  3G2Y A;  2OLV A;  2ZC5 B;  2Y2M A;  3Q7V A;  5EOE A;  2EFX A;  1KE0 A;  1FR6 A;  2WAF A;  4QHC A;  1N9B A;  3ZG0 A;  3HLW A;  4PM9 A;  4S2O A;  1KGF A;  1TEM A;  4MLL A;  3UDI A;  3IF6 B;  2Y91 A;  3A3J A;  4Y0O A;  2QPN A;  3CMZ A;  4NET A;  5DF7 A;  4EBN A;  1RGZ A;  2XFT A;  4YIN A;  5CED A;  3UE1 A;  2HP9 A;  1S6R A;  1W5D A;  2GDN A;  4F94 A;  3N8L A;  5CHM A;  5M19 A;  4KZ4 A;  4JPM A;  1PW8 A;  3GQZ A;  1LLB A;  1NZU A;  3MXR A;  1N4O A;  1BTL A;  3FKV A;  2OSU A;  4HES A;  4S2N A;  3OZH A;  4EQI A;  5KSH A;  2Z2M B;  1GHI A;  3FYZ A;  1YLT A;  1XX2 A;  5FI2 A;  3MFD A;  3SH9 A;  4WYY A;  3MKE A;  1Q2P A;  4A5R A;  1FOF A;  3O87 A;  1MWS A;  2ZM2 A;  3O86 A;  3BEC A;  3DW0 A;  4RX2 A;  2P74 A;  4RYE A;  3GTC A;  4QU3 A;  2ZJ9 A;  2XLN A;  1XGJ A;  2WAD A;  4P87 A;  1I5Q A;  1IYS A;  4JF5 A;  5CXW A;  3NY4 A;  3A3F A;  4WM9 A;  1JWZ A;  4K0W A;  1K25 A;  3V39 A;  1PIO A;  1O7E A;  3A3I A;  3WS1 A;  4U0X A;  4BL3 A;  1FSY A;  2XR0 A;  3W4P A;  3UY6 A;  5FAT A;  5HAI A;  5GHX A;  3VSK A;  5EEC A;  3HLE A;  4GNU A;  1BLC A;  3M2J A;  3QNB A;  1NJ4 A;  1AXB A;  4P85 A;  2EX8 A;  2WKH A;  5AQ9 A;  3ITB A;  3IWQ A;  1ZKJ A;  2PU4 A;  5CGS A;  3VP1 A;  4GDB A;  4OP8 A;  4K0X A;  4UA7 A;  2Y2I A;  3MXS A;  2C6W B;  1IKG A;  2H5S A;  2XDM A;  2H10 A;  1DJA A;  5FQJ A;  3GVB A;  4E3N A;  4N9L A;  3IF6 C;  4R4S A;  2ZQD A;  5GHZ A;  4C3Q A;  5FSR A;  5CER A;  1K57 C;  3OPR A;  2Q9N A;  4PM7 A;  4QD4 A;  5DF8 A;  3GR2 A;  1GHP A;  4OOM A;  4P0M A;  5DTT A;  1PWG A;  1J9M A;  3W4O A;  4FH4 A;  4JBF A;  5F83 A;  4X56 A;  4OOL A;  4WZ5 A;  3HVF A;  4KG6 A;  2EXA A;  4OQI A;  4WZ4 A;  5F82 A;  3IWI A;  5E2E A;  2PU2 A;  3UE0 A;  1LHY A;  1E25 A;  4DE3 A;  1YMS A;  4S2L A;  5CTM A;  2XGN A;  4RA7 A;  5EUA A;  2EX2 A;  4E3I A;  3DTM A;  4JF4 A;  1K55 C;  4BD0 A;  4PM5 A;  1KVL A;  1XA7 A;  2G2U A;  3VP4 A;  4WEL A;  1NRF A;  4KQQ A;  4WMC D;  2WGI A;  1PWD A;  4XUZ A;  3ZVT A;  1K54 A;  4FCF A;  2V20 A;  4UA6 A;  2WZX A;  1E4D A;  1WYC A;  4GDN A;  1WYB A;  2Y2K A;  1JVJ A;  1K4E A;  4K91 A;  3WS5 A;  3MZD A;  5EVL A;  1YQS A;  4EUZ A;  1DY6 A;  3Q82 A;  3SS5 A;  1I2W A;  3ZNY A;  5HFO A;  1CI9 A;  4O7D A;  2WGW A;  4GN2 A;  1K6S A;  4S2M A;  3PBQ A;  3WS0 A;  4DE1 A;  4OPQ A;  5J8X A;  3G2Z A;  2I72 A;  3IXD A;  1PYY A;  1W8Q A;  3OPL A;  4MNR A;  4ZAM A;  3UPO A;  4DXC A;  5FQM A;  1PI4 A;  4QY6 A;  3VP2 A;  1YM1 A;  1NYM A;  1GA9 A;  2Y2G A;  4KQR A;  3A3D A;  1K4F A;  2Y2O A;  2XF3 A;  4UA9 A;  3G31 A;  3E2K A;  3HRE A;  3P09 A;  1XA1 A;  3D4F A;  3BFC A;  3IXH A;  3ZDJ A;  3ZHH A;  4S2P A;  5E2F A;  3QNC A;  5M18 A;  3IXG A;  4DRT A;  1GCE A;  1GHM A;  2ZQ8 A;  2XD1 A;  3C7V A;  3WRT A;  5JYP A;  4FH2 A;  4ZJ2 A;  1ZC2 A;  3M6H A;  2QMI A;  4R3B A;  3TOI A;  5E2G A;  1HTZ A;  2ZQ9 A;  1H8Y A;  3N7W A;  4RVA A;  3BFE A;  3VMA A;  1SHV A;  2ZQ7 A;  5DTK A;  5HAP A;  3HBR A;  1W7F A;  1HVB A;  4LCM A;  5HAR A;  3MZF A;  1ES4 A;  1SDE A;  4Y0U A;  5TFQ A;  2XFS A;  3IXB A;  3SS4 A;  5EE8 A;  2FFF B;  3IH8 A;  1ES2 A;  4LV3 A;  4DE2 A;  2DNS A;  3MKF A;  1H8Z A;  5BOH A;  3NCK A;  4KZA A;  1PWC A;  4JKT A;  1MKI A;  2P9V B;  1EI5 A;  4KZ5 A;  1FCN A;  1BUL A;  3IT9 A;  3DWK A;  3S1Y A;  2Y2L A;  2RL3 A;  5CHU A;  4GB7 A;  1K6R A;  3LO7 A;  3BM6 A;  3IWO A;  3OPH A;  5FA7 A;  2X02 A;  2J8Y A;  3FZC A;  1MWT A;  3CJM A;  3G34 A;  2XH9 A;  4KG2 A;  3AGF A;  3Q7Z A;  3TSG A;  5EVI C;  1SKF A;  1XPB A;  1L2S A;  1ERM A;  4OH0 A;  4JLF A;  5FAS A;  1YLJ A;  3I7J A;  1JTG A;  1YT4 A;  5A92 A;  3BFF A;  4FD8 A;  3SH8 A;  3JYI A;  1JWV A;  2XD5 A;  3GMW A;  4Y7P A;  4E3M A;  4EV4 A;  1SCW A;  3V3S A;  4OPY A;  2WGV A;  4E3K A;  2H0Y A;  3AGD A;  3ZCZ A;  4E6X A;  3MZE A;  4MBK A;  1YMX A;  3M6B A;  3ZVW A;  2HDQ A;  4QY5 A;  4PPR A;  5GL9 A;  4DDY A;  4R23 A;  1ONG A;  2XQZ A;  2WZZ A;  4E3L A;  5CGW A;  3NBL A;  4KZ6 A;  3ISG A;  1BSG A;  5CEC A;  1H5X A;  3Q7V B;  3OCN A;  2ZC4 B;  3VFF A;  1G68 A;  1HD8 A;  1K56 A;  4JF6 A;  2A49 A;  4DE0 A;  2WAE A;  4LV2 A;  1PZP A;  4HBT A;  2JC7 A;  5FQI A;  1FCM A;  1W79 A;  2HDS A;  3C4P A;  3UN7 A;  4OKP A;  4EBP A;  2X01 A;  4D2O A;  4WBG A;  1KGE A;  2HDR A;  4C6Y A;  2WKI A;  1LL9 A;  1K56 D;  2JBF A;  2XK1 A;  3PBT A;  3VOY A;  3FWL A;  4E3J A;  2H0T A;  1IKI A;  1LL5 A;  2HPB A;  2C5W B;  3G30 A;  1TDL A;  3IF6 A;  3NC8 A;  4KZ9 A;  1ES3 A;  3G32 A;  1L0D A;  5TGF A;  1K57 A;  5FI6 A;  2JCH A;  3BLM A;  3HUM A;  4R0Q A;  4BD1 A;  2R9W A;  1KVM A;  3Q07 A;  1ONH A;  1K38 A;  4GOG A;  4U0T A;  4IVK A;  3ZG7 B;  3G35 A;  1Z6F A;  5KMW A;  4PM8 A;  4ZJ1 A;  1IYP A;  3G4P A;  4MBF A;  3ZNT A;  4B4X A;  3BLS A;  1PZO A;  4IBX A;  5DF9 A;  4JXV A;  4GZB A;  1BUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...