3WRZA

N288q-n321q mutant beta-lactamase derived from chromohalobacter sp.560 (without soaking)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
357
structure length
357
Chain Sequence
QTREVLDPIVASLMEAQQIPGMAIALVRPEGTTISHYGAADRETGTPVDDDTLFEIGSLSKTLTATLASLAEVEGKLDFDAPVSRYLPELEGSAFDDISGLNLGTHTGGGLPLFVPDEVTDRASLMAWYREWQPTEPIGESRTYSNLGIGLLGLETAASLDGEFVPTMRAKVLAPLGMQDTWYDVPEARMADYAMGEDKDGQPTRVSPGVLDDEAYGIKTTAADLAKLVRANLHLADVDAELQQAIDATRQGHYRVGDMTQALIWEQYSLPVAPETLRAGQGYDMILEPNAAEALEPPQSPRDDVWVNKTGSTQGFGGYIVMLPGKHTGLVMLANKNYPNDARVEAAYRILSGLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Structure of a highly acidic beta-lactamase from the moderate halophile Chromohalobacter sp. 560 and the discovery of a Cs(+)-selective binding site
pubmed doi rcsb
source organism Chromohalobacter sp. 560
total genus 116
structure length 357
sequence length 357
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3wrzA00
3ZVTA 5FI6A 1VQQA 4L0LA 4U0TA 1KGGA 1W7FA 4X69A 5BOHA 3A3FA 3BFCA 1MBLA 4E3MA 5FI2A 3QNBA 4OPRA 3C4PA 3P09A 5L2FA 2WAEA 3Q7VB 4QY5A 4FD8A 1U60A 4ZJ2A 3LY4A 4JXVA 2Y2HA 3RXXA 1HVBA 4WM9A 4FH4A 1IYSA 4LV1A 1GA9A 1DJAA 4FCFA 5EVIA 2J8YA 4KQOA 4UAAA 2Y2OA 2HP6A 2XD1A 5CHUA 4OLDA 2A3UA 5HL1A 1XGJA 1TDLA 4K0XA 2G2WA 1MKIA 1LLBA 4EBLA 2ZQCA 3RJUA 2DNSA 5AQ9A 1GHIA 5AQBA 4OVDA 1TVFA 5HARA 1TEMA 3C7VA 2XDMA 3OC2A 2H0TA 4IBXA 3WWXA 3VFFA 2ZQ7A 3ZG7B 2XEPA 4K0WA 1N9BA 3LCEA 3SH7A 1WE4A 1Q2QA 4ZJ1A 4BENA 4KZ4A 3IXDA 1LL9A 4WZ5A 4JF6A 5G18A 3FV7A 1N4OA 2QZ6A 3IF6B 4UA6A 3W8KA 4DF6A 4GN2A 3VSLA 1KVLA 2Y2KA 3C5AA 4JXWA 2ZD8A 5CTMA 3MKFA 4PM8A 3HUMA 1FSWA 1LHYA 1NY0A 1K55A 4HBUA 4NK3A 1KE4A 4S2NC 4S2OA 5FAOA 5FQKA 3ZG8B 2JC7A 3ZNYA 3MFDA 1Z6FA 2HDSA 3BLSA 3UNWA 2WGVA 1NZUA 2QPNA 1KDWA 1PWCA 4OPZA 5FATA 1LL5A 4OQGA 5DTKA 4WYYA 4Y7PA 4FH2A 2EX8A 3LY3A 1QMFA 3VP0A 3VFHA 4MBHA 5CGXA 3ZG9B 1K6RA 2XH9A 4JXGA 4RYEA 1PW8A 2CC1A 1ES4A 2VGJA 2ZC7A 4DE0A 3WRZA 1CK3A 5HW3A 1NJ4A 3Q7VA 4OLGA 4MBFA 1ES2A 2UWXA 1SHVA 2E8IA 2XR0A 2EX2A 3HLDA 3VP2A 2WK0A 4OQIA 1MWSA 2V20A 3VP3A 4EQIA 3OPPA 4N92A 4B4XA 4KG2A 1L0GA 4P6BA 3BM6A 1PWDA 2G2UA 3BEBA 4MNRA 5AQ7A 4DXCA 4IVKA 1SCWA 4PPRA 1PI5A 4QD4A 1NZOA 1XPBA 3O87A 1CI8A 2HPBA 3VP1A 3GVBA 4BD1A 4X53A 4DE1A 3GSGA 4UA7A 1K56A 1K54A 3HLFA 4KZ3A 3FZCA 1BULA 5A93A 4DRTA 3ZG5A 2R9XA 3CJMA 3DWKA 3SH8A 1PYYA 4U0XA 4DDYA 5JYOA 4ZDXA 1NYMA 4WZ4A 4RVAA 3N8RA 4ZAMA 3ZHHA 4JLFA 2VGKA 3HBRA 2V2FF 4LV2A 2Z2LB 4XXRA 2Y2LA 3NY4A 4CJNA 3UDIA 4OQHA 5EE8A 3LEZA 1K4FA 3N8SA 3IF6A 1ES5A 5GLDA 3NCKA 4OPYA 5EOOA 3PAEA 2XGNA 3NIAA 2OLUA 1ESIA 1K25A 3HLBA 4BJPA 1PI4A 5CGWA 1PWGA 4RA7A 1FOFA 5GLBA 3DWZA 1YLZA 2XFTA 2R9WA 3E2LA 1XA1A 3I7JA 4WEKA 1IKIA 1AXBA 2XLNA 1CEFA 4DKIA 3IH9A 4HBTA 2Z2MB 2EX9A 3N8LA 4DDSA 3HLEA 3V3RA 3GV9A 3NBLA 1E3UD 3UPOA 4OOYA 4N9LA 1RGYA 3HREA 1C3BA 4Y0UA 1MWUA 1S0WA 5EPHA 5FAPA 1H8ZA 1JVJA 3BFGA 4PM7A 3UPPA 4EV4A 4S2PA 3N6IA 4B88A 4LCLA 4BQMA 5KMWA 1HZOA 4GDBA 1ALQA 1K4EA 4S2MA 5DVAA 5CERA 3NI9A 3IH8A 1BLCA 4GZBA 4OPQA 2DCFA 4E3LA 4KZAA 3S4XA 3Q1FA 4BLMA 2Y2NA 4X55A 3ISGA 5FQIA 4DXBA 1YM1A 2X71A 5F83A 1QMEA 3EQUA 5AQAA 5A92A 3V3SA 4EBPA 3Q7ZA 4KG5A 3ITBA 1YMXA 2WKHA 2WZXA 5TGFA 1FSYA 5CHMA 3D4FA 5CRFA 1PZOA 3HLGA 3Q82A 5FQJA 4FSFA 5FDHA 3WS1A 2ZMAA 4IBRA 4R3BA 3RXWA 3Q07A 1XKZA 4JPMA 1MY8A 4GNUA 3VP4A 1LI0A 2ZC4B 2Y2IA 2WUQA 3UO9A 4R23A 3A3JA 1ERQA 4D2OA 4OH0A 1FR1A 4HESA 3HLCA 5FASA 4JF4A 4GKUA 3VOZA 2HP5A 4KZBA 5EVIC 3E2KA 5GHZA 2HDRA 1IYOA 4KZ5A 3S22A 2Y91A 2ZM2A 3O86A 4GDNA 1BLPA 1FCOA 4R4RA 1EWZA 1PW1A 4OOLA 2IWBA 4DE2A 2OLVA 1EI5A 3CG5A 4GD8A 1IEMA 1L2SA 5FQMA 1CI9A 1YT4A 2JE5A 3G32A 4N1XA 3TOIA 1M40A 2X02A 3TSGA 2EX6A 2Q9NA 1K38A 4KG6A 3UN7A 1MWTA 1RP5A 3ZFZA 2X01A 4WMCD 2Y2QA 3PBTA 3V50A 2Y2MA 2IWDA 5M19A 4H8RA 1NXYA 3NDGA 4QU3A 4PM5A 3O3VA 4KENB 3G35A 4WZ5C 4F94A 5FQ9A 4QB8A 2XF3A 1S6RA 1Y54A 2WKIA 1YLYA 4X68A 1JTDA 3EQVA 1MWRA 4X6TA 5F1GA 1W5DA 3G4PA 5TFQA 4ZBEA 3MZFA 1XP4A 3IWQA 5EECA 1XX2A 3SS4A 4P87A 4R4SA 3PAGA 3ZVWA 2IWCA 1K55C 1JWZA 4YFMA 5EOEA 2V1ZA 1GHMA 3GR2A 3PBSA 3GQZA 3MKEA 5CGSA 1YLJA 5GL9A 5JYPA 5FQQA 4QY6A 3M2JA 4KZ8A 2EFXA 4MBKA 3UDFA 2RL3A 3M6BA 5CEBA 3VOYA 4JXSA 1HD8A 1NRFA 2FFFB 1DY6A 1JWVA 2Q9MA 1W8QA 3BFDA 1JTGA 1YLTA 3V5MA 2RCXA 5M1AA 2HDUA 2PU4A 3FKWA 4KQRA 5DF7A 3WS0A 1WYCA 2J7VA 3IXHA 1NYYA 1CEGA 1OMEA 2DRWA 4N9KA 4R1GA 1ONGA 3BFEA 4HEFA 2C6WB 3IHAA 1H8YA 2J9PA 1K57A 5GHXA 2HDQA 4BL3A 3W4PA 4GD6A 4R3JA 3UE3A 3PBRA 1MXOA 3IHBA 3ZGAB 3ZNTA 2P74A 3GRJA 1GA0A 3WS4A 3SS5A 3HUNA 1KGFA 1L0DA 1O7EA 4M3KA 1KE3A 2WGWB 3G30A 4KZ9A 2J9OA 3AGFA 1ZG4A 3VSKA 3C7UA 4A5RA 5E2FA 5EVID 3NDEA 1XXMA 4O7DA 2ZC5B 1MPLA 3WS2A 4LV0A 3PBNA 4QJGA 3LO7A 3G2YA 3HUOA 1TDGA 1O07A 1FR6A 3A3DA 4X56A 2OV5A 5KSHA 4KQQA 2ZM0A 3AGDA 4UA9A 3OZHA 5FSRA 3TG9A 3UDXA 5HFOA 2ZJ9A 2EFUA 5E2HA 3IF6C 3M2KA 4OP8A 4QHCA 2BLSA 4PM6A 4P0MA 1E25A 3DTMA 3IWIA 1M6KA 1ZG6A 3G2ZA 1L0EA 4C3QA 4MEZA 1DJCA 2H0YA 3OPHA 3JYIA 3PBOA 1RCJA 1KGEA 3CMZA 2B5RA 3MZEA 4OP5A 4GOGA 1IYPA 3IXBA 1ES3A 3PBQA 4EBNA 5A90A 3HLWA 2Y55A 3SH9A 4YINA 2Y59A 3QHYA 3BECA 1BTLA 3ZG0A 3UE1A 4S2JA 5EVLA 4ZTKA 5I94A 2P9VB 3A3IA 1XA7A 4LCMA 4E6WA 1FCNA 1GCEA 2ZQAA 4S2NA 4S2IA 3BRMA 3SOIA 4ZJ3A 2GDNA 3MXSA 1E3UA 1DJBA 4Y0TA 4JBFA 4EUZA 4LENA 4XUXA 1Q2PA 1LI9A 2XFSA 5E43A 4RX3A 3A3EA 2XQZA 4K91A 4EWFA 5U47A 3UY6A 2ZC6B 1G6AA 3OCLA 4Q8IA 3BFFA 1BT5A 5DF9A 1J9MA 2PU2A 4OOMA 3IWOA 4BD0A 3CZDA 3M6HA 1YQSA 3O88A 3OPRA 2WGWA 2ZQ9A 4PM9A 3HL9A 3IXGA 3ZDJA 2ZM8A 1ONHA 1BLSA 1YLWA 2ZC3B 5GLCA 5DF8A 5DTTA 4Y0OA 3UE0A 5GLAA 3N7WA 1GHPA 4WELA 1BLHA 2WADA 1K56D 2ZQ8A 2BG1A 3IT9A 4E3KA 1PIOA 3IF5A 4WEJA 5E2GA 4DE3A 5FAQA 1I2SA 3G31A 3FWLA 3UPNA 1BSGA 1G68A 2Y4AA 3C4OA 4C6YA 2Y2PA 2Y2JA 1H5XA 5GHYA 4P85A 5CTNA 4E3IA 5KZHA 4JKTA 1RGZA 1L0FA 2HP9A 2XD5A 5IHVA 4CPKA 5EUAA 5CEDA 4IVIA 5HAPA 4ID4A 3BYDA 4UHUA 1YMSA 1JWPA 1K6SA 2JCHA 3W4OA 2A49A 1SDEA 4OKPA 4JF5A 4OONA 4NETA 5KSCA 3NC8A 4KZ7A 4C75A 1IELA 3N4IA 5TR7A 3VMAA 1KVMA 1SDNA 2P9VA 4U3TA 3OCNA 4WBGA 5F1FA 3ITAA 4XUZA 1PZPA 3GMWA 4N1HA 3MZDA 5EVIB 1IYQA 3MBZA 2FFYA 1BUEA 3FYZA 2I72A 4WMCA 4E6XA 3G34A 3MXRA 2H10A 3V39A 5A91A 1I2WA 2PBYA 3WRTA 4MLLA 1FCMA 5DTSA 5HAIA 4PMAA 3GTCA 4S2KA 3OPLA 2OSUA 2ZLYA 1I5QA 5CXWA 4Z9QA 5FI7A 3S1YA 4OQ0A 2QMIA 4LV3A 2WGIA 5HX9A 2Y2GA 2EXAA 2XK1A 1ESUA 5HAQA 5CHJA 2JBFA 4KZ6A 1E4DA 1EROA 1K54C 1ZKJA 3AGEA 3QNCA 1ZC2A 2WZZA 4B4ZA 1SKFA 1W79A 2H5SA 4E3NA 1KDSA 4S2LA 5CECA 4R0QA 1KE0A 2EXBA 3BLMA 3W4QA 1ERMA 4GB7A 1BZAA 3P98A 2WAFA 3SS3A 3FKVA 4BL2A 2WKEA 3ZCZA 4E3JA 3B3XA 3DW0A 3PTEA 1W8YA 2ZQDA 4E3OA 2C5WB 1YLPA 3Q81A 1IKGA 1K57C 1HTZA 1XGIA 4RX2A 3WS5A 1WYBA 1VM1A 5D3OA 3IQAA 5F82A 5J8XA 5E2EA 2WYXA 5M18A 5FA7A 3HVFA 1FQGA 4IEDA
chains in the Genus database with same CATH superfamily
5FI6A 4U0TA 4EEPA 4X1LA 4HNBA 3A3FA 1MBLA 4E3MA 5FI2A 3QNBA 2D02A 4QY5A 4XT2B 1NWZA 1U60A 4ZJ2A 3LY4A 5J7EA 4JXVA 3T50A 4LGWA 4LV1A 4GHIB 4GJ4A 4FCFA 4UAAA 1T1AA 4OLDA 3BQAA 3NOTC 4QPRA 3QP1A 1GHIA 5AQBA 3OC2A 2H0TA 3WWXA 3VFFA 2VGLS 3LCEA 1Q2QA 2K31A 4JF6A 4BMWA 1N4OA 3EOIA 3W8KA 4DF6A 3IX8A 2W3EA 5CTMA 3NOUC 4JXWA 4HBUA 1K55A 5FAOA 4NG2A 5FQKA 4EUVA 3ZG8B 2JC7A 3ZNYA 2JKTI 2HDSA 1NZUA 2QPNA 4OPZA 5FATA 1LL5A 4Y7PA 4FH2A 2EX8A 3CHWP 3F1PB 1QMFA 1VEUB 4MBHA 2XA7M 2XH9A 4BBTA 1PW8A 3ZQ5A 5HW3A 2UV0E 4MBFA 2MJ6A 2O99A 3H82B 3B33A 1MWSA 1SKOA 5AVFA 4PPRA 4QD4A 3LR3A 4UA7A 4KZ3A 3HLFA 3FZCA 2PDRA 3HJKA 3ZG5A 3DWKA 3SH8A 1NYMA 4RVAA 4ZAMA 2XSSA 2V2FF 2Z2LB 4XXRA 1K4FA 3E4QA 1ES5A 5GLDA 3NCKA 4Y13A 5LBRA 3PAEA 2HZ5A 3KX0X 2XGNA 4O01A 4FTXA 1PI4A 1MKMA 5GLBA 1XJ6A 2R9WA 3E2LA 1IKIA 1AXBA 1F2KA 1CEFA 3LR4A 1ODVA 4HBTA 4ME4A 2Z2MB 2JKGA 1WA9A 3NBLA 5FAPA 4LCLA 4BQMA 4S2MA 1GSWA 3KSGA 3FG8A 2KDKA 4X55A 3EGDC 4Z1WA 3GDIA 2GX5A 5J4EA 2X71A 2VX8A 2H28A 5AQAA 3R7WB 4EBPA 3Q7ZA 1TS8A 2WKHA 1PZOA 3HLGA 4FSFA 5HD5A 4R3BA 1F9IA 3VP4A 3UB7A 2VV8A 4R23A 5HPIA 4HHDA 1FR1A 4O8GA 4JF4A 4GKUA 3KSIA 1IYOA 2W3HA 3S22A 2Y91A 2ZM2A 4GDNA 3LICA 3TRCA 1EWZA 1PW1A 2PR5A 4OOLA 2IWBA 1EI5A 2J3TD 1IEMA 1L2SA 5FQMA 3G32A 5AJGA 3TOIA 1M40A 2X02A 2Q9NA 1F5MA 4HP9A 3JPUA 1MWTA 4GS9A 4WMCD 4F3LA 3V50A 2IWDA 3CI6A 1NXYA 4QU3A 3O3VA 1LSVA 3QP4A 1S6RA 1YLYA 5TJJA 3MZFA 4HI4A 5EECA 1XX2A 3LGOA 3SS4A 4EW7A 3A0VA 4H6JB 3GR2A 2VLGA 3PBSA 2A2LA 3GQZA 3M2JA 4WN5A 4JXSA 1HD8A 2FFFB 1W8QA 3IX3A 3V5MA 2EA9A 1L3LA 2W1RA 3P01A 2HDUA 5DF7A 4R1GA 3IXHA 4N9KA 2KLIA 3KYQA 1ONGA 5F68A 5IS1A 2Q0OA 4R3JA 3UE3A 3PBRA 2J3WA 3L9KA 3LIEA 3WS4A 4YOFA 3HUNA 4YWZA 1O7EA 1KE3A 1TF1A 2G7UA 3UE6A 4A5RA 4GLQA 4GS9B 2QJ5A 3G2YA 1TDGA 3A3DA 2VKSA 4UEYA 5KSHA 3CUEA 2ZM0A 3AGDA 1GSVA 3IWIA 1ZG6A 1DJCA 2H0YA 3JYIA 1KGEA 3IXBA 3LIFA 1H3QA 3R4KA 4R38A 5EVLA 2P9VB 1XA7A 1UWNX 4PKYA 2ZQAA 4S2NA 3BRMA 2GDNA 1DJBA 1Q2PA 2XFSA 5E43A 3UY6A 4BWIA 1G6AA 4BD0A 1BT5A 1J9MA 4OOMA 3M6HA 3OPRA 2WGWA 4PM9A 3F1OB 5GLCA 3HCYA 1GHPA 2XRNA 2WADA 3V67A 2BG1A 3C4OA 1H5XA 1CQAA 4P85A 5EFWA 5KIZA 4NEED 4E3IA 1RGZA 1L0FA 1K6SA 1S1YA 3NC8A 4KZ7A 4WLAA 4C75A 1IELA 2Y8HA 3MXQA 3VMAA 1KVMA 1SDNA 4WBGA 5F1FA 3GMWA 5EVIB 1IYQA 2VA0A 1P97A 2FFYA 3H7WB 3LIBA 2EWWA 3C38A 2HJ9C 1FCMA 5DTSA 4PMAA 1T1CA 1H8MA 5HAQA 2Y2GA 2JBFA 1EROA 3QNCA 4B4ZA 1SKFA 2H5SA 4CLCA 4E3NA 1KE0A 4LRXC 3W2ZA 3P98A 3SS3A 2W1TA 2WKEA 3B3XA 3DW0A 1W8YA 1PNEA 5DKLA 1K57C 1HTZA 5E2EA 1FQGA 4IEDA 4HJ4A 3CWFA 3ICYA 1VQQA 4L0LA 1W7FA 3BFCA 3PHYA 4OPRA 3A0RA 3OOVA 4FD8A 2JKTM 1Z09A 4RQ9A 1HVBA 1D1JA 4LRYC 1DJAA 2J8YA 5F69A 2HP6A 4D60A 1H0MA 5CHUA 4K0XA 2G2WA 1MKIA 4EBLA 2ZQCA 3PXPA 5DJTA 1TVFA 1OT9A 1TEMA 2ZL1B 2ZQ7A 3ZG7B 2XEPA 2JN7A 3IXDA 3T1QB 1G6OA 3IF6B 1TS6A 4DJ3A 4GN2A 1KVLA 3C5AA 5A8BA 3MFDA 1Z6FA 3BLSA 2WGVA 1NLYA 1D06A 1F98A 3KYEA 4NKPA 3KSHA 3SZTA 1KDWA 3S7QA 4OQGA 2ZMVA 3VFHA 3ZG9B 3T4KA 1P9WA 2CC1A 2VGJA 3UB5P 4DE0A 3WRZA 1CK3A 4OLGA 4LLOB 4XT2A 3TE8A 1DP6A 5EVEA 3HLDA 3OPPA 4B4XA 4GHIA 3KYZA 1PWDA 4IVKA 3MSHA 1PI5A 3O87A 4NXGA 5HD3A 4BD1A 4G3KA 2R9XA 3CJMA 1PYYA 5JYOA 5HL6A 2VGKA 5AVEA 2Y2LA 4OQHA 5EE8A 3NULA 4DJ2A 3N8SA 2J3TC 4CLCE 5EOOA 3S7OA 2OLUA 3VOLA 1ESIA 1PWGA 1FOFA 3DWZA 3I7JA 1XA1A 4IHQA 2XLNA 2CMNA 4MN5A 3F1PA 1VEUA 4DDSA 3OBFA 3HLEA 3V3RA 3GV9A 4N9LA 3HREA 1PFLA 4Y0UA 1MWUA 1S0WA 3LUQA 3BFGA 2AVXA 3H82A 5CERA 1BLCA 4OPQA 2DCFA 2GJ3A 2I9VA 3Q1FA 4HY8A 4IJGA 4NXFA 1QMEA 1YMXA 2WZXA 5TGFA 1XJ3A 5CHMA 4Q0HA 3Q82A 3C30A 5FDHA 2ZMAA 3HJIA 1XKZA 4NXBA 2ZC4B 2Y2IA 2VK3A 1ERQA 4Y3IA 2WKRA 3HLCA 5GHZA 2KOIA 2ZOIA 3E2KA 3IX4A 4KZBA 4DE2A 3CG5A 1LT0A 1YT4A 4N1XA 1TS7A 2O9AA 3LEQA 1DRMA 1RP5A 3ZFZA 4PM5A 4KENB 4Q0JA 4F94A 4QB8A 4I3JA 3ZYTA 2K7SA 2V1AA 5F1GA 1W5DA 2PAVP 3G4PA 1XP4A 2K2NA 2ZMFA 4R4SA 3ZVWA 3PAGA 2IWCA 1K55C 1JWZA 2V1ZA 1GHMA 5FEGA 2XA7S 4CLCD 2NUTC 4HJ6A 5FQQA 3S7NA 2V8CA 5F5YA 4Y17A 3UDFA 3M6BA 3R7WA 4IUHA 2Q9MA 1X0OA 1YLTA 5M1AA 2V9AA 2DRWA 3IHAA 2J9PA 5GHXA 4GD6A 1S4SA 4R70A 3ZNTA 4NXEA 5EM0A 1GA0A 4KZ9A 2J9OA 3IS2B 1ZG4A 3E4PA 4EXOA 3VSKA 2GNXA 3NECA 5E2FA 3NDEA 3E4OA 4O7DA 3WS2A 3RTYA 1W63Q 4KQQA 3TG9A 3O5YA 5E2HA 5FEFA 3M2KA 4OP8A 4QHCA 4PM6A 3DTMA 3G2ZA 1BYWA 3K3CA 3OPHA 4H6JA 1CJFA 5MC7A 1RCJA 2B5RA 4R6LA 4ZRRA 2INWA 2QHKA 3SH9A 4YINA 3QHYA 1BTLA 3UE1A 2BASA 4P6ZS 3MFXA 3EGXC 4LCMA 1EW0A 1FCNA 1GCEA 4G3WA 3T4QA 4JGOA 1E3UA 4Y0TA 1N9OA 4JBFA 3A3EA 2XQZA 1NRJA 3DTIA 1OTDA 2ZC6B 2QWSA 3CZDA 1YQSA 5CX7A 2ZQ9A 3BW6A 2PT7A 3JVVA 5DF8A 1Y28A 5GLAA 4WELA 1BLHA 3EEHA 3CITA 3LR0A 4FOFA 5FAQA 1I2SA 3G31A 4O0PA 4GCZA 3FWLA 1BSGA 2YKHA 2B18A 4II7A 1DP8A 2W3DA 1ZHHB 5KZHA 1IFQA 4JKTA 5CEDA 2XD5A 4CPKA 5EUAA 5HAPA 2O9BA 1JWPA 4EERA 1KOUA 2JCHA 1VHMA 1SDEA 4OKPA 4YNRA 2P9VA 1G28A 3MBZA 3FYZA 2I72A 3BQ8A 3E98A 3MXRA 4B93A 3T4JA 1T1BA 5A91A 1I2WA 4MLLA 5HAIA 2HF6A 4S2KA 4I5SA 2ZLYA 1I5QA 4Z9QA 2QMIA 5HX9A 2XK1A 5CHJA 4KZ6A 1E4DA 1K54C 3AGEA 4LRZE 1W79A 2VZWA 3F1OA 4S2LA 4R0QA 1N9NA 3BLMA 4EU0A 1IOUA 3FKVA 5HWTA 3ZCZA 4E3JA 4HIAA 3Q81A 3WS5A 5F82A 4JGPA 3EWKA 4HP4A 5DJUA 2P7JA 1KGGA 3NOPC 4X69A 3T4SA 4AFIA 5BOHA 1V9YA 3C4PA 3P09A 5L2FA 2WAEA 3CPTB 3Q7VB 4JGQA 1FILA 3FC7A 3RXXA 4ETXA 3VV4A 4UQIS 3LFVA 1IYSA 1GA9A 5EVIA 1OPXA 2Y2OA 2PHYA 3CUEC 3T4TA 2A3UA 1XGJA 3H7WA 1TDLA 2HGVA 3H9WA 2P08A 1LLBA 3T1SA 2DNSA 5AQ9A 4OVDA 5HDDA 3NHQA 3C7VA 1SZVA 5HPFA 1WE4A 1N9LA 4KZ4A 4WZ5A 5G18A 2QZ6A 2Y2KA 3MKFA 4PM8A 4S2NC 1YSPA 1NY0A 4NK3A 1KE4A 3QP8A 1VETB 2FH5A 1PWCA 5DTKA 3VP0A 3GECA 2VV6A 2ZC7A 1NJ4A 2UWXA 2B02A 5HDSA 3VP2A 2WK0A 2WKQA 4N92A 4KG2A 1L0GA 5IU1A 3EEAA 4P6BA 3BM6A 2G2UA 1SCWA 1NZOA 1Y4OA 3KSFA 1CI8A 3VP1A 4X53A 4DE1A 2EWVA 1K56A 1YAXA 1BULA 3LYXA 4DRTA 2ZL1A 4DDYA 4MCWA 3N8RA 3ZHHA 2PD7A 3U4LP 3HBRA 2BTFP 4CJNA 3D9YA 3IF6A 3NIAA 1K25A 3HLBA 4I3AA 4L9FA 5CGWA 4RA7A 1YLZA 2KX6A 4WEKA 3IBJA 4DKIA 3SW1A 3QP5A 1E3UD 3UPOA 4OOYA 1RGYA 4E3LA 1C3BA 3F1NB 1JVJA 2J80A 4PM7A 5HDCA 4KQDA 3UPPA 4B88A 3N6IA 4Q0IA 4CLCC 3BJNA 1HZOA 5EM1A 4QWOA 1K4EA 5DVAA 3NI9A 2L1MA 3IH8A 4I38A 5G4YA 4KZAA 4BLMA 2Y2NA 3ISGA 2V0WA 1ZTUA 2JKFA 2A24A 4DXBA 1YM1A 4ESPA 4G3VA 3T4LA 5A92A 3D4FA 3CLOA 5FQJA 4IBRA 3RXWA 4GNUA 1LI0A 5TBMB 1T19A 2WUQA 3UO9A 3A3JA 2Z6CA 4D2OA 4HESA 2PYRA 5FASA 3VOZA 4KZ5A 4ARZB 2V0UA 1FCOA 2O0YA 4R4RA 2PR6A 4GD8A 1CI9A 2VEAA 3LI9A 2JE5A 3PYPA 2P04A 4KG6A 2EX6A 1K38A 2Y2MA 3T1RA 3NDGA 3K2NA 5FQ9A 1Y54A 4X68A 3EQVA 1MWRA 4X6TA 5TFQA 4ZBEA 3IWQA 1A0KA 4P87A 5EOEA 2E8JA 3MKEA 5CGSA 1YLJA 5JYPA 2A24B 4MBKA 5CEBA 1NRFA 5J3WA 2XROA 1DY6A 1JWVA 5DFXA 1JTGA 4MN6A 2PU4A 3FKWA 3U2AA 2J7VA 1OMEA 1CEGA 1D7EA 3BFEA 4HEFA 1H8YA 2HDQA 3TJZC 4BL3A 4I39A 2QYBA 4EQ1A 2P74A 3CAXA 1AWIA 1L0DA 4M3KA 3AGFA 3C7UA 2ACGA 2JHEA 5EVID 5L07A 2ZC5B 1MPLA 4LV0A 3PBNA 5FL3A 2PD8A 1FR6A 4X56A 3OZHA 5HFOA 1TS0A 2ZJ9A 4MMNA 4JGRA 4MEZA 3PBOA 4KUKA 3MZEA 4OP5A 1IYPA 4BBVA 2L4RA 3PR6A 3A0SA 5A90A 3HLWA 2Y55A 3LIAA 3BECA 2OWJA 4S2JA 4ZTKA 3LI8A 3A3IA 5I94A 1VB6A 2VGLM 4S2IA 3SOIA 1PRQA 5K5BA 3LIDA 5IT5A 1LI9A 1NLZA 2QKPA 4K91A 4EWFA 1G5UA 5U47A 4FUWA 4PAUA 3OCLA 4Q8IA 3BFFA 5DF9A 3VE3A 3HL9A 3IS2A 3IXGA 3ZDJA 2ZM8A 5HZHA 1ONHA 1BLSA 1DP9A 1YLWA 5DTTA 2M7UA 4PKYG 4HH2A 1XJ2A 1K56D 1LSWA 3IT9A 1YKDA 3KO6A 3IF5A 4DE3A 4WUJA 4L9GA 4HJ3A 3S7PA 1G68A 2Y4AA 2M7VA 2OWHA 5CTNA 4HH3A 5IHVA 3MMHA 5HWVA 4ID4A 3BYDA 2IA2A 1XFQA 4UHUA 3MS6A 4GW9A 1JNUA 3W4OA 4OONA 3MQ0A 4U3TA 3OCNA 4XUZA 1PZPA 3IBRA 4N1HA 3MZDA 1BUEA 4E6XA 3K3DA 3G34A 2H10A 3MQOA 3FPVA 2HV1A 2PBYA 4IUKA 3C8CA 3GTCA 2ZOHA 4LFUA 1OJ5A 5CXWA 3C2WA 3S1YA 4OQ0A 5F6AA 4LV3A 2EXAA 1ZC2A 2WZZA 4MN7A 4MDZA 5CECA 2EXBA 3W4QA 4GB7A 4Y5FA 3D3OA 4BL2A 5FDSA 4R3AA 4E3OA 2C5WB 1IKGA 3UB9A 1XGIA 4RX2A 1WYBA 3JVUA 5M18A 3HVFA 3ZVTA 1STZA 2L0WA 4DMZA 4ETZA 2Y2HA 4WM9A 4FH4A 4P6ZM 1SKOB 4KQOA 2XD1A 5HL1A 3RH8B 4X1MA 3RJUA 5HARA 2XDMA 4IBXA 4K0WA 1N9BA 1P0ZA 3SH7A 4ZJ1A 4BENA 4L9EA 1LL9A 1UWPX 1OTEA 2JKRI 3FV7A 3ULFA 2WKPA 2NUPC 4UA6A 1MC0A 3VSLA 2ZD8A 3HUMA 1FSWA 1LHYA 3B47A 4K08A 2PYPA 4S2OA 2M1CA 3UNWA 4HOIA 4DN0A 4WYYA 3LY3A 3LR5A 5CGXA 1K6RA 4JXGA 2W0NA 4RYEA 1ES4A 3CPTA 3DBAA 3Q7VA 1ES2A 4BBUA 3DAVA 1SHVA 2E8IA 2XR0A 2EX2A 4OQIA 2V20A 3VP3A 4EQIA 5EV0A 4WF0A 4EESA 3B42A 4EETB 3BEBA 4DXCA 4MNRA 5AQ7A 2D01A 1XPBA 2HPBA 1GSXA 3GVBA 3GSGA 1K54A 5A93A 4U0XA 1LL8A 4ZDXA 4WZ4A 4JLFA 4LV2A 3NY4A 3QP2A 3UDIA 1J3WA 3LEZA 1UGUA 4OPYA 4BJPA 1VETA 2HJEA 2XFTA 4M4XA 1V9ZA 5DFYA 3IH9A 2ZBBA 2EX9A 1OT6A 3N8LA 3D72A 1OTAA 4F3LB 5EPHA 1H8ZA 4EV4A 4S2PA 4CQHA 2FZ0A 1ALQA 3BWLA 4GDBA 1OTBA 4UQIM 4GZBA 3S4XA 4B9OA 5FQIA 5F83A 5DKKA 3EQUA 3V3SA 1ACFA 4KG5A 4PHTA 3ITBA 1S4RA 1S67L 1FSYA 5CRFA 4Y2FA 3WS1A 3Q07A 4JPMA 1MY8A 1P9RA 4OH0A 3RFBA 4E04A 2HP5A 5EVIC 2HDRA 3O86A 1BLPA 2OLVA 5L09A 1CF0A 3TSGA 3UN7A 2X01A 2Y2QA 3PBTA 5L10A 5M19A 2V8FA 4H8RA 3F1NA 3BY8A 3G35A 4WZ5C 5I5LA 2XF3A 2WKIA 1JTDA 5HWWA 4LPZA 2YKFA 3NJAA 3UMDA 4YFMA 5GL9A 2VJWA 4QY6A 4KZ8A 2EFXA 3DTEA 2RL3A 3VOYA 1XFNA 3MQQA 3QP6A 3BFDA 3E0YA 2B95A 2RCXA 4KQRA 3WS0A 1WYCA 1NYYA 4EEUA 2C6WB 2QJ7A 1K57A 5TBMA 5L8MA 3W4PA 4WL9A 1MXOA 4ARZA 3IHBA 3ZGAB 1S66L 3GRJA 3SS5A 1KGFA 1LSXA 2WGWB 3G30A 3OLOA 1TD5A 1XXMA 2PRFA 4QJGA 3LO7A 3HUOA 1O07A 2OV5A 3T4OA 1MZUA 4UA9A 3UDXA 2VV7A 5FSRA 1YPRA 3VE4A 2EFUA 2LB5A 1HLUP 3IF6C 2BLSA 4P0MA 1E25A 1M6KA 1L0EA 3L7HA 5C5KA 4C3QA 3CMZA 2LB9A 4GOGA 3PBQA 1ES3A 4EBNA 1W63M 2Y59A 4HQAA 3ZG0A 3T12B 3UB8A 4E6WA 2O9CA 4ZJ3A 3MXSA 2OAQ1 4KUOA 4EUZA 4LENA 4XUXA 2Y79A 4RX3A 2OAP1 1OJGA 1FIKA 5KMWA 2PU2A 3IWOA 3O88A 1T18A 4CLCB 2ZC3B 1YSQA 4Y0OA 3TW8A 3UE0A 3N7WA 2W1TB 4E3KA 2ZQ8A 1PIOA 4WEJA 5E2GA 3UPNA 4C6YA 2Y2PA 2Y2JA 5GHYA 2GZAA 2DMWA 3BY9A 2HP9A 2OOLA 2PBDP 4IVIA 2R78A 3T1XA 1YMSA 1S1ZA 2W3FA 5G4ZA 2W3GA 2A49A 3DTKA 4JF5A 5KSCA 4NETA 3N4IA 5TR7A 2V1BA 3ITAA 3UB6A 3MR0A 4WMCA 2Z6DA 3V39A 3UMEA 3WRTA 1XJ4A 4X25A 3MJQA 3OPLA 2OSUA 5FI7A 4Y15A 2WGIA 3P7NA 1ESUA 1ZKJA 3MF0A 1KDSA 1ERMA 1BZAA 2WAFA 4I3IA 5HSQA 3FPWA 3PTEA 2ZQDA 1YLPA 1OTIA 2W27A 1K0KA 1VM1A 5D3OA 3IQAA 5J8XA 2WYXA 3G6OA 5FA7A 2JKRM
chains in the Genus database with same CATH topology
3ZVTA 5FI6A 1VQQA 4L0LA 4U0TA 1KGGA 1W7FA 4X69A 5BOHA 3A3FA 3BFCA 1MBLA 4E3MA 5FI2A 3QNBA 4OPRA 3C4PA 3P09A 5L2FA 2WAEA 3Q7VB 4QY5A 4FD8A 1U60A 4ZJ2A 3LY4A 4JXVA 2Y2HA 3RXXA 1HVBA 4WM9A 4FH4A 1IYSA 4LV1A 1GA9A 1DJAA 4FCFA 5EVIA 2J8YA 4KQOA 4UAAA 2Y2OA 2HP6A 2XD1A 5CHUA 4OLDA 2A3UA 5HL1A 1XGJA 1TDLA 4K0XA 2G2WA 1MKIA 1LLBA 4EBLA 2ZQCA 3RJUA 2DNSA 5AQ9A 1GHIA 5AQBA 4OVDA 1TVFA 5HARA 1TEMA 3C7VA 2XDMA 3OC2A 2H0TA 4IBXA 3WWXA 3VFFA 2ZQ7A 3ZG7B 2XEPA 4K0WA 1N9BA 3LCEA 3SH7A 1WE4A 1Q2QA 4ZJ1A 4BENA 4KZ4A 3IXDA 1LL9A 4WZ5A 4JF6A 5G18A 3FV7A 1N4OA 2QZ6A 3IF6B 4UA6A 3W8KA 4DF6A 4GN2A 3VSLA 1KVLA 2Y2KA 3C5AA 4JXWA 2ZD8A 5CTMA 3MKFA 4PM8A 3HUMA 1FSWA 1LHYA 1NY0A 1K55A 4HBUA 4NK3A 1KE4A 4S2NC 4S2OA 5FAOA 5FQKA 3ZG8B 2JC7A 3ZNYA 3MFDA 1Z6FA 2HDSA 3BLSA 3UNWA 2WGVA 1NZUA 2QPNA 1KDWA 1PWCA 4OPZA 5FATA 1LL5A 4OQGA 5DTKA 4WYYA 4Y7PA 4FH2A 2EX8A 3LY3A 1QMFA 3VP0A 3VFHA 4MBHA 5CGXA 3ZG9B 1K6RA 2XH9A 4JXGA 4RYEA 1PW8A 2CC1A 1ES4A 2VGJA 2ZC7A 4DE0A 3WRZA 1CK3A 5HW3A 1NJ4A 3Q7VA 4OLGA 4MBFA 1ES2A 2UWXA 1SHVA 2E8IA 2XR0A 2EX2A 3HLDA 3VP2A 2WK0A 4OQIA 1MWSA 2V20A 3VP3A 4EQIA 3OPPA 4N92A 4B4XA 4KG2A 1L0GA 4P6BA 3BM6A 1PWDA 2G2UA 3BEBA 4MNRA 5AQ7A 4DXCA 4IVKA 1SCWA 4PPRA 1PI5A 4QD4A 1NZOA 1XPBA 3O87A 1CI8A 2HPBA 3VP1A 3GVBA 4BD1A 4X53A 4DE1A 3GSGA 4UA7A 1K56A 1K54A 3HLFA 4KZ3A 3FZCA 1BULA 5A93A 4DRTA 3ZG5A 2R9XA 3CJMA 3DWKA 3SH8A 1PYYA 4U0XA 4DDYA 5JYOA 4ZDXA 1NYMA 4WZ4A 4RVAA 3N8RA 4ZAMA 3ZHHA 4JLFA 2VGKA 3HBRA 2V2FF 4LV2A 2Z2LB 4XXRA 2Y2LA 3NY4A 4CJNA 3UDIA 4OQHA 5EE8A 3LEZA 1K4FA 3N8SA 3IF6A 1ES5A 5GLDA 3NCKA 4OPYA 5EOOA 3PAEA 2XGNA 3NIAA 2OLUA 1ESIA 1K25A 3HLBA 4BJPA 1PI4A 5CGWA 1PWGA 4RA7A 1FOFA 5GLBA 3DWZA 1YLZA 2XFTA 2R9WA 3E2LA 1XA1A 3I7JA 4WEKA 1IKIA 1AXBA 2XLNA 1CEFA 4DKIA 3IH9A 4HBTA 2Z2MB 2EX9A 3N8LA 4DDSA 3HLEA 3V3RA 3GV9A 3NBLA 1E3UD 3UPOA 4OOYA 4N9LA 1RGYA 3HREA 1C3BA 4Y0UA 1MWUA 1S0WA 5EPHA 5FAPA 1H8ZA 1JVJA 3BFGA 4PM7A 3UPPA 4EV4A 4S2PA 3N6IA 4B88A 4LCLA 4BQMA 5KMWA 1HZOA 4GDBA 1ALQA 1K4EA 4S2MA 5DVAA 5CERA 3NI9A 3IH8A 1BLCA 4GZBA 4OPQA 2DCFA 4E3LA 4KZAA 3S4XA 3Q1FA 4BLMA 2Y2NA 4X55A 3ISGA 5FQIA 4DXBA 1YM1A 2X71A 5F83A 1QMEA 3EQUA 5AQAA 5A92A 3V3SA 4EBPA 3Q7ZA 4KG5A 3ITBA 1YMXA 2WKHA 2WZXA 5TGFA 1FSYA 5CHMA 3D4FA 5CRFA 1PZOA 3HLGA 3Q82A 5FQJA 4FSFA 5FDHA 3WS1A 2ZMAA 4IBRA 4R3BA 3RXWA 3Q07A 1XKZA 4JPMA 1MY8A 4GNUA 3VP4A 1LI0A 2ZC4B 2Y2IA 2WUQA 3UO9A 4R23A 3A3JA 1ERQA 4D2OA 4OH0A 1FR1A 4HESA 3HLCA 5FASA 4JF4A 4GKUA 3VOZA 2HP5A 4KZBA 5EVIC 3E2KA 5GHZA 2HDRA 1IYOA 4KZ5A 3S22A 2Y91A 2ZM2A 3O86A 4GDNA 1BLPA 1FCOA 4R4RA 1EWZA 1PW1A 4OOLA 2IWBA 4DE2A 2OLVA 1EI5A 3CG5A 4GD8A 1IEMA 1L2SA 5FQMA 1CI9A 1YT4A 2JE5A 3G32A 4N1XA 3TOIA 1M40A 2X02A 3TSGA 2EX6A 2Q9NA 1K38A 4KG6A 3UN7A 1MWTA 1RP5A 3ZFZA 2X01A 4WMCD 2Y2QA 3PBTA 3V50A 2Y2MA 2IWDA 5M19A 4H8RA 1NXYA 3NDGA 4QU3A 4PM5A 3O3VA 4KENB 3G35A 4WZ5C 4F94A 5FQ9A 4QB8A 2XF3A 1S6RA 1Y54A 2WKIA 1YLYA 4X68A 1JTDA 3EQVA 1MWRA 4X6TA 5F1GA 1W5DA 3G4PA 5TFQA 4ZBEA 3MZFA 1XP4A 3IWQA 5EECA 1XX2A 3SS4A 4P87A 4R4SA 3PAGA 3ZVWA 2IWCA 1K55C 1JWZA 4YFMA 5EOEA 2V1ZA 1GHMA 3GR2A 3PBSA 3GQZA 3MKEA 5CGSA 1YLJA 5GL9A 5JYPA 5FQQA 4QY6A 3M2JA 4KZ8A 2EFXA 4MBKA 3UDFA 2RL3A 3M6BA 5CEBA 3VOYA 4JXSA 1HD8A 1NRFA 2FFFB 1DY6A 1JWVA 2Q9MA 1W8QA 3BFDA 1JTGA 1YLTA 3V5MA 2RCXA 5M1AA 2HDUA 2PU4A 3FKWA 4KQRA 5DF7A 3WS0A 1WYCA 2J7VA 3IXHA 1NYYA 1CEGA 1OMEA 2DRWA 4N9KA 4R1GA 1ONGA 3BFEA 4HEFA 2C6WB 3IHAA 1H8YA 2J9PA 1K57A 5GHXA 2HDQA 4BL3A 3W4PA 4GD6A 4R3JA 3UE3A 3PBRA 1MXOA 3IHBA 3ZGAB 3ZNTA 2P74A 3GRJA 1GA0A 3WS4A 3SS5A 3HUNA 1KGFA 1L0DA 1O7EA 4M3KA 1KE3A 2WGWB 3G30A 4KZ9A 2J9OA 3AGFA 1ZG4A 3VSKA 3C7UA 4A5RA 5E2FA 5EVID 3NDEA 1XXMA 4O7DA 2ZC5B 1MPLA 3WS2A 4LV0A 3PBNA 4QJGA 3LO7A 3G2YA 3HUOA 1TDGA 1O07A 1FR6A 3A3DA 4X56A 2OV5A 5KSHA 4KQQA 2ZM0A 3AGDA 4UA9A 3OZHA 5FSRA 3TG9A 3UDXA 5HFOA 2ZJ9A 2EFUA 5E2HA 3IF6C 3M2KA 4OP8A 4QHCA 2BLSA 4PM6A 4P0MA 1E25A 3DTMA 3IWIA 1M6KA 1ZG6A 3G2ZA 1L0EA 4C3QA 4MEZA 1DJCA 2H0YA 3OPHA 3JYIA 3PBOA 1RCJA 1KGEA 3CMZA 2B5RA 3MZEA 4OP5A 4GOGA 1IYPA 3IXBA 1ES3A 3PBQA 4EBNA 5A90A 3HLWA 2Y55A 3SH9A 4YINA 2Y59A 3QHYA 3BECA 1BTLA 3ZG0A 3UE1A 4S2JA 5EVLA 4ZTKA 5I94A 2P9VB 3A3IA 1XA7A 4LCMA 4E6WA 1FCNA 1GCEA 2ZQAA 4S2NA 4S2IA 3BRMA 3SOIA 4ZJ3A 2GDNA 3MXSA 1E3UA 1DJBA 4Y0TA 4JBFA 4EUZA 4LENA 4XUXA 1Q2PA 1LI9A 2XFSA 5E43A 4RX3A 3A3EA 2XQZA 4K91A 4EWFA 5U47A 3UY6A 2ZC6B 1G6AA 3OCLA 4Q8IA 3BFFA 1BT5A 5DF9A 1J9MA 2PU2A 4OOMA 3IWOA 4BD0A 3CZDA 3M6HA 1YQSA 3O88A 3OPRA 2WGWA 2ZQ9A 4PM9A 3HL9A 3IXGA 3ZDJA 2ZM8A 1ONHA 1BLSA 1YLWA 2ZC3B 5GLCA 5DF8A 5DTTA 4Y0OA 3UE0A 5GLAA 3N7WA 1GHPA 4WELA 1BLHA 2WADA 1K56D 2ZQ8A 2BG1A 3IT9A 4E3KA 1PIOA 3IF5A 4WEJA 5E2GA 4DE3A 5FAQA 1I2SA 3G31A 3FWLA 3UPNA 1BSGA 1G68A 2Y4AA 3C4OA 4C6YA 2Y2PA 2Y2JA 1H5XA 5GHYA 4P85A 5CTNA 4E3IA 5KZHA 4JKTA 1RGZA 1L0FA 2HP9A 2XD5A 5IHVA 4CPKA 5EUAA 5CEDA 4IVIA 5HAPA 4ID4A 3BYDA 4UHUA 1YMSA 1JWPA 1K6SA 2JCHA 3W4OA 2A49A 1SDEA 4OKPA 4JF5A 4OONA 4NETA 5KSCA 3NC8A 4KZ7A 4C75A 1IELA 3N4IA 5TR7A 3VMAA 1KVMA 1SDNA 2P9VA 4U3TA 3OCNA 4WBGA 5F1FA 3ITAA 4XUZA 1PZPA 3GMWA 4N1HA 3MZDA 5EVIB 1IYQA 3MBZA 2FFYA 1BUEA 3FYZA 2I72A 4WMCA 4E6XA 3G34A 3MXRA 2H10A 3V39A 5A91A 1I2WA 2PBYA 3WRTA 4MLLA 1FCMA 5DTSA 5HAIA 4PMAA 3GTCA 4S2KA 3OPLA 2OSUA 2ZLYA 1I5QA 5CXWA 4Z9QA 5FI7A 3S1YA 4OQ0A 2QMIA 4LV3A 2WGIA 5HX9A 2Y2GA 2EXAA 2XK1A 1ESUA 5HAQA 5CHJA 2JBFA 4KZ6A 1E4DA 1EROA 1K54C 1ZKJA 3AGEA 3QNCA 1ZC2A 2WZZA 4B4ZA 1SKFA 1W79A 2H5SA 4E3NA 1KDSA 4S2LA 5CECA 4R0QA 1KE0A 2EXBA 3BLMA 3W4QA 1ERMA 4GB7A 1BZAA 3P98A 2WAFA 3SS3A 3FKVA 4BL2A 2WKEA 3ZCZA 4E3JA 3B3XA 3DW0A 3PTEA 1W8YA 2ZQDA 4E3OA 2C5WB 1YLPA 3Q81A 1IKGA 1K57C 1HTZA 1XGIA 4RX2A 3WS5A 1WYBA 1VM1A 5D3OA 3IQAA 5F82A 5J8XA 5E2EA 2WYXA 5M18A 5FA7A 3HVFA 1FQGA 4IEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZVT A;  5FI6 A;  1VQQ A;  4L0L A;  4U0T A;  1KGG A;  1W7F A;  4X69 A;  5BOH A;  3A3F A;  3BFC A;  1MBL A;  4E3M A;  5FI2 A;  3QNB A;  4OPR A;  3C4P A;  3P09 A;  5L2F A;  2WAE A;  3Q7V B;  4QY5 A;  4FD8 A;  1U60 A;  4ZJ2 A;  3LY4 A;  4JXV A;  2Y2H A;  3RXX A;  1HVB A;  4WM9 A;  4FH4 A;  1IYS A;  4LV1 A;  1GA9 A;  1DJA A;  4FCF A;  5EVI A;  2J8Y A;  4KQO A;  4UAA A;  2Y2O A;  2HP6 A;  2XD1 A;  5CHU A;  4OLD A;  2A3U A;  5HL1 A;  1XGJ A;  1TDL A;  4K0X A;  2G2W A;  1MKI A;  1LLB A;  4EBL A;  2ZQC A;  3RJU A;  2DNS A;  5AQ9 A;  1GHI A;  5AQB A;  4OVD A;  1TVF A;  5HAR A;  1TEM A;  3C7V A;  2XDM A;  3OC2 A;  2H0T A;  4IBX A;  3WWX A;  3VFF A;  2ZQ7 A;  3ZG7 B;  2XEP A;  4K0W A;  1N9B A;  3LCE A;  3SH7 A;  1WE4 A;  1Q2Q A;  4ZJ1 A;  4BEN A;  4KZ4 A;  3IXD A;  1LL9 A;  4WZ5 A;  4JF6 A;  5G18 A;  3FV7 A;  1N4O A;  2QZ6 A;  3IF6 B;  4UA6 A;  3W8K A;  4DF6 A;  4GN2 A;  3VSL A;  1KVL A;  2Y2K A;  3C5A A;  4JXW A;  2ZD8 A;  5CTM A;  3MKF A;  4PM8 A;  3HUM A;  1FSW A;  1LHY A;  1NY0 A;  1K55 A;  4HBU A;  4NK3 A;  1KE4 A;  4S2N C;  4S2O A;  5FAO A;  5FQK A;  3ZG8 B;  2JC7 A;  3ZNY A;  3MFD A;  1Z6F A;  2HDS A;  3BLS A;  3UNW A;  2WGV A;  1NZU A;  2QPN A;  1KDW A;  1PWC A;  4OPZ A;  5FAT A;  1LL5 A;  4OQG A;  5DTK A;  4WYY A;  4Y7P A;  4FH2 A;  2EX8 A;  3LY3 A;  1QMF A;  3VP0 A;  3VFH A;  4MBH A;  5CGX A;  3ZG9 B;  1K6R A;  2XH9 A;  4JXG A;  4RYE A;  1PW8 A;  2CC1 A;  1ES4 A;  2VGJ A;  2ZC7 A;  4DE0 A;  3WRZ A;  1CK3 A;  5HW3 A;  1NJ4 A;  3Q7V A;  4OLG A;  4MBF A;  1ES2 A;  2UWX A;  1SHV A;  2E8I A;  2XR0 A;  2EX2 A;  3HLD A;  3VP2 A;  2WK0 A;  4OQI A;  1MWS A;  2V20 A;  3VP3 A;  4EQI A;  3OPP A;  4N92 A;  4B4X A;  4KG2 A;  1L0G A;  4P6B A;  3BM6 A;  1PWD A;  2G2U A;  3BEB A;  4MNR A;  5AQ7 A;  4DXC A;  4IVK A;  1SCW A;  4PPR A;  1PI5 A;  4QD4 A;  1NZO A;  1XPB A;  3O87 A;  1CI8 A;  2HPB A;  3VP1 A;  3GVB A;  4BD1 A;  4X53 A;  4DE1 A;  3GSG A;  4UA7 A;  1K56 A;  1K54 A;  3HLF A;  4KZ3 A;  3FZC A;  1BUL A;  5A93 A;  4DRT A;  3ZG5 A;  2R9X A;  3CJM A;  3DWK A;  3SH8 A;  1PYY A;  4U0X A;  4DDY A;  5JYO A;  4ZDX A;  1NYM A;  4WZ4 A;  4RVA A;  3N8R A;  4ZAM A;  3ZHH A;  4JLF A;  2VGK A;  3HBR A;  2V2F F;  4LV2 A;  2Z2L B;  4XXR A;  2Y2L A;  3NY4 A;  4CJN A;  3UDI A;  4OQH A;  5EE8 A;  3LEZ A;  1K4F A;  3N8S A;  3IF6 A;  1ES5 A;  5GLD A;  3NCK A;  4OPY A;  5EOO A;  3PAE A;  2XGN A;  3NIA A;  2OLU A;  1ESI A;  1K25 A;  3HLB A;  4BJP A;  1PI4 A;  5CGW A;  1PWG A;  4RA7 A;  1FOF A;  5GLB A;  3DWZ A;  1YLZ A;  2XFT A;  2R9W A;  3E2L A;  1XA1 A;  3I7J A;  4WEK A;  1IKI A;  1AXB A;  2XLN A;  1CEF A;  4DKI A;  3IH9 A;  4HBT A;  2Z2M B;  2EX9 A;  3N8L A;  4DDS A;  3HLE A;  3V3R A;  3GV9 A;  3NBL A;  1E3U D;  3UPO A;  4OOY A;  4N9L A;  1RGY A;  3HRE A;  1C3B A;  4Y0U A;  1MWU A;  1S0W A;  5EPH A;  5FAP A;  1H8Z A;  1JVJ A;  3BFG A;  4PM7 A;  3UPP A;  4EV4 A;  4S2P A;  3N6I A;  4B88 A;  4LCL A;  4BQM A;  5KMW A;  1HZO A;  4GDB A;  1ALQ A;  1K4E A;  4S2M A;  5DVA A;  5CER A;  3NI9 A;  3IH8 A;  1BLC A;  4GZB A;  4OPQ A;  2DCF A;  4E3L A;  4KZA A;  3S4X A;  3Q1F A;  4BLM A;  2Y2N A;  4X55 A;  3ISG A;  5FQI A;  4DXB A;  1YM1 A;  2X71 A;  5F83 A;  1QME A;  3EQU A;  5AQA A;  5A92 A;  3V3S A;  4EBP A;  3Q7Z A;  4KG5 A;  3ITB A;  1YMX A;  2WKH A;  2WZX A;  5TGF A;  1FSY A;  5CHM A;  3D4F A;  5CRF A;  1PZO A;  3HLG A;  3Q82 A;  5FQJ A;  4FSF A;  5FDH A;  3WS1 A;  2ZMA A;  4IBR A;  4R3B A;  3RXW A;  3Q07 A;  1XKZ A;  4JPM A;  1MY8 A;  4GNU A;  3VP4 A;  1LI0 A;  2ZC4 B;  2Y2I A;  2WUQ A;  3UO9 A;  4R23 A;  3A3J A;  1ERQ A;  4D2O A;  4OH0 A;  1FR1 A;  4HES A;  3HLC A;  5FAS A;  4JF4 A;  4GKU A;  3VOZ A;  2HP5 A;  4KZB A;  5EVI C;  3E2K A;  5GHZ A;  2HDR A;  1IYO A;  4KZ5 A;  3S22 A;  2Y91 A;  2ZM2 A;  3O86 A;  4GDN A;  1BLP A;  1FCO A;  4R4R A;  1EWZ A;  1PW1 A;  4OOL A;  2IWB A;  4DE2 A;  2OLV A;  1EI5 A;  3CG5 A;  4GD8 A;  1IEM A;  1L2S A;  5FQM A;  1CI9 A;  1YT4 A;  2JE5 A;  3G32 A;  4N1X A;  3TOI A;  1M40 A;  2X02 A;  3TSG A;  2EX6 A;  2Q9N A;  1K38 A;  4KG6 A;  3UN7 A;  1MWT A;  1RP5 A;  3ZFZ A;  2X01 A;  4WMC D;  2Y2Q A;  3PBT A;  3V50 A;  2Y2M A;  2IWD A;  5M19 A;  4H8R A;  1NXY A;  3NDG A;  4QU3 A;  4PM5 A;  3O3V A;  4KEN B;  3G35 A;  4WZ5 C;  4F94 A;  5FQ9 A;  4QB8 A;  2XF3 A;  1S6R A;  1Y54 A;  2WKI A;  1YLY A;  4X68 A;  1JTD A;  3EQV A;  1MWR A;  4X6T A;  5F1G A;  1W5D A;  3G4P A;  5TFQ A;  4ZBE A;  3MZF A;  1XP4 A;  3IWQ A;  5EEC A;  1XX2 A;  3SS4 A;  4P87 A;  4R4S A;  3PAG A;  3ZVW A;  2IWC A;  1K55 C;  1JWZ A;  4YFM A;  5EOE A;  2V1Z A;  1GHM A;  3GR2 A;  3PBS A;  3GQZ A;  3MKE A;  5CGS A;  1YLJ A;  5GL9 A;  5JYP A;  5FQQ A;  4QY6 A;  3M2J A;  4KZ8 A;  2EFX A;  4MBK A;  3UDF A;  2RL3 A;  3M6B A;  5CEB A;  3VOY A;  4JXS A;  1HD8 A;  1NRF A;  2FFF B;  1DY6 A;  1JWV A;  2Q9M A;  1W8Q A;  3BFD A;  1JTG A;  1YLT A;  3V5M A;  2RCX A;  5M1A A;  2HDU A;  2PU4 A;  3FKW A;  4KQR A;  5DF7 A;  3WS0 A;  1WYC A;  2J7V A;  3IXH A;  1NYY A;  1CEG A;  1OME A;  2DRW A;  4N9K A;  4R1G A;  1ONG A;  3BFE A;  4HEF A;  2C6W B;  3IHA A;  1H8Y A;  2J9P A;  1K57 A;  5GHX A;  2HDQ A;  4BL3 A;  3W4P A;  4GD6 A;  4R3J A;  3UE3 A;  3PBR A;  1MXO A;  3IHB A;  3ZGA B;  3ZNT A;  2P74 A;  3GRJ A;  1GA0 A;  3WS4 A;  3SS5 A;  3HUN A;  1KGF A;  1L0D A;  1O7E A;  4M3K A;  1KE3 A;  2WGW B;  3G30 A;  4KZ9 A;  2J9O A;  3AGF A;  1ZG4 A;  3VSK A;  3C7U A;  4A5R A;  5E2F A;  5EVI D;  3NDE A;  1XXM A;  4O7D A;  2ZC5 B;  1MPL A;  3WS2 A;  4LV0 A;  3PBN A;  4QJG A;  3LO7 A;  3G2Y A;  3HUO A;  1TDG A;  1O07 A;  1FR6 A;  3A3D A;  4X56 A;  2OV5 A;  5KSH A;  4KQQ A;  2ZM0 A;  3AGD A;  4UA9 A;  3OZH A;  5FSR A;  3TG9 A;  3UDX A;  5HFO A;  2ZJ9 A;  2EFU A;  5E2H A;  3IF6 C;  3M2K A;  4OP8 A;  4QHC A;  2BLS A;  4PM6 A;  4P0M A;  1E25 A;  3DTM A;  3IWI A;  1M6K A;  1ZG6 A;  3G2Z A;  1L0E A;  4C3Q A;  4MEZ A;  1DJC A;  2H0Y A;  3OPH A;  3JYI A;  3PBO A;  1RCJ A;  1KGE A;  3CMZ A;  2B5R A;  3MZE A;  4OP5 A;  4GOG A;  1IYP A;  3IXB A;  1ES3 A;  3PBQ A;  4EBN A;  5A90 A;  3HLW A;  2Y55 A;  3SH9 A;  4YIN A;  2Y59 A;  3QHY A;  3BEC A;  1BTL A;  3ZG0 A;  3UE1 A;  4S2J A;  5EVL A;  4ZTK A;  5I94 A;  2P9V B;  3A3I A;  1XA7 A;  4LCM A;  4E6W A;  1FCN A;  1GCE A;  2ZQA A;  4S2N A;  4S2I A;  3BRM A;  3SOI A;  4ZJ3 A;  2GDN A;  3MXS A;  1E3U A;  1DJB A;  4Y0T A;  4JBF A;  4EUZ A;  4LEN A;  4XUX A;  1Q2P A;  1LI9 A;  2XFS A;  5E43 A;  4RX3 A;  3A3E A;  2XQZ A;  4K91 A;  4EWF A;  5U47 A;  3UY6 A;  2ZC6 B;  1G6A A;  3OCL A;  4Q8I A;  3BFF A;  1BT5 A;  5DF9 A;  1J9M A;  2PU2 A;  4OOM A;  3IWO A;  4BD0 A;  3CZD A;  3M6H A;  1YQS A;  3O88 A;  3OPR A;  2WGW A;  2ZQ9 A;  4PM9 A;  3HL9 A;  3IXG A;  3ZDJ A;  2ZM8 A;  1ONH A;  1BLS A;  1YLW A;  2ZC3 B;  5GLC A;  5DF8 A;  5DTT A;  4Y0O A;  3UE0 A;  5GLA A;  3N7W A;  1GHP A;  4WEL A;  1BLH A;  2WAD A;  1K56 D;  2ZQ8 A;  2BG1 A;  3IT9 A;  4E3K A;  1PIO A;  3IF5 A;  4WEJ A;  5E2G A;  4DE3 A;  5FAQ A;  1I2S A;  3G31 A;  3FWL A;  3UPN A;  1BSG A;  1G68 A;  2Y4A A;  3C4O A;  4C6Y A;  2Y2P A;  2Y2J A;  1H5X A;  5GHY A;  4P85 A;  5CTN A;  4E3I A;  5KZH A;  4JKT A;  1RGZ A;  1L0F A;  2HP9 A;  2XD5 A;  5IHV A;  4CPK A;  5EUA A;  5CED A;  4IVI A;  5HAP A;  4ID4 A;  3BYD A;  4UHU A;  1YMS A;  1JWP A;  1K6S A;  2JCH A;  3W4O A;  2A49 A;  1SDE A;  4OKP A;  4JF5 A;  4OON A;  4NET A;  5KSC A;  3NC8 A;  4KZ7 A;  4C75 A;  1IEL A;  3N4I A;  5TR7 A;  3VMA A;  1KVM A;  1SDN A;  2P9V A;  4U3T A;  3OCN A;  4WBG A;  5F1F A;  3ITA A;  4XUZ A;  1PZP A;  3GMW A;  4N1H A;  3MZD A;  5EVI B;  1IYQ A;  3MBZ A;  2FFY A;  1BUE A;  3FYZ A;  2I72 A;  4WMC A;  4E6X A;  3G34 A;  3MXR A;  2H10 A;  3V39 A;  5A91 A;  1I2W A;  2PBY A;  3WRT A;  4MLL A;  1FCM A;  5DTS A;  5HAI A;  4PMA A;  3GTC A;  4S2K A;  3OPL A;  2OSU A;  2ZLY A;  1I5Q A;  5CXW A;  4Z9Q A;  5FI7 A;  3S1Y A;  4OQ0 A;  2QMI A;  4LV3 A;  2WGI A;  5HX9 A;  2Y2G A;  2EXA A;  2XK1 A;  1ESU A;  5HAQ A;  5CHJ A;  2JBF A;  4KZ6 A;  1E4D A;  1ERO A;  1K54 C;  1ZKJ A;  3AGE A;  3QNC A;  1ZC2 A;  2WZZ A;  4B4Z A;  1SKF A;  1W79 A;  2H5S A;  4E3N A;  1KDS A;  4S2L A;  5CEC A;  4R0Q A;  1KE0 A;  2EXB A;  3BLM A;  3W4Q A;  1ERM A;  4GB7 A;  1BZA A;  3P98 A;  2WAF A;  3SS3 A;  3FKV A;  4BL2 A;  2WKE A;  3ZCZ A;  4E3J A;  3B3X A;  3DW0 A;  3PTE A;  1W8Y A;  2ZQD A;  4E3O A;  2C5W B;  1YLP A;  3Q81 A;  1IKG A;  1K57 C;  1HTZ A;  1XGI A;  4RX2 A;  3WS5 A;  1WYB A;  1VM1 A;  5D3O A;  3IQA A;  5F82 A;  5J8X A;  5E2E A;  2WYX A;  5M18 A;  5FA7 A;  3HVF A;  1FQG A;  4IED A; 
#chains in the Genus database with same CATH topology
 5FI6 A;  4U0T A;  4EEP A;  4X1L A;  4HNB A;  3A3F A;  1MBL A;  4E3M A;  5FI2 A;  3QNB A;  2D02 A;  4QY5 A;  4XT2 B;  1NWZ A;  1U60 A;  4ZJ2 A;  3LY4 A;  5J7E A;  4JXV A;  3T50 A;  4LGW A;  4LV1 A;  4GHI B;  4GJ4 A;  4FCF A;  4UAA A;  1T1A A;  4OLD A;  3BQA A;  3NOT C;  4QPR A;  3QP1 A;  1GHI A;  5AQB A;  3OC2 A;  2H0T A;  3WWX A;  3VFF A;  2VGL S;  3LCE A;  1Q2Q A;  2K31 A;  4JF6 A;  4BMW A;  1N4O A;  3EOI A;  3W8K A;  4DF6 A;  3IX8 A;  2W3E A;  5CTM A;  3NOU C;  4JXW A;  4HBU A;  1K55 A;  5FAO A;  4NG2 A;  5FQK A;  4EUV A;  3ZG8 B;  2JC7 A;  3ZNY A;  2JKT I;  2HDS A;  1NZU A;  2QPN A;  4OPZ A;  5FAT A;  1LL5 A;  4Y7P A;  4FH2 A;  2EX8 A;  3CHW P;  3F1P B;  1QMF A;  1VEU B;  4MBH A;  2XA7 M;  2XH9 A;  4BBT A;  1PW8 A;  3ZQ5 A;  5HW3 A;  2UV0 E;  4MBF A;  2MJ6 A;  2O99 A;  3H82 B;  3B33 A;  1MWS A;  1SKO A;  5AVF A;  4PPR A;  4QD4 A;  3LR3 A;  4UA7 A;  4KZ3 A;  3HLF A;  3FZC A;  2PDR A;  3HJK A;  3ZG5 A;  3DWK A;  3SH8 A;  1NYM A;  4RVA A;  4ZAM A;  2XSS A;  2V2F F;  2Z2L B;  4XXR A;  1K4F A;  3E4Q A;  1ES5 A;  5GLD A;  3NCK A;  4Y13 A;  5LBR A;  3PAE A;  2HZ5 A;  3KX0 X;  2XGN A;  4O01 A;  4FTX A;  1PI4 A;  1MKM A;  5GLB A;  1XJ6 A;  2R9W A;  3E2L A;  1IKI A;  1AXB A;  1F2K A;  1CEF A;  3LR4 A;  1ODV A;  4HBT A;  4ME4 A;  2Z2M B;  2JKG A;  1WA9 A;  3NBL A;  5FAP A;  4LCL A;  4BQM A;  4S2M A;  1GSW A;  3KSG A;  3FG8 A;  2KDK A;  4X55 A;  3EGD C;  4Z1W A;  3GDI A;  2GX5 A;  5J4E A;  2X71 A;  2VX8 A;  2H28 A;  5AQA A;  3R7W B;  4EBP A;  3Q7Z A;  1TS8 A;  2WKH A;  1PZO A;  3HLG A;  4FSF A;  5HD5 A;  4R3B A;  1F9I A;  3VP4 A;  3UB7 A;  2VV8 A;  4R23 A;  5HPI A;  4HHD A;  1FR1 A;  4O8G A;  4JF4 A;  4GKU A;  3KSI A;  1IYO A;  2W3H A;  3S22 A;  2Y91 A;  2ZM2 A;  4GDN A;  3LIC A;  3TRC A;  1EWZ A;  1PW1 A;  2PR5 A;  4OOL A;  2IWB A;  1EI5 A;  2J3T D;  1IEM A;  1L2S A;  5FQM A;  3G32 A;  5AJG A;  3TOI A;  1M40 A;  2X02 A;  2Q9N A;  1F5M A;  4HP9 A;  3JPU A;  1MWT A;  4GS9 A;  4WMC D;  4F3L A;  3V50 A;  2IWD A;  3CI6 A;  1NXY A;  4QU3 A;  3O3V A;  1LSV A;  3QP4 A;  1S6R A;  1YLY A;  5TJJ A;  3MZF A;  4HI4 A;  5EEC A;  1XX2 A;  3LGO A;  3SS4 A;  4EW7 A;  3A0V A;  4H6J B;  3GR2 A;  2VLG A;  3PBS A;  2A2L A;  3GQZ A;  3M2J A;  4WN5 A;  4JXS A;  1HD8 A;  2FFF B;  1W8Q A;  3IX3 A;  3V5M A;  2EA9 A;  1L3L A;  2W1R A;  3P01 A;  2HDU A;  5DF7 A;  4R1G A;  3IXH A;  4N9K A;  2KLI A;  3KYQ A;  1ONG A;  5F68 A;  5IS1 A;  2Q0O A;  4R3J A;  3UE3 A;  3PBR A;  2J3W A;  3L9K A;  3LIE A;  3WS4 A;  4YOF A;  3HUN A;  4YWZ A;  1O7E A;  1KE3 A;  1TF1 A;  2G7U A;  3UE6 A;  4A5R A;  4GLQ A;  4GS9 B;  2QJ5 A;  3G2Y A;  1TDG A;  3A3D A;  2VKS A;  4UEY A;  5KSH A;  3CUE A;  2ZM0 A;  3AGD A;  1GSV A;  3IWI A;  1ZG6 A;  1DJC A;  2H0Y A;  3JYI A;  1KGE A;  3IXB A;  3LIF A;  1H3Q A;  3R4K A;  4R38 A;  5EVL A;  2P9V B;  1XA7 A;  1UWN X;  4PKY A;  2ZQA A;  4S2N A;  3BRM A;  2GDN A;  1DJB A;  1Q2P A;  2XFS A;  5E43 A;  3UY6 A;  4BWI A;  1G6A A;  4BD0 A;  1BT5 A;  1J9M A;  4OOM A;  3M6H A;  3OPR A;  2WGW A;  4PM9 A;  3F1O B;  5GLC A;  3HCY A;  1GHP A;  2XRN A;  2WAD A;  3V67 A;  2BG1 A;  3C4O A;  1H5X A;  1CQA A;  4P85 A;  5EFW A;  5KIZ A;  4NEE D;  4E3I A;  1RGZ A;  1L0F A;  1K6S A;  1S1Y A;  3NC8 A;  4KZ7 A;  4WLA A;  4C75 A;  1IEL A;  2Y8H A;  3MXQ A;  3VMA A;  1KVM A;  1SDN A;  4WBG A;  5F1F A;  3GMW A;  5EVI B;  1IYQ A;  2VA0 A;  1P97 A;  2FFY A;  3H7W B;  3LIB A;  2EWW A;  3C38 A;  2HJ9 C;  1FCM A;  5DTS A;  4PMA A;  1T1C A;  1H8M A;  5HAQ A;  2Y2G A;  2JBF A;  1ERO A;  3QNC A;  4B4Z A;  1SKF A;  2H5S A;  4CLC A;  4E3N A;  1KE0 A;  4LRX C;  3W2Z A;  3P98 A;  3SS3 A;  2W1T A;  2WKE A;  3B3X A;  3DW0 A;  1W8Y A;  1PNE A;  5DKL A;  1K57 C;  1HTZ A;  5E2E A;  1FQG A;  4IED A;  4HJ4 A;  3CWF A;  3ICY A;  1VQQ A;  4L0L A;  1W7F A;  3BFC A;  3PHY A;  4OPR A;  3A0R A;  3OOV A;  4FD8 A;  2JKT M;  1Z09 A;  4RQ9 A;  1HVB A;  1D1J A;  4LRY C;  1DJA A;  2J8Y A;  5F69 A;  2HP6 A;  4D60 A;  1H0M A;  5CHU A;  4K0X A;  2G2W A;  1MKI A;  4EBL A;  2ZQC A;  3PXP A;  5DJT A;  1TVF A;  1OT9 A;  1TEM A;  2ZL1 B;  2ZQ7 A;  3ZG7 B;  2XEP A;  2JN7 A;  3IXD A;  3T1Q B;  1G6O A;  3IF6 B;  1TS6 A;  4DJ3 A;  4GN2 A;  1KVL A;  3C5A A;  5A8B A;  3MFD A;  1Z6F A;  3BLS A;  2WGV A;  1NLY A;  1D06 A;  1F98 A;  3KYE A;  4NKP A;  3KSH A;  3SZT A;  1KDW A;  3S7Q A;  4OQG A;  2ZMV A;  3VFH A;  3ZG9 B;  3T4K A;  1P9W A;  2CC1 A;  2VGJ A;  3UB5 P;  4DE0 A;  3WRZ A;  1CK3 A;  4OLG A;  4LLO B;  4XT2 A;  3TE8 A;  1DP6 A;  5EVE A;  3HLD A;  3OPP A;  4B4X A;  4GHI A;  3KYZ A;  1PWD A;  4IVK A;  3MSH A;  1PI5 A;  3O87 A;  4NXG A;  5HD3 A;  4BD1 A;  4G3K A;  2R9X A;  3CJM A;  1PYY A;  5JYO A;  5HL6 A;  2VGK A;  5AVE A;  2Y2L A;  4OQH A;  5EE8 A;  3NUL A;  4DJ2 A;  3N8S A;  2J3T C;  4CLC E;  5EOO A;  3S7O A;  2OLU A;  3VOL A;  1ESI A;  1PWG A;  1FOF A;  3DWZ A;  3I7J A;  1XA1 A;  4IHQ A;  2XLN A;  2CMN A;  4MN5 A;  3F1P A;  1VEU A;  4DDS A;  3OBF A;  3HLE A;  3V3R A;  3GV9 A;  4N9L A;  3HRE A;  1PFL A;  4Y0U A;  1MWU A;  1S0W A;  3LUQ A;  3BFG A;  2AVX A;  3H82 A;  5CER A;  1BLC A;  4OPQ A;  2DCF A;  2GJ3 A;  2I9V A;  3Q1F A;  4HY8 A;  4IJG A;  4NXF A;  1QME A;  1YMX A;  2WZX A;  5TGF A;  1XJ3 A;  5CHM A;  4Q0H A;  3Q82 A;  3C30 A;  5FDH A;  2ZMA A;  3HJI A;  1XKZ A;  4NXB A;  2ZC4 B;  2Y2I A;  2VK3 A;  1ERQ A;  4Y3I A;  2WKR A;  3HLC A;  5GHZ A;  2KOI A;  2ZOI A;  3E2K A;  3IX4 A;  4KZB A;  4DE2 A;  3CG5 A;  1LT0 A;  1YT4 A;  4N1X A;  1TS7 A;  2O9A A;  3LEQ A;  1DRM A;  1RP5 A;  3ZFZ A;  4PM5 A;  4KEN B;  4Q0J A;  4F94 A;  4QB8 A;  4I3J A;  3ZYT A;  2K7S A;  2V1A A;  5F1G A;  1W5D A;  2PAV P;  3G4P A;  1XP4 A;  2K2N A;  2ZMF A;  4R4S A;  3ZVW A;  3PAG A;  2IWC A;  1K55 C;  1JWZ A;  2V1Z A;  1GHM A;  5FEG A;  2XA7 S;  4CLC D;  2NUT C;  4HJ6 A;  5FQQ A;  3S7N A;  2V8C A;  5F5Y A;  4Y17 A;  3UDF A;  3M6B A;  3R7W A;  4IUH A;  2Q9M A;  1X0O A;  1YLT A;  5M1A A;  2V9A A;  2DRW A;  3IHA A;  2J9P A;  5GHX A;  4GD6 A;  1S4S A;  4R70 A;  3ZNT A;  4NXE A;  5EM0 A;  1GA0 A;  4KZ9 A;  2J9O A;  3IS2 B;  1ZG4 A;  3E4P A;  4EXO A;  3VSK A;  2GNX A;  3NEC A;  5E2F A;  3NDE A;  3E4O A;  4O7D A;  3WS2 A;  3RTY A;  1W63 Q;  4KQQ A;  3TG9 A;  3O5Y A;  5E2H A;  5FEF A;  3M2K A;  4OP8 A;  4QHC A;  4PM6 A;  3DTM A;  3G2Z A;  1BYW A;  3K3C A;  3OPH A;  4H6J A;  1CJF A;  5MC7 A;  1RCJ A;  2B5R A;  4R6L A;  4ZRR A;  2INW A;  2QHK A;  3SH9 A;  4YIN A;  3QHY A;  1BTL A;  3UE1 A;  2BAS A;  4P6Z S;  3MFX A;  3EGX C;  4LCM A;  1EW0 A;  1FCN A;  1GCE A;  4G3W A;  3T4Q A;  4JGO A;  1E3U A;  4Y0T A;  1N9O A;  4JBF A;  3A3E A;  2XQZ A;  1NRJ A;  3DTI A;  1OTD A;  2ZC6 B;  2QWS A;  3CZD A;  1YQS A;  5CX7 A;  2ZQ9 A;  3BW6 A;  2PT7 A;  3JVV A;  5DF8 A;  1Y28 A;  5GLA A;  4WEL A;  1BLH A;  3EEH A;  3CIT A;  3LR0 A;  4FOF A;  5FAQ A;  1I2S A;  3G31 A;  4O0P A;  4GCZ A;  3FWL A;  1BSG A;  2YKH A;  2B18 A;  4II7 A;  1DP8 A;  2W3D A;  1ZHH B;  5KZH A;  1IFQ A;  4JKT A;  5CED A;  2XD5 A;  4CPK A;  5EUA A;  5HAP A;  2O9B A;  1JWP A;  4EER A;  1KOU A;  2JCH A;  1VHM A;  1SDE A;  4OKP A;  4YNR A;  2P9V A;  1G28 A;  3MBZ A;  3FYZ A;  2I72 A;  3BQ8 A;  3E98 A;  3MXR A;  4B93 A;  3T4J A;  1T1B A;  5A91 A;  1I2W A;  4MLL A;  5HAI A;  2HF6 A;  4S2K A;  4I5S A;  2ZLY A;  1I5Q A;  4Z9Q A;  2QMI A;  5HX9 A;  2XK1 A;  5CHJ A;  4KZ6 A;  1E4D A;  1K54 C;  3AGE A;  4LRZ E;  1W79 A;  2VZW A;  3F1O A;  4S2L A;  4R0Q A;  1N9N A;  3BLM A;  4EU0 A;  1IOU A;  3FKV A;  5HWT A;  3ZCZ A;  4E3J A;  4HIA A;  3Q81 A;  3WS5 A;  5F82 A;  4JGP A;  3EWK A;  4HP4 A;  5DJU A;  2P7J A;  1KGG A;  3NOP C;  4X69 A;  3T4S A;  4AFI A;  5BOH A;  1V9Y A;  3C4P A;  3P09 A;  5L2F A;  2WAE A;  3CPT B;  3Q7V B;  4JGQ A;  1FIL A;  3FC7 A;  3RXX A;  4ETX A;  3VV4 A;  4UQI S;  3LFV A;  1IYS A;  1GA9 A;  5EVI A;  1OPX A;  2Y2O A;  2PHY A;  3CUE C;  3T4T A;  2A3U A;  1XGJ A;  3H7W A;  1TDL A;  2HGV A;  3H9W A;  2P08 A;  1LLB A;  3T1S A;  2DNS A;  5AQ9 A;  4OVD A;  5HDD A;  3NHQ A;  3C7V A;  1SZV A;  5HPF A;  1WE4 A;  1N9L A;  4KZ4 A;  4WZ5 A;  5G18 A;  2QZ6 A;  2Y2K A;  3MKF A;  4PM8 A;  4S2N C;  1YSP A;  1NY0 A;  4NK3 A;  1KE4 A;  3QP8 A;  1VET B;  2FH5 A;  1PWC A;  5DTK A;  3VP0 A;  3GEC A;  2VV6 A;  2ZC7 A;  1NJ4 A;  2UWX A;  2B02 A;  5HDS A;  3VP2 A;  2WK0 A;  2WKQ A;  4N92 A;  4KG2 A;  1L0G A;  5IU1 A;  3EEA A;  4P6B A;  3BM6 A;  2G2U A;  1SCW A;  1NZO A;  1Y4O A;  3KSF A;  1CI8 A;  3VP1 A;  4X53 A;  4DE1 A;  2EWV A;  1K56 A;  1YAX A;  1BUL A;  3LYX A;  4DRT A;  2ZL1 A;  4DDY A;  4MCW A;  3N8R A;  3ZHH A;  2PD7 A;  3U4L P;  3HBR A;  2BTF P;  4CJN A;  3D9Y A;  3IF6 A;  3NIA A;  1K25 A;  3HLB A;  4I3A A;  4L9F A;  5CGW A;  4RA7 A;  1YLZ A;  2KX6 A;  4WEK A;  3IBJ A;  4DKI A;  3SW1 A;  3QP5 A;  1E3U D;  3UPO A;  4OOY A;  1RGY A;  4E3L A;  1C3B A;  3F1N B;  1JVJ A;  2J80 A;  4PM7 A;  5HDC A;  4KQD A;  3UPP A;  4B88 A;  3N6I A;  4Q0I A;  4CLC C;  3BJN A;  1HZO A;  5EM1 A;  4QWO A;  1K4E A;  5DVA A;  3NI9 A;  2L1M A;  3IH8 A;  4I38 A;  5G4Y A;  4KZA A;  4BLM A;  2Y2N A;  3ISG A;  2V0W A;  1ZTU A;  2JKF A;  2A24 A;  4DXB A;  1YM1 A;  4ESP A;  4G3V A;  3T4L A;  5A92 A;  3D4F A;  3CLO A;  5FQJ A;  4IBR A;  3RXW A;  4GNU A;  1LI0 A;  5TBM B;  1T19 A;  2WUQ A;  3UO9 A;  3A3J A;  2Z6C A;  4D2O A;  4HES A;  2PYR A;  5FAS A;  3VOZ A;  4KZ5 A;  4ARZ B;  2V0U A;  1FCO A;  2O0Y A;  4R4R A;  2PR6 A;  4GD8 A;  1CI9 A;  2VEA A;  3LI9 A;  2JE5 A;  3PYP A;  2P04 A;  4KG6 A;  2EX6 A;  1K38 A;  2Y2M A;  3T1R A;  3NDG A;  3K2N A;  5FQ9 A;  1Y54 A;  4X68 A;  3EQV A;  1MWR A;  4X6T A;  5TFQ A;  4ZBE A;  3IWQ A;  1A0K A;  4P87 A;  5EOE A;  2E8J A;  3MKE A;  5CGS A;  1YLJ A;  5JYP A;  2A24 B;  4MBK A;  5CEB A;  1NRF A;  5J3W A;  2XRO A;  1DY6 A;  1JWV A;  5DFX A;  1JTG A;  4MN6 A;  2PU4 A;  3FKW A;  3U2A A;  2J7V A;  1OME A;  1CEG A;  1D7E A;  3BFE A;  4HEF A;  1H8Y A;  2HDQ A;  3TJZ C;  4BL3 A;  4I39 A;  2QYB A;  4EQ1 A;  2P74 A;  3CAX A;  1AWI A;  1L0D A;  4M3K A;  3AGF A;  3C7U A;  2ACG A;  2JHE A;  5EVI D;  5L07 A;  2ZC5 B;  1MPL A;  4LV0 A;  3PBN A;  5FL3 A;  2PD8 A;  1FR6 A;  4X56 A;  3OZH A;  5HFO A;  1TS0 A;  2ZJ9 A;  4MMN A;  4JGR A;  4MEZ A;  3PBO A;  4KUK A;  3MZE A;  4OP5 A;  1IYP A;  4BBV A;  2L4R A;  3PR6 A;  3A0S A;  5A90 A;  3HLW A;  2Y55 A;  3LIA A;  3BEC A;  2OWJ A;  4S2J A;  4ZTK A;  3LI8 A;  3A3I A;  5I94 A;  1VB6 A;  2VGL M;  4S2I A;  3SOI A;  1PRQ A;  5K5B A;  3LID A;  5IT5 A;  1LI9 A;  1NLZ A;  2QKP A;  4K91 A;  4EWF A;  1G5U A;  5U47 A;  4FUW A;  4PAU A;  3OCL A;  4Q8I A;  3BFF A;  5DF9 A;  3VE3 A;  3HL9 A;  3IS2 A;  3IXG A;  3ZDJ A;  2ZM8 A;  5HZH A;  1ONH A;  1BLS A;  1DP9 A;  1YLW A;  5DTT A;  2M7U A;  4PKY G;  4HH2 A;  1XJ2 A;  1K56 D;  1LSW A;  3IT9 A;  1YKD A;  3KO6 A;  3IF5 A;  4DE3 A;  4WUJ A;  4L9G A;  4HJ3 A;  3S7P A;  1G68 A;  2Y4A A;  2M7V A;  2OWH A;  5CTN A;  4HH3 A;  5IHV A;  3MMH A;  5HWV A;  4ID4 A;  3BYD A;  2IA2 A;  1XFQ A;  4UHU A;  3MS6 A;  4GW9 A;  1JNU A;  3W4O A;  4OON A;  3MQ0 A;  4U3T A;  3OCN A;  4XUZ A;  1PZP A;  3IBR A;  4N1H A;  3MZD A;  1BUE A;  4E6X A;  3K3D A;  3G34 A;  2H10 A;  3MQO A;  3FPV A;  2HV1 A;  2PBY A;  4IUK A;  3C8C A;  3GTC A;  2ZOH A;  4LFU A;  1OJ5 A;  5CXW A;  3C2W A;  3S1Y A;  4OQ0 A;  5F6A A;  4LV3 A;  2EXA A;  1ZC2 A;  2WZZ A;  4MN7 A;  4MDZ A;  5CEC A;  2EXB A;  3W4Q A;  4GB7 A;  4Y5F A;  3D3O A;  4BL2 A;  5FDS A;  4R3A A;  4E3O A;  2C5W B;  1IKG A;  3UB9 A;  1XGI A;  4RX2 A;  1WYB A;  3JVU A;  5M18 A;  3HVF A;  3ZVT A;  1STZ A;  2L0W A;  4DMZ A;  4ETZ A;  2Y2H A;  4WM9 A;  4FH4 A;  4P6Z M;  1SKO B;  4KQO A;  2XD1 A;  5HL1 A;  3RH8 B;  4X1M A;  3RJU A;  5HAR A;  2XDM A;  4IBX A;  4K0W A;  1N9B A;  1P0Z A;  3SH7 A;  4ZJ1 A;  4BEN A;  4L9E A;  1LL9 A;  1UWP X;  1OTE A;  2JKR I;  3FV7 A;  3ULF A;  2WKP A;  2NUP C;  4UA6 A;  1MC0 A;  3VSL A;  2ZD8 A;  3HUM A;  1FSW A;  1LHY A;  3B47 A;  4K08 A;  2PYP A;  4S2O A;  2M1C A;  3UNW A;  4HOI A;  4DN0 A;  4WYY A;  3LY3 A;  3LR5 A;  5CGX A;  1K6R A;  4JXG A;  2W0N A;  4RYE A;  1ES4 A;  3CPT A;  3DBA A;  3Q7V A;  1ES2 A;  4BBU A;  3DAV A;  1SHV A;  2E8I A;  2XR0 A;  2EX2 A;  4OQI A;  2V20 A;  3VP3 A;  4EQI A;  5EV0 A;  4WF0 A;  4EES A;  3B42 A;  4EET B;  3BEB A;  4DXC A;  4MNR A;  5AQ7 A;  2D01 A;  1XPB A;  2HPB A;  1GSX A;  3GVB A;  3GSG A;  1K54 A;  5A93 A;  4U0X A;  1LL8 A;  4ZDX A;  4WZ4 A;  4JLF A;  4LV2 A;  3NY4 A;  3QP2 A;  3UDI A;  1J3W A;  3LEZ A;  1UGU A;  4OPY A;  4BJP A;  1VET A;  2HJE A;  2XFT A;  4M4X A;  1V9Z A;  5DFY A;  3IH9 A;  2ZBB A;  2EX9 A;  1OT6 A;  3N8L A;  3D72 A;  1OTA A;  4F3L B;  5EPH A;  1H8Z A;  4EV4 A;  4S2P A;  4CQH A;  2FZ0 A;  1ALQ A;  3BWL A;  4GDB A;  1OTB A;  4UQI M;  4GZB A;  3S4X A;  4B9O A;  5FQI A;  5F83 A;  5DKK A;  3EQU A;  3V3S A;  1ACF A;  4KG5 A;  4PHT A;  3ITB A;  1S4R A;  1S67 L;  1FSY A;  5CRF A;  4Y2F A;  3WS1 A;  3Q07 A;  4JPM A;  1MY8 A;  1P9R A;  4OH0 A;  3RFB A;  4E04 A;  2HP5 A;  5EVI C;  2HDR A;  3O86 A;  1BLP A;  2OLV A;  5L09 A;  1CF0 A;  3TSG A;  3UN7 A;  2X01 A;  2Y2Q A;  3PBT A;  5L10 A;  5M19 A;  2V8F A;  4H8R A;  3F1N A;  3BY8 A;  3G35 A;  4WZ5 C;  5I5L A;  2XF3 A;  2WKI A;  1JTD A;  5HWW A;  4LPZ A;  2YKF A;  3NJA A;  3UMD A;  4YFM A;  5GL9 A;  2VJW A;  4QY6 A;  4KZ8 A;  2EFX A;  3DTE A;  2RL3 A;  3VOY A;  1XFN A;  3MQQ A;  3QP6 A;  3BFD A;  3E0Y A;  2B95 A;  2RCX A;  4KQR A;  3WS0 A;  1WYC A;  1NYY A;  4EEU A;  2C6W B;  2QJ7 A;  1K57 A;  5TBM A;  5L8M A;  3W4P A;  4WL9 A;  1MXO A;  4ARZ A;  3IHB A;  3ZGA B;  1S66 L;  3GRJ A;  3SS5 A;  1KGF A;  1LSX A;  2WGW B;  3G30 A;  3OLO A;  1TD5 A;  1XXM A;  2PRF A;  4QJG A;  3LO7 A;  3HUO A;  1O07 A;  2OV5 A;  3T4O A;  1MZU A;  4UA9 A;  3UDX A;  2VV7 A;  5FSR A;  1YPR A;  3VE4 A;  2EFU A;  2LB5 A;  1HLU P;  3IF6 C;  2BLS A;  4P0M A;  1E25 A;  1M6K A;  1L0E A;  3L7H A;  5C5K A;  4C3Q A;  3CMZ A;  2LB9 A;  4GOG A;  3PBQ A;  1ES3 A;  4EBN A;  1W63 M;  2Y59 A;  4HQA A;  3ZG0 A;  3T12 B;  3UB8 A;  4E6W A;  2O9C A;  4ZJ3 A;  3MXS A;  2OAQ 1;  4KUO A;  4EUZ A;  4LEN A;  4XUX A;  2Y79 A;  4RX3 A;  2OAP 1;  1OJG A;  1FIK A;  5KMW A;  2PU2 A;  3IWO A;  3O88 A;  1T18 A;  4CLC B;  2ZC3 B;  1YSQ A;  4Y0O A;  3TW8 A;  3UE0 A;  3N7W A;  2W1T B;  4E3K A;  2ZQ8 A;  1PIO A;  4WEJ A;  5E2G A;  3UPN A;  4C6Y A;  2Y2P A;  2Y2J A;  5GHY A;  2GZA A;  2DMW A;  3BY9 A;  2HP9 A;  2OOL A;  2PBD P;  4IVI A;  2R78 A;  3T1X A;  1YMS A;  1S1Z A;  2W3F A;  5G4Z A;  2W3G A;  2A49 A;  3DTK A;  4JF5 A;  5KSC A;  4NET A;  3N4I A;  5TR7 A;  2V1B A;  3ITA A;  3UB6 A;  3MR0 A;  4WMC A;  2Z6D A;  3V39 A;  3UME A;  3WRT A;  1XJ4 A;  4X25 A;  3MJQ A;  3OPL A;  2OSU A;  5FI7 A;  4Y15 A;  2WGI A;  3P7N A;  1ESU A;  1ZKJ A;  3MF0 A;  1KDS A;  1ERM A;  1BZA A;  2WAF A;  4I3I A;  5HSQ A;  3FPW A;  3PTE A;  2ZQD A;  1YLP A;  1OTI A;  2W27 A;  1K0K A;  1VM1 A;  5D3O A;  3IQA A;  5J8X A;  2WYX A;  3G6O A;  5FA7 A;  2JKR M; 
#chains in the Genus database with same CATH homology
 3ZVT A;  5FI6 A;  1VQQ A;  4L0L A;  4U0T A;  1KGG A;  1W7F A;  4X69 A;  5BOH A;  3A3F A;  3BFC A;  1MBL A;  4E3M A;  5FI2 A;  3QNB A;  4OPR A;  3C4P A;  3P09 A;  5L2F A;  2WAE A;  3Q7V B;  4QY5 A;  4FD8 A;  1U60 A;  4ZJ2 A;  3LY4 A;  4JXV A;  2Y2H A;  3RXX A;  1HVB A;  4WM9 A;  4FH4 A;  1IYS A;  4LV1 A;  1GA9 A;  1DJA A;  4FCF A;  5EVI A;  2J8Y A;  4KQO A;  4UAA A;  2Y2O A;  2HP6 A;  2XD1 A;  5CHU A;  4OLD A;  2A3U A;  5HL1 A;  1XGJ A;  1TDL A;  4K0X A;  2G2W A;  1MKI A;  1LLB A;  4EBL A;  2ZQC A;  3RJU A;  2DNS A;  5AQ9 A;  1GHI A;  5AQB A;  4OVD A;  1TVF A;  5HAR A;  1TEM A;  3C7V A;  2XDM A;  3OC2 A;  2H0T A;  4IBX A;  3WWX A;  3VFF A;  2ZQ7 A;  3ZG7 B;  2XEP A;  4K0W A;  1N9B A;  3LCE A;  3SH7 A;  1WE4 A;  1Q2Q A;  4ZJ1 A;  4BEN A;  4KZ4 A;  3IXD A;  1LL9 A;  4WZ5 A;  4JF6 A;  5G18 A;  3FV7 A;  1N4O A;  2QZ6 A;  3IF6 B;  4UA6 A;  3W8K A;  4DF6 A;  4GN2 A;  3VSL A;  1KVL A;  2Y2K A;  3C5A A;  4JXW A;  2ZD8 A;  5CTM A;  3MKF A;  4PM8 A;  3HUM A;  1FSW A;  1LHY A;  1NY0 A;  1K55 A;  4HBU A;  4NK3 A;  1KE4 A;  4S2N C;  4S2O A;  5FAO A;  5FQK A;  3ZG8 B;  2JC7 A;  3ZNY A;  3MFD A;  1Z6F A;  2HDS A;  3BLS A;  3UNW A;  2WGV A;  1NZU A;  2QPN A;  1KDW A;  1PWC A;  4OPZ A;  5FAT A;  1LL5 A;  4OQG A;  5DTK A;  4WYY A;  4Y7P A;  4FH2 A;  2EX8 A;  3LY3 A;  1QMF A;  3VP0 A;  3VFH A;  4MBH A;  5CGX A;  3ZG9 B;  1K6R A;  2XH9 A;  4JXG A;  4RYE A;  1PW8 A;  2CC1 A;  1ES4 A;  2VGJ A;  2ZC7 A;  4DE0 A;  3WRZ A;  1CK3 A;  5HW3 A;  1NJ4 A;  3Q7V A;  4OLG A;  4MBF A;  1ES2 A;  2UWX A;  1SHV A;  2E8I A;  2XR0 A;  2EX2 A;  3HLD A;  3VP2 A;  2WK0 A;  4OQI A;  1MWS A;  2V20 A;  3VP3 A;  4EQI A;  3OPP A;  4N92 A;  4B4X A;  4KG2 A;  1L0G A;  4P6B A;  3BM6 A;  1PWD A;  2G2U A;  3BEB A;  4MNR A;  5AQ7 A;  4DXC A;  4IVK A;  1SCW A;  4PPR A;  1PI5 A;  4QD4 A;  1NZO A;  1XPB A;  3O87 A;  1CI8 A;  2HPB A;  3VP1 A;  3GVB A;  4BD1 A;  4X53 A;  4DE1 A;  3GSG A;  4UA7 A;  1K56 A;  1K54 A;  3HLF A;  4KZ3 A;  3FZC A;  1BUL A;  5A93 A;  4DRT A;  3ZG5 A;  2R9X A;  3CJM A;  3DWK A;  3SH8 A;  1PYY A;  4U0X A;  4DDY A;  5JYO A;  4ZDX A;  1NYM A;  4WZ4 A;  4RVA A;  3N8R A;  4ZAM A;  3ZHH A;  4JLF A;  2VGK A;  3HBR A;  2V2F F;  4LV2 A;  2Z2L B;  4XXR A;  2Y2L A;  3NY4 A;  4CJN A;  3UDI A;  4OQH A;  5EE8 A;  3LEZ A;  1K4F A;  3N8S A;  3IF6 A;  1ES5 A;  5GLD A;  3NCK A;  4OPY A;  5EOO A;  3PAE A;  2XGN A;  3NIA A;  2OLU A;  1ESI A;  1K25 A;  3HLB A;  4BJP A;  1PI4 A;  5CGW A;  1PWG A;  4RA7 A;  1FOF A;  5GLB A;  3DWZ A;  1YLZ A;  2XFT A;  2R9W A;  3E2L A;  1XA1 A;  3I7J A;  4WEK A;  1IKI A;  1AXB A;  2XLN A;  1CEF A;  4DKI A;  3IH9 A;  4HBT A;  2Z2M B;  2EX9 A;  3N8L A;  4DDS A;  3HLE A;  3V3R A;  3GV9 A;  3NBL A;  1E3U D;  3UPO A;  4OOY A;  4N9L A;  1RGY A;  3HRE A;  1C3B A;  4Y0U A;  1MWU A;  1S0W A;  5EPH A;  5FAP A;  1H8Z A;  1JVJ A;  3BFG A;  4PM7 A;  3UPP A;  4EV4 A;  4S2P A;  3N6I A;  4B88 A;  4LCL A;  4BQM A;  5KMW A;  1HZO A;  4GDB A;  1ALQ A;  1K4E A;  4S2M A;  5DVA A;  5CER A;  3NI9 A;  3IH8 A;  1BLC A;  4GZB A;  4OPQ A;  2DCF A;  4E3L A;  4KZA A;  3S4X A;  3Q1F A;  4BLM A;  2Y2N A;  4X55 A;  3ISG A;  5FQI A;  4DXB A;  1YM1 A;  2X71 A;  5F83 A;  1QME A;  3EQU A;  5AQA A;  5A92 A;  3V3S A;  4EBP A;  3Q7Z A;  4KG5 A;  3ITB A;  1YMX A;  2WKH A;  2WZX A;  5TGF A;  1FSY A;  5CHM A;  3D4F A;  5CRF A;  1PZO A;  3HLG A;  3Q82 A;  5FQJ A;  4FSF A;  5FDH A;  3WS1 A;  2ZMA A;  4IBR A;  4R3B A;  3RXW A;  3Q07 A;  1XKZ A;  4JPM A;  1MY8 A;  4GNU A;  3VP4 A;  1LI0 A;  2ZC4 B;  2Y2I A;  2WUQ A;  3UO9 A;  4R23 A;  3A3J A;  1ERQ A;  4D2O A;  4OH0 A;  1FR1 A;  4HES A;  3HLC A;  5FAS A;  4JF4 A;  4GKU A;  3VOZ A;  2HP5 A;  4KZB A;  5EVI C;  3E2K A;  5GHZ A;  2HDR A;  1IYO A;  4KZ5 A;  3S22 A;  2Y91 A;  2ZM2 A;  3O86 A;  4GDN A;  1BLP A;  1FCO A;  4R4R A;  1EWZ A;  1PW1 A;  4OOL A;  2IWB A;  4DE2 A;  2OLV A;  1EI5 A;  3CG5 A;  4GD8 A;  1IEM A;  1L2S A;  5FQM A;  1CI9 A;  1YT4 A;  2JE5 A;  3G32 A;  4N1X A;  3TOI A;  1M40 A;  2X02 A;  3TSG A;  2EX6 A;  2Q9N A;  1K38 A;  4KG6 A;  3UN7 A;  1MWT A;  1RP5 A;  3ZFZ A;  2X01 A;  4WMC D;  2Y2Q A;  3PBT A;  3V50 A;  2Y2M A;  2IWD A;  5M19 A;  4H8R A;  1NXY A;  3NDG A;  4QU3 A;  4PM5 A;  3O3V A;  4KEN B;  3G35 A;  4WZ5 C;  4F94 A;  5FQ9 A;  4QB8 A;  2XF3 A;  1S6R A;  1Y54 A;  2WKI A;  1YLY A;  4X68 A;  1JTD A;  3EQV A;  1MWR A;  4X6T A;  5F1G A;  1W5D A;  3G4P A;  5TFQ A;  4ZBE A;  3MZF A;  1XP4 A;  3IWQ A;  5EEC A;  1XX2 A;  3SS4 A;  4P87 A;  4R4S A;  3PAG A;  3ZVW A;  2IWC A;  1K55 C;  1JWZ A;  4YFM A;  5EOE A;  2V1Z A;  1GHM A;  3GR2 A;  3PBS A;  3GQZ A;  3MKE A;  5CGS A;  1YLJ A;  5GL9 A;  5JYP A;  5FQQ A;  4QY6 A;  3M2J A;  4KZ8 A;  2EFX A;  4MBK A;  3UDF A;  2RL3 A;  3M6B A;  5CEB A;  3VOY A;  4JXS A;  1HD8 A;  1NRF A;  2FFF B;  1DY6 A;  1JWV A;  2Q9M A;  1W8Q A;  3BFD A;  1JTG A;  1YLT A;  3V5M A;  2RCX A;  5M1A A;  2HDU A;  2PU4 A;  3FKW A;  4KQR A;  5DF7 A;  3WS0 A;  1WYC A;  2J7V A;  3IXH A;  1NYY A;  1CEG A;  1OME A;  2DRW A;  4N9K A;  4R1G A;  1ONG A;  3BFE A;  4HEF A;  2C6W B;  3IHA A;  1H8Y A;  2J9P A;  1K57 A;  5GHX A;  2HDQ A;  4BL3 A;  3W4P A;  4GD6 A;  4R3J A;  3UE3 A;  3PBR A;  1MXO A;  3IHB A;  3ZGA B;  3ZNT A;  2P74 A;  3GRJ A;  1GA0 A;  3WS4 A;  3SS5 A;  3HUN A;  1KGF A;  1L0D A;  1O7E A;  4M3K A;  1KE3 A;  2WGW B;  3G30 A;  4KZ9 A;  2J9O A;  3AGF A;  1ZG4 A;  3VSK A;  3C7U A;  4A5R A;  5E2F A;  5EVI D;  3NDE A;  1XXM A;  4O7D A;  2ZC5 B;  1MPL A;  3WS2 A;  4LV0 A;  3PBN A;  4QJG A;  3LO7 A;  3G2Y A;  3HUO A;  1TDG A;  1O07 A;  1FR6 A;  3A3D A;  4X56 A;  2OV5 A;  5KSH A;  4KQQ A;  2ZM0 A;  3AGD A;  4UA9 A;  3OZH A;  5FSR A;  3TG9 A;  3UDX A;  5HFO A;  2ZJ9 A;  2EFU A;  5E2H A;  3IF6 C;  3M2K A;  4OP8 A;  4QHC A;  2BLS A;  4PM6 A;  4P0M A;  1E25 A;  3DTM A;  3IWI A;  1M6K A;  1ZG6 A;  3G2Z A;  1L0E A;  4C3Q A;  4MEZ A;  1DJC A;  2H0Y A;  3OPH A;  3JYI A;  3PBO A;  1RCJ A;  1KGE A;  3CMZ A;  2B5R A;  3MZE A;  4OP5 A;  4GOG A;  1IYP A;  3IXB A;  1ES3 A;  3PBQ A;  4EBN A;  5A90 A;  3HLW A;  2Y55 A;  3SH9 A;  4YIN A;  2Y59 A;  3QHY A;  3BEC A;  1BTL A;  3ZG0 A;  3UE1 A;  4S2J A;  5EVL A;  4ZTK A;  5I94 A;  2P9V B;  3A3I A;  1XA7 A;  4LCM A;  4E6W A;  1FCN A;  1GCE A;  2ZQA A;  4S2N A;  4S2I A;  3BRM A;  3SOI A;  4ZJ3 A;  2GDN A;  3MXS A;  1E3U A;  1DJB A;  4Y0T A;  4JBF A;  4EUZ A;  4LEN A;  4XUX A;  1Q2P A;  1LI9 A;  2XFS A;  5E43 A;  4RX3 A;  3A3E A;  2XQZ A;  4K91 A;  4EWF A;  5U47 A;  3UY6 A;  2ZC6 B;  1G6A A;  3OCL A;  4Q8I A;  3BFF A;  1BT5 A;  5DF9 A;  1J9M A;  2PU2 A;  4OOM A;  3IWO A;  4BD0 A;  3CZD A;  3M6H A;  1YQS A;  3O88 A;  3OPR A;  2WGW A;  2ZQ9 A;  4PM9 A;  3HL9 A;  3IXG A;  3ZDJ A;  2ZM8 A;  1ONH A;  1BLS A;  1YLW A;  2ZC3 B;  5GLC A;  5DF8 A;  5DTT A;  4Y0O A;  3UE0 A;  5GLA A;  3N7W A;  1GHP A;  4WEL A;  1BLH A;  2WAD A;  1K56 D;  2ZQ8 A;  2BG1 A;  3IT9 A;  4E3K A;  1PIO A;  3IF5 A;  4WEJ A;  5E2G A;  4DE3 A;  5FAQ A;  1I2S A;  3G31 A;  3FWL A;  3UPN A;  1BSG A;  1G68 A;  2Y4A A;  3C4O A;  4C6Y A;  2Y2P A;  2Y2J A;  1H5X A;  5GHY A;  4P85 A;  5CTN A;  4E3I A;  5KZH A;  4JKT A;  1RGZ A;  1L0F A;  2HP9 A;  2XD5 A;  5IHV A;  4CPK A;  5EUA A;  5CED A;  4IVI A;  5HAP A;  4ID4 A;  3BYD A;  4UHU A;  1YMS A;  1JWP A;  1K6S A;  2JCH A;  3W4O A;  2A49 A;  1SDE A;  4OKP A;  4JF5 A;  4OON A;  4NET A;  5KSC A;  3NC8 A;  4KZ7 A;  4C75 A;  1IEL A;  3N4I A;  5TR7 A;  3VMA A;  1KVM A;  1SDN A;  2P9V A;  4U3T A;  3OCN A;  4WBG A;  5F1F A;  3ITA A;  4XUZ A;  1PZP A;  3GMW A;  4N1H A;  3MZD A;  5EVI B;  1IYQ A;  3MBZ A;  2FFY A;  1BUE A;  3FYZ A;  2I72 A;  4WMC A;  4E6X A;  3G34 A;  3MXR A;  2H10 A;  3V39 A;  5A91 A;  1I2W A;  2PBY A;  3WRT A;  4MLL A;  1FCM A;  5DTS A;  5HAI A;  4PMA A;  3GTC A;  4S2K A;  3OPL A;  2OSU A;  2ZLY A;  1I5Q A;  5CXW A;  4Z9Q A;  5FI7 A;  3S1Y A;  4OQ0 A;  2QMI A;  4LV3 A;  2WGI A;  5HX9 A;  2Y2G A;  2EXA A;  2XK1 A;  1ESU A;  5HAQ A;  5CHJ A;  2JBF A;  4KZ6 A;  1E4D A;  1ERO A;  1K54 C;  1ZKJ A;  3AGE A;  3QNC A;  1ZC2 A;  2WZZ A;  4B4Z A;  1SKF A;  1W79 A;  2H5S A;  4E3N A;  1KDS A;  4S2L A;  5CEC A;  4R0Q A;  1KE0 A;  2EXB A;  3BLM A;  3W4Q A;  1ERM A;  4GB7 A;  1BZA A;  3P98 A;  2WAF A;  3SS3 A;  3FKV A;  4BL2 A;  2WKE A;  3ZCZ A;  4E3J A;  3B3X A;  3DW0 A;  3PTE A;  1W8Y A;  2ZQD A;  4E3O A;  2C5W B;  1YLP A;  3Q81 A;  1IKG A;  1K57 C;  1HTZ A;  1XGI A;  4RX2 A;  3WS5 A;  1WYB A;  1VM1 A;  5D3O A;  3IQA A;  5F82 A;  5J8X A;  5E2E A;  2WYX A;  5M18 A;  5FA7 A;  3HVF A;  1FQG A;  4IED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...