3WRZA

N288q-n321q mutant beta-lactamase derived from chromohalobacter sp.560 (without soaking)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
357
structure length
357
Chain Sequence
QTREVLDPIVASLMEAQQIPGMAIALVRPEGTTISHYGAADRETGTPVDDDTLFEIGSLSKTLTATLASLAEVEGKLDFDAPVSRYLPELEGSAFDDISGLNLGTHTGGGLPLFVPDEVTDRASLMAWYREWQPTEPIGESRTYSNLGIGLLGLETAASLDGEFVPTMRAKVLAPLGMQDTWYDVPEARMADYAMGEDKDGQPTRVSPGVLDDEAYGIKTTAADLAKLVRANLHLADVDAELQQAIDATRQGHYRVGDMTQALIWEQYSLPVAPETLRAGQGYDMILEPNAAEALEPPQSPRDDVWVNKTGSTQGFGGYIVMLPGKHTGLVMLANKNYPNDARVEAAYRILSGLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structure of a highly acidic beta-lactamase from the moderate halophile Chromohalobacter sp. 560 and the discovery of a Cs(+)-selective binding site
pubmed doi rcsb
source organism Chromohalobacter sp. 560
molecule tags Hydrolase
total genus 116
structure length 357
sequence length 357
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3wrzA00
4JLFA 3VSLA 3IF6B 1BLSA 1ZC2A 4ZBEA 5CHJA 4KZ4A 3DW0A 4QB8A 3WRTA 3MZFA 3ZHHA 5TFQA 4GN2A 5CGSA 4QU3A 1SHVA 4B88A 3V50A 3PBOA 5IHVA 1ZG4A 2J8YA 4KG2A 4OKPA 1LI0A 3IH9A 2ZM2A 4GDNA 2HDRA 2ZC6B 3S22A 2ZQ8A 1L0DA 3UDXA 5F1FA 3NDEA 5FQKA 4JBFA 4KZ6A 4YFMA 2ZQCA 4QHCA 4N92A 4DDSA 3SOIA 1MBLA 3IHBA 2R9XA 1EWZA 2ZLYA 1BT5A 3HL9A 3C5AA 1MKIA 3PAEA 1E4DA 5AQ7A 5CGXA 3Q82A 3ZCZA 3O87A 2RCXA 3M2KA 4F94A 2J7VA 1Q2PA 3Q07A 4WM9A 1GHMA 3RXXA 3HVFA 3OPPA 1G68A 5FAPA 2Y2HA 4S2NC 2H0YA 1ES5A 5FI7A 4DE0A 4QD4A 4PM5A 1GHIA 4PM7A 5FA7A 5EVIC 5FSRA 1NZUA 2Y2PA 1CI8A 1KGFA 3ISGA 4X68A 3W4OA 3ZVWA 1FCOA 1I5QA 1JWVA 3NIAA 4KQQA 4OPQA 2OV5A 1BTLA 2ZQ7A 2WGWA 5G18A 4KQOA 4OP8A 3PBRA 4RX2A 3EQUA 4GOGA 4U0TA 1GA0A 3IQAA 4EBPA 5E43A 4OQHA 4RX3A 2ZJ9A 4UA9A 3IF6A 2Y2NA 1LL5A 4BQMA 4E3LA 4CPKA 4E3MA 1FR1A 1PI5A 3ZVTA 2Z2LB 3O3VA 1GA9A 2A49A 5CRFA 2V20A 3VMAA 3ZG0A 3MBZA 4MBHA 3PBSA 3C4PA 4OQGA 2V1ZA 5F83A 3IXHA 4WMCD 5AQ9A 2JCHA 3BEBA 3G35A 5CERA 4PMAA 2BLSA 3IXDA 4OOLA 5D3OA 2WZXA 1KVMA 2I72A 3ZFZA 4DXCA 4ZDXA 3ZGAB 1YLYA 3MXSA 3N7WA 2J9PA 4D2OA 4Y0OA 4EWFA 1DY6A 1IELA 1WYCA 4BENA 1FOFA 3A3JA 5GL9A 5HAQA 4IVKA 1XX2A 2Y55A 4GKUA 3NBLA 1NXYA 3BFFA 3S1YA 4BL3A 1NYMA 3FZCA 1HD8A 4X69A 5KSHA 1M6KA 2G2UA 4YINA 5HFOA 1ALQA 3OZHA 3SS5A 1K38A 4HEFA 2JE5A 4EQIA 3GRJA 2Y2QA 5GHZA 2QPNA 1W8QA 5EOEA 4WELA 4PM8A 1ESUA 1K6RA 3M6HA 1VQQA 4DE2A 1HVBA 1KDWA 2DRWA 2ZC3B 2EX6A 1K4EA 3O86A 3EQVA 4HESA 3C4OA 2Y2GA 4MBKA 4KZ7A 4S2PA 3MXRA 4R4RA 4N9KA 3A3IA 3VP4A 1O07A 4X55A 4ZJ3A 1OMEA 2X71A 1IKGA 3DTMA 5GLBA 3PTEA 2WAEA 3GV9A 4Q8IA 1L0FA 4OQIA 3ZG5A 2ZQ9A 1MWRA 1KE0A 4KZ3A 5E2EA 1LLBA 3IH8A 3QNCA 4FCFA 1WE4A 2Q9NA 4LENA 5TR7A 4H8RA 1PW8A 4X53A 3WWXA 3W8KA 4S2OA 2X02A 5CGWA 1CEFA 5J8XA 2XD1A 3HLWA 4ZJ2A 4JXGA 3Q7VA 5FI2A 1KDSA 2OLVA 3ZNYA 4S2KA 3HUMA 1RCJA 2H5SA 3OPHA 4OLDA 3C7VA 1JWPA 1ES4A 2XH9A 3UPNA 1GHPA 5DTSA 2ZQAA 3QHYA 5DF7A 4BJPA 5HX9A 3MZEA 3BLMA 3M6BA 5CHUA 1MWUA 4Y0UA 3AGEA 3DWZA 1DJBA 3LY4A 1BLPA 1K6SA 2WKHA 4OOYA 3NC8A 1WYBA 2BG1A 1MY8A 1YQSA 3OC2A 3HUOA 3GVBA 1PZPA 3BFEA 4S2JA 1G6AA 4X56A 4Z9QA 4IBXA 1SDEA 1XKZA 1K56A 3G4PA 2X01A 4DE3A 4OONA 3BYDA 1K56D 2XK1A 3TSGA 1K54A 1MXOA 1HZOA 1XXMA 2R9WA 1KGGA 4JPMA 1PWGA 4OVDA 4C6YA 3UPOA 5FATA 2Y2LA 5CEDA 1PWDA 5E2FA 4ZAMA 3FKVA 3NDGA 4JXSA 5HW3A 3V39A 5CXWA 1N4OA 5GLCA 2A3UA 2EX8A 3SH9A 4LV0A 4RVAA 1ZG6A 3UN7A 4P6BA 1FSYA 2G2WA 2UWXA 1K55C 1MPLA 4BLMA 3CJMA 1YLJA 4KG5A 3BFDA 2P9VB 1KE3A 1XA7A 3FYZA 3HUNA 3UE1A 1Y54A 1ONHA 1JTGA 4HBTA 3IWOA 4LV3A 1H5XA 5EUAA 3N8RA 3ZG7B 1JTDA 2CC1A 5DVAA 4R3JA 3BRMA 1C3BA 4GB7A 2HDUA 1XPBA 3GR2A 4LV2A 4E3KA 5DTKA 5KMWA 5KSCA 4CJNA 3VP2A 1YMSA 3BECA 2IWCA 2OLUA 3AGDA 2WUQA 4KZAA 2IWBA 4KZ9A 5JYOA 5EVIB 4EUZA 5CECA 3N4IA 2HP5A 4Y0TA 3UY6A 4JKTA 4E3JA 3ZNTA 4K0XA 3QNBA 1O7EA 1TDGA 1TDLA 3A3EA 1SCWA 2C5WB 4U3TA 3WS2A 5M19A 2XEPA 1K4FA 2ZD8A 4P85A 4B4ZA 1BSGA 1BUEA 5FQ9A 4EV4A 5BOHA 4WZ5A 4C75A 2EFUA 1DJCA 2H0TA 4OOMA 1DJAA 5EECA 5GLAA 1H8YA 3IT9A 5M18A 4A5RA 2ZC5B 3WS0A 2WGIA 1YLPA 3UDIA 4OQ0A 3ZG8B 4DF6A 2E8IA 1RGYA 2QZ6A 5GHYA 2H10A 5FDHA 2XD5A 1L0GA 1YM1A 4R1GA 2HDSA 2ZQDA 4JF6A 5CTMA 3P09A 3BFGA 5FQQA 2Y2IA 5AQAA 3ITBA 3WS5A 1EI5A 1NJ4A 1XGJA 3LEZA 1JWZA 2JC7A 3BM6A 2C6WB 1W7FA 4BD1A 2HDQA 3DWKA 1GCEA 3GTCA 4JXWA 1N9BA 1S0WA 4R4SA 5I94A 3VP0A 1CI9A 1K25A 3TG9A 4MEZA 1HTZA 3CMZA 5EVLA 4K0WA 4E6XA 2GDNA 2ZM0A 3G2YA 4DKIA 4RYEA 1CEGA 1K54C 5HAIA 1PIOA 3D4FA 5HAPA 5HARA 2XDMA 4FSFA 1H8ZA 3Q7ZA 4K91A 4FH4A 3PBTA 1BLHA 2PU2A 3LY3A 5F82A 3UPPA 4DXBA 1I2WA 2WZZA 2Y59A 3IF5A 4S2IA 4MLLA 4U0XA 3OCLA 3G32A 1W5DA 1MWSA 2Z2MB 1J9MA 3V3SA 1LL9A 1KGEA 1LI9A 3HLGA 3G30A 2JBFA 1AXBA 3IHAA 4DE1A 4WEKA 4Y7PA 3HLCA 4OLGA 3SS4A 5FI6A 2HP6A 4MBFA 4QY5A 4DDYA 1FCMA 3NCKA 4N1XA 3N6IA 1U60A 1SKFA 3MKFA 4BL2A 3NY4A 1FR6A 3B3XA 2WGVA 5FAOA 4RA7A 1VM1A 3V5MA 4OP5A 3LO7A 3O88A 3GSGA 4IEDA 3HLBA 2IWDA 3IF6C 3BLSA 3E2LA 3FWLA 4FD8A 4R0QA 3JYIA 3I7JA 2ZC7A 5A92A 4MNRA 4E3NA 1ERQA 1E25A 3N8SA 2Y4AA 3IWIA 5CTNA 1NYYA 4OPYA 1W79A 3WS4A 4XXRA 5A91A 5FQIA 2XQZA 3OPRA 4GDBA 3SH7A 4QJGA 1MWTA 5EE8A 1IKIA 1ONGA 4PPRA 5EOOA 4S2LA 4WZ5C 4WBGA 4E6WA 3ZDJA 4M3KA 4HBUA 2HPBA 3HLEA 3UE0A 1I2SA 1M40A 1FCNA 1K57A 3V3RA 5AQBA 5GHXA 3HLFA 3HREA 4UAAA 1LHYA 2Y2JA 1YMXA 3CG5A 5KZHA 2B5RA 4WEJA 1SDNA 1NY0A 4KZ5A 4LCLA 2Q9MA 3M2JA 4DRTA 2XFTA 1ESIA 3BFCA 4JF5A 2WK0A 1YT4A 1FSWA 1TVFA 5M1AA 3SH8A 4IVIA 1KVLA 1L2SA 2QMIA 3HBRA 1Q2QA 1QMEA 4LV1A 3UNWA 4NK3A 4GD6A 3FKWA 4OPZA 3S4XA 3UE3A 3VOZA 2ZMAA 4KZ8A 3VSKA 4GZBA 2ZM8A 3OCNA 4BD0A 1IYPA 1L0EA 5DF9A 2PU4A 1BULA 2WYXA 3IXBA 3VOYA 1NRFA 1RP5A 1PYYA 2XFSA 2Y91A 2ZC4B 4XUXA 1IYQA 1PW1A 1W8YA 4QY6A 3ITAA 4IBRA 1RGZA 4P87A 1XP4A 3MZDA 2EX9A 3G31A 2PBYA 3TOIA 2FFYA 2OSUA 4LCMA 3VFFA 1YLZA 1QMFA 2J9OA 3W4PA 1ERMA 3CZDA 5FASA 1NZOA 3UDFA 2VGKA 3ZG9B 1XGIA 4B4XA 1ZKJA 5TGFA 4ID4A 1YLTA 3N8LA 4GD8A 2XGNA 1JVJA 4WMCA 4EBLA 3OPLA 2EXAA 2EXBA 2Y2OA 3HLDA 3MKEA 1PWCA 3LCEA 2DNSA 3PBNA 4XUZA 2P9VA 3NI9A 3W4QA 3VFHA 4E3IA 4JF4A 4KZBA 1IYSA 5GLDA 4E3OA 4R23A 5DF8A 3RXWA 3G34A 1K55A 4S2NA 3FV7A 3Q7VB 4N1HA 4ZJ1A 4OH0A 1PI4A 1YLWA 3WRZA 5EVIA 4OPRA 2RL3A 2XLNA 3PAGA 4UA6A 2Y2MA 1BZAA 5EVID 3Q1FA 2VGJA 4ZTKA 3Q81A 1ES3A 1PZOA 4WYYA 4UA7A 2XR0A 2DCFA 5CEBA 1TEMA 3VP3A 1CK3A 3A3FA 5CHMA 4L0LA 5E2GA 2WKIA 2WKEA 3P98A 4JXVA 5A93A 4WZ4A 4X6TA 1XA1A 3GMWA 4PM9A 3MFDA 1KE4A 1FQGA 2XF3A 1K57C 1ES2A 2P74A 2V2FF 4FH2A 4O7DA 1IYOA 5FQMA 1E3UA 5HL1A 1E3UD 3G2ZA 5L2FA 3GQZA 4GNUA 4UHUA 3IWQA 5DTTA 3UO9A 4P0MA 2EX2A 1BLCA 4KENB 4C3QA 5FQJA 3A3DA 2WADA 5F1GA 3AGFA 4PM6A 2EFXA 5U47A 1EROA 2WAFA 4NETA 5EPHA 3C7UA 5E2HA 2FFFB 4KG6A 5FAQA 4N9LA 2HP9A 3IXGA 3SS3A 5A90A 2WGWB 3WS1A 2Y2KA 4EBNA 3E2KA 1S6RA 4S2MA 3RJUA 3VP1A 4R3BA 1Z6FA 5JYPA 4KQRA 1IEMA 3PBQA
chains in the Genus database with same CATH superfamily
3IF6B 1BLSA 3DW0A 5DJUA 1OT9A 3CUEA 2VZWA 1MKMA 4GN2A 4QU3A 1SHVA 1OTBA 4KUKA 3V50A 1ZG4A 2J3TD 2J8YA 2ZM2A 3NDEA 2ZQCA 4R6LA 3T1RA 3UMDA 4DDSA 3SOIA 2R9XA 1EWZA 2ZLYA 3Q82A 2R78A 2RCXA 2J7VA 4WM9A 1T1AA 3OPPA 5FAPA 5FI7A 2M1CA 2OAP1 4DE0A 4QD4A 4PM7A 5FA7A 1FCOA 4GCZA 4EU0A 4OPQA 2OV5A 1UWPX 1BTLA 4EBPA 3LGOA 5J3WA 2Y2NA 1LL5A 4E3LA 4E3MA 3T1SA 3F1NB 5CRFA 1GA9A 2V20A 2Z6CA 3KYZA 4IHQA 2BLSA 1Y4OA 4DXCA 1LSXA 2PYRA 1FILA 3T12B 3MFXA 1WA9A 3NBLA 2W1TB 4BL3A 1IOUA 1M6KA 2G2UA 4B93A 5HFOA 1SKOA 3OZHA 1W8QA 5EOEA 4GS9A 4PM8A 4EXOA 1K6RA 1MC0A 2UV0E 3T4QA 1DRMA 2DRWA 2EX6A 2QJ5A 3O86A 4MBKA 1J3WA 3BY8A 4R4RA 3VP4A 4Y13A 1O07A 4ZJ3A 2FZ0A 2HJ9C 3PTEA 2WAEA 3ZG5A 1CF0A 2Q9NA 4LENA 4H8RA 3C2WA 1CEFA 4O8GA 3HLWA 3Q7VA 2OLVA 2H5SA 4OLDA 3C7VA 1JWPA 2XH9A 3EGDC 5DTSA 2ZQAA 4BJPA 3PYPA 2KX6A 1MWUA 4Y0UA 3QP5A 1DJBA 4NXBA 4BWIA 3NC8A 1YQSA 3OC2A 3HUOA 4X56A 4JGOA 4Z9QA 4IBXA 1SDEA 1XKZA 1K56A 2Y8HA 2XK1A 3TSGA 3P7NA 1XXMA 2XSSA 3OOVA 3NDGA 5FEGA 1LL8A 2A3UA 3LI8A 4RVAA 3UN7A 1FSYA 1K55C 3BFDA 4P6ZS 4HBTA 2JKRI 1H5XA 4GB7A 1YKDA 2QWSA 2WUQA 3IS2A 4KZAA 5CECA 3N4IA 4Y0TA 2JN7A 3OBFA 4IUHA 2VV6A 3ZNTA 3QNBA 3DBAA 3A3EA 5F68A 4U3TA 1NRJA 4LPZA 1D1JA 4L9GA 4WN5A 2GX5A 1F2KA 5FQ9A 4WZ5A 4MN6A 1XJ6A 3IT9A 3LIFA 2L4RA 2ZC5B 3WS0A 1YLPA 4UEYA 4OQ0A 5DJTA 4NXEA 1OTAA 2XD5A 1OJ5A 2HDSA 4JF6A 5FQQA 4EQ1A 2Y2IA 3ITBA 3WS5A 1NJ4A 2QHKA 1JWZA 4BD1A 4RQ9A 3GTCA 1GCEA 4MEZA 3LIBA 4UQIM 1NLZA 4HH2A 2P04A 4I5SA 5HARA 3T4KA 4FSFA 3PBTA 1BLHA 2PU2A 3LY3A 5F82A 3UPPA 1I2WA 3FPWA 4S2IA 5TBMB 4MLLA 3C30A 3OCLA 1W5DA 2M7UA 2Z2MB 2LB9A 3HLGA 3UB5P 2JBFA 5HDCA 4Y7PA 3NECA 5J7EA 4OLGA 2W27A 5FI6A 2A24B 4MBFA 3S7NA 1FCMA 2FH5A 1U60A 4BL2A 2NUPC 2WGVA 3F1OA 4IEDA 2IWDA 4R0QA 3BLSA 3L9KA 3I7JA 2ZC7A 1ERQA 2IA2A 4OPYA 1S1ZA 4XXRA 2V1AA 3HLEA 1LHYA 4WEJA 3C8CA 3R7WA 4KZ5A 2W0NA 4F3LB 2Q9MA 3M2JA 4X1LA 1YT4A 4IVIA 1S67L 5HPFA 1W63Q 4LV1A 3S4XA 3FKWA 4HI4A 2VEAA 2ZMAA 4GZBA 3OCNA 1IYPA 1BULA 2WYXA 3VOYA 3QP2A 2XFSA 1IYQA 3MJQA 4AFIA 3BQ8A 4MN5A 1STZA 3DTIA 4DMZA 3TOIA 3NOPC 4I3JA 1YLZA 2J9OA 3W4PA 1ERMA 3L7HA 4ID4A 1YLTA 2PYPA 3CWFA 4LRZE 2EXAA 3LCEA 2DNSA 4XUZA 3W4QA 3NI9A 3D3OA 1G5UA 5EV0A 4NG2A 2O99A 2HV1A 3FV7A 3MSHA 2JHEA 2VGJA 3E0YA 2KOIA 4ZTKA 3Q81A 5HD5A 1PZOA 3P01A 1TF1A 5E2GA 2PDRA 4GHIA 3E4OA 5HL1A 2V0UA 4BBUA 4GNUA 4UHUA 1Y28A 5FQJA 2HZ5A 3T4OA 3A3DA 5F1GA 3AGFA 5U47A 4I3AA 2OWJA 5HPIA 4N9LA 1XJ3A 3WS1A 3HJKA 3MQOA 1S6RA 3RJUA 4LFUA 4HHDA 4JGQA 1ZHHB 3VSLA 3BY9A 3NHQA 2PHYA 1T19A 2W3EA 3UB8A 5IHVA 1G6OA 4B9OA 2ZC6B 3UDXA 2ZQ8A 5FQKA 4JBFA 4KZ6A 3U2AA 5EFWA 3LI9A 2YKHA 2OOLA 1G28A 1MKIA 1OTEA 3O87A 4Q0IA 4LRXC 2JKTI 2K7SA 4F94A 2J3WA 1Q2PA 1GHMA 3RXXA 1G68A 3CPTB 1ES5A 1GHIA 2Y2PA 3W4OA 4HH3A 3NIAA 3R4KA 4KQQA 2ZQ7A 5G18A 4XT2B 4RX2A 1EW0A 3EQUA 3B33A 1ODVA 5E43A 3KO6A 2ZJ9A 4UA9A 3IF6A 5CX7A 2VLGA 3ZVTA 2Z2LB 3O3VA 2A49A 2QKPA 3VMAA 4CLCC 3C4PA 3H7WA 2D01A 3T4JA 4WMCD 5AQ9A 3G35A 5D3OA 2WZXA 2K2NA 3ZFZA 4D2OA 4EWFA 3A3JA 5GL9A 1YSQA 1NYMA 5KSHA 4HEFA 3GRJA 2Y2QA 3W2ZA 1DP9A 1ESUA 1MZUA 3GECA 4H6JB 4X1MA 4DE2A 1K4EA 3EQVA 4HESA 3MXRA 4N9KA 3A3IA 3EOIA 2X71A 4Q0HA 1IKGA 4OQIA 2ZQ9A 1MWRA 2AVXA 2VV7A 3MXQA 5E2EA 1A0KA 1P9WA 4FCFA 1WE4A 4X53A 5L09A 3W8KA 4S2OA 2X02A 4O0PA 5CGWA 2XD1A 4ZJ2A 4ETZA 5FI2A 1KDSA 3ZNYA 1RCJA 2XRNA 2VGLM 4NXGA 4FOFA 3FC7A 3UPNA 1GHPA 3QHYA 5DF7A 4ETXA 3BLMA 3M6BA 4Y3IA 5CHUA 1H3QA 3RH8B 1K6SA 4OOYA 5EVEA 1MY8A 1P9RA 5TJJA 3MMHA 3BFEA 4G3WA 3MR0A 2G7UA 3G4PA 4DE3A 4OONA 3IX4A 5HDSA 3VE4A 1PWGA 4OVDA 3UPOA 2ZMFA 2Y2LA 1AWIA 4ZAMA 1DP8A 4JXSA 5HW3A 3V39A 2VX8A 3H82B 5GLCA 4GJ4A 3NULA 4LV0A 2UWXA 4BLMA 4GW9A 4KG5A 2P9VB 3UE1A 1ONHA 3ZG7B 3LYXA 3N8RA 3PXPA 4HQAA 3KSFA 3A0VA 3OLOA 1XPBA 3GR2A 5KMWA 5KSCA 1N9LA 1TS8A 1YMSA 3BECA 2ZL1B 5EVIB 4EUZA 1V9YA 4QPRA 4K0XA 3TE8A 1O7EA 1TDGA 2VJWA 3LIDA 1SCWA 2C5WB 4FUWA 3KSIA 3KSHA 3QP6A 3TRCA 3K3DA 1BUEA 4HJ3A 5EM0A 1DJAA 5EECA 5GLAA 5M18A 1RGYA 2QZ6A 1OT6A 2ZQDA 3BFGA 4D60A 1EI5A 1XGJA 3BM6A 2GJ3A 4JXWA 4CLCE 1K25A 1HTZA 3JVUA 4K0WA 4E6XA 4RYEA 1CEGA 1K54C 3S7PA 3D4FA 3PR6A 2XDMA 3Q7ZA 4FH4A 1PFLA 3MF0A 3IF5A 4U0XA 5IT5A 3G32A 1MWSA 1J9MA 3MQ0A 1ZTUA 3G30A 4K08A 4MMNA 4WEKA 3LEQA 2HP6A 4QY5A 3NCKA 3N6IA 1SKFA 3NY4A 3B3XA 4RA7A 4PKYA 2PRFA 3LR3A 3HLBA 3IF6C 4FD8A 3FWLA 4CQHA 1BYWA 4MNRA 3LR4A 5LBRA 3N8SA 2Y4AA 2ACGA 1OJGA 4YOFA 1NYYA 1W79A 4M4XA 2XQZA 3OPRA 5HZHA 1ONGA 4E6WA 4WBGA 1I2SA 1M40A 5TBMA 5GHXA 1T1CA 3HREA 3IX8A 3LR5A 4ARZB 3IBRA 2A24A 1VHMA 1KOUA 5G4YA 3SH8A 1L2SA 5F69A 1QMEA 4GD6A 4OPZA 4X25A 4BD0A 3VE3A 4GS9B 3IXBA 4XUXA 4DJ2A 4QY6A 1RGZA 1VB6A 2L1MA 1XP4A 4UQIS 3MZDA 3G31A 4IJGA 4EW7A 4PAUA 2FFYA 2OSUA 3K2NA 4QWOA 1QMFA 3UDFA 1SZVA 5TGFA 4GD8A 4EBLA 4WMCA 3OPLA 3MKEA 5AVFA 3PBNA 3VFHA 4E3IA 3T50A 3JVVA 5GLDA 4F3LA 3G34A 2XA7S 3Q7VB 4N1HA 2O0YA 4HOIA 3WRZA 4OPRA 2XLNA 1GSXA 2Y2MA 5EVID 1P97A 1V9ZA 5HD3A 4HNBA 1OTDA 4WYYA 2ZMVA 2QJ7A 3SZTA 5CEBA 4L0LA 3MFDA 1KE4A 1FQGA 2XF3A 4CLCA 1NWZA 1XJ2A 3EGXC 5AJGA 1E3UA 1ACFA 2XA7M 3BWLA 3O5YA 1T18A 2QYBA 3UO9A 1BLCA 4C3QA 2EFXA 2WAFA 5EPHA 3C7UA 2FFFB 4KG6A 2WGWB 3G6OA 2Y2KA 1Z09A 3VP1A 4R3BA 1Z6FA 3OPHA 4O7DA 1IEMA 4JLFA 2E8JA 3V67A 5TFQA 5CGSA 3U4LP 4OKPA 1LI0A 1YAXA 4GDNA 5F1FA 1L0DA 2B18A 4HP9A 4R38A 3IHBA 3E4QA 1BT5A 2WKPA 5CGXA 3ZCZA 3H9WA 3NOTC 3Q07A 3HVFA 2Y2HA 3SW1A 4PM5A 3ZVWA 1NZUA 3ISGA 1CI8A 1KGFA 4X68A 3TW8A 1LT0A 3PBRA 4U0TA 1GA0A 4BBVA 4OQHA 4BBTA 4BQMA 4CPKA 4EEPA 1PI5A 3B42A 3CHWP 4OQGA 2V1ZA 3IXHA 5CERA 4PMAA 3IXDA 1KVMA 2I72A 4ZDXA 1UWNX 3MXSA 3F1PB 3N7WA 2J9PA 4BENA 3MQQA 2O9BA 1XX2A 4IVKA 2Y55A 4GKUA 3S1YA 1HD8A 3CPTA 4YINA 1ALQA 1K38A 2LB5A 5GHZA 4WELA 3M6HA 1VEUB 4I39A 1HVBA 4YNRA 2ZC3B 4KZ7A 4S2PA 5J4EA 5GLBA 4Q8IA 3GV9A 1S1YA 4KZ3A 3IH8A 3QNCA 5FEFA 5TR7A 3S7OA 4JXGA 4S2KA 2XROA 3KYQA 4NKPA 1OPXA 3MZEA 5F6AA 1H0MA 2B95A 3LY4A 1BLPA 2WKHA 1L3LA 1WYBA 2BG1A 1DP6A 4H6JA 3GVBA 1PZPA 2PR5A 3DTEA 1G6AA 2X01A 1UGUA 3BYDA 1K56D 1K54A 2HGVA 1KGGA 4JPMA 4C6YA 1XFQA 3QP4A 5CEDA 1PWDA 2GNXA 2L0WA 4LRYC 1X0OA 2EX8A 3SH9A 3D72A 1ZG6A 1FIKA 3LICA 1K0KA 2VA0A 1MPLA 3CJMA 1YLJA 1KE3A 1XA7A 1Y54A 1JTGA 3UMEA 3IWOA 4LV3A 1JTDA 5DVAA 3UE6A 4MDZA 4E3KA 2ZOIA 3VP2A 3UB7A 4EERA 2OLUA 3AGDA 4FTXA 3KSGA 4JKTA 2J80A 4PKYG 5HWTA 2JKTM 4I3IA 4B4ZA 1BSGA 4EV4A 5BOHA 2B02A 5L10A 2D02A 4OOMA 1H8YA 4WUJA 3IX3A 2WGIA 4WLAA 2MJ6A 3H82A 4GHIB 4HIAA 5K5BA 1PRQA 3HJIA 1YM1A 4R1GA 3A0RA 3VOLA 4L9EA 3P09A 2JC7A 1W7FA 2VGLS 3DWKA 2ZL1A 1S0WA 2J3TC 2M7VA 1CI9A 3TG9A 1OTIA 3T1QB 3F1NA 1TS7A 2ZM0A 3G2YA 1PIOA 2HF6A 5HAPA 2W3GA 4K91A 3T1XA 2WZZA 2Y59A 5DFXA 2ZBBA 1TS0A 3JPUA 1LI9A 1XJ4A 2PD7A 3IHAA 2W1TA 4HJ4A 1NLYA 4N1XA 3MKFA 2W3FA 4ZRRA 1VM1A 3S7QA 3O88A 5HSQA 4KQDA 3E2LA 4E3NA 1E25A 2VKSA 5CTNA 3A0SA 3WS4A 5A91A 4GDBA 1S4RA 3SH7A 4QJGA 1MWTA 5EE8A 2JKFA 5EOOA 3ZDJA 1F9IA 4M3KA 4HBUA 1FCNA 3H7WB 5HDDA 3V3RA 4MN7A 4Y5FA 4UAAA 3CG5A 2B5RA 1SDNA 1NY0A 4LCLA 4DRTA 2XFTA 1ESIA 4JF5A 1TVFA 5M1AA 1KVLA 1Q2QA 2O9AA 4HJ6A 3UNWA 1GSVA 5EM1A 4NK3A 3UE3A 3VOZA 3VSKA 5DF9A 2PU4A 2Q0OA 1VETB 4NXFA 2Y91A 2EX9A 1S66L 5MC7A 5AVEA 2NUTC 1NZOA 4Y17A 2VGKA 2I9VA 5DFYA 4B4XA 5KIZA 3N8LA 2YKFA 1JVJA 2EXBA 5G4ZA 2PR6A 4JF4A 4KZBA 1IYSA 4ARZA 4E3OA 4R23A 5DF8A 2HJEA 1D7EA 2K31A 1YLWA 2Z6DA 4EUVA 3UB6A 1ES3A 2BTFP 3VP3A 3A3FA 3CAXA 5CHMA 2WKIA 5HL6A 5A93A 4WZ4A 4NEED 1K57C 1ES2A 4FH2A 5FQMA 1IYOA 2PD8A 3ZQ5A 5L2FA 3GQZA 5DTTA 4P0MA 2EX2A 3T4TA 3K3CA 4KENB 3LR0A 4PM6A 1EROA 4NETA 5FAQA 5A90A 2V9AA 4EBNA 3DAVA 1TS6A 2BASA 5IS1A 5JYPA 4KQRA 3PBQA 1ZC2A 4ZBEA 5CHJA 4KZ4A 4QB8A 3WRTA 3MZFA 3ZHHA 3FG8A 4B88A 3PBOA 4KG2A 3IH9A 3DTKA 2HDRA 3S22A 4YFMA 4QHCA 4N92A 1MBLA 1F98A 3HL9A 3C5AA 3PAEA 1E4DA 5AQ7A 3M2KA 4S2NC 2H0YA 1SKOB 5EVIC 5FSRA 1I5QA 1JWVA 4EETB 2WGWA 3HCYA 4KQOA 4E04A 4OP8A 4GOGA 5L07A 3IQAA 3CLOA 4RX3A 2JKRM 1FR1A 2V0WA 3ZG0A 3MBZA 4MBHA 3PBSA 4IUKA 5F83A 4R3AA 4JGPA 4BMWA 2WKQA 2PAVP 2JCHA 3BEBA 4OOLA 3ZGAB 1YLYA 4P6ZM 4Y0OA 1DY6A 3EEAA 1IELA 1WYCA 2EWVA 1FOFA 5HAQA 4PHTA 1NXYA 3BFFA 3FZCA 4X69A 4LLOB 2A2LA 3SS5A 1T1BA 2JE5A 4EQIA 4KUOA 2QPNA 3IBJA 1VQQA 3ICYA 3CUEC 1KDWA 2CMNA 1F5MA 2EA9A 3C4OA 2Y2GA 4G3KA 1P0ZA 3TJZC 3EWKA 5FL3A 4X55A 1CQAA 1OMEA 3DTMA 1L0FA 4Y2FA 1KE0A 3NJAA 4I38A 1LLBA 2DMWA 3QP8A 3F1PA 4LGWA 1PW8A 2VV8A 3WWXA 3LIEA 2PBDP 5J8XA 2Y79A 3HUMA 4ME4A 1ES4A 3IS2B 3B47A 5HX9A 4O01A 3AGEA 3DWZA 3KX0X 4Y15A 2V8FA 3C38A 2KDKA 1VEUA 1D06A 4S2JA 3FPVA 2JKGA 5FDSA 1MXOA 1HZOA 2R9WA 3GDIA 5FATA 1IFQA 5E2FA 3D9YA 3FKVA 1W63M 5CXWA 1N4OA 3BW6A 4WL9A 2OAQ1 2WKRA 4P6BA 2G2WA 2W3DA 1YSPA 3HUNA 3FYZA 5EUAA 2CC1A 4R3JA 3BRMA 1C3BA 2HDUA 4LV2A 5DTKA 4Z1WA 3LFVA 4CJNA 2IWCA 2IWBA 4KZ9A 5JYOA 2HP5A 3T4SA 3UY6A 4E3JA 1HLUP 1GSWA 4MCWA 1TDLA 3WS2A 4EESA 5M19A 2XEPA 1K4FA 2ZD8A 4P85A 2V8CA 4C75A 2EFUA 1DJCA 2H0TA 4CLCB 4A5RA 3UDIA 3ZG8B 5F5YA 4DF6A 5HWWA 2E8IA 4ESPA 5GHYA 2H10A 3LUQA 5FDHA 1L0GA 5CTMA 3F1OB 1CJFA 5AQAA 3LEZA 3MS6A 4XT2A 2C6WB 2HDQA 5HWVA 3BJNA 1N9BA 4R4SA 5I94A 3VP0A 3CMZA 5EVLA 2GDNA 4DKIA 5HAIA 1H8ZA 3VV4A 4HP4A 4DXBA 5A8BA 1H8MA 3V3SA 1LL9A 1KGEA 2ZOHA 3R7WB 1AXBA 4DE1A 3HLCA 4GLQA 3RFBA 4DDYA 2OWHA 4L9FA 4Q0JA 3NOUC 1FR6A 5FAOA 3RTYA 3V5MA 4OP5A 1TD5A 3LO7A 3GSGA 5L8MA 2EWWA 3SS4A 3JYIA 5A92A 3ULFA 3CI6A 1YPRA 2O9CA 4G3VA 5DKKA 3IWIA 5FQIA 1N9OA 4DN0A 5I5LA 1IKIA 4PPRA 5C5KA 4S2LA 4WZ5C 1LSVA 3BQAA 2HPBA 3ZYTA 3UE0A 1K57A 5AQBA 3HLFA 4II7A 2Y2JA 1YMXA 5KZHA 3KYEA 2PT7A 1N9NA 3BFCA 1FSWA 2WK0A 2QMIA 3HBRA 3T4LA 3EEHA 4KZ8A 2ZM8A 1L0EA 4EEUA 1NRFA 1RP5A 1PYYA 2ZC4B 1PW1A 1W8YA 3ITAA 4IBRA 1PNEA 4P87A 2PBYA 3PHYA 4YWZA 3CITA 3VFFA 4LCMA 2INWA 3CZDA 5FASA 4DJ3A 3ZG9B 1XGIA 1ZKJA 3UB9A 1JNUA 2XGNA 3HLDA 2Y2OA 1PWCA 4R70A 2P9VA 2W1RA 5IU1A 3RXWA 3LIAA 3QP1A 1K55A 4S2NA 4ZJ1A 4OH0A 1PI4A 5DKLA 5EVIA 2RL3A 3PAGA 4JGRA 4UA6A 2GZAA 1BZAA 3E98A 3Q1FA 2KLIA 2V1BA 4HY8A 4UA7A 1S4SA 4WF0A 2XR0A 2DCFA 1VETA 3E4PA 1LSWA 1TEMA 1CK3A 3P98A 2WKEA 4JXVA 4X6TA 1XA1A 2VK3A 3GMWA 4PM9A 2W3HA 2P74A 2V2FF 4CLCD 2P7JA 1E3UD 3G2ZA 3IWQA 1XFNA 2H28A 2WADA 2P08A 5E2HA 2HP9A 3IXGA 3SS3A 3E2KA 4S2MA
chains in the Genus database with same CATH topology
4JLFA 3VSLA 3IF6B 1BLSA 1ZC2A 4ZBEA 5CHJA 4KZ4A 3DW0A 4QB8A 3WRTA 3MZFA 3ZHHA 5TFQA 4GN2A 5CGSA 4QU3A 1SHVA 4B88A 3V50A 3PBOA 5IHVA 1ZG4A 2J8YA 4KG2A 4OKPA 1LI0A 3IH9A 2ZM2A 4GDNA 2HDRA 2ZC6B 3S22A 2ZQ8A 1L0DA 3UDXA 5F1FA 3NDEA 5FQKA 4JBFA 4KZ6A 4YFMA 2ZQCA 4QHCA 4N92A 4DDSA 3SOIA 1MBLA 3IHBA 2R9XA 1EWZA 2ZLYA 1BT5A 3HL9A 3C5AA 1MKIA 3PAEA 1E4DA 5AQ7A 5CGXA 3Q82A 3ZCZA 3O87A 2RCXA 3M2KA 4F94A 2J7VA 1Q2PA 3Q07A 4WM9A 1GHMA 3RXXA 3HVFA 3OPPA 1G68A 5FAPA 2Y2HA 4S2NC 2H0YA 1ES5A 5FI7A 4DE0A 4QD4A 4PM5A 1GHIA 4PM7A 5FA7A 5EVIC 5FSRA 1NZUA 2Y2PA 1CI8A 1KGFA 3ISGA 4X68A 3W4OA 3ZVWA 1FCOA 1I5QA 1JWVA 3NIAA 4KQQA 4OPQA 2OV5A 1BTLA 2ZQ7A 2WGWA 5G18A 4KQOA 4OP8A 3PBRA 4RX2A 3EQUA 4GOGA 4U0TA 1GA0A 3IQAA 4EBPA 5E43A 4OQHA 4RX3A 2ZJ9A 4UA9A 3IF6A 2Y2NA 1LL5A 4BQMA 4E3LA 4CPKA 4E3MA 1FR1A 1PI5A 3ZVTA 2Z2LB 3O3VA 1GA9A 2A49A 5CRFA 2V20A 3VMAA 3ZG0A 3MBZA 4MBHA 3PBSA 3C4PA 4OQGA 2V1ZA 5F83A 3IXHA 4WMCD 5AQ9A 2JCHA 3BEBA 3G35A 5CERA 4PMAA 2BLSA 3IXDA 4OOLA 5D3OA 2WZXA 1KVMA 2I72A 3ZFZA 4DXCA 4ZDXA 3ZGAB 1YLYA 3MXSA 3N7WA 2J9PA 4D2OA 4Y0OA 4EWFA 1DY6A 1IELA 1WYCA 4BENA 1FOFA 3A3JA 5GL9A 5HAQA 4IVKA 1XX2A 2Y55A 4GKUA 3NBLA 1NXYA 3BFFA 3S1YA 4BL3A 1NYMA 3FZCA 1HD8A 4X69A 5KSHA 1M6KA 2G2UA 4YINA 5HFOA 1ALQA 3OZHA 3SS5A 1K38A 4HEFA 2JE5A 4EQIA 3GRJA 2Y2QA 5GHZA 2QPNA 1W8QA 5EOEA 4WELA 4PM8A 1ESUA 1K6RA 3M6HA 1VQQA 4DE2A 1HVBA 1KDWA 2DRWA 2ZC3B 2EX6A 1K4EA 3O86A 3EQVA 4HESA 3C4OA 2Y2GA 4MBKA 4KZ7A 4S2PA 3MXRA 4R4RA 4N9KA 3A3IA 3VP4A 1O07A 4X55A 4ZJ3A 1OMEA 2X71A 1IKGA 3DTMA 5GLBA 3PTEA 2WAEA 3GV9A 4Q8IA 1L0FA 4OQIA 3ZG5A 2ZQ9A 1MWRA 1KE0A 4KZ3A 5E2EA 1LLBA 3IH8A 3QNCA 4FCFA 1WE4A 2Q9NA 4LENA 5TR7A 4H8RA 1PW8A 4X53A 3WWXA 3W8KA 4S2OA 2X02A 5CGWA 1CEFA 5J8XA 2XD1A 3HLWA 4ZJ2A 4JXGA 3Q7VA 5FI2A 1KDSA 2OLVA 3ZNYA 4S2KA 3HUMA 1RCJA 2H5SA 3OPHA 4OLDA 3C7VA 1JWPA 1ES4A 2XH9A 3UPNA 1GHPA 5DTSA 2ZQAA 3QHYA 5DF7A 4BJPA 5HX9A 3MZEA 3BLMA 3M6BA 5CHUA 1MWUA 4Y0UA 3AGEA 3DWZA 1DJBA 3LY4A 1BLPA 1K6SA 2WKHA 4OOYA 3NC8A 1WYBA 2BG1A 1MY8A 1YQSA 3OC2A 3HUOA 3GVBA 1PZPA 3BFEA 4S2JA 1G6AA 4X56A 4Z9QA 4IBXA 1SDEA 1XKZA 1K56A 3G4PA 2X01A 4DE3A 4OONA 3BYDA 1K56D 2XK1A 3TSGA 1K54A 1MXOA 1HZOA 1XXMA 2R9WA 1KGGA 4JPMA 1PWGA 4OVDA 4C6YA 3UPOA 5FATA 2Y2LA 5CEDA 1PWDA 5E2FA 4ZAMA 3FKVA 3NDGA 4JXSA 5HW3A 3V39A 5CXWA 1N4OA 5GLCA 2A3UA 2EX8A 3SH9A 4LV0A 4RVAA 1ZG6A 3UN7A 4P6BA 1FSYA 2G2WA 2UWXA 1K55C 1MPLA 4BLMA 3CJMA 1YLJA 4KG5A 3BFDA 2P9VB 1KE3A 1XA7A 3FYZA 3HUNA 3UE1A 1Y54A 1ONHA 1JTGA 4HBTA 3IWOA 4LV3A 1H5XA 5EUAA 3N8RA 3ZG7B 1JTDA 2CC1A 5DVAA 4R3JA 3BRMA 1C3BA 4GB7A 2HDUA 1XPBA 3GR2A 4LV2A 4E3KA 5DTKA 5KMWA 5KSCA 4CJNA 3VP2A 1YMSA 3BECA 2IWCA 2OLUA 3AGDA 2WUQA 4KZAA 2IWBA 4KZ9A 5JYOA 5EVIB 4EUZA 5CECA 3N4IA 2HP5A 4Y0TA 3UY6A 4JKTA 4E3JA 3ZNTA 4K0XA 3QNBA 1O7EA 1TDGA 1TDLA 3A3EA 1SCWA 2C5WB 4U3TA 3WS2A 5M19A 2XEPA 1K4FA 2ZD8A 4P85A 4B4ZA 1BSGA 1BUEA 5FQ9A 4EV4A 5BOHA 4WZ5A 4C75A 2EFUA 1DJCA 2H0TA 4OOMA 1DJAA 5EECA 5GLAA 1H8YA 3IT9A 5M18A 4A5RA 2ZC5B 3WS0A 2WGIA 1YLPA 3UDIA 4OQ0A 3ZG8B 4DF6A 2E8IA 1RGYA 2QZ6A 5GHYA 2H10A 5FDHA 2XD5A 1L0GA 1YM1A 4R1GA 2HDSA 2ZQDA 4JF6A 5CTMA 3P09A 3BFGA 5FQQA 2Y2IA 5AQAA 3ITBA 3WS5A 1EI5A 1NJ4A 1XGJA 3LEZA 1JWZA 2JC7A 3BM6A 2C6WB 1W7FA 4BD1A 2HDQA 3DWKA 1GCEA 3GTCA 4JXWA 1N9BA 1S0WA 4R4SA 5I94A 3VP0A 1CI9A 1K25A 3TG9A 4MEZA 1HTZA 3CMZA 5EVLA 4K0WA 4E6XA 2GDNA 2ZM0A 3G2YA 4DKIA 4RYEA 1CEGA 1K54C 5HAIA 1PIOA 3D4FA 5HAPA 5HARA 2XDMA 4FSFA 1H8ZA 3Q7ZA 4K91A 4FH4A 3PBTA 1BLHA 2PU2A 3LY3A 5F82A 3UPPA 4DXBA 1I2WA 2WZZA 2Y59A 3IF5A 4S2IA 4MLLA 4U0XA 3OCLA 3G32A 1W5DA 1MWSA 2Z2MB 1J9MA 3V3SA 1LL9A 1KGEA 1LI9A 3HLGA 3G30A 2JBFA 1AXBA 3IHAA 4DE1A 4WEKA 4Y7PA 3HLCA 4OLGA 3SS4A 5FI6A 2HP6A 4MBFA 4QY5A 4DDYA 1FCMA 3NCKA 4N1XA 3N6IA 1U60A 1SKFA 3MKFA 4BL2A 3NY4A 1FR6A 3B3XA 2WGVA 5FAOA 4RA7A 1VM1A 3V5MA 4OP5A 3LO7A 3O88A 3GSGA 4IEDA 3HLBA 2IWDA 3IF6C 3BLSA 3E2LA 3FWLA 4FD8A 4R0QA 3JYIA 3I7JA 2ZC7A 5A92A 4MNRA 4E3NA 1ERQA 1E25A 3N8SA 2Y4AA 3IWIA 5CTNA 1NYYA 4OPYA 1W79A 3WS4A 4XXRA 5A91A 5FQIA 2XQZA 3OPRA 4GDBA 3SH7A 4QJGA 1MWTA 5EE8A 1IKIA 1ONGA 4PPRA 5EOOA 4S2LA 4WZ5C 4WBGA 4E6WA 3ZDJA 4M3KA 4HBUA 2HPBA 3HLEA 3UE0A 1I2SA 1M40A 1FCNA 1K57A 3V3RA 5AQBA 5GHXA 3HLFA 3HREA 4UAAA 1LHYA 2Y2JA 1YMXA 3CG5A 5KZHA 2B5RA 4WEJA 1SDNA 1NY0A 4KZ5A 4LCLA 2Q9MA 3M2JA 4DRTA 2XFTA 1ESIA 3BFCA 4JF5A 2WK0A 1YT4A 1FSWA 1TVFA 5M1AA 3SH8A 4IVIA 1KVLA 1L2SA 2QMIA 3HBRA 1Q2QA 1QMEA 4LV1A 3UNWA 4NK3A 4GD6A 3FKWA 4OPZA 3S4XA 3UE3A 3VOZA 2ZMAA 4KZ8A 3VSKA 4GZBA 2ZM8A 3OCNA 4BD0A 1IYPA 1L0EA 5DF9A 2PU4A 1BULA 2WYXA 3IXBA 3VOYA 1NRFA 1RP5A 1PYYA 2XFSA 2Y91A 2ZC4B 4XUXA 1IYQA 1PW1A 1W8YA 4QY6A 3ITAA 4IBRA 1RGZA 4P87A 1XP4A 3MZDA 2EX9A 3G31A 2PBYA 3TOIA 2FFYA 2OSUA 4LCMA 3VFFA 1YLZA 1QMFA 2J9OA 3W4PA 1ERMA 3CZDA 5FASA 1NZOA 3UDFA 2VGKA 3ZG9B 1XGIA 4B4XA 1ZKJA 5TGFA 4ID4A 1YLTA 3N8LA 4GD8A 2XGNA 1JVJA 4WMCA 4EBLA 3OPLA 2EXAA 2EXBA 2Y2OA 3HLDA 3MKEA 1PWCA 3LCEA 2DNSA 3PBNA 4XUZA 2P9VA 3NI9A 3W4QA 3VFHA 4E3IA 4JF4A 4KZBA 1IYSA 5GLDA 4E3OA 4R23A 5DF8A 3RXWA 3G34A 1K55A 4S2NA 3FV7A 3Q7VB 4N1HA 4ZJ1A 4OH0A 1PI4A 1YLWA 3WRZA 5EVIA 4OPRA 2RL3A 2XLNA 3PAGA 4UA6A 2Y2MA 1BZAA 5EVID 3Q1FA 2VGJA 4ZTKA 3Q81A 1ES3A 1PZOA 4WYYA 4UA7A 2XR0A 2DCFA 5CEBA 1TEMA 3VP3A 1CK3A 3A3FA 5CHMA 4L0LA 5E2GA 2WKIA 2WKEA 3P98A 4JXVA 5A93A 4WZ4A 4X6TA 1XA1A 3GMWA 4PM9A 3MFDA 1KE4A 1FQGA 2XF3A 1K57C 1ES2A 2P74A 2V2FF 4FH2A 4O7DA 1IYOA 5FQMA 1E3UA 5HL1A 1E3UD 3G2ZA 5L2FA 3GQZA 4GNUA 4UHUA 3IWQA 5DTTA 3UO9A 4P0MA 2EX2A 1BLCA 4KENB 4C3QA 5FQJA 3A3DA 2WADA 5F1GA 3AGFA 4PM6A 2EFXA 5U47A 1EROA 2WAFA 4NETA 5EPHA 3C7UA 5E2HA 2FFFB 4KG6A 5FAQA 4N9LA 2HP9A 3IXGA 3SS3A 5A90A 2WGWB 3WS1A 2Y2KA 4EBNA 3E2KA 1S6RA 4S2MA 3RJUA 3VP1A 4R3BA 1Z6FA 5JYPA 4KQRA 1IEMA 3PBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JLF A;  3VSL A;  3IF6 B;  1BLS A;  1ZC2 A;  4ZBE A;  5CHJ A;  4KZ4 A;  3DW0 A;  4QB8 A;  3WRT A;  3MZF A;  3ZHH A;  5TFQ A;  4GN2 A;  5CGS A;  4QU3 A;  1SHV A;  4B88 A;  3V50 A;  3PBO A;  5IHV A;  1ZG4 A;  2J8Y A;  4KG2 A;  4OKP A;  1LI0 A;  3IH9 A;  2ZM2 A;  4GDN A;  2HDR A;  2ZC6 B;  3S22 A;  2ZQ8 A;  1L0D A;  3UDX A;  5F1F A;  3NDE A;  5FQK A;  4JBF A;  4KZ6 A;  4YFM A;  2ZQC A;  4QHC A;  4N92 A;  4DDS A;  3SOI A;  1MBL A;  3IHB A;  2R9X A;  1EWZ A;  2ZLY A;  1BT5 A;  3HL9 A;  3C5A A;  1MKI A;  3PAE A;  1E4D A;  5AQ7 A;  5CGX A;  3Q82 A;  3ZCZ A;  3O87 A;  2RCX A;  3M2K A;  4F94 A;  2J7V A;  1Q2P A;  3Q07 A;  4WM9 A;  1GHM A;  3RXX A;  3HVF A;  3OPP A;  1G68 A;  5FAP A;  2Y2H A;  4S2N C;  2H0Y A;  1ES5 A;  5FI7 A;  4DE0 A;  4QD4 A;  4PM5 A;  1GHI A;  4PM7 A;  5FA7 A;  5EVI C;  5FSR A;  1NZU A;  2Y2P A;  1CI8 A;  1KGF A;  3ISG A;  4X68 A;  3W4O A;  3ZVW A;  1FCO A;  1I5Q A;  1JWV A;  3NIA A;  4KQQ A;  4OPQ A;  2OV5 A;  1BTL A;  2ZQ7 A;  2WGW A;  5G18 A;  4KQO A;  4OP8 A;  3PBR A;  4RX2 A;  3EQU A;  4GOG A;  4U0T A;  1GA0 A;  3IQA A;  4EBP A;  5E43 A;  4OQH A;  4RX3 A;  2ZJ9 A;  4UA9 A;  3IF6 A;  2Y2N A;  1LL5 A;  4BQM A;  4E3L A;  4CPK A;  4E3M A;  1FR1 A;  1PI5 A;  3ZVT A;  2Z2L B;  3O3V A;  1GA9 A;  2A49 A;  5CRF A;  2V20 A;  3VMA A;  3ZG0 A;  3MBZ A;  4MBH A;  3PBS A;  3C4P A;  4OQG A;  2V1Z A;  5F83 A;  3IXH A;  4WMC D;  5AQ9 A;  2JCH A;  3BEB A;  3G35 A;  5CER A;  4PMA A;  2BLS A;  3IXD A;  4OOL A;  5D3O A;  2WZX A;  1KVM A;  2I72 A;  3ZFZ A;  4DXC A;  4ZDX A;  3ZGA B;  1YLY A;  3MXS A;  3N7W A;  2J9P A;  4D2O A;  4Y0O A;  4EWF A;  1DY6 A;  1IEL A;  1WYC A;  4BEN A;  1FOF A;  3A3J A;  5GL9 A;  5HAQ A;  4IVK A;  1XX2 A;  2Y55 A;  4GKU A;  3NBL A;  1NXY A;  3BFF A;  3S1Y A;  4BL3 A;  1NYM A;  3FZC A;  1HD8 A;  4X69 A;  5KSH A;  1M6K A;  2G2U A;  4YIN A;  5HFO A;  1ALQ A;  3OZH A;  3SS5 A;  1K38 A;  4HEF A;  2JE5 A;  4EQI A;  3GRJ A;  2Y2Q A;  5GHZ A;  2QPN A;  1W8Q A;  5EOE A;  4WEL A;  4PM8 A;  1ESU A;  1K6R A;  3M6H A;  1VQQ A;  4DE2 A;  1HVB A;  1KDW A;  2DRW A;  2ZC3 B;  2EX6 A;  1K4E A;  3O86 A;  3EQV A;  4HES A;  3C4O A;  2Y2G A;  4MBK A;  4KZ7 A;  4S2P A;  3MXR A;  4R4R A;  4N9K A;  3A3I A;  3VP4 A;  1O07 A;  4X55 A;  4ZJ3 A;  1OME A;  2X71 A;  1IKG A;  3DTM A;  5GLB A;  3PTE A;  2WAE A;  3GV9 A;  4Q8I A;  1L0F A;  4OQI A;  3ZG5 A;  2ZQ9 A;  1MWR A;  1KE0 A;  4KZ3 A;  5E2E A;  1LLB A;  3IH8 A;  3QNC A;  4FCF A;  1WE4 A;  2Q9N A;  4LEN A;  5TR7 A;  4H8R A;  1PW8 A;  4X53 A;  3WWX A;  3W8K A;  4S2O A;  2X02 A;  5CGW A;  1CEF A;  5J8X A;  2XD1 A;  3HLW A;  4ZJ2 A;  4JXG A;  3Q7V A;  5FI2 A;  1KDS A;  2OLV A;  3ZNY A;  4S2K A;  3HUM A;  1RCJ A;  2H5S A;  3OPH A;  4OLD A;  3C7V A;  1JWP A;  1ES4 A;  2XH9 A;  3UPN A;  1GHP A;  5DTS A;  2ZQA A;  3QHY A;  5DF7 A;  4BJP A;  5HX9 A;  3MZE A;  3BLM A;  3M6B A;  5CHU A;  1MWU A;  4Y0U A;  3AGE A;  3DWZ A;  1DJB A;  3LY4 A;  1BLP A;  1K6S A;  2WKH A;  4OOY A;  3NC8 A;  1WYB A;  2BG1 A;  1MY8 A;  1YQS A;  3OC2 A;  3HUO A;  3GVB A;  1PZP A;  3BFE A;  4S2J A;  1G6A A;  4X56 A;  4Z9Q A;  4IBX A;  1SDE A;  1XKZ A;  1K56 A;  3G4P A;  2X01 A;  4DE3 A;  4OON A;  3BYD A;  1K56 D;  2XK1 A;  3TSG A;  1K54 A;  1MXO A;  1HZO A;  1XXM A;  2R9W A;  1KGG A;  4JPM A;  1PWG A;  4OVD A;  4C6Y A;  3UPO A;  5FAT A;  2Y2L A;  5CED A;  1PWD A;  5E2F A;  4ZAM A;  3FKV A;  3NDG A;  4JXS A;  5HW3 A;  3V39 A;  5CXW A;  1N4O A;  5GLC A;  2A3U A;  2EX8 A;  3SH9 A;  4LV0 A;  4RVA A;  1ZG6 A;  3UN7 A;  4P6B A;  1FSY A;  2G2W A;  2UWX A;  1K55 C;  1MPL A;  4BLM A;  3CJM A;  1YLJ A;  4KG5 A;  3BFD A;  2P9V B;  1KE3 A;  1XA7 A;  3FYZ A;  3HUN A;  3UE1 A;  1Y54 A;  1ONH A;  1JTG A;  4HBT A;  3IWO A;  4LV3 A;  1H5X A;  5EUA A;  3N8R A;  3ZG7 B;  1JTD A;  2CC1 A;  5DVA A;  4R3J A;  3BRM A;  1C3B A;  4GB7 A;  2HDU A;  1XPB A;  3GR2 A;  4LV2 A;  4E3K A;  5DTK A;  5KMW A;  5KSC A;  4CJN A;  3VP2 A;  1YMS A;  3BEC A;  2IWC A;  2OLU A;  3AGD A;  2WUQ A;  4KZA A;  2IWB A;  4KZ9 A;  5JYO A;  5EVI B;  4EUZ A;  5CEC A;  3N4I A;  2HP5 A;  4Y0T A;  3UY6 A;  4JKT A;  4E3J A;  3ZNT A;  4K0X A;  3QNB A;  1O7E A;  1TDG A;  1TDL A;  3A3E A;  1SCW A;  2C5W B;  4U3T A;  3WS2 A;  5M19 A;  2XEP A;  1K4F A;  2ZD8 A;  4P85 A;  4B4Z A;  1BSG A;  1BUE A;  5FQ9 A;  4EV4 A;  5BOH A;  4WZ5 A;  4C75 A;  2EFU A;  1DJC A;  2H0T A;  4OOM A;  1DJA A;  5EEC A;  5GLA A;  1H8Y A;  3IT9 A;  5M18 A;  4A5R A;  2ZC5 B;  3WS0 A;  2WGI A;  1YLP A;  3UDI A;  4OQ0 A;  3ZG8 B;  4DF6 A;  2E8I A;  1RGY A;  2QZ6 A;  5GHY A;  2H10 A;  5FDH A;  2XD5 A;  1L0G A;  1YM1 A;  4R1G A;  2HDS A;  2ZQD A;  4JF6 A;  5CTM A;  3P09 A;  3BFG A;  5FQQ A;  2Y2I A;  5AQA A;  3ITB A;  3WS5 A;  1EI5 A;  1NJ4 A;  1XGJ A;  3LEZ A;  1JWZ A;  2JC7 A;  3BM6 A;  2C6W B;  1W7F A;  4BD1 A;  2HDQ A;  3DWK A;  1GCE A;  3GTC A;  4JXW A;  1N9B A;  1S0W A;  4R4S A;  5I94 A;  3VP0 A;  1CI9 A;  1K25 A;  3TG9 A;  4MEZ A;  1HTZ A;  3CMZ A;  5EVL A;  4K0W A;  4E6X A;  2GDN A;  2ZM0 A;  3G2Y A;  4DKI A;  4RYE A;  1CEG A;  1K54 C;  5HAI A;  1PIO A;  3D4F A;  5HAP A;  5HAR A;  2XDM A;  4FSF A;  1H8Z A;  3Q7Z A;  4K91 A;  4FH4 A;  3PBT A;  1BLH A;  2PU2 A;  3LY3 A;  5F82 A;  3UPP A;  4DXB A;  1I2W A;  2WZZ A;  2Y59 A;  3IF5 A;  4S2I A;  4MLL A;  4U0X A;  3OCL A;  3G32 A;  1W5D A;  1MWS A;  2Z2M B;  1J9M A;  3V3S A;  1LL9 A;  1KGE A;  1LI9 A;  3HLG A;  3G30 A;  2JBF A;  1AXB A;  3IHA A;  4DE1 A;  4WEK A;  4Y7P A;  3HLC A;  4OLG A;  3SS4 A;  5FI6 A;  2HP6 A;  4MBF A;  4QY5 A;  4DDY A;  1FCM A;  3NCK A;  4N1X A;  3N6I A;  1U60 A;  1SKF A;  3MKF A;  4BL2 A;  3NY4 A;  1FR6 A;  3B3X A;  2WGV A;  5FAO A;  4RA7 A;  1VM1 A;  3V5M A;  4OP5 A;  3LO7 A;  3O88 A;  3GSG A;  4IED A;  3HLB A;  2IWD A;  3IF6 C;  3BLS A;  3E2L A;  3FWL A;  4FD8 A;  4R0Q A;  3JYI A;  3I7J A;  2ZC7 A;  5A92 A;  4MNR A;  4E3N A;  1ERQ A;  1E25 A;  3N8S A;  2Y4A A;  3IWI A;  5CTN A;  1NYY A;  4OPY A;  1W79 A;  3WS4 A;  4XXR A;  5A91 A;  5FQI A;  2XQZ A;  3OPR A;  4GDB A;  3SH7 A;  4QJG A;  1MWT A;  5EE8 A;  1IKI A;  1ONG A;  4PPR A;  5EOO A;  4S2L A;  4WZ5 C;  4WBG A;  4E6W A;  3ZDJ A;  4M3K A;  4HBU A;  2HPB A;  3HLE A;  3UE0 A;  1I2S A;  1M40 A;  1FCN A;  1K57 A;  3V3R A;  5AQB A;  5GHX A;  3HLF A;  3HRE A;  4UAA A;  1LHY A;  2Y2J A;  1YMX A;  3CG5 A;  5KZH A;  2B5R A;  4WEJ A;  1SDN A;  1NY0 A;  4KZ5 A;  4LCL A;  2Q9M A;  3M2J A;  4DRT A;  2XFT A;  1ESI A;  3BFC A;  4JF5 A;  2WK0 A;  1YT4 A;  1FSW A;  1TVF A;  5M1A A;  3SH8 A;  4IVI A;  1KVL A;  1L2S A;  2QMI A;  3HBR A;  1Q2Q A;  1QME A;  4LV1 A;  3UNW A;  4NK3 A;  4GD6 A;  3FKW A;  4OPZ A;  3S4X A;  3UE3 A;  3VOZ A;  2ZMA A;  4KZ8 A;  3VSK A;  4GZB A;  2ZM8 A;  3OCN A;  4BD0 A;  1IYP A;  1L0E A;  5DF9 A;  2PU4 A;  1BUL A;  2WYX A;  3IXB A;  3VOY A;  1NRF A;  1RP5 A;  1PYY A;  2XFS A;  2Y91 A;  2ZC4 B;  4XUX A;  1IYQ A;  1PW1 A;  1W8Y A;  4QY6 A;  3ITA A;  4IBR A;  1RGZ A;  4P87 A;  1XP4 A;  3MZD A;  2EX9 A;  3G31 A;  2PBY A;  3TOI A;  2FFY A;  2OSU A;  4LCM A;  3VFF A;  1YLZ A;  1QMF A;  2J9O A;  3W4P A;  1ERM A;  3CZD A;  5FAS A;  1NZO A;  3UDF A;  2VGK A;  3ZG9 B;  1XGI A;  4B4X A;  1ZKJ A;  5TGF A;  4ID4 A;  1YLT A;  3N8L A;  4GD8 A;  2XGN A;  1JVJ A;  4WMC A;  4EBL A;  3OPL A;  2EXA A;  2EXB A;  2Y2O A;  3HLD A;  3MKE A;  1PWC A;  3LCE A;  2DNS A;  3PBN A;  4XUZ A;  2P9V A;  3NI9 A;  3W4Q A;  3VFH A;  4E3I A;  4JF4 A;  4KZB A;  1IYS A;  5GLD A;  4E3O A;  4R23 A;  5DF8 A;  3RXW A;  3G34 A;  1K55 A;  4S2N A;  3FV7 A;  3Q7V B;  4N1H A;  4ZJ1 A;  4OH0 A;  1PI4 A;  1YLW A;  3WRZ A;  5EVI A;  4OPR A;  2RL3 A;  2XLN A;  3PAG A;  4UA6 A;  2Y2M A;  1BZA A;  5EVI D;  3Q1F A;  2VGJ A;  4ZTK A;  3Q81 A;  1ES3 A;  1PZO A;  4WYY A;  4UA7 A;  2XR0 A;  2DCF A;  5CEB A;  1TEM A;  3VP3 A;  1CK3 A;  3A3F A;  5CHM A;  4L0L A;  5E2G A;  2WKI A;  2WKE A;  3P98 A;  4JXV A;  5A93 A;  4WZ4 A;  4X6T A;  1XA1 A;  3GMW A;  4PM9 A;  3MFD A;  1KE4 A;  1FQG A;  2XF3 A;  1K57 C;  1ES2 A;  2P74 A;  2V2F F;  4FH2 A;  4O7D A;  1IYO A;  5FQM A;  1E3U A;  5HL1 A;  1E3U D;  3G2Z A;  5L2F A;  3GQZ A;  4GNU A;  4UHU A;  3IWQ A;  5DTT A;  3UO9 A;  4P0M A;  2EX2 A;  1BLC A;  4KEN B;  4C3Q A;  5FQJ A;  3A3D A;  2WAD A;  5F1G A;  3AGF A;  4PM6 A;  2EFX A;  5U47 A;  1ERO A;  2WAF A;  4NET A;  5EPH A;  3C7U A;  5E2H A;  2FFF B;  4KG6 A;  5FAQ A;  4N9L A;  2HP9 A;  3IXG A;  3SS3 A;  5A90 A;  2WGW B;  3WS1 A;  2Y2K A;  4EBN A;  3E2K A;  1S6R A;  4S2M A;  3RJU A;  3VP1 A;  4R3B A;  1Z6F A;  5JYP A;  4KQR A;  1IEM A;  3PBQ A; 
#chains in the Genus database with same CATH topology
 3IF6 B;  1BLS A;  3DW0 A;  5DJU A;  1OT9 A;  3CUE A;  2VZW A;  1MKM A;  4GN2 A;  4QU3 A;  1SHV A;  1OTB A;  4KUK A;  3V50 A;  1ZG4 A;  2J3T D;  2J8Y A;  2ZM2 A;  3NDE A;  2ZQC A;  4R6L A;  3T1R A;  3UMD A;  4DDS A;  3SOI A;  2R9X A;  1EWZ A;  2ZLY A;  3Q82 A;  2R78 A;  2RCX A;  2J7V A;  4WM9 A;  1T1A A;  3OPP A;  5FAP A;  5FI7 A;  2M1C A;  2OAP 1;  4DE0 A;  4QD4 A;  4PM7 A;  5FA7 A;  1FCO A;  4GCZ A;  4EU0 A;  4OPQ A;  2OV5 A;  1UWP X;  1BTL A;  4EBP A;  3LGO A;  5J3W A;  2Y2N A;  1LL5 A;  4E3L A;  4E3M A;  3T1S A;  3F1N B;  5CRF A;  1GA9 A;  2V20 A;  2Z6C A;  3KYZ A;  4IHQ A;  2BLS A;  1Y4O A;  4DXC A;  1LSX A;  2PYR A;  1FIL A;  3T12 B;  3MFX A;  1WA9 A;  3NBL A;  2W1T B;  4BL3 A;  1IOU A;  1M6K A;  2G2U A;  4B93 A;  5HFO A;  1SKO A;  3OZH A;  1W8Q A;  5EOE A;  4GS9 A;  4PM8 A;  4EXO A;  1K6R A;  1MC0 A;  2UV0 E;  3T4Q A;  1DRM A;  2DRW A;  2EX6 A;  2QJ5 A;  3O86 A;  4MBK A;  1J3W A;  3BY8 A;  4R4R A;  3VP4 A;  4Y13 A;  1O07 A;  4ZJ3 A;  2FZ0 A;  2HJ9 C;  3PTE A;  2WAE A;  3ZG5 A;  1CF0 A;  2Q9N A;  4LEN A;  4H8R A;  3C2W A;  1CEF A;  4O8G A;  3HLW A;  3Q7V A;  2OLV A;  2H5S A;  4OLD A;  3C7V A;  1JWP A;  2XH9 A;  3EGD C;  5DTS A;  2ZQA A;  4BJP A;  3PYP A;  2KX6 A;  1MWU A;  4Y0U A;  3QP5 A;  1DJB A;  4NXB A;  4BWI A;  3NC8 A;  1YQS A;  3OC2 A;  3HUO A;  4X56 A;  4JGO A;  4Z9Q A;  4IBX A;  1SDE A;  1XKZ A;  1K56 A;  2Y8H A;  2XK1 A;  3TSG A;  3P7N A;  1XXM A;  2XSS A;  3OOV A;  3NDG A;  5FEG A;  1LL8 A;  2A3U A;  3LI8 A;  4RVA A;  3UN7 A;  1FSY A;  1K55 C;  3BFD A;  4P6Z S;  4HBT A;  2JKR I;  1H5X A;  4GB7 A;  1YKD A;  2QWS A;  2WUQ A;  3IS2 A;  4KZA A;  5CEC A;  3N4I A;  4Y0T A;  2JN7 A;  3OBF A;  4IUH A;  2VV6 A;  3ZNT A;  3QNB A;  3DBA A;  3A3E A;  5F68 A;  4U3T A;  1NRJ A;  4LPZ A;  1D1J A;  4L9G A;  4WN5 A;  2GX5 A;  1F2K A;  5FQ9 A;  4WZ5 A;  4MN6 A;  1XJ6 A;  3IT9 A;  3LIF A;  2L4R A;  2ZC5 B;  3WS0 A;  1YLP A;  4UEY A;  4OQ0 A;  5DJT A;  4NXE A;  1OTA A;  2XD5 A;  1OJ5 A;  2HDS A;  4JF6 A;  5FQQ A;  4EQ1 A;  2Y2I A;  3ITB A;  3WS5 A;  1NJ4 A;  2QHK A;  1JWZ A;  4BD1 A;  4RQ9 A;  3GTC A;  1GCE A;  4MEZ A;  3LIB A;  4UQI M;  1NLZ A;  4HH2 A;  2P04 A;  4I5S A;  5HAR A;  3T4K A;  4FSF A;  3PBT A;  1BLH A;  2PU2 A;  3LY3 A;  5F82 A;  3UPP A;  1I2W A;  3FPW A;  4S2I A;  5TBM B;  4MLL A;  3C30 A;  3OCL A;  1W5D A;  2M7U A;  2Z2M B;  2LB9 A;  3HLG A;  3UB5 P;  2JBF A;  5HDC A;  4Y7P A;  3NEC A;  5J7E A;  4OLG A;  2W27 A;  5FI6 A;  2A24 B;  4MBF A;  3S7N A;  1FCM A;  2FH5 A;  1U60 A;  4BL2 A;  2NUP C;  2WGV A;  3F1O A;  4IED A;  2IWD A;  4R0Q A;  3BLS A;  3L9K A;  3I7J A;  2ZC7 A;  1ERQ A;  2IA2 A;  4OPY A;  1S1Z A;  4XXR A;  2V1A A;  3HLE A;  1LHY A;  4WEJ A;  3C8C A;  3R7W A;  4KZ5 A;  2W0N A;  4F3L B;  2Q9M A;  3M2J A;  4X1L A;  1YT4 A;  4IVI A;  1S67 L;  5HPF A;  1W63 Q;  4LV1 A;  3S4X A;  3FKW A;  4HI4 A;  2VEA A;  2ZMA A;  4GZB A;  3OCN A;  1IYP A;  1BUL A;  2WYX A;  3VOY A;  3QP2 A;  2XFS A;  1IYQ A;  3MJQ A;  4AFI A;  3BQ8 A;  4MN5 A;  1STZ A;  3DTI A;  4DMZ A;  3TOI A;  3NOP C;  4I3J A;  1YLZ A;  2J9O A;  3W4P A;  1ERM A;  3L7H A;  4ID4 A;  1YLT A;  2PYP A;  3CWF A;  4LRZ E;  2EXA A;  3LCE A;  2DNS A;  4XUZ A;  3W4Q A;  3NI9 A;  3D3O A;  1G5U A;  5EV0 A;  4NG2 A;  2O99 A;  2HV1 A;  3FV7 A;  3MSH A;  2JHE A;  2VGJ A;  3E0Y A;  2KOI A;  4ZTK A;  3Q81 A;  5HD5 A;  1PZO A;  3P01 A;  1TF1 A;  5E2G A;  2PDR A;  4GHI A;  3E4O A;  5HL1 A;  2V0U A;  4BBU A;  4GNU A;  4UHU A;  1Y28 A;  5FQJ A;  2HZ5 A;  3T4O A;  3A3D A;  5F1G A;  3AGF A;  5U47 A;  4I3A A;  2OWJ A;  5HPI A;  4N9L A;  1XJ3 A;  3WS1 A;  3HJK A;  3MQO A;  1S6R A;  3RJU A;  4LFU A;  4HHD A;  4JGQ A;  1ZHH B;  3VSL A;  3BY9 A;  3NHQ A;  2PHY A;  1T19 A;  2W3E A;  3UB8 A;  5IHV A;  1G6O A;  4B9O A;  2ZC6 B;  3UDX A;  2ZQ8 A;  5FQK A;  4JBF A;  4KZ6 A;  3U2A A;  5EFW A;  3LI9 A;  2YKH A;  2OOL A;  1G28 A;  1MKI A;  1OTE A;  3O87 A;  4Q0I A;  4LRX C;  2JKT I;  2K7S A;  4F94 A;  2J3W A;  1Q2P A;  1GHM A;  3RXX A;  1G68 A;  3CPT B;  1ES5 A;  1GHI A;  2Y2P A;  3W4O A;  4HH3 A;  3NIA A;  3R4K A;  4KQQ A;  2ZQ7 A;  5G18 A;  4XT2 B;  4RX2 A;  1EW0 A;  3EQU A;  3B33 A;  1ODV A;  5E43 A;  3KO6 A;  2ZJ9 A;  4UA9 A;  3IF6 A;  5CX7 A;  2VLG A;  3ZVT A;  2Z2L B;  3O3V A;  2A49 A;  2QKP A;  3VMA A;  4CLC C;  3C4P A;  3H7W A;  2D01 A;  3T4J A;  4WMC D;  5AQ9 A;  3G35 A;  5D3O A;  2WZX A;  2K2N A;  3ZFZ A;  4D2O A;  4EWF A;  3A3J A;  5GL9 A;  1YSQ A;  1NYM A;  5KSH A;  4HEF A;  3GRJ A;  2Y2Q A;  3W2Z A;  1DP9 A;  1ESU A;  1MZU A;  3GEC A;  4H6J B;  4X1M A;  4DE2 A;  1K4E A;  3EQV A;  4HES A;  3MXR A;  4N9K A;  3A3I A;  3EOI A;  2X71 A;  4Q0H A;  1IKG A;  4OQI A;  2ZQ9 A;  1MWR A;  2AVX A;  2VV7 A;  3MXQ A;  5E2E A;  1A0K A;  1P9W A;  4FCF A;  1WE4 A;  4X53 A;  5L09 A;  3W8K A;  4S2O A;  2X02 A;  4O0P A;  5CGW A;  2XD1 A;  4ZJ2 A;  4ETZ A;  5FI2 A;  1KDS A;  3ZNY A;  1RCJ A;  2XRN A;  2VGL M;  4NXG A;  4FOF A;  3FC7 A;  3UPN A;  1GHP A;  3QHY A;  5DF7 A;  4ETX A;  3BLM A;  3M6B A;  4Y3I A;  5CHU A;  1H3Q A;  3RH8 B;  1K6S A;  4OOY A;  5EVE A;  1MY8 A;  1P9R A;  5TJJ A;  3MMH A;  3BFE A;  4G3W A;  3MR0 A;  2G7U A;  3G4P A;  4DE3 A;  4OON A;  3IX4 A;  5HDS A;  3VE4 A;  1PWG A;  4OVD A;  3UPO A;  2ZMF A;  2Y2L A;  1AWI A;  4ZAM A;  1DP8 A;  4JXS A;  5HW3 A;  3V39 A;  2VX8 A;  3H82 B;  5GLC A;  4GJ4 A;  3NUL A;  4LV0 A;  2UWX A;  4BLM A;  4GW9 A;  4KG5 A;  2P9V B;  3UE1 A;  1ONH A;  3ZG7 B;  3LYX A;  3N8R A;  3PXP A;  4HQA A;  3KSF A;  3A0V A;  3OLO A;  1XPB A;  3GR2 A;  5KMW A;  5KSC A;  1N9L A;  1TS8 A;  1YMS A;  3BEC A;  2ZL1 B;  5EVI B;  4EUZ A;  1V9Y A;  4QPR A;  4K0X A;  3TE8 A;  1O7E A;  1TDG A;  2VJW A;  3LID A;  1SCW A;  2C5W B;  4FUW A;  3KSI A;  3KSH A;  3QP6 A;  3TRC A;  3K3D A;  1BUE A;  4HJ3 A;  5EM0 A;  1DJA A;  5EEC A;  5GLA A;  5M18 A;  1RGY A;  2QZ6 A;  1OT6 A;  2ZQD A;  3BFG A;  4D60 A;  1EI5 A;  1XGJ A;  3BM6 A;  2GJ3 A;  4JXW A;  4CLC E;  1K25 A;  1HTZ A;  3JVU A;  4K0W A;  4E6X A;  4RYE A;  1CEG A;  1K54 C;  3S7P A;  3D4F A;  3PR6 A;  2XDM A;  3Q7Z A;  4FH4 A;  1PFL A;  3MF0 A;  3IF5 A;  4U0X A;  5IT5 A;  3G32 A;  1MWS A;  1J9M A;  3MQ0 A;  1ZTU A;  3G30 A;  4K08 A;  4MMN A;  4WEK A;  3LEQ A;  2HP6 A;  4QY5 A;  3NCK A;  3N6I A;  1SKF A;  3NY4 A;  3B3X A;  4RA7 A;  4PKY A;  2PRF A;  3LR3 A;  3HLB A;  3IF6 C;  4FD8 A;  3FWL A;  4CQH A;  1BYW A;  4MNR A;  3LR4 A;  5LBR A;  3N8S A;  2Y4A A;  2ACG A;  1OJG A;  4YOF A;  1NYY A;  1W79 A;  4M4X A;  2XQZ A;  3OPR A;  5HZH A;  1ONG A;  4E6W A;  4WBG A;  1I2S A;  1M40 A;  5TBM A;  5GHX A;  1T1C A;  3HRE A;  3IX8 A;  3LR5 A;  4ARZ B;  3IBR A;  2A24 A;  1VHM A;  1KOU A;  5G4Y A;  3SH8 A;  1L2S A;  5F69 A;  1QME A;  4GD6 A;  4OPZ A;  4X25 A;  4BD0 A;  3VE3 A;  4GS9 B;  3IXB A;  4XUX A;  4DJ2 A;  4QY6 A;  1RGZ A;  1VB6 A;  2L1M A;  1XP4 A;  4UQI S;  3MZD A;  3G31 A;  4IJG A;  4EW7 A;  4PAU A;  2FFY A;  2OSU A;  3K2N A;  4QWO A;  1QMF A;  3UDF A;  1SZV A;  5TGF A;  4GD8 A;  4EBL A;  4WMC A;  3OPL A;  3MKE A;  5AVF A;  3PBN A;  3VFH A;  4E3I A;  3T50 A;  3JVV A;  5GLD A;  4F3L A;  3G34 A;  2XA7 S;  3Q7V B;  4N1H A;  2O0Y A;  4HOI A;  3WRZ A;  4OPR A;  2XLN A;  1GSX A;  2Y2M A;  5EVI D;  1P97 A;  1V9Z A;  5HD3 A;  4HNB A;  1OTD A;  4WYY A;  2ZMV A;  2QJ7 A;  3SZT A;  5CEB A;  4L0L A;  3MFD A;  1KE4 A;  1FQG A;  2XF3 A;  4CLC A;  1NWZ A;  1XJ2 A;  3EGX C;  5AJG A;  1E3U A;  1ACF A;  2XA7 M;  3BWL A;  3O5Y A;  1T18 A;  2QYB A;  3UO9 A;  1BLC A;  4C3Q A;  2EFX A;  2WAF A;  5EPH A;  3C7U A;  2FFF B;  4KG6 A;  2WGW B;  3G6O A;  2Y2K A;  1Z09 A;  3VP1 A;  4R3B A;  1Z6F A;  3OPH A;  4O7D A;  1IEM A;  4JLF A;  2E8J A;  3V67 A;  5TFQ A;  5CGS A;  3U4L P;  4OKP A;  1LI0 A;  1YAX A;  4GDN A;  5F1F A;  1L0D A;  2B18 A;  4HP9 A;  4R38 A;  3IHB A;  3E4Q A;  1BT5 A;  2WKP A;  5CGX A;  3ZCZ A;  3H9W A;  3NOT C;  3Q07 A;  3HVF A;  2Y2H A;  3SW1 A;  4PM5 A;  3ZVW A;  1NZU A;  3ISG A;  1CI8 A;  1KGF A;  4X68 A;  3TW8 A;  1LT0 A;  3PBR A;  4U0T A;  1GA0 A;  4BBV A;  4OQH A;  4BBT A;  4BQM A;  4CPK A;  4EEP A;  1PI5 A;  3B42 A;  3CHW P;  4OQG A;  2V1Z A;  3IXH A;  5CER A;  4PMA A;  3IXD A;  1KVM A;  2I72 A;  4ZDX A;  1UWN X;  3MXS A;  3F1P B;  3N7W A;  2J9P A;  4BEN A;  3MQQ A;  2O9B A;  1XX2 A;  4IVK A;  2Y55 A;  4GKU A;  3S1Y A;  1HD8 A;  3CPT A;  4YIN A;  1ALQ A;  1K38 A;  2LB5 A;  5GHZ A;  4WEL A;  3M6H A;  1VEU B;  4I39 A;  1HVB A;  4YNR A;  2ZC3 B;  4KZ7 A;  4S2P A;  5J4E A;  5GLB A;  4Q8I A;  3GV9 A;  1S1Y A;  4KZ3 A;  3IH8 A;  3QNC A;  5FEF A;  5TR7 A;  3S7O A;  4JXG A;  4S2K A;  2XRO A;  3KYQ A;  4NKP A;  1OPX A;  3MZE A;  5F6A A;  1H0M A;  2B95 A;  3LY4 A;  1BLP A;  2WKH A;  1L3L A;  1WYB A;  2BG1 A;  1DP6 A;  4H6J A;  3GVB A;  1PZP A;  2PR5 A;  3DTE A;  1G6A A;  2X01 A;  1UGU A;  3BYD A;  1K56 D;  1K54 A;  2HGV A;  1KGG A;  4JPM A;  4C6Y A;  1XFQ A;  3QP4 A;  5CED A;  1PWD A;  2GNX A;  2L0W A;  4LRY C;  1X0O A;  2EX8 A;  3SH9 A;  3D72 A;  1ZG6 A;  1FIK A;  3LIC A;  1K0K A;  2VA0 A;  1MPL A;  3CJM A;  1YLJ A;  1KE3 A;  1XA7 A;  1Y54 A;  1JTG A;  3UME A;  3IWO A;  4LV3 A;  1JTD A;  5DVA A;  3UE6 A;  4MDZ A;  4E3K A;  2ZOI A;  3VP2 A;  3UB7 A;  4EER A;  2OLU A;  3AGD A;  4FTX A;  3KSG A;  4JKT A;  2J80 A;  4PKY G;  5HWT A;  2JKT M;  4I3I A;  4B4Z A;  1BSG A;  4EV4 A;  5BOH A;  2B02 A;  5L10 A;  2D02 A;  4OOM A;  1H8Y A;  4WUJ A;  3IX3 A;  2WGI A;  4WLA A;  2MJ6 A;  3H82 A;  4GHI B;  4HIA A;  5K5B A;  1PRQ A;  3HJI A;  1YM1 A;  4R1G A;  3A0R A;  3VOL A;  4L9E A;  3P09 A;  2JC7 A;  1W7F A;  2VGL S;  3DWK A;  2ZL1 A;  1S0W A;  2J3T C;  2M7V A;  1CI9 A;  3TG9 A;  1OTI A;  3T1Q B;  3F1N A;  1TS7 A;  2ZM0 A;  3G2Y A;  1PIO A;  2HF6 A;  5HAP A;  2W3G A;  4K91 A;  3T1X A;  2WZZ A;  2Y59 A;  5DFX A;  2ZBB A;  1TS0 A;  3JPU A;  1LI9 A;  1XJ4 A;  2PD7 A;  3IHA A;  2W1T A;  4HJ4 A;  1NLY A;  4N1X A;  3MKF A;  2W3F A;  4ZRR A;  1VM1 A;  3S7Q A;  3O88 A;  5HSQ A;  4KQD A;  3E2L A;  4E3N A;  1E25 A;  2VKS A;  5CTN A;  3A0S A;  3WS4 A;  5A91 A;  4GDB A;  1S4R A;  3SH7 A;  4QJG A;  1MWT A;  5EE8 A;  2JKF A;  5EOO A;  3ZDJ A;  1F9I A;  4M3K A;  4HBU A;  1FCN A;  3H7W B;  5HDD A;  3V3R A;  4MN7 A;  4Y5F A;  4UAA A;  3CG5 A;  2B5R A;  1SDN A;  1NY0 A;  4LCL A;  4DRT A;  2XFT A;  1ESI A;  4JF5 A;  1TVF A;  5M1A A;  1KVL A;  1Q2Q A;  2O9A A;  4HJ6 A;  3UNW A;  1GSV A;  5EM1 A;  4NK3 A;  3UE3 A;  3VOZ A;  3VSK A;  5DF9 A;  2PU4 A;  2Q0O A;  1VET B;  4NXF A;  2Y91 A;  2EX9 A;  1S66 L;  5MC7 A;  5AVE A;  2NUT C;  1NZO A;  4Y17 A;  2VGK A;  2I9V A;  5DFY A;  4B4X A;  5KIZ A;  3N8L A;  2YKF A;  1JVJ A;  2EXB A;  5G4Z A;  2PR6 A;  4JF4 A;  4KZB A;  1IYS A;  4ARZ A;  4E3O A;  4R23 A;  5DF8 A;  2HJE A;  1D7E A;  2K31 A;  1YLW A;  2Z6D A;  4EUV A;  3UB6 A;  1ES3 A;  2BTF P;  3VP3 A;  3A3F A;  3CAX A;  5CHM A;  2WKI A;  5HL6 A;  5A93 A;  4WZ4 A;  4NEE D;  1K57 C;  1ES2 A;  4FH2 A;  5FQM A;  1IYO A;  2PD8 A;  3ZQ5 A;  5L2F A;  3GQZ A;  5DTT A;  4P0M A;  2EX2 A;  3T4T A;  3K3C A;  4KEN B;  3LR0 A;  4PM6 A;  1ERO A;  4NET A;  5FAQ A;  5A90 A;  2V9A A;  4EBN A;  3DAV A;  1TS6 A;  2BAS A;  5IS1 A;  5JYP A;  4KQR A;  3PBQ A;  1ZC2 A;  4ZBE A;  5CHJ A;  4KZ4 A;  4QB8 A;  3WRT A;  3MZF A;  3ZHH A;  3FG8 A;  4B88 A;  3PBO A;  4KG2 A;  3IH9 A;  3DTK A;  2HDR A;  3S22 A;  4YFM A;  4QHC A;  4N92 A;  1MBL A;  1F98 A;  3HL9 A;  3C5A A;  3PAE A;  1E4D A;  5AQ7 A;  3M2K A;  4S2N C;  2H0Y A;  1SKO B;  5EVI C;  5FSR A;  1I5Q A;  1JWV A;  4EET B;  2WGW A;  3HCY A;  4KQO A;  4E04 A;  4OP8 A;  4GOG A;  5L07 A;  3IQA A;  3CLO A;  4RX3 A;  2JKR M;  1FR1 A;  2V0W A;  3ZG0 A;  3MBZ A;  4MBH A;  3PBS A;  4IUK A;  5F83 A;  4R3A A;  4JGP A;  4BMW A;  2WKQ A;  2PAV P;  2JCH A;  3BEB A;  4OOL A;  3ZGA B;  1YLY A;  4P6Z M;  4Y0O A;  1DY6 A;  3EEA A;  1IEL A;  1WYC A;  2EWV A;  1FOF A;  5HAQ A;  4PHT A;  1NXY A;  3BFF A;  3FZC A;  4X69 A;  4LLO B;  2A2L A;  3SS5 A;  1T1B A;  2JE5 A;  4EQI A;  4KUO A;  2QPN A;  3IBJ A;  1VQQ A;  3ICY A;  3CUE C;  1KDW A;  2CMN A;  1F5M A;  2EA9 A;  3C4O A;  2Y2G A;  4G3K A;  1P0Z A;  3TJZ C;  3EWK A;  5FL3 A;  4X55 A;  1CQA A;  1OME A;  3DTM A;  1L0F A;  4Y2F A;  1KE0 A;  3NJA A;  4I38 A;  1LLB A;  2DMW A;  3QP8 A;  3F1P A;  4LGW A;  1PW8 A;  2VV8 A;  3WWX A;  3LIE A;  2PBD P;  5J8X A;  2Y79 A;  3HUM A;  4ME4 A;  1ES4 A;  3IS2 B;  3B47 A;  5HX9 A;  4O01 A;  3AGE A;  3DWZ A;  3KX0 X;  4Y15 A;  2V8F A;  3C38 A;  2KDK A;  1VEU A;  1D06 A;  4S2J A;  3FPV A;  2JKG A;  5FDS A;  1MXO A;  1HZO A;  2R9W A;  3GDI A;  5FAT A;  1IFQ A;  5E2F A;  3D9Y A;  3FKV A;  1W63 M;  5CXW A;  1N4O A;  3BW6 A;  4WL9 A;  2OAQ 1;  2WKR A;  4P6B A;  2G2W A;  2W3D A;  1YSP A;  3HUN A;  3FYZ A;  5EUA A;  2CC1 A;  4R3J A;  3BRM A;  1C3B A;  2HDU A;  4LV2 A;  5DTK A;  4Z1W A;  3LFV A;  4CJN A;  2IWC A;  2IWB A;  4KZ9 A;  5JYO A;  2HP5 A;  3T4S A;  3UY6 A;  4E3J A;  1HLU P;  1GSW A;  4MCW A;  1TDL A;  3WS2 A;  4EES A;  5M19 A;  2XEP A;  1K4F A;  2ZD8 A;  4P85 A;  2V8C A;  4C75 A;  2EFU A;  1DJC A;  2H0T A;  4CLC B;  4A5R A;  3UDI A;  3ZG8 B;  5F5Y A;  4DF6 A;  5HWW A;  2E8I A;  4ESP A;  5GHY A;  2H10 A;  3LUQ A;  5FDH A;  1L0G A;  5CTM A;  3F1O B;  1CJF A;  5AQA A;  3LEZ A;  3MS6 A;  4XT2 A;  2C6W B;  2HDQ A;  5HWV A;  3BJN A;  1N9B A;  4R4S A;  5I94 A;  3VP0 A;  3CMZ A;  5EVL A;  2GDN A;  4DKI A;  5HAI A;  1H8Z A;  3VV4 A;  4HP4 A;  4DXB A;  5A8B A;  1H8M A;  3V3S A;  1LL9 A;  1KGE A;  2ZOH A;  3R7W B;  1AXB A;  4DE1 A;  3HLC A;  4GLQ A;  3RFB A;  4DDY A;  2OWH A;  4L9F A;  4Q0J A;  3NOU C;  1FR6 A;  5FAO A;  3RTY A;  3V5M A;  4OP5 A;  1TD5 A;  3LO7 A;  3GSG A;  5L8M A;  2EWW A;  3SS4 A;  3JYI A;  5A92 A;  3ULF A;  3CI6 A;  1YPR A;  2O9C A;  4G3V A;  5DKK A;  3IWI A;  5FQI A;  1N9O A;  4DN0 A;  5I5L A;  1IKI A;  4PPR A;  5C5K A;  4S2L A;  4WZ5 C;  1LSV A;  3BQA A;  2HPB A;  3ZYT A;  3UE0 A;  1K57 A;  5AQB A;  3HLF A;  4II7 A;  2Y2J A;  1YMX A;  5KZH A;  3KYE A;  2PT7 A;  1N9N A;  3BFC A;  1FSW A;  2WK0 A;  2QMI A;  3HBR A;  3T4L A;  3EEH A;  4KZ8 A;  2ZM8 A;  1L0E A;  4EEU A;  1NRF A;  1RP5 A;  1PYY A;  2ZC4 B;  1PW1 A;  1W8Y A;  3ITA A;  4IBR A;  1PNE A;  4P87 A;  2PBY A;  3PHY A;  4YWZ A;  3CIT A;  3VFF A;  4LCM A;  2INW A;  3CZD A;  5FAS A;  4DJ3 A;  3ZG9 B;  1XGI A;  1ZKJ A;  3UB9 A;  1JNU A;  2XGN A;  3HLD A;  2Y2O A;  1PWC A;  4R70 A;  2P9V A;  2W1R A;  5IU1 A;  3RXW A;  3LIA A;  3QP1 A;  1K55 A;  4S2N A;  4ZJ1 A;  4OH0 A;  1PI4 A;  5DKL A;  5EVI A;  2RL3 A;  3PAG A;  4JGR A;  4UA6 A;  2GZA A;  1BZA A;  3E98 A;  3Q1F A;  2KLI A;  2V1B A;  4HY8 A;  4UA7 A;  1S4S A;  4WF0 A;  2XR0 A;  2DCF A;  1VET A;  3E4P A;  1LSW A;  1TEM A;  1CK3 A;  3P98 A;  2WKE A;  4JXV A;  4X6T A;  1XA1 A;  2VK3 A;  3GMW A;  4PM9 A;  2W3H A;  2P74 A;  2V2F F;  4CLC D;  2P7J A;  1E3U D;  3G2Z A;  3IWQ A;  1XFN A;  2H28 A;  2WAD A;  2P08 A;  5E2H A;  2HP9 A;  3IXG A;  3SS3 A;  3E2K A;  4S2M A; 
#chains in the Genus database with same CATH homology
 4JLF A;  3VSL A;  3IF6 B;  1BLS A;  1ZC2 A;  4ZBE A;  5CHJ A;  4KZ4 A;  3DW0 A;  4QB8 A;  3WRT A;  3MZF A;  3ZHH A;  5TFQ A;  4GN2 A;  5CGS A;  4QU3 A;  1SHV A;  4B88 A;  3V50 A;  3PBO A;  5IHV A;  1ZG4 A;  2J8Y A;  4KG2 A;  4OKP A;  1LI0 A;  3IH9 A;  2ZM2 A;  4GDN A;  2HDR A;  2ZC6 B;  3S22 A;  2ZQ8 A;  1L0D A;  3UDX A;  5F1F A;  3NDE A;  5FQK A;  4JBF A;  4KZ6 A;  4YFM A;  2ZQC A;  4QHC A;  4N92 A;  4DDS A;  3SOI A;  1MBL A;  3IHB A;  2R9X A;  1EWZ A;  2ZLY A;  1BT5 A;  3HL9 A;  3C5A A;  1MKI A;  3PAE A;  1E4D A;  5AQ7 A;  5CGX A;  3Q82 A;  3ZCZ A;  3O87 A;  2RCX A;  3M2K A;  4F94 A;  2J7V A;  1Q2P A;  3Q07 A;  4WM9 A;  1GHM A;  3RXX A;  3HVF A;  3OPP A;  1G68 A;  5FAP A;  2Y2H A;  4S2N C;  2H0Y A;  1ES5 A;  5FI7 A;  4DE0 A;  4QD4 A;  4PM5 A;  1GHI A;  4PM7 A;  5FA7 A;  5EVI C;  5FSR A;  1NZU A;  2Y2P A;  1CI8 A;  1KGF A;  3ISG A;  4X68 A;  3W4O A;  3ZVW A;  1FCO A;  1I5Q A;  1JWV A;  3NIA A;  4KQQ A;  4OPQ A;  2OV5 A;  1BTL A;  2ZQ7 A;  2WGW A;  5G18 A;  4KQO A;  4OP8 A;  3PBR A;  4RX2 A;  3EQU A;  4GOG A;  4U0T A;  1GA0 A;  3IQA A;  4EBP A;  5E43 A;  4OQH A;  4RX3 A;  2ZJ9 A;  4UA9 A;  3IF6 A;  2Y2N A;  1LL5 A;  4BQM A;  4E3L A;  4CPK A;  4E3M A;  1FR1 A;  1PI5 A;  3ZVT A;  2Z2L B;  3O3V A;  1GA9 A;  2A49 A;  5CRF A;  2V20 A;  3VMA A;  3ZG0 A;  3MBZ A;  4MBH A;  3PBS A;  3C4P A;  4OQG A;  2V1Z A;  5F83 A;  3IXH A;  4WMC D;  5AQ9 A;  2JCH A;  3BEB A;  3G35 A;  5CER A;  4PMA A;  2BLS A;  3IXD A;  4OOL A;  5D3O A;  2WZX A;  1KVM A;  2I72 A;  3ZFZ A;  4DXC A;  4ZDX A;  3ZGA B;  1YLY A;  3MXS A;  3N7W A;  2J9P A;  4D2O A;  4Y0O A;  4EWF A;  1DY6 A;  1IEL A;  1WYC A;  4BEN A;  1FOF A;  3A3J A;  5GL9 A;  5HAQ A;  4IVK A;  1XX2 A;  2Y55 A;  4GKU A;  3NBL A;  1NXY A;  3BFF A;  3S1Y A;  4BL3 A;  1NYM A;  3FZC A;  1HD8 A;  4X69 A;  5KSH A;  1M6K A;  2G2U A;  4YIN A;  5HFO A;  1ALQ A;  3OZH A;  3SS5 A;  1K38 A;  4HEF A;  2JE5 A;  4EQI A;  3GRJ A;  2Y2Q A;  5GHZ A;  2QPN A;  1W8Q A;  5EOE A;  4WEL A;  4PM8 A;  1ESU A;  1K6R A;  3M6H A;  1VQQ A;  4DE2 A;  1HVB A;  1KDW A;  2DRW A;  2ZC3 B;  2EX6 A;  1K4E A;  3O86 A;  3EQV A;  4HES A;  3C4O A;  2Y2G A;  4MBK A;  4KZ7 A;  4S2P A;  3MXR A;  4R4R A;  4N9K A;  3A3I A;  3VP4 A;  1O07 A;  4X55 A;  4ZJ3 A;  1OME A;  2X71 A;  1IKG A;  3DTM A;  5GLB A;  3PTE A;  2WAE A;  3GV9 A;  4Q8I A;  1L0F A;  4OQI A;  3ZG5 A;  2ZQ9 A;  1MWR A;  1KE0 A;  4KZ3 A;  5E2E A;  1LLB A;  3IH8 A;  3QNC A;  4FCF A;  1WE4 A;  2Q9N A;  4LEN A;  5TR7 A;  4H8R A;  1PW8 A;  4X53 A;  3WWX A;  3W8K A;  4S2O A;  2X02 A;  5CGW A;  1CEF A;  5J8X A;  2XD1 A;  3HLW A;  4ZJ2 A;  4JXG A;  3Q7V A;  5FI2 A;  1KDS A;  2OLV A;  3ZNY A;  4S2K A;  3HUM A;  1RCJ A;  2H5S A;  3OPH A;  4OLD A;  3C7V A;  1JWP A;  1ES4 A;  2XH9 A;  3UPN A;  1GHP A;  5DTS A;  2ZQA A;  3QHY A;  5DF7 A;  4BJP A;  5HX9 A;  3MZE A;  3BLM A;  3M6B A;  5CHU A;  1MWU A;  4Y0U A;  3AGE A;  3DWZ A;  1DJB A;  3LY4 A;  1BLP A;  1K6S A;  2WKH A;  4OOY A;  3NC8 A;  1WYB A;  2BG1 A;  1MY8 A;  1YQS A;  3OC2 A;  3HUO A;  3GVB A;  1PZP A;  3BFE A;  4S2J A;  1G6A A;  4X56 A;  4Z9Q A;  4IBX A;  1SDE A;  1XKZ A;  1K56 A;  3G4P A;  2X01 A;  4DE3 A;  4OON A;  3BYD A;  1K56 D;  2XK1 A;  3TSG A;  1K54 A;  1MXO A;  1HZO A;  1XXM A;  2R9W A;  1KGG A;  4JPM A;  1PWG A;  4OVD A;  4C6Y A;  3UPO A;  5FAT A;  2Y2L A;  5CED A;  1PWD A;  5E2F A;  4ZAM A;  3FKV A;  3NDG A;  4JXS A;  5HW3 A;  3V39 A;  5CXW A;  1N4O A;  5GLC A;  2A3U A;  2EX8 A;  3SH9 A;  4LV0 A;  4RVA A;  1ZG6 A;  3UN7 A;  4P6B A;  1FSY A;  2G2W A;  2UWX A;  1K55 C;  1MPL A;  4BLM A;  3CJM A;  1YLJ A;  4KG5 A;  3BFD A;  2P9V B;  1KE3 A;  1XA7 A;  3FYZ A;  3HUN A;  3UE1 A;  1Y54 A;  1ONH A;  1JTG A;  4HBT A;  3IWO A;  4LV3 A;  1H5X A;  5EUA A;  3N8R A;  3ZG7 B;  1JTD A;  2CC1 A;  5DVA A;  4R3J A;  3BRM A;  1C3B A;  4GB7 A;  2HDU A;  1XPB A;  3GR2 A;  4LV2 A;  4E3K A;  5DTK A;  5KMW A;  5KSC A;  4CJN A;  3VP2 A;  1YMS A;  3BEC A;  2IWC A;  2OLU A;  3AGD A;  2WUQ A;  4KZA A;  2IWB A;  4KZ9 A;  5JYO A;  5EVI B;  4EUZ A;  5CEC A;  3N4I A;  2HP5 A;  4Y0T A;  3UY6 A;  4JKT A;  4E3J A;  3ZNT A;  4K0X A;  3QNB A;  1O7E A;  1TDG A;  1TDL A;  3A3E A;  1SCW A;  2C5W B;  4U3T A;  3WS2 A;  5M19 A;  2XEP A;  1K4F A;  2ZD8 A;  4P85 A;  4B4Z A;  1BSG A;  1BUE A;  5FQ9 A;  4EV4 A;  5BOH A;  4WZ5 A;  4C75 A;  2EFU A;  1DJC A;  2H0T A;  4OOM A;  1DJA A;  5EEC A;  5GLA A;  1H8Y A;  3IT9 A;  5M18 A;  4A5R A;  2ZC5 B;  3WS0 A;  2WGI A;  1YLP A;  3UDI A;  4OQ0 A;  3ZG8 B;  4DF6 A;  2E8I A;  1RGY A;  2QZ6 A;  5GHY A;  2H10 A;  5FDH A;  2XD5 A;  1L0G A;  1YM1 A;  4R1G A;  2HDS A;  2ZQD A;  4JF6 A;  5CTM A;  3P09 A;  3BFG A;  5FQQ A;  2Y2I A;  5AQA A;  3ITB A;  3WS5 A;  1EI5 A;  1NJ4 A;  1XGJ A;  3LEZ A;  1JWZ A;  2JC7 A;  3BM6 A;  2C6W B;  1W7F A;  4BD1 A;  2HDQ A;  3DWK A;  1GCE A;  3GTC A;  4JXW A;  1N9B A;  1S0W A;  4R4S A;  5I94 A;  3VP0 A;  1CI9 A;  1K25 A;  3TG9 A;  4MEZ A;  1HTZ A;  3CMZ A;  5EVL A;  4K0W A;  4E6X A;  2GDN A;  2ZM0 A;  3G2Y A;  4DKI A;  4RYE A;  1CEG A;  1K54 C;  5HAI A;  1PIO A;  3D4F A;  5HAP A;  5HAR A;  2XDM A;  4FSF A;  1H8Z A;  3Q7Z A;  4K91 A;  4FH4 A;  3PBT A;  1BLH A;  2PU2 A;  3LY3 A;  5F82 A;  3UPP A;  4DXB A;  1I2W A;  2WZZ A;  2Y59 A;  3IF5 A;  4S2I A;  4MLL A;  4U0X A;  3OCL A;  3G32 A;  1W5D A;  1MWS A;  2Z2M B;  1J9M A;  3V3S A;  1LL9 A;  1KGE A;  1LI9 A;  3HLG A;  3G30 A;  2JBF A;  1AXB A;  3IHA A;  4DE1 A;  4WEK A;  4Y7P A;  3HLC A;  4OLG A;  3SS4 A;  5FI6 A;  2HP6 A;  4MBF A;  4QY5 A;  4DDY A;  1FCM A;  3NCK A;  4N1X A;  3N6I A;  1U60 A;  1SKF A;  3MKF A;  4BL2 A;  3NY4 A;  1FR6 A;  3B3X A;  2WGV A;  5FAO A;  4RA7 A;  1VM1 A;  3V5M A;  4OP5 A;  3LO7 A;  3O88 A;  3GSG A;  4IED A;  3HLB A;  2IWD A;  3IF6 C;  3BLS A;  3E2L A;  3FWL A;  4FD8 A;  4R0Q A;  3JYI A;  3I7J A;  2ZC7 A;  5A92 A;  4MNR A;  4E3N A;  1ERQ A;  1E25 A;  3N8S A;  2Y4A A;  3IWI A;  5CTN A;  1NYY A;  4OPY A;  1W79 A;  3WS4 A;  4XXR A;  5A91 A;  5FQI A;  2XQZ A;  3OPR A;  4GDB A;  3SH7 A;  4QJG A;  1MWT A;  5EE8 A;  1IKI A;  1ONG A;  4PPR A;  5EOO A;  4S2L A;  4WZ5 C;  4WBG A;  4E6W A;  3ZDJ A;  4M3K A;  4HBU A;  2HPB A;  3HLE A;  3UE0 A;  1I2S A;  1M40 A;  1FCN A;  1K57 A;  3V3R A;  5AQB A;  5GHX A;  3HLF A;  3HRE A;  4UAA A;  1LHY A;  2Y2J A;  1YMX A;  3CG5 A;  5KZH A;  2B5R A;  4WEJ A;  1SDN A;  1NY0 A;  4KZ5 A;  4LCL A;  2Q9M A;  3M2J A;  4DRT A;  2XFT A;  1ESI A;  3BFC A;  4JF5 A;  2WK0 A;  1YT4 A;  1FSW A;  1TVF A;  5M1A A;  3SH8 A;  4IVI A;  1KVL A;  1L2S A;  2QMI A;  3HBR A;  1Q2Q A;  1QME A;  4LV1 A;  3UNW A;  4NK3 A;  4GD6 A;  3FKW A;  4OPZ A;  3S4X A;  3UE3 A;  3VOZ A;  2ZMA A;  4KZ8 A;  3VSK A;  4GZB A;  2ZM8 A;  3OCN A;  4BD0 A;  1IYP A;  1L0E A;  5DF9 A;  2PU4 A;  1BUL A;  2WYX A;  3IXB A;  3VOY A;  1NRF A;  1RP5 A;  1PYY A;  2XFS A;  2Y91 A;  2ZC4 B;  4XUX A;  1IYQ A;  1PW1 A;  1W8Y A;  4QY6 A;  3ITA A;  4IBR A;  1RGZ A;  4P87 A;  1XP4 A;  3MZD A;  2EX9 A;  3G31 A;  2PBY A;  3TOI A;  2FFY A;  2OSU A;  4LCM A;  3VFF A;  1YLZ A;  1QMF A;  2J9O A;  3W4P A;  1ERM A;  3CZD A;  5FAS A;  1NZO A;  3UDF A;  2VGK A;  3ZG9 B;  1XGI A;  4B4X A;  1ZKJ A;  5TGF A;  4ID4 A;  1YLT A;  3N8L A;  4GD8 A;  2XGN A;  1JVJ A;  4WMC A;  4EBL A;  3OPL A;  2EXA A;  2EXB A;  2Y2O A;  3HLD A;  3MKE A;  1PWC A;  3LCE A;  2DNS A;  3PBN A;  4XUZ A;  2P9V A;  3NI9 A;  3W4Q A;  3VFH A;  4E3I A;  4JF4 A;  4KZB A;  1IYS A;  5GLD A;  4E3O A;  4R23 A;  5DF8 A;  3RXW A;  3G34 A;  1K55 A;  4S2N A;  3FV7 A;  3Q7V B;  4N1H A;  4ZJ1 A;  4OH0 A;  1PI4 A;  1YLW A;  3WRZ A;  5EVI A;  4OPR A;  2RL3 A;  2XLN A;  3PAG A;  4UA6 A;  2Y2M A;  1BZA A;  5EVI D;  3Q1F A;  2VGJ A;  4ZTK A;  3Q81 A;  1ES3 A;  1PZO A;  4WYY A;  4UA7 A;  2XR0 A;  2DCF A;  5CEB A;  1TEM A;  3VP3 A;  1CK3 A;  3A3F A;  5CHM A;  4L0L A;  5E2G A;  2WKI A;  2WKE A;  3P98 A;  4JXV A;  5A93 A;  4WZ4 A;  4X6T A;  1XA1 A;  3GMW A;  4PM9 A;  3MFD A;  1KE4 A;  1FQG A;  2XF3 A;  1K57 C;  1ES2 A;  2P74 A;  2V2F F;  4FH2 A;  4O7D A;  1IYO A;  5FQM A;  1E3U A;  5HL1 A;  1E3U D;  3G2Z A;  5L2F A;  3GQZ A;  4GNU A;  4UHU A;  3IWQ A;  5DTT A;  3UO9 A;  4P0M A;  2EX2 A;  1BLC A;  4KEN B;  4C3Q A;  5FQJ A;  3A3D A;  2WAD A;  5F1G A;  3AGF A;  4PM6 A;  2EFX A;  5U47 A;  1ERO A;  2WAF A;  4NET A;  5EPH A;  3C7U A;  5E2H A;  2FFF B;  4KG6 A;  5FAQ A;  4N9L A;  2HP9 A;  3IXG A;  3SS3 A;  5A90 A;  2WGW B;  3WS1 A;  2Y2K A;  4EBN A;  3E2K A;  1S6R A;  4S2M A;  3RJU A;  3VP1 A;  4R3B A;  1Z6F A;  5JYP A;  4KQR A;  1IEM A;  3PBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...