3WRZA

N288q-n321q mutant beta-lactamase derived from chromohalobacter sp.560 (without soaking)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
357
structure length
357
Chain Sequence
b'QTREVLDPIVASLMEAQQIPGMAIALVRPEGTTISHYGAADRETGTPVDDDTLFEIGSLSKTLTATLASLAEVEGKLDFDAPVSRYLPELEGSAFDDISGLNLGTHTGGGLPLFVPDEVTDRASLMAWYREWQPTEPIGESRTYSNLGIGLLGLETAASLDGEFVPTMRAKVLAPLGMQDTWYDVPEARMADYAMGEDKDGQPTRVSPGVLDDEAYGIKTTAADLAKLVRANLHLADVDAELQQAIDATRQGHYRVGDMTQALIWEQYSLPVAPETLRAGQGYDMILEPNAAEALEPPQSPRDDVWVNKTGSTQGFGGYIVMLPGKHTGLVMLANKNYPNDARVEAAYRILSGLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
molecule tags Hydrolase
source organism Chromohalobacter sp. 560
publication title Structure of a highly acidic beta-lactamase from the moderate halophile Chromohalobacter sp. 560 and the discovery of a Cs(+)-selective binding site
pubmed doi rcsb
total genus 116
structure length 357
sequence length 357
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3wrzA00
1CEFA 1NXYA 2J9PA 3BECA 3HUNA 5FAOA 5M18A 3IHBA 4MLLA 2EXAA 1KGFA 3NDGA 3VOYA 1K55A 4HEFA 5EPHA 5GL9A 3UDIA 1XGJA 1SHVA 3BFEA 1NYMA 4PM6A 4X53A 2EX2A 1PWCA 2A49A 2XLNA 3GSGA 1XPBA 4JF5A 4GD6A 2DRWA 2WK0A 3IXDA 3UE3A 5GHXA 3Q1FA 5EOOA 5CEBA 4KZ3A 3MZEA 4DE1A 1PZPA 1FR1A 3B3XA 1L0DA 3QNBA 2V2FF 1MWSA 4OQIA 3UO9A 4JPMA 4DE3A 2XQZA 3OPRA 1L0FA 3NI9A 3PBSA 4KQRA 1M6KA 1PI4A 4N92A 5DF8A 2ZM8A 3G4PA 3OPHA 4N9KA 3ZHHA 4DDSA 3UDXA 3ZCZA 3CZDA 3FWLA 4S2NA 1YLWA 4IBRA 2H0TA 4EBLA 5E2HA 1KE3A 3Q7VA 2J9OA 4WZ5A 1LL9A 4OOMA 5A93A 1SCWA 1SDEA 3BRMA 3V3SA 3IH9A 2OSUA 1W8QA 4X56A 1BSGA 2EX9A 3SH9A 4R3JA 5EVLA 4P0MA 4BL2A 4RX3A 4UA9A 2HDUA 1H8ZA 5E43A 1JTGA 1S0WA 2ZQ7A 4JXVA 4UHUA 3QHYA 1KDWA 1K57C 1HVBA 1ALQA 3C7VA 5G18A 4S2NC 3UPNA 3N8RA 4B88A 1PIOA 3OCNA 2C5WB 4ZBEA 4CJNA 1FCOA 3S1YA 1K55C 3NCKA 1JVJA 4OP5A 2QPNA 5DTTA 3GVBA 4UA6A 5GHYA 1IEMA 2H5SA 3IF5A 3V5MA 1BT5A 4OPQA 2Y2JA 2IWCA 4OPRA 2Y2KA 4B4ZA 5CXWA 1HD8A 3VP1A 4O7DA 1ZG4A 4ZJ1A 4PM7A 4C6YA 1L2SA 3NIAA 4OP8A 3AGDA 3TG9A 3W8KA 2EX6A 3FKWA 4MBFA 3HUMA 5M1AA 1H5XA 1RGZA 3IWIA 2ZM2A 3M6HA 2ZQAA 4PM8A 4X69A 3ZG0A 3HREA 3IF6C 2XDMA 4PM5A 4DE0A 2QMIA 1DJBA 3NY4A 4QY6A 3O88A 5A91A 1TDLA 2Z2MB 3GTCA 1Q2PA 4WMCA 3A3JA 1ESUA 4GB7A 4E3OA 1GHPA 3E2KA 4S2MA 3AGFA 1O07A 2HP6A 2ZC6B 1IYOA 1NY0A 4BD1A 4FH2A 4DXBA 3GQZA 2ZLYA 4RA7A 5F82A 4ZJ2A 3SS5A 1IELA 4PM9A 3PBOA 3O87A 1SDNA 4GNUA 3WS0A 1N4OA 3WWXA 3CG5A 1BZAA 1ES5A 1LI0A 1YMXA 5AQ7A 5FAQA 3TSGA 5J8XA 1PW8A 4WBGA 1L0EA 5FQMA 3UNWA 5JYPA 4U0XA 2IWBA 2WYXA 2XEPA 1KVLA 3IXHA 3P98A 4KZ8A 3V3RA 1W79A 4CPKA 3PBTA 1ONHA 2HP9A 3NDEA 4GOGA 2Q9MA 3DW0A 4XXRA 5U47A 1GCEA 1FSYA 3ZG9B 4R1GA 4IEDA 3W4OA 1IKGA 2Y2LA 4LV1A 1MWUA 1YLTA 1YM1A 2EX8A 1ESIA 3A3DA 5CHUA 4C75A 1G6AA 5KSCA 4DXCA 1RP5A 4P87A 2JBFA 1K6SA 1LLBA 3PBRA 5FQIA 3SOIA 4S2KA 4ZJ3A 4N9LA 4KQQA 5CHJA 2Y91A 3G32A 4DF6A 3Q82A 5CHMA 1ES3A 1IYQA 4BENA 3HVFA 3G35A 3NBLA 4JLFA 4QHCA 3DWZA 1K4EA 5FQQA 4HBTA 5E2FA 1E3UD 5GLBA 1QMFA 1ZKJA 4KG6A 1YLYA 2OV5A 3I7JA 1FR6A 2WGVA 4EQIA 4IVKA 4JBFA 2FFYA 3ZG7B 1OMEA 2V20A 4N1XA 4L0LA 4Z9QA 3UY6A 2UWXA 1I5QA 2WAFA 4KZ9A 4E6XA 3BEBA 4QB8A 4E3LA 3VP0A 4EWFA 2ZQCA 3PTEA 4DE2A 5CTMA 4K91A 4OQHA 4KG5A 1AXBA 1BLSA 1Q2QA 1XX2A 3HLWA 3P09A 4S2IA 5BOHA 5FA7A 1MKIA 5FQ9A 5GHZA 1ONGA 1FQGA 5FASA 4E3MA 1YT4A 1N9BA 2DCFA 2WADA 5EVID 5CTNA 3IXBA 1W7FA 3LCEA 5FI7A 1GHIA 2VGKA 2HDRA 3IQAA 4K0XA 5M19A 3MBZA 4MBKA 3AGEA 5KSHA 2P9VB 5CECA 4OKPA 3G30A 4WZ5C 5CRFA 3JYIA 4ZTKA 1VM1A 1KE4A 1BULA 1M40A 4OLGA 3BFCA 4D2OA 1L0GA 5EVIA 1PW1A 4YINA 2BLSA 1Y54A 4JXWA 1KE0A 3IT9A 4RYEA 5HL1A 1PYYA 4WELA 1FCMA 3BLMA 5CGSA 4R4RA 3HLGA 4OVDA 4WEKA 5EOEA 1XA7A 1YLJA 3FKVA 5EVIC 2WKEA 1RCJA 4Y0TA 4R23A 2ZQDA 3IWOA 4MBHA 4MNRA 5TFQA 3WS5A 4BL3A 4K0WA 2WGWA 3Q7ZA 4OH0A 2G2WA 4GN2A 3S4XA 2P74A 2H10A 3C4OA 3NC8A 4S2JA 3RXWA 3TOIA 3UN7A 1EWZA 5F83A 5DVAA 3N4IA 5L2FA 2Y2GA 5CEDA 3W4QA 1FOFA 2ZM0A 1JWZA 3LY3A 4Y0UA 1DJAA 3V50A 1YLPA 3VFFA 2ZC3B 2CC1A 2Y2NA 2I72A 4P6BA 1JWPA 1GHMA 1Z6FA 3ISGA 4JXGA 2XH9A 4KZBA 3N8SA 3WS2A 3IF6A 1GA9A 2DNSA 5FSRA 3UPPA 3MXRA 5DTKA 4Q8IA 2ZC4B 2EFUA 3MXSA 3VFHA 1TEMA 3MZFA 4QY5A 4KZ5A 5AQBA 1K54A 4E3JA 3HLBA 4H8RA 1NRFA 1G68A 4A5RA 1MPLA 4ZDXA 3UE0A 3HL9A 1YQSA 1J9MA 1GA0A 4FCFA 3WS4A 1LI9A 4YFMA 4PMAA 3O86A 3OCLA 5DF7A 3A3EA 1HTZA 1WE4A 3M2KA 5F1FA 5FAPA 1MBLA 4JF6A 2X01A 2PU4A 4JF4A 3PBQA 3FV7A 2QZ6A 2WAEA 5DTSA 3C4PA 3FYZA 3HLFA 2C6WB 2WGIA 2WUQA 4BD0A 4BLMA 1PI5A 3G34A 1K54C 3SH8A 2HDSA 2JCHA 1ZG6A 3MZDA 4X55A 4OPZA 4XUXA 5EE8A 4E3NA 4X6TA 4DRTA 4EV4A 3HLEA 3EQUA 1CI9A 4GZBA 2E8IA 1ES2A 5FDHA 4UA7A 2JE5A 2OLVA 1K6RA 1LHYA 3ZG5A 1BLPA 4LV3A 2WGWB 2WZXA 3ZNTA 3MFDA 1MXOA 3BYDA 3MKEA 1CI8A 2RL3A 4DKIA 2P9VA 1TVFA 1H8YA 3V39A 1KVMA 4WEJA 3G31A 2ZQ9A 2X02A 2Y2QA 4S2PA 2XR0A 1VQQA 2G2UA 3DTMA 4OPYA 5FI2A 3VSLA 2J7VA 3BFDA 5KMWA 3MKFA 1BLHA 1IYPA 4E3IA 5FI6A 1W5DA 3IXGA 1JTDA 4IBXA 4KENB 5EVIB 3VSKA 4B4XA 1NZUA 3VP2A 1BTLA 4HBUA 4RVAA 4X68A 5IHVA 3OC2A 1DY6A 2XFTA 1W8YA 4LV0A 4XUZA 3ZFZA 3DWKA 5D3OA 3ZVWA 3SS4A 4GDNA 4DDYA 3IHAA 5CGWA 1LL5A 3HLDA 4LENA 3HBRA 4C3QA 2Y2PA 3FZCA 3N7WA 4S2LA 4U3TA 1XXMA 4E3KA 1NJ4A 2ZQ8A 2XF3A 1O7EA 2Y2IA 1SKFA 3IWQA 1FCNA 2IWDA 3OPPA 3BFGA 2WKIA 4IVIA 4GKUA 4KZAA 4WM9A 4QJGA 1K56A 2V1ZA 4LCMA 4U0TA 1E3UA 2VGJA 4OOYA 5E2EA 1WYCA 4MEZA 4UAAA 5FQKA 5A92A 5EECA 3ZVTA 4OOLA 5JYOA 3VP4A 4KZ4A 3HUOA 1BUEA 2Y2HA 4RX2A 1MY8A 1IYSA 2BG1A 4F94A 5TR7A 3SH7A 3PBNA 3ITBA 3Q7VB 1PWDA 4EUZA 4NETA 3ZGAB 1C3BA 4JXSA 3ITAA 1NZOA 3IH8A 4N1HA 4PPRA 4R4SA 4R0QA 3M6BA 3UPOA 3HLCA 2EFXA 5KZHA 1S6RA 4OQGA 1EROA 5TGFA 3EQVA 3GRJA 1PZOA 2HDQA 2XGNA 5HAPA 1I2SA 3N8LA 2WZZA 2WKHA 4OONA 5CERA 3UE1A 1TDGA 2R9WA 1FSWA 3ZDJA 5HAQA 3PAGA 3UDFA 1I2WA 3Q07A 3BFFA 1PWGA 2Q9NA 5HX9A 1KGEA 1U60A 1XKZA 4Y0OA 1JWVA 1QMEA 2ZD8A 3OPLA 2RCXA 1EI5A 3CMZA 3C7UA 1DJCA 4S2OA 5FQJA 1RGYA 5AQ9A 1CK3A 3WRTA 4QD4A 4E6WA 4EBNA 5E2GA 2HPBA 1YLZA 1ERMA 2Y55A 4KG2A 2A3UA 4QU3A 1E4DA 3IF6B 3VP3A 5A90A 4M3KA 1BLCA 2ZJ9A 4OLDA 3O3VA 4ID4A 5FATA 4GDBA 2PU2A 4OQ0A 2J8YA 2X71A 3A3IA 3WRZA 1K4FA 5GLCA 3BLSA 3W4PA 2FFFB 3E2LA 5HFOA 4KZ6A 1YMSA 1E25A 3RJUA 4Y7PA 3WS1A 2ZC7A 1K38A 4FD8A 5HW3A 3G2ZA 3ZNYA 4HESA 2ZMAA 4LV2A 1NYYA 2XK1A 2Z2LB 1K56D 4ZAMA 2EXBA 3G2YA 1XP4A 2JC7A 1ERQA 2XFSA 4KQOA 3ZG8B 1KDSA 1MWRA 3SS3A 2XD1A 4JKTA 3LEZA 1XGIA 2R9XA 5I94A 4FSFA 3LY4A 4LCLA 1ZC2A 4R3BA 5CGXA 2ZC5B 3C5AA 1XA1A 3BM6A 2Y2OA 3LO7A 4WMCD 3GR2A 2XD5A 2GDNA 3OZHA 5AQAA 5HARA 2Y59A 5DF9A 1CEGA 2HP5A 3S22A 2OLUA 5GLDA 4WZ4A 2Y4AA 4GD8A 3VMAA 3M2JA 1K57A 1MWTA 4P85A 4NK3A 2Y2MA 4BQMA 1KGGA 4FH4A 5HAIA 3VOZA 2H0YA 5F1GA 1ES4A 4KZ7A 4EBPA 1WYBA 3CJMA 1HZOA 4WYYA 4BJPA 3QNCA 2PBYA 3N6IA 3Q81A 1IKIA 1K25A 3GV9A 5EUAA 3RXXA 2B5RA 3A3FA 3D4FA 3GMWA 5GLAA 3PAEA
chains in the Genus database with same CATH superfamily
1CEFA 1NXYA 5FAOA 5M18A 4MLLA 3KSIA 3UDIA 2V8CA 4GD6A 1YPRA 2WK0A 5GHXA 3Q1FA 3IBRA 3CAXA 3L7HA 5EOOA 3T1XA 3NOPC 4I3JA 5DFXA 2O0YA 2P08A 5AVFA 3UB8A 4EEPA 1AWIA 4GCZA 1XJ6A 4Q0HA 5DF8A 1VHMA 2ZM8A 3G4PA 4N9KA 3ZHHA 1XJ4A 1XFNA 4QPRA 1MZUA 4EBLA 3QP1A 2J9OA 1LL9A 4ARZB 3D9YA 3UB6A 4R3JA 4UA9A 2HDUA 5E43A 2ZQ7A 4UHUA 1ALQA 5EV0A 4MN5A 5G18A 2V1BA 4HNBA 1DP6A 4B88A 1PIOA 2A24B 1FCOA 3GVBA 3IF5A 2GX5A 2Y2JA 4OPRA 4B4ZA 3GECA 3NIAA 2YKFA 1UWNX 3FKWA 3W8KA 3T1SA 3HUMA 1RGZA 2ZQAA 3MQ0A 4X69A 3RTYA 3FG8A 2HZ5A 2L0WA 2QMIA 3O88A 2K31A 4S2MA 2HP6A 2ZC6B 4XT2A 3GQZA 4ZJ2A 1UWPX 1SDNA 4GNUA 3WWXA 1FIKA 1BZAA 5AQ7A 2B95A 3UNWA 4HH2A 5JYPA 2D01A 3P01A 1KVLA 4KZ8A 1W79A 4CPKA 3PBTA 4XXRA 1GCEA 3ZG9B 3W4OA 4IEDA 1YLTA 1YM1A 2NUPC 3A3DA 1TS7A 1G6AA 5L10A 4P87A 2O99A 2JBFA 2H28A 3SOIA 4S2KA 4KQQA 5CHJA 2Y91A 3Q82A 4JGQA 3NBLA 2HGVA 5HD5A 5E2FA 2W27A 1E3UD 2MJ6A 1QMFA 1ZKJA 1YLYA 3S7QA 5EVEA 4IVKA 4X25A 4N1XA 4L0LA 3VOLA 2UWXA 2WAFA 4KZ9A 4QB8A 4E3LA 3VP0A 1H8MA 3DTIA 3BQAA 4KG5A 4KUKA 1XX2A 3HLWA 5BOHA 1VEUB 4D60A 3O5YA 1ONGA 1FQGA 4E3MA 2WADA 1N9BA 2DCFA 5L07A 4G3KA 2W3EA 1OTEA 3AGEA 5IT5A 5EM0A 4OKPA 4F3LA 4LFUA 5CRFA 4DJ2A 1VM1A 5K5BA 4D2OA 1PW1A 4L9FA 1Y54A 3IT9A 4HJ4A 5HL1A 3T4LA 4WEKA 1YLJA 4DJ3A 4NKPA 4OH0A 3S4XA 2P74A 3LFVA 3NC8A 4S2JA 3RXWA 4LRXC 1EWZA 1F9IA 5F83A 3N4IA 3PXPA 3DBAA 4I3AA 2J80A 1DJAA 3LEQA 4MN7A 3LIFA 1GSWA 1JWPA 1Z6FA 3LR4A 2XH9A 5L09A 3H7WA 1GA9A 3ULFA 3MZFA 1OTBA 5AQBA 2QKPA 2JKFA 3UE0A 1YQSA 1J9MA 1D06A 1LI9A 3UE6A 3OCLA 5DF7A 3A3EA 1S4SA 4JF6A 2X01A 4JF4A 2INWA 5DTSA 3LR5A 3G34A 5J3WA 2HDSA 2JCHA 1ZG6A 4XUXA 3HLEA 2CMNA 2E8IA 1ES2A 1T1CA 2OLVA 3MR0A 2WZXA 5J7EA 1FILA 3MKEA 2KLIA 1H8YA 1KVMA 4FOFA 4WEJA 2Y2QA 4S2PA 2IA2A 1VQQA 2G2UA 2XR0A 3DTMA 4OPYA 1W5DA 3HCYA 4IBXA 1JTDA 3VSKA 1NZUA 3H9WA 3UMEA 4CLCE 1S67L 2Y8HA 5D3OA 3JPUA 3LYXA 1LL5A 3CWFA 2Y2PA 2VK3A 4E3KA 1XXMA 1NJ4A 2XF3A 1O7EA 2Y2IA 2IWDA 4IVIA 4CLCD 4WM9A 4JGPA 3NHQA 4QJGA 3T4QA 4PKYG 3LICA 1E3UA 1S66L 5E2EA 1WYCA 4UAAA 5A92A 5EECA 4OOLA 3PR6A 2LB9A 4KZ4A 4RX2A 1EW0A 2BG1A 4F94A 5TR7A 3Q7VB 3ITAA 1NZOA 4PPRA 4R4SA 4R0QA 4Z1WA 4Y15A 3GRJA 2HDQA 2XGNA 1I2SA 3UE1A 2WKHA 5HAQA 1CF0A 3UDFA 4HQAA 4Y17A 1I2WA 4R70A 2RCXA 3CMZA 3C7UA 4S2OA 2PD7A 1G28A 5AQ9A 4QD4A 4KG2A 2JKTI 1E4DA 4AFIA 3IF6B 3VP3A 5A90A 4M3KA 2ZJ9A 1Z09A 3O3VA 4ID4A 1G5UA 1YSQA 3BLSA 4ETXA 5HFOA 3F1PA 1YMSA 1E25A 2EA9A 4FD8A 3G2ZA 2XK1A 4ZAMA 1K56D 1LSXA 1PFLA 2JC7A 4R6LA 2XFSA 5F6AA 3SS3A 1XGIA 4FSFA 1ZC2A 4PAUA 3BM6A 3LO7A 3OZHA 1CEGA 2HP5A 2LB5A 3LR3A 3M2JA 3DAVA 2Y2MA 4FH4A 5F1GA 2AVXA 3C38A 2A24A 3Q81A 1K25A 3EGXC 3RXXA 1N9OA 3D4FA 5GLAA 4CLCB 2OWJA 2J9PA 3BECA 2P7JA 3NDGA 4HEFA 5AVEA 3LGOA 2XLNA 4WLAA 1K0KA 4ARZA 4Y13A 2DRWA 3IXDA 3UE3A 3OBFA 4LRYC 5DKLA 5CEBA 3MZEA 5LBRA 3FPVA 3B3XA 3QNBA 2VZWA 3UO9A 4DE3A 2XQZA 3T4OA 3NOTC 1IOUA 3CZDA 3FWLA 4S2NA 4IBRA 2EWWA 3Q7VA 4WZ5A 1SCWA 3HJIA 3JVVA 3V3SA 3KYQA 1W8QA 4X56A 2PAVP 5EVLA 3MQOA 2PR5A 4RX3A 1ZTUA 4JGRA 1JTGA 1S0WA 1MC0A 3QHYA 1K57C 1HVBA 5AJGA 3UPNA 3MXQA 5HD3A 1J3WA 4ZBEA 2QPNA 3V5MA 1SZVA 5TBMB 1VB6A 2BASA 2W3DA 1HD8A 4DN0A 4ZJ1A 1L2SA 4P6ZS 2VV8A 2EX6A 4MBFA 5M1AA 2ZM2A 4EERA 1LSVA 2XDMA 2PT7A 2VGLS 2P04A 5L8MA 5C5KA 4E3OA 1GHPA 3AGFA 1YSPA 4BD1A 3NULA 4NG2A 2V0UA 4DXBA 4RA7A 3SS5A 4PM9A 3GDIA 3WS0A 3CUEC 3T1QB 3TRCA 1ES5A 5FAQA 2JKRM 3E4QA 3QP8A 5FQMA 2DMWA 4U0XA 3C30A 3IXHA 3CPTB 2HP9A 3NDEA 4QWOA 4LV1A 1MWUA 1XJ3A 3IS2B 4C75A 1V9YA 4DXCA 4ME4A 3H82A 5FQIA 3F1NB 2Q0OA 4N9LA 1S1YA 2VX8A 3G32A 2GZAA 4HHDA 1F98A 3DWZA 3EEHA 2ZOIA 1SKOA 2OV5A 4O0PA 1FR6A 4JBFA 3ZG7B 3UY6A 1I5QA 4E6XA 3A0SA 4GS9A 3BEBA 4EWFA 2ZQCA 3PTEA 5CTMA 2JHEA 5HPIA 4K91A 1BLSA 2XA7S 3QP4A 4HJ3A 5FA7A 4Q0IA 5FASA 1YT4A 5EVID 5CTNA 1W7FA 4F3LB 1GHIA 3SZTA 4EW7A 5KSHA 4H6JA 2P9VB 4X1LA 3D3OA 4ZTKA 4I38A 1KE4A 1BULA 3BQ8A 1L0GA 2FZ0A 2Y79A 2BLSA 1MKMA 1KE0A 2PYPA 3HLGA 5EOEA 5EVIC 1RCJA 5I5LA 4Y0TA 1T1AA 4R23A 4MMNA 1IFQA 5TFQA 1S4RA 3NJAA 2R78A 4EU0A 4B93A 3W4QA 1N9LA 1JWZA 3LY3A 3V50A 2ZC3B 2Y2NA 2I72A 3QP5A 2DNSA 3UPPA 2ZC4B 3MXSA 1TEMA 2I9VA 1VETB 1G68A 4ZDXA 3HL9A 1P0ZA 3WS4A 4HP9A 1TS0A 5IS1A 1NLYA 1MBLA 2O9AA 5KIZA 3LIEA 2PU4A 3PBQA 2QZ6A 3HLFA 2WUQA 1PI5A 3LIDA 3SH8A 3MZDA 4X55A 4OPZA 3IX3A 4E3NA 2YKHA 4Y3IA 5HDSA 1CI9A 4GZBA 4UA7A 2V8FA 1LHYA 5TJJA 1BLPA 3ZG5A 2J3TC 2WGWB 4BMWA 3EEAA 3QP2A 3VSLA 4E3IA 5EVIB 2ZL1A 4B4XA 1BTLA 4HBUA 4RVAA 4X68A 5IHVA 1DY6A 2XFTA 4XUZA 4HIAA 3DWKA 3SS4A 4GDNA 1OPXA 1P97A 2QJ5A 3BW6A 2ZQ8A 3OPPA 1FCNA 2WKIA 4KZAA 4U0TA 3EOIA 3BWLA 3CHWP 3VP4A 1LL8A 2Y2HA 1MY8A 1IYSA 3SH7A 3ZGAB 4UQIS 4X1MA 3UPOA 5KZHA 4LRZE 5CERA 3E0YA 4OONA 1TDGA 1TD5A 4HY8A 4MDZA 4WL9A 3BFFA 1KGEA 1XKZA 2ZD8A 3OPLA 2QHKA 2W0NA 4R3AA 1EI5A 1VETA 3IX8A 2M7VA 1DJCA 4E6WA 1RGYA 5F68A 4O8GA 4HI4A 4EBNA 4YWZA 1YLZA 1ERMA 3DTEA 2Y55A 2ZBBA 3L9KA 2Z6DA 4OLDA 5FATA 2J8YA 1K4FA 5GLCA 4Y2FA 2OAQ1 1TF1A 4Y7PA 3WS1A 2ZC7A 2B02A 4HESA 4II7A 3VV4A 2W1RA 3ZG8B 2G7UA 1NRJA 5I94A 3CITA 3LY4A 4BBTA 4R3BA 5CGXA 2ZC5B 3LIBA 1XA1A 2Y2OA 3GR2A 4P6ZM 5HARA 2Y59A 5DF9A 5GLDA 4WZ4A 1XFQA 3VMAA 3G6OA 4P85A 1W63M 3MJQA 4NK3A 5DKKA 4BQMA 5HAIA 3VOZA 2H0YA 5HZHA 4EBPA 4BJPA 4EXOA 3N6IA 3LI8A 1GSVA 4MCWA 3GMWA 4PHTA 3PAEA 4NXBA 3HUNA 2ACGA 3PHYA 3FC7A 2E8JA 3VOYA 1K55A 5EPHA 5GL9A 1XGJA 1NYMA 2NUTC 4X53A 2J3TD 3B47A 4JF5A 3E4PA 1L0DA 3A0VA 2V2FF 1MWSA 4JPMA 3VE3A 2ZMFA 4KQRA 3OPRA 1L0FA 3PBSA 4N92A 3OPHA 3UDXA 3ZCZA 1YLWA 2KOIA 2H0TA 5E2HA 1KE3A 4OOMA 3BRMA 3IBJA 2XA7M 4RQ9A 3H82B 2OSUA 2EX9A 1N9NA 4P0MA 4JXVA 1KDWA 3C7VA 4S2NC 1L3LA 3OCNA 4CJNA 1K55C 1JVJA 5F69A 5DTTA 4UA6A 1IEMA 2H5SA 4WN5A 1G6OA 1LT0A 1PNEA 3TE8A 5CXWA 3VP1A 4O7DA 1ZG4A 3LIAA 1XJ2A 4OP8A 3TG9A 3BY8A 2HF6A 3KO6A 1H5XA 3IWIA 3R7WA 4ESPA 3HREA 1TS6A 4DE0A 1DJBA 1OT6A 4YOFA 3V67A 3K2NA 5HL6A 4WMCA 3A3JA 2OOLA 1ESUA 4GB7A 3UMDA 4EUVA 5HSQA 2OAP1 1IYOA 1NY0A 4FH2A 2ZLYA 5F82A 4I5SA 3B33A 3O87A 5HPFA 1N4OA 2W3GA 2VEAA 1LI0A 5J8XA 1PW8A 3EGDC 5J4EA 2XEPA 2QJ7A 2W3HA 2M7UA 1ONHA 2VV7A 1OTIA 5U47A 1FSYA 3SW1A 1IKGA 1LLBA 3TJZC 3K3DA 5HDCA 3D72A 1ES3A 1IYQA 2VJWA 3HVFA 4JLFA 4HBTA 4KG6A 3I7JA 2WGVA 4EQIA 2PHYA 2FFYA 1OMEA 2VV6A 3ICYA 4M4XA 4NXEA 5A8BA 1AXBA 2QWSA 4GHIB 2O9BA 5FQ9A 1MKIA 5GHZA 3IXBA 3LCEA 4YNRA 4MN6A 4K0XA 4NEED 4MBKA 5CECA 4WZ5C 4JGOA 2ZMVA 2V1AA 4NXGA 1M40A 3ZYTA 3P7NA 3BFCA 3R4KA 5G4ZA 5EVIA 4JXWA 1ACFA 1PYYA 4WELA 3BLMA 5CGSA 5G4YA 4R4RA 4OVDA 2WKEA 2ZQDA 2W1TA 3IWOA 4MBHA 4MNRA 3WS5A 4IUKA 4K0WA 2WGWA 2VKSA 3CI6A 2H10A 3C4OA 3TOIA 3UN7A 2ZM0A 4Y0UA 1YLPA 2WKPA 4BBUA 4P6BA 4NXFA 4JXGA 4BBVA 4KZBA 3N8SA 3WS2A 3IF6A 5FSRA 1YAXA 5DTKA 2EFUA 3VFHA 4QY5A 4PKYA 1K54A 3W2ZA 3HLBA 4H8RA 1NRFA 4A5RA 3E4OA 2K7SA 2L4RA 1GA0A 4FCFA 3KX0X 4PMAA 5FAPA 2W1TB 4BD0A 1PRQA 4BLMA 4UEYA 1OTAA 4HJ6A 5EE8A 1BYWA 2KX6A 4X6TA 4DRTA 4EV4A 1A0KA 4L9EA 5FDHA 2JE5A 1GSXA 2Z6CA 1K6RA 4LV3A 1DP8A 2J3WA 3ZNTA 1MXOA 3BYDA 4DKIA 3UB5P 5CX7A 2ZQ9A 2X02A 5FI2A 2J7VA 3BFDA 5KMWA 3MKFA 1BLHA 1IYPA 3NECA 3IXGA 4KENB 3VP2A 3OC2A 3LR0A 4GHIA 3ZFZA 1W8YA 3ZVWA 1F5MA 2V0WA 5CGWA 4LENA 3HBRA 4C3QA 3FZCA 4H6JB 4U3TA 5EM1A 2XROA 3BFGA 4CQHA 1K56A 4LCMA 5DJUA 3CLOA 3RH8B 5FQKA 4IJGA 3HUOA 1UGUA 5HWVA 2K2NA 3ITBA 1PWDA 3IX4A 4UQIM 1HLUP 4NETA 3MF0A 2HJ9C 4GS9B 1CJFA 1V9ZA 2EFXA 3F1OA 2GJ3A 4OQGA 1EROA 5TGFA 3EQVA 1PZOA 2EWVA 4DMZA 1OJGA 2JKRI 2WZZA 1SKOB 2R9WA 3ZDJA 3PAGA 5HX9A 2A2LA 4Y5FA 3F1NA 5FQJA 3WRTA 1CK3A 5E2GA 5DJTA 2HPBA 2A3UA 3ZQ5A 4QU3A 3H7WB 1BLCA 4GDBA 3W4PA 3E2LA 2XSSA 3RJUA 3ZNYA 5HWWA 4LV2A 2Z2LB 1T1BA 1ERQA 4E04A 2XD1A 3LEZA 2R9XA 4GW9A 3R7WB 3C5AA 4WMCD 2GDNA 4R38A 4GD8A 3PYPA 2WKRA 2D02A 4KZ7A 1HZOA 4WYYA 3QNCA 3HJKA 2O9CA 5EUAA 3IHBA 4HOIA 2EXAA 1KGFA 3BFEA 1SHVA 4PM6A 3OOVA 2EX2A 5TBMA 3UB9A 1PWCA 2A49A 3GSGA 1ODVA 1XPBA 1VEUA 4KZ3A 4DE1A 1PZPA 1FR1A 3E98A 4OQIA 3T4JA 3NI9A 1M6KA 1PI4A 3T1RA 3F1OB 3FPWA 4DDSA 5HWTA 4EEUA 2XRNA 2JKTM 5A93A 1LSWA 1OT9A 1SDEA 5EFWA 3IH9A 5HDDA 1BSGA 3SH9A 4BL2A 1YKDA 1H8ZA 3C2WA 3MS6A 1H0MA 3N8RA 4G3WA 2C5WB 3S7NA 3S1YA 3NCKA 4OP5A 5GHYA 3T50A 1BT5A 4OPQA 2IWCA 2Y2KA 5FL3A 4PM7A 4C6YA 3AGDA 4CLCA 3M6HA 4PM8A 1DRMA 3ZG0A 4GLQA 3IF6C 4PM5A 1ZHHB 3NY4A 4QY6A 5A91A 1TDLA 2BTFP 2Z2MB 3GTCA 1KOUA 1Q2PA 3E2KA 1O07A 1TS8A 1IELA 3PBOA 4GJ4A 2PBDP 1OTDA 3S7OA 3CG5A 2B18A 1YMXA 5DFYA 3TSGA 4WBGA 1L0EA 2IWBA 4LGWA 3TW8A 2WYXA 3V3RA 3P98A 3F1PB 3NOUC 4GOGA 2Q9MA 3DW0A 3A0RA 2QYBA 4R1GA 4L9GA 2Y2LA 2EX8A 1ESIA 5CHUA 5KSCA 2OWHA 1RP5A 4IUHA 3KSHA 1K6SA 3PBRA 4ZJ3A 3U4LP 4IHQA 4DF6A 5CHMA 3MSHA 4BENA 4QHCA 3G35A 2ZOHA 1K4EA 5FQQA 2VGLM 5GLBA 4K08A 2V20A 4Z9QA 2WKQA 4DE2A 2JN7A 4OQHA 1NLZA 4HH3A 1Q2QA 4S2IA 3P09A 2ZL1B 1OJ5A 1WA9A 5FI7A 2HJEA 2VA0A 2VGKA 3IQAA 2HDRA 5M19A 3MBZA 2V9AA 5F5YA 3G30A 3JYIA 3S7PA 4OLGA 2M1CA 4YINA 1D1JA 4KQDA 4RYEA 1FCMA 3KSFA 1XA7A 3FKVA 4BL3A 3Q7ZA 2G2WA 4GN2A 3B42A 5DVAA 5L2FA 4EESA 2Y2GA 5CEDA 1FOFA 2PD8A 1Y28A 3VFFA 2CC1A 2PRFA 3ISGA 1GHMA 1T18A 3K3CA 1S1ZA 4FTXA 1X0OA 4Q0JA 4FUWA 3MXRA 5FDSA 3UB7A 4Q8IA 4KZ5A 1NWZA 4E3JA 1MPLA 4LLOB 4YFMA 3RFBA 1F2KA 3O86A 3EWKA 1HTZA 1WE4A 3M2KA 4WF0A 5F1FA 1DP9A 5FEGA 3FV7A 2WAEA 3C4PA 3FYZA 2C6WB 2WGIA 4WUJA 1K54C 1W63Q 3VE4A 3T4KA 3EQUA 4EETB 2VLGA 3OLOA 3MFDA 4B9OA 4ETZA 4I3IA 1CI8A 2RL3A 3KSGA 2P9VA 1TVFA 3V39A 2PYRA 3G31A 3MQQA 5FI6A 3LUQA 4CLCC 3LI9A 3MFXA 5JYOA 4LV0A 4KUOA 4DDYA 1D7EA 3IHAA 3HLDA 4EQ1A 4S2LA 3N7WA 1H3QA 3QP6A 3IWQA 1SKFA 5MC7A 4GKUA 5IU1A 3C8CA 2V1ZA 2VGJA 4OOYA 4MEZA 3ZVTA 4LPZA 1CQAA 1BUEA 4G3VA 2KDKA 3PBNA 4EUZA 1C3BA 4JXSA 3IH8A 4N1HA 3M6BA 3HLCA 1STZA 1S6RA 3KYZA 4ZRRA 3IS2A 5HAPA 3N8LA 1FSWA 1P9RA 5FEFA 3JVUA 3Q07A 1PWGA 2FH5A 2Q9NA 3CPTA 2UV0E 1U60A 4Y0OA 1JWVA 1QMEA 4HP4A 3DTKA 2L1MA 3U2AA 3BY9A 2GNXA 4OQ0A 2PU2A 2X71A 2HV1A 3A3IA 3WRZA 3MMHA 2FFFB 1Y4OA 4KZ6A 2PDRA 2JKGA 1K38A 5HW3A 2ZMAA 1NYYA 2EXBA 3G2YA 1XP4A 4KQOA 1KDSA 1MWRA 4I39A 4JKTA 3KYEA 4LCLA 1T19A 4XT2B 5AQAA 2XD5A 3S22A 2OLUA 4O01A 2Y4AA 3BJNA 1K57A 1MWTA 1P9WA 3CUEA 3T4SA 1KGGA 4BWIA 1ES4A 1JNUA 3T4TA 1WYBA 3CJMA 2W3FA 2PBYA 2PR6A 1IKIA 3GV9A 2B5RA 3A3FA 3T12B
chains in the Genus database with same CATH topology
1CEFA 1NXYA 2J9PA 3BECA 3HUNA 5FAOA 5M18A 3IHBA 4MLLA 2EXAA 1KGFA 3NDGA 3VOYA 1K55A 4HEFA 5EPHA 5GL9A 3UDIA 1XGJA 1SHVA 3BFEA 1NYMA 4PM6A 4X53A 2EX2A 1PWCA 2A49A 2XLNA 3GSGA 1XPBA 4JF5A 4GD6A 2DRWA 2WK0A 3IXDA 3UE3A 5GHXA 3Q1FA 5EOOA 5CEBA 4KZ3A 3MZEA 4DE1A 1PZPA 1FR1A 3B3XA 1L0DA 3QNBA 2V2FF 1MWSA 4OQIA 3UO9A 4JPMA 4DE3A 2XQZA 3OPRA 1L0FA 3NI9A 3PBSA 4KQRA 1M6KA 1PI4A 4N92A 5DF8A 2ZM8A 3G4PA 3OPHA 4N9KA 3ZHHA 4DDSA 3UDXA 3ZCZA 3CZDA 3FWLA 4S2NA 1YLWA 4IBRA 2H0TA 4EBLA 5E2HA 1KE3A 3Q7VA 2J9OA 4WZ5A 1LL9A 4OOMA 5A93A 1SCWA 1SDEA 3BRMA 3V3SA 3IH9A 2OSUA 1W8QA 4X56A 1BSGA 2EX9A 3SH9A 4R3JA 5EVLA 4P0MA 4BL2A 4RX3A 4UA9A 2HDUA 1H8ZA 5E43A 1JTGA 1S0WA 2ZQ7A 4JXVA 4UHUA 3QHYA 1KDWA 1K57C 1HVBA 1ALQA 3C7VA 5G18A 4S2NC 3UPNA 3N8RA 4B88A 1PIOA 3OCNA 2C5WB 4ZBEA 4CJNA 1FCOA 3S1YA 1K55C 3NCKA 1JVJA 4OP5A 2QPNA 5DTTA 3GVBA 4UA6A 5GHYA 1IEMA 2H5SA 3IF5A 3V5MA 1BT5A 4OPQA 2Y2JA 2IWCA 4OPRA 2Y2KA 4B4ZA 5CXWA 1HD8A 3VP1A 4O7DA 1ZG4A 4ZJ1A 4PM7A 4C6YA 1L2SA 3NIAA 4OP8A 3AGDA 3TG9A 3W8KA 2EX6A 3FKWA 4MBFA 3HUMA 5M1AA 1H5XA 1RGZA 3IWIA 2ZM2A 3M6HA 2ZQAA 4PM8A 4X69A 3ZG0A 3HREA 3IF6C 2XDMA 4PM5A 4DE0A 2QMIA 1DJBA 3NY4A 4QY6A 3O88A 5A91A 1TDLA 2Z2MB 3GTCA 1Q2PA 4WMCA 3A3JA 1ESUA 4GB7A 4E3OA 1GHPA 3E2KA 4S2MA 3AGFA 1O07A 2HP6A 2ZC6B 1IYOA 1NY0A 4BD1A 4FH2A 4DXBA 3GQZA 2ZLYA 4RA7A 5F82A 4ZJ2A 3SS5A 1IELA 4PM9A 3PBOA 3O87A 1SDNA 4GNUA 3WS0A 1N4OA 3WWXA 3CG5A 1BZAA 1ES5A 1LI0A 1YMXA 5AQ7A 5FAQA 3TSGA 5J8XA 1PW8A 4WBGA 1L0EA 5FQMA 3UNWA 5JYPA 4U0XA 2IWBA 2WYXA 2XEPA 1KVLA 3IXHA 3P98A 4KZ8A 3V3RA 1W79A 4CPKA 3PBTA 1ONHA 2HP9A 3NDEA 4GOGA 2Q9MA 3DW0A 4XXRA 5U47A 1GCEA 1FSYA 3ZG9B 4R1GA 4IEDA 3W4OA 1IKGA 2Y2LA 4LV1A 1MWUA 1YLTA 1YM1A 2EX8A 1ESIA 3A3DA 5CHUA 4C75A 1G6AA 5KSCA 4DXCA 1RP5A 4P87A 2JBFA 1K6SA 1LLBA 3PBRA 5FQIA 3SOIA 4S2KA 4ZJ3A 4N9LA 4KQQA 5CHJA 2Y91A 3G32A 4DF6A 3Q82A 5CHMA 1ES3A 1IYQA 4BENA 3HVFA 3G35A 3NBLA 4JLFA 4QHCA 3DWZA 1K4EA 5FQQA 4HBTA 5E2FA 1E3UD 5GLBA 1QMFA 1ZKJA 4KG6A 1YLYA 2OV5A 3I7JA 1FR6A 2WGVA 4EQIA 4IVKA 4JBFA 2FFYA 3ZG7B 1OMEA 2V20A 4N1XA 4L0LA 4Z9QA 3UY6A 2UWXA 1I5QA 2WAFA 4KZ9A 4E6XA 3BEBA 4QB8A 4E3LA 3VP0A 4EWFA 2ZQCA 3PTEA 4DE2A 5CTMA 4K91A 4OQHA 4KG5A 1AXBA 1BLSA 1Q2QA 1XX2A 3HLWA 3P09A 4S2IA 5BOHA 5FA7A 1MKIA 5FQ9A 5GHZA 1ONGA 1FQGA 5FASA 4E3MA 1YT4A 1N9BA 2DCFA 2WADA 5EVID 5CTNA 3IXBA 1W7FA 3LCEA 5FI7A 1GHIA 2VGKA 2HDRA 3IQAA 4K0XA 5M19A 3MBZA 4MBKA 3AGEA 5KSHA 2P9VB 5CECA 4OKPA 3G30A 4WZ5C 5CRFA 3JYIA 4ZTKA 1VM1A 1KE4A 1BULA 1M40A 4OLGA 3BFCA 4D2OA 1L0GA 5EVIA 1PW1A 4YINA 2BLSA 1Y54A 4JXWA 1KE0A 3IT9A 4RYEA 5HL1A 1PYYA 4WELA 1FCMA 3BLMA 5CGSA 4R4RA 3HLGA 4OVDA 4WEKA 5EOEA 1XA7A 1YLJA 3FKVA 5EVIC 2WKEA 1RCJA 4Y0TA 4R23A 2ZQDA 3IWOA 4MBHA 4MNRA 5TFQA 3WS5A 4BL3A 4K0WA 2WGWA 3Q7ZA 4OH0A 2G2WA 4GN2A 3S4XA 2P74A 2H10A 3C4OA 3NC8A 4S2JA 3RXWA 3TOIA 3UN7A 1EWZA 5F83A 5DVAA 3N4IA 5L2FA 2Y2GA 5CEDA 3W4QA 1FOFA 2ZM0A 1JWZA 3LY3A 4Y0UA 1DJAA 3V50A 1YLPA 3VFFA 2ZC3B 2CC1A 2Y2NA 2I72A 4P6BA 1JWPA 1GHMA 1Z6FA 3ISGA 4JXGA 2XH9A 4KZBA 3N8SA 3WS2A 3IF6A 1GA9A 2DNSA 5FSRA 3UPPA 3MXRA 5DTKA 4Q8IA 2ZC4B 2EFUA 3MXSA 3VFHA 1TEMA 3MZFA 4QY5A 4KZ5A 5AQBA 1K54A 4E3JA 3HLBA 4H8RA 1NRFA 1G68A 4A5RA 1MPLA 4ZDXA 3UE0A 3HL9A 1YQSA 1J9MA 1GA0A 4FCFA 3WS4A 1LI9A 4YFMA 4PMAA 3O86A 3OCLA 5DF7A 3A3EA 1HTZA 1WE4A 3M2KA 5F1FA 5FAPA 1MBLA 4JF6A 2X01A 2PU4A 4JF4A 3PBQA 3FV7A 2QZ6A 2WAEA 5DTSA 3C4PA 3FYZA 3HLFA 2C6WB 2WGIA 2WUQA 4BD0A 4BLMA 1PI5A 3G34A 1K54C 3SH8A 2HDSA 2JCHA 1ZG6A 3MZDA 4X55A 4OPZA 4XUXA 5EE8A 4E3NA 4X6TA 4DRTA 4EV4A 3HLEA 3EQUA 1CI9A 4GZBA 2E8IA 1ES2A 5FDHA 4UA7A 2JE5A 2OLVA 1K6RA 1LHYA 3ZG5A 1BLPA 4LV3A 2WGWB 2WZXA 3ZNTA 3MFDA 1MXOA 3BYDA 3MKEA 1CI8A 2RL3A 4DKIA 2P9VA 1TVFA 1H8YA 3V39A 1KVMA 4WEJA 3G31A 2ZQ9A 2X02A 2Y2QA 4S2PA 2XR0A 1VQQA 2G2UA 3DTMA 4OPYA 5FI2A 3VSLA 2J7VA 3BFDA 5KMWA 3MKFA 1BLHA 1IYPA 4E3IA 5FI6A 1W5DA 3IXGA 1JTDA 4IBXA 4KENB 5EVIB 3VSKA 4B4XA 1NZUA 3VP2A 1BTLA 4HBUA 4RVAA 4X68A 5IHVA 3OC2A 1DY6A 2XFTA 1W8YA 4LV0A 4XUZA 3ZFZA 3DWKA 5D3OA 3ZVWA 3SS4A 4GDNA 4DDYA 3IHAA 5CGWA 1LL5A 3HLDA 4LENA 3HBRA 4C3QA 2Y2PA 3FZCA 3N7WA 4S2LA 4U3TA 1XXMA 4E3KA 1NJ4A 2ZQ8A 2XF3A 1O7EA 2Y2IA 1SKFA 3IWQA 1FCNA 2IWDA 3OPPA 3BFGA 2WKIA 4IVIA 4GKUA 4KZAA 4WM9A 4QJGA 1K56A 2V1ZA 4LCMA 4U0TA 1E3UA 2VGJA 4OOYA 5E2EA 1WYCA 4MEZA 4UAAA 5FQKA 5A92A 5EECA 3ZVTA 4OOLA 5JYOA 3VP4A 4KZ4A 3HUOA 1BUEA 2Y2HA 4RX2A 1MY8A 1IYSA 2BG1A 4F94A 5TR7A 3SH7A 3PBNA 3ITBA 3Q7VB 1PWDA 4EUZA 4NETA 3ZGAB 1C3BA 4JXSA 3ITAA 1NZOA 3IH8A 4N1HA 4PPRA 4R4SA 4R0QA 3M6BA 3UPOA 3HLCA 2EFXA 5KZHA 1S6RA 4OQGA 1EROA 5TGFA 3EQVA 3GRJA 1PZOA 2HDQA 2XGNA 5HAPA 1I2SA 3N8LA 2WZZA 2WKHA 4OONA 5CERA 3UE1A 1TDGA 2R9WA 1FSWA 3ZDJA 5HAQA 3PAGA 3UDFA 1I2WA 3Q07A 3BFFA 1PWGA 2Q9NA 5HX9A 1KGEA 1U60A 1XKZA 4Y0OA 1JWVA 1QMEA 2ZD8A 3OPLA 2RCXA 1EI5A 3CMZA 3C7UA 1DJCA 4S2OA 5FQJA 1RGYA 5AQ9A 1CK3A 3WRTA 4QD4A 4E6WA 4EBNA 5E2GA 2HPBA 1YLZA 1ERMA 2Y55A 4KG2A 2A3UA 4QU3A 1E4DA 3IF6B 3VP3A 5A90A 4M3KA 1BLCA 2ZJ9A 4OLDA 3O3VA 4ID4A 5FATA 4GDBA 2PU2A 4OQ0A 2J8YA 2X71A 3A3IA 3WRZA 1K4FA 5GLCA 3BLSA 3W4PA 2FFFB 3E2LA 5HFOA 4KZ6A 1YMSA 1E25A 3RJUA 4Y7PA 3WS1A 2ZC7A 1K38A 4FD8A 5HW3A 3G2ZA 3ZNYA 4HESA 2ZMAA 4LV2A 1NYYA 2XK1A 2Z2LB 1K56D 4ZAMA 2EXBA 3G2YA 1XP4A 2JC7A 1ERQA 2XFSA 4KQOA 3ZG8B 1KDSA 1MWRA 3SS3A 2XD1A 4JKTA 3LEZA 1XGIA 2R9XA 5I94A 4FSFA 3LY4A 4LCLA 1ZC2A 4R3BA 5CGXA 2ZC5B 3C5AA 1XA1A 3BM6A 2Y2OA 3LO7A 4WMCD 3GR2A 2XD5A 2GDNA 3OZHA 5AQAA 5HARA 2Y59A 5DF9A 1CEGA 2HP5A 3S22A 2OLUA 5GLDA 4WZ4A 2Y4AA 4GD8A 3VMAA 3M2JA 1K57A 1MWTA 4P85A 4NK3A 2Y2MA 4BQMA 1KGGA 4FH4A 5HAIA 3VOZA 2H0YA 5F1GA 1ES4A 4KZ7A 4EBPA 1WYBA 3CJMA 1HZOA 4WYYA 4BJPA 3QNCA 2PBYA 3N6IA 3Q81A 1IKIA 1K25A 3GV9A 5EUAA 3RXXA 2B5RA 3A3FA 3D4FA 3GMWA 5GLAA 3PAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CEF A;  1NXY A;  2J9P A;  3BEC A;  3HUN A;  5FAO A;  5M18 A;  3IHB A;  4MLL A;  2EXA A;  1KGF A;  3NDG A;  3VOY A;  1K55 A;  4HEF A;  5EPH A;  5GL9 A;  3UDI A;  1XGJ A;  1SHV A;  3BFE A;  1NYM A;  4PM6 A;  4X53 A;  2EX2 A;  1PWC A;  2A49 A;  2XLN A;  3GSG A;  1XPB A;  4JF5 A;  4GD6 A;  2DRW A;  2WK0 A;  3IXD A;  3UE3 A;  5GHX A;  3Q1F A;  5EOO A;  5CEB A;  4KZ3 A;  3MZE A;  4DE1 A;  1PZP A;  1FR1 A;  3B3X A;  1L0D A;  3QNB A;  2V2F F;  1MWS A;  4OQI A;  3UO9 A;  4JPM A;  4DE3 A;  2XQZ A;  3OPR A;  1L0F A;  3NI9 A;  3PBS A;  4KQR A;  1M6K A;  1PI4 A;  4N92 A;  5DF8 A;  2ZM8 A;  3G4P A;  3OPH A;  4N9K A;  3ZHH A;  4DDS A;  3UDX A;  3ZCZ A;  3CZD A;  3FWL A;  4S2N A;  1YLW A;  4IBR A;  2H0T A;  4EBL A;  5E2H A;  1KE3 A;  3Q7V A;  2J9O A;  4WZ5 A;  1LL9 A;  4OOM A;  5A93 A;  1SCW A;  1SDE A;  3BRM A;  3V3S A;  3IH9 A;  2OSU A;  1W8Q A;  4X56 A;  1BSG A;  2EX9 A;  3SH9 A;  4R3J A;  5EVL A;  4P0M A;  4BL2 A;  4RX3 A;  4UA9 A;  2HDU A;  1H8Z A;  5E43 A;  1JTG A;  1S0W A;  2ZQ7 A;  4JXV A;  4UHU A;  3QHY A;  1KDW A;  1K57 C;  1HVB A;  1ALQ A;  3C7V A;  5G18 A;  4S2N C;  3UPN A;  3N8R A;  4B88 A;  1PIO A;  3OCN A;  2C5W B;  4ZBE A;  4CJN A;  1FCO A;  3S1Y A;  1K55 C;  3NCK A;  1JVJ A;  4OP5 A;  2QPN A;  5DTT A;  3GVB A;  4UA6 A;  5GHY A;  1IEM A;  2H5S A;  3IF5 A;  3V5M A;  1BT5 A;  4OPQ A;  2Y2J A;  2IWC A;  4OPR A;  2Y2K A;  4B4Z A;  5CXW A;  1HD8 A;  3VP1 A;  4O7D A;  1ZG4 A;  4ZJ1 A;  4PM7 A;  4C6Y A;  1L2S A;  3NIA A;  4OP8 A;  3AGD A;  3TG9 A;  3W8K A;  2EX6 A;  3FKW A;  4MBF A;  3HUM A;  5M1A A;  1H5X A;  1RGZ A;  3IWI A;  2ZM2 A;  3M6H A;  2ZQA A;  4PM8 A;  4X69 A;  3ZG0 A;  3HRE A;  3IF6 C;  2XDM A;  4PM5 A;  4DE0 A;  2QMI A;  1DJB A;  3NY4 A;  4QY6 A;  3O88 A;  5A91 A;  1TDL A;  2Z2M B;  3GTC A;  1Q2P A;  4WMC A;  3A3J A;  1ESU A;  4GB7 A;  4E3O A;  1GHP A;  3E2K A;  4S2M A;  3AGF A;  1O07 A;  2HP6 A;  2ZC6 B;  1IYO A;  1NY0 A;  4BD1 A;  4FH2 A;  4DXB A;  3GQZ A;  2ZLY A;  4RA7 A;  5F82 A;  4ZJ2 A;  3SS5 A;  1IEL A;  4PM9 A;  3PBO A;  3O87 A;  1SDN A;  4GNU A;  3WS0 A;  1N4O A;  3WWX A;  3CG5 A;  1BZA A;  1ES5 A;  1LI0 A;  1YMX A;  5AQ7 A;  5FAQ A;  3TSG A;  5J8X A;  1PW8 A;  4WBG A;  1L0E A;  5FQM A;  3UNW A;  5JYP A;  4U0X A;  2IWB A;  2WYX A;  2XEP A;  1KVL A;  3IXH A;  3P98 A;  4KZ8 A;  3V3R A;  1W79 A;  4CPK A;  3PBT A;  1ONH A;  2HP9 A;  3NDE A;  4GOG A;  2Q9M A;  3DW0 A;  4XXR A;  5U47 A;  1GCE A;  1FSY A;  3ZG9 B;  4R1G A;  4IED A;  3W4O A;  1IKG A;  2Y2L A;  4LV1 A;  1MWU A;  1YLT A;  1YM1 A;  2EX8 A;  1ESI A;  3A3D A;  5CHU A;  4C75 A;  1G6A A;  5KSC A;  4DXC A;  1RP5 A;  4P87 A;  2JBF A;  1K6S A;  1LLB A;  3PBR A;  5FQI A;  3SOI A;  4S2K A;  4ZJ3 A;  4N9L A;  4KQQ A;  5CHJ A;  2Y91 A;  3G32 A;  4DF6 A;  3Q82 A;  5CHM A;  1ES3 A;  1IYQ A;  4BEN A;  3HVF A;  3G35 A;  3NBL A;  4JLF A;  4QHC A;  3DWZ A;  1K4E A;  5FQQ A;  4HBT A;  5E2F A;  1E3U D;  5GLB A;  1QMF A;  1ZKJ A;  4KG6 A;  1YLY A;  2OV5 A;  3I7J A;  1FR6 A;  2WGV A;  4EQI A;  4IVK A;  4JBF A;  2FFY A;  3ZG7 B;  1OME A;  2V20 A;  4N1X A;  4L0L A;  4Z9Q A;  3UY6 A;  2UWX A;  1I5Q A;  2WAF A;  4KZ9 A;  4E6X A;  3BEB A;  4QB8 A;  4E3L A;  3VP0 A;  4EWF A;  2ZQC A;  3PTE A;  4DE2 A;  5CTM A;  4K91 A;  4OQH A;  4KG5 A;  1AXB A;  1BLS A;  1Q2Q A;  1XX2 A;  3HLW A;  3P09 A;  4S2I A;  5BOH A;  5FA7 A;  1MKI A;  5FQ9 A;  5GHZ A;  1ONG A;  1FQG A;  5FAS A;  4E3M A;  1YT4 A;  1N9B A;  2DCF A;  2WAD A;  5EVI D;  5CTN A;  3IXB A;  1W7F A;  3LCE A;  5FI7 A;  1GHI A;  2VGK A;  2HDR A;  3IQA A;  4K0X A;  5M19 A;  3MBZ A;  4MBK A;  3AGE A;  5KSH A;  2P9V B;  5CEC A;  4OKP A;  3G30 A;  4WZ5 C;  5CRF A;  3JYI A;  4ZTK A;  1VM1 A;  1KE4 A;  1BUL A;  1M40 A;  4OLG A;  3BFC A;  4D2O A;  1L0G A;  5EVI A;  1PW1 A;  4YIN A;  2BLS A;  1Y54 A;  4JXW A;  1KE0 A;  3IT9 A;  4RYE A;  5HL1 A;  1PYY A;  4WEL A;  1FCM A;  3BLM A;  5CGS A;  4R4R A;  3HLG A;  4OVD A;  4WEK A;  5EOE A;  1XA7 A;  1YLJ A;  3FKV A;  5EVI C;  2WKE A;  1RCJ A;  4Y0T A;  4R23 A;  2ZQD A;  3IWO A;  4MBH A;  4MNR A;  5TFQ A;  3WS5 A;  4BL3 A;  4K0W A;  2WGW A;  3Q7Z A;  4OH0 A;  2G2W A;  4GN2 A;  3S4X A;  2P74 A;  2H10 A;  3C4O A;  3NC8 A;  4S2J A;  3RXW A;  3TOI A;  3UN7 A;  1EWZ A;  5F83 A;  5DVA A;  3N4I A;  5L2F A;  2Y2G A;  5CED A;  3W4Q A;  1FOF A;  2ZM0 A;  1JWZ A;  3LY3 A;  4Y0U A;  1DJA A;  3V50 A;  1YLP A;  3VFF A;  2ZC3 B;  2CC1 A;  2Y2N A;  2I72 A;  4P6B A;  1JWP A;  1GHM A;  1Z6F A;  3ISG A;  4JXG A;  2XH9 A;  4KZB A;  3N8S A;  3WS2 A;  3IF6 A;  1GA9 A;  2DNS A;  5FSR A;  3UPP A;  3MXR A;  5DTK A;  4Q8I A;  2ZC4 B;  2EFU A;  3MXS A;  3VFH A;  1TEM A;  3MZF A;  4QY5 A;  4KZ5 A;  5AQB A;  1K54 A;  4E3J A;  3HLB A;  4H8R A;  1NRF A;  1G68 A;  4A5R A;  1MPL A;  4ZDX A;  3UE0 A;  3HL9 A;  1YQS A;  1J9M A;  1GA0 A;  4FCF A;  3WS4 A;  1LI9 A;  4YFM A;  4PMA A;  3O86 A;  3OCL A;  5DF7 A;  3A3E A;  1HTZ A;  1WE4 A;  3M2K A;  5F1F A;  5FAP A;  1MBL A;  4JF6 A;  2X01 A;  2PU4 A;  4JF4 A;  3PBQ A;  3FV7 A;  2QZ6 A;  2WAE A;  5DTS A;  3C4P A;  3FYZ A;  3HLF A;  2C6W B;  2WGI A;  2WUQ A;  4BD0 A;  4BLM A;  1PI5 A;  3G34 A;  1K54 C;  3SH8 A;  2HDS A;  2JCH A;  1ZG6 A;  3MZD A;  4X55 A;  4OPZ A;  4XUX A;  5EE8 A;  4E3N A;  4X6T A;  4DRT A;  4EV4 A;  3HLE A;  3EQU A;  1CI9 A;  4GZB A;  2E8I A;  1ES2 A;  5FDH A;  4UA7 A;  2JE5 A;  2OLV A;  1K6R A;  1LHY A;  3ZG5 A;  1BLP A;  4LV3 A;  2WGW B;  2WZX A;  3ZNT A;  3MFD A;  1MXO A;  3BYD A;  3MKE A;  1CI8 A;  2RL3 A;  4DKI A;  2P9V A;  1TVF A;  1H8Y A;  3V39 A;  1KVM A;  4WEJ A;  3G31 A;  2ZQ9 A;  2X02 A;  2Y2Q A;  4S2P A;  2XR0 A;  1VQQ A;  2G2U A;  3DTM A;  4OPY A;  5FI2 A;  3VSL A;  2J7V A;  3BFD A;  5KMW A;  3MKF A;  1BLH A;  1IYP A;  4E3I A;  5FI6 A;  1W5D A;  3IXG A;  1JTD A;  4IBX A;  4KEN B;  5EVI B;  3VSK A;  4B4X A;  1NZU A;  3VP2 A;  1BTL A;  4HBU A;  4RVA A;  4X68 A;  5IHV A;  3OC2 A;  1DY6 A;  2XFT A;  1W8Y A;  4LV0 A;  4XUZ A;  3ZFZ A;  3DWK A;  5D3O A;  3ZVW A;  3SS4 A;  4GDN A;  4DDY A;  3IHA A;  5CGW A;  1LL5 A;  3HLD A;  4LEN A;  3HBR A;  4C3Q A;  2Y2P A;  3FZC A;  3N7W A;  4S2L A;  4U3T A;  1XXM A;  4E3K A;  1NJ4 A;  2ZQ8 A;  2XF3 A;  1O7E A;  2Y2I A;  1SKF A;  3IWQ A;  1FCN A;  2IWD A;  3OPP A;  3BFG A;  2WKI A;  4IVI A;  4GKU A;  4KZA A;  4WM9 A;  4QJG A;  1K56 A;  2V1Z A;  4LCM A;  4U0T A;  1E3U A;  2VGJ A;  4OOY A;  5E2E A;  1WYC A;  4MEZ A;  4UAA A;  5FQK A;  5A92 A;  5EEC A;  3ZVT A;  4OOL A;  5JYO A;  3VP4 A;  4KZ4 A;  3HUO A;  1BUE A;  2Y2H A;  4RX2 A;  1MY8 A;  1IYS A;  2BG1 A;  4F94 A;  5TR7 A;  3SH7 A;  3PBN A;  3ITB A;  3Q7V B;  1PWD A;  4EUZ A;  4NET A;  3ZGA B;  1C3B A;  4JXS A;  3ITA A;  1NZO A;  3IH8 A;  4N1H A;  4PPR A;  4R4S A;  4R0Q A;  3M6B A;  3UPO A;  3HLC A;  2EFX A;  5KZH A;  1S6R A;  4OQG A;  1ERO A;  5TGF A;  3EQV A;  3GRJ A;  1PZO A;  2HDQ A;  2XGN A;  5HAP A;  1I2S A;  3N8L A;  2WZZ A;  2WKH A;  4OON A;  5CER A;  3UE1 A;  1TDG A;  2R9W A;  1FSW A;  3ZDJ A;  5HAQ A;  3PAG A;  3UDF A;  1I2W A;  3Q07 A;  3BFF A;  1PWG A;  2Q9N A;  5HX9 A;  1KGE A;  1U60 A;  1XKZ A;  4Y0O A;  1JWV A;  1QME A;  2ZD8 A;  3OPL A;  2RCX A;  1EI5 A;  3CMZ A;  3C7U A;  1DJC A;  4S2O A;  5FQJ A;  1RGY A;  5AQ9 A;  1CK3 A;  3WRT A;  4QD4 A;  4E6W A;  4EBN A;  5E2G A;  2HPB A;  1YLZ A;  1ERM A;  2Y55 A;  4KG2 A;  2A3U A;  4QU3 A;  1E4D A;  3IF6 B;  3VP3 A;  5A90 A;  4M3K A;  1BLC A;  2ZJ9 A;  4OLD A;  3O3V A;  4ID4 A;  5FAT A;  4GDB A;  2PU2 A;  4OQ0 A;  2J8Y A;  2X71 A;  3A3I A;  3WRZ A;  1K4F A;  5GLC A;  3BLS A;  3W4P A;  2FFF B;  3E2L A;  5HFO A;  4KZ6 A;  1YMS A;  1E25 A;  3RJU A;  4Y7P A;  3WS1 A;  2ZC7 A;  1K38 A;  4FD8 A;  5HW3 A;  3G2Z A;  3ZNY A;  4HES A;  2ZMA A;  4LV2 A;  1NYY A;  2XK1 A;  2Z2L B;  1K56 D;  4ZAM A;  2EXB A;  3G2Y A;  1XP4 A;  2JC7 A;  1ERQ A;  2XFS A;  4KQO A;  3ZG8 B;  1KDS A;  1MWR A;  3SS3 A;  2XD1 A;  4JKT A;  3LEZ A;  1XGI A;  2R9X A;  5I94 A;  4FSF A;  3LY4 A;  4LCL A;  1ZC2 A;  4R3B A;  5CGX A;  2ZC5 B;  3C5A A;  1XA1 A;  3BM6 A;  2Y2O A;  3LO7 A;  4WMC D;  3GR2 A;  2XD5 A;  2GDN A;  3OZH A;  5AQA A;  5HAR A;  2Y59 A;  5DF9 A;  1CEG A;  2HP5 A;  3S22 A;  2OLU A;  5GLD A;  4WZ4 A;  2Y4A A;  4GD8 A;  3VMA A;  3M2J A;  1K57 A;  1MWT A;  4P85 A;  4NK3 A;  2Y2M A;  4BQM A;  1KGG A;  4FH4 A;  5HAI A;  3VOZ A;  2H0Y A;  5F1G A;  1ES4 A;  4KZ7 A;  4EBP A;  1WYB A;  3CJM A;  1HZO A;  4WYY A;  4BJP A;  3QNC A;  2PBY A;  3N6I A;  3Q81 A;  1IKI A;  1K25 A;  3GV9 A;  5EUA A;  3RXX A;  2B5R A;  3A3F A;  3D4F A;  3GMW A;  5GLA A;  3PAE A; 
#chains in the Genus database with same CATH topology
 1CEF A;  1NXY A;  5FAO A;  5M18 A;  4MLL A;  3KSI A;  3UDI A;  2V8C A;  4GD6 A;  1YPR A;  2WK0 A;  5GHX A;  3Q1F A;  3IBR A;  3CAX A;  3L7H A;  5EOO A;  3T1X A;  3NOP C;  4I3J A;  5DFX A;  2O0Y A;  2P08 A;  5AVF A;  3UB8 A;  4EEP A;  1AWI A;  4GCZ A;  1XJ6 A;  4Q0H A;  5DF8 A;  1VHM A;  2ZM8 A;  3G4P A;  4N9K A;  3ZHH A;  1XJ4 A;  1XFN A;  4QPR A;  1MZU A;  4EBL A;  3QP1 A;  2J9O A;  1LL9 A;  4ARZ B;  3D9Y A;  3UB6 A;  4R3J A;  4UA9 A;  2HDU A;  5E43 A;  2ZQ7 A;  4UHU A;  1ALQ A;  5EV0 A;  4MN5 A;  5G18 A;  2V1B A;  4HNB A;  1DP6 A;  4B88 A;  1PIO A;  2A24 B;  1FCO A;  3GVB A;  3IF5 A;  2GX5 A;  2Y2J A;  4OPR A;  4B4Z A;  3GEC A;  3NIA A;  2YKF A;  1UWN X;  3FKW A;  3W8K A;  3T1S A;  3HUM A;  1RGZ A;  2ZQA A;  3MQ0 A;  4X69 A;  3RTY A;  3FG8 A;  2HZ5 A;  2L0W A;  2QMI A;  3O88 A;  2K31 A;  4S2M A;  2HP6 A;  2ZC6 B;  4XT2 A;  3GQZ A;  4ZJ2 A;  1UWP X;  1SDN A;  4GNU A;  3WWX A;  1FIK A;  1BZA A;  5AQ7 A;  2B95 A;  3UNW A;  4HH2 A;  5JYP A;  2D01 A;  3P01 A;  1KVL A;  4KZ8 A;  1W79 A;  4CPK A;  3PBT A;  4XXR A;  1GCE A;  3ZG9 B;  3W4O A;  4IED A;  1YLT A;  1YM1 A;  2NUP C;  3A3D A;  1TS7 A;  1G6A A;  5L10 A;  4P87 A;  2O99 A;  2JBF A;  2H28 A;  3SOI A;  4S2K A;  4KQQ A;  5CHJ A;  2Y91 A;  3Q82 A;  4JGQ A;  3NBL A;  2HGV A;  5HD5 A;  5E2F A;  2W27 A;  1E3U D;  2MJ6 A;  1QMF A;  1ZKJ A;  1YLY A;  3S7Q A;  5EVE A;  4IVK A;  4X25 A;  4N1X A;  4L0L A;  3VOL A;  2UWX A;  2WAF A;  4KZ9 A;  4QB8 A;  4E3L A;  3VP0 A;  1H8M A;  3DTI A;  3BQA A;  4KG5 A;  4KUK A;  1XX2 A;  3HLW A;  5BOH A;  1VEU B;  4D60 A;  3O5Y A;  1ONG A;  1FQG A;  4E3M A;  2WAD A;  1N9B A;  2DCF A;  5L07 A;  4G3K A;  2W3E A;  1OTE A;  3AGE A;  5IT5 A;  5EM0 A;  4OKP A;  4F3L A;  4LFU A;  5CRF A;  4DJ2 A;  1VM1 A;  5K5B A;  4D2O A;  1PW1 A;  4L9F A;  1Y54 A;  3IT9 A;  4HJ4 A;  5HL1 A;  3T4L A;  4WEK A;  1YLJ A;  4DJ3 A;  4NKP A;  4OH0 A;  3S4X A;  2P74 A;  3LFV A;  3NC8 A;  4S2J A;  3RXW A;  4LRX C;  1EWZ A;  1F9I A;  5F83 A;  3N4I A;  3PXP A;  3DBA A;  4I3A A;  2J80 A;  1DJA A;  3LEQ A;  4MN7 A;  3LIF A;  1GSW A;  1JWP A;  1Z6F A;  3LR4 A;  2XH9 A;  5L09 A;  3H7W A;  1GA9 A;  3ULF A;  3MZF A;  1OTB A;  5AQB A;  2QKP A;  2JKF A;  3UE0 A;  1YQS A;  1J9M A;  1D06 A;  1LI9 A;  3UE6 A;  3OCL A;  5DF7 A;  3A3E A;  1S4S A;  4JF6 A;  2X01 A;  4JF4 A;  2INW A;  5DTS A;  3LR5 A;  3G34 A;  5J3W A;  2HDS A;  2JCH A;  1ZG6 A;  4XUX A;  3HLE A;  2CMN A;  2E8I A;  1ES2 A;  1T1C A;  2OLV A;  3MR0 A;  2WZX A;  5J7E A;  1FIL A;  3MKE A;  2KLI A;  1H8Y A;  1KVM A;  4FOF A;  4WEJ A;  2Y2Q A;  4S2P A;  2IA2 A;  1VQQ A;  2G2U A;  2XR0 A;  3DTM A;  4OPY A;  1W5D A;  3HCY A;  4IBX A;  1JTD A;  3VSK A;  1NZU A;  3H9W A;  3UME A;  4CLC E;  1S67 L;  2Y8H A;  5D3O A;  3JPU A;  3LYX A;  1LL5 A;  3CWF A;  2Y2P A;  2VK3 A;  4E3K A;  1XXM A;  1NJ4 A;  2XF3 A;  1O7E A;  2Y2I A;  2IWD A;  4IVI A;  4CLC D;  4WM9 A;  4JGP A;  3NHQ A;  4QJG A;  3T4Q A;  4PKY G;  3LIC A;  1E3U A;  1S66 L;  5E2E A;  1WYC A;  4UAA A;  5A92 A;  5EEC A;  4OOL A;  3PR6 A;  2LB9 A;  4KZ4 A;  4RX2 A;  1EW0 A;  2BG1 A;  4F94 A;  5TR7 A;  3Q7V B;  3ITA A;  1NZO A;  4PPR A;  4R4S A;  4R0Q A;  4Z1W A;  4Y15 A;  3GRJ A;  2HDQ A;  2XGN A;  1I2S A;  3UE1 A;  2WKH A;  5HAQ A;  1CF0 A;  3UDF A;  4HQA A;  4Y17 A;  1I2W A;  4R70 A;  2RCX A;  3CMZ A;  3C7U A;  4S2O A;  2PD7 A;  1G28 A;  5AQ9 A;  4QD4 A;  4KG2 A;  2JKT I;  1E4D A;  4AFI A;  3IF6 B;  3VP3 A;  5A90 A;  4M3K A;  2ZJ9 A;  1Z09 A;  3O3V A;  4ID4 A;  1G5U A;  1YSQ A;  3BLS A;  4ETX A;  5HFO A;  3F1P A;  1YMS A;  1E25 A;  2EA9 A;  4FD8 A;  3G2Z A;  2XK1 A;  4ZAM A;  1K56 D;  1LSX A;  1PFL A;  2JC7 A;  4R6L A;  2XFS A;  5F6A A;  3SS3 A;  1XGI A;  4FSF A;  1ZC2 A;  4PAU A;  3BM6 A;  3LO7 A;  3OZH A;  1CEG A;  2HP5 A;  2LB5 A;  3LR3 A;  3M2J A;  3DAV A;  2Y2M A;  4FH4 A;  5F1G A;  2AVX A;  3C38 A;  2A24 A;  3Q81 A;  1K25 A;  3EGX C;  3RXX A;  1N9O A;  3D4F A;  5GLA A;  4CLC B;  2OWJ A;  2J9P A;  3BEC A;  2P7J A;  3NDG A;  4HEF A;  5AVE A;  3LGO A;  2XLN A;  4WLA A;  1K0K A;  4ARZ A;  4Y13 A;  2DRW A;  3IXD A;  3UE3 A;  3OBF A;  4LRY C;  5DKL A;  5CEB A;  3MZE A;  5LBR A;  3FPV A;  3B3X A;  3QNB A;  2VZW A;  3UO9 A;  4DE3 A;  2XQZ A;  3T4O A;  3NOT C;  1IOU A;  3CZD A;  3FWL A;  4S2N A;  4IBR A;  2EWW A;  3Q7V A;  4WZ5 A;  1SCW A;  3HJI A;  3JVV A;  3V3S A;  3KYQ A;  1W8Q A;  4X56 A;  2PAV P;  5EVL A;  3MQO A;  2PR5 A;  4RX3 A;  1ZTU A;  4JGR A;  1JTG A;  1S0W A;  1MC0 A;  3QHY A;  1K57 C;  1HVB A;  5AJG A;  3UPN A;  3MXQ A;  5HD3 A;  1J3W A;  4ZBE A;  2QPN A;  3V5M A;  1SZV A;  5TBM B;  1VB6 A;  2BAS A;  2W3D A;  1HD8 A;  4DN0 A;  4ZJ1 A;  1L2S A;  4P6Z S;  2VV8 A;  2EX6 A;  4MBF A;  5M1A A;  2ZM2 A;  4EER A;  1LSV A;  2XDM A;  2PT7 A;  2VGL S;  2P04 A;  5L8M A;  5C5K A;  4E3O A;  1GHP A;  3AGF A;  1YSP A;  4BD1 A;  3NUL A;  4NG2 A;  2V0U A;  4DXB A;  4RA7 A;  3SS5 A;  4PM9 A;  3GDI A;  3WS0 A;  3CUE C;  3T1Q B;  3TRC A;  1ES5 A;  5FAQ A;  2JKR M;  3E4Q A;  3QP8 A;  5FQM A;  2DMW A;  4U0X A;  3C30 A;  3IXH A;  3CPT B;  2HP9 A;  3NDE A;  4QWO A;  4LV1 A;  1MWU A;  1XJ3 A;  3IS2 B;  4C75 A;  1V9Y A;  4DXC A;  4ME4 A;  3H82 A;  5FQI A;  3F1N B;  2Q0O A;  4N9L A;  1S1Y A;  2VX8 A;  3G32 A;  2GZA A;  4HHD A;  1F98 A;  3DWZ A;  3EEH A;  2ZOI A;  1SKO A;  2OV5 A;  4O0P A;  1FR6 A;  4JBF A;  3ZG7 B;  3UY6 A;  1I5Q A;  4E6X A;  3A0S A;  4GS9 A;  3BEB A;  4EWF A;  2ZQC A;  3PTE A;  5CTM A;  2JHE A;  5HPI A;  4K91 A;  1BLS A;  2XA7 S;  3QP4 A;  4HJ3 A;  5FA7 A;  4Q0I A;  5FAS A;  1YT4 A;  5EVI D;  5CTN A;  1W7F A;  4F3L B;  1GHI A;  3SZT A;  4EW7 A;  5KSH A;  4H6J A;  2P9V B;  4X1L A;  3D3O A;  4ZTK A;  4I38 A;  1KE4 A;  1BUL A;  3BQ8 A;  1L0G A;  2FZ0 A;  2Y79 A;  2BLS A;  1MKM A;  1KE0 A;  2PYP A;  3HLG A;  5EOE A;  5EVI C;  1RCJ A;  5I5L A;  4Y0T A;  1T1A A;  4R23 A;  4MMN A;  1IFQ A;  5TFQ A;  1S4R A;  3NJA A;  2R78 A;  4EU0 A;  4B93 A;  3W4Q A;  1N9L A;  1JWZ A;  3LY3 A;  3V50 A;  2ZC3 B;  2Y2N A;  2I72 A;  3QP5 A;  2DNS A;  3UPP A;  2ZC4 B;  3MXS A;  1TEM A;  2I9V A;  1VET B;  1G68 A;  4ZDX A;  3HL9 A;  1P0Z A;  3WS4 A;  4HP9 A;  1TS0 A;  5IS1 A;  1NLY A;  1MBL A;  2O9A A;  5KIZ A;  3LIE A;  2PU4 A;  3PBQ A;  2QZ6 A;  3HLF A;  2WUQ A;  1PI5 A;  3LID A;  3SH8 A;  3MZD A;  4X55 A;  4OPZ A;  3IX3 A;  4E3N A;  2YKH A;  4Y3I A;  5HDS A;  1CI9 A;  4GZB A;  4UA7 A;  2V8F A;  1LHY A;  5TJJ A;  1BLP A;  3ZG5 A;  2J3T C;  2WGW B;  4BMW A;  3EEA A;  3QP2 A;  3VSL A;  4E3I A;  5EVI B;  2ZL1 A;  4B4X A;  1BTL A;  4HBU A;  4RVA A;  4X68 A;  5IHV A;  1DY6 A;  2XFT A;  4XUZ A;  4HIA A;  3DWK A;  3SS4 A;  4GDN A;  1OPX A;  1P97 A;  2QJ5 A;  3BW6 A;  2ZQ8 A;  3OPP A;  1FCN A;  2WKI A;  4KZA A;  4U0T A;  3EOI A;  3BWL A;  3CHW P;  3VP4 A;  1LL8 A;  2Y2H A;  1MY8 A;  1IYS A;  3SH7 A;  3ZGA B;  4UQI S;  4X1M A;  3UPO A;  5KZH A;  4LRZ E;  5CER A;  3E0Y A;  4OON A;  1TDG A;  1TD5 A;  4HY8 A;  4MDZ A;  4WL9 A;  3BFF A;  1KGE A;  1XKZ A;  2ZD8 A;  3OPL A;  2QHK A;  2W0N A;  4R3A A;  1EI5 A;  1VET A;  3IX8 A;  2M7V A;  1DJC A;  4E6W A;  1RGY A;  5F68 A;  4O8G A;  4HI4 A;  4EBN A;  4YWZ A;  1YLZ A;  1ERM A;  3DTE A;  2Y55 A;  2ZBB A;  3L9K A;  2Z6D A;  4OLD A;  5FAT A;  2J8Y A;  1K4F A;  5GLC A;  4Y2F A;  2OAQ 1;  1TF1 A;  4Y7P A;  3WS1 A;  2ZC7 A;  2B02 A;  4HES A;  4II7 A;  3VV4 A;  2W1R A;  3ZG8 B;  2G7U A;  1NRJ A;  5I94 A;  3CIT A;  3LY4 A;  4BBT A;  4R3B A;  5CGX A;  2ZC5 B;  3LIB A;  1XA1 A;  2Y2O A;  3GR2 A;  4P6Z M;  5HAR A;  2Y59 A;  5DF9 A;  5GLD A;  4WZ4 A;  1XFQ A;  3VMA A;  3G6O A;  4P85 A;  1W63 M;  3MJQ A;  4NK3 A;  5DKK A;  4BQM A;  5HAI A;  3VOZ A;  2H0Y A;  5HZH A;  4EBP A;  4BJP A;  4EXO A;  3N6I A;  3LI8 A;  1GSV A;  4MCW A;  3GMW A;  4PHT A;  3PAE A;  4NXB A;  3HUN A;  2ACG A;  3PHY A;  3FC7 A;  2E8J A;  3VOY A;  1K55 A;  5EPH A;  5GL9 A;  1XGJ A;  1NYM A;  2NUT C;  4X53 A;  2J3T D;  3B47 A;  4JF5 A;  3E4P A;  1L0D A;  3A0V A;  2V2F F;  1MWS A;  4JPM A;  3VE3 A;  2ZMF A;  4KQR A;  3OPR A;  1L0F A;  3PBS A;  4N92 A;  3OPH A;  3UDX A;  3ZCZ A;  1YLW A;  2KOI A;  2H0T A;  5E2H A;  1KE3 A;  4OOM A;  3BRM A;  3IBJ A;  2XA7 M;  4RQ9 A;  3H82 B;  2OSU A;  2EX9 A;  1N9N A;  4P0M A;  4JXV A;  1KDW A;  3C7V A;  4S2N C;  1L3L A;  3OCN A;  4CJN A;  1K55 C;  1JVJ A;  5F69 A;  5DTT A;  4UA6 A;  1IEM A;  2H5S A;  4WN5 A;  1G6O A;  1LT0 A;  1PNE A;  3TE8 A;  5CXW A;  3VP1 A;  4O7D A;  1ZG4 A;  3LIA A;  1XJ2 A;  4OP8 A;  3TG9 A;  3BY8 A;  2HF6 A;  3KO6 A;  1H5X A;  3IWI A;  3R7W A;  4ESP A;  3HRE A;  1TS6 A;  4DE0 A;  1DJB A;  1OT6 A;  4YOF A;  3V67 A;  3K2N A;  5HL6 A;  4WMC A;  3A3J A;  2OOL A;  1ESU A;  4GB7 A;  3UMD A;  4EUV A;  5HSQ A;  2OAP 1;  1IYO A;  1NY0 A;  4FH2 A;  2ZLY A;  5F82 A;  4I5S A;  3B33 A;  3O87 A;  5HPF A;  1N4O A;  2W3G A;  2VEA A;  1LI0 A;  5J8X A;  1PW8 A;  3EGD C;  5J4E A;  2XEP A;  2QJ7 A;  2W3H A;  2M7U A;  1ONH A;  2VV7 A;  1OTI A;  5U47 A;  1FSY A;  3SW1 A;  1IKG A;  1LLB A;  3TJZ C;  3K3D A;  5HDC A;  3D72 A;  1ES3 A;  1IYQ A;  2VJW A;  3HVF A;  4JLF A;  4HBT A;  4KG6 A;  3I7J A;  2WGV A;  4EQI A;  2PHY A;  2FFY A;  1OME A;  2VV6 A;  3ICY A;  4M4X A;  4NXE A;  5A8B A;  1AXB A;  2QWS A;  4GHI B;  2O9B A;  5FQ9 A;  1MKI A;  5GHZ A;  3IXB A;  3LCE A;  4YNR A;  4MN6 A;  4K0X A;  4NEE D;  4MBK A;  5CEC A;  4WZ5 C;  4JGO A;  2ZMV A;  2V1A A;  4NXG A;  1M40 A;  3ZYT A;  3P7N A;  3BFC A;  3R4K A;  5G4Z A;  5EVI A;  4JXW A;  1ACF A;  1PYY A;  4WEL A;  3BLM A;  5CGS A;  5G4Y A;  4R4R A;  4OVD A;  2WKE A;  2ZQD A;  2W1T A;  3IWO A;  4MBH A;  4MNR A;  3WS5 A;  4IUK A;  4K0W A;  2WGW A;  2VKS A;  3CI6 A;  2H10 A;  3C4O A;  3TOI A;  3UN7 A;  2ZM0 A;  4Y0U A;  1YLP A;  2WKP A;  4BBU A;  4P6B A;  4NXF A;  4JXG A;  4BBV A;  4KZB A;  3N8S A;  3WS2 A;  3IF6 A;  5FSR A;  1YAX A;  5DTK A;  2EFU A;  3VFH A;  4QY5 A;  4PKY A;  1K54 A;  3W2Z A;  3HLB A;  4H8R A;  1NRF A;  4A5R A;  3E4O A;  2K7S A;  2L4R A;  1GA0 A;  4FCF A;  3KX0 X;  4PMA A;  5FAP A;  2W1T B;  4BD0 A;  1PRQ A;  4BLM A;  4UEY A;  1OTA A;  4HJ6 A;  5EE8 A;  1BYW A;  2KX6 A;  4X6T A;  4DRT A;  4EV4 A;  1A0K A;  4L9E A;  5FDH A;  2JE5 A;  1GSX A;  2Z6C A;  1K6R A;  4LV3 A;  1DP8 A;  2J3W A;  3ZNT A;  1MXO A;  3BYD A;  4DKI A;  3UB5 P;  5CX7 A;  2ZQ9 A;  2X02 A;  5FI2 A;  2J7V A;  3BFD A;  5KMW A;  3MKF A;  1BLH A;  1IYP A;  3NEC A;  3IXG A;  4KEN B;  3VP2 A;  3OC2 A;  3LR0 A;  4GHI A;  3ZFZ A;  1W8Y A;  3ZVW A;  1F5M A;  2V0W A;  5CGW A;  4LEN A;  3HBR A;  4C3Q A;  3FZC A;  4H6J B;  4U3T A;  5EM1 A;  2XRO A;  3BFG A;  4CQH A;  1K56 A;  4LCM A;  5DJU A;  3CLO A;  3RH8 B;  5FQK A;  4IJG A;  3HUO A;  1UGU A;  5HWV A;  2K2N A;  3ITB A;  1PWD A;  3IX4 A;  4UQI M;  1HLU P;  4NET A;  3MF0 A;  2HJ9 C;  4GS9 B;  1CJF A;  1V9Z A;  2EFX A;  3F1O A;  2GJ3 A;  4OQG A;  1ERO A;  5TGF A;  3EQV A;  1PZO A;  2EWV A;  4DMZ A;  1OJG A;  2JKR I;  2WZZ A;  1SKO B;  2R9W A;  3ZDJ A;  3PAG A;  5HX9 A;  2A2L A;  4Y5F A;  3F1N A;  5FQJ A;  3WRT A;  1CK3 A;  5E2G A;  5DJT A;  2HPB A;  2A3U A;  3ZQ5 A;  4QU3 A;  3H7W B;  1BLC A;  4GDB A;  3W4P A;  3E2L A;  2XSS A;  3RJU A;  3ZNY A;  5HWW A;  4LV2 A;  2Z2L B;  1T1B A;  1ERQ A;  4E04 A;  2XD1 A;  3LEZ A;  2R9X A;  4GW9 A;  3R7W B;  3C5A A;  4WMC D;  2GDN A;  4R38 A;  4GD8 A;  3PYP A;  2WKR A;  2D02 A;  4KZ7 A;  1HZO A;  4WYY A;  3QNC A;  3HJK A;  2O9C A;  5EUA A;  3IHB A;  4HOI A;  2EXA A;  1KGF A;  3BFE A;  1SHV A;  4PM6 A;  3OOV A;  2EX2 A;  5TBM A;  3UB9 A;  1PWC A;  2A49 A;  3GSG A;  1ODV A;  1XPB A;  1VEU A;  4KZ3 A;  4DE1 A;  1PZP A;  1FR1 A;  3E98 A;  4OQI A;  3T4J A;  3NI9 A;  1M6K A;  1PI4 A;  3T1R A;  3F1O B;  3FPW A;  4DDS A;  5HWT A;  4EEU A;  2XRN A;  2JKT M;  5A93 A;  1LSW A;  1OT9 A;  1SDE A;  5EFW A;  3IH9 A;  5HDD A;  1BSG A;  3SH9 A;  4BL2 A;  1YKD A;  1H8Z A;  3C2W A;  3MS6 A;  1H0M A;  3N8R A;  4G3W A;  2C5W B;  3S7N A;  3S1Y A;  3NCK A;  4OP5 A;  5GHY A;  3T50 A;  1BT5 A;  4OPQ A;  2IWC A;  2Y2K A;  5FL3 A;  4PM7 A;  4C6Y A;  3AGD A;  4CLC A;  3M6H A;  4PM8 A;  1DRM A;  3ZG0 A;  4GLQ A;  3IF6 C;  4PM5 A;  1ZHH B;  3NY4 A;  4QY6 A;  5A91 A;  1TDL A;  2BTF P;  2Z2M B;  3GTC A;  1KOU A;  1Q2P A;  3E2K A;  1O07 A;  1TS8 A;  1IEL A;  3PBO A;  4GJ4 A;  2PBD P;  1OTD A;  3S7O A;  3CG5 A;  2B18 A;  1YMX A;  5DFY A;  3TSG A;  4WBG A;  1L0E A;  2IWB A;  4LGW A;  3TW8 A;  2WYX A;  3V3R A;  3P98 A;  3F1P B;  3NOU C;  4GOG A;  2Q9M A;  3DW0 A;  3A0R A;  2QYB A;  4R1G A;  4L9G A;  2Y2L A;  2EX8 A;  1ESI A;  5CHU A;  5KSC A;  2OWH A;  1RP5 A;  4IUH A;  3KSH A;  1K6S A;  3PBR A;  4ZJ3 A;  3U4L P;  4IHQ A;  4DF6 A;  5CHM A;  3MSH A;  4BEN A;  4QHC A;  3G35 A;  2ZOH A;  1K4E A;  5FQQ A;  2VGL M;  5GLB A;  4K08 A;  2V20 A;  4Z9Q A;  2WKQ A;  4DE2 A;  2JN7 A;  4OQH A;  1NLZ A;  4HH3 A;  1Q2Q A;  4S2I A;  3P09 A;  2ZL1 B;  1OJ5 A;  1WA9 A;  5FI7 A;  2HJE A;  2VA0 A;  2VGK A;  3IQA A;  2HDR A;  5M19 A;  3MBZ A;  2V9A A;  5F5Y A;  3G30 A;  3JYI A;  3S7P A;  4OLG A;  2M1C A;  4YIN A;  1D1J A;  4KQD A;  4RYE A;  1FCM A;  3KSF A;  1XA7 A;  3FKV A;  4BL3 A;  3Q7Z A;  2G2W A;  4GN2 A;  3B42 A;  5DVA A;  5L2F A;  4EES A;  2Y2G A;  5CED A;  1FOF A;  2PD8 A;  1Y28 A;  3VFF A;  2CC1 A;  2PRF A;  3ISG A;  1GHM A;  1T18 A;  3K3C A;  1S1Z A;  4FTX A;  1X0O A;  4Q0J A;  4FUW A;  3MXR A;  5FDS A;  3UB7 A;  4Q8I A;  4KZ5 A;  1NWZ A;  4E3J A;  1MPL A;  4LLO B;  4YFM A;  3RFB A;  1F2K A;  3O86 A;  3EWK A;  1HTZ A;  1WE4 A;  3M2K A;  4WF0 A;  5F1F A;  1DP9 A;  5FEG A;  3FV7 A;  2WAE A;  3C4P A;  3FYZ A;  2C6W B;  2WGI A;  4WUJ A;  1K54 C;  1W63 Q;  3VE4 A;  3T4K A;  3EQU A;  4EET B;  2VLG A;  3OLO A;  3MFD A;  4B9O A;  4ETZ A;  4I3I A;  1CI8 A;  2RL3 A;  3KSG A;  2P9V A;  1TVF A;  3V39 A;  2PYR A;  3G31 A;  3MQQ A;  5FI6 A;  3LUQ A;  4CLC C;  3LI9 A;  3MFX A;  5JYO A;  4LV0 A;  4KUO A;  4DDY A;  1D7E A;  3IHA A;  3HLD A;  4EQ1 A;  4S2L A;  3N7W A;  1H3Q A;  3QP6 A;  3IWQ A;  1SKF A;  5MC7 A;  4GKU A;  5IU1 A;  3C8C A;  2V1Z A;  2VGJ A;  4OOY A;  4MEZ A;  3ZVT A;  4LPZ A;  1CQA A;  1BUE A;  4G3V A;  2KDK A;  3PBN A;  4EUZ A;  1C3B A;  4JXS A;  3IH8 A;  4N1H A;  3M6B A;  3HLC A;  1STZ A;  1S6R A;  3KYZ A;  4ZRR A;  3IS2 A;  5HAP A;  3N8L A;  1FSW A;  1P9R A;  5FEF A;  3JVU A;  3Q07 A;  1PWG A;  2FH5 A;  2Q9N A;  3CPT A;  2UV0 E;  1U60 A;  4Y0O A;  1JWV A;  1QME A;  4HP4 A;  3DTK A;  2L1M A;  3U2A A;  3BY9 A;  2GNX A;  4OQ0 A;  2PU2 A;  2X71 A;  2HV1 A;  3A3I A;  3WRZ A;  3MMH A;  2FFF B;  1Y4O A;  4KZ6 A;  2PDR A;  2JKG A;  1K38 A;  5HW3 A;  2ZMA A;  1NYY A;  2EXB A;  3G2Y A;  1XP4 A;  4KQO A;  1KDS A;  1MWR A;  4I39 A;  4JKT A;  3KYE A;  4LCL A;  1T19 A;  4XT2 B;  5AQA A;  2XD5 A;  3S22 A;  2OLU A;  4O01 A;  2Y4A A;  3BJN A;  1K57 A;  1MWT A;  1P9W A;  3CUE A;  3T4S A;  1KGG A;  4BWI A;  1ES4 A;  1JNU A;  3T4T A;  1WYB A;  3CJM A;  2W3F A;  2PBY A;  2PR6 A;  1IKI A;  3GV9 A;  2B5R A;  3A3F A;  3T12 B; 
#chains in the Genus database with same CATH homology
 1CEF A;  1NXY A;  2J9P A;  3BEC A;  3HUN A;  5FAO A;  5M18 A;  3IHB A;  4MLL A;  2EXA A;  1KGF A;  3NDG A;  3VOY A;  1K55 A;  4HEF A;  5EPH A;  5GL9 A;  3UDI A;  1XGJ A;  1SHV A;  3BFE A;  1NYM A;  4PM6 A;  4X53 A;  2EX2 A;  1PWC A;  2A49 A;  2XLN A;  3GSG A;  1XPB A;  4JF5 A;  4GD6 A;  2DRW A;  2WK0 A;  3IXD A;  3UE3 A;  5GHX A;  3Q1F A;  5EOO A;  5CEB A;  4KZ3 A;  3MZE A;  4DE1 A;  1PZP A;  1FR1 A;  3B3X A;  1L0D A;  3QNB A;  2V2F F;  1MWS A;  4OQI A;  3UO9 A;  4JPM A;  4DE3 A;  2XQZ A;  3OPR A;  1L0F A;  3NI9 A;  3PBS A;  4KQR A;  1M6K A;  1PI4 A;  4N92 A;  5DF8 A;  2ZM8 A;  3G4P A;  3OPH A;  4N9K A;  3ZHH A;  4DDS A;  3UDX A;  3ZCZ A;  3CZD A;  3FWL A;  4S2N A;  1YLW A;  4IBR A;  2H0T A;  4EBL A;  5E2H A;  1KE3 A;  3Q7V A;  2J9O A;  4WZ5 A;  1LL9 A;  4OOM A;  5A93 A;  1SCW A;  1SDE A;  3BRM A;  3V3S A;  3IH9 A;  2OSU A;  1W8Q A;  4X56 A;  1BSG A;  2EX9 A;  3SH9 A;  4R3J A;  5EVL A;  4P0M A;  4BL2 A;  4RX3 A;  4UA9 A;  2HDU A;  1H8Z A;  5E43 A;  1JTG A;  1S0W A;  2ZQ7 A;  4JXV A;  4UHU A;  3QHY A;  1KDW A;  1K57 C;  1HVB A;  1ALQ A;  3C7V A;  5G18 A;  4S2N C;  3UPN A;  3N8R A;  4B88 A;  1PIO A;  3OCN A;  2C5W B;  4ZBE A;  4CJN A;  1FCO A;  3S1Y A;  1K55 C;  3NCK A;  1JVJ A;  4OP5 A;  2QPN A;  5DTT A;  3GVB A;  4UA6 A;  5GHY A;  1IEM A;  2H5S A;  3IF5 A;  3V5M A;  1BT5 A;  4OPQ A;  2Y2J A;  2IWC A;  4OPR A;  2Y2K A;  4B4Z A;  5CXW A;  1HD8 A;  3VP1 A;  4O7D A;  1ZG4 A;  4ZJ1 A;  4PM7 A;  4C6Y A;  1L2S A;  3NIA A;  4OP8 A;  3AGD A;  3TG9 A;  3W8K A;  2EX6 A;  3FKW A;  4MBF A;  3HUM A;  5M1A A;  1H5X A;  1RGZ A;  3IWI A;  2ZM2 A;  3M6H A;  2ZQA A;  4PM8 A;  4X69 A;  3ZG0 A;  3HRE A;  3IF6 C;  2XDM A;  4PM5 A;  4DE0 A;  2QMI A;  1DJB A;  3NY4 A;  4QY6 A;  3O88 A;  5A91 A;  1TDL A;  2Z2M B;  3GTC A;  1Q2P A;  4WMC A;  3A3J A;  1ESU A;  4GB7 A;  4E3O A;  1GHP A;  3E2K A;  4S2M A;  3AGF A;  1O07 A;  2HP6 A;  2ZC6 B;  1IYO A;  1NY0 A;  4BD1 A;  4FH2 A;  4DXB A;  3GQZ A;  2ZLY A;  4RA7 A;  5F82 A;  4ZJ2 A;  3SS5 A;  1IEL A;  4PM9 A;  3PBO A;  3O87 A;  1SDN A;  4GNU A;  3WS0 A;  1N4O A;  3WWX A;  3CG5 A;  1BZA A;  1ES5 A;  1LI0 A;  1YMX A;  5AQ7 A;  5FAQ A;  3TSG A;  5J8X A;  1PW8 A;  4WBG A;  1L0E A;  5FQM A;  3UNW A;  5JYP A;  4U0X A;  2IWB A;  2WYX A;  2XEP A;  1KVL A;  3IXH A;  3P98 A;  4KZ8 A;  3V3R A;  1W79 A;  4CPK A;  3PBT A;  1ONH A;  2HP9 A;  3NDE A;  4GOG A;  2Q9M A;  3DW0 A;  4XXR A;  5U47 A;  1GCE A;  1FSY A;  3ZG9 B;  4R1G A;  4IED A;  3W4O A;  1IKG A;  2Y2L A;  4LV1 A;  1MWU A;  1YLT A;  1YM1 A;  2EX8 A;  1ESI A;  3A3D A;  5CHU A;  4C75 A;  1G6A A;  5KSC A;  4DXC A;  1RP5 A;  4P87 A;  2JBF A;  1K6S A;  1LLB A;  3PBR A;  5FQI A;  3SOI A;  4S2K A;  4ZJ3 A;  4N9L A;  4KQQ A;  5CHJ A;  2Y91 A;  3G32 A;  4DF6 A;  3Q82 A;  5CHM A;  1ES3 A;  1IYQ A;  4BEN A;  3HVF A;  3G35 A;  3NBL A;  4JLF A;  4QHC A;  3DWZ A;  1K4E A;  5FQQ A;  4HBT A;  5E2F A;  1E3U D;  5GLB A;  1QMF A;  1ZKJ A;  4KG6 A;  1YLY A;  2OV5 A;  3I7J A;  1FR6 A;  2WGV A;  4EQI A;  4IVK A;  4JBF A;  2FFY A;  3ZG7 B;  1OME A;  2V20 A;  4N1X A;  4L0L A;  4Z9Q A;  3UY6 A;  2UWX A;  1I5Q A;  2WAF A;  4KZ9 A;  4E6X A;  3BEB A;  4QB8 A;  4E3L A;  3VP0 A;  4EWF A;  2ZQC A;  3PTE A;  4DE2 A;  5CTM A;  4K91 A;  4OQH A;  4KG5 A;  1AXB A;  1BLS A;  1Q2Q A;  1XX2 A;  3HLW A;  3P09 A;  4S2I A;  5BOH A;  5FA7 A;  1MKI A;  5FQ9 A;  5GHZ A;  1ONG A;  1FQG A;  5FAS A;  4E3M A;  1YT4 A;  1N9B A;  2DCF A;  2WAD A;  5EVI D;  5CTN A;  3IXB A;  1W7F A;  3LCE A;  5FI7 A;  1GHI A;  2VGK A;  2HDR A;  3IQA A;  4K0X A;  5M19 A;  3MBZ A;  4MBK A;  3AGE A;  5KSH A;  2P9V B;  5CEC A;  4OKP A;  3G30 A;  4WZ5 C;  5CRF A;  3JYI A;  4ZTK A;  1VM1 A;  1KE4 A;  1BUL A;  1M40 A;  4OLG A;  3BFC A;  4D2O A;  1L0G A;  5EVI A;  1PW1 A;  4YIN A;  2BLS A;  1Y54 A;  4JXW A;  1KE0 A;  3IT9 A;  4RYE A;  5HL1 A;  1PYY A;  4WEL A;  1FCM A;  3BLM A;  5CGS A;  4R4R A;  3HLG A;  4OVD A;  4WEK A;  5EOE A;  1XA7 A;  1YLJ A;  3FKV A;  5EVI C;  2WKE A;  1RCJ A;  4Y0T A;  4R23 A;  2ZQD A;  3IWO A;  4MBH A;  4MNR A;  5TFQ A;  3WS5 A;  4BL3 A;  4K0W A;  2WGW A;  3Q7Z A;  4OH0 A;  2G2W A;  4GN2 A;  3S4X A;  2P74 A;  2H10 A;  3C4O A;  3NC8 A;  4S2J A;  3RXW A;  3TOI A;  3UN7 A;  1EWZ A;  5F83 A;  5DVA A;  3N4I A;  5L2F A;  2Y2G A;  5CED A;  3W4Q A;  1FOF A;  2ZM0 A;  1JWZ A;  3LY3 A;  4Y0U A;  1DJA A;  3V50 A;  1YLP A;  3VFF A;  2ZC3 B;  2CC1 A;  2Y2N A;  2I72 A;  4P6B A;  1JWP A;  1GHM A;  1Z6F A;  3ISG A;  4JXG A;  2XH9 A;  4KZB A;  3N8S A;  3WS2 A;  3IF6 A;  1GA9 A;  2DNS A;  5FSR A;  3UPP A;  3MXR A;  5DTK A;  4Q8I A;  2ZC4 B;  2EFU A;  3MXS A;  3VFH A;  1TEM A;  3MZF A;  4QY5 A;  4KZ5 A;  5AQB A;  1K54 A;  4E3J A;  3HLB A;  4H8R A;  1NRF A;  1G68 A;  4A5R A;  1MPL A;  4ZDX A;  3UE0 A;  3HL9 A;  1YQS A;  1J9M A;  1GA0 A;  4FCF A;  3WS4 A;  1LI9 A;  4YFM A;  4PMA A;  3O86 A;  3OCL A;  5DF7 A;  3A3E A;  1HTZ A;  1WE4 A;  3M2K A;  5F1F A;  5FAP A;  1MBL A;  4JF6 A;  2X01 A;  2PU4 A;  4JF4 A;  3PBQ A;  3FV7 A;  2QZ6 A;  2WAE A;  5DTS A;  3C4P A;  3FYZ A;  3HLF A;  2C6W B;  2WGI A;  2WUQ A;  4BD0 A;  4BLM A;  1PI5 A;  3G34 A;  1K54 C;  3SH8 A;  2HDS A;  2JCH A;  1ZG6 A;  3MZD A;  4X55 A;  4OPZ A;  4XUX A;  5EE8 A;  4E3N A;  4X6T A;  4DRT A;  4EV4 A;  3HLE A;  3EQU A;  1CI9 A;  4GZB A;  2E8I A;  1ES2 A;  5FDH A;  4UA7 A;  2JE5 A;  2OLV A;  1K6R A;  1LHY A;  3ZG5 A;  1BLP A;  4LV3 A;  2WGW B;  2WZX A;  3ZNT A;  3MFD A;  1MXO A;  3BYD A;  3MKE A;  1CI8 A;  2RL3 A;  4DKI A;  2P9V A;  1TVF A;  1H8Y A;  3V39 A;  1KVM A;  4WEJ A;  3G31 A;  2ZQ9 A;  2X02 A;  2Y2Q A;  4S2P A;  2XR0 A;  1VQQ A;  2G2U A;  3DTM A;  4OPY A;  5FI2 A;  3VSL A;  2J7V A;  3BFD A;  5KMW A;  3MKF A;  1BLH A;  1IYP A;  4E3I A;  5FI6 A;  1W5D A;  3IXG A;  1JTD A;  4IBX A;  4KEN B;  5EVI B;  3VSK A;  4B4X A;  1NZU A;  3VP2 A;  1BTL A;  4HBU A;  4RVA A;  4X68 A;  5IHV A;  3OC2 A;  1DY6 A;  2XFT A;  1W8Y A;  4LV0 A;  4XUZ A;  3ZFZ A;  3DWK A;  5D3O A;  3ZVW A;  3SS4 A;  4GDN A;  4DDY A;  3IHA A;  5CGW A;  1LL5 A;  3HLD A;  4LEN A;  3HBR A;  4C3Q A;  2Y2P A;  3FZC A;  3N7W A;  4S2L A;  4U3T A;  1XXM A;  4E3K A;  1NJ4 A;  2ZQ8 A;  2XF3 A;  1O7E A;  2Y2I A;  1SKF A;  3IWQ A;  1FCN A;  2IWD A;  3OPP A;  3BFG A;  2WKI A;  4IVI A;  4GKU A;  4KZA A;  4WM9 A;  4QJG A;  1K56 A;  2V1Z A;  4LCM A;  4U0T A;  1E3U A;  2VGJ A;  4OOY A;  5E2E A;  1WYC A;  4MEZ A;  4UAA A;  5FQK A;  5A92 A;  5EEC A;  3ZVT A;  4OOL A;  5JYO A;  3VP4 A;  4KZ4 A;  3HUO A;  1BUE A;  2Y2H A;  4RX2 A;  1MY8 A;  1IYS A;  2BG1 A;  4F94 A;  5TR7 A;  3SH7 A;  3PBN A;  3ITB A;  3Q7V B;  1PWD A;  4EUZ A;  4NET A;  3ZGA B;  1C3B A;  4JXS A;  3ITA A;  1NZO A;  3IH8 A;  4N1H A;  4PPR A;  4R4S A;  4R0Q A;  3M6B A;  3UPO A;  3HLC A;  2EFX A;  5KZH A;  1S6R A;  4OQG A;  1ERO A;  5TGF A;  3EQV A;  3GRJ A;  1PZO A;  2HDQ A;  2XGN A;  5HAP A;  1I2S A;  3N8L A;  2WZZ A;  2WKH A;  4OON A;  5CER A;  3UE1 A;  1TDG A;  2R9W A;  1FSW A;  3ZDJ A;  5HAQ A;  3PAG A;  3UDF A;  1I2W A;  3Q07 A;  3BFF A;  1PWG A;  2Q9N A;  5HX9 A;  1KGE A;  1U60 A;  1XKZ A;  4Y0O A;  1JWV A;  1QME A;  2ZD8 A;  3OPL A;  2RCX A;  1EI5 A;  3CMZ A;  3C7U A;  1DJC A;  4S2O A;  5FQJ A;  1RGY A;  5AQ9 A;  1CK3 A;  3WRT A;  4QD4 A;  4E6W A;  4EBN A;  5E2G A;  2HPB A;  1YLZ A;  1ERM A;  2Y55 A;  4KG2 A;  2A3U A;  4QU3 A;  1E4D A;  3IF6 B;  3VP3 A;  5A90 A;  4M3K A;  1BLC A;  2ZJ9 A;  4OLD A;  3O3V A;  4ID4 A;  5FAT A;  4GDB A;  2PU2 A;  4OQ0 A;  2J8Y A;  2X71 A;  3A3I A;  3WRZ A;  1K4F A;  5GLC A;  3BLS A;  3W4P A;  2FFF B;  3E2L A;  5HFO A;  4KZ6 A;  1YMS A;  1E25 A;  3RJU A;  4Y7P A;  3WS1 A;  2ZC7 A;  1K38 A;  4FD8 A;  5HW3 A;  3G2Z A;  3ZNY A;  4HES A;  2ZMA A;  4LV2 A;  1NYY A;  2XK1 A;  2Z2L B;  1K56 D;  4ZAM A;  2EXB A;  3G2Y A;  1XP4 A;  2JC7 A;  1ERQ A;  2XFS A;  4KQO A;  3ZG8 B;  1KDS A;  1MWR A;  3SS3 A;  2XD1 A;  4JKT A;  3LEZ A;  1XGI A;  2R9X A;  5I94 A;  4FSF A;  3LY4 A;  4LCL A;  1ZC2 A;  4R3B A;  5CGX A;  2ZC5 B;  3C5A A;  1XA1 A;  3BM6 A;  2Y2O A;  3LO7 A;  4WMC D;  3GR2 A;  2XD5 A;  2GDN A;  3OZH A;  5AQA A;  5HAR A;  2Y59 A;  5DF9 A;  1CEG A;  2HP5 A;  3S22 A;  2OLU A;  5GLD A;  4WZ4 A;  2Y4A A;  4GD8 A;  3VMA A;  3M2J A;  1K57 A;  1MWT A;  4P85 A;  4NK3 A;  2Y2M A;  4BQM A;  1KGG A;  4FH4 A;  5HAI A;  3VOZ A;  2H0Y A;  5F1G A;  1ES4 A;  4KZ7 A;  4EBP A;  1WYB A;  3CJM A;  1HZO A;  4WYY A;  4BJP A;  3QNC A;  2PBY A;  3N6I A;  3Q81 A;  1IKI A;  1K25 A;  3GV9 A;  5EUA A;  3RXX A;  2B5R A;  3A3F A;  3D4F A;  3GMW A;  5GLA A;  3PAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...