3WRZA

N288q-n321q mutant beta-lactamase derived from chromohalobacter sp.560 (without soaking)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
357
structure length
357
Chain Sequence
QTREVLDPIVASLMEAQQIPGMAIALVRPEGTTISHYGAADRETGTPVDDDTLFEIGSLSKTLTATLASLAEVEGKLDFDAPVSRYLPELEGSAFDDISGLNLGTHTGGGLPLFVPDEVTDRASLMAWYREWQPTEPIGESRTYSNLGIGLLGLETAASLDGEFVPTMRAKVLAPLGMQDTWYDVPEARMADYAMGEDKDGQPTRVSPGVLDDEAYGIKTTAADLAKLVRANLHLADVDAELQQAIDATRQGHYRVGDMTQALIWEQYSLPVAPETLRAGQGYDMILEPNAAEALEPPQSPRDDVWVNKTGSTQGFGGYIVMLPGKHTGLVMLANKNYPNDARVEAAYRILSGLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a highly acidic beta-lactamase from the moderate halophile Chromohalobacter sp. 560 and the discovery of a Cs(+)-selective binding site
pubmed doi rcsb
source organism Chromohalobacter sp. 560
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 116
structure length 357
sequence length 357
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3wrzA00
3PBRA 4QHCA 5CERA 4PM5A 5DVAA 3ITBA 4WEJA 4EBNA 3BFGA 1E3UD 4KQQA 4WBGA 2J9OA 3UNWA 2Y2GA 2WGIA 2ZD8A 1K57C 1KDSA 3G2ZA 3VSKA 3G31A 4S2IA 5DTTA 1K54C 4DXCA 4OOLA 3QNBA 3I7JA 2X02A 2Y2MA 2Y2NA 1K25A 1RP5A 3G34A 4S2NC 1L2SA 3AGEA 4BENA 3IF6B 4U0TA 5FQMA 3C7UA 4GOGA 1PYYA 5FAQA 4DF6A 1DJBA 1Q2PA 2JBFA 2XDMA 3GR2A 4X6TA 3W4QA 2WADA 1PW8A 4IVKA 3LY3A 1JWPA 3NI9A 1MKIA 1ONGA 3PBNA 1H5XA 1JTDA 1CEFA 1L0DA 3HL9A 5GLBA 1NZOA 2EXBA 3PBTA 1WYBA 5DF7A 1ONHA 2ZQDA 5CHUA 3IXGA 3WWXA 1YLPA 1BLHA 1LL5A 1K56A 1H8YA 2GDNA 3MXSA 5A90A 2WAFA 3HBRA 4S2LA 1KGGA 2ZC3B 3EQUA 2XEPA 5CTMA 1FOFA 1G6AA 2XQZA 4E3NA 3MXRA 5HAIA 3VP0A 1BZAA 4KZ5A 1LL9A 2Y2OA 2WKEA 1LI9A 2V2FF 1K55A 3HVFA 4LENA 3V39A 2Q9MA 3HLWA 3RXWA 4JXSA 4BJPA 4X53A 4WMCD 1GA9A 4KZAA 1DJAA 4ZJ1A 3TSGA 4LV0A 1YMXA 5GHZA 3ISGA 3NBLA 4JXGA 2HDSA 3FKWA 3FV7A 3BECA 4Y0OA 4Y0UA 4PM6A 3S22A 3D4FA 4KZ4A 2FFFB 2EX8A 4KZ3A 3A3EA 1FR1A 4OOMA 5FASA 5CHMA 3IQAA 4S2OA 2XK1A 1HZOA 4P6BA 4K0WA 3O86A 3GMWA 1BUEA 4R1GA 3C4OA 1BSGA 2QMIA 1FSWA 3A3DA 1U60A 1HD8A 3HLCA 1O7EA 3MBZA 1PIOA 3VP1A 1N4OA 3NDGA 2G2WA 3WS2A 5F1FA 4OQIA 3N8LA 2XD1A 5KSCA 4OOYA 2HDQA 3HLFA 4GB7A 4IVIA 4UA9A 4KZ7A 3TG9A 4LV3A 4BD0A 3S4XA 3FYZA 4R3JA 1K57A 3P09A 5TFQA 4GZBA 1NYYA 2ZLYA 5FQIA 1N9BA 1DJCA 2Y2LA 1KE4A 4R4RA 5FAPA 2WK0A 2Y2KA 3NC8A 1I2SA 1YLYA 3LEZA 1MWUA 1ALQA 3IWIA 1I5QA 3Q7ZA 2ZM8A 3FKVA 3N8RA 5AQBA 2E8IA 3E2LA 3LCEA 2XFTA 3Q82A 4YINA 3ZGAB 4XUXA 4B4ZA 5CTNA 3V5MA 2UWXA 4PM7A 1O07A 3G4PA 5HAPA 5EVIC 4JF6A 5CHJA 3WS1A 5GLAA 4B4XA 2V20A 3Q07A 4BL3A 2XD5A 3AGDA 3PAEA 4OQGA 3BLSA 3UO9A 3ZHHA 5HL1A 1H8ZA 4B88A 1FCOA 4DXBA 1WYCA 1ZC2A 3OPLA 4E3JA 3BFEA 3N7WA 1ZKJA 1SDNA 5FDHA 5CEBA 5GHYA 1GA0A 4WZ4A 1ERQA 4MLLA 4PM8A 4DDYA 2ZQAA 4MBKA 3RJUA 4X56A 1CI9A 4U0XA 2IWDA 5HFOA 3BFDA 4Q8IA 3OCLA 3NY4A 3MZFA 4OONA 1M6KA 3HLEA 1YT4A 3A3JA 1JWZA 2XR0A 5E2GA 5EVIA 4OPRA 4C6YA 3UPPA 3UPOA 5EOOA 3G35A 4XUZA 2P9VA 2J7VA 4WYYA 3MFDA 3ZNTA 5KZHA 4N9KA 4WEKA 2A49A 3HLDA 3PBOA 3A3IA 4KENB 4H8RA 4RX3A 4BD1A 4UA6A 2RCXA 5TGFA 3N4IA 5E2EA 5M19A 4U3TA 5AQ9A 2J8YA 2JE5A 3OPHA 4QD4A 1NRFA 2QZ6A 5FA7A 4GD6A 1K56D 3EQVA 3HREA 4JKTA 2ZM2A 3MKEA 3DWZA 1WE4A 1K38A 1BTLA 1BT5A 1ES4A 3IHAA 4N1HA 2EX9A 1K4EA 3M2JA 3WS4A 3N8SA 4N92A 4S2PA 2Y55A 3SS4A 5AQAA 3FWLA 4E3LA 1PWDA 4YFMA 3BFCA 5J8XA 1C3BA 1K4FA 3BRMA 4P0MA 2EFXA 5M18A 5FQQA 4ID4A 3CG5A 1FSYA 2A3UA 4KG5A 3VP2A 3IXDA 4OH0A 5FI7A 4K91A 1XA7A 2ZC4B 3IH8A 2HDRA 5I94A 1ERMA 4GD8A 3BFFA 3V3RA 3WRTA 1QMEA 2X71A 5EVLA 2H0YA 2B5RA 3GRJA 3OPRA 5HARA 3SH9A 1FR6A 2IWCA 1CK3A 2OLUA 1Y54A 4OVDA 1GHMA 4HBTA 1JWVA 4DE3A 1BLPA 2ZM0A 4HEFA 4JBFA 1IKGA 3AGFA 3VFHA 2ZC7A 1KGEA 3UE3A 1KDWA 4EV4A 3V3SA 4DE1A 1MWRA 1PWCA 1AXBA 3M2KA 4GDBA 3GV9A 2WGWB 4S2MA 4Y0TA 5F1GA 1K6SA 3IH9A 3IXBA 2OV5A 3IF6C 2HP5A 2ZC5B 5FATA 4FD8A 2G2UA 3W8KA 5A93A 4EBLA 3M6BA 2EXAA 2WZXA 3QNCA 4KG6A 3NIAA 3OC2A 3VOYA 1XA1A 4HBUA 1FCMA 1J9MA 2IWBA 1MXOA 1ZG4A 2XF3A 4NK3A 2Y4AA 4UAAA 1IYSA 1MWSA 5EUAA 2DNSA 2RL3A 2WZZA 4WELA 3ZDJA 1K55C 2Z2MB 5HAQA 1PI5A 1MY8A 1KVMA 5EVID 1ESUA 3C7VA 4Y7PA 1BLSA 5G18A 3HLBA 2CC1A 4XXRA 3PTEA 5U47A 1YLTA 2ZJ9A 3WS0A 3BLMA 4LV2A 4E6XA 3NCKA 1NYMA 4QY5A 4ZBEA 1SKFA 4MNRA 2HP6A 3BYDA 3IF6A 1KVLA 4CJNA 4R23A 4X68A 4JPMA 2WYXA 1GHIA 1ES2A 1XX2A 1LHYA 2Y2QA 4N9LA 3SOIA 1RCJA 5FI2A 3W4PA 1HTZA 4BQMA 4ZAMA 3HUNA 3GTCA 3Q7VA 4OP5A 4S2JA 3VMAA 4P85A 5IHVA 1TDLA 1XP4A 3UPNA 4MEZA 4WM9A 5CGXA 1SCWA 3OCNA 1PZOA 1NJ4A 2XGNA 4JF4A 2H10A 1W8QA 1IYPA 4DRTA 2WAEA 5E2HA 1VQQA 1YLJA 2V1ZA 1TVFA 3BEBA 1CEGA 3UN7A 1EI5A 2HP9A 4K0XA 5EE8A 3ZFZA 4DE0A 1Z6FA 1NZUA 4OP8A 5FAOA 1L0EA 1YLWA 4JF5A 4R4SA 2H0TA 5CGWA 5F83A 3VP3A 2Y2JA 1MWTA 2Z2LB 3LO7A 4EBPA 1CI8A 4O7DA 3JYIA 4KZ8A 1FCNA 2Y59A 2R9WA 3OZHA 1K6RA 3A3FA 4QB8A 5D3OA 3N6IA 5EOEA 3C5AA 2WUQA 1ESIA 1GCEA 2Y2PA 4ZDXA 1RGZA 2Q9NA 2I72A 4JLFA 2JC7A 5FQJA 1E25A 1L0FA 2HDUA 4PPRA 4GDNA 2OSUA 3Q7VB 3ZG0A 2PU2A 1XGJA 3CZDA 3UY6A 1TEMA 1M40A 3VFFA 2ZQ7A 4E3KA 4F94A 4RA7A 3ZG5A 4N1XA 2C6WB 3MZEA 1PWGA 1Q2QA 4BL2A 1BLCA 2ZQ9A 4OLGA 5DTSA 5M1AA 4R0QA 1RGYA 4CPKA 2PU4A 2XH9A 3ZVWA 5JYPA 4OPQA 1FQGA 2HPBA 3SS3A 4FH4A 1IKIA 1K54A 3ZG9B 3G2YA 4OLDA 5FQKA 4ZJ3A 4OPYA 2VGJA 5EECA 3VP4A 4OPZA 1EWZA 3MKFA 3O3VA 1GHPA 1YM1A 5FQ9A 3W4OA 4E3OA 3PBQA 3GQZA 1BULA 4C3QA 2X01A 4WMCA 5GLDA 5DTKA 2EFUA 4C75A 4LCLA 3ITAA 3O88A 4PM9A 1L0GA 3WRZA 5FI6A 1MBLA 1KGFA 4QY6A 4A5RA 3G30A 2DRWA 4KQOA 2C5WB 5A91A 5CECA 5E2FA 1NY0A 3UDXA 3IWQA 3SH8A 3M6HA 4QJGA 1W5DA 3HUMA 4KZ9A 3SS5A 1KE3A 3P98A 3PBSA 4MBFA 1DY6A 1ES5A 3RXXA 3SH7A 2WGVA 5GHXA 1LI0A 4PMAA 4UHUA 1KE0A 1SHVA 2P9VB 4JXVA 3V50A 5E43A 3GSGA 4FH2A 5JYOA 5AQ7A 4DKIA 5DF8A 3VOZA 2ZC6B 2ZQ8A 3IF5A 2OLVA 3NDEA 4KZ6A 1E3UA 2XFSA 1ZG6A 3S1YA 4D2OA 5CEDA 4ZTKA 1YMSA 4WZ5A 1QMFA 3UE1A 1ES3A 3HUOA 3UDFA 4JXWA 3UDIA 1EROA 3CJMA 5GLCA 1S0WA 3ZNYA 1XGIA 2XLNA 1XKZA 4RX2A 3B3XA 3ZG7B 1PW1A 4KG2A 4S2NA 3ZCZA 5EVIB 4OKPA 1I2WA 1PZPA 3QHYA 2FFYA 4QU3A 4X69A 2Y91A 1JTGA 2Y2HA 4E3MA 3TOIA 4NETA 3CMZA 3G32A 1IELA 1YQSA 3PAGA 1G68A 4P87A 3DW0A 3E2KA 3OPPA 2WKHA 4WZ5C 2J9PA 2Y2IA 4GN2A 3GVBA 2QPNA 4E6WA 4EQIA 1JVJA 5CXWA 2EX6A 4EWFA 3DWKA 4LV1A 2EX2A 4M3KA 4KZBA 3MZDA 4ZJ2A 3FZCA 3IHBA 3O87A 2ZQCA 2JCHA 4MBHA 4Z9QA 5GL9A 1IYQA 3C4PA 4KQRA 3Q1FA 2BG1A 2P74A 1W8YA 5HX9A 1PI4A 3VSLA 1XPBA 3UE0A 4DE2A 1XXMA 1OMEA 3ZVTA 4BLMA 2PBYA 4FSFA 4FCFA 1IEMA 4DDSA 1MPLA 4X55A 2WKIA 1E4DA 4IEDA 4RVAA 5KMWA 3ZG8B 1W7FA 1LLBA 1VM1A 2BLSA 3IT9A 4OQHA 4GKUA 5HW3A 5A92A 1S6RA 4OQ0A 4UA7A 3BM6A 5KSHA 5L2FA 4E3IA 3DTMA 1SDEA 1TDGA 2VGKA 2DCFA 2R9XA 3LY4A 4GNUA 4R3BA 2WGWA 5DF9A 5EPHA 5FSRA 5F82A 3IXHA 1W79A 3IWOA 3Q81A 4L0LA 4S2KA 4EUZA 4IBXA 3HLGA 4IBRA 4RYEA 2H5SA 5CRFA 5TR7A 5BOHA 3WS5A 1NXYA 4LCMA 1HVBA 4HESA 1YLZA 2ZMAA 1IYOA 5CGSA
chains in the Genus database with same CATH superfamily
3JVUA 3BFGA 4KQQA 1TD5A 4WBGA 3UNWA 2Y2GA 1V9ZA 4HQAA 2O0YA 4S2IA 1S1ZA 4O01A 3RFBA 4XT2B 2ACGA 2QJ5A 2NUTC 4PHTA 1PYYA 2PHYA 3FPVA 2K7SA 3GR2A 3T4QA 3W4QA 5J4EA 4EXOA 1JTDA 3HL9A 4AFIA 2AVXA 3R4KA 3T4SA 2ZQDA 2INWA 4WL9A 4IUKA 1Y28A 2YKHA 5A90A 3R7WA 2WAFA 1DP8A 1G6AA 4GHIB 2A24A 1F2KA 1H8MA 3MXRA 3VP0A 4KZ5A 2Y2OA 2WKEA 3CI6A 3HVFA 4LENA 4ARZB 1IFQA 3RXWA 4JXSA 1VHMA 4ZJ1A 3NBLA 5G4ZA 3BECA 3C8CA 4Y0OA 4Y0UA 2FFFB 1FR1A 2QJ7A 3O86A 1BSGA 3LR0A 3KSGA 3MBZA 3BQ8A 1N4OA 3NDGA 2XD1A 3HLFA 3B47A 3TG9A 5HDSA 3FYZA 4R3JA 4FOFA 1NYYA 2L0WA 2VA0A 4CLCD 2FZ0A 1DJCA 2B02A 2Y2KA 3NC8A 5AVEA 1ALQA 4L9FA 1STZA 2VKSA 2VEAA 3N8RA 1NLYA 3S7PA 4B4ZA 5CTNA 1BYWA 3EGXC 1AWIA 2UWXA 1LSWA 2V1AA 4JF6A 5CHJA 2NUPC 5GLAA 2M7VA 4HI4A 2V20A 3AGDA 5HL1A 5HDCA 3LIBA 3P7NA 4E3JA 3BFEA 1ZKJA 1SDNA 3L9KA 3CITA 4MLLA 4UQIS 4U0XA 2IWDA 3BFDA 3OCLA 3NY4A 2PT7A 3ZYTA 4Y17A 5C5KA 1ZTUA 5EVIA 3BJNA 4OPRA 3UPPA 3UPOA 5EOOA 1YSPA 4WYYA 1OJGA 3ZNTA 4KUKA 3T1SA 4N9KA 4WEKA 1V9YA 3PBOA 3VV4A 1GSWA 2PAVP 5M19A 4GD6A 1K56D 3HREA 4JKTA 1SKOB 2P04A 5I5LA 3QP6A 3DWZA 3U2AA 1BTLA 1ES4A 3G6OA 1P9WA 3S7OA 2Y55A 5LBRA 3V67A 3BFCA 3LI9A 2EFXA 4MMNA 4ID4A 4KG5A 3VP2A 3IXDA 4EW7A 1XA7A 5CX7A 3IH8A 1MKMA 1UGUA 1ERMA 4GD8A 4Y3IA 2B5RA 3GRJA 2IWCA 2OLUA 1GHMA 5HD3A 1BLPA 2LB9A 1IKGA 3VFHA 1LL8A 5TJJA 3MR0A 4D60A 4Y0TA 2H28A 3IH9A 3IXBA 2OV5A 3IF6C 2HP5A 2QWSA 2D01A 1MZUA 2O9AA 3OC2A 4HBUA 5EV0A 2IWBA 1ZG4A 2RL3A 3DTEA 4EETB 2HF6A 5HAQA 4I38A 1PI5A 1MY8A 1KVMA 4XXRA 4NG2A 3PTEA 2ZMVA 3NCKA 4QY5A 2HP6A 3D72A 4X68A 2Y2QA 1ES2A 1XX2A 4LLOB 3W4PA 4ZAMA 3HUNA 4S2JA 2VGLS 2OWHA 1DRMA 3UPNA 3VOLA 3CPTB 1PZOA 1NJ4A 1W8QA 1IYPA 3QP4A 3F1PA 4FTXA 1CEGA 3ZFZA 1Z6FA 1NZUA 4OP8A 4GCZA 2HJ9C 1OT9A 2R9WA 3OZHA 3A3FA 3N6IA 2PYRA 3C5AA 1GCEA 1S4RA 1LSVA 4HJ6A 2I72A 5FQJA 2JKGA 1E25A 1VB6A 4Y2FA 2OSUA 1YKDA 2PR6A 2ZQ7A 4F94A 3UB7A 4N1XA 2C6WB 3MZEA 1PWGA 1Q2QA 1BLCA 4WUJA 4R0QA 4ESPA 1JNUA 2HPBA 3SS3A 4BBTA 2PRFA 4ZJ3A 4OPYA 2V1BA 3MKFA 1YM1A 3ICYA 3PBQA 1BULA 4C3QA 5GLDA 3ITAA 4PM9A 3UMEA 2ZL1A 3LICA 3F1OB 2DRWA 4KQOA 1T1AA 2C5WB 5EM1A 2MJ6A 1NY0A 2LB5A 3SH8A 4YWZA 1W5DA 4KZ9A 3SS5A 2VLGA 2WGVA 5GHXA 4PMAA 4JXVA 2OAP1 3CUEA 5JYOA 5AQ7A 3VOZA 3IF5A 4KZ6A 3S1YA 4D2OA 3UE1A 1ZHHB 3HUOA 1UWNX 3MQ0A 3ZNYA 3LYXA 1S0WA 5AVFA 3ZCZA 5EVIB 4HP4A 3QHYA 4X69A 3ZQ5A 2Y91A 4CLCA 4NETA 3CMZA 1YQSA 2FH5A 4E6WA 2EX6A 3DWKA 3ULFA 1GSXA 2W1TB 5L09A 4HIAA 4H6JB 4KQRA 3Q1FA 3VSLA 5HX9A 4BLMA 4GJ4A 4LFUA 4BWIA 1W7FA 1VM1A 2V8CA 4OQHA 2WKPA 5HW3A 5DFYA 2VGKA 2DCFA 4UEYA 2WGWA 5DJUA 3A0VA 1W79A 3Q81A 2QHKA 3UB6A 3HLGA 5F5YA 3GDIA 4IHQA 3R7WB 4I39A 3PBRA 5CERA 2GJ3A 3ITBA 1E3UD 1PNEA 2J9OA 2WGIA 2ZD8A 2KX6A 1K57C 1P97A 1G6OA 1F98A 3G2ZA 3A0RA 4DXCA 4S2NC 1OJ5A 3G34A 3MS6A 1L2SA 4II7A 4BENA 5HSQA 3IF6B 4PAUA 2W3HA 5FQMA 2V9AA 4GOGA 1OPXA 4X6TA 2WADA 1PW8A 3LY3A 1JWPA 2PD8A 1L0DA 2EXBA 5DF7A 5G4YA 3MXSA 4P6ZS 5CTMA 4JGRA 5HAIA 2J3TD 1K55A 1OTDA 2D02A 3V39A 2Q9MA 3HLWA 5K5BA 4WMCD 1DJAA 3ISGA 4JXGA 3FKWA 4DJ3A 3D4FA 4KZ4A 2EX8A 4KZ3A 4YNRA 5FASA 5CHMA 3U4LP 4R1GA 3L7HA 1U60A 3HLCA 1O7EA 3E4PA 3QP5A 2ZMFA 3HCYA 3JPUA 2PR5A 5KSCA 4LRZE 4KUOA 1D7EA 4GB7A 1S67L 4BD0A 3P09A 5TFQA 1N9BA 4R4RA 2WK0A 3LEZA 4ZRRA 3UB8A 2ZM8A 5AQBA 5EVEA 3Q82A 1TF1A 4EQ1A 5EVIC 2O99A 1OT6A 4R38A 4B4XA 2XD5A 3DTIA 3PAEA 4B88A 4DXBA 1ZC2A 3N7WA 3LGOA 5FDHA 4LRYC 5GHYA 1X0OA 2ZL1B 2ZQAA 4MBKA 5L07A 3RJUA 1CI9A 1S4SA 4OONA 3HLEA 2XR0A 5E2GA 2W0NA 3G35A 2GX5A 2J7VA 3MFDA 3HLDA 3A3IA 3QP8A 4H8RA 2RCXA 1NRFA 2QZ6A 3EQVA 2ZM2A 3KSHA 1BT5A 2CMNA 1XJ3A 4N1HA 2A24B 4EEPA 3N8SA 1KOUA 5AQAA 1UWPX 5J8XA 4P0MA 3CG5A 2JKRI 4OH0A 2ZC4B 2QYBA 2HDRA 5L8MA 3T4TA 3WRTA 4H6JA 1TS6A 2UV0E 3OPRA 4OVDA 4DE3A 2ZM0A 4EV4A 3V3SA 3BY9A 1MWRA 2WGWB 4R70A 3M6BA 3QNCA 3NIAA 3CPTA 3VOYA 1XA1A 2JKRM 4Q0HA 4UAAA 3TW8A 4K08A 2WZZA 3ZDJA 1K55C 5EVID 4Y7PA 2ZJ9A 3MFXA 3EEHA 1SKFA 3IF6A 4JPMA 2ZOIA 2E8JA 4N9LA 3SOIA 1RCJA 2B18A 1HTZA 4JGQA 4OP5A 4EUVA 3H7WA 4MEZA 4WM9A 2A2LA 3IS2B 4BBUA 1YLJA 5FDSA 1WA9A 3UN7A 1VEUA 1N9OA 3UB5P 4HNBA 4DN0A 4JF5A 2ZOHA 5CGWA 5F83A 3VP3A 5F69A 3JYIA 1TS0A 2WUQA 2V0WA 2Y2PA 4YOFA 2W3FA 4CLCC 4ZDXA 5DJTA 2JC7A 1L0FA 2HDUA 4GDNA 1XGJA 3CZDA 3S7NA 3NULA 3VFFA 5MC7A 3ZG5A 2ZQ9A 5M1AA 5DTSA 1RGYA 3F1NA 5JYPA 1F5MA 1FQGA 3FC7A 5FQKA 2VGJA 3VP4A 3O3VA 1HLUP 4DMZA 3PHYA 3GQZA 4WMCA 4C75A 5DTKA 1MBLA 4IUHA 4MN5A 5A91A 5CECA 4ARZA 3EOIA 3KX0X 3HUMA 3RXXA 3PBSA 3T50A 1ES5A 3SH7A 2W1TA 1SHVA 4PKYG 3NOPC 2ZC6B 2OLVA 3E98A 5HWWA 1E3UA 3MQQA 5CEDA 5HPFA 1YSQA 2EA9A 3CJMA 5FEFA 2EWWA 3EEAA 3ZG7B 5DKKA 1I2WA 2Y2HA 3TOIA 4P6ZM 3E2KA 2K2NA 2Y2IA 3GVBA 2QPNA 5IT5A 1JVJA 5CXWA 4EWFA 1W63M 4LV1A 3MF0A 4M3KA 4KZBA 3IHBA 3F1PB 5GL9A 4Z9QA 1Z09A 3C4PA 2BG1A 1W8YA 1XJ2A 1XPBA 3UE0A 1OMEA 4FSFA 4DDSA 4X55A 2WKIA 2KOIA 4RVAA 2V0UA 5KMWA 3ZG8B 5A92A 3BM6A 5KSHA 3DTMA 1SDEA 4R3BA 2R9XA 5DF9A 5FSRA 3IWOA 5DKLA 4IBRA 3CUEC 4HESA 4B9OA 2ZMAA 4QHCA 5DVAA 4WEJA 5HL6A 2XSSA 4HY8A 2W3DA 3G31A 3DBAA 3QNBA 3I7JA 2Y2NA 3AGEA 5FAQA 3B42A 2JBFA 1MKIA 3PBNA 2JKFA 1NZOA 3EGDC 2PDRA 3IXGA 3WWXA 1YLPA 3LIDA 2GDNA 1T18A 1XJ6A 2VV8A 5HD5A 3EQUA 2ZC3B 1FOFA 2XQZA 3SW1A 1LI9A 2V2FF 4BJPA 1GA9A 4KZAA 4G3KA 3VE4A 4LV0A 1YMXA 3H82A 3FV7A 3OOVA 3S22A 3H7WB 2DMWA 3A3EA 4S2OA 1HZOA 1BUEA 2XA7S 4HHDA 2W3GA 1PIOA 4GLQA 3VP1A 4JGPA 3WS2A 2G2WA 3KO6A 4OQIA 4IVIA 4KZ7A 1CJFA 2ZLYA 5FQIA 2JHEA 2Y2LA 1KE4A 5HDDA 5FAPA 3IX3A 1MWUA 3IBJA 2ZBBA 4Y15A 4MCWA 3E2LA 3ZGAB 4YINA 3T1XA 3V5MA 1O07A 5HAPA 3F1NB 2GZAA 4BL3A 3Q07A 4OQGA 4G3VA 4HJ3A 1FCOA 4JGOA 3OPLA 1P0ZA 4ETXA 5CEBA 5TBMB 1NRJA 2HGVA 4DDYA 4X56A 5HFOA 4Q8IA 4GW9A 4I3IA 3MZFA 3LFVA 3W2ZA 3A3JA 3RH8B 4C6YA 2J3WA 1NWZA 4XUZA 4WLAA 2EWVA 3O5YA 2A49A 1N9NA 3BW6A 3LIEA 5TGFA 5E2EA 3OPHA 4O0PA 4MDZA 1YAXA 4XT2A 4HP9A 2Z6DA 1WE4A 3IHAA 1H3QA 2EX9A 1K4EA 3T1QB 4S2PA 4E3LA 1W63Q 3QP2A 4YFMA 4PKYA 5M18A 1FSYA 4K91A 3F1OA 3SZTA 3E4OA 5FL3A 3BFFA 1QMEA 2X71A 5EVLA 5HARA 3SH9A 2Z6CA 1SZVA 1CK3A 4Q0JA 4HBTA 1JWVA 3BQAA 4JBFA 2XROA 3EWKA 3AGFA 2ZC7A 1KGEA 3UE3A 1KDWA 4DE1A 1PWCA 3M2KA 1CQAA 4S2MA 1OTEA 2Y79A 5F1GA 1K6SA 2VV6A 5A93A 2ZC5B 5FATA 3MXQA 4EBLA 1Y4OA 2EXAA 2WZXA 3NECA 1J3WA 1FCMA 1MXOA 2XF3A 2PD7A 3S7QA 2JN7A 5EUAA 1OTBA 4WELA 2WKQA 3T12B 1S66L 2Z2MB 3BWLA 4HOIA 3C7VA 1BLSA 3HLBA 2CC1A 5U47A 1YLTA 3WS0A 3HJKA 4LV2A 4E6XA 1NYMA 4ZBEA 1P9RA 4MNRA 4CJNA 1GHIA 1LHYA 4WF0A 4BQMA 1OTAA 4P85A 2L4RA 1XP4A 5CGXA 1SCWA 1IOUA 3GECA 3OCNA 2XGNA 2H10A 4DRTA 5E2HA 3CWFA 1VQQA 2V1ZA 3IX4A 1TVFA 3BEBA 1T1BA 5EE8A 1L0EA 3FG8A 1YLWA 2L1MA 4EBPA 2Y2JA 3LO7A 1FILA 1CI8A 3KSFA 4F3LB 1K6RA 1VETB 5D3OA 2Q9NA 1YPRA 4JLFA 4X1MA 1FIKA 2Y8HA 4PPRA 3Q7VB 2YKFA 5AJGA 3UY6A 4HJ4A 2PYPA 2VZWA 2K31A 1G5UA 1H0MA 2VK3A 4CPKA 2PU4A 2XH9A 3NOTC 3ZVWA 4OPQA 3KSIA 4FH4A 1K54A 3ZG9B 4OLDA 3D9YA 4E04A 5EECA 2GNXA 4E3OA 3W4OA 2X01A 4GS9A 3K3DA 3WRZA 5FI6A 3G30A 2G7UA 4G3WA 4BMWA 5E2FA 5DFXA 2W27A 4M4XA 3E0YA 2B95A 3M6HA 4UHUA 2P9VB 3V50A 5E43A 2BTFP 3NDEA 5TBMA 4ZTKA 1YMSA 4WZ5A 2VGLM 3UDFA 3UDIA 4JXWA 1EROA 5GLCA 1L3LA 1XGIA 3DAVA 3LIFA 4Z1WA 1XKZA 4RX2A 2J80A 4EU0A 3B3XA 3PYPA 1PW1A 4S2NA 1PZPA 2M7UA 1ACFA 4QU3A 4E3MA 4NXBA 2HZ5A 3G32A 3KYEA 1G68A 4P87A 3MQOA 3OPPA 4WZ5C 4EQIA 3NOUC 2EX2A 5FEGA 1G28A 3FZCA 3O87A 4MBHA 2KLIA 4Q0IA 1PI4A 4DE2A 3DTKA 3ZVTA 5J3WA 1IEMA 1MPLA 3P01A 1E4DA 4IEDA 1LT0A 4ETZA 4I3AA 2BLSA 4GKUA 2VV7A 5L2FA 4E3IA 1TDGA 3RTYA 5EPHA 5F82A 3IXHA 4EUZA 4L9EA 1EW0A 3KYQA 2H5SA 5HZHA 5BOHA 3WS5A 1NXYA 1HVBA 3PR6A 4HH3A 4PM5A 4EBNA 4L9GA 5F6AA 1D1JA 1KDSA 3C2WA 3VSKA 5DTTA 1K54C 4OOLA 2X02A 2Y2MA 1K25A 1RP5A 4U0TA 3C7UA 1MC0A 3CHWP 3K2NA 3UMDA 4DF6A 1DJBA 4Y13A 1Q2PA 2XDMA 4EEUA 4O8GA 4IVKA 3NI9A 1ONGA 5GLBA 1H5XA 1CEFA 3PBTA 1WYBA 1ONHA 2XA7M 3PXPA 5CHUA 1BLHA 1LL5A 1K56A 1H8YA 5L10A 3HBRA 4S2LA 4LRXC 1KGGA 2XEPA 4E3NA 2W1RA 1BZAA 1LL9A 4X53A 3TSGA 5GHZA 1TS7A 2HDSA 4PM6A 4DJ2A 4OOMA 3IQAA 2XK1A 4P6BA 4K0WA 3GMWA 3C4OA 3T4LA 2QMIA 1NLZA 1FSWA 3A3DA 1HD8A 5F1FA 3BY8A 3N8LA 4OOYA 2J3TC 2HDQA 4UA9A 4LV3A 3S4XA 4CLCE 1K57A 4GZBA 3TE8A 2Q0OA 1YLYA 1I2SA 3IWIA 4RQ9A 1I5QA 4CLCB 4IJGA 3Q7ZA 3FKVA 3LR5A 2E8IA 5IS1A 2KDKA 3LCEA 2XFTA 4XUXA 2P08A 4PM7A 1PRQA 3G4PA 3WS1A 4EESA 3UB9A 1PFLA 5A8BA 4NXEA 2BASA 2HV1A 3BLSA 3UO9A 3ZHHA 1H8ZA 1XFNA 1DP9A 4CQHA 1WYCA 4GS9B 1GA0A 4WZ4A 1ERQA 4PM8A 1T1CA 3QP1A 3JVVA 1M6KA 1YT4A 1JWZA 2JKTI 2P9VA 5KZHA 4KENB 4RX3A 1XJ4A 4BD1A 4UA6A 3N4IA 4U3TA 5AQ9A 2J8YA 2JE5A 4QD4A 5FA7A 3MKEA 1K38A 3LI8A 5EM0A 3M2JA 3WS4A 3SS4A 4N92A 2PBDP 2O9BA 3FWLA 4X1LA 1PWDA 1C3BA 1K4FA 3BRMA 3H82B 5KIZA 5FQQA 2A3UA 5FI7A 4R3AA 4LPZA 3LR3A 5I94A 3V3RA 3D3OA 3C38A 2H0YA 1FR6A 1OTIA 1Y54A 2V8FA 4R6LA 3CLOA 4HEFA 5HWVA 3NJAA 1TS8A 4X25A 2W3EA 4QWOA 1AXBA 4GDBA 3GV9A 5EFWA 3T1RA 1LSXA 3TJZC 1GSVA 3W8KA 4FD8A 2G2UA 4I5SA 4KG6A 1J9MA 4WN5A 3HJIA 2M1CA 3OBFA 4NK3A 2Y4AA 1IYSA 1MWSA 2DNSA 3C30A 4NXGA 2OWJA 1ESUA 5G18A 3T4JA 3BLMA 2HJEA 2VJWA 4F3LA 2OAQ1 3UE6A 3BYDA 1KVLA 4R23A 4GHIA 2WYXA 5FI2A 3B33A 3Q7VA 3GTCA 3IX8A 3VMAA 5IHVA 1TDLA 5F68A 4HH2A 4JF4A 2WAEA 4QPRA 5J7EA 1XFQA 4MN6A 1EI5A 2HP9A 4K0XA 4MN7A 4DE0A 5FAOA 3LIAA 4R4SA 2H0TA 1MWTA 2R78A 2Z2LB 2IA2A 4O7DA 4KZ8A 1FCNA 2Y59A 4QB8A 5EOEA 5HWTA 1ESIA 4UQIM 3TRCA 1RGZA 3CAXA 4EERA 4NXFA 3IBRA 3ZG0A 2PU2A 3K3CA 1TEMA 2VX8A 1M40A 4E3KA 4RA7A 4BL2A 4OLGA 4NKPA 1IKIA 3G2YA 4FUWA 4OPZA 1EWZA 3KYZA 1GHPA 5FQ9A 3H9WA 2EFUA 4LCLA 3O88A 1L0GA 3E4QA 1KGFA 4QY6A 4A5RA 3UDXA 3IWQA 1D06A 4LGWA 4BBVA 3T4KA 4B93A 4QJGA 4I3JA 1KE3A 3P98A 4MBFA 1DY6A 1LI0A 2I9VA 1KE0A 2XRNA 3GSGA 4FH2A 4DKIA 3NHQA 1CF0A 5DF8A 2ZQ8A 2QKPA 2XFSA 1ZG6A 1QMFA 1ES3A 3FPWA 3LUQA 4Y5FA 2XLNA 1SKOA 3T4OA 4KG2A 3MSHA 1DP6A 4OKPA 3VE3A 2FFYA 3OLOA 1JTGA 1S1YA 2O9CA 4NEED 1IELA 3MJQA 3PAGA 3DW0A 2WKHA 2P7JA 2J9PA 4GN2A 5HPIA 1T19A 3MZDA 4ZJ2A 5IU1A 1ODVA 2ZQCA 2JCHA 1IYQA 2P74A 1XXMA 2OOLA 2PBYA 4FCFA 3A0SA 3MMHA 1VETA 1LLBA 1A0KA 3IT9A 1S6RA 4OQ0A 4UA7A 4GNUA 1N9LA 3LY4A 3IS2A 1F9IA 4L0LA 4S2KA 3LEQA 2JKTM 4KQDA 1VEUB 4IBXA 3LR4A 4RYEA 5CRFA 5TR7A 1K0KA 2WKRA 4ME4A 4LCMA 1YLZA 1IYOA 5CGSA
chains in the Genus database with same CATH topology
3PBRA 4QHCA 5CERA 4PM5A 5DVAA 3ITBA 4WEJA 4EBNA 3BFGA 1E3UD 4KQQA 4WBGA 2J9OA 3UNWA 2Y2GA 2WGIA 2ZD8A 1K57C 1KDSA 3G2ZA 3VSKA 3G31A 4S2IA 5DTTA 1K54C 4DXCA 4OOLA 3QNBA 3I7JA 2X02A 2Y2MA 2Y2NA 1K25A 1RP5A 3G34A 4S2NC 1L2SA 3AGEA 4BENA 3IF6B 4U0TA 5FQMA 3C7UA 4GOGA 1PYYA 5FAQA 4DF6A 1DJBA 1Q2PA 2JBFA 2XDMA 3GR2A 4X6TA 3W4QA 2WADA 1PW8A 4IVKA 3LY3A 1JWPA 3NI9A 1MKIA 1ONGA 3PBNA 1H5XA 1JTDA 1CEFA 1L0DA 3HL9A 5GLBA 1NZOA 2EXBA 3PBTA 1WYBA 5DF7A 1ONHA 2ZQDA 5CHUA 3IXGA 3WWXA 1YLPA 1BLHA 1LL5A 1K56A 1H8YA 2GDNA 3MXSA 5A90A 2WAFA 3HBRA 4S2LA 1KGGA 2ZC3B 3EQUA 2XEPA 5CTMA 1FOFA 1G6AA 2XQZA 4E3NA 3MXRA 5HAIA 3VP0A 1BZAA 4KZ5A 1LL9A 2Y2OA 2WKEA 1LI9A 2V2FF 1K55A 3HVFA 4LENA 3V39A 2Q9MA 3HLWA 3RXWA 4JXSA 4BJPA 4X53A 4WMCD 1GA9A 4KZAA 1DJAA 4ZJ1A 3TSGA 4LV0A 1YMXA 5GHZA 3ISGA 3NBLA 4JXGA 2HDSA 3FKWA 3FV7A 3BECA 4Y0OA 4Y0UA 4PM6A 3S22A 3D4FA 4KZ4A 2FFFB 2EX8A 4KZ3A 3A3EA 1FR1A 4OOMA 5FASA 5CHMA 3IQAA 4S2OA 2XK1A 1HZOA 4P6BA 4K0WA 3O86A 3GMWA 1BUEA 4R1GA 3C4OA 1BSGA 2QMIA 1FSWA 3A3DA 1U60A 1HD8A 3HLCA 1O7EA 3MBZA 1PIOA 3VP1A 1N4OA 3NDGA 2G2WA 3WS2A 5F1FA 4OQIA 3N8LA 2XD1A 5KSCA 4OOYA 2HDQA 3HLFA 4GB7A 4IVIA 4UA9A 4KZ7A 3TG9A 4LV3A 4BD0A 3S4XA 3FYZA 4R3JA 1K57A 3P09A 5TFQA 4GZBA 1NYYA 2ZLYA 5FQIA 1N9BA 1DJCA 2Y2LA 1KE4A 4R4RA 5FAPA 2WK0A 2Y2KA 3NC8A 1I2SA 1YLYA 3LEZA 1MWUA 1ALQA 3IWIA 1I5QA 3Q7ZA 2ZM8A 3FKVA 3N8RA 5AQBA 2E8IA 3E2LA 3LCEA 2XFTA 3Q82A 4YINA 3ZGAB 4XUXA 4B4ZA 5CTNA 3V5MA 2UWXA 4PM7A 1O07A 3G4PA 5HAPA 5EVIC 4JF6A 5CHJA 3WS1A 5GLAA 4B4XA 2V20A 3Q07A 4BL3A 2XD5A 3AGDA 3PAEA 4OQGA 3BLSA 3UO9A 3ZHHA 5HL1A 1H8ZA 4B88A 1FCOA 4DXBA 1WYCA 1ZC2A 3OPLA 4E3JA 3BFEA 3N7WA 1ZKJA 1SDNA 5FDHA 5CEBA 5GHYA 1GA0A 4WZ4A 1ERQA 4MLLA 4PM8A 4DDYA 2ZQAA 4MBKA 3RJUA 4X56A 1CI9A 4U0XA 2IWDA 5HFOA 3BFDA 4Q8IA 3OCLA 3NY4A 3MZFA 4OONA 1M6KA 3HLEA 1YT4A 3A3JA 1JWZA 2XR0A 5E2GA 5EVIA 4OPRA 4C6YA 3UPPA 3UPOA 5EOOA 3G35A 4XUZA 2P9VA 2J7VA 4WYYA 3MFDA 3ZNTA 5KZHA 4N9KA 4WEKA 2A49A 3HLDA 3PBOA 3A3IA 4KENB 4H8RA 4RX3A 4BD1A 4UA6A 2RCXA 5TGFA 3N4IA 5E2EA 5M19A 4U3TA 5AQ9A 2J8YA 2JE5A 3OPHA 4QD4A 1NRFA 2QZ6A 5FA7A 4GD6A 1K56D 3EQVA 3HREA 4JKTA 2ZM2A 3MKEA 3DWZA 1WE4A 1K38A 1BTLA 1BT5A 1ES4A 3IHAA 4N1HA 2EX9A 1K4EA 3M2JA 3WS4A 3N8SA 4N92A 4S2PA 2Y55A 3SS4A 5AQAA 3FWLA 4E3LA 1PWDA 4YFMA 3BFCA 5J8XA 1C3BA 1K4FA 3BRMA 4P0MA 2EFXA 5M18A 5FQQA 4ID4A 3CG5A 1FSYA 2A3UA 4KG5A 3VP2A 3IXDA 4OH0A 5FI7A 4K91A 1XA7A 2ZC4B 3IH8A 2HDRA 5I94A 1ERMA 4GD8A 3BFFA 3V3RA 3WRTA 1QMEA 2X71A 5EVLA 2H0YA 2B5RA 3GRJA 3OPRA 5HARA 3SH9A 1FR6A 2IWCA 1CK3A 2OLUA 1Y54A 4OVDA 1GHMA 4HBTA 1JWVA 4DE3A 1BLPA 2ZM0A 4HEFA 4JBFA 1IKGA 3AGFA 3VFHA 2ZC7A 1KGEA 3UE3A 1KDWA 4EV4A 3V3SA 4DE1A 1MWRA 1PWCA 1AXBA 3M2KA 4GDBA 3GV9A 2WGWB 4S2MA 4Y0TA 5F1GA 1K6SA 3IH9A 3IXBA 2OV5A 3IF6C 2HP5A 2ZC5B 5FATA 4FD8A 2G2UA 3W8KA 5A93A 4EBLA 3M6BA 2EXAA 2WZXA 3QNCA 4KG6A 3NIAA 3OC2A 3VOYA 1XA1A 4HBUA 1FCMA 1J9MA 2IWBA 1MXOA 1ZG4A 2XF3A 4NK3A 2Y4AA 4UAAA 1IYSA 1MWSA 5EUAA 2DNSA 2RL3A 2WZZA 4WELA 3ZDJA 1K55C 2Z2MB 5HAQA 1PI5A 1MY8A 1KVMA 5EVID 1ESUA 3C7VA 4Y7PA 1BLSA 5G18A 3HLBA 2CC1A 4XXRA 3PTEA 5U47A 1YLTA 2ZJ9A 3WS0A 3BLMA 4LV2A 4E6XA 3NCKA 1NYMA 4QY5A 4ZBEA 1SKFA 4MNRA 2HP6A 3BYDA 3IF6A 1KVLA 4CJNA 4R23A 4X68A 4JPMA 2WYXA 1GHIA 1ES2A 1XX2A 1LHYA 2Y2QA 4N9LA 3SOIA 1RCJA 5FI2A 3W4PA 1HTZA 4BQMA 4ZAMA 3HUNA 3GTCA 3Q7VA 4OP5A 4S2JA 3VMAA 4P85A 5IHVA 1TDLA 1XP4A 3UPNA 4MEZA 4WM9A 5CGXA 1SCWA 3OCNA 1PZOA 1NJ4A 2XGNA 4JF4A 2H10A 1W8QA 1IYPA 4DRTA 2WAEA 5E2HA 1VQQA 1YLJA 2V1ZA 1TVFA 3BEBA 1CEGA 3UN7A 1EI5A 2HP9A 4K0XA 5EE8A 3ZFZA 4DE0A 1Z6FA 1NZUA 4OP8A 5FAOA 1L0EA 1YLWA 4JF5A 4R4SA 2H0TA 5CGWA 5F83A 3VP3A 2Y2JA 1MWTA 2Z2LB 3LO7A 4EBPA 1CI8A 4O7DA 3JYIA 4KZ8A 1FCNA 2Y59A 2R9WA 3OZHA 1K6RA 3A3FA 4QB8A 5D3OA 3N6IA 5EOEA 3C5AA 2WUQA 1ESIA 1GCEA 2Y2PA 4ZDXA 1RGZA 2Q9NA 2I72A 4JLFA 2JC7A 5FQJA 1E25A 1L0FA 2HDUA 4PPRA 4GDNA 2OSUA 3Q7VB 3ZG0A 2PU2A 1XGJA 3CZDA 3UY6A 1TEMA 1M40A 3VFFA 2ZQ7A 4E3KA 4F94A 4RA7A 3ZG5A 4N1XA 2C6WB 3MZEA 1PWGA 1Q2QA 4BL2A 1BLCA 2ZQ9A 4OLGA 5DTSA 5M1AA 4R0QA 1RGYA 4CPKA 2PU4A 2XH9A 3ZVWA 5JYPA 4OPQA 1FQGA 2HPBA 3SS3A 4FH4A 1IKIA 1K54A 3ZG9B 3G2YA 4OLDA 5FQKA 4ZJ3A 4OPYA 2VGJA 5EECA 3VP4A 4OPZA 1EWZA 3MKFA 3O3VA 1GHPA 1YM1A 5FQ9A 3W4OA 4E3OA 3PBQA 3GQZA 1BULA 4C3QA 2X01A 4WMCA 5GLDA 5DTKA 2EFUA 4C75A 4LCLA 3ITAA 3O88A 4PM9A 1L0GA 3WRZA 5FI6A 1MBLA 1KGFA 4QY6A 4A5RA 3G30A 2DRWA 4KQOA 2C5WB 5A91A 5CECA 5E2FA 1NY0A 3UDXA 3IWQA 3SH8A 3M6HA 4QJGA 1W5DA 3HUMA 4KZ9A 3SS5A 1KE3A 3P98A 3PBSA 4MBFA 1DY6A 1ES5A 3RXXA 3SH7A 2WGVA 5GHXA 1LI0A 4PMAA 4UHUA 1KE0A 1SHVA 2P9VB 4JXVA 3V50A 5E43A 3GSGA 4FH2A 5JYOA 5AQ7A 4DKIA 5DF8A 3VOZA 2ZC6B 2ZQ8A 3IF5A 2OLVA 3NDEA 4KZ6A 1E3UA 2XFSA 1ZG6A 3S1YA 4D2OA 5CEDA 4ZTKA 1YMSA 4WZ5A 1QMFA 3UE1A 1ES3A 3HUOA 3UDFA 4JXWA 3UDIA 1EROA 3CJMA 5GLCA 1S0WA 3ZNYA 1XGIA 2XLNA 1XKZA 4RX2A 3B3XA 3ZG7B 1PW1A 4KG2A 4S2NA 3ZCZA 5EVIB 4OKPA 1I2WA 1PZPA 3QHYA 2FFYA 4QU3A 4X69A 2Y91A 1JTGA 2Y2HA 4E3MA 3TOIA 4NETA 3CMZA 3G32A 1IELA 1YQSA 3PAGA 1G68A 4P87A 3DW0A 3E2KA 3OPPA 2WKHA 4WZ5C 2J9PA 2Y2IA 4GN2A 3GVBA 2QPNA 4E6WA 4EQIA 1JVJA 5CXWA 2EX6A 4EWFA 3DWKA 4LV1A 2EX2A 4M3KA 4KZBA 3MZDA 4ZJ2A 3FZCA 3IHBA 3O87A 2ZQCA 2JCHA 4MBHA 4Z9QA 5GL9A 1IYQA 3C4PA 4KQRA 3Q1FA 2BG1A 2P74A 1W8YA 5HX9A 1PI4A 3VSLA 1XPBA 3UE0A 4DE2A 1XXMA 1OMEA 3ZVTA 4BLMA 2PBYA 4FSFA 4FCFA 1IEMA 4DDSA 1MPLA 4X55A 2WKIA 1E4DA 4IEDA 4RVAA 5KMWA 3ZG8B 1W7FA 1LLBA 1VM1A 2BLSA 3IT9A 4OQHA 4GKUA 5HW3A 5A92A 1S6RA 4OQ0A 4UA7A 3BM6A 5KSHA 5L2FA 4E3IA 3DTMA 1SDEA 1TDGA 2VGKA 2DCFA 2R9XA 3LY4A 4GNUA 4R3BA 2WGWA 5DF9A 5EPHA 5FSRA 5F82A 3IXHA 1W79A 3IWOA 3Q81A 4L0LA 4S2KA 4EUZA 4IBXA 3HLGA 4IBRA 4RYEA 2H5SA 5CRFA 5TR7A 5BOHA 3WS5A 1NXYA 4LCMA 1HVBA 4HESA 1YLZA 2ZMAA 1IYOA 5CGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PBR A;  4QHC A;  5CER A;  4PM5 A;  5DVA A;  3ITB A;  4WEJ A;  4EBN A;  3BFG A;  1E3U D;  4KQQ A;  4WBG A;  2J9O A;  3UNW A;  2Y2G A;  2WGI A;  2ZD8 A;  1K57 C;  1KDS A;  3G2Z A;  3VSK A;  3G31 A;  4S2I A;  5DTT A;  1K54 C;  4DXC A;  4OOL A;  3QNB A;  3I7J A;  2X02 A;  2Y2M A;  2Y2N A;  1K25 A;  1RP5 A;  3G34 A;  4S2N C;  1L2S A;  3AGE A;  4BEN A;  3IF6 B;  4U0T A;  5FQM A;  3C7U A;  4GOG A;  1PYY A;  5FAQ A;  4DF6 A;  1DJB A;  1Q2P A;  2JBF A;  2XDM A;  3GR2 A;  4X6T A;  3W4Q A;  2WAD A;  1PW8 A;  4IVK A;  3LY3 A;  1JWP A;  3NI9 A;  1MKI A;  1ONG A;  3PBN A;  1H5X A;  1JTD A;  1CEF A;  1L0D A;  3HL9 A;  5GLB A;  1NZO A;  2EXB A;  3PBT A;  1WYB A;  5DF7 A;  1ONH A;  2ZQD A;  5CHU A;  3IXG A;  3WWX A;  1YLP A;  1BLH A;  1LL5 A;  1K56 A;  1H8Y A;  2GDN A;  3MXS A;  5A90 A;  2WAF A;  3HBR A;  4S2L A;  1KGG A;  2ZC3 B;  3EQU A;  2XEP A;  5CTM A;  1FOF A;  1G6A A;  2XQZ A;  4E3N A;  3MXR A;  5HAI A;  3VP0 A;  1BZA A;  4KZ5 A;  1LL9 A;  2Y2O A;  2WKE A;  1LI9 A;  2V2F F;  1K55 A;  3HVF A;  4LEN A;  3V39 A;  2Q9M A;  3HLW A;  3RXW A;  4JXS A;  4BJP A;  4X53 A;  4WMC D;  1GA9 A;  4KZA A;  1DJA A;  4ZJ1 A;  3TSG A;  4LV0 A;  1YMX A;  5GHZ A;  3ISG A;  3NBL A;  4JXG A;  2HDS A;  3FKW A;  3FV7 A;  3BEC A;  4Y0O A;  4Y0U A;  4PM6 A;  3S22 A;  3D4F A;  4KZ4 A;  2FFF B;  2EX8 A;  4KZ3 A;  3A3E A;  1FR1 A;  4OOM A;  5FAS A;  5CHM A;  3IQA A;  4S2O A;  2XK1 A;  1HZO A;  4P6B A;  4K0W A;  3O86 A;  3GMW A;  1BUE A;  4R1G A;  3C4O A;  1BSG A;  2QMI A;  1FSW A;  3A3D A;  1U60 A;  1HD8 A;  3HLC A;  1O7E A;  3MBZ A;  1PIO A;  3VP1 A;  1N4O A;  3NDG A;  2G2W A;  3WS2 A;  5F1F A;  4OQI A;  3N8L A;  2XD1 A;  5KSC A;  4OOY A;  2HDQ A;  3HLF A;  4GB7 A;  4IVI A;  4UA9 A;  4KZ7 A;  3TG9 A;  4LV3 A;  4BD0 A;  3S4X A;  3FYZ A;  4R3J A;  1K57 A;  3P09 A;  5TFQ A;  4GZB A;  1NYY A;  2ZLY A;  5FQI A;  1N9B A;  1DJC A;  2Y2L A;  1KE4 A;  4R4R A;  5FAP A;  2WK0 A;  2Y2K A;  3NC8 A;  1I2S A;  1YLY A;  3LEZ A;  1MWU A;  1ALQ A;  3IWI A;  1I5Q A;  3Q7Z A;  2ZM8 A;  3FKV A;  3N8R A;  5AQB A;  2E8I A;  3E2L A;  3LCE A;  2XFT A;  3Q82 A;  4YIN A;  3ZGA B;  4XUX A;  4B4Z A;  5CTN A;  3V5M A;  2UWX A;  4PM7 A;  1O07 A;  3G4P A;  5HAP A;  5EVI C;  4JF6 A;  5CHJ A;  3WS1 A;  5GLA A;  4B4X A;  2V20 A;  3Q07 A;  4BL3 A;  2XD5 A;  3AGD A;  3PAE A;  4OQG A;  3BLS A;  3UO9 A;  3ZHH A;  5HL1 A;  1H8Z A;  4B88 A;  1FCO A;  4DXB A;  1WYC A;  1ZC2 A;  3OPL A;  4E3J A;  3BFE A;  3N7W A;  1ZKJ A;  1SDN A;  5FDH A;  5CEB A;  5GHY A;  1GA0 A;  4WZ4 A;  1ERQ A;  4MLL A;  4PM8 A;  4DDY A;  2ZQA A;  4MBK A;  3RJU A;  4X56 A;  1CI9 A;  4U0X A;  2IWD A;  5HFO A;  3BFD A;  4Q8I A;  3OCL A;  3NY4 A;  3MZF A;  4OON A;  1M6K A;  3HLE A;  1YT4 A;  3A3J A;  1JWZ A;  2XR0 A;  5E2G A;  5EVI A;  4OPR A;  4C6Y A;  3UPP A;  3UPO A;  5EOO A;  3G35 A;  4XUZ A;  2P9V A;  2J7V A;  4WYY A;  3MFD A;  3ZNT A;  5KZH A;  4N9K A;  4WEK A;  2A49 A;  3HLD A;  3PBO A;  3A3I A;  4KEN B;  4H8R A;  4RX3 A;  4BD1 A;  4UA6 A;  2RCX A;  5TGF A;  3N4I A;  5E2E A;  5M19 A;  4U3T A;  5AQ9 A;  2J8Y A;  2JE5 A;  3OPH A;  4QD4 A;  1NRF A;  2QZ6 A;  5FA7 A;  4GD6 A;  1K56 D;  3EQV A;  3HRE A;  4JKT A;  2ZM2 A;  3MKE A;  3DWZ A;  1WE4 A;  1K38 A;  1BTL A;  1BT5 A;  1ES4 A;  3IHA A;  4N1H A;  2EX9 A;  1K4E A;  3M2J A;  3WS4 A;  3N8S A;  4N92 A;  4S2P A;  2Y55 A;  3SS4 A;  5AQA A;  3FWL A;  4E3L A;  1PWD A;  4YFM A;  3BFC A;  5J8X A;  1C3B A;  1K4F A;  3BRM A;  4P0M A;  2EFX A;  5M18 A;  5FQQ A;  4ID4 A;  3CG5 A;  1FSY A;  2A3U A;  4KG5 A;  3VP2 A;  3IXD A;  4OH0 A;  5FI7 A;  4K91 A;  1XA7 A;  2ZC4 B;  3IH8 A;  2HDR A;  5I94 A;  1ERM A;  4GD8 A;  3BFF A;  3V3R A;  3WRT A;  1QME A;  2X71 A;  5EVL A;  2H0Y A;  2B5R A;  3GRJ A;  3OPR A;  5HAR A;  3SH9 A;  1FR6 A;  2IWC A;  1CK3 A;  2OLU A;  1Y54 A;  4OVD A;  1GHM A;  4HBT A;  1JWV A;  4DE3 A;  1BLP A;  2ZM0 A;  4HEF A;  4JBF A;  1IKG A;  3AGF A;  3VFH A;  2ZC7 A;  1KGE A;  3UE3 A;  1KDW A;  4EV4 A;  3V3S A;  4DE1 A;  1MWR A;  1PWC A;  1AXB A;  3M2K A;  4GDB A;  3GV9 A;  2WGW B;  4S2M A;  4Y0T A;  5F1G A;  1K6S A;  3IH9 A;  3IXB A;  2OV5 A;  3IF6 C;  2HP5 A;  2ZC5 B;  5FAT A;  4FD8 A;  2G2U A;  3W8K A;  5A93 A;  4EBL A;  3M6B A;  2EXA A;  2WZX A;  3QNC A;  4KG6 A;  3NIA A;  3OC2 A;  3VOY A;  1XA1 A;  4HBU A;  1FCM A;  1J9M A;  2IWB A;  1MXO A;  1ZG4 A;  2XF3 A;  4NK3 A;  2Y4A A;  4UAA A;  1IYS A;  1MWS A;  5EUA A;  2DNS A;  2RL3 A;  2WZZ A;  4WEL A;  3ZDJ A;  1K55 C;  2Z2M B;  5HAQ A;  1PI5 A;  1MY8 A;  1KVM A;  5EVI D;  1ESU A;  3C7V A;  4Y7P A;  1BLS A;  5G18 A;  3HLB A;  2CC1 A;  4XXR A;  3PTE A;  5U47 A;  1YLT A;  2ZJ9 A;  3WS0 A;  3BLM A;  4LV2 A;  4E6X A;  3NCK A;  1NYM A;  4QY5 A;  4ZBE A;  1SKF A;  4MNR A;  2HP6 A;  3BYD A;  3IF6 A;  1KVL A;  4CJN A;  4R23 A;  4X68 A;  4JPM A;  2WYX A;  1GHI A;  1ES2 A;  1XX2 A;  1LHY A;  2Y2Q A;  4N9L A;  3SOI A;  1RCJ A;  5FI2 A;  3W4P A;  1HTZ A;  4BQM A;  4ZAM A;  3HUN A;  3GTC A;  3Q7V A;  4OP5 A;  4S2J A;  3VMA A;  4P85 A;  5IHV A;  1TDL A;  1XP4 A;  3UPN A;  4MEZ A;  4WM9 A;  5CGX A;  1SCW A;  3OCN A;  1PZO A;  1NJ4 A;  2XGN A;  4JF4 A;  2H10 A;  1W8Q A;  1IYP A;  4DRT A;  2WAE A;  5E2H A;  1VQQ A;  1YLJ A;  2V1Z A;  1TVF A;  3BEB A;  1CEG A;  3UN7 A;  1EI5 A;  2HP9 A;  4K0X A;  5EE8 A;  3ZFZ A;  4DE0 A;  1Z6F A;  1NZU A;  4OP8 A;  5FAO A;  1L0E A;  1YLW A;  4JF5 A;  4R4S A;  2H0T A;  5CGW A;  5F83 A;  3VP3 A;  2Y2J A;  1MWT A;  2Z2L B;  3LO7 A;  4EBP A;  1CI8 A;  4O7D A;  3JYI A;  4KZ8 A;  1FCN A;  2Y59 A;  2R9W A;  3OZH A;  1K6R A;  3A3F A;  4QB8 A;  5D3O A;  3N6I A;  5EOE A;  3C5A A;  2WUQ A;  1ESI A;  1GCE A;  2Y2P A;  4ZDX A;  1RGZ A;  2Q9N A;  2I72 A;  4JLF A;  2JC7 A;  5FQJ A;  1E25 A;  1L0F A;  2HDU A;  4PPR A;  4GDN A;  2OSU A;  3Q7V B;  3ZG0 A;  2PU2 A;  1XGJ A;  3CZD A;  3UY6 A;  1TEM A;  1M40 A;  3VFF A;  2ZQ7 A;  4E3K A;  4F94 A;  4RA7 A;  3ZG5 A;  4N1X A;  2C6W B;  3MZE A;  1PWG A;  1Q2Q A;  4BL2 A;  1BLC A;  2ZQ9 A;  4OLG A;  5DTS A;  5M1A A;  4R0Q A;  1RGY A;  4CPK A;  2PU4 A;  2XH9 A;  3ZVW A;  5JYP A;  4OPQ A;  1FQG A;  2HPB A;  3SS3 A;  4FH4 A;  1IKI A;  1K54 A;  3ZG9 B;  3G2Y A;  4OLD A;  5FQK A;  4ZJ3 A;  4OPY A;  2VGJ A;  5EEC A;  3VP4 A;  4OPZ A;  1EWZ A;  3MKF A;  3O3V A;  1GHP A;  1YM1 A;  5FQ9 A;  3W4O A;  4E3O A;  3PBQ A;  3GQZ A;  1BUL A;  4C3Q A;  2X01 A;  4WMC A;  5GLD A;  5DTK A;  2EFU A;  4C75 A;  4LCL A;  3ITA A;  3O88 A;  4PM9 A;  1L0G A;  3WRZ A;  5FI6 A;  1MBL A;  1KGF A;  4QY6 A;  4A5R A;  3G30 A;  2DRW A;  4KQO A;  2C5W B;  5A91 A;  5CEC A;  5E2F A;  1NY0 A;  3UDX A;  3IWQ A;  3SH8 A;  3M6H A;  4QJG A;  1W5D A;  3HUM A;  4KZ9 A;  3SS5 A;  1KE3 A;  3P98 A;  3PBS A;  4MBF A;  1DY6 A;  1ES5 A;  3RXX A;  3SH7 A;  2WGV A;  5GHX A;  1LI0 A;  4PMA A;  4UHU A;  1KE0 A;  1SHV A;  2P9V B;  4JXV A;  3V50 A;  5E43 A;  3GSG A;  4FH2 A;  5JYO A;  5AQ7 A;  4DKI A;  5DF8 A;  3VOZ A;  2ZC6 B;  2ZQ8 A;  3IF5 A;  2OLV A;  3NDE A;  4KZ6 A;  1E3U A;  2XFS A;  1ZG6 A;  3S1Y A;  4D2O A;  5CED A;  4ZTK A;  1YMS A;  4WZ5 A;  1QMF A;  3UE1 A;  1ES3 A;  3HUO A;  3UDF A;  4JXW A;  3UDI A;  1ERO A;  3CJM A;  5GLC A;  1S0W A;  3ZNY A;  1XGI A;  2XLN A;  1XKZ A;  4RX2 A;  3B3X A;  3ZG7 B;  1PW1 A;  4KG2 A;  4S2N A;  3ZCZ A;  5EVI B;  4OKP A;  1I2W A;  1PZP A;  3QHY A;  2FFY A;  4QU3 A;  4X69 A;  2Y91 A;  1JTG A;  2Y2H A;  4E3M A;  3TOI A;  4NET A;  3CMZ A;  3G32 A;  1IEL A;  1YQS A;  3PAG A;  1G68 A;  4P87 A;  3DW0 A;  3E2K A;  3OPP A;  2WKH A;  4WZ5 C;  2J9P A;  2Y2I A;  4GN2 A;  3GVB A;  2QPN A;  4E6W A;  4EQI A;  1JVJ A;  5CXW A;  2EX6 A;  4EWF A;  3DWK A;  4LV1 A;  2EX2 A;  4M3K A;  4KZB A;  3MZD A;  4ZJ2 A;  3FZC A;  3IHB A;  3O87 A;  2ZQC A;  2JCH A;  4MBH A;  4Z9Q A;  5GL9 A;  1IYQ A;  3C4P A;  4KQR A;  3Q1F A;  2BG1 A;  2P74 A;  1W8Y A;  5HX9 A;  1PI4 A;  3VSL A;  1XPB A;  3UE0 A;  4DE2 A;  1XXM A;  1OME A;  3ZVT A;  4BLM A;  2PBY A;  4FSF A;  4FCF A;  1IEM A;  4DDS A;  1MPL A;  4X55 A;  2WKI A;  1E4D A;  4IED A;  4RVA A;  5KMW A;  3ZG8 B;  1W7F A;  1LLB A;  1VM1 A;  2BLS A;  3IT9 A;  4OQH A;  4GKU A;  5HW3 A;  5A92 A;  1S6R A;  4OQ0 A;  4UA7 A;  3BM6 A;  5KSH A;  5L2F A;  4E3I A;  3DTM A;  1SDE A;  1TDG A;  2VGK A;  2DCF A;  2R9X A;  3LY4 A;  4GNU A;  4R3B A;  2WGW A;  5DF9 A;  5EPH A;  5FSR A;  5F82 A;  3IXH A;  1W79 A;  3IWO A;  3Q81 A;  4L0L A;  4S2K A;  4EUZ A;  4IBX A;  3HLG A;  4IBR A;  4RYE A;  2H5S A;  5CRF A;  5TR7 A;  5BOH A;  3WS5 A;  1NXY A;  4LCM A;  1HVB A;  4HES A;  1YLZ A;  2ZMA A;  1IYO A;  5CGS A; 
#chains in the Genus database with same CATH topology
 3JVU A;  3BFG A;  4KQQ A;  1TD5 A;  4WBG A;  3UNW A;  2Y2G A;  1V9Z A;  4HQA A;  2O0Y A;  4S2I A;  1S1Z A;  4O01 A;  3RFB A;  4XT2 B;  2ACG A;  2QJ5 A;  2NUT C;  4PHT A;  1PYY A;  2PHY A;  3FPV A;  2K7S A;  3GR2 A;  3T4Q A;  3W4Q A;  5J4E A;  4EXO A;  1JTD A;  3HL9 A;  4AFI A;  2AVX A;  3R4K A;  3T4S A;  2ZQD A;  2INW A;  4WL9 A;  4IUK A;  1Y28 A;  2YKH A;  5A90 A;  3R7W A;  2WAF A;  1DP8 A;  1G6A A;  4GHI B;  2A24 A;  1F2K A;  1H8M A;  3MXR A;  3VP0 A;  4KZ5 A;  2Y2O A;  2WKE A;  3CI6 A;  3HVF A;  4LEN A;  4ARZ B;  1IFQ A;  3RXW A;  4JXS A;  1VHM A;  4ZJ1 A;  3NBL A;  5G4Z A;  3BEC A;  3C8C A;  4Y0O A;  4Y0U A;  2FFF B;  1FR1 A;  2QJ7 A;  3O86 A;  1BSG A;  3LR0 A;  3KSG A;  3MBZ A;  3BQ8 A;  1N4O A;  3NDG A;  2XD1 A;  3HLF A;  3B47 A;  3TG9 A;  5HDS A;  3FYZ A;  4R3J A;  4FOF A;  1NYY A;  2L0W A;  2VA0 A;  4CLC D;  2FZ0 A;  1DJC A;  2B02 A;  2Y2K A;  3NC8 A;  5AVE A;  1ALQ A;  4L9F A;  1STZ A;  2VKS A;  2VEA A;  3N8R A;  1NLY A;  3S7P A;  4B4Z A;  5CTN A;  1BYW A;  3EGX C;  1AWI A;  2UWX A;  1LSW A;  2V1A A;  4JF6 A;  5CHJ A;  2NUP C;  5GLA A;  2M7V A;  4HI4 A;  2V20 A;  3AGD A;  5HL1 A;  5HDC A;  3LIB A;  3P7N A;  4E3J A;  3BFE A;  1ZKJ A;  1SDN A;  3L9K A;  3CIT A;  4MLL A;  4UQI S;  4U0X A;  2IWD A;  3BFD A;  3OCL A;  3NY4 A;  2PT7 A;  3ZYT A;  4Y17 A;  5C5K A;  1ZTU A;  5EVI A;  3BJN A;  4OPR A;  3UPP A;  3UPO A;  5EOO A;  1YSP A;  4WYY A;  1OJG A;  3ZNT A;  4KUK A;  3T1S A;  4N9K A;  4WEK A;  1V9Y A;  3PBO A;  3VV4 A;  1GSW A;  2PAV P;  5M19 A;  4GD6 A;  1K56 D;  3HRE A;  4JKT A;  1SKO B;  2P04 A;  5I5L A;  3QP6 A;  3DWZ A;  3U2A A;  1BTL A;  1ES4 A;  3G6O A;  1P9W A;  3S7O A;  2Y55 A;  5LBR A;  3V67 A;  3BFC A;  3LI9 A;  2EFX A;  4MMN A;  4ID4 A;  4KG5 A;  3VP2 A;  3IXD A;  4EW7 A;  1XA7 A;  5CX7 A;  3IH8 A;  1MKM A;  1UGU A;  1ERM A;  4GD8 A;  4Y3I A;  2B5R A;  3GRJ A;  2IWC A;  2OLU A;  1GHM A;  5HD3 A;  1BLP A;  2LB9 A;  1IKG A;  3VFH A;  1LL8 A;  5TJJ A;  3MR0 A;  4D60 A;  4Y0T A;  2H28 A;  3IH9 A;  3IXB A;  2OV5 A;  3IF6 C;  2HP5 A;  2QWS A;  2D01 A;  1MZU A;  2O9A A;  3OC2 A;  4HBU A;  5EV0 A;  2IWB A;  1ZG4 A;  2RL3 A;  3DTE A;  4EET B;  2HF6 A;  5HAQ A;  4I38 A;  1PI5 A;  1MY8 A;  1KVM A;  4XXR A;  4NG2 A;  3PTE A;  2ZMV A;  3NCK A;  4QY5 A;  2HP6 A;  3D72 A;  4X68 A;  2Y2Q A;  1ES2 A;  1XX2 A;  4LLO B;  3W4P A;  4ZAM A;  3HUN A;  4S2J A;  2VGL S;  2OWH A;  1DRM A;  3UPN A;  3VOL A;  3CPT B;  1PZO A;  1NJ4 A;  1W8Q A;  1IYP A;  3QP4 A;  3F1P A;  4FTX A;  1CEG A;  3ZFZ A;  1Z6F A;  1NZU A;  4OP8 A;  4GCZ A;  2HJ9 C;  1OT9 A;  2R9W A;  3OZH A;  3A3F A;  3N6I A;  2PYR A;  3C5A A;  1GCE A;  1S4R A;  1LSV A;  4HJ6 A;  2I72 A;  5FQJ A;  2JKG A;  1E25 A;  1VB6 A;  4Y2F A;  2OSU A;  1YKD A;  2PR6 A;  2ZQ7 A;  4F94 A;  3UB7 A;  4N1X A;  2C6W B;  3MZE A;  1PWG A;  1Q2Q A;  1BLC A;  4WUJ A;  4R0Q A;  4ESP A;  1JNU A;  2HPB A;  3SS3 A;  4BBT A;  2PRF A;  4ZJ3 A;  4OPY A;  2V1B A;  3MKF A;  1YM1 A;  3ICY A;  3PBQ A;  1BUL A;  4C3Q A;  5GLD A;  3ITA A;  4PM9 A;  3UME A;  2ZL1 A;  3LIC A;  3F1O B;  2DRW A;  4KQO A;  1T1A A;  2C5W B;  5EM1 A;  2MJ6 A;  1NY0 A;  2LB5 A;  3SH8 A;  4YWZ A;  1W5D A;  4KZ9 A;  3SS5 A;  2VLG A;  2WGV A;  5GHX A;  4PMA A;  4JXV A;  2OAP 1;  3CUE A;  5JYO A;  5AQ7 A;  3VOZ A;  3IF5 A;  4KZ6 A;  3S1Y A;  4D2O A;  3UE1 A;  1ZHH B;  3HUO A;  1UWN X;  3MQ0 A;  3ZNY A;  3LYX A;  1S0W A;  5AVF A;  3ZCZ A;  5EVI B;  4HP4 A;  3QHY A;  4X69 A;  3ZQ5 A;  2Y91 A;  4CLC A;  4NET A;  3CMZ A;  1YQS A;  2FH5 A;  4E6W A;  2EX6 A;  3DWK A;  3ULF A;  1GSX A;  2W1T B;  5L09 A;  4HIA A;  4H6J B;  4KQR A;  3Q1F A;  3VSL A;  5HX9 A;  4BLM A;  4GJ4 A;  4LFU A;  4BWI A;  1W7F A;  1VM1 A;  2V8C A;  4OQH A;  2WKP A;  5HW3 A;  5DFY A;  2VGK A;  2DCF A;  4UEY A;  2WGW A;  5DJU A;  3A0V A;  1W79 A;  3Q81 A;  2QHK A;  3UB6 A;  3HLG A;  5F5Y A;  3GDI A;  4IHQ A;  3R7W B;  4I39 A;  3PBR A;  5CER A;  2GJ3 A;  3ITB A;  1E3U D;  1PNE A;  2J9O A;  2WGI A;  2ZD8 A;  2KX6 A;  1K57 C;  1P97 A;  1G6O A;  1F98 A;  3G2Z A;  3A0R A;  4DXC A;  4S2N C;  1OJ5 A;  3G34 A;  3MS6 A;  1L2S A;  4II7 A;  4BEN A;  5HSQ A;  3IF6 B;  4PAU A;  2W3H A;  5FQM A;  2V9A A;  4GOG A;  1OPX A;  4X6T A;  2WAD A;  1PW8 A;  3LY3 A;  1JWP A;  2PD8 A;  1L0D A;  2EXB A;  5DF7 A;  5G4Y A;  3MXS A;  4P6Z S;  5CTM A;  4JGR A;  5HAI A;  2J3T D;  1K55 A;  1OTD A;  2D02 A;  3V39 A;  2Q9M A;  3HLW A;  5K5B A;  4WMC D;  1DJA A;  3ISG A;  4JXG A;  3FKW A;  4DJ3 A;  3D4F A;  4KZ4 A;  2EX8 A;  4KZ3 A;  4YNR A;  5FAS A;  5CHM A;  3U4L P;  4R1G A;  3L7H A;  1U60 A;  3HLC A;  1O7E A;  3E4P A;  3QP5 A;  2ZMF A;  3HCY A;  3JPU A;  2PR5 A;  5KSC A;  4LRZ E;  4KUO A;  1D7E A;  4GB7 A;  1S67 L;  4BD0 A;  3P09 A;  5TFQ A;  1N9B A;  4R4R A;  2WK0 A;  3LEZ A;  4ZRR A;  3UB8 A;  2ZM8 A;  5AQB A;  5EVE A;  3Q82 A;  1TF1 A;  4EQ1 A;  5EVI C;  2O99 A;  1OT6 A;  4R38 A;  4B4X A;  2XD5 A;  3DTI A;  3PAE A;  4B88 A;  4DXB A;  1ZC2 A;  3N7W A;  3LGO A;  5FDH A;  4LRY C;  5GHY A;  1X0O A;  2ZL1 B;  2ZQA A;  4MBK A;  5L07 A;  3RJU A;  1CI9 A;  1S4S A;  4OON A;  3HLE A;  2XR0 A;  5E2G A;  2W0N A;  3G35 A;  2GX5 A;  2J7V A;  3MFD A;  3HLD A;  3A3I A;  3QP8 A;  4H8R A;  2RCX A;  1NRF A;  2QZ6 A;  3EQV A;  2ZM2 A;  3KSH A;  1BT5 A;  2CMN A;  1XJ3 A;  4N1H A;  2A24 B;  4EEP A;  3N8S A;  1KOU A;  5AQA A;  1UWP X;  5J8X A;  4P0M A;  3CG5 A;  2JKR I;  4OH0 A;  2ZC4 B;  2QYB A;  2HDR A;  5L8M A;  3T4T A;  3WRT A;  4H6J A;  1TS6 A;  2UV0 E;  3OPR A;  4OVD A;  4DE3 A;  2ZM0 A;  4EV4 A;  3V3S A;  3BY9 A;  1MWR A;  2WGW B;  4R70 A;  3M6B A;  3QNC A;  3NIA A;  3CPT A;  3VOY A;  1XA1 A;  2JKR M;  4Q0H A;  4UAA A;  3TW8 A;  4K08 A;  2WZZ A;  3ZDJ A;  1K55 C;  5EVI D;  4Y7P A;  2ZJ9 A;  3MFX A;  3EEH A;  1SKF A;  3IF6 A;  4JPM A;  2ZOI A;  2E8J A;  4N9L A;  3SOI A;  1RCJ A;  2B18 A;  1HTZ A;  4JGQ A;  4OP5 A;  4EUV A;  3H7W A;  4MEZ A;  4WM9 A;  2A2L A;  3IS2 B;  4BBU A;  1YLJ A;  5FDS A;  1WA9 A;  3UN7 A;  1VEU A;  1N9O A;  3UB5 P;  4HNB A;  4DN0 A;  4JF5 A;  2ZOH A;  5CGW A;  5F83 A;  3VP3 A;  5F69 A;  3JYI A;  1TS0 A;  2WUQ A;  2V0W A;  2Y2P A;  4YOF A;  2W3F A;  4CLC C;  4ZDX A;  5DJT A;  2JC7 A;  1L0F A;  2HDU A;  4GDN A;  1XGJ A;  3CZD A;  3S7N A;  3NUL A;  3VFF A;  5MC7 A;  3ZG5 A;  2ZQ9 A;  5M1A A;  5DTS A;  1RGY A;  3F1N A;  5JYP A;  1F5M A;  1FQG A;  3FC7 A;  5FQK A;  2VGJ A;  3VP4 A;  3O3V A;  1HLU P;  4DMZ A;  3PHY A;  3GQZ A;  4WMC A;  4C75 A;  5DTK A;  1MBL A;  4IUH A;  4MN5 A;  5A91 A;  5CEC A;  4ARZ A;  3EOI A;  3KX0 X;  3HUM A;  3RXX A;  3PBS A;  3T50 A;  1ES5 A;  3SH7 A;  2W1T A;  1SHV A;  4PKY G;  3NOP C;  2ZC6 B;  2OLV A;  3E98 A;  5HWW A;  1E3U A;  3MQQ A;  5CED A;  5HPF A;  1YSQ A;  2EA9 A;  3CJM A;  5FEF A;  2EWW A;  3EEA A;  3ZG7 B;  5DKK A;  1I2W A;  2Y2H A;  3TOI A;  4P6Z M;  3E2K A;  2K2N A;  2Y2I A;  3GVB A;  2QPN A;  5IT5 A;  1JVJ A;  5CXW A;  4EWF A;  1W63 M;  4LV1 A;  3MF0 A;  4M3K A;  4KZB A;  3IHB A;  3F1P B;  5GL9 A;  4Z9Q A;  1Z09 A;  3C4P A;  2BG1 A;  1W8Y A;  1XJ2 A;  1XPB A;  3UE0 A;  1OME A;  4FSF A;  4DDS A;  4X55 A;  2WKI A;  2KOI A;  4RVA A;  2V0U A;  5KMW A;  3ZG8 B;  5A92 A;  3BM6 A;  5KSH A;  3DTM A;  1SDE A;  4R3B A;  2R9X A;  5DF9 A;  5FSR A;  3IWO A;  5DKL A;  4IBR A;  3CUE C;  4HES A;  4B9O A;  2ZMA A;  4QHC A;  5DVA A;  4WEJ A;  5HL6 A;  2XSS A;  4HY8 A;  2W3D A;  3G31 A;  3DBA A;  3QNB A;  3I7J A;  2Y2N A;  3AGE A;  5FAQ A;  3B42 A;  2JBF A;  1MKI A;  3PBN A;  2JKF A;  1NZO A;  3EGD C;  2PDR A;  3IXG A;  3WWX A;  1YLP A;  3LID A;  2GDN A;  1T18 A;  1XJ6 A;  2VV8 A;  5HD5 A;  3EQU A;  2ZC3 B;  1FOF A;  2XQZ A;  3SW1 A;  1LI9 A;  2V2F F;  4BJP A;  1GA9 A;  4KZA A;  4G3K A;  3VE4 A;  4LV0 A;  1YMX A;  3H82 A;  3FV7 A;  3OOV A;  3S22 A;  3H7W B;  2DMW A;  3A3E A;  4S2O A;  1HZO A;  1BUE A;  2XA7 S;  4HHD A;  2W3G A;  1PIO A;  4GLQ A;  3VP1 A;  4JGP A;  3WS2 A;  2G2W A;  3KO6 A;  4OQI A;  4IVI A;  4KZ7 A;  1CJF A;  2ZLY A;  5FQI A;  2JHE A;  2Y2L A;  1KE4 A;  5HDD A;  5FAP A;  3IX3 A;  1MWU A;  3IBJ A;  2ZBB A;  4Y15 A;  4MCW A;  3E2L A;  3ZGA B;  4YIN A;  3T1X A;  3V5M A;  1O07 A;  5HAP A;  3F1N B;  2GZA A;  4BL3 A;  3Q07 A;  4OQG A;  4G3V A;  4HJ3 A;  1FCO A;  4JGO A;  3OPL A;  1P0Z A;  4ETX A;  5CEB A;  5TBM B;  1NRJ A;  2HGV A;  4DDY A;  4X56 A;  5HFO A;  4Q8I A;  4GW9 A;  4I3I A;  3MZF A;  3LFV A;  3W2Z A;  3A3J A;  3RH8 B;  4C6Y A;  2J3W A;  1NWZ A;  4XUZ A;  4WLA A;  2EWV A;  3O5Y A;  2A49 A;  1N9N A;  3BW6 A;  3LIE A;  5TGF A;  5E2E A;  3OPH A;  4O0P A;  4MDZ A;  1YAX A;  4XT2 A;  4HP9 A;  2Z6D A;  1WE4 A;  3IHA A;  1H3Q A;  2EX9 A;  1K4E A;  3T1Q B;  4S2P A;  4E3L A;  1W63 Q;  3QP2 A;  4YFM A;  4PKY A;  5M18 A;  1FSY A;  4K91 A;  3F1O A;  3SZT A;  3E4O A;  5FL3 A;  3BFF A;  1QME A;  2X71 A;  5EVL A;  5HAR A;  3SH9 A;  2Z6C A;  1SZV A;  1CK3 A;  4Q0J A;  4HBT A;  1JWV A;  3BQA A;  4JBF A;  2XRO A;  3EWK A;  3AGF A;  2ZC7 A;  1KGE A;  3UE3 A;  1KDW A;  4DE1 A;  1PWC A;  3M2K A;  1CQA A;  4S2M A;  1OTE A;  2Y79 A;  5F1G A;  1K6S A;  2VV6 A;  5A93 A;  2ZC5 B;  5FAT A;  3MXQ A;  4EBL A;  1Y4O A;  2EXA A;  2WZX A;  3NEC A;  1J3W A;  1FCM A;  1MXO A;  2XF3 A;  2PD7 A;  3S7Q A;  2JN7 A;  5EUA A;  1OTB A;  4WEL A;  2WKQ A;  3T12 B;  1S66 L;  2Z2M B;  3BWL A;  4HOI A;  3C7V A;  1BLS A;  3HLB A;  2CC1 A;  5U47 A;  1YLT A;  3WS0 A;  3HJK A;  4LV2 A;  4E6X A;  1NYM A;  4ZBE A;  1P9R A;  4MNR A;  4CJN A;  1GHI A;  1LHY A;  4WF0 A;  4BQM A;  1OTA A;  4P85 A;  2L4R A;  1XP4 A;  5CGX A;  1SCW A;  1IOU A;  3GEC A;  3OCN A;  2XGN A;  2H10 A;  4DRT A;  5E2H A;  3CWF A;  1VQQ A;  2V1Z A;  3IX4 A;  1TVF A;  3BEB A;  1T1B A;  5EE8 A;  1L0E A;  3FG8 A;  1YLW A;  2L1M A;  4EBP A;  2Y2J A;  3LO7 A;  1FIL A;  1CI8 A;  3KSF A;  4F3L B;  1K6R A;  1VET B;  5D3O A;  2Q9N A;  1YPR A;  4JLF A;  4X1M A;  1FIK A;  2Y8H A;  4PPR A;  3Q7V B;  2YKF A;  5AJG A;  3UY6 A;  4HJ4 A;  2PYP A;  2VZW A;  2K31 A;  1G5U A;  1H0M A;  2VK3 A;  4CPK A;  2PU4 A;  2XH9 A;  3NOT C;  3ZVW A;  4OPQ A;  3KSI A;  4FH4 A;  1K54 A;  3ZG9 B;  4OLD A;  3D9Y A;  4E04 A;  5EEC A;  2GNX A;  4E3O A;  3W4O A;  2X01 A;  4GS9 A;  3K3D A;  3WRZ A;  5FI6 A;  3G30 A;  2G7U A;  4G3W A;  4BMW A;  5E2F A;  5DFX A;  2W27 A;  4M4X A;  3E0Y A;  2B95 A;  3M6H A;  4UHU A;  2P9V B;  3V50 A;  5E43 A;  2BTF P;  3NDE A;  5TBM A;  4ZTK A;  1YMS A;  4WZ5 A;  2VGL M;  3UDF A;  3UDI A;  4JXW A;  1ERO A;  5GLC A;  1L3L A;  1XGI A;  3DAV A;  3LIF A;  4Z1W A;  1XKZ A;  4RX2 A;  2J80 A;  4EU0 A;  3B3X A;  3PYP A;  1PW1 A;  4S2N A;  1PZP A;  2M7U A;  1ACF A;  4QU3 A;  4E3M A;  4NXB A;  2HZ5 A;  3G32 A;  3KYE A;  1G68 A;  4P87 A;  3MQO A;  3OPP A;  4WZ5 C;  4EQI A;  3NOU C;  2EX2 A;  5FEG A;  1G28 A;  3FZC A;  3O87 A;  4MBH A;  2KLI A;  4Q0I A;  1PI4 A;  4DE2 A;  3DTK A;  3ZVT A;  5J3W A;  1IEM A;  1MPL A;  3P01 A;  1E4D A;  4IED A;  1LT0 A;  4ETZ A;  4I3A A;  2BLS A;  4GKU A;  2VV7 A;  5L2F A;  4E3I A;  1TDG A;  3RTY A;  5EPH A;  5F82 A;  3IXH A;  4EUZ A;  4L9E A;  1EW0 A;  3KYQ A;  2H5S A;  5HZH A;  5BOH A;  3WS5 A;  1NXY A;  1HVB A;  3PR6 A;  4HH3 A;  4PM5 A;  4EBN A;  4L9G A;  5F6A A;  1D1J A;  1KDS A;  3C2W A;  3VSK A;  5DTT A;  1K54 C;  4OOL A;  2X02 A;  2Y2M A;  1K25 A;  1RP5 A;  4U0T A;  3C7U A;  1MC0 A;  3CHW P;  3K2N A;  3UMD A;  4DF6 A;  1DJB A;  4Y13 A;  1Q2P A;  2XDM A;  4EEU A;  4O8G A;  4IVK A;  3NI9 A;  1ONG A;  5GLB A;  1H5X A;  1CEF A;  3PBT A;  1WYB A;  1ONH A;  2XA7 M;  3PXP A;  5CHU A;  1BLH A;  1LL5 A;  1K56 A;  1H8Y A;  5L10 A;  3HBR A;  4S2L A;  4LRX C;  1KGG A;  2XEP A;  4E3N A;  2W1R A;  1BZA A;  1LL9 A;  4X53 A;  3TSG A;  5GHZ A;  1TS7 A;  2HDS A;  4PM6 A;  4DJ2 A;  4OOM A;  3IQA A;  2XK1 A;  4P6B A;  4K0W A;  3GMW A;  3C4O A;  3T4L A;  2QMI A;  1NLZ A;  1FSW A;  3A3D A;  1HD8 A;  5F1F A;  3BY8 A;  3N8L A;  4OOY A;  2J3T C;  2HDQ A;  4UA9 A;  4LV3 A;  3S4X A;  4CLC E;  1K57 A;  4GZB A;  3TE8 A;  2Q0O A;  1YLY A;  1I2S A;  3IWI A;  4RQ9 A;  1I5Q A;  4CLC B;  4IJG A;  3Q7Z A;  3FKV A;  3LR5 A;  2E8I A;  5IS1 A;  2KDK A;  3LCE A;  2XFT A;  4XUX A;  2P08 A;  4PM7 A;  1PRQ A;  3G4P A;  3WS1 A;  4EES A;  3UB9 A;  1PFL A;  5A8B A;  4NXE A;  2BAS A;  2HV1 A;  3BLS A;  3UO9 A;  3ZHH A;  1H8Z A;  1XFN A;  1DP9 A;  4CQH A;  1WYC A;  4GS9 B;  1GA0 A;  4WZ4 A;  1ERQ A;  4PM8 A;  1T1C A;  3QP1 A;  3JVV A;  1M6K A;  1YT4 A;  1JWZ A;  2JKT I;  2P9V A;  5KZH A;  4KEN B;  4RX3 A;  1XJ4 A;  4BD1 A;  4UA6 A;  3N4I A;  4U3T A;  5AQ9 A;  2J8Y A;  2JE5 A;  4QD4 A;  5FA7 A;  3MKE A;  1K38 A;  3LI8 A;  5EM0 A;  3M2J A;  3WS4 A;  3SS4 A;  4N92 A;  2PBD P;  2O9B A;  3FWL A;  4X1L A;  1PWD A;  1C3B A;  1K4F A;  3BRM A;  3H82 B;  5KIZ A;  5FQQ A;  2A3U A;  5FI7 A;  4R3A A;  4LPZ A;  3LR3 A;  5I94 A;  3V3R A;  3D3O A;  3C38 A;  2H0Y A;  1FR6 A;  1OTI A;  1Y54 A;  2V8F A;  4R6L A;  3CLO A;  4HEF A;  5HWV A;  3NJA A;  1TS8 A;  4X25 A;  2W3E A;  4QWO A;  1AXB A;  4GDB A;  3GV9 A;  5EFW A;  3T1R A;  1LSX A;  3TJZ C;  1GSV A;  3W8K A;  4FD8 A;  2G2U A;  4I5S A;  4KG6 A;  1J9M A;  4WN5 A;  3HJI A;  2M1C A;  3OBF A;  4NK3 A;  2Y4A A;  1IYS A;  1MWS A;  2DNS A;  3C30 A;  4NXG A;  2OWJ A;  1ESU A;  5G18 A;  3T4J A;  3BLM A;  2HJE A;  2VJW A;  4F3L A;  2OAQ 1;  3UE6 A;  3BYD A;  1KVL A;  4R23 A;  4GHI A;  2WYX A;  5FI2 A;  3B33 A;  3Q7V A;  3GTC A;  3IX8 A;  3VMA A;  5IHV A;  1TDL A;  5F68 A;  4HH2 A;  4JF4 A;  2WAE A;  4QPR A;  5J7E A;  1XFQ A;  4MN6 A;  1EI5 A;  2HP9 A;  4K0X A;  4MN7 A;  4DE0 A;  5FAO A;  3LIA A;  4R4S A;  2H0T A;  1MWT A;  2R78 A;  2Z2L B;  2IA2 A;  4O7D A;  4KZ8 A;  1FCN A;  2Y59 A;  4QB8 A;  5EOE A;  5HWT A;  1ESI A;  4UQI M;  3TRC A;  1RGZ A;  3CAX A;  4EER A;  4NXF A;  3IBR A;  3ZG0 A;  2PU2 A;  3K3C A;  1TEM A;  2VX8 A;  1M40 A;  4E3K A;  4RA7 A;  4BL2 A;  4OLG A;  4NKP A;  1IKI A;  3G2Y A;  4FUW A;  4OPZ A;  1EWZ A;  3KYZ A;  1GHP A;  5FQ9 A;  3H9W A;  2EFU A;  4LCL A;  3O88 A;  1L0G A;  3E4Q A;  1KGF A;  4QY6 A;  4A5R A;  3UDX A;  3IWQ A;  1D06 A;  4LGW A;  4BBV A;  3T4K A;  4B93 A;  4QJG A;  4I3J A;  1KE3 A;  3P98 A;  4MBF A;  1DY6 A;  1LI0 A;  2I9V A;  1KE0 A;  2XRN A;  3GSG A;  4FH2 A;  4DKI A;  3NHQ A;  1CF0 A;  5DF8 A;  2ZQ8 A;  2QKP A;  2XFS A;  1ZG6 A;  1QMF A;  1ES3 A;  3FPW A;  3LUQ A;  4Y5F A;  2XLN A;  1SKO A;  3T4O A;  4KG2 A;  3MSH A;  1DP6 A;  4OKP A;  3VE3 A;  2FFY A;  3OLO A;  1JTG A;  1S1Y A;  2O9C A;  4NEE D;  1IEL A;  3MJQ A;  3PAG A;  3DW0 A;  2WKH A;  2P7J A;  2J9P A;  4GN2 A;  5HPI A;  1T19 A;  3MZD A;  4ZJ2 A;  5IU1 A;  1ODV A;  2ZQC A;  2JCH A;  1IYQ A;  2P74 A;  1XXM A;  2OOL A;  2PBY A;  4FCF A;  3A0S A;  3MMH A;  1VET A;  1LLB A;  1A0K A;  3IT9 A;  1S6R A;  4OQ0 A;  4UA7 A;  4GNU A;  1N9L A;  3LY4 A;  3IS2 A;  1F9I A;  4L0L A;  4S2K A;  3LEQ A;  2JKT M;  4KQD A;  1VEU B;  4IBX A;  3LR4 A;  4RYE A;  5CRF A;  5TR7 A;  1K0K A;  2WKR A;  4ME4 A;  4LCM A;  1YLZ A;  1IYO A;  5CGS A; 
#chains in the Genus database with same CATH homology
 3PBR A;  4QHC A;  5CER A;  4PM5 A;  5DVA A;  3ITB A;  4WEJ A;  4EBN A;  3BFG A;  1E3U D;  4KQQ A;  4WBG A;  2J9O A;  3UNW A;  2Y2G A;  2WGI A;  2ZD8 A;  1K57 C;  1KDS A;  3G2Z A;  3VSK A;  3G31 A;  4S2I A;  5DTT A;  1K54 C;  4DXC A;  4OOL A;  3QNB A;  3I7J A;  2X02 A;  2Y2M A;  2Y2N A;  1K25 A;  1RP5 A;  3G34 A;  4S2N C;  1L2S A;  3AGE A;  4BEN A;  3IF6 B;  4U0T A;  5FQM A;  3C7U A;  4GOG A;  1PYY A;  5FAQ A;  4DF6 A;  1DJB A;  1Q2P A;  2JBF A;  2XDM A;  3GR2 A;  4X6T A;  3W4Q A;  2WAD A;  1PW8 A;  4IVK A;  3LY3 A;  1JWP A;  3NI9 A;  1MKI A;  1ONG A;  3PBN A;  1H5X A;  1JTD A;  1CEF A;  1L0D A;  3HL9 A;  5GLB A;  1NZO A;  2EXB A;  3PBT A;  1WYB A;  5DF7 A;  1ONH A;  2ZQD A;  5CHU A;  3IXG A;  3WWX A;  1YLP A;  1BLH A;  1LL5 A;  1K56 A;  1H8Y A;  2GDN A;  3MXS A;  5A90 A;  2WAF A;  3HBR A;  4S2L A;  1KGG A;  2ZC3 B;  3EQU A;  2XEP A;  5CTM A;  1FOF A;  1G6A A;  2XQZ A;  4E3N A;  3MXR A;  5HAI A;  3VP0 A;  1BZA A;  4KZ5 A;  1LL9 A;  2Y2O A;  2WKE A;  1LI9 A;  2V2F F;  1K55 A;  3HVF A;  4LEN A;  3V39 A;  2Q9M A;  3HLW A;  3RXW A;  4JXS A;  4BJP A;  4X53 A;  4WMC D;  1GA9 A;  4KZA A;  1DJA A;  4ZJ1 A;  3TSG A;  4LV0 A;  1YMX A;  5GHZ A;  3ISG A;  3NBL A;  4JXG A;  2HDS A;  3FKW A;  3FV7 A;  3BEC A;  4Y0O A;  4Y0U A;  4PM6 A;  3S22 A;  3D4F A;  4KZ4 A;  2FFF B;  2EX8 A;  4KZ3 A;  3A3E A;  1FR1 A;  4OOM A;  5FAS A;  5CHM A;  3IQA A;  4S2O A;  2XK1 A;  1HZO A;  4P6B A;  4K0W A;  3O86 A;  3GMW A;  1BUE A;  4R1G A;  3C4O A;  1BSG A;  2QMI A;  1FSW A;  3A3D A;  1U60 A;  1HD8 A;  3HLC A;  1O7E A;  3MBZ A;  1PIO A;  3VP1 A;  1N4O A;  3NDG A;  2G2W A;  3WS2 A;  5F1F A;  4OQI A;  3N8L A;  2XD1 A;  5KSC A;  4OOY A;  2HDQ A;  3HLF A;  4GB7 A;  4IVI A;  4UA9 A;  4KZ7 A;  3TG9 A;  4LV3 A;  4BD0 A;  3S4X A;  3FYZ A;  4R3J A;  1K57 A;  3P09 A;  5TFQ A;  4GZB A;  1NYY A;  2ZLY A;  5FQI A;  1N9B A;  1DJC A;  2Y2L A;  1KE4 A;  4R4R A;  5FAP A;  2WK0 A;  2Y2K A;  3NC8 A;  1I2S A;  1YLY A;  3LEZ A;  1MWU A;  1ALQ A;  3IWI A;  1I5Q A;  3Q7Z A;  2ZM8 A;  3FKV A;  3N8R A;  5AQB A;  2E8I A;  3E2L A;  3LCE A;  2XFT A;  3Q82 A;  4YIN A;  3ZGA B;  4XUX A;  4B4Z A;  5CTN A;  3V5M A;  2UWX A;  4PM7 A;  1O07 A;  3G4P A;  5HAP A;  5EVI C;  4JF6 A;  5CHJ A;  3WS1 A;  5GLA A;  4B4X A;  2V20 A;  3Q07 A;  4BL3 A;  2XD5 A;  3AGD A;  3PAE A;  4OQG A;  3BLS A;  3UO9 A;  3ZHH A;  5HL1 A;  1H8Z A;  4B88 A;  1FCO A;  4DXB A;  1WYC A;  1ZC2 A;  3OPL A;  4E3J A;  3BFE A;  3N7W A;  1ZKJ A;  1SDN A;  5FDH A;  5CEB A;  5GHY A;  1GA0 A;  4WZ4 A;  1ERQ A;  4MLL A;  4PM8 A;  4DDY A;  2ZQA A;  4MBK A;  3RJU A;  4X56 A;  1CI9 A;  4U0X A;  2IWD A;  5HFO A;  3BFD A;  4Q8I A;  3OCL A;  3NY4 A;  3MZF A;  4OON A;  1M6K A;  3HLE A;  1YT4 A;  3A3J A;  1JWZ A;  2XR0 A;  5E2G A;  5EVI A;  4OPR A;  4C6Y A;  3UPP A;  3UPO A;  5EOO A;  3G35 A;  4XUZ A;  2P9V A;  2J7V A;  4WYY A;  3MFD A;  3ZNT A;  5KZH A;  4N9K A;  4WEK A;  2A49 A;  3HLD A;  3PBO A;  3A3I A;  4KEN B;  4H8R A;  4RX3 A;  4BD1 A;  4UA6 A;  2RCX A;  5TGF A;  3N4I A;  5E2E A;  5M19 A;  4U3T A;  5AQ9 A;  2J8Y A;  2JE5 A;  3OPH A;  4QD4 A;  1NRF A;  2QZ6 A;  5FA7 A;  4GD6 A;  1K56 D;  3EQV A;  3HRE A;  4JKT A;  2ZM2 A;  3MKE A;  3DWZ A;  1WE4 A;  1K38 A;  1BTL A;  1BT5 A;  1ES4 A;  3IHA A;  4N1H A;  2EX9 A;  1K4E A;  3M2J A;  3WS4 A;  3N8S A;  4N92 A;  4S2P A;  2Y55 A;  3SS4 A;  5AQA A;  3FWL A;  4E3L A;  1PWD A;  4YFM A;  3BFC A;  5J8X A;  1C3B A;  1K4F A;  3BRM A;  4P0M A;  2EFX A;  5M18 A;  5FQQ A;  4ID4 A;  3CG5 A;  1FSY A;  2A3U A;  4KG5 A;  3VP2 A;  3IXD A;  4OH0 A;  5FI7 A;  4K91 A;  1XA7 A;  2ZC4 B;  3IH8 A;  2HDR A;  5I94 A;  1ERM A;  4GD8 A;  3BFF A;  3V3R A;  3WRT A;  1QME A;  2X71 A;  5EVL A;  2H0Y A;  2B5R A;  3GRJ A;  3OPR A;  5HAR A;  3SH9 A;  1FR6 A;  2IWC A;  1CK3 A;  2OLU A;  1Y54 A;  4OVD A;  1GHM A;  4HBT A;  1JWV A;  4DE3 A;  1BLP A;  2ZM0 A;  4HEF A;  4JBF A;  1IKG A;  3AGF A;  3VFH A;  2ZC7 A;  1KGE A;  3UE3 A;  1KDW A;  4EV4 A;  3V3S A;  4DE1 A;  1MWR A;  1PWC A;  1AXB A;  3M2K A;  4GDB A;  3GV9 A;  2WGW B;  4S2M A;  4Y0T A;  5F1G A;  1K6S A;  3IH9 A;  3IXB A;  2OV5 A;  3IF6 C;  2HP5 A;  2ZC5 B;  5FAT A;  4FD8 A;  2G2U A;  3W8K A;  5A93 A;  4EBL A;  3M6B A;  2EXA A;  2WZX A;  3QNC A;  4KG6 A;  3NIA A;  3OC2 A;  3VOY A;  1XA1 A;  4HBU A;  1FCM A;  1J9M A;  2IWB A;  1MXO A;  1ZG4 A;  2XF3 A;  4NK3 A;  2Y4A A;  4UAA A;  1IYS A;  1MWS A;  5EUA A;  2DNS A;  2RL3 A;  2WZZ A;  4WEL A;  3ZDJ A;  1K55 C;  2Z2M B;  5HAQ A;  1PI5 A;  1MY8 A;  1KVM A;  5EVI D;  1ESU A;  3C7V A;  4Y7P A;  1BLS A;  5G18 A;  3HLB A;  2CC1 A;  4XXR A;  3PTE A;  5U47 A;  1YLT A;  2ZJ9 A;  3WS0 A;  3BLM A;  4LV2 A;  4E6X A;  3NCK A;  1NYM A;  4QY5 A;  4ZBE A;  1SKF A;  4MNR A;  2HP6 A;  3BYD A;  3IF6 A;  1KVL A;  4CJN A;  4R23 A;  4X68 A;  4JPM A;  2WYX A;  1GHI A;  1ES2 A;  1XX2 A;  1LHY A;  2Y2Q A;  4N9L A;  3SOI A;  1RCJ A;  5FI2 A;  3W4P A;  1HTZ A;  4BQM A;  4ZAM A;  3HUN A;  3GTC A;  3Q7V A;  4OP5 A;  4S2J A;  3VMA A;  4P85 A;  5IHV A;  1TDL A;  1XP4 A;  3UPN A;  4MEZ A;  4WM9 A;  5CGX A;  1SCW A;  3OCN A;  1PZO A;  1NJ4 A;  2XGN A;  4JF4 A;  2H10 A;  1W8Q A;  1IYP A;  4DRT A;  2WAE A;  5E2H A;  1VQQ A;  1YLJ A;  2V1Z A;  1TVF A;  3BEB A;  1CEG A;  3UN7 A;  1EI5 A;  2HP9 A;  4K0X A;  5EE8 A;  3ZFZ A;  4DE0 A;  1Z6F A;  1NZU A;  4OP8 A;  5FAO A;  1L0E A;  1YLW A;  4JF5 A;  4R4S A;  2H0T A;  5CGW A;  5F83 A;  3VP3 A;  2Y2J A;  1MWT A;  2Z2L B;  3LO7 A;  4EBP A;  1CI8 A;  4O7D A;  3JYI A;  4KZ8 A;  1FCN A;  2Y59 A;  2R9W A;  3OZH A;  1K6R A;  3A3F A;  4QB8 A;  5D3O A;  3N6I A;  5EOE A;  3C5A A;  2WUQ A;  1ESI A;  1GCE A;  2Y2P A;  4ZDX A;  1RGZ A;  2Q9N A;  2I72 A;  4JLF A;  2JC7 A;  5FQJ A;  1E25 A;  1L0F A;  2HDU A;  4PPR A;  4GDN A;  2OSU A;  3Q7V B;  3ZG0 A;  2PU2 A;  1XGJ A;  3CZD A;  3UY6 A;  1TEM A;  1M40 A;  3VFF A;  2ZQ7 A;  4E3K A;  4F94 A;  4RA7 A;  3ZG5 A;  4N1X A;  2C6W B;  3MZE A;  1PWG A;  1Q2Q A;  4BL2 A;  1BLC A;  2ZQ9 A;  4OLG A;  5DTS A;  5M1A A;  4R0Q A;  1RGY A;  4CPK A;  2PU4 A;  2XH9 A;  3ZVW A;  5JYP A;  4OPQ A;  1FQG A;  2HPB A;  3SS3 A;  4FH4 A;  1IKI A;  1K54 A;  3ZG9 B;  3G2Y A;  4OLD A;  5FQK A;  4ZJ3 A;  4OPY A;  2VGJ A;  5EEC A;  3VP4 A;  4OPZ A;  1EWZ A;  3MKF A;  3O3V A;  1GHP A;  1YM1 A;  5FQ9 A;  3W4O A;  4E3O A;  3PBQ A;  3GQZ A;  1BUL A;  4C3Q A;  2X01 A;  4WMC A;  5GLD A;  5DTK A;  2EFU A;  4C75 A;  4LCL A;  3ITA A;  3O88 A;  4PM9 A;  1L0G A;  3WRZ A;  5FI6 A;  1MBL A;  1KGF A;  4QY6 A;  4A5R A;  3G30 A;  2DRW A;  4KQO A;  2C5W B;  5A91 A;  5CEC A;  5E2F A;  1NY0 A;  3UDX A;  3IWQ A;  3SH8 A;  3M6H A;  4QJG A;  1W5D A;  3HUM A;  4KZ9 A;  3SS5 A;  1KE3 A;  3P98 A;  3PBS A;  4MBF A;  1DY6 A;  1ES5 A;  3RXX A;  3SH7 A;  2WGV A;  5GHX A;  1LI0 A;  4PMA A;  4UHU A;  1KE0 A;  1SHV A;  2P9V B;  4JXV A;  3V50 A;  5E43 A;  3GSG A;  4FH2 A;  5JYO A;  5AQ7 A;  4DKI A;  5DF8 A;  3VOZ A;  2ZC6 B;  2ZQ8 A;  3IF5 A;  2OLV A;  3NDE A;  4KZ6 A;  1E3U A;  2XFS A;  1ZG6 A;  3S1Y A;  4D2O A;  5CED A;  4ZTK A;  1YMS A;  4WZ5 A;  1QMF A;  3UE1 A;  1ES3 A;  3HUO A;  3UDF A;  4JXW A;  3UDI A;  1ERO A;  3CJM A;  5GLC A;  1S0W A;  3ZNY A;  1XGI A;  2XLN A;  1XKZ A;  4RX2 A;  3B3X A;  3ZG7 B;  1PW1 A;  4KG2 A;  4S2N A;  3ZCZ A;  5EVI B;  4OKP A;  1I2W A;  1PZP A;  3QHY A;  2FFY A;  4QU3 A;  4X69 A;  2Y91 A;  1JTG A;  2Y2H A;  4E3M A;  3TOI A;  4NET A;  3CMZ A;  3G32 A;  1IEL A;  1YQS A;  3PAG A;  1G68 A;  4P87 A;  3DW0 A;  3E2K A;  3OPP A;  2WKH A;  4WZ5 C;  2J9P A;  2Y2I A;  4GN2 A;  3GVB A;  2QPN A;  4E6W A;  4EQI A;  1JVJ A;  5CXW A;  2EX6 A;  4EWF A;  3DWK A;  4LV1 A;  2EX2 A;  4M3K A;  4KZB A;  3MZD A;  4ZJ2 A;  3FZC A;  3IHB A;  3O87 A;  2ZQC A;  2JCH A;  4MBH A;  4Z9Q A;  5GL9 A;  1IYQ A;  3C4P A;  4KQR A;  3Q1F A;  2BG1 A;  2P74 A;  1W8Y A;  5HX9 A;  1PI4 A;  3VSL A;  1XPB A;  3UE0 A;  4DE2 A;  1XXM A;  1OME A;  3ZVT A;  4BLM A;  2PBY A;  4FSF A;  4FCF A;  1IEM A;  4DDS A;  1MPL A;  4X55 A;  2WKI A;  1E4D A;  4IED A;  4RVA A;  5KMW A;  3ZG8 B;  1W7F A;  1LLB A;  1VM1 A;  2BLS A;  3IT9 A;  4OQH A;  4GKU A;  5HW3 A;  5A92 A;  1S6R A;  4OQ0 A;  4UA7 A;  3BM6 A;  5KSH A;  5L2F A;  4E3I A;  3DTM A;  1SDE A;  1TDG A;  2VGK A;  2DCF A;  2R9X A;  3LY4 A;  4GNU A;  4R3B A;  2WGW A;  5DF9 A;  5EPH A;  5FSR A;  5F82 A;  3IXH A;  1W79 A;  3IWO A;  3Q81 A;  4L0L A;  4S2K A;  4EUZ A;  4IBX A;  3HLG A;  4IBR A;  4RYE A;  2H5S A;  5CRF A;  5TR7 A;  5BOH A;  3WS5 A;  1NXY A;  4LCM A;  1HVB A;  4HES A;  1YLZ A;  2ZMA A;  1IYO A;  5CGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...