3WRZA

N288q-n321q mutant beta-lactamase derived from chromohalobacter sp.560 (without soaking)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
357
structure length
357
Chain Sequence
b'QTREVLDPIVASLMEAQQIPGMAIALVRPEGTTISHYGAADRETGTPVDDDTLFEIGSLSKTLTATLASLAEVEGKLDFDAPVSRYLPELEGSAFDDISGLNLGTHTGGGLPLFVPDEVTDRASLMAWYREWQPTEPIGESRTYSNLGIGLLGLETAASLDGEFVPTMRAKVLAPLGMQDTWYDVPEARMADYAMGEDKDGQPTRVSPGVLDDEAYGIKTTAADLAKLVRANLHLADVDAELQQAIDATRQGHYRVGDMTQALIWEQYSLPVAPETLRAGQGYDMILEPNAAEALEPPQSPRDDVWVNKTGSTQGFGGYIVMLPGKHTGLVMLANKNYPNDARVEAAYRILSGLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structure of a highly acidic beta-lactamase from the moderate halophile Chromohalobacter sp. 560 and the discovery of a Cs(+)-selective binding site
pubmed doi rcsb
source organism Chromohalobacter sp. 560
molecule tags Hydrolase
total genus 116
structure length 357
sequence length 357
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3wrzA00
2CC1A 4IBRA 1ZG4A 4WZ5A 1VM1A 3M2KA 2Y55A 1N9BA 3IF6B 3A3JA 2ZQDA 3BECA 4ID4A 5M19A 4OQHA 2WZZA 2FFYA 3SH9A 1E25A 1ONGA 4KQQA 2HP6A 2R9XA 2WADA 5CGXA 4P6BA 3OPLA 4U0TA 1ALQA 2Y2NA 4A5RA 1HZOA 4KZ9A 4WZ4A 3VP1A 3SH7A 2WZXA 2Y2PA 1XGIA 4CJNA 4ZAMA 1JWPA 5FQIA 3W4PA 4WMCA 3PAGA 1O7EA 3BFCA 4N92A 4OP5A 2HDQA 4GB7A 3RXXA 4EUZA 2J9PA 3HLEA 2A3UA 2VGJA 5G18A 2WKEA 4JXGA 4B4XA 2Y2QA 1YT4A 3A3EA 4DF6A 4OVDA 2XR0A 3D4FA 3G2ZA 4GD6A 3I7JA 5D3OA 3UDFA 3HLDA 3NIAA 4WELA 5FQKA 5M18A 4X68A 3LEZA 4X6TA 5DVAA 3ZFZA 1C3BA 4WM9A 1L0FA 4PM8A 3NDEA 5GHYA 1RGZA 4EBLA 1KGEA 3PBTA 3E2LA 4RX3A 1M6KA 5E2FA 3UPPA 3C4PA 1EWZA 1MWRA 1W7FA 3PBQA 3ISGA 5FAPA 1XA1A 4C6YA 5BOHA 5EOOA 3WS2A 3DWKA 3IF6C 5F83A 3Q81A 3CJMA 1RGYA 4N9LA 2R9WA 5CTMA 1KE4A 2ZC6B 4EBPA 3EQVA 2JE5A 2Z2MB 4KG5A 1NYYA 1YLYA 1YQSA 4S2IA 3DW0A 3GSGA 2EFUA 2WYXA 2ZMAA 4KQOA 4S2OA 4S2NC 1XKZA 4PMAA 4QU3A 4MNRA 3OPHA 1PWDA 3ZG0A 1HVBA 1GHIA 4GZBA 3VP3A 2P9VA 1OMEA 2VGKA 1KDSA 1KGGA 3MZFA 1K6RA 4WEKA 2ZQ9A 3IWQA 1DJBA 2PU4A 3M6HA 1I2WA 1MPLA 4Q8IA 1JTGA 3W4OA 3B3XA 1H8YA 4E3MA 2C5WB 1NZUA 4JPMA 1SHVA 2EX8A 3NC8A 3GRJA 4DE3A 4PM5A 3FKVA 3UPOA 3O87A 2RL3A 3HLCA 3NBLA 3BFFA 4OOMA 4OLGA 1G68A 2H0YA 1W5DA 3SS3A 5EVIA 2JCHA 3HUMA 4E3NA 5E43A 3S4XA 1BLSA 1E3UD 2DCFA 2PBYA 5EPHA 5HX9A 4S2LA 1FCOA 2PU2A 3N7WA 4MEZA 3LY4A 5HAIA 5A92A 5GL9A 4E3JA 3DWZA 3HLGA 2ZM8A 3OPPA 2Y2KA 3CMZA 3QNCA 4LV0A 4KG6A 4H8RA 5CXWA 5FQJA 4N1HA 3MZEA 1LI0A 3P98A 2C6WB 2WKIA 4O7DA 3ZG9B 1NZOA 1TEMA 3CG5A 4BLMA 1BSGA 4R4SA 5TFQA 2X02A 2EX2A 1ES5A 1RCJA 1K57A 5AQBA 2XD1A 3ZCZA 2XF3A 4GN2A 3VP4A 1FSYA 4OKPA 4DE2A 3VOYA 3WS4A 5EOEA 3V50A 3SH8A 4KZAA 1PW8A 4UA6A 1VQQA 1LL9A 3WS1A 5CEDA 5HARA 3LO7A 5U47A 3N8LA 5DF7A 5FI7A 3AGEA 5GLAA 3TG9A 3ZG8B 3FKWA 5F1GA 2Y2OA 3IT9A 5AQAA 4KZBA 3UY6A 3MBZA 5CEBA 3BYDA 4JXWA 3G31A 5DF9A 3A3FA 4DE1A 1SCWA 3PTEA 4DXCA 1CI9A 5KSHA 1CI8A 1YMXA 3UE0A 4JF5A 3WRZA 3A3IA 3IF5A 4OPZA 1O07A 3Q7VA 1LHYA 3SOIA 1LLBA 4UHUA 4JF6A 4YFMA 3ZVWA 4GD8A 5CHMA 4X55A 2XGNA 2HPBA 4R3BA 2ZLYA 4FH4A 2XFSA 1IKGA 1NY0A 3PAEA 1MWUA 5TGFA 3IQAA 1ESUA 1BTLA 1MKIA 3Q7ZA 4K0XA 2H5SA 2OLVA 1IYOA 5J8XA 1W79A 1LL5A 4S2KA 4HBTA 5FI6A 4YINA 3PBSA 4N1XA 4S2MA 1ES4A 2ZD8A 3NDGA 4LV1A 4ZJ1A 4BENA 4BQMA 3O86A 2Y91A 4DDSA 2ZC4B 4JXSA 4F94A 1FCNA 4UA7A 1BLHA 4OOYA 3PBRA 2ZM2A 4GDNA 1XGJA 4HBUA 5GHZA 4ZTKA 1BUEA 2I72A 3V39A 1QMEA 1FOFA 3GQZA 5M1AA 4DDYA 3IWOA 1S0WA 3IF6A 3BLSA 1PW1A 5AQ9A 4WEJA 5L2FA 4PM7A 1FR1A 3ITAA 1BZAA 2ZC5B 4KZ5A 4IEDA 3GR2A 1J9MA 1MWSA 4U0XA 3ZGAB 4HEFA 4QB8A 3ZNYA 3M2JA 5FA7A 3IHBA 4XUZA 3BEBA 5EVLA 4M3KA 4C75A 5FAQA 1ESIA 1BLCA 3IH8A 3ZG5A 1IYQA 2P9VB 3HUNA 3BFGA 4WBGA 4E3IA 4IVKA 5JYPA 3W8KA 3UO9A 4B4ZA 4FD8A 1ZKJA 2J7VA 4JBFA 3NCKA 2X01A 4LCLA 3TOIA 2XH9A 3MXSA 2EX9A 1KDWA 2IWBA 1IYPA 3V3SA 4P85A 4JLFA 5FSRA 3TSGA 1NJ4A 4BD0A 3HLWA 1M40A 3Q07A 4LENA 4DE0A 1U60A 1YMSA 4Y7PA 1KVMA 1YLJA 2OLUA 2XDMA 5CTNA 2HDSA 4OP8A 4E3OA 2V20A 4E6WA 1XX2A 1RP5A 5CHJA 5EVIB 4BD1A 1XP4A 4R0QA 1NYMA 3AGFA 3HLFA 1S6RA 4B88A 1JTDA 2GDNA 3MKEA 4X53A 3NY4A 4WMCD 2XLNA 5A93A 4R3JA 2E8IA 3IXBA 1AXBA 3BFDA 4BL3A 3FWLA 3FZCA 3C5AA 3WWXA 3G30A 1ES3A 3C7UA 4OQGA 3NI9A 3RXWA 1DJAA 1K4FA 1MWTA 3A3DA 5FQ9A 2Q9NA 2JBFA 2Y2HA 3O88A 2Q9MA 3P09A 5DTSA 5FATA 4PPRA 1W8YA 4S2PA 4MLLA 1K38A 3VP2A 2HDRA 1ZC2A 1K6SA 2P74A 3OPRA 1K54C 3JYIA 2HP5A 3QHYA 4JKTA 1WE4A 5FI2A 4KZ3A 4QY6A 1K55A 4LV3A 2ZQAA 1H8ZA 3DTMA 4K0WA 5F1FA 4GNUA 4RX2A 4Y0UA 5JYOA 4GDBA 1GA0A 4WYYA 3VSKA 3CZDA 1PZOA 2EFXA 3VSLA 3VFFA 1L0EA 1IEMA 2XEPA 4HESA 3SS4A 1L2SA 3C7VA 4QJGA 5HW3A 3BFEA 4OPYA 1K56D 3IH9A 2JC7A 5KMWA 4EQIA 4DXBA 2WAEA 5EVIC 3IXDA 1SDEA 1ES2A 4ZJ2A 5A91A 4OOLA 3Q7VB 1FR6A 1MY8A 2Y59A 3AGDA 4E3KA 2G2UA 3BM6A 3EQUA 2XQZA 4GKUA 3GTCA 1HD8A 2H10A 2WK0A 2Y2IA 4Z9QA 3OCLA 2ZQ8A 3G34A 3LCEA 1PIOA 3G35A 1IKIA 5CHUA 2Y2LA 4KQRA 5TR7A 5E2HA 3UPNA 1I5QA 4K91A 4KZ6A 1BT5A 4RA7A 1PWGA 2WGWA 3VP0A 1TVFA 2BLSA 5I94A 1YLWA 1K57C 5EVID 5DTKA 4BJPA 2QZ6A 3UE3A 3UN7A 2ZJ9A 1DY6A 4KG2A 2XD5A 1CK3A 2G2WA 3IHAA 4LCMA 2WGVA 2WGIA 1LI9A 1Q2QA 3GMWA 2Z2LB 5A90A 5FQQA 2Y2MA 3UE1A 4R23A 1DJCA 2ZC3B 4OLDA 4MBKA 1XPBA 4DRTA 3MFDA 4U3TA 2X71A 5E2EA 1KE3A 2EXBA 1FSWA 2HDUA 3HVFA 5GLCA 3OC2A 4WZ5C 1N4OA 1Q2PA 3O3VA 5GHXA 1ONHA 2Y4AA 3GV9A 4JF4A 3Q82A 1K25A 4FH2A 4BL2A 2EXAA 2OV5A 4QD4A 2J9OA 2IWDA 1EROA 3M6BA 3IXHA 2A49A 4LV2A 1Y54A 3OZHA 1MXOA 4S2NA 4DKIA 4JXVA 3ITBA 1SKFA 5HFOA 1GHMA 2Y2GA 2H0TA 3V5MA 1L0DA 5GLBA 5IHVA 1E3UA 5KSCA 2V2FF 4Y0OA 4Y0TA 5EECA 5EE8A 2UWXA 1IELA 5FQMA 3VFHA 3HLBA 2EX6A 5FASA 1GA9A 4ZJ3A 1MBLA 2WKHA 4OH0A 5FDHA 4X56A 3W4QA 5KZHA 4S2JA 5DTTA 3FYZA 1JWVA 4OPQA 4X69A 3G2YA 5FAOA 4D2OA 4UA9A 5EUAA 1CEFA 1Z6FA 2XK1A 2ZQ7A 5HAQA 3S1YA 1G6AA 5CRFA 3ZG7B 4EWFA 3MKFA 4IBXA 3V3RA 4UAAA 1PYYA 1PI4A 5HL1A 1ERMA 2ZM0A 2ZC7A 1K56A 4KZ7A 2HP9A 4ZBEA 5CECA 2IWCA 4MBFA 1WYCA 1PZPA 3HL9A 4NETA 3WS5A 4KZ8A 4L0LA 1K54A 2BG1A 1IYSA 2RCXA 2OSUA 1ERQA 1QMFA 5CERA 1W8QA 1CEGA 2WUQA 3N8RA 5E2GA 3S22A 3LY3A 4XUXA 3IXGA 3QNBA 5F82A 3UDIA 2DNSA 1JWZA 1KGFA 2XFTA 4NK3A 2DRWA 3OCNA 1FQGA 4QY5A 4C3QA 1YLPA 1TDLA 4R4RA 3MZDA 3ZNTA 3E2KA 3HBRA 3Q1FA 4R1GA 5DF8A 4EV4A 2Y2JA 2QMIA 1K4EA 2FFFB 3N8SA 4OQ0A 3WRTA 4RVAA 2V1ZA 4GOGA 4XXRA 3C4OA 3N4IA 4N9KA 4CPKA 1EI5A 4EBNA 2WAFA 4E3LA 1NXYA 5HAPA 1YM1A 1YLZA 3RJUA 1GHPA 1FCMA 3PBNA 1YLTA 1ZG6A 3GVBA 1GCEA 1JVJA 1XXMA 1H5XA 5CGSA 2J8YA 4OONA 3MXRA 2QPNA 3IWIA 4KZ4A 4IVIA 4KENB 3ZHHA 4ZDXA 4P0MA 4PM9A 4FCFA 3ZVTA 1WYBA 2B5RA 3FV7A 1KE0A 2WGWB 3PBOA 4OQIA 3G4PA 4PM6A 1K55C 1SDNA 1PI5A 3UNWA 3VOZA 3G32A 3HREA 1NRFA 3WS0A 4E6XA 3VMAA 3BRMA 4FSFA 5CGWA 1KVLA 4P87A 4MBHA 1I2SA 3ZDJA 3BLMA 4OPRA 1BLPA 1HTZA 4RYEA 3HUOA 5GLDA 2ZQCA 3UDXA 1XA7A 1E4DA 1BULA 1L0GA 3SS5A 1PWCA 4QHCA 1TDGA 5AQ7A 3N6IA
chains in the Genus database with same CATH superfamily
4IBRA 3IX3A 4WZ5A 2MJ6A 4RQ9A 2FFYA 2WADA 5CGXA 4P6BA 2PD8A 1HZOA 4KZ9A 3ZYTA 2Y2PA 3KSHA 1JWPA 5FQIA 5HDCA 3UB5P 4II7A 4LRZE 4WMCA 5L09A 4I3IA 4GB7A 3RXXA 2EWWA 2W1TB 3NHQA 1YT4A 4OVDA 3D4FA 5D3OA 5A8BA 4K08A 5FQKA 3LEZA 5DVAA 1C3BA 4CLCE 1NLZA 1M6KA 3UPPA 3C4PA 3E4OA 1W7FA 4C6YA 2PBDP 5EOOA 3IF6C 4G3WA 5AVFA 4EBPA 1YLYA 3GSGA 2EFUA 2ZMAA 3LIEA 4S2NC 4L9FA 2W1RA 3K3DA 4GZBA 4R6LA 5HD5A 1OTAA 4WEKA 2ZQ9A 2O99A 1DJBA 3M6HA 3MF0A 1I2WA 4Q8IA 2YKHA 1S67L 3CLOA 2EX8A 4PM5A 3FKVA 3UPOA 2RL3A 3BFFA 4OOMA 1G68A 3HUMA 4E3NA 2PBYA 2DCFA 2XRNA 4S2LA 3MQ0A 3C8CA 5GL9A 1VEUB 1TS6A 2ZM8A 3OPPA 5CXWA 4KG6A 4UQIM 3MZEA 1LI0A 3FG8A 1F9IA 1ES5A 1RCJA 3ZCZA 4GN2A 1PW8A 2KDKA 1LL9A 2PYPA 3LO7A 5U47A 5TBMA 1VB6A 5FI7A 3T1QB 5F1GA 3IT9A 3MBZA 1P0ZA 3BYDA 4JXWA 3G31A 5DF9A 4DE1A 2VV8A 3A3IA 3BWLA 3TJZC 4HJ3A 2E8JA 2HPBA 2R78A 4FH4A 1TS0A 3UB6A 3PAEA 2P08A 1BTLA 4Y13A 2QYBA 5FI6A 4YINA 3PBSA 4S2MA 2ZD8A 3NDGA 4LV1A 2QKPA 3O86A 4F94A 4MMNA 1XGJA 5GHZA 1FOFA 3GQZA 3PR6A 3IWOA 1FR1A 1BZAA 4KZ5A 4IEDA 3GR2A 4U0XA 4QB8A 3ZNYA 2H28A 3M2JA 3H9WA 5HWWA 5DFYA 4L9EA 4M3KA 1ESIA 3QP6A 3IH8A 2P9VB 2FH5A 4WBGA 5JYPA 5J4EA 4FD8A 5LBRA 2JHEA 2J7VA 4CLCB 4JBFA 2X01A 4LCLA 2XH9A 3IX8A 3MSHA 3V3SA 4EESA 4JLFA 1MKMA 1NJ4A 4JGRA 3KYZA 1YLJA 5CTNA 2HDSA 4OP8A 5L07A 4E3OA 3F1OA 3HJKA 1XX2A 4BD1A 4L9GA 1JTDA 4EQ1A 3T1SA 3MKEA 3S7NA 3NY4A 4R3JA 2E8IA 1LL8A 3IXBA 2B18A 3BFDA 4BL3A 3G30A 2VGLM 3NI9A 3QP1A 1DJAA 4H6JA 1BYWA 5DTSA 3P09A 1W8YA 2CMNA 1YPRA 1K54C 3JYIA 4LRXC 1WE4A 4KZ3A 4QY6A 2HJEA 4RX2A 1OTEA 4Y0UA 2OAQ1 4BBUA 3CITA 3CZDA 3CPTB 4PKYG 2EFXA 1L0EA 4HESA 4MN6A 1F98A 5HW3A 1MC0A 5EVIC 5HSQA 3Q7VB 3EQUA 3GTCA 2OWJA 2Y2IA 4HI4A 4EERA 5E2HA 1D06A 1T1AA 4QPRA 1TVFA 2BLSA 1K57C 4BMWA 5DTKA 4BJPA 3UE3A 2G2WA 2WGIA 1A0KA 5FQQA 3UE1A 3UB7A 2ZC3B 4MBKA 1XPBA 4U3TA 5DFXA 3FPWA 2EXBA 3KYEA 3BW6A 2PR6A 4DJ3A 1OTDA 3OC2A 5DJUA 4WZ5C 5HPFA 1ONHA 4JF4A 2OV5A 1HLUP 1EROA 3M6BA 4WN5A 2A49A 4DKIA 4S2NA 4JXVA 3T4SA 3V5MA 1L0DA 4R38A 2ZL1B 5GLBA 5IHVA 1WA9A 2V2FF 4Y0OA 5I5LA 4LFUA 5EECA 3CAXA 3VFHA 5FASA 3C2WA 5FDHA 4X56A 5KZHA 5EM0A 1CEFA 3OOVA 3S1YA 3ZG7B 1IOUA 3V3RA 5HL1A 2VKSA 2ZM0A 2YKFA 5CECA 1PNEA 1PZPA 4HNBA 2RCXA 5FEGA 1QMFA 3R7WB 4B93A 3LY3A 4HH3A 2DNSA 5HWVA 3HBRA 4R1GA 4NEED 5DF8A 2PYRA 1W63Q 5J7EA 2GJ3A 4XXRA 3N4IA 1EI5A 1NXYA 3PBNA 5HDSA 1XXMA 4XT2A 3D3OA 4OONA 2QWSA 4BBTA 4PAUA 2QPNA 3LR4A 4IVIA 3ZHHA 5HD3A 4FCFA 3PBOA 1KE0A 2M1CA 1OT9A 1TD5A 3G4PA 1K55C 4WL9A 3WS0A 3ZQ5A 4P87A 4MBHA 4FTXA 4GCZA 4OPRA 4RYEA 2ZQCA 3V67A 3UDXA 1YSPA 1L0GA 3SS5A 2G7UA 4CQHA 1TDGA 2PAVP 2CC1A 3LIDA 2OAP1 3A3JA 4ID4A 1E25A 1ONGA 3SW1A 2R9XA 4MCWA 3LYXA 2WKRA 3DTKA 4WZ4A 3VP1A 2WZXA 1XGIA 2ZOHA 4CJNA 3FPVA 3PHYA 4N92A 2HDQA 2J9PA 3HLEA 4HJ4A 2WKEA 2OOLA 2Y2QA 1GSWA 4GD6A 3UB9A 3HLDA 3NIAA 4YNRA 4X68A 3T4JA 4X6TA 3QP4A 4PKYA 3PXPA 3K3CA 4PM8A 1RGZA 3FC7A 1KGEA 1EWZA 3PBQA 2K2NA 3CJMA 3JVUA 2ZC6B 3EQVA 2Z2MB 1YQSA 3T4KA 4S2OA 4QU3A 3CWFA 3ZG0A 1GHIA 4P6ZM 2O9BA 1K6RA 3E0YA 4GHIB 1SZVA 1H8YA 4JPMA 3GRJA 3VOLA 3NBLA 4KUKA 4OLGA 1UGUA 3SS3A 1CJFA 5EVIA 4GW9A 3S4XA 1E3UD 4WUJA 5HAIA 3F1PA 2PRFA 4F3LB 1XJ4A 4LV0A 3LIBA 2L4RA 1ZTUA 1TEMA 3CG5A 1BSGA 3KX0X 5TFQA 3LFVA 1K57A 5AQBA 2XD1A 3VOYA 3EEHA 4KZAA 3WS1A 5CEDA 2PDRA 3N8LA 5DF7A 1J3WA 3AGEA 3ZG8B 3FKWA 2Y2OA 1T18A 5CEBA 2V8CA 5KSHA 2VX8A 3IF5A 4OPZA 3SOIA 4YFMA 5CHMA 4NKPA 3MFXA 3B42A 2ZLYA 2XFSA 4HIAA 1DP6A 1NY0A 3IQAA 1ESUA 4K0XA 5J8XA 1IYOA 1LL5A 2BASA 4JXSA 3S7QA 4UA7A 1BLHA 2A24B 4ARZA 2QJ5A 4ZTKA 1BUEA 5M1AA 4DDYA 4DN0A 1S0WA 3BLSA 5AQ9A 2PD7A 3ZGAB 2PHYA 3IHBA 5C5KA 4XUZA 4YWZA 2ZMFA 5FAQA 1S4SA 1BLCA 3BFGA 2V0UA 3W8KA 4B4ZA 1ZKJA 3C30A 1H8MA 3S7OA 1KDWA 2IWBA 4P85A 4BD0A 3ULFA 1M40A 4DE0A 3S7PA 4Y7PA 2OLUA 4O8GA 4E6WA 3QP8A 1RP5A 3UMDA 4R0QA 2XLNA 1VETB 1AXBA 4X1MA 3K2NA 5EFWA 3EWKA 1T1BA 1K4FA 3A3DA 4MLLA 1K38A 1ZC2A 3EOIA 5HWTA 1H0MA 1K55A 2ZQAA 3DTMA 4GHIA 3MXQA 4GDBA 4WYYA 3VSLA 3H82B 1L2SA 3SS4A 2GZAA 4OPYA 1K56D 4EQIA 4DXBA 2WAEA 3KSGA 4ZJ2A 3AGDA 4E3KA 3BM6A 4F3LA 2XQZA 2H10A 3LGOA 3OCLA 3LCEA 4AFIA 5CHUA 2Y2LA 5TR7A 4K91A 3ICYA 3OLOA 5FL3A 2W3FA 4LCMA 2WGVA 1Q2QA 2Z2LB 4FUWA 3BJNA 5L8MA 2JN7A 4R23A 2P04A 4E04A 4DRTA 2XA7M 3GV9A 3Q82A 1K25A 4FH2A 2J9OA 2LB9A 4LV2A 1Y54A 3LI8A 1SKFA 5HFOA 2H0TA 5HL6A 4FOFA 4ZRRA 2ACGA 2B95A 3LIAA 3T12B 4Y0TA 2PT7A 3HLBA 2W1TA 3OBFA 4S2JA 5DTTA 2M7VA 1JWVA 4D2OA 3G2YA 4Y2FA 4ESPA 5EUAA 2XK1A 4MDZA 1T19A 5FDSA 1OJGA 4UAAA 3RH8B 1K56A 4MBFA 1SKOB 2K7SA 1ERQA 5CERA 5AVEA 5E2GA 4XUXA 3IXGA 5F82A 3UDIA 1JWZA 4NK3A 3OCNA 4Y17A 1TDLA 3ZNTA 3E2KA 1DRMA 1V9YA 4OQ0A 3WRTA 2WAFA 4E3LA 5HAPA 2VK3A 1FCMA 1XFQA 1YLTA 3GVBA 1JVJA 3CUEA 1H5XA 3MXRA 1X0OA 2O0YA 4UEYA 4PM9A 1VEUA 4CLCD 2WGWB 4PM6A 3VE4A 1PI5A 3UNWA 3VOZA 1JNUA 1LSVA 4E6XA 3VMAA 3BRMA 1I2SA 3LR0A 1HTZA 2FZ0A 2KLIA 3HUOA 5GLDA 3VE3A 1N9OA 4G3VA 1BULA 1PWCA 1MZUA 4QHCA 3F1NB 3T1RA 3KYQA 1VM1A 3M2KA 2Y55A 4B9OA 3BECA 5M19A 2WZZA 3SH9A 4KQQA 2HP6A 2W3EA 4U0TA 2Y2NA 4A5RA 4IUKA 4G3KA 2XROA 4ZAMA 3NOPC 3W4PA 3EGXC 3IS2B 1O7EA 3A0VA 3BFCA 4OP5A 2V8FA 4EUZA 2A3UA 4UQIS 4B4XA 2XR0A 3MR0A 3UDFA 3H7WB 5M18A 3ZFZA 4WF0A 1L0FA 2GNXA 3HCYA 3NDEA 5GHYA 2NUPC 4EBLA 3PBTA 3E2LA 3ISGA 5FAPA 1XA1A 1S66L 2O9AA 3QP5A 3LUQA 4GS9B 4N9LA 2R9WA 1TS8A 1N9NA 2JE5A 1NYYA 3DW0A 4KQOA 2EA9A 4GLQA 2P9VA 1OMEA 2VGKA 1KDSA 4I38A 1KGGA 4CLCA 2PU4A 4Y15A 2ZBBA 1JTGA 3W4OA 3B3XA 4E3MA 1NZUA 3NC8A 3O87A 3W2ZA 3HLCA 3L9KA 4I3AA 2JCHA 5E43A 1BLSA 5HX9A 2PU2A 3N7WA 3LY4A 3T4OA 3U2AA 5A92A 1XJ2A 4JGQA 3QNCA 2D02A 4N1HA 3D72A 3P98A 4M4XA 2C6WB 4HHDA 2WKIA 4O7DA 1H3QA 1NZOA 4BLMA 2X02A 2V1BA 2XF3A 3A0SA 1FSYA 4OKPA 3WS4A 5EOEA 3V50A 5TJJA 1F5MA 3CPTA 3EEAA 2J80A 3TG9A 1Z09A 1GSVA 5AQAA 4KZBA 1PRQA 2V1AA 3A3FA 1NLYA 3PTEA 1CI8A 1YKDA 3Q7VA 1LHYA 4JF6A 3ZVWA 4KUOA 4R3BA 1OTBA 5FEFA 2Y79A 1IKGA 2INWA 2VGLS 3R4KA 3Q7ZA 2H5SA 2OLVA 3E4PA 2HF6A 4HBTA 2HGVA 2PR5A 4N1XA 3CI6A 4Q0HA 4OOYA 3P7NA 3PBRA 1S1YA 3F1NA 2I72A 3V39A 1QMEA 2JKRI 3TRCA 3BY9A 4WEJA 2K31A 5L2FA 4PM7A 2ZC5B 4R70A 4EEPA 1J9MA 1MWSA 1IFQA 1XJ6A 4HEFA 3BQAA 5FA7A 2JKTI 4C75A 2ZMVA 1IYQA 1T1CA 3HUNA 3IS2A 2HJ9C 3TOIA 3MXSA 2ZL1A 2EX9A 1IYPA 2JKTM 5F6AA 3HLWA 3Q07A 2V20A 3RFBA 1XP4A 1NYMA 2NUTC 3AGFA 1S6RA 4B88A 2J3TD 2W0NA 4X53A 4WMCD 1NWZA 1CQAA 1CF0A 3B33A 3FWLA 3WWXA 3JVVA 2W3GA 3C7UA 2ZOIA 2Z6CA 1MWTA 3O88A 2Q9MA 3L7HA 3DTEA 4S2PA 3VP2A 2P74A 3QHYA 5FI2A 3R7WA 4JGOA 1H8ZA 4GJ4A 4DMZA 1TF1A 3LICA 3GECA 1PZOA 5TBMB 1IEMA 2XEPA 2Q0OA 3BFEA 5EVEA 1XJ3A 3IH9A 5KMWA 1Y4OA 1K0KA 1SDEA 3LR5A 1ES2A 5A91A 2AVXA 4OOLA 2Y59A 2G2UA 3JPUA 1HD8A 3P01A 3CUEC 4Z9QA 5G4YA 1FILA 3B47A 2ZQ8A 3G34A 4BBVA 1PIOA 3G35A 1F2KA 4KQRA 4HY8A 3UPNA 4RA7A 1BT5A 5IU1A 1KOUA 5I94A 1YLWA 4NXEA 3UN7A 1DY6A 2XD5A 1CK3A 3IHAA 3GMWA 2Y2MA 1DJCA 4OLDA 4X1LA 3MFDA 2X71A 5E2EA 3HVFA 1PFLA 1N4OA 1Q2PA 5GHXA 4HP4A 2Y4AA 2QHKA 4QD4A 3IBJA 3OZHA 1MXOA 1GHMA 2W3DA 2V0WA 4ME4A 1E3UA 4BWIA 2O9CA 2UWXA 2EX6A 3LEQA 1MBLA 1W63M 3W4QA 3F1OB 4X69A 1Z6FA 5F5YA 2WKPA 2IA2A 3O5YA 3UMEA 3MQQA 4KZ7A 2HP9A 4O01A 4H6JB 3HL9A 4KZ8A 2BG1A 1IYSA 1OPXA 4NXGA 1S1ZA 2VA0A 4I39A 2VJWA 1W8QA 1CEGA 3A0RA 3BQ8A 1FIKA 4QY5A 1KGFA 4NXBA 2DRWA 1FQGA 1YLPA 3MZDA 3G6OA 4CLCC 2VLGA 4EV4A 2Y2JA 2QMIA 3N8SA 2V1ZA 4GOGA 5HDDA 4EBNA 1YM1A 3RJUA 1LSXA 1ZG6A 5CGSA 2J8YA 3IWIA 4KZ4A 3E98A 3NJAA 4ZDXA 1AWIA 4HOIA 3ZVTA 1WYBA 2P7JA 4OQIA 3RTYA 1SDNA 4DJ2A 3G32A 3HREA 4KQDA 1OT6A 4P6ZS 1BLPA 1XA7A 3D9YA 3LR3A 3N6IA 1ZG4A 1ACFA 1N9BA 3IF6B 2ZQDA 4OQHA 4LGWA 4IHQA 3OPLA 1ALQA 3IBRA 3MQOA 2KOIA 4HH2A 3SH7A 1S4RA 3NECA 2JKGA 3PAGA 3PYPA 2VGJA 5G18A 4JXGA 1N9LA 3A3EA 5KIZA 4DF6A 5EV0A 2XSSA 5IS1A 3G2ZA 2HV1A 3I7JA 4WELA 4WM9A 3T4LA 2A24A 2VEAA 4RX3A 5E2FA 1MWRA 5BOHA 4MN5A 3WS2A 3DWKA 5F83A 3Q81A 1RGYA 5CTMA 1KE4A 4S2IA 1D1JA 4KG5A 2WYXA 1XKZA 4PMAA 4MNRA 2BTFP 3OPHA 4YOFA 1PWDA 1HVBA 3VP3A 3MZFA 3GDIA 3IWQA 4EW7A 5F69A 1MPLA 2C5WB 1SHVA 4DE3A 2H0YA 1W5DA 5HZHA 4XT2B 5EPHA 1FCOA 4MEZA 1VETA 4E3JA 3DWZA 3HLGA 2Z6DA 2Y2KA 3CMZA 5FQJA 4H8RA 2V9AA 2VV7A 3SZTA 3DBAA 3ZG9B 2I9VA 5EM1A 4EXOA 2M7UA 3TW8A 4R4SA 2EX2A 4ETXA 3VP4A 4DE2A 3DTIA 3SH8A 1L3LA 4O0PA 4UA6A 1VQQA 2QJ7A 3MMHA 5HARA 1ODVA 1GSXA 5GLAA 3H82A 2L1MA 3UY6A 1STZA 1V9ZA 1SCWA 4DXCA 1CI9A 1YMXA 2VV6A 3UE0A 4JF5A 3UB8A 3WRZA 1O07A 3LI9A 1LLBA 4UHUA 4GD8A 4Y3IA 4X55A 2XGNA 1ZHHB 1MWUA 5TGFA 1MKIA 1W79A 4S2KA 4HP9A 4BENA 4BQMA 1ES4A 3VV4A 4ZJ1A 4Y5FA 2Y91A 5DKLA 4DDSA 2ZC4B 1NRJA 1FCNA 4Q0IA 1DP9A 3T50A 2ZM2A 4GDNA 4HBUA 3E4QA 3IF6A 1PW1A 2OWHA 1VHMA 3ITAA 4HJ6A 4Q0JA 4JGPA 3BEBA 5EVLA 2A2LA 2W27A 2J3TC 3ZG5A 4E3IA 4IVKA 3UO9A 1G5UA 4X25A 3NCKA 4R3AA 4HQAA 4EETB 5FSRA 3TSGA 2GX5A 4LENA 1U60A 1YMSA 3NULA 1KVMA 2XDMA 5CHJA 5EVIB 3T1XA 3HLFA 2GDNA 3F1PB 5A93A 3MJQA 3HJIA 3FZCA 3C5AA 3LIFA 2XA7S 1ES3A 4OQGA 3RXWA 5FQ9A 2Q9NA 2JBFA 2Y2HA 5FATA 1SKOA 4PPRA 2HDRA 1K6SA 3OPRA 4I5SA 2HP5A 4JKTA 4D60A 5J3WA 3BY8A 5MC7A 2WKQA 4LV3A 3T4QA 3KSIA 4K0WA 4QWOA 5F1FA 3MS6A 4GNUA 5JYOA 1GA0A 2D01A 3VSKA 4MN7A 3VFFA 3C7VA 4QJGA 2HZ5A 2JC7A 3IXDA 4I3JA 1OJ5A 4NXFA 1FR6A 1MY8A 2LB5A 4GKUA 2WK0A 1IKIA 1I5QA 4KZ6A 1PWGA 2WGWA 3VP0A 4IJGA 5EVID 2QZ6A 2EWVA 2ZJ9A 4KG2A 1P97A 4ARZB 1LI9A 1D7EA 5A90A 1TS7A 1G28A 1XFNA 2J3WA 1G6OA 3IX4A 1KE3A 1FSWA 1DP8A 2HDUA 1UWPX 5GLCA 3EGDC 3CHWP 3O3VA 4BL2A 2EXAA 2IWDA 4WLAA 4EU0A 3IXHA 5G4ZA 4Z1WA 3ITBA 2Y2GA 2JKRM 1Y28A 5KSCA 1LSWA 1P9WA 3T4TA 5EE8A 1IELA 5AJGA 5FQMA 1GA9A 4ZJ3A 2WKHA 5CX7A 5L10A 2Y8HA 4OH0A 3C38A 1LT0A 3FYZA 1YAXA 4OPQA 5FAOA 5HPIA 4UA9A 2JKFA 2ZQ7A 5HAQA 1EW0A 3H7WA 1G6AA 5CRFA 4EWFA 2VZWA 3MKFA 4IBXA 1PYYA 1PI4A 1ERMA 2UV0E 2ZC7A 4NG2A 4ZBEA 2IWCA 5F68A 1WYCA 4NETA 3WS5A 3KSFA 4GS9A 4L0LA 5DKKA 1K54A 5DJTA 1YSQA 2OSUA 2L0WA 2WUQA 3N8RA 1UWNX 3S22A 4LRYC 3QNBA 2XFTA 4C3QA 4LLOB 4R4RA 3Q1FA 3QP2A 1K4EA 3KO6A 2FFFB 4RVAA 4CPKA 2DMWA 3C4OA 4N9KA 1YLZA 1OTIA 3U4LP 1GHPA 4PHTA 2B02A 1GCEA 4EUVA 3UE6A 3NOUC 4KENB 3TE8A 4P0MA 2W3HA 4IUHA 2B5RA 2KX6A 3FV7A 4ETZA 1NRFA 4LPZA 4FSFA 5CGWA 4EEUA 1KVLA 3DAVA 1P9RA 3ZDJA 3BLMA 3NOTC 1E4DA 5K5BA 5IT5A 5AQ7A
chains in the Genus database with same CATH topology
2CC1A 4IBRA 1ZG4A 4WZ5A 1VM1A 3M2KA 2Y55A 1N9BA 3IF6B 3A3JA 2ZQDA 3BECA 4ID4A 5M19A 4OQHA 2WZZA 2FFYA 3SH9A 1E25A 1ONGA 4KQQA 2HP6A 2R9XA 2WADA 5CGXA 4P6BA 3OPLA 4U0TA 1ALQA 2Y2NA 4A5RA 1HZOA 4KZ9A 4WZ4A 3VP1A 3SH7A 2WZXA 2Y2PA 1XGIA 4CJNA 4ZAMA 1JWPA 5FQIA 3W4PA 4WMCA 3PAGA 1O7EA 3BFCA 4N92A 4OP5A 2HDQA 4GB7A 3RXXA 4EUZA 2J9PA 3HLEA 2A3UA 2VGJA 5G18A 2WKEA 4JXGA 4B4XA 2Y2QA 1YT4A 3A3EA 4DF6A 4OVDA 2XR0A 3D4FA 3G2ZA 4GD6A 3I7JA 5D3OA 3UDFA 3HLDA 3NIAA 4WELA 5FQKA 5M18A 4X68A 3LEZA 4X6TA 5DVAA 3ZFZA 1C3BA 4WM9A 1L0FA 4PM8A 3NDEA 5GHYA 1RGZA 4EBLA 1KGEA 3PBTA 3E2LA 4RX3A 1M6KA 5E2FA 3UPPA 3C4PA 1EWZA 1MWRA 1W7FA 3PBQA 3ISGA 5FAPA 1XA1A 4C6YA 5BOHA 5EOOA 3WS2A 3DWKA 3IF6C 5F83A 3Q81A 3CJMA 1RGYA 4N9LA 2R9WA 5CTMA 1KE4A 2ZC6B 4EBPA 3EQVA 2JE5A 2Z2MB 4KG5A 1NYYA 1YLYA 1YQSA 4S2IA 3DW0A 3GSGA 2EFUA 2WYXA 2ZMAA 4KQOA 4S2OA 4S2NC 1XKZA 4PMAA 4QU3A 4MNRA 3OPHA 1PWDA 3ZG0A 1HVBA 1GHIA 4GZBA 3VP3A 2P9VA 1OMEA 2VGKA 1KDSA 1KGGA 3MZFA 1K6RA 4WEKA 2ZQ9A 3IWQA 1DJBA 2PU4A 3M6HA 1I2WA 1MPLA 4Q8IA 1JTGA 3W4OA 3B3XA 1H8YA 4E3MA 2C5WB 1NZUA 4JPMA 1SHVA 2EX8A 3NC8A 3GRJA 4DE3A 4PM5A 3FKVA 3UPOA 3O87A 2RL3A 3HLCA 3NBLA 3BFFA 4OOMA 4OLGA 1G68A 2H0YA 1W5DA 3SS3A 5EVIA 2JCHA 3HUMA 4E3NA 5E43A 3S4XA 1BLSA 1E3UD 2DCFA 2PBYA 5EPHA 5HX9A 4S2LA 1FCOA 2PU2A 3N7WA 4MEZA 3LY4A 5HAIA 5A92A 5GL9A 4E3JA 3DWZA 3HLGA 2ZM8A 3OPPA 2Y2KA 3CMZA 3QNCA 4LV0A 4KG6A 4H8RA 5CXWA 5FQJA 4N1HA 3MZEA 1LI0A 3P98A 2C6WB 2WKIA 4O7DA 3ZG9B 1NZOA 1TEMA 3CG5A 4BLMA 1BSGA 4R4SA 5TFQA 2X02A 2EX2A 1ES5A 1RCJA 1K57A 5AQBA 2XD1A 3ZCZA 2XF3A 4GN2A 3VP4A 1FSYA 4OKPA 4DE2A 3VOYA 3WS4A 5EOEA 3V50A 3SH8A 4KZAA 1PW8A 4UA6A 1VQQA 1LL9A 3WS1A 5CEDA 5HARA 3LO7A 5U47A 3N8LA 5DF7A 5FI7A 3AGEA 5GLAA 3TG9A 3ZG8B 3FKWA 5F1GA 2Y2OA 3IT9A 5AQAA 4KZBA 3UY6A 3MBZA 5CEBA 3BYDA 4JXWA 3G31A 5DF9A 3A3FA 4DE1A 1SCWA 3PTEA 4DXCA 1CI9A 5KSHA 1CI8A 1YMXA 3UE0A 4JF5A 3WRZA 3A3IA 3IF5A 4OPZA 1O07A 3Q7VA 1LHYA 3SOIA 1LLBA 4UHUA 4JF6A 4YFMA 3ZVWA 4GD8A 5CHMA 4X55A 2XGNA 2HPBA 4R3BA 2ZLYA 4FH4A 2XFSA 1IKGA 1NY0A 3PAEA 1MWUA 5TGFA 3IQAA 1ESUA 1BTLA 1MKIA 3Q7ZA 4K0XA 2H5SA 2OLVA 1IYOA 5J8XA 1W79A 1LL5A 4S2KA 4HBTA 5FI6A 4YINA 3PBSA 4N1XA 4S2MA 1ES4A 2ZD8A 3NDGA 4LV1A 4ZJ1A 4BENA 4BQMA 3O86A 2Y91A 4DDSA 2ZC4B 4JXSA 4F94A 1FCNA 4UA7A 1BLHA 4OOYA 3PBRA 2ZM2A 4GDNA 1XGJA 4HBUA 5GHZA 4ZTKA 1BUEA 2I72A 3V39A 1QMEA 1FOFA 3GQZA 5M1AA 4DDYA 3IWOA 1S0WA 3IF6A 3BLSA 1PW1A 5AQ9A 4WEJA 5L2FA 4PM7A 1FR1A 3ITAA 1BZAA 2ZC5B 4KZ5A 4IEDA 3GR2A 1J9MA 1MWSA 4U0XA 3ZGAB 4HEFA 4QB8A 3ZNYA 3M2JA 5FA7A 3IHBA 4XUZA 3BEBA 5EVLA 4M3KA 4C75A 5FAQA 1ESIA 1BLCA 3IH8A 3ZG5A 1IYQA 2P9VB 3HUNA 3BFGA 4WBGA 4E3IA 4IVKA 5JYPA 3W8KA 3UO9A 4B4ZA 4FD8A 1ZKJA 2J7VA 4JBFA 3NCKA 2X01A 4LCLA 3TOIA 2XH9A 3MXSA 2EX9A 1KDWA 2IWBA 1IYPA 3V3SA 4P85A 4JLFA 5FSRA 3TSGA 1NJ4A 4BD0A 3HLWA 1M40A 3Q07A 4LENA 4DE0A 1U60A 1YMSA 4Y7PA 1KVMA 1YLJA 2OLUA 2XDMA 5CTNA 2HDSA 4OP8A 4E3OA 2V20A 4E6WA 1XX2A 1RP5A 5CHJA 5EVIB 4BD1A 1XP4A 4R0QA 1NYMA 3AGFA 3HLFA 1S6RA 4B88A 1JTDA 2GDNA 3MKEA 4X53A 3NY4A 4WMCD 2XLNA 5A93A 4R3JA 2E8IA 3IXBA 1AXBA 3BFDA 4BL3A 3FWLA 3FZCA 3C5AA 3WWXA 3G30A 1ES3A 3C7UA 4OQGA 3NI9A 3RXWA 1DJAA 1K4FA 1MWTA 3A3DA 5FQ9A 2Q9NA 2JBFA 2Y2HA 3O88A 2Q9MA 3P09A 5DTSA 5FATA 4PPRA 1W8YA 4S2PA 4MLLA 1K38A 3VP2A 2HDRA 1ZC2A 1K6SA 2P74A 3OPRA 1K54C 3JYIA 2HP5A 3QHYA 4JKTA 1WE4A 5FI2A 4KZ3A 4QY6A 1K55A 4LV3A 2ZQAA 1H8ZA 3DTMA 4K0WA 5F1FA 4GNUA 4RX2A 4Y0UA 5JYOA 4GDBA 1GA0A 4WYYA 3VSKA 3CZDA 1PZOA 2EFXA 3VSLA 3VFFA 1L0EA 1IEMA 2XEPA 4HESA 3SS4A 1L2SA 3C7VA 4QJGA 5HW3A 3BFEA 4OPYA 1K56D 3IH9A 2JC7A 5KMWA 4EQIA 4DXBA 2WAEA 5EVIC 3IXDA 1SDEA 1ES2A 4ZJ2A 5A91A 4OOLA 3Q7VB 1FR6A 1MY8A 2Y59A 3AGDA 4E3KA 2G2UA 3BM6A 3EQUA 2XQZA 4GKUA 3GTCA 1HD8A 2H10A 2WK0A 2Y2IA 4Z9QA 3OCLA 2ZQ8A 3G34A 3LCEA 1PIOA 3G35A 1IKIA 5CHUA 2Y2LA 4KQRA 5TR7A 5E2HA 3UPNA 1I5QA 4K91A 4KZ6A 1BT5A 4RA7A 1PWGA 2WGWA 3VP0A 1TVFA 2BLSA 5I94A 1YLWA 1K57C 5EVID 5DTKA 4BJPA 2QZ6A 3UE3A 3UN7A 2ZJ9A 1DY6A 4KG2A 2XD5A 1CK3A 2G2WA 3IHAA 4LCMA 2WGVA 2WGIA 1LI9A 1Q2QA 3GMWA 2Z2LB 5A90A 5FQQA 2Y2MA 3UE1A 4R23A 1DJCA 2ZC3B 4OLDA 4MBKA 1XPBA 4DRTA 3MFDA 4U3TA 2X71A 5E2EA 1KE3A 2EXBA 1FSWA 2HDUA 3HVFA 5GLCA 3OC2A 4WZ5C 1N4OA 1Q2PA 3O3VA 5GHXA 1ONHA 2Y4AA 3GV9A 4JF4A 3Q82A 1K25A 4FH2A 4BL2A 2EXAA 2OV5A 4QD4A 2J9OA 2IWDA 1EROA 3M6BA 3IXHA 2A49A 4LV2A 1Y54A 3OZHA 1MXOA 4S2NA 4DKIA 4JXVA 3ITBA 1SKFA 5HFOA 1GHMA 2Y2GA 2H0TA 3V5MA 1L0DA 5GLBA 5IHVA 1E3UA 5KSCA 2V2FF 4Y0OA 4Y0TA 5EECA 5EE8A 2UWXA 1IELA 5FQMA 3VFHA 3HLBA 2EX6A 5FASA 1GA9A 4ZJ3A 1MBLA 2WKHA 4OH0A 5FDHA 4X56A 3W4QA 5KZHA 4S2JA 5DTTA 3FYZA 1JWVA 4OPQA 4X69A 3G2YA 5FAOA 4D2OA 4UA9A 5EUAA 1CEFA 1Z6FA 2XK1A 2ZQ7A 5HAQA 3S1YA 1G6AA 5CRFA 3ZG7B 4EWFA 3MKFA 4IBXA 3V3RA 4UAAA 1PYYA 1PI4A 5HL1A 1ERMA 2ZM0A 2ZC7A 1K56A 4KZ7A 2HP9A 4ZBEA 5CECA 2IWCA 4MBFA 1WYCA 1PZPA 3HL9A 4NETA 3WS5A 4KZ8A 4L0LA 1K54A 2BG1A 1IYSA 2RCXA 2OSUA 1ERQA 1QMFA 5CERA 1W8QA 1CEGA 2WUQA 3N8RA 5E2GA 3S22A 3LY3A 4XUXA 3IXGA 3QNBA 5F82A 3UDIA 2DNSA 1JWZA 1KGFA 2XFTA 4NK3A 2DRWA 3OCNA 1FQGA 4QY5A 4C3QA 1YLPA 1TDLA 4R4RA 3MZDA 3ZNTA 3E2KA 3HBRA 3Q1FA 4R1GA 5DF8A 4EV4A 2Y2JA 2QMIA 1K4EA 2FFFB 3N8SA 4OQ0A 3WRTA 4RVAA 2V1ZA 4GOGA 4XXRA 3C4OA 3N4IA 4N9KA 4CPKA 1EI5A 4EBNA 2WAFA 4E3LA 1NXYA 5HAPA 1YM1A 1YLZA 3RJUA 1GHPA 1FCMA 3PBNA 1YLTA 1ZG6A 3GVBA 1GCEA 1JVJA 1XXMA 1H5XA 5CGSA 2J8YA 4OONA 3MXRA 2QPNA 3IWIA 4KZ4A 4IVIA 4KENB 3ZHHA 4ZDXA 4P0MA 4PM9A 4FCFA 3ZVTA 1WYBA 2B5RA 3FV7A 1KE0A 2WGWB 3PBOA 4OQIA 3G4PA 4PM6A 1K55C 1SDNA 1PI5A 3UNWA 3VOZA 3G32A 3HREA 1NRFA 3WS0A 4E6XA 3VMAA 3BRMA 4FSFA 5CGWA 1KVLA 4P87A 4MBHA 1I2SA 3ZDJA 3BLMA 4OPRA 1BLPA 1HTZA 4RYEA 3HUOA 5GLDA 2ZQCA 3UDXA 1XA7A 1E4DA 1BULA 1L0GA 3SS5A 1PWCA 4QHCA 1TDGA 5AQ7A 3N6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CC1 A;  4IBR A;  1ZG4 A;  4WZ5 A;  1VM1 A;  3M2K A;  2Y55 A;  1N9B A;  3IF6 B;  3A3J A;  2ZQD A;  3BEC A;  4ID4 A;  5M19 A;  4OQH A;  2WZZ A;  2FFY A;  3SH9 A;  1E25 A;  1ONG A;  4KQQ A;  2HP6 A;  2R9X A;  2WAD A;  5CGX A;  4P6B A;  3OPL A;  4U0T A;  1ALQ A;  2Y2N A;  4A5R A;  1HZO A;  4KZ9 A;  4WZ4 A;  3VP1 A;  3SH7 A;  2WZX A;  2Y2P A;  1XGI A;  4CJN A;  4ZAM A;  1JWP A;  5FQI A;  3W4P A;  4WMC A;  3PAG A;  1O7E A;  3BFC A;  4N92 A;  4OP5 A;  2HDQ A;  4GB7 A;  3RXX A;  4EUZ A;  2J9P A;  3HLE A;  2A3U A;  2VGJ A;  5G18 A;  2WKE A;  4JXG A;  4B4X A;  2Y2Q A;  1YT4 A;  3A3E A;  4DF6 A;  4OVD A;  2XR0 A;  3D4F A;  3G2Z A;  4GD6 A;  3I7J A;  5D3O A;  3UDF A;  3HLD A;  3NIA A;  4WEL A;  5FQK A;  5M18 A;  4X68 A;  3LEZ A;  4X6T A;  5DVA A;  3ZFZ A;  1C3B A;  4WM9 A;  1L0F A;  4PM8 A;  3NDE A;  5GHY A;  1RGZ A;  4EBL A;  1KGE A;  3PBT A;  3E2L A;  4RX3 A;  1M6K A;  5E2F A;  3UPP A;  3C4P A;  1EWZ A;  1MWR A;  1W7F A;  3PBQ A;  3ISG A;  5FAP A;  1XA1 A;  4C6Y A;  5BOH A;  5EOO A;  3WS2 A;  3DWK A;  3IF6 C;  5F83 A;  3Q81 A;  3CJM A;  1RGY A;  4N9L A;  2R9W A;  5CTM A;  1KE4 A;  2ZC6 B;  4EBP A;  3EQV A;  2JE5 A;  2Z2M B;  4KG5 A;  1NYY A;  1YLY A;  1YQS A;  4S2I A;  3DW0 A;  3GSG A;  2EFU A;  2WYX A;  2ZMA A;  4KQO A;  4S2O A;  4S2N C;  1XKZ A;  4PMA A;  4QU3 A;  4MNR A;  3OPH A;  1PWD A;  3ZG0 A;  1HVB A;  1GHI A;  4GZB A;  3VP3 A;  2P9V A;  1OME A;  2VGK A;  1KDS A;  1KGG A;  3MZF A;  1K6R A;  4WEK A;  2ZQ9 A;  3IWQ A;  1DJB A;  2PU4 A;  3M6H A;  1I2W A;  1MPL A;  4Q8I A;  1JTG A;  3W4O A;  3B3X A;  1H8Y A;  4E3M A;  2C5W B;  1NZU A;  4JPM A;  1SHV A;  2EX8 A;  3NC8 A;  3GRJ A;  4DE3 A;  4PM5 A;  3FKV A;  3UPO A;  3O87 A;  2RL3 A;  3HLC A;  3NBL A;  3BFF A;  4OOM A;  4OLG A;  1G68 A;  2H0Y A;  1W5D A;  3SS3 A;  5EVI A;  2JCH A;  3HUM A;  4E3N A;  5E43 A;  3S4X A;  1BLS A;  1E3U D;  2DCF A;  2PBY A;  5EPH A;  5HX9 A;  4S2L A;  1FCO A;  2PU2 A;  3N7W A;  4MEZ A;  3LY4 A;  5HAI A;  5A92 A;  5GL9 A;  4E3J A;  3DWZ A;  3HLG A;  2ZM8 A;  3OPP A;  2Y2K A;  3CMZ A;  3QNC A;  4LV0 A;  4KG6 A;  4H8R A;  5CXW A;  5FQJ A;  4N1H A;  3MZE A;  1LI0 A;  3P98 A;  2C6W B;  2WKI A;  4O7D A;  3ZG9 B;  1NZO A;  1TEM A;  3CG5 A;  4BLM A;  1BSG A;  4R4S A;  5TFQ A;  2X02 A;  2EX2 A;  1ES5 A;  1RCJ A;  1K57 A;  5AQB A;  2XD1 A;  3ZCZ A;  2XF3 A;  4GN2 A;  3VP4 A;  1FSY A;  4OKP A;  4DE2 A;  3VOY A;  3WS4 A;  5EOE A;  3V50 A;  3SH8 A;  4KZA A;  1PW8 A;  4UA6 A;  1VQQ A;  1LL9 A;  3WS1 A;  5CED A;  5HAR A;  3LO7 A;  5U47 A;  3N8L A;  5DF7 A;  5FI7 A;  3AGE A;  5GLA A;  3TG9 A;  3ZG8 B;  3FKW A;  5F1G A;  2Y2O A;  3IT9 A;  5AQA A;  4KZB A;  3UY6 A;  3MBZ A;  5CEB A;  3BYD A;  4JXW A;  3G31 A;  5DF9 A;  3A3F A;  4DE1 A;  1SCW A;  3PTE A;  4DXC A;  1CI9 A;  5KSH A;  1CI8 A;  1YMX A;  3UE0 A;  4JF5 A;  3WRZ A;  3A3I A;  3IF5 A;  4OPZ A;  1O07 A;  3Q7V A;  1LHY A;  3SOI A;  1LLB A;  4UHU A;  4JF6 A;  4YFM A;  3ZVW A;  4GD8 A;  5CHM A;  4X55 A;  2XGN A;  2HPB A;  4R3B A;  2ZLY A;  4FH4 A;  2XFS A;  1IKG A;  1NY0 A;  3PAE A;  1MWU A;  5TGF A;  3IQA A;  1ESU A;  1BTL A;  1MKI A;  3Q7Z A;  4K0X A;  2H5S A;  2OLV A;  1IYO A;  5J8X A;  1W79 A;  1LL5 A;  4S2K A;  4HBT A;  5FI6 A;  4YIN A;  3PBS A;  4N1X A;  4S2M A;  1ES4 A;  2ZD8 A;  3NDG A;  4LV1 A;  4ZJ1 A;  4BEN A;  4BQM A;  3O86 A;  2Y91 A;  4DDS A;  2ZC4 B;  4JXS A;  4F94 A;  1FCN A;  4UA7 A;  1BLH A;  4OOY A;  3PBR A;  2ZM2 A;  4GDN A;  1XGJ A;  4HBU A;  5GHZ A;  4ZTK A;  1BUE A;  2I72 A;  3V39 A;  1QME A;  1FOF A;  3GQZ A;  5M1A A;  4DDY A;  3IWO A;  1S0W A;  3IF6 A;  3BLS A;  1PW1 A;  5AQ9 A;  4WEJ A;  5L2F A;  4PM7 A;  1FR1 A;  3ITA A;  1BZA A;  2ZC5 B;  4KZ5 A;  4IED A;  3GR2 A;  1J9M A;  1MWS A;  4U0X A;  3ZGA B;  4HEF A;  4QB8 A;  3ZNY A;  3M2J A;  5FA7 A;  3IHB A;  4XUZ A;  3BEB A;  5EVL A;  4M3K A;  4C75 A;  5FAQ A;  1ESI A;  1BLC A;  3IH8 A;  3ZG5 A;  1IYQ A;  2P9V B;  3HUN A;  3BFG A;  4WBG A;  4E3I A;  4IVK A;  5JYP A;  3W8K A;  3UO9 A;  4B4Z A;  4FD8 A;  1ZKJ A;  2J7V A;  4JBF A;  3NCK A;  2X01 A;  4LCL A;  3TOI A;  2XH9 A;  3MXS A;  2EX9 A;  1KDW A;  2IWB A;  1IYP A;  3V3S A;  4P85 A;  4JLF A;  5FSR A;  3TSG A;  1NJ4 A;  4BD0 A;  3HLW A;  1M40 A;  3Q07 A;  4LEN A;  4DE0 A;  1U60 A;  1YMS A;  4Y7P A;  1KVM A;  1YLJ A;  2OLU A;  2XDM A;  5CTN A;  2HDS A;  4OP8 A;  4E3O A;  2V20 A;  4E6W A;  1XX2 A;  1RP5 A;  5CHJ A;  5EVI B;  4BD1 A;  1XP4 A;  4R0Q A;  1NYM A;  3AGF A;  3HLF A;  1S6R A;  4B88 A;  1JTD A;  2GDN A;  3MKE A;  4X53 A;  3NY4 A;  4WMC D;  2XLN A;  5A93 A;  4R3J A;  2E8I A;  3IXB A;  1AXB A;  3BFD A;  4BL3 A;  3FWL A;  3FZC A;  3C5A A;  3WWX A;  3G30 A;  1ES3 A;  3C7U A;  4OQG A;  3NI9 A;  3RXW A;  1DJA A;  1K4F A;  1MWT A;  3A3D A;  5FQ9 A;  2Q9N A;  2JBF A;  2Y2H A;  3O88 A;  2Q9M A;  3P09 A;  5DTS A;  5FAT A;  4PPR A;  1W8Y A;  4S2P A;  4MLL A;  1K38 A;  3VP2 A;  2HDR A;  1ZC2 A;  1K6S A;  2P74 A;  3OPR A;  1K54 C;  3JYI A;  2HP5 A;  3QHY A;  4JKT A;  1WE4 A;  5FI2 A;  4KZ3 A;  4QY6 A;  1K55 A;  4LV3 A;  2ZQA A;  1H8Z A;  3DTM A;  4K0W A;  5F1F A;  4GNU A;  4RX2 A;  4Y0U A;  5JYO A;  4GDB A;  1GA0 A;  4WYY A;  3VSK A;  3CZD A;  1PZO A;  2EFX A;  3VSL A;  3VFF A;  1L0E A;  1IEM A;  2XEP A;  4HES A;  3SS4 A;  1L2S A;  3C7V A;  4QJG A;  5HW3 A;  3BFE A;  4OPY A;  1K56 D;  3IH9 A;  2JC7 A;  5KMW A;  4EQI A;  4DXB A;  2WAE A;  5EVI C;  3IXD A;  1SDE A;  1ES2 A;  4ZJ2 A;  5A91 A;  4OOL A;  3Q7V B;  1FR6 A;  1MY8 A;  2Y59 A;  3AGD A;  4E3K A;  2G2U A;  3BM6 A;  3EQU A;  2XQZ A;  4GKU A;  3GTC A;  1HD8 A;  2H10 A;  2WK0 A;  2Y2I A;  4Z9Q A;  3OCL A;  2ZQ8 A;  3G34 A;  3LCE A;  1PIO A;  3G35 A;  1IKI A;  5CHU A;  2Y2L A;  4KQR A;  5TR7 A;  5E2H A;  3UPN A;  1I5Q A;  4K91 A;  4KZ6 A;  1BT5 A;  4RA7 A;  1PWG A;  2WGW A;  3VP0 A;  1TVF A;  2BLS A;  5I94 A;  1YLW A;  1K57 C;  5EVI D;  5DTK A;  4BJP A;  2QZ6 A;  3UE3 A;  3UN7 A;  2ZJ9 A;  1DY6 A;  4KG2 A;  2XD5 A;  1CK3 A;  2G2W A;  3IHA A;  4LCM A;  2WGV A;  2WGI A;  1LI9 A;  1Q2Q A;  3GMW A;  2Z2L B;  5A90 A;  5FQQ A;  2Y2M A;  3UE1 A;  4R23 A;  1DJC A;  2ZC3 B;  4OLD A;  4MBK A;  1XPB A;  4DRT A;  3MFD A;  4U3T A;  2X71 A;  5E2E A;  1KE3 A;  2EXB A;  1FSW A;  2HDU A;  3HVF A;  5GLC A;  3OC2 A;  4WZ5 C;  1N4O A;  1Q2P A;  3O3V A;  5GHX A;  1ONH A;  2Y4A A;  3GV9 A;  4JF4 A;  3Q82 A;  1K25 A;  4FH2 A;  4BL2 A;  2EXA A;  2OV5 A;  4QD4 A;  2J9O A;  2IWD A;  1ERO A;  3M6B A;  3IXH A;  2A49 A;  4LV2 A;  1Y54 A;  3OZH A;  1MXO A;  4S2N A;  4DKI A;  4JXV A;  3ITB A;  1SKF A;  5HFO A;  1GHM A;  2Y2G A;  2H0T A;  3V5M A;  1L0D A;  5GLB A;  5IHV A;  1E3U A;  5KSC A;  2V2F F;  4Y0O A;  4Y0T A;  5EEC A;  5EE8 A;  2UWX A;  1IEL A;  5FQM A;  3VFH A;  3HLB A;  2EX6 A;  5FAS A;  1GA9 A;  4ZJ3 A;  1MBL A;  2WKH A;  4OH0 A;  5FDH A;  4X56 A;  3W4Q A;  5KZH A;  4S2J A;  5DTT A;  3FYZ A;  1JWV A;  4OPQ A;  4X69 A;  3G2Y A;  5FAO A;  4D2O A;  4UA9 A;  5EUA A;  1CEF A;  1Z6F A;  2XK1 A;  2ZQ7 A;  5HAQ A;  3S1Y A;  1G6A A;  5CRF A;  3ZG7 B;  4EWF A;  3MKF A;  4IBX A;  3V3R A;  4UAA A;  1PYY A;  1PI4 A;  5HL1 A;  1ERM A;  2ZM0 A;  2ZC7 A;  1K56 A;  4KZ7 A;  2HP9 A;  4ZBE A;  5CEC A;  2IWC A;  4MBF A;  1WYC A;  1PZP A;  3HL9 A;  4NET A;  3WS5 A;  4KZ8 A;  4L0L A;  1K54 A;  2BG1 A;  1IYS A;  2RCX A;  2OSU A;  1ERQ A;  1QMF A;  5CER A;  1W8Q A;  1CEG A;  2WUQ A;  3N8R A;  5E2G A;  3S22 A;  3LY3 A;  4XUX A;  3IXG A;  3QNB A;  5F82 A;  3UDI A;  2DNS A;  1JWZ A;  1KGF A;  2XFT A;  4NK3 A;  2DRW A;  3OCN A;  1FQG A;  4QY5 A;  4C3Q A;  1YLP A;  1TDL A;  4R4R A;  3MZD A;  3ZNT A;  3E2K A;  3HBR A;  3Q1F A;  4R1G A;  5DF8 A;  4EV4 A;  2Y2J A;  2QMI A;  1K4E A;  2FFF B;  3N8S A;  4OQ0 A;  3WRT A;  4RVA A;  2V1Z A;  4GOG A;  4XXR A;  3C4O A;  3N4I A;  4N9K A;  4CPK A;  1EI5 A;  4EBN A;  2WAF A;  4E3L A;  1NXY A;  5HAP A;  1YM1 A;  1YLZ A;  3RJU A;  1GHP A;  1FCM A;  3PBN A;  1YLT A;  1ZG6 A;  3GVB A;  1GCE A;  1JVJ A;  1XXM A;  1H5X A;  5CGS A;  2J8Y A;  4OON A;  3MXR A;  2QPN A;  3IWI A;  4KZ4 A;  4IVI A;  4KEN B;  3ZHH A;  4ZDX A;  4P0M A;  4PM9 A;  4FCF A;  3ZVT A;  1WYB A;  2B5R A;  3FV7 A;  1KE0 A;  2WGW B;  3PBO A;  4OQI A;  3G4P A;  4PM6 A;  1K55 C;  1SDN A;  1PI5 A;  3UNW A;  3VOZ A;  3G32 A;  3HRE A;  1NRF A;  3WS0 A;  4E6X A;  3VMA A;  3BRM A;  4FSF A;  5CGW A;  1KVL A;  4P87 A;  4MBH A;  1I2S A;  3ZDJ A;  3BLM A;  4OPR A;  1BLP A;  1HTZ A;  4RYE A;  3HUO A;  5GLD A;  2ZQC A;  3UDX A;  1XA7 A;  1E4D A;  1BUL A;  1L0G A;  3SS5 A;  1PWC A;  4QHC A;  1TDG A;  5AQ7 A;  3N6I A; 
#chains in the Genus database with same CATH topology
 4IBR A;  3IX3 A;  4WZ5 A;  2MJ6 A;  4RQ9 A;  2FFY A;  2WAD A;  5CGX A;  4P6B A;  2PD8 A;  1HZO A;  4KZ9 A;  3ZYT A;  2Y2P A;  3KSH A;  1JWP A;  5FQI A;  5HDC A;  3UB5 P;  4II7 A;  4LRZ E;  4WMC A;  5L09 A;  4I3I A;  4GB7 A;  3RXX A;  2EWW A;  2W1T B;  3NHQ A;  1YT4 A;  4OVD A;  3D4F A;  5D3O A;  5A8B A;  4K08 A;  5FQK A;  3LEZ A;  5DVA A;  1C3B A;  4CLC E;  1NLZ A;  1M6K A;  3UPP A;  3C4P A;  3E4O A;  1W7F A;  4C6Y A;  2PBD P;  5EOO A;  3IF6 C;  4G3W A;  5AVF A;  4EBP A;  1YLY A;  3GSG A;  2EFU A;  2ZMA A;  3LIE A;  4S2N C;  4L9F A;  2W1R A;  3K3D A;  4GZB A;  4R6L A;  5HD5 A;  1OTA A;  4WEK A;  2ZQ9 A;  2O99 A;  1DJB A;  3M6H A;  3MF0 A;  1I2W A;  4Q8I A;  2YKH A;  1S67 L;  3CLO A;  2EX8 A;  4PM5 A;  3FKV A;  3UPO A;  2RL3 A;  3BFF A;  4OOM A;  1G68 A;  3HUM A;  4E3N A;  2PBY A;  2DCF A;  2XRN A;  4S2L A;  3MQ0 A;  3C8C A;  5GL9 A;  1VEU B;  1TS6 A;  2ZM8 A;  3OPP A;  5CXW A;  4KG6 A;  4UQI M;  3MZE A;  1LI0 A;  3FG8 A;  1F9I A;  1ES5 A;  1RCJ A;  3ZCZ A;  4GN2 A;  1PW8 A;  2KDK A;  1LL9 A;  2PYP A;  3LO7 A;  5U47 A;  5TBM A;  1VB6 A;  5FI7 A;  3T1Q B;  5F1G A;  3IT9 A;  3MBZ A;  1P0Z A;  3BYD A;  4JXW A;  3G31 A;  5DF9 A;  4DE1 A;  2VV8 A;  3A3I A;  3BWL A;  3TJZ C;  4HJ3 A;  2E8J A;  2HPB A;  2R78 A;  4FH4 A;  1TS0 A;  3UB6 A;  3PAE A;  2P08 A;  1BTL A;  4Y13 A;  2QYB A;  5FI6 A;  4YIN A;  3PBS A;  4S2M A;  2ZD8 A;  3NDG A;  4LV1 A;  2QKP A;  3O86 A;  4F94 A;  4MMN A;  1XGJ A;  5GHZ A;  1FOF A;  3GQZ A;  3PR6 A;  3IWO A;  1FR1 A;  1BZA A;  4KZ5 A;  4IED A;  3GR2 A;  4U0X A;  4QB8 A;  3ZNY A;  2H28 A;  3M2J A;  3H9W A;  5HWW A;  5DFY A;  4L9E A;  4M3K A;  1ESI A;  3QP6 A;  3IH8 A;  2P9V B;  2FH5 A;  4WBG A;  5JYP A;  5J4E A;  4FD8 A;  5LBR A;  2JHE A;  2J7V A;  4CLC B;  4JBF A;  2X01 A;  4LCL A;  2XH9 A;  3IX8 A;  3MSH A;  3V3S A;  4EES A;  4JLF A;  1MKM A;  1NJ4 A;  4JGR A;  3KYZ A;  1YLJ A;  5CTN A;  2HDS A;  4OP8 A;  5L07 A;  4E3O A;  3F1O A;  3HJK A;  1XX2 A;  4BD1 A;  4L9G A;  1JTD A;  4EQ1 A;  3T1S A;  3MKE A;  3S7N A;  3NY4 A;  4R3J A;  2E8I A;  1LL8 A;  3IXB A;  2B18 A;  3BFD A;  4BL3 A;  3G30 A;  2VGL M;  3NI9 A;  3QP1 A;  1DJA A;  4H6J A;  1BYW A;  5DTS A;  3P09 A;  1W8Y A;  2CMN A;  1YPR A;  1K54 C;  3JYI A;  4LRX C;  1WE4 A;  4KZ3 A;  4QY6 A;  2HJE A;  4RX2 A;  1OTE A;  4Y0U A;  2OAQ 1;  4BBU A;  3CIT A;  3CZD A;  3CPT B;  4PKY G;  2EFX A;  1L0E A;  4HES A;  4MN6 A;  1F98 A;  5HW3 A;  1MC0 A;  5EVI C;  5HSQ A;  3Q7V B;  3EQU A;  3GTC A;  2OWJ A;  2Y2I A;  4HI4 A;  4EER A;  5E2H A;  1D06 A;  1T1A A;  4QPR A;  1TVF A;  2BLS A;  1K57 C;  4BMW A;  5DTK A;  4BJP A;  3UE3 A;  2G2W A;  2WGI A;  1A0K A;  5FQQ A;  3UE1 A;  3UB7 A;  2ZC3 B;  4MBK A;  1XPB A;  4U3T A;  5DFX A;  3FPW A;  2EXB A;  3KYE A;  3BW6 A;  2PR6 A;  4DJ3 A;  1OTD A;  3OC2 A;  5DJU A;  4WZ5 C;  5HPF A;  1ONH A;  4JF4 A;  2OV5 A;  1HLU P;  1ERO A;  3M6B A;  4WN5 A;  2A49 A;  4DKI A;  4S2N A;  4JXV A;  3T4S A;  3V5M A;  1L0D A;  4R38 A;  2ZL1 B;  5GLB A;  5IHV A;  1WA9 A;  2V2F F;  4Y0O A;  5I5L A;  4LFU A;  5EEC A;  3CAX A;  3VFH A;  5FAS A;  3C2W A;  5FDH A;  4X56 A;  5KZH A;  5EM0 A;  1CEF A;  3OOV A;  3S1Y A;  3ZG7 B;  1IOU A;  3V3R A;  5HL1 A;  2VKS A;  2ZM0 A;  2YKF A;  5CEC A;  1PNE A;  1PZP A;  4HNB A;  2RCX A;  5FEG A;  1QMF A;  3R7W B;  4B93 A;  3LY3 A;  4HH3 A;  2DNS A;  5HWV A;  3HBR A;  4R1G A;  4NEE D;  5DF8 A;  2PYR A;  1W63 Q;  5J7E A;  2GJ3 A;  4XXR A;  3N4I A;  1EI5 A;  1NXY A;  3PBN A;  5HDS A;  1XXM A;  4XT2 A;  3D3O A;  4OON A;  2QWS A;  4BBT A;  4PAU A;  2QPN A;  3LR4 A;  4IVI A;  3ZHH A;  5HD3 A;  4FCF A;  3PBO A;  1KE0 A;  2M1C A;  1OT9 A;  1TD5 A;  3G4P A;  1K55 C;  4WL9 A;  3WS0 A;  3ZQ5 A;  4P87 A;  4MBH A;  4FTX A;  4GCZ A;  4OPR A;  4RYE A;  2ZQC A;  3V67 A;  3UDX A;  1YSP A;  1L0G A;  3SS5 A;  2G7U A;  4CQH A;  1TDG A;  2PAV P;  2CC1 A;  3LID A;  2OAP 1;  3A3J A;  4ID4 A;  1E25 A;  1ONG A;  3SW1 A;  2R9X A;  4MCW A;  3LYX A;  2WKR A;  3DTK A;  4WZ4 A;  3VP1 A;  2WZX A;  1XGI A;  2ZOH A;  4CJN A;  3FPV A;  3PHY A;  4N92 A;  2HDQ A;  2J9P A;  3HLE A;  4HJ4 A;  2WKE A;  2OOL A;  2Y2Q A;  1GSW A;  4GD6 A;  3UB9 A;  3HLD A;  3NIA A;  4YNR A;  4X68 A;  3T4J A;  4X6T A;  3QP4 A;  4PKY A;  3PXP A;  3K3C A;  4PM8 A;  1RGZ A;  3FC7 A;  1KGE A;  1EWZ A;  3PBQ A;  2K2N A;  3CJM A;  3JVU A;  2ZC6 B;  3EQV A;  2Z2M B;  1YQS A;  3T4K A;  4S2O A;  4QU3 A;  3CWF A;  3ZG0 A;  1GHI A;  4P6Z M;  2O9B A;  1K6R A;  3E0Y A;  4GHI B;  1SZV A;  1H8Y A;  4JPM A;  3GRJ A;  3VOL A;  3NBL A;  4KUK A;  4OLG A;  1UGU A;  3SS3 A;  1CJF A;  5EVI A;  4GW9 A;  3S4X A;  1E3U D;  4WUJ A;  5HAI A;  3F1P A;  2PRF A;  4F3L B;  1XJ4 A;  4LV0 A;  3LIB A;  2L4R A;  1ZTU A;  1TEM A;  3CG5 A;  1BSG A;  3KX0 X;  5TFQ A;  3LFV A;  1K57 A;  5AQB A;  2XD1 A;  3VOY A;  3EEH A;  4KZA A;  3WS1 A;  5CED A;  2PDR A;  3N8L A;  5DF7 A;  1J3W A;  3AGE A;  3ZG8 B;  3FKW A;  2Y2O A;  1T18 A;  5CEB A;  2V8C A;  5KSH A;  2VX8 A;  3IF5 A;  4OPZ A;  3SOI A;  4YFM A;  5CHM A;  4NKP A;  3MFX A;  3B42 A;  2ZLY A;  2XFS A;  4HIA A;  1DP6 A;  1NY0 A;  3IQA A;  1ESU A;  4K0X A;  5J8X A;  1IYO A;  1LL5 A;  2BAS A;  4JXS A;  3S7Q A;  4UA7 A;  1BLH A;  2A24 B;  4ARZ A;  2QJ5 A;  4ZTK A;  1BUE A;  5M1A A;  4DDY A;  4DN0 A;  1S0W A;  3BLS A;  5AQ9 A;  2PD7 A;  3ZGA B;  2PHY A;  3IHB A;  5C5K A;  4XUZ A;  4YWZ A;  2ZMF A;  5FAQ A;  1S4S A;  1BLC A;  3BFG A;  2V0U A;  3W8K A;  4B4Z A;  1ZKJ A;  3C30 A;  1H8M A;  3S7O A;  1KDW A;  2IWB A;  4P85 A;  4BD0 A;  3ULF A;  1M40 A;  4DE0 A;  3S7P A;  4Y7P A;  2OLU A;  4O8G A;  4E6W A;  3QP8 A;  1RP5 A;  3UMD A;  4R0Q A;  2XLN A;  1VET B;  1AXB A;  4X1M A;  3K2N A;  5EFW A;  3EWK A;  1T1B A;  1K4F A;  3A3D A;  4MLL A;  1K38 A;  1ZC2 A;  3EOI A;  5HWT A;  1H0M A;  1K55 A;  2ZQA A;  3DTM A;  4GHI A;  3MXQ A;  4GDB A;  4WYY A;  3VSL A;  3H82 B;  1L2S A;  3SS4 A;  2GZA A;  4OPY A;  1K56 D;  4EQI A;  4DXB A;  2WAE A;  3KSG A;  4ZJ2 A;  3AGD A;  4E3K A;  3BM6 A;  4F3L A;  2XQZ A;  2H10 A;  3LGO A;  3OCL A;  3LCE A;  4AFI A;  5CHU A;  2Y2L A;  5TR7 A;  4K91 A;  3ICY A;  3OLO A;  5FL3 A;  2W3F A;  4LCM A;  2WGV A;  1Q2Q A;  2Z2L B;  4FUW A;  3BJN A;  5L8M A;  2JN7 A;  4R23 A;  2P04 A;  4E04 A;  4DRT A;  2XA7 M;  3GV9 A;  3Q82 A;  1K25 A;  4FH2 A;  2J9O A;  2LB9 A;  4LV2 A;  1Y54 A;  3LI8 A;  1SKF A;  5HFO A;  2H0T A;  5HL6 A;  4FOF A;  4ZRR A;  2ACG A;  2B95 A;  3LIA A;  3T12 B;  4Y0T A;  2PT7 A;  3HLB A;  2W1T A;  3OBF A;  4S2J A;  5DTT A;  2M7V A;  1JWV A;  4D2O A;  3G2Y A;  4Y2F A;  4ESP A;  5EUA A;  2XK1 A;  4MDZ A;  1T19 A;  5FDS A;  1OJG A;  4UAA A;  3RH8 B;  1K56 A;  4MBF A;  1SKO B;  2K7S A;  1ERQ A;  5CER A;  5AVE A;  5E2G A;  4XUX A;  3IXG A;  5F82 A;  3UDI A;  1JWZ A;  4NK3 A;  3OCN A;  4Y17 A;  1TDL A;  3ZNT A;  3E2K A;  1DRM A;  1V9Y A;  4OQ0 A;  3WRT A;  2WAF A;  4E3L A;  5HAP A;  2VK3 A;  1FCM A;  1XFQ A;  1YLT A;  3GVB A;  1JVJ A;  3CUE A;  1H5X A;  3MXR A;  1X0O A;  2O0Y A;  4UEY A;  4PM9 A;  1VEU A;  4CLC D;  2WGW B;  4PM6 A;  3VE4 A;  1PI5 A;  3UNW A;  3VOZ A;  1JNU A;  1LSV A;  4E6X A;  3VMA A;  3BRM A;  1I2S A;  3LR0 A;  1HTZ A;  2FZ0 A;  2KLI A;  3HUO A;  5GLD A;  3VE3 A;  1N9O A;  4G3V A;  1BUL A;  1PWC A;  1MZU A;  4QHC A;  3F1N B;  3T1R A;  3KYQ A;  1VM1 A;  3M2K A;  2Y55 A;  4B9O A;  3BEC A;  5M19 A;  2WZZ A;  3SH9 A;  4KQQ A;  2HP6 A;  2W3E A;  4U0T A;  2Y2N A;  4A5R A;  4IUK A;  4G3K A;  2XRO A;  4ZAM A;  3NOP C;  3W4P A;  3EGX C;  3IS2 B;  1O7E A;  3A0V A;  3BFC A;  4OP5 A;  2V8F A;  4EUZ A;  2A3U A;  4UQI S;  4B4X A;  2XR0 A;  3MR0 A;  3UDF A;  3H7W B;  5M18 A;  3ZFZ A;  4WF0 A;  1L0F A;  2GNX A;  3HCY A;  3NDE A;  5GHY A;  2NUP C;  4EBL A;  3PBT A;  3E2L A;  3ISG A;  5FAP A;  1XA1 A;  1S66 L;  2O9A A;  3QP5 A;  3LUQ A;  4GS9 B;  4N9L A;  2R9W A;  1TS8 A;  1N9N A;  2JE5 A;  1NYY A;  3DW0 A;  4KQO A;  2EA9 A;  4GLQ A;  2P9V A;  1OME A;  2VGK A;  1KDS A;  4I38 A;  1KGG A;  4CLC A;  2PU4 A;  4Y15 A;  2ZBB A;  1JTG A;  3W4O A;  3B3X A;  4E3M A;  1NZU A;  3NC8 A;  3O87 A;  3W2Z A;  3HLC A;  3L9K A;  4I3A A;  2JCH A;  5E43 A;  1BLS A;  5HX9 A;  2PU2 A;  3N7W A;  3LY4 A;  3T4O A;  3U2A A;  5A92 A;  1XJ2 A;  4JGQ A;  3QNC A;  2D02 A;  4N1H A;  3D72 A;  3P98 A;  4M4X A;  2C6W B;  4HHD A;  2WKI A;  4O7D A;  1H3Q A;  1NZO A;  4BLM A;  2X02 A;  2V1B A;  2XF3 A;  3A0S A;  1FSY A;  4OKP A;  3WS4 A;  5EOE A;  3V50 A;  5TJJ A;  1F5M A;  3CPT A;  3EEA A;  2J80 A;  3TG9 A;  1Z09 A;  1GSV A;  5AQA A;  4KZB A;  1PRQ A;  2V1A A;  3A3F A;  1NLY A;  3PTE A;  1CI8 A;  1YKD A;  3Q7V A;  1LHY A;  4JF6 A;  3ZVW A;  4KUO A;  4R3B A;  1OTB A;  5FEF A;  2Y79 A;  1IKG A;  2INW A;  2VGL S;  3R4K A;  3Q7Z A;  2H5S A;  2OLV A;  3E4P A;  2HF6 A;  4HBT A;  2HGV A;  2PR5 A;  4N1X A;  3CI6 A;  4Q0H A;  4OOY A;  3P7N A;  3PBR A;  1S1Y A;  3F1N A;  2I72 A;  3V39 A;  1QME A;  2JKR I;  3TRC A;  3BY9 A;  4WEJ A;  2K31 A;  5L2F A;  4PM7 A;  2ZC5 B;  4R70 A;  4EEP A;  1J9M A;  1MWS A;  1IFQ A;  1XJ6 A;  4HEF A;  3BQA A;  5FA7 A;  2JKT I;  4C75 A;  2ZMV A;  1IYQ A;  1T1C A;  3HUN A;  3IS2 A;  2HJ9 C;  3TOI A;  3MXS A;  2ZL1 A;  2EX9 A;  1IYP A;  2JKT M;  5F6A A;  3HLW A;  3Q07 A;  2V20 A;  3RFB A;  1XP4 A;  1NYM A;  2NUT C;  3AGF A;  1S6R A;  4B88 A;  2J3T D;  2W0N A;  4X53 A;  4WMC D;  1NWZ A;  1CQA A;  1CF0 A;  3B33 A;  3FWL A;  3WWX A;  3JVV A;  2W3G A;  3C7U A;  2ZOI A;  2Z6C A;  1MWT A;  3O88 A;  2Q9M A;  3L7H A;  3DTE A;  4S2P A;  3VP2 A;  2P74 A;  3QHY A;  5FI2 A;  3R7W A;  4JGO A;  1H8Z A;  4GJ4 A;  4DMZ A;  1TF1 A;  3LIC A;  3GEC A;  1PZO A;  5TBM B;  1IEM A;  2XEP A;  2Q0O A;  3BFE A;  5EVE A;  1XJ3 A;  3IH9 A;  5KMW A;  1Y4O A;  1K0K A;  1SDE A;  3LR5 A;  1ES2 A;  5A91 A;  2AVX A;  4OOL A;  2Y59 A;  2G2U A;  3JPU A;  1HD8 A;  3P01 A;  3CUE C;  4Z9Q A;  5G4Y A;  1FIL A;  3B47 A;  2ZQ8 A;  3G34 A;  4BBV A;  1PIO A;  3G35 A;  1F2K A;  4KQR A;  4HY8 A;  3UPN A;  4RA7 A;  1BT5 A;  5IU1 A;  1KOU A;  5I94 A;  1YLW A;  4NXE A;  3UN7 A;  1DY6 A;  2XD5 A;  1CK3 A;  3IHA A;  3GMW A;  2Y2M A;  1DJC A;  4OLD A;  4X1L A;  3MFD A;  2X71 A;  5E2E A;  3HVF A;  1PFL A;  1N4O A;  1Q2P A;  5GHX A;  4HP4 A;  2Y4A A;  2QHK A;  4QD4 A;  3IBJ A;  3OZH A;  1MXO A;  1GHM A;  2W3D A;  2V0W A;  4ME4 A;  1E3U A;  4BWI A;  2O9C A;  2UWX A;  2EX6 A;  3LEQ A;  1MBL A;  1W63 M;  3W4Q A;  3F1O B;  4X69 A;  1Z6F A;  5F5Y A;  2WKP A;  2IA2 A;  3O5Y A;  3UME A;  3MQQ A;  4KZ7 A;  2HP9 A;  4O01 A;  4H6J B;  3HL9 A;  4KZ8 A;  2BG1 A;  1IYS A;  1OPX A;  4NXG A;  1S1Z A;  2VA0 A;  4I39 A;  2VJW A;  1W8Q A;  1CEG A;  3A0R A;  3BQ8 A;  1FIK A;  4QY5 A;  1KGF A;  4NXB A;  2DRW A;  1FQG A;  1YLP A;  3MZD A;  3G6O A;  4CLC C;  2VLG A;  4EV4 A;  2Y2J A;  2QMI A;  3N8S A;  2V1Z A;  4GOG A;  5HDD A;  4EBN A;  1YM1 A;  3RJU A;  1LSX A;  1ZG6 A;  5CGS A;  2J8Y A;  3IWI A;  4KZ4 A;  3E98 A;  3NJA A;  4ZDX A;  1AWI A;  4HOI A;  3ZVT A;  1WYB A;  2P7J A;  4OQI A;  3RTY A;  1SDN A;  4DJ2 A;  3G32 A;  3HRE A;  4KQD A;  1OT6 A;  4P6Z S;  1BLP A;  1XA7 A;  3D9Y A;  3LR3 A;  3N6I A;  1ZG4 A;  1ACF A;  1N9B A;  3IF6 B;  2ZQD A;  4OQH A;  4LGW A;  4IHQ A;  3OPL A;  1ALQ A;  3IBR A;  3MQO A;  2KOI A;  4HH2 A;  3SH7 A;  1S4R A;  3NEC A;  2JKG A;  3PAG A;  3PYP A;  2VGJ A;  5G18 A;  4JXG A;  1N9L A;  3A3E A;  5KIZ A;  4DF6 A;  5EV0 A;  2XSS A;  5IS1 A;  3G2Z A;  2HV1 A;  3I7J A;  4WEL A;  4WM9 A;  3T4L A;  2A24 A;  2VEA A;  4RX3 A;  5E2F A;  1MWR A;  5BOH A;  4MN5 A;  3WS2 A;  3DWK A;  5F83 A;  3Q81 A;  1RGY A;  5CTM A;  1KE4 A;  4S2I A;  1D1J A;  4KG5 A;  2WYX A;  1XKZ A;  4PMA A;  4MNR A;  2BTF P;  3OPH A;  4YOF A;  1PWD A;  1HVB A;  3VP3 A;  3MZF A;  3GDI A;  3IWQ A;  4EW7 A;  5F69 A;  1MPL A;  2C5W B;  1SHV A;  4DE3 A;  2H0Y A;  1W5D A;  5HZH A;  4XT2 B;  5EPH A;  1FCO A;  4MEZ A;  1VET A;  4E3J A;  3DWZ A;  3HLG A;  2Z6D A;  2Y2K A;  3CMZ A;  5FQJ A;  4H8R A;  2V9A A;  2VV7 A;  3SZT A;  3DBA A;  3ZG9 B;  2I9V A;  5EM1 A;  4EXO A;  2M7U A;  3TW8 A;  4R4S A;  2EX2 A;  4ETX A;  3VP4 A;  4DE2 A;  3DTI A;  3SH8 A;  1L3L A;  4O0P A;  4UA6 A;  1VQQ A;  2QJ7 A;  3MMH A;  5HAR A;  1ODV A;  1GSX A;  5GLA A;  3H82 A;  2L1M A;  3UY6 A;  1STZ A;  1V9Z A;  1SCW A;  4DXC A;  1CI9 A;  1YMX A;  2VV6 A;  3UE0 A;  4JF5 A;  3UB8 A;  3WRZ A;  1O07 A;  3LI9 A;  1LLB A;  4UHU A;  4GD8 A;  4Y3I A;  4X55 A;  2XGN A;  1ZHH B;  1MWU A;  5TGF A;  1MKI A;  1W79 A;  4S2K A;  4HP9 A;  4BEN A;  4BQM A;  1ES4 A;  3VV4 A;  4ZJ1 A;  4Y5F A;  2Y91 A;  5DKL A;  4DDS A;  2ZC4 B;  1NRJ A;  1FCN A;  4Q0I A;  1DP9 A;  3T50 A;  2ZM2 A;  4GDN A;  4HBU A;  3E4Q A;  3IF6 A;  1PW1 A;  2OWH A;  1VHM A;  3ITA A;  4HJ6 A;  4Q0J A;  4JGP A;  3BEB A;  5EVL A;  2A2L A;  2W27 A;  2J3T C;  3ZG5 A;  4E3I A;  4IVK A;  3UO9 A;  1G5U A;  4X25 A;  3NCK A;  4R3A A;  4HQA A;  4EET B;  5FSR A;  3TSG A;  2GX5 A;  4LEN A;  1U60 A;  1YMS A;  3NUL A;  1KVM A;  2XDM A;  5CHJ A;  5EVI B;  3T1X A;  3HLF A;  2GDN A;  3F1P B;  5A93 A;  3MJQ A;  3HJI A;  3FZC A;  3C5A A;  3LIF A;  2XA7 S;  1ES3 A;  4OQG A;  3RXW A;  5FQ9 A;  2Q9N A;  2JBF A;  2Y2H A;  5FAT A;  1SKO A;  4PPR A;  2HDR A;  1K6S A;  3OPR A;  4I5S A;  2HP5 A;  4JKT A;  4D60 A;  5J3W A;  3BY8 A;  5MC7 A;  2WKQ A;  4LV3 A;  3T4Q A;  3KSI A;  4K0W A;  4QWO A;  5F1F A;  3MS6 A;  4GNU A;  5JYO A;  1GA0 A;  2D01 A;  3VSK A;  4MN7 A;  3VFF A;  3C7V A;  4QJG A;  2HZ5 A;  2JC7 A;  3IXD A;  4I3J A;  1OJ5 A;  4NXF A;  1FR6 A;  1MY8 A;  2LB5 A;  4GKU A;  2WK0 A;  1IKI A;  1I5Q A;  4KZ6 A;  1PWG A;  2WGW A;  3VP0 A;  4IJG A;  5EVI D;  2QZ6 A;  2EWV A;  2ZJ9 A;  4KG2 A;  1P97 A;  4ARZ B;  1LI9 A;  1D7E A;  5A90 A;  1TS7 A;  1G28 A;  1XFN A;  2J3W A;  1G6O A;  3IX4 A;  1KE3 A;  1FSW A;  1DP8 A;  2HDU A;  1UWP X;  5GLC A;  3EGD C;  3CHW P;  3O3V A;  4BL2 A;  2EXA A;  2IWD A;  4WLA A;  4EU0 A;  3IXH A;  5G4Z A;  4Z1W A;  3ITB A;  2Y2G A;  2JKR M;  1Y28 A;  5KSC A;  1LSW A;  1P9W A;  3T4T A;  5EE8 A;  1IEL A;  5AJG A;  5FQM A;  1GA9 A;  4ZJ3 A;  2WKH A;  5CX7 A;  5L10 A;  2Y8H A;  4OH0 A;  3C38 A;  1LT0 A;  3FYZ A;  1YAX A;  4OPQ A;  5FAO A;  5HPI A;  4UA9 A;  2JKF A;  2ZQ7 A;  5HAQ A;  1EW0 A;  3H7W A;  1G6A A;  5CRF A;  4EWF A;  2VZW A;  3MKF A;  4IBX A;  1PYY A;  1PI4 A;  1ERM A;  2UV0 E;  2ZC7 A;  4NG2 A;  4ZBE A;  2IWC A;  5F68 A;  1WYC A;  4NET A;  3WS5 A;  3KSF A;  4GS9 A;  4L0L A;  5DKK A;  1K54 A;  5DJT A;  1YSQ A;  2OSU A;  2L0W A;  2WUQ A;  3N8R A;  1UWN X;  3S22 A;  4LRY C;  3QNB A;  2XFT A;  4C3Q A;  4LLO B;  4R4R A;  3Q1F A;  3QP2 A;  1K4E A;  3KO6 A;  2FFF B;  4RVA A;  4CPK A;  2DMW A;  3C4O A;  4N9K A;  1YLZ A;  1OTI A;  3U4L P;  1GHP A;  4PHT A;  2B02 A;  1GCE A;  4EUV A;  3UE6 A;  3NOU C;  4KEN B;  3TE8 A;  4P0M A;  2W3H A;  4IUH A;  2B5R A;  2KX6 A;  3FV7 A;  4ETZ A;  1NRF A;  4LPZ A;  4FSF A;  5CGW A;  4EEU A;  1KVL A;  3DAV A;  1P9R A;  3ZDJ A;  3BLM A;  3NOT C;  1E4D A;  5K5B A;  5IT5 A;  5AQ7 A; 
#chains in the Genus database with same CATH homology
 2CC1 A;  4IBR A;  1ZG4 A;  4WZ5 A;  1VM1 A;  3M2K A;  2Y55 A;  1N9B A;  3IF6 B;  3A3J A;  2ZQD A;  3BEC A;  4ID4 A;  5M19 A;  4OQH A;  2WZZ A;  2FFY A;  3SH9 A;  1E25 A;  1ONG A;  4KQQ A;  2HP6 A;  2R9X A;  2WAD A;  5CGX A;  4P6B A;  3OPL A;  4U0T A;  1ALQ A;  2Y2N A;  4A5R A;  1HZO A;  4KZ9 A;  4WZ4 A;  3VP1 A;  3SH7 A;  2WZX A;  2Y2P A;  1XGI A;  4CJN A;  4ZAM A;  1JWP A;  5FQI A;  3W4P A;  4WMC A;  3PAG A;  1O7E A;  3BFC A;  4N92 A;  4OP5 A;  2HDQ A;  4GB7 A;  3RXX A;  4EUZ A;  2J9P A;  3HLE A;  2A3U A;  2VGJ A;  5G18 A;  2WKE A;  4JXG A;  4B4X A;  2Y2Q A;  1YT4 A;  3A3E A;  4DF6 A;  4OVD A;  2XR0 A;  3D4F A;  3G2Z A;  4GD6 A;  3I7J A;  5D3O A;  3UDF A;  3HLD A;  3NIA A;  4WEL A;  5FQK A;  5M18 A;  4X68 A;  3LEZ A;  4X6T A;  5DVA A;  3ZFZ A;  1C3B A;  4WM9 A;  1L0F A;  4PM8 A;  3NDE A;  5GHY A;  1RGZ A;  4EBL A;  1KGE A;  3PBT A;  3E2L A;  4RX3 A;  1M6K A;  5E2F A;  3UPP A;  3C4P A;  1EWZ A;  1MWR A;  1W7F A;  3PBQ A;  3ISG A;  5FAP A;  1XA1 A;  4C6Y A;  5BOH A;  5EOO A;  3WS2 A;  3DWK A;  3IF6 C;  5F83 A;  3Q81 A;  3CJM A;  1RGY A;  4N9L A;  2R9W A;  5CTM A;  1KE4 A;  2ZC6 B;  4EBP A;  3EQV A;  2JE5 A;  2Z2M B;  4KG5 A;  1NYY A;  1YLY A;  1YQS A;  4S2I A;  3DW0 A;  3GSG A;  2EFU A;  2WYX A;  2ZMA A;  4KQO A;  4S2O A;  4S2N C;  1XKZ A;  4PMA A;  4QU3 A;  4MNR A;  3OPH A;  1PWD A;  3ZG0 A;  1HVB A;  1GHI A;  4GZB A;  3VP3 A;  2P9V A;  1OME A;  2VGK A;  1KDS A;  1KGG A;  3MZF A;  1K6R A;  4WEK A;  2ZQ9 A;  3IWQ A;  1DJB A;  2PU4 A;  3M6H A;  1I2W A;  1MPL A;  4Q8I A;  1JTG A;  3W4O A;  3B3X A;  1H8Y A;  4E3M A;  2C5W B;  1NZU A;  4JPM A;  1SHV A;  2EX8 A;  3NC8 A;  3GRJ A;  4DE3 A;  4PM5 A;  3FKV A;  3UPO A;  3O87 A;  2RL3 A;  3HLC A;  3NBL A;  3BFF A;  4OOM A;  4OLG A;  1G68 A;  2H0Y A;  1W5D A;  3SS3 A;  5EVI A;  2JCH A;  3HUM A;  4E3N A;  5E43 A;  3S4X A;  1BLS A;  1E3U D;  2DCF A;  2PBY A;  5EPH A;  5HX9 A;  4S2L A;  1FCO A;  2PU2 A;  3N7W A;  4MEZ A;  3LY4 A;  5HAI A;  5A92 A;  5GL9 A;  4E3J A;  3DWZ A;  3HLG A;  2ZM8 A;  3OPP A;  2Y2K A;  3CMZ A;  3QNC A;  4LV0 A;  4KG6 A;  4H8R A;  5CXW A;  5FQJ A;  4N1H A;  3MZE A;  1LI0 A;  3P98 A;  2C6W B;  2WKI A;  4O7D A;  3ZG9 B;  1NZO A;  1TEM A;  3CG5 A;  4BLM A;  1BSG A;  4R4S A;  5TFQ A;  2X02 A;  2EX2 A;  1ES5 A;  1RCJ A;  1K57 A;  5AQB A;  2XD1 A;  3ZCZ A;  2XF3 A;  4GN2 A;  3VP4 A;  1FSY A;  4OKP A;  4DE2 A;  3VOY A;  3WS4 A;  5EOE A;  3V50 A;  3SH8 A;  4KZA A;  1PW8 A;  4UA6 A;  1VQQ A;  1LL9 A;  3WS1 A;  5CED A;  5HAR A;  3LO7 A;  5U47 A;  3N8L A;  5DF7 A;  5FI7 A;  3AGE A;  5GLA A;  3TG9 A;  3ZG8 B;  3FKW A;  5F1G A;  2Y2O A;  3IT9 A;  5AQA A;  4KZB A;  3UY6 A;  3MBZ A;  5CEB A;  3BYD A;  4JXW A;  3G31 A;  5DF9 A;  3A3F A;  4DE1 A;  1SCW A;  3PTE A;  4DXC A;  1CI9 A;  5KSH A;  1CI8 A;  1YMX A;  3UE0 A;  4JF5 A;  3WRZ A;  3A3I A;  3IF5 A;  4OPZ A;  1O07 A;  3Q7V A;  1LHY A;  3SOI A;  1LLB A;  4UHU A;  4JF6 A;  4YFM A;  3ZVW A;  4GD8 A;  5CHM A;  4X55 A;  2XGN A;  2HPB A;  4R3B A;  2ZLY A;  4FH4 A;  2XFS A;  1IKG A;  1NY0 A;  3PAE A;  1MWU A;  5TGF A;  3IQA A;  1ESU A;  1BTL A;  1MKI A;  3Q7Z A;  4K0X A;  2H5S A;  2OLV A;  1IYO A;  5J8X A;  1W79 A;  1LL5 A;  4S2K A;  4HBT A;  5FI6 A;  4YIN A;  3PBS A;  4N1X A;  4S2M A;  1ES4 A;  2ZD8 A;  3NDG A;  4LV1 A;  4ZJ1 A;  4BEN A;  4BQM A;  3O86 A;  2Y91 A;  4DDS A;  2ZC4 B;  4JXS A;  4F94 A;  1FCN A;  4UA7 A;  1BLH A;  4OOY A;  3PBR A;  2ZM2 A;  4GDN A;  1XGJ A;  4HBU A;  5GHZ A;  4ZTK A;  1BUE A;  2I72 A;  3V39 A;  1QME A;  1FOF A;  3GQZ A;  5M1A A;  4DDY A;  3IWO A;  1S0W A;  3IF6 A;  3BLS A;  1PW1 A;  5AQ9 A;  4WEJ A;  5L2F A;  4PM7 A;  1FR1 A;  3ITA A;  1BZA A;  2ZC5 B;  4KZ5 A;  4IED A;  3GR2 A;  1J9M A;  1MWS A;  4U0X A;  3ZGA B;  4HEF A;  4QB8 A;  3ZNY A;  3M2J A;  5FA7 A;  3IHB A;  4XUZ A;  3BEB A;  5EVL A;  4M3K A;  4C75 A;  5FAQ A;  1ESI A;  1BLC A;  3IH8 A;  3ZG5 A;  1IYQ A;  2P9V B;  3HUN A;  3BFG A;  4WBG A;  4E3I A;  4IVK A;  5JYP A;  3W8K A;  3UO9 A;  4B4Z A;  4FD8 A;  1ZKJ A;  2J7V A;  4JBF A;  3NCK A;  2X01 A;  4LCL A;  3TOI A;  2XH9 A;  3MXS A;  2EX9 A;  1KDW A;  2IWB A;  1IYP A;  3V3S A;  4P85 A;  4JLF A;  5FSR A;  3TSG A;  1NJ4 A;  4BD0 A;  3HLW A;  1M40 A;  3Q07 A;  4LEN A;  4DE0 A;  1U60 A;  1YMS A;  4Y7P A;  1KVM A;  1YLJ A;  2OLU A;  2XDM A;  5CTN A;  2HDS A;  4OP8 A;  4E3O A;  2V20 A;  4E6W A;  1XX2 A;  1RP5 A;  5CHJ A;  5EVI B;  4BD1 A;  1XP4 A;  4R0Q A;  1NYM A;  3AGF A;  3HLF A;  1S6R A;  4B88 A;  1JTD A;  2GDN A;  3MKE A;  4X53 A;  3NY4 A;  4WMC D;  2XLN A;  5A93 A;  4R3J A;  2E8I A;  3IXB A;  1AXB A;  3BFD A;  4BL3 A;  3FWL A;  3FZC A;  3C5A A;  3WWX A;  3G30 A;  1ES3 A;  3C7U A;  4OQG A;  3NI9 A;  3RXW A;  1DJA A;  1K4F A;  1MWT A;  3A3D A;  5FQ9 A;  2Q9N A;  2JBF A;  2Y2H A;  3O88 A;  2Q9M A;  3P09 A;  5DTS A;  5FAT A;  4PPR A;  1W8Y A;  4S2P A;  4MLL A;  1K38 A;  3VP2 A;  2HDR A;  1ZC2 A;  1K6S A;  2P74 A;  3OPR A;  1K54 C;  3JYI A;  2HP5 A;  3QHY A;  4JKT A;  1WE4 A;  5FI2 A;  4KZ3 A;  4QY6 A;  1K55 A;  4LV3 A;  2ZQA A;  1H8Z A;  3DTM A;  4K0W A;  5F1F A;  4GNU A;  4RX2 A;  4Y0U A;  5JYO A;  4GDB A;  1GA0 A;  4WYY A;  3VSK A;  3CZD A;  1PZO A;  2EFX A;  3VSL A;  3VFF A;  1L0E A;  1IEM A;  2XEP A;  4HES A;  3SS4 A;  1L2S A;  3C7V A;  4QJG A;  5HW3 A;  3BFE A;  4OPY A;  1K56 D;  3IH9 A;  2JC7 A;  5KMW A;  4EQI A;  4DXB A;  2WAE A;  5EVI C;  3IXD A;  1SDE A;  1ES2 A;  4ZJ2 A;  5A91 A;  4OOL A;  3Q7V B;  1FR6 A;  1MY8 A;  2Y59 A;  3AGD A;  4E3K A;  2G2U A;  3BM6 A;  3EQU A;  2XQZ A;  4GKU A;  3GTC A;  1HD8 A;  2H10 A;  2WK0 A;  2Y2I A;  4Z9Q A;  3OCL A;  2ZQ8 A;  3G34 A;  3LCE A;  1PIO A;  3G35 A;  1IKI A;  5CHU A;  2Y2L A;  4KQR A;  5TR7 A;  5E2H A;  3UPN A;  1I5Q A;  4K91 A;  4KZ6 A;  1BT5 A;  4RA7 A;  1PWG A;  2WGW A;  3VP0 A;  1TVF A;  2BLS A;  5I94 A;  1YLW A;  1K57 C;  5EVI D;  5DTK A;  4BJP A;  2QZ6 A;  3UE3 A;  3UN7 A;  2ZJ9 A;  1DY6 A;  4KG2 A;  2XD5 A;  1CK3 A;  2G2W A;  3IHA A;  4LCM A;  2WGV A;  2WGI A;  1LI9 A;  1Q2Q A;  3GMW A;  2Z2L B;  5A90 A;  5FQQ A;  2Y2M A;  3UE1 A;  4R23 A;  1DJC A;  2ZC3 B;  4OLD A;  4MBK A;  1XPB A;  4DRT A;  3MFD A;  4U3T A;  2X71 A;  5E2E A;  1KE3 A;  2EXB A;  1FSW A;  2HDU A;  3HVF A;  5GLC A;  3OC2 A;  4WZ5 C;  1N4O A;  1Q2P A;  3O3V A;  5GHX A;  1ONH A;  2Y4A A;  3GV9 A;  4JF4 A;  3Q82 A;  1K25 A;  4FH2 A;  4BL2 A;  2EXA A;  2OV5 A;  4QD4 A;  2J9O A;  2IWD A;  1ERO A;  3M6B A;  3IXH A;  2A49 A;  4LV2 A;  1Y54 A;  3OZH A;  1MXO A;  4S2N A;  4DKI A;  4JXV A;  3ITB A;  1SKF A;  5HFO A;  1GHM A;  2Y2G A;  2H0T A;  3V5M A;  1L0D A;  5GLB A;  5IHV A;  1E3U A;  5KSC A;  2V2F F;  4Y0O A;  4Y0T A;  5EEC A;  5EE8 A;  2UWX A;  1IEL A;  5FQM A;  3VFH A;  3HLB A;  2EX6 A;  5FAS A;  1GA9 A;  4ZJ3 A;  1MBL A;  2WKH A;  4OH0 A;  5FDH A;  4X56 A;  3W4Q A;  5KZH A;  4S2J A;  5DTT A;  3FYZ A;  1JWV A;  4OPQ A;  4X69 A;  3G2Y A;  5FAO A;  4D2O A;  4UA9 A;  5EUA A;  1CEF A;  1Z6F A;  2XK1 A;  2ZQ7 A;  5HAQ A;  3S1Y A;  1G6A A;  5CRF A;  3ZG7 B;  4EWF A;  3MKF A;  4IBX A;  3V3R A;  4UAA A;  1PYY A;  1PI4 A;  5HL1 A;  1ERM A;  2ZM0 A;  2ZC7 A;  1K56 A;  4KZ7 A;  2HP9 A;  4ZBE A;  5CEC A;  2IWC A;  4MBF A;  1WYC A;  1PZP A;  3HL9 A;  4NET A;  3WS5 A;  4KZ8 A;  4L0L A;  1K54 A;  2BG1 A;  1IYS A;  2RCX A;  2OSU A;  1ERQ A;  1QMF A;  5CER A;  1W8Q A;  1CEG A;  2WUQ A;  3N8R A;  5E2G A;  3S22 A;  3LY3 A;  4XUX A;  3IXG A;  3QNB A;  5F82 A;  3UDI A;  2DNS A;  1JWZ A;  1KGF A;  2XFT A;  4NK3 A;  2DRW A;  3OCN A;  1FQG A;  4QY5 A;  4C3Q A;  1YLP A;  1TDL A;  4R4R A;  3MZD A;  3ZNT A;  3E2K A;  3HBR A;  3Q1F A;  4R1G A;  5DF8 A;  4EV4 A;  2Y2J A;  2QMI A;  1K4E A;  2FFF B;  3N8S A;  4OQ0 A;  3WRT A;  4RVA A;  2V1Z A;  4GOG A;  4XXR A;  3C4O A;  3N4I A;  4N9K A;  4CPK A;  1EI5 A;  4EBN A;  2WAF A;  4E3L A;  1NXY A;  5HAP A;  1YM1 A;  1YLZ A;  3RJU A;  1GHP A;  1FCM A;  3PBN A;  1YLT A;  1ZG6 A;  3GVB A;  1GCE A;  1JVJ A;  1XXM A;  1H5X A;  5CGS A;  2J8Y A;  4OON A;  3MXR A;  2QPN A;  3IWI A;  4KZ4 A;  4IVI A;  4KEN B;  3ZHH A;  4ZDX A;  4P0M A;  4PM9 A;  4FCF A;  3ZVT A;  1WYB A;  2B5R A;  3FV7 A;  1KE0 A;  2WGW B;  3PBO A;  4OQI A;  3G4P A;  4PM6 A;  1K55 C;  1SDN A;  1PI5 A;  3UNW A;  3VOZ A;  3G32 A;  3HRE A;  1NRF A;  3WS0 A;  4E6X A;  3VMA A;  3BRM A;  4FSF A;  5CGW A;  1KVL A;  4P87 A;  4MBH A;  1I2S A;  3ZDJ A;  3BLM A;  4OPR A;  1BLP A;  1HTZ A;  4RYE A;  3HUO A;  5GLD A;  2ZQC A;  3UDX A;  1XA7 A;  1E4D A;  1BUL A;  1L0G A;  3SS5 A;  1PWC A;  4QHC A;  1TDG A;  5AQ7 A;  3N6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...