3O5YA

The crystal structure of the gaf domain of a two-component sensor histidine kinase from bacillus halodurans to 2.45a
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
142
Chain Sequence
MSLDDIINNMIDKLKLLVHFDRISFLLLANETLKLSHVYPKGSHSLDIGSTIPKEQSLYWSALDQRQTIFRSLTDTQDNFYEKQYLAILDLKSILVIPIYSKNKRVGVLSIGRKQQIDWSLDDLAFLEQLTDHLAVSIENVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein
publication title The Crystal Structure of the GAF domain of a two-component sensor histidine kinase from Bacillus halodurans to 2.45A
rcsb
source organism Bacillus halodurans
molecule tags Transcription regulator
total genus 38
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3o5yA00
3EEAA 5HL6A 2W1RA 2XSSA 2VJWA 4G3WA 4PAUA 2XRNA 3BJNA 3W2ZA 3IBJA 1TF1A 3OBFA 5HPFA 3E0YA 3ZQ5A 3R4KA 2O99A 2O9AA 2M7UA 3KSHA 4ME4A 4Z1WA 1YKDA 4QPRA 4ETZA 3O5YA 5AJGA 3KSGA 4Q0JA 2O0YA 4Y5FA 3G6OA 4GW9A 5DFYA 4YOFA 2QYBA 2LB5A 3DBAA 1YSPA 3NHQA 4DN0A 2K31A 4RQ9A 5I5LA 2B18A 4DMZA 2K2NA 2VKSA 3NOPC 3KO6A 2W1TA 3K2NA 4LRZE 3S7OA 3MF0A 1MKMA 1ZTUA 3CI6A 4Y2FA 1F5MA 2Y8HA 2IA2A 1STZA 5TJJA 4MCWA 4E04A 2GX5A 2Y79A 2W3DA 4LRXC 4MMNA 4ZRRA 4CQHA 2W3EA 5HSQA 4O0PA 2KLIA 2VEAA 5L8MA 3S7NA 2W1TB 3IBRA 4O01A 3RFBA 1TD5A 3VV4A 2XROA 4BWIA 4ETXA 4IJGA 4EU0A 3C2WA 4FOFA 4IUHA 3TRCA 3HCYA 2W3FA 2W3HA 5K5BA 2KOIA 3D3OA 4Y3IA 4YNRA 4LRYC 4EUVA 2LB9A 4MDZA 4GLQA 4G3KA 3NOTC 4O8GA 2HGVA 4R6LA 1YSQA 2G7UA 3MMHA 3CITA 3OOVA 4Q0HA 4IUKA 2O9BA 2OOLA 5DFXA 3E98A 3NOUC 1VHMA 2ZMFA 3KSIA 5HPIA 5C5KA 1MC0A 2VZWA 4MN7A 5LBRA 3S7QA 2O9CA 2W3GA 3LFVA 4G3VA 4Q0IA 2M7VA 3MQ0A 4R70A 3KSFA 3S7PA
chains in the Genus database with same CATH superfamily
5EVEA 1PWGA 2ZQ9A 2JKTM 2XSSA 1N9BA 3QHYA 1FILA 4L0LA 5HPFA 1MZUA 3R4KA 4DJ3A 3M2JA 1YMSA 2ACGA 2ZL1A 3T4JA 3TOIA 5KSHA 4DE0A 2Y2HA 2O0YA 3B33A 1XPBA 1GCEA 3W4PA 2ZC4B 3NHQA 3HUOA 5FATA 3NOPC 4KG5A 3BY9A 5GLCA 1K4EA 1TVFA 1FSYA 1JTDA 3QP6A 1P9WA 3IWOA 1YLYA 4KZ7A 4HP4A 2WGWA 2M1CA 4KZ8A 3MXQA 2GNXA 3V3RA 1NZUA 4LGWA 3MKEA 1E4DA 3WS2A 5FQIA 1XGIA 4ETXA 5HARA 5EUAA 4FOFA 2Y2NA 2V1BA 2C6WB 4L9EA 4OH0A 4UEYA 5EM1A 1JVJA 1FCOA 1BZAA 5TBMB 2V9AA 3JPUA 1BULA 3TG9A 2V20A 1W5DA 3DAVA 3PBOA 1WYBA 1SKOA 3C5AA 1OT6A 4F3LA 3IXGA 3BECA 3B47A 1X0OA 2DRWA 2B5RA 3LICA 1YLTA 1ES4A 1VEUA 1K56D 4PM5A 1QMEA 1KVMA 4BL2A 2JHEA 3OCNA 1H8YA 3PBQA 1RGYA 4DE3A 3UNWA 4Z1WA 3TE8A 2X71A 1WA9A 4Y5FA 3G6OA 1K54C 4YOFA 5F69A 3F1NA 3UN7A 3A3IA 3W8KA 3K2NA 4P6ZM 1XJ6A 5AQ7A 4NXFA 3TSGA 4FSFA 1KOUA 1S4RA 3GR2A 5EECA 1JWVA 5HL1A 3IWIA 3MSHA 2H0YA 1Y4OA 4IBRA 3IHAA 4O7DA 3UPPA 1OJGA 2VV7A 4XXRA 2WYXA 3GRJA 1IKIA 5AVEA 4DKIA 2A24B 1ACFA 2EWVA 1EW0A 2P7JA 1XJ4A 2VX8A 1K54A 2EA9A 3HREA 3KX0X 1HD8A 2I72A 1OTAA 3QP2A 1SKFA 3NOUC 2J3WA 1OTBA 1YM1A 1DY6A 2BLSA 2OAQ1 2M7VA 2VGLS 5IS1A 1LSWA 2QKPA 4N1HA 4GDNA 4EBNA 2XEPA 5EV0A 3N7WA 1TS0A 4UA9A 3MFXA 1T18A 3WS1A 3UB5P 4GKUA 2L1MA 2I9VA 2WKHA 3UB9A 5A8BA 1FCMA 1FSWA 3QP4A 3KSGA 3W4OA 1BUEA 4X69A 3A3JA 4ZJ3A 1YSPA 3HUNA 1N9OA 2FFYA 3T1RA 1K56A 3RJUA 4S2NA 4QJGA 4LLOB 5F83A 1HVBA 5CERA 2PDRA 3CUEC 3R7WB 2GX5A 1CF0A 1K55A 2ZC6B 2QHKA 5FQKA 4ZRRA 4E6XA 1IKGA 1E3UD 3NDGA 1XKZA 4NETA 5HDDA 1ZKJA 5HDSA 4S2LA 1UGUA 2XK1A 1OTDA 4LCMA 5EPHA 3GVBA 2PD7A 3TRCA 1L3LA 5DF9A 3T4QA 2XD5A 1RCJA 4HH2A 1L2SA 1S0WA 2LB9A 4KQDA 3DWKA 3EGDC 3ZNTA 3FV7A 5GLBA 3EQUA 4KZBA 4E6WA 4O8GA 2J8YA 3UB8A 3S4XA 3HLFA 1YLPA 3MZFA 4M4XA 3MR0A 1G68A 1NXYA 5AQ9A 1BLCA 3NIAA 1VETA 3S7PA 1PW8A 2ZQDA 1LSVA 2IWDA 3IXBA 1MBLA 4KZ6A 3ZQ5A 5J3WA 5FEFA 1KE3A 1TS8A 1NRJA 2HDQA 1MPLA 3D9YA 3DBAA 3JVUA 4OPZA 4RQ9A 5GLDA 3DWZA 3M6HA 2W1TA 1FIKA 1ONHA 2VGKA 4OQ0A 3Q7VA 1N9LA 3CI6A 1ZG4A 4MCWA 4OVDA 4I3JA 3T1SA 2B02A 5DJTA 3LO7A 2PBDP 5HW3A 1W63Q 3WS4A 5FDHA 4E3OA 1HZOA 4KG2A 5FA7A 2Z2MB 2VA0A 5EVID 1IEMA 3V3SA 4MBHA 3HCYA 4KUKA 1XX2A 3LY3A 5CHUA 2YKFA 3HVFA 5A91A 2Z6CA 3UDFA 4FUWA 2PR6A 4KG6A 1HTZA 4CLCD 1K57A 4B4ZA 2Y2PA 3IX8A 5DKKA 3M6BA 4K08A 1VHMA 4D60A 3LI8A 4FD8A 3S7QA 2O9CA 2W3GA 3IX4A 4NG2A 3LIAA 3G32A 4C3QA 5BOHA 3T12B 4ESPA 4XUXA 3IS2A 2W1RA 2HDSA 3PHYA 1ERQA 1D1JA 4BMWA 4G3WA 3SS4A 3RH8B 2XRNA 3SH7A 2PRFA 1J3WA 2HZ5A 3FZCA 3M2KA 3HUMA 4JF5A 5J7EA 3F1PA 1LL8A 2XD1A 2PD8A 2ZM0A 4GB7A 2QWSA 1W79A 4EEUA 2PHYA 3UB7A 3CG5A 1VB6A 1J9MA 1I2SA 4GS9A 3PR6A 1MWSA 1P97A 3KO6A 4NXGA 4DF6A 3HBRA 1GA0A 3VP4A 1YLWA 2C5WB 2E8IA 5KZHA 3LR5A 5M1AA 4ARZB 2EX9A 3UE0A 1V9YA 3IH9A 3IF6B 5D3OA 4PHTA 1QMFA 3BFCA 3LIBA 4YFMA 1BLSA 3CHWP 3OPPA 2NUTC 4S2MA 1BT5A 1TDGA 3TJZC 1H8MA 4E3IA 1F9IA 4GHIB 2J3TD 2XQZA 3O86A 5FQJA 1PW1A 1LT0A 2ZC5B 2ZD8A 2J7VA 4G3KA 2Y2QA 5FDSA 1YSQA 4P87A 4ZJ1A 1PYYA 4JPMA 2OOLA 1LI0A 3PBTA 2ZMFA 4OONA 2ZLYA 1GA9A 4MN7A 5EVIA 5FL3A 4Z9QA 2AVXA 1G5UA 5U47A 1S1YA 3T50A 3EGXC 3JYIA 5CXWA 2ZOHA 4I3IA 1ALQA 1O7EA 3BRMA 3LEZA 2Y2OA 5DKLA 4QD4A 4CLCA 2O9AA 3SH9A 1TDLA 5EVLA 2JN7A 5IU1A 3CPTB 4ME4A 1ZC2A 4R23A 3RXWA 3H7WA 4E3JA 4WZ5A 2E8JA 3VE3A 4MLLA 2EX2A 4BJPA 3A3FA 3N4IA 2V8CA 2ZMVA 2IWCA 4II7A 2VLGA 2ZL1B 3UMDA 4E04A 2JE5A 1PZOA 3KYQA 2J3TC 1IYQA 5EE8A 2P9VA 4IBXA 4MMNA 3LUQA 1K6RA 4PM7A 1XA7A 1W8YA 5FASA 4OOYA 4GN2A 1P9RA 3BQAA 3WS5A 3T1XA 3ZG0A 3H9WA 2JBFA 2R9XA 4JKTA 3T4KA 5FAOA 2G2WA 3G4PA 4PM6A 2VV6A 2PR5A 4OQGA 1S4SA 1IFQA 4L9FA 2WGWB 5MC7A 3VFHA 2HF6A 3FKWA 5HFOA 3IF5A 4HI4A 3OPLA 2XA7S 3OCLA 3VP0A 4B88A 4HNBA 1MC0A 3WS0A 5FEGA 1N4OA 3ZNYA 4Q0IA 1JTGA 2KDKA 4K0WA 3SW1A 4I5SA 3VP3A 3CMZA 2J9OA 3HLEA 1H5XA 2VGLM 2WAFA 2ZM8A 3V67A 5A93A 1SKOB 2EXBA 2ZQ8A 4F3LB 2O99A 2XH9A 5AJGA 5DF8A 2PT7A 4Q0JA 5HWWA 1VEUB 4Y7PA 1K38A 1CJFA 4WL9A 4BBUA 2VKSA 4IVIA 1NYMA 3EWKA 4KENB 3GSGA 5HWTA 3SS5A 4M3KA 3E4PA 3UDXA 1Y54A 2KLIA 3F1NB 3GTCA 5A90A 1K0KA 4OP8A 1IYPA 5TGFA 3C4PA 3BY8A 1I2WA 4KQQA 4XUZA 3VOYA 4EUVA 3C30A 1NZOA 4DXCA 4JGRA 4XT2A 2P08A 1PFLA 1Q2PA 4DJ2A 2Y4AA 4C6YA 4Y17A 4OKPA 4LV1A 4MN6A 4CJNA 4KZ5A 4NXBA 2VZWA 1RGZA 1FCNA 4YINA 1DJCA 1MY8A 4B93A 2JKGA 1G28A 3SZTA 3KSFA 5FI7A 4PKYA 2QZ6A 3NBLA 2R78A 1ERMA 1MKIA 4ID4A 4PAUA 3T4TA 3BJNA 4WUJA 1TF1A 3UE3A 4S2NC 2UWXA 2A49A 3T4SA 2R9WA 1U60A 2PYPA 4FH4A 1XGJA 3E4OA 3IT9A 1K55C 4I39A 3LR0A 5FQ9A 3ZG7B 4EBLA 2QYBA 3BLSA 1BLHA 3CAXA 3QNBA 1NWZA 1YMXA 1XFNA 1EI5A 3EQVA 5J4EA 5CEDA 3WWXA 4JF4A 3CZDA 1TS6A 4E3NA 3BFGA 3UDIA 5GHZA 3LY4A 3SOIA 3ISGA 1WE4A 1AXBA 3BFDA 4PM9A 4GJ4A 2H0TA 4LV3A 4N9LA 4HJ6A 5AVFA 5GL9A 3H82A 3BFEA 4EXOA 2ZJ9A 2W3HA 1DP8A 1NYYA 1PWCA 3UE6A 1UWPX 4LRYC 2XDMA 1H3QA 5CGXA 2A2LA 1NLYA 1FR6A 3MMHA 5EM0A 2V0UA 5L07A 1EROA 4IUKA 2WGVA 5FSRA 3VP2A 5C5KA 2HP5A 3P09A 4B4XA 3OZHA 2K7SA 1S67L 3T4OA 3UPOA 3N8LA 3UB6A 3FPWA 2YKHA 4P6ZS 2ZQCA 1IELA 3C8CA 3EEAA 2ZBBA 3D4FA 2Y55A 1CQAA 5IHVA 3LGOA 2X01A 1NY0A 3U2AA 4R0QA 1XA1A 2EX6A 2KX6A 1S1ZA 5KMWA 2OAP1 3ZHHA 1VETB 4GCZA 4KZ4A 4KUOA 3UMEA 1YLZA 4Y0TA 4H8RA 2K31A 3VP1A 3GECA 4GDBA 4ZDXA 4KZAA 1MKMA 3VMAA 4Y2FA 1F5MA 1YT4A 1UWNX 2JCHA 3VFFA 5CTNA 1PNEA 4EW7A 3MZEA 1JNUA 4HQAA 2W3DA 3OC2A 3MQQA 5I94A 1FR1A 2V1AA 4NEED 4YWZA 3FC7A 2W1TB 1K57C 5FAQA 3Q7VB 3KYEA 4O01A 3VV4A 2H28A 1OTIA 1N9NA 3LCEA 3QNCA 2W3FA 4R3AA 4K0XA 4Y0OA 4YNRA 3F1OA 4KQOA 5A92A 1DRMA 2Y2IA 1S66L 1M6KA 1L0DA 3BWLA 4GOGA 2Y91A 3WRZA 2OLVA 3MFDA 4RX2A 4DRTA 5HPIA 5LBRA 4Y13A 4G3VA 4WN5A 5E43A 5DVAA 2CC1A 2XGNA 5FAPA 4F94A 3CWFA 2OWJA 1LHYA 5HL6A 4PPRA 2G2UA 3ZVTA 1FQGA 2L4RA 1TEMA 2Z2LB 3Q81A 3ZFZA 2M7UA 2ZMAA 4H6JA 5E2FA 3KSHA 5JYOA 2HV1A 4P6BA 3IS2B 1KGEA 4X1MA 2IWBA 4WZ4A 3HJIA 4R4SA 5F5YA 1K25A 3S7OA 1M40A 1GHIA 3AGDA 3MF0A 3F1PB 3LEQA 5TJJA 3Q1FA 1OT9A 3W4QA 3PXPA 4LRXC 4U0XA 5E2EA 2H5SA 3B42A 4GS9B 4BENA 1GSVA 1CI8A 3HLWA 3L9KA 4B9OA 1T1AA 3FPVA 5L8MA 4EBPA 3S7NA 3MKFA 4QB8A 2W27A 4HOIA 4HBTA 4RVAA 1ZG6A 2BASA 3ZG9B 3D72A 1GHMA 5EVIC 3PYPA 2DNSA 2JKRI 3NJAA 4NXEA 4HESA 1I5QA 5HAPA 5JYPA 1DP6A 1KVLA 5GLAA 1XFQA 4NKPA 5HD5A 1KGGA 1XJ3A 3C38A 3LYXA 1OMEA 5DF7A 2Q9MA 1K6SA 3E98A 2GZAA 4S2JA 4Q8IA 3T4LA 1C3BA 4CLCC 3BEBA 3BFFA 2XA7M 2HP9A 1SHVA 1YLJA 2QMIA 3MQ0A 4WZ5C 5F6AA 3PBSA 3Q82A 1K4FA 3LIDA 5L10A 4EQIA 1JWZA 3A0SA 3MXSA 4JXGA 2WKQA 3LR3A 3W2ZA 2WKEA 2HDUA 3P01A 2EWWA 1F2KA 4LFUA 4EWFA 5EVIB 3PTEA 5GHXA 2A3UA 1XXMA 2FFFB 3LIFA 4ZAMA 3IH8A 3T1QB 4GW9A 5DFYA 3FYZA 4OP5A 4N92A 3CJMA 4X25A 5CGSA 1VM1A 3PBNA 3HLBA 2J9PA 1ZTUA 4CLCB 2Y2JA 5HAIA 1XP4A 1OPXA 4BLMA 2Y79A 4MEZA 1T1CA 2H10A 4KZ3A 4WM9A 3H7WB 3V50A 2DMWA 5HZHA 2VEAA 3QP1A 3PBRA 1E25A 2XFSA 3N8RA 2Q0OA 4WBGA 2JKFA 1BSGA 4S2PA 3FWLA 4A5RA 1TS7A 3C2WA 2JKTI 2P9VB 5HWVA 4FTXA 1ESIA 2Z6DA 2WKIA 1KE4A 3ZVWA 2PU2A 4MBFA 1SDEA 4KQRA 1LL9A 3DTMA 2ZM2A 3SH8A 1YQSA 3UPNA 2O9BA 4EESA 2OV5A 1Z09A 3FKVA 3LFVA 4GZBA 2QJ7A 1ZHHB 3HLGA 4WF0A 4RYEA 3NULA 1GSWA 3KYZA 5FI6A 3EOIA 1G6AA 2L0WA 4EUZA 1IYOA 3GMWA 4JXWA 3C4OA 3OBFA 3ZCZA 4HH3A 3OPHA 3LIEA 4OLGA 2UV0E 4S2IA 1W7FA 4UQIS 3B3XA 3BQ8A 3VSKA 5EOEA 1BYWA 2V8FA 3IWQA 3AGFA 1O07A 2OLUA 2FH5A 4BQMA 1NLZA 1KE0A 4LRZE 1SZVA 3ZGAB 5CHMA 3RXXA 3S22A 4QHCA 1YPRA 4HBUA 2W3EA 5TBMA 4ZBEA 5E2HA 1MWRA 4OPQA 1OJ5A 4R3JA 1RP5A 3A0RA 5DTKA 1KGFA 1MXOA 2WZZA 5TR7A 4IEDA 3O88A 1OTEA 4QU3A 3RTYA 3SS3A 1W8QA 4MNRA 3WRTA 1ES2A 4CLCE 1CEFA 3LI9A 2J80A 3D3OA 4HIAA 3DW0A 3K3DA 3LR4A 2HP6A 5IT5A 3DTIA 2EFUA 3IXDA 5EFWA 4S2KA 3CITA 3NECA 3NY4A 4Q0HA 1PIOA 4C75A 1BLPA 4JGPA 3MXRA 4N9KA 1CEGA 2INWA 3V5MA 4XT2B 4HJ3A 5KSCA 4HJ4A 5CX7A 1HLUP 4EETB 2RL3A 4RA7A 3G35A 1BTLA 2OSUA 3E2LA 2WUQA 4QPRA 4ETZA 2Y2LA 1H0MA 1CI9A 3MS6A 5L2FA 4Y15A 2ZC7A 4DDYA 2B18A 2EFXA 4MN5A 4LCLA 2BG1A 3OLOA 2JC7A 3ZDJA 3IQAA 3GV9A 4JGOA 1STZA 4P0MA 2A24A 4OOMA 3NC8A 4WELA 3O87A 3ITBA 3DTEA 4HP9A 2P74A 3ULFA 3HLCA 4UA7A 4DE1A 3BLMA 2D02A 3O3VA 5F1GA 5HD3A 3JVVA 3FG8A 2Y2MA 1V9ZA 2QPNA 5KIZA 4HHDA 4IUHA 3V39A 5AQBA 3NI9A 3L7HA 2VK3A 4JBFA 3G2ZA 3QP5A 3HL9A 4LENA 2PYRA 4OPYA 2WGIA 4WEKA 3OOVA 2WK0A 3BW6A 5TFQA 1LI9A 3H82B 5DFXA 3KSIA 5FQMA 2ZQ7A 4GD8A 4QY5A 3PAEA 1KDWA 3UY6A 2BTFP 3A3EA 3MJQA 5G4YA 5HX9A 1DP9A 3VOZA 5FI2A 4R38A 4EV4A 4BD0A 1L0EA 4GD6A 1LLBA 2Y2GA 3MZDA 4E3LA 3R7WA 3CLOA 2WAEA 3EEHA 2XR0A 1S6RA 3GQZA 4Y0UA 4MBKA 5GHYA 1A0KA 2X02A 3C7VA 2K2NA 4WMCD 2VV8A 1DJBA 2Y59A 3E4QA 2WKPA 2EXAA 2Y8HA 3AGEA 1T19A 2D01A 5DJUA 4L9GA 3ZYTA 4CPKA 4FCFA 4ZJ2A 4PKYG 4JXVA 5CTMA 2Y2KA 4CQHA 3ICYA 1VQQA 1IYSA 3S1YA 3E2KA 4U0TA 1ES5A 3A3DA 4X1LA 2DCFA 2HPBA 1ES3A 3G30A 4AFIA 5M19A 1NRFA 4E3KA 4BWIA 2XROA 3G2YA 4EU0A 3CUEA 1PZPA 4R1GA 5DTSA 3IHBA 3P7NA 1GHPA 5CEBA 4GLQA 1L0FA 3NDEA 2ZQAA 3NOTC 2HGVA 4HY8A 3G34A 4IHQA 2WKRA 2W0NA 3VSLA 2ZC3B 3G31A 3MQOA 1PRQA 3F1OB 1LL5A 1SCWA 4PMAA 4EERA 4X55A 4OQHA 2OWHA 2VJWA 1ONGA 1D06A 3QP8A 1PI4A 3OPRA 4PM8A 2P04A 1KDSA 1YAXA 4WLAA 4R4RA 5J8XA 1W63M 5F82A 4FH2A 1Q2QA 3Q7ZA 4BL3A 4UAAA 2LB5A 5I5LA 1JWPA 2HJEA 2HDRA 4WYYA 2GDNA 2IA2A 4DE2A 4H6JB 3UO9A 5CGWA 5G4ZA 4OLDA 4LPZA 4LV2A 4R3BA 5G18A 5F68A 4DXBA 5CRFA 4D2OA 1E3UA 5CHJA 3IBRA 1L0GA 1TD5A 1NJ4A 3K3CA 3HJKA 4OPRA 4WMCA 2XLNA 3MBZA 2Q9NA 3DTKA 4RX3A 3ZG8B 5K5BA 3N6IA 2KOIA 3A0VA 4Y3IA 4DDSA 3BM6A 1IOUA 5HDCA 2V0WA 4MDZA 3IF6C 4HEFA 4R6LA 3VOLA 1GSXA 2G7UA 2QJ5A 5L09A 1P0ZA 4N1XA 4EEPA 2FZ0A 3UE1A 4I3AA 4ZTKA 2VGJA 2CMNA 4BD1A 4K91A 5F1FA 2V2FF 4EQ1A 4LV0A 5CECA 1XJ2A 4UA6A 4JF6A 1AWIA 1FOFA 5HAQA 2WADA 2HJ9C 5AQAA 4BBTA 2JKRM 2B95A 4E3MA 1F98A 4X6TA 4BBVA 3IBJA 3PAGA 3E0YA 3VE4A 3IXHA 3NCKA 5M18A 4X56A 2PAVP 4OOLA 1YKDA 3O5YA 3BYDA 4ARZA 4JGQA 1PWDA 3IF6A 3HLDA 2GJ3A 1WYCA 4DN0A 2ZOIA 5DTTA 1DJAA 4DMZA 3U4LP 1T1BA 4UQIM 3Q07A 3ITAA 1ODVA 4S2OA 2V1ZA 4U3TA 4GHIA 2MJ6A 1EWZA 3C7UA 3GDIA 1Z6FA 2RCXA 4X68A 4UHUA 5FQQA 1D7EA 5HSQA 4O0PA 4KZ9A 3ZG5A 5E2GA 4OQIA 4QWOA 3RFBA 3I7JA 4IJGA 1Y28A 3P98A 5EOOA 4JXSA 3N8SA 2XF3A 3TW8A 2WZXA 1MWUA 1LSXA 4X53A 4JLFA 2NUPC 4P85A 2PBYA 2PU4A 4WEJA 1SDNA 4QY6A 1G6OA 2EX8A 4NK3A 1H8ZA 4GNUA 2XFTA 1CK3A 1ESUA 3CPTA 1PI5A 1MWTA 4I38A 3IX3A 4R70A 4IVKA
chains in the Genus database with same CATH topology
3C8CA 3EEAA 4HJ3A 2W1RA 3PHYA 2ZBBA 2JKTM 2XSSA 4HJ4A 5CX7A 4BMWA 4G3WA 3RH8B 2XRNA 4EETB 3U2AA 4L0LA 5HPFA 2KX6A 1MZUA 3R4KA 5J7EA 3F1PA 4DJ3A 1LL8A 1S1ZA 2OAP1 2PD8A 2QWSA 3T4JA 4EEUA 5KSHA 2PHYA 4QPRA 4GCZA 4ETZA 4KUOA 3UMEA 3UB7A 2O0YA 3B33A 1VB6A 4GS9A 3PR6A 3NHQA 2K31A 2B18A 4MN5A 1P97A 3GECA 3NOPC 3KO6A 3BY9A 4NXGA 3OLOA 1MKMA 4Y2FA 1F5MA 1UWNX 4JGOA 1STZA 1P9WA 4EW7A 2A24A 1JNUA 4OOMA 3LR5A 4HQAA 4HP4A 2W3DA 4ARZB 3OC2A 4WELA 1V9YA 2M1CA 3MXQA 3MQQA 2GNXA 4HP9A 3ULFA 4PHTA 3LIBA 2V1AA 4NEED 2D02A 3FC7A 4YWZA 2W1TB 5HD3A 2NUTC 3JVVA 3FG8A 4O01A 3VV4A 2H28A 1OTIA 1N9NA 4ETXA 3TJZC 1H8MA 1V9ZA 1F9IA 5KIZA 4GHIB 2J3TD 4HHDA 4FOFA 4IUHA 2W3FA 2V1BA 4R3AA 4L9EA 4UEYA 5TBMB 2V9AA 4YNRA 3F1OA 1LT0A 4KQOA 1DRMA 1S66L 4G3KA 2PYRA 4WEKA 3BWLA 1YSQA 3OOVA 3BW6A 3PBOA 2OOLA 3H82B 5DFXA 3PBTA 2ZMFA 3KSIA 1OT6A 5HPIA 4F3LA 4MN7A 5FL3A 5LBRA 3B47A 4G3VA 1X0OA 4WN5A 1S1YA 3LICA 3T50A 3CWFA 3EGXC 2OWJA 5HL6A 3MJQA 2L4RA 2ZOHA 4I3IA 5G4YA 1DP9A 2JHEA 3OCNA 4R38A 5DKLA 3PBQA 4CLCA 2O9AA 2M7UA 4H6JA 3KSHA 2JN7A 5IU1A 2HV1A 4ME4A 4Z1WA 3R7WA 3TE8A 1WA9A 3CLOA 3IS2B 3H7WA 4Y5FA 3G6OA 3EEHA 3HJIA 4YOFA 3VE3A 5F69A 2K2NA 3F1NA 2VV8A 4BJPA 5F5YA 3K2NA 3E4QA 3S7OA 4P6ZM 2WKPA 1XJ6A 2ZMVA 3MF0A 3F1PB 2Y8HA 4II7A 4NXFA 2VLGA 5TJJA 1T19A 2D01A 3UMDA 4E04A 5DJUA 4FSFA 1KOUA 4L9GA 1S4RA 3ZYTA 1OT9A 3PXPA 3KYQA 2J3TC 4LRXC 4PKYG 4MMNA 3LUQA 4CQHA 3ICYA 3B42A 4GS9B 1GSVA 4B9OA 1T1AA 1OJGA 3FPVA 1P9RA 3BQAA 2VV7A 5L8MA 3S7NA 4AFIA 3H9WA 2W27A 4HOIA 3T4KA 2XROA 5AVEA 4BWIA 2BASA 4EU0A 2VV6A 3D72A 2A24B 2PR5A 3CUEA 3PYPA 2EWVA 1S4SA 1IFQA 2JKRI 4L9FA 3NJAA 1EW0A 4NXEA 5MC7A 2HF6A 3P7NA 2P7JA 1XJ4A 2VX8A 1DP6A 2EA9A 4GLQA 3NOTC 4HI4A 1XFQA 2HGVA 4NKPA 2XA7S 5HD5A 3OCLA 4HY8A 3KX0X 1XJ3A 1OTAA 3C38A 3LYXA 3E98A 2GZAA 4IHQA 2WKRA 3NOUC 3T4LA 2J3WA 2W0NA 4CLCC 1OTBA 2XA7M 4HNBA 1MC0A 3MQOA 4Q0IA 2OAQ1 2KDKA 3F1OB 2M7VA 2VGLS 3MQ0A 3SW1A 4I5SA 5F6AA 5IS1A 2QKPA 1LSWA 3PBSA 4EERA 3LIDA 2OWHA 2VJWA 1TS0A 2VGLM 1D06A 3A0SA 2WKQA 3LR3A 3W2ZA 3V67A 3MFXA 1T18A 2P04A 3P01A 2EWWA 1YAXA 4F3LB 2O99A 2L1MA 2I9VA 4WLAA 3UB9A 5A8BA 1W63M 3LIFA 5AJGA 2PT7A 3KSGA 4Q0JA 5HWWA 4GW9A 5DFYA 2LB5A 1YSPA 5I5LA 4WL9A 1N9OA 2HJEA 4BBUA 2VKSA 3EWKA 3PBNA 5HWTA 1ZTUA 4CLCB 4LLOB 2IA2A 4H6JB 5G4ZA 1OPXA 2PDRA 3CUEC 4LPZA 2GX5A 3R7WB 2Y79A 1T1CA 2QHKA 3E4PA 3H7WB 4ZRRA 2DMWA 5F68A 5HDDA 5HDSA 1UGUA 5HZHA 2KLIA 2VEAA 3F1NB 3PBRA 3IBRA 1TD5A 1OTDA 3K3CA 3HJKA 2PD7A 1TS7A 3BY8A 3C2WA 3TRCA 5K5BA 2JKTI 2KOIA 5DF9A 3A0VA 3T4QA 5HWVA 4Y3IA 1IOUA 4HH2A 5HDCA 4EUVA 3FPWA 2LB9A 3C30A 4KQDA 2V0WA 2Z6DA 4MDZA 3EGDC 4JGRA 4XT2A 2P08A 3EQUA 4DJ2A 4O8GA 4R6LA 3UB8A 3VOLA 1GSXA 2G7UA 2QJ5A 1P0ZA 4MN6A 4EEPA 2FZ0A 2O9BA 4EESA 4I3AA 4NXBA 2CMNA 4M4XA 2VZWA 3MR0A 3LFVA 4EQ1A 2QJ7A 4B93A 1XJ2A 1ZHHB 1G28A 4WF0A 3KSFA 1GSWA 3S7PA 3KYZA 4PKYA 2HJ9C 3EOIA 2R78A 2L0WA 4BBTA 2JKRM 1LSVA 4PAUA 3T4TA 3BJNA 1F98A 4WUJA 4BBVA 3IBJA 1TF1A 3UE3A 3OBFA 3E0YA 3ZQ5A 3VE4A 5J3WA 3T4SA 4HH3A 3LIEA 2PYPA 1TS8A 3E4OA 4OOLA 1YKDA 1NRJA 3O5YA 4I39A 3LR0A 4ARZA 4JGQA 4UQIS 3BQ8A 2GJ3A 2QYBA 3DBAA 1BYWA 4DN0A 2ZOIA 3JVUA 4RQ9A 4DMZA 3CAXA 1T1BA 4UQIM 2W1TA 1NWZA 2FH5A 1NLZA 4LRZE 1XFNA 1ODVA 1N9LA 3CI6A 4MCWA 4GHIA 2MJ6A 3EQVA 5J4EA 3GDIA 4I3JA 2B02A 5DJTA 2W3EA 5TBMA 1TS6A 1D7EA 5HSQA 1OJ5A 4O0PA 3A0RA 1W63Q 1OTEA 3RFBA 2VA0A 3RTYA 4GJ4A 5AVFA 4HJ6A 4IJGA 3H82A 4EXOA 4CLCE 1Y28A 3HCYA 2W3HA 3LI9A 4KUKA 2J80A 1DP8A 3UE6A 1UWPX 3TW8A 3D3OA 4HIAA 4LRYC 3K3DA 2YKFA 1H3QA 3LR4A 1LSXA 2Z6CA 2NUPC 5IT5A 4WEJA 2A2LA 2PR6A 1NLYA 5EFWA 4CLCD 3MMHA 3CITA 2V0UA 1G6OA 4Q0HA 5DKKA 4IUKA 4K08A 1VHMA 5C5KA 4JGPA 3LI8A 3S7QA 2O9CA 2W3GA 2K7SA 1S67L 3LIAA 3T4OA 2INWA 4I38A 4R70A 4XT2B 3UB6A 3IS2A 2YKHA 4P6ZS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EEA A;  5HL6 A;  2W1R A;  2XSS A;  2VJW A;  4G3W A;  4PAU A;  2XRN A;  3BJN A;  3W2Z A;  3IBJ A;  1TF1 A;  3OBF A;  5HPF A;  3E0Y A;  3ZQ5 A;  3R4K A;  2O99 A;  2O9A A;  2M7U A;  3KSH A;  4ME4 A;  4Z1W A;  1YKD A;  4QPR A;  4ETZ A;  3O5Y A;  5AJG A;  3KSG A;  4Q0J A;  2O0Y A;  4Y5F A;  3G6O A;  4GW9 A;  5DFY A;  4YOF A;  2QYB A;  2LB5 A;  3DBA A;  1YSP A;  3NHQ A;  4DN0 A;  2K31 A;  4RQ9 A;  5I5L A;  2B18 A;  4DMZ A;  2K2N A;  2VKS A;  3NOP C;  3KO6 A;  2W1T A;  3K2N A;  4LRZ E;  3S7O A;  3MF0 A;  1MKM A;  1ZTU A;  3CI6 A;  4Y2F A;  1F5M A;  2Y8H A;  2IA2 A;  1STZ A;  5TJJ A;  4MCW A;  4E04 A;  2GX5 A;  2Y79 A;  2W3D A;  4LRX C;  4MMN A;  4ZRR A;  4CQH A;  2W3E A;  5HSQ A;  4O0P A;  2KLI A;  2VEA A;  5L8M A;  3S7N A;  2W1T B;  3IBR A;  4O01 A;  3RFB A;  1TD5 A;  3VV4 A;  2XRO A;  4BWI A;  4ETX A;  4IJG A;  4EU0 A;  3C2W A;  4FOF A;  4IUH A;  3TRC A;  3HCY A;  2W3F A;  2W3H A;  5K5B A;  2KOI A;  3D3O A;  4Y3I A;  4YNR A;  4LRY C;  4EUV A;  2LB9 A;  4MDZ A;  4GLQ A;  4G3K A;  3NOT C;  4O8G A;  2HGV A;  4R6L A;  1YSQ A;  2G7U A;  3MMH A;  3CIT A;  3OOV A;  4Q0H A;  4IUK A;  2O9B A;  2OOL A;  5DFX A;  3E98 A;  3NOU C;  1VHM A;  2ZMF A;  3KSI A;  5HPI A;  5C5K A;  1MC0 A;  2VZW A;  4MN7 A;  5LBR A;  3S7Q A;  2O9C A;  2W3G A;  3LFV A;  4G3V A;  4Q0I A;  2M7V A;  3MQ0 A;  4R70 A;  3KSF A;  3S7P A; 
#chains in the Genus database with same CATH topology
 5EVE A;  1PWG A;  2ZQ9 A;  2JKT M;  2XSS A;  1N9B A;  3QHY A;  1FIL A;  4L0L A;  5HPF A;  1MZU A;  3R4K A;  4DJ3 A;  3M2J A;  1YMS A;  2ACG A;  2ZL1 A;  3T4J A;  3TOI A;  5KSH A;  4DE0 A;  2Y2H A;  2O0Y A;  3B33 A;  1XPB A;  1GCE A;  3W4P A;  2ZC4 B;  3NHQ A;  3HUO A;  5FAT A;  3NOP C;  4KG5 A;  3BY9 A;  5GLC A;  1K4E A;  1TVF A;  1FSY A;  1JTD A;  3QP6 A;  1P9W A;  3IWO A;  1YLY A;  4KZ7 A;  4HP4 A;  2WGW A;  2M1C A;  4KZ8 A;  3MXQ A;  2GNX A;  3V3R A;  1NZU A;  4LGW A;  3MKE A;  1E4D A;  3WS2 A;  5FQI A;  1XGI A;  4ETX A;  5HAR A;  5EUA A;  4FOF A;  2Y2N A;  2V1B A;  2C6W B;  4L9E A;  4OH0 A;  4UEY A;  5EM1 A;  1JVJ A;  1FCO A;  1BZA A;  5TBM B;  2V9A A;  3JPU A;  1BUL A;  3TG9 A;  2V20 A;  1W5D A;  3DAV A;  3PBO A;  1WYB A;  1SKO A;  3C5A A;  1OT6 A;  4F3L A;  3IXG A;  3BEC A;  3B47 A;  1X0O A;  2DRW A;  2B5R A;  3LIC A;  1YLT A;  1ES4 A;  1VEU A;  1K56 D;  4PM5 A;  1QME A;  1KVM A;  4BL2 A;  2JHE A;  3OCN A;  1H8Y A;  3PBQ A;  1RGY A;  4DE3 A;  3UNW A;  4Z1W A;  3TE8 A;  2X71 A;  1WA9 A;  4Y5F A;  3G6O A;  1K54 C;  4YOF A;  5F69 A;  3F1N A;  3UN7 A;  3A3I A;  3W8K A;  3K2N A;  4P6Z M;  1XJ6 A;  5AQ7 A;  4NXF A;  3TSG A;  4FSF A;  1KOU A;  1S4R A;  3GR2 A;  5EEC A;  1JWV A;  5HL1 A;  3IWI A;  3MSH A;  2H0Y A;  1Y4O A;  4IBR A;  3IHA A;  4O7D A;  3UPP A;  1OJG A;  2VV7 A;  4XXR A;  2WYX A;  3GRJ A;  1IKI A;  5AVE A;  4DKI A;  2A24 B;  1ACF A;  2EWV A;  1EW0 A;  2P7J A;  1XJ4 A;  2VX8 A;  1K54 A;  2EA9 A;  3HRE A;  3KX0 X;  1HD8 A;  2I72 A;  1OTA A;  3QP2 A;  1SKF A;  3NOU C;  2J3W A;  1OTB A;  1YM1 A;  1DY6 A;  2BLS A;  2OAQ 1;  2M7V A;  2VGL S;  5IS1 A;  1LSW A;  2QKP A;  4N1H A;  4GDN A;  4EBN A;  2XEP A;  5EV0 A;  3N7W A;  1TS0 A;  4UA9 A;  3MFX A;  1T18 A;  3WS1 A;  3UB5 P;  4GKU A;  2L1M A;  2I9V A;  2WKH A;  3UB9 A;  5A8B A;  1FCM A;  1FSW A;  3QP4 A;  3KSG A;  3W4O A;  1BUE A;  4X69 A;  3A3J A;  4ZJ3 A;  1YSP A;  3HUN A;  1N9O A;  2FFY A;  3T1R A;  1K56 A;  3RJU A;  4S2N A;  4QJG A;  4LLO B;  5F83 A;  1HVB A;  5CER A;  2PDR A;  3CUE C;  3R7W B;  2GX5 A;  1CF0 A;  1K55 A;  2ZC6 B;  2QHK A;  5FQK A;  4ZRR A;  4E6X A;  1IKG A;  1E3U D;  3NDG A;  1XKZ A;  4NET A;  5HDD A;  1ZKJ A;  5HDS A;  4S2L A;  1UGU A;  2XK1 A;  1OTD A;  4LCM A;  5EPH A;  3GVB A;  2PD7 A;  3TRC A;  1L3L A;  5DF9 A;  3T4Q A;  2XD5 A;  1RCJ A;  4HH2 A;  1L2S A;  1S0W A;  2LB9 A;  4KQD A;  3DWK A;  3EGD C;  3ZNT A;  3FV7 A;  5GLB A;  3EQU A;  4KZB A;  4E6W A;  4O8G A;  2J8Y A;  3UB8 A;  3S4X A;  3HLF A;  1YLP A;  3MZF A;  4M4X A;  3MR0 A;  1G68 A;  1NXY A;  5AQ9 A;  1BLC A;  3NIA A;  1VET A;  3S7P A;  1PW8 A;  2ZQD A;  1LSV A;  2IWD A;  3IXB A;  1MBL A;  4KZ6 A;  3ZQ5 A;  5J3W A;  5FEF A;  1KE3 A;  1TS8 A;  1NRJ A;  2HDQ A;  1MPL A;  3D9Y A;  3DBA A;  3JVU A;  4OPZ A;  4RQ9 A;  5GLD A;  3DWZ A;  3M6H A;  2W1T A;  1FIK A;  1ONH A;  2VGK A;  4OQ0 A;  3Q7V A;  1N9L A;  3CI6 A;  1ZG4 A;  4MCW A;  4OVD A;  4I3J A;  3T1S A;  2B02 A;  5DJT A;  3LO7 A;  2PBD P;  5HW3 A;  1W63 Q;  3WS4 A;  5FDH A;  4E3O A;  1HZO A;  4KG2 A;  5FA7 A;  2Z2M B;  2VA0 A;  5EVI D;  1IEM A;  3V3S A;  4MBH A;  3HCY A;  4KUK A;  1XX2 A;  3LY3 A;  5CHU A;  2YKF A;  3HVF A;  5A91 A;  2Z6C A;  3UDF A;  4FUW A;  2PR6 A;  4KG6 A;  1HTZ A;  4CLC D;  1K57 A;  4B4Z A;  2Y2P A;  3IX8 A;  5DKK A;  3M6B A;  4K08 A;  1VHM A;  4D60 A;  3LI8 A;  4FD8 A;  3S7Q A;  2O9C A;  2W3G A;  3IX4 A;  4NG2 A;  3LIA A;  3G32 A;  4C3Q A;  5BOH A;  3T12 B;  4ESP A;  4XUX A;  3IS2 A;  2W1R A;  2HDS A;  3PHY A;  1ERQ A;  1D1J A;  4BMW A;  4G3W A;  3SS4 A;  3RH8 B;  2XRN A;  3SH7 A;  2PRF A;  1J3W A;  2HZ5 A;  3FZC A;  3M2K A;  3HUM A;  4JF5 A;  5J7E A;  3F1P A;  1LL8 A;  2XD1 A;  2PD8 A;  2ZM0 A;  4GB7 A;  2QWS A;  1W79 A;  4EEU A;  2PHY A;  3UB7 A;  3CG5 A;  1VB6 A;  1J9M A;  1I2S A;  4GS9 A;  3PR6 A;  1MWS A;  1P97 A;  3KO6 A;  4NXG A;  4DF6 A;  3HBR A;  1GA0 A;  3VP4 A;  1YLW A;  2C5W B;  2E8I A;  5KZH A;  3LR5 A;  5M1A A;  4ARZ B;  2EX9 A;  3UE0 A;  1V9Y A;  3IH9 A;  3IF6 B;  5D3O A;  4PHT A;  1QMF A;  3BFC A;  3LIB A;  4YFM A;  1BLS A;  3CHW P;  3OPP A;  2NUT C;  4S2M A;  1BT5 A;  1TDG A;  3TJZ C;  1H8M A;  4E3I A;  1F9I A;  4GHI B;  2J3T D;  2XQZ A;  3O86 A;  5FQJ A;  1PW1 A;  1LT0 A;  2ZC5 B;  2ZD8 A;  2J7V A;  4G3K A;  2Y2Q A;  5FDS A;  1YSQ A;  4P87 A;  4ZJ1 A;  1PYY A;  4JPM A;  2OOL A;  1LI0 A;  3PBT A;  2ZMF A;  4OON A;  2ZLY A;  1GA9 A;  4MN7 A;  5EVI A;  5FL3 A;  4Z9Q A;  2AVX A;  1G5U A;  5U47 A;  1S1Y A;  3T50 A;  3EGX C;  3JYI A;  5CXW A;  2ZOH A;  4I3I A;  1ALQ A;  1O7E A;  3BRM A;  3LEZ A;  2Y2O A;  5DKL A;  4QD4 A;  4CLC A;  2O9A A;  3SH9 A;  1TDL A;  5EVL A;  2JN7 A;  5IU1 A;  3CPT B;  4ME4 A;  1ZC2 A;  4R23 A;  3RXW A;  3H7W A;  4E3J A;  4WZ5 A;  2E8J A;  3VE3 A;  4MLL A;  2EX2 A;  4BJP A;  3A3F A;  3N4I A;  2V8C A;  2ZMV A;  2IWC A;  4II7 A;  2VLG A;  2ZL1 B;  3UMD A;  4E04 A;  2JE5 A;  1PZO A;  3KYQ A;  2J3T C;  1IYQ A;  5EE8 A;  2P9V A;  4IBX A;  4MMN A;  3LUQ A;  1K6R A;  4PM7 A;  1XA7 A;  1W8Y A;  5FAS A;  4OOY A;  4GN2 A;  1P9R A;  3BQA A;  3WS5 A;  3T1X A;  3ZG0 A;  3H9W A;  2JBF A;  2R9X A;  4JKT A;  3T4K A;  5FAO A;  2G2W A;  3G4P A;  4PM6 A;  2VV6 A;  2PR5 A;  4OQG A;  1S4S A;  1IFQ A;  4L9F A;  2WGW B;  5MC7 A;  3VFH A;  2HF6 A;  3FKW A;  5HFO A;  3IF5 A;  4HI4 A;  3OPL A;  2XA7 S;  3OCL A;  3VP0 A;  4B88 A;  4HNB A;  1MC0 A;  3WS0 A;  5FEG A;  1N4O A;  3ZNY A;  4Q0I A;  1JTG A;  2KDK A;  4K0W A;  3SW1 A;  4I5S A;  3VP3 A;  3CMZ A;  2J9O A;  3HLE A;  1H5X A;  2VGL M;  2WAF A;  2ZM8 A;  3V67 A;  5A93 A;  1SKO B;  2EXB A;  2ZQ8 A;  4F3L B;  2O99 A;  2XH9 A;  5AJG A;  5DF8 A;  2PT7 A;  4Q0J A;  5HWW A;  1VEU B;  4Y7P A;  1K38 A;  1CJF A;  4WL9 A;  4BBU A;  2VKS A;  4IVI A;  1NYM A;  3EWK A;  4KEN B;  3GSG A;  5HWT A;  3SS5 A;  4M3K A;  3E4P A;  3UDX A;  1Y54 A;  2KLI A;  3F1N B;  3GTC A;  5A90 A;  1K0K A;  4OP8 A;  1IYP A;  5TGF A;  3C4P A;  3BY8 A;  1I2W A;  4KQQ A;  4XUZ A;  3VOY A;  4EUV A;  3C30 A;  1NZO A;  4DXC A;  4JGR A;  4XT2 A;  2P08 A;  1PFL A;  1Q2P A;  4DJ2 A;  2Y4A A;  4C6Y A;  4Y17 A;  4OKP A;  4LV1 A;  4MN6 A;  4CJN A;  4KZ5 A;  4NXB A;  2VZW A;  1RGZ A;  1FCN A;  4YIN A;  1DJC A;  1MY8 A;  4B93 A;  2JKG A;  1G28 A;  3SZT A;  3KSF A;  5FI7 A;  4PKY A;  2QZ6 A;  3NBL A;  2R78 A;  1ERM A;  1MKI A;  4ID4 A;  4PAU A;  3T4T A;  3BJN A;  4WUJ A;  1TF1 A;  3UE3 A;  4S2N C;  2UWX A;  2A49 A;  3T4S A;  2R9W A;  1U60 A;  2PYP A;  4FH4 A;  1XGJ A;  3E4O A;  3IT9 A;  1K55 C;  4I39 A;  3LR0 A;  5FQ9 A;  3ZG7 B;  4EBL A;  2QYB A;  3BLS A;  1BLH A;  3CAX A;  3QNB A;  1NWZ A;  1YMX A;  1XFN A;  1EI5 A;  3EQV A;  5J4E A;  5CED A;  3WWX A;  4JF4 A;  3CZD A;  1TS6 A;  4E3N A;  3BFG A;  3UDI A;  5GHZ A;  3LY4 A;  3SOI A;  3ISG A;  1WE4 A;  1AXB A;  3BFD A;  4PM9 A;  4GJ4 A;  2H0T A;  4LV3 A;  4N9L A;  4HJ6 A;  5AVF A;  5GL9 A;  3H82 A;  3BFE A;  4EXO A;  2ZJ9 A;  2W3H A;  1DP8 A;  1NYY A;  1PWC A;  3UE6 A;  1UWP X;  4LRY C;  2XDM A;  1H3Q A;  5CGX A;  2A2L A;  1NLY A;  1FR6 A;  3MMH A;  5EM0 A;  2V0U A;  5L07 A;  1ERO A;  4IUK A;  2WGV A;  5FSR A;  3VP2 A;  5C5K A;  2HP5 A;  3P09 A;  4B4X A;  3OZH A;  2K7S A;  1S67 L;  3T4O A;  3UPO A;  3N8L A;  3UB6 A;  3FPW A;  2YKH A;  4P6Z S;  2ZQC A;  1IEL A;  3C8C A;  3EEA A;  2ZBB A;  3D4F A;  2Y55 A;  1CQA A;  5IHV A;  3LGO A;  2X01 A;  1NY0 A;  3U2A A;  4R0Q A;  1XA1 A;  2EX6 A;  2KX6 A;  1S1Z A;  5KMW A;  2OAP 1;  3ZHH A;  1VET B;  4GCZ A;  4KZ4 A;  4KUO A;  3UME A;  1YLZ A;  4Y0T A;  4H8R A;  2K31 A;  3VP1 A;  3GEC A;  4GDB A;  4ZDX A;  4KZA A;  1MKM A;  3VMA A;  4Y2F A;  1F5M A;  1YT4 A;  1UWN X;  2JCH A;  3VFF A;  5CTN A;  1PNE A;  4EW7 A;  3MZE A;  1JNU A;  4HQA A;  2W3D A;  3OC2 A;  3MQQ A;  5I94 A;  1FR1 A;  2V1A A;  4NEE D;  4YWZ A;  3FC7 A;  2W1T B;  1K57 C;  5FAQ A;  3Q7V B;  3KYE A;  4O01 A;  3VV4 A;  2H28 A;  1OTI A;  1N9N A;  3LCE A;  3QNC A;  2W3F A;  4R3A A;  4K0X A;  4Y0O A;  4YNR A;  3F1O A;  4KQO A;  5A92 A;  1DRM A;  2Y2I A;  1S66 L;  1M6K A;  1L0D A;  3BWL A;  4GOG A;  2Y91 A;  3WRZ A;  2OLV A;  3MFD A;  4RX2 A;  4DRT A;  5HPI A;  5LBR A;  4Y13 A;  4G3V A;  4WN5 A;  5E43 A;  5DVA A;  2CC1 A;  2XGN A;  5FAP A;  4F94 A;  3CWF A;  2OWJ A;  1LHY A;  5HL6 A;  4PPR A;  2G2U A;  3ZVT A;  1FQG A;  2L4R A;  1TEM A;  2Z2L B;  3Q81 A;  3ZFZ A;  2M7U A;  2ZMA A;  4H6J A;  5E2F A;  3KSH A;  5JYO A;  2HV1 A;  4P6B A;  3IS2 B;  1KGE A;  4X1M A;  2IWB A;  4WZ4 A;  3HJI A;  4R4S A;  5F5Y A;  1K25 A;  3S7O A;  1M40 A;  1GHI A;  3AGD A;  3MF0 A;  3F1P B;  3LEQ A;  5TJJ A;  3Q1F A;  1OT9 A;  3W4Q A;  3PXP A;  4LRX C;  4U0X A;  5E2E A;  2H5S A;  3B42 A;  4GS9 B;  4BEN A;  1GSV A;  1CI8 A;  3HLW A;  3L9K A;  4B9O A;  1T1A A;  3FPV A;  5L8M A;  4EBP A;  3S7N A;  3MKF A;  4QB8 A;  2W27 A;  4HOI A;  4HBT A;  4RVA A;  1ZG6 A;  2BAS A;  3ZG9 B;  3D72 A;  1GHM A;  5EVI C;  3PYP A;  2DNS A;  2JKR I;  3NJA A;  4NXE A;  4HES A;  1I5Q A;  5HAP A;  5JYP A;  1DP6 A;  1KVL A;  5GLA A;  1XFQ A;  4NKP A;  5HD5 A;  1KGG A;  1XJ3 A;  3C38 A;  3LYX A;  1OME A;  5DF7 A;  2Q9M A;  1K6S A;  3E98 A;  2GZA A;  4S2J A;  4Q8I A;  3T4L A;  1C3B A;  4CLC C;  3BEB A;  3BFF A;  2XA7 M;  2HP9 A;  1SHV A;  1YLJ A;  2QMI A;  3MQ0 A;  4WZ5 C;  5F6A A;  3PBS A;  3Q82 A;  1K4F A;  3LID A;  5L10 A;  4EQI A;  1JWZ A;  3A0S A;  3MXS A;  4JXG A;  2WKQ A;  3LR3 A;  3W2Z A;  2WKE A;  2HDU A;  3P01 A;  2EWW A;  1F2K A;  4LFU A;  4EWF A;  5EVI B;  3PTE A;  5GHX A;  2A3U A;  1XXM A;  2FFF B;  3LIF A;  4ZAM A;  3IH8 A;  3T1Q B;  4GW9 A;  5DFY A;  3FYZ A;  4OP5 A;  4N92 A;  3CJM A;  4X25 A;  5CGS A;  1VM1 A;  3PBN A;  3HLB A;  2J9P A;  1ZTU A;  4CLC B;  2Y2J A;  5HAI A;  1XP4 A;  1OPX A;  4BLM A;  2Y79 A;  4MEZ A;  1T1C A;  2H10 A;  4KZ3 A;  4WM9 A;  3H7W B;  3V50 A;  2DMW A;  5HZH A;  2VEA A;  3QP1 A;  3PBR A;  1E25 A;  2XFS A;  3N8R A;  2Q0O A;  4WBG A;  2JKF A;  1BSG A;  4S2P A;  3FWL A;  4A5R A;  1TS7 A;  3C2W A;  2JKT I;  2P9V B;  5HWV A;  4FTX A;  1ESI A;  2Z6D A;  2WKI A;  1KE4 A;  3ZVW A;  2PU2 A;  4MBF A;  1SDE A;  4KQR A;  1LL9 A;  3DTM A;  2ZM2 A;  3SH8 A;  1YQS A;  3UPN A;  2O9B A;  4EES A;  2OV5 A;  1Z09 A;  3FKV A;  3LFV A;  4GZB A;  2QJ7 A;  1ZHH B;  3HLG A;  4WF0 A;  4RYE A;  3NUL A;  1GSW A;  3KYZ A;  5FI6 A;  3EOI A;  1G6A A;  2L0W A;  4EUZ A;  1IYO A;  3GMW A;  4JXW A;  3C4O A;  3OBF A;  3ZCZ A;  4HH3 A;  3OPH A;  3LIE A;  4OLG A;  2UV0 E;  4S2I A;  1W7F A;  4UQI S;  3B3X A;  3BQ8 A;  3VSK A;  5EOE A;  1BYW A;  2V8F A;  3IWQ A;  3AGF A;  1O07 A;  2OLU A;  2FH5 A;  4BQM A;  1NLZ A;  1KE0 A;  4LRZ E;  1SZV A;  3ZGA B;  5CHM A;  3RXX A;  3S22 A;  4QHC A;  1YPR A;  4HBU A;  2W3E A;  5TBM A;  4ZBE A;  5E2H A;  1MWR A;  4OPQ A;  1OJ5 A;  4R3J A;  1RP5 A;  3A0R A;  5DTK A;  1KGF A;  1MXO A;  2WZZ A;  5TR7 A;  4IED A;  3O88 A;  1OTE A;  4QU3 A;  3RTY A;  3SS3 A;  1W8Q A;  4MNR A;  3WRT A;  1ES2 A;  4CLC E;  1CEF A;  3LI9 A;  2J80 A;  3D3O A;  4HIA A;  3DW0 A;  3K3D A;  3LR4 A;  2HP6 A;  5IT5 A;  3DTI A;  2EFU A;  3IXD A;  5EFW A;  4S2K A;  3CIT A;  3NEC A;  3NY4 A;  4Q0H A;  1PIO A;  4C75 A;  1BLP A;  4JGP A;  3MXR A;  4N9K A;  1CEG A;  2INW A;  3V5M A;  4XT2 B;  4HJ3 A;  5KSC A;  4HJ4 A;  5CX7 A;  1HLU P;  4EET B;  2RL3 A;  4RA7 A;  3G35 A;  1BTL A;  2OSU A;  3E2L A;  2WUQ A;  4QPR A;  4ETZ A;  2Y2L A;  1H0M A;  1CI9 A;  3MS6 A;  5L2F A;  4Y15 A;  2ZC7 A;  4DDY A;  2B18 A;  2EFX A;  4MN5 A;  4LCL A;  2BG1 A;  3OLO A;  2JC7 A;  3ZDJ A;  3IQA A;  3GV9 A;  4JGO A;  1STZ A;  4P0M A;  2A24 A;  4OOM A;  3NC8 A;  4WEL A;  3O87 A;  3ITB A;  3DTE A;  4HP9 A;  2P74 A;  3ULF A;  3HLC A;  4UA7 A;  4DE1 A;  3BLM A;  2D02 A;  3O3V A;  5F1G A;  5HD3 A;  3JVV A;  3FG8 A;  2Y2M A;  1V9Z A;  2QPN A;  5KIZ A;  4HHD A;  4IUH A;  3V39 A;  5AQB A;  3NI9 A;  3L7H A;  2VK3 A;  4JBF A;  3G2Z A;  3QP5 A;  3HL9 A;  4LEN A;  2PYR A;  4OPY A;  2WGI A;  4WEK A;  3OOV A;  2WK0 A;  3BW6 A;  5TFQ A;  1LI9 A;  3H82 B;  5DFX A;  3KSI A;  5FQM A;  2ZQ7 A;  4GD8 A;  4QY5 A;  3PAE A;  1KDW A;  3UY6 A;  2BTF P;  3A3E A;  3MJQ A;  5G4Y A;  5HX9 A;  1DP9 A;  3VOZ A;  5FI2 A;  4R38 A;  4EV4 A;  4BD0 A;  1L0E A;  4GD6 A;  1LLB A;  2Y2G A;  3MZD A;  4E3L A;  3R7W A;  3CLO A;  2WAE A;  3EEH A;  2XR0 A;  1S6R A;  3GQZ A;  4Y0U A;  4MBK A;  5GHY A;  1A0K A;  2X02 A;  3C7V A;  2K2N A;  4WMC D;  2VV8 A;  1DJB A;  2Y59 A;  3E4Q A;  2WKP A;  2EXA A;  2Y8H A;  3AGE A;  1T19 A;  2D01 A;  5DJU A;  4L9G A;  3ZYT A;  4CPK A;  4FCF A;  4ZJ2 A;  4PKY G;  4JXV A;  5CTM A;  2Y2K A;  4CQH A;  3ICY A;  1VQQ A;  1IYS A;  3S1Y A;  3E2K A;  4U0T A;  1ES5 A;  3A3D A;  4X1L A;  2DCF A;  2HPB A;  1ES3 A;  3G30 A;  4AFI A;  5M19 A;  1NRF A;  4E3K A;  4BWI A;  2XRO A;  3G2Y A;  4EU0 A;  3CUE A;  1PZP A;  4R1G A;  5DTS A;  3IHB A;  3P7N A;  1GHP A;  5CEB A;  4GLQ A;  1L0F A;  3NDE A;  2ZQA A;  3NOT C;  2HGV A;  4HY8 A;  3G34 A;  4IHQ A;  2WKR A;  2W0N A;  3VSL A;  2ZC3 B;  3G31 A;  3MQO A;  1PRQ A;  3F1O B;  1LL5 A;  1SCW A;  4PMA A;  4EER A;  4X55 A;  4OQH A;  2OWH A;  2VJW A;  1ONG A;  1D06 A;  3QP8 A;  1PI4 A;  3OPR A;  4PM8 A;  2P04 A;  1KDS A;  1YAX A;  4WLA A;  4R4R A;  5J8X A;  1W63 M;  5F82 A;  4FH2 A;  1Q2Q A;  3Q7Z A;  4BL3 A;  4UAA A;  2LB5 A;  5I5L A;  1JWP A;  2HJE A;  2HDR A;  4WYY A;  2GDN A;  2IA2 A;  4DE2 A;  4H6J B;  3UO9 A;  5CGW A;  5G4Z A;  4OLD A;  4LPZ A;  4LV2 A;  4R3B A;  5G18 A;  5F68 A;  4DXB A;  5CRF A;  4D2O A;  1E3U A;  5CHJ A;  3IBR A;  1L0G A;  1TD5 A;  1NJ4 A;  3K3C A;  3HJK A;  4OPR A;  4WMC A;  2XLN A;  3MBZ A;  2Q9N A;  3DTK A;  4RX3 A;  3ZG8 B;  5K5B A;  3N6I A;  2KOI A;  3A0V A;  4Y3I A;  4DDS A;  3BM6 A;  1IOU A;  5HDC A;  2V0W A;  4MDZ A;  3IF6 C;  4HEF A;  4R6L A;  3VOL A;  1GSX A;  2G7U A;  2QJ5 A;  5L09 A;  1P0Z A;  4N1X A;  4EEP A;  2FZ0 A;  3UE1 A;  4I3A A;  4ZTK A;  2VGJ A;  2CMN A;  4BD1 A;  4K91 A;  5F1F A;  2V2F F;  4EQ1 A;  4LV0 A;  5CEC A;  1XJ2 A;  4UA6 A;  4JF6 A;  1AWI A;  1FOF A;  5HAQ A;  2WAD A;  2HJ9 C;  5AQA A;  4BBT A;  2JKR M;  2B95 A;  4E3M A;  1F98 A;  4X6T A;  4BBV A;  3IBJ A;  3PAG A;  3E0Y A;  3VE4 A;  3IXH A;  3NCK A;  5M18 A;  4X56 A;  2PAV P;  4OOL A;  1YKD A;  3O5Y A;  3BYD A;  4ARZ A;  4JGQ A;  1PWD A;  3IF6 A;  3HLD A;  2GJ3 A;  1WYC A;  4DN0 A;  2ZOI A;  5DTT A;  1DJA A;  4DMZ A;  3U4L P;  1T1B A;  4UQI M;  3Q07 A;  3ITA A;  1ODV A;  4S2O A;  2V1Z A;  4U3T A;  4GHI A;  2MJ6 A;  1EWZ A;  3C7U A;  3GDI A;  1Z6F A;  2RCX A;  4X68 A;  4UHU A;  5FQQ A;  1D7E A;  5HSQ A;  4O0P A;  4KZ9 A;  3ZG5 A;  5E2G A;  4OQI A;  4QWO A;  3RFB A;  3I7J A;  4IJG A;  1Y28 A;  3P98 A;  5EOO A;  4JXS A;  3N8S A;  2XF3 A;  3TW8 A;  2WZX A;  1MWU A;  1LSX A;  4X53 A;  4JLF A;  2NUP C;  4P85 A;  2PBY A;  2PU4 A;  4WEJ A;  1SDN A;  4QY6 A;  1G6O A;  2EX8 A;  4NK3 A;  1H8Z A;  4GNU A;  2XFT A;  1CK3 A;  1ESU A;  3CPT A;  1PI5 A;  1MWT A;  4I38 A;  3IX3 A;  4R70 A;  4IVK A; 
#chains in the Genus database with same CATH homology
 3C8C A;  3EEA A;  4HJ3 A;  2W1R A;  3PHY A;  2ZBB A;  2JKT M;  2XSS A;  4HJ4 A;  5CX7 A;  4BMW A;  4G3W A;  3RH8 B;  2XRN A;  4EET B;  3U2A A;  4L0L A;  5HPF A;  2KX6 A;  1MZU A;  3R4K A;  5J7E A;  3F1P A;  4DJ3 A;  1LL8 A;  1S1Z A;  2OAP 1;  2PD8 A;  2QWS A;  3T4J A;  4EEU A;  5KSH A;  2PHY A;  4QPR A;  4GCZ A;  4ETZ A;  4KUO A;  3UME A;  3UB7 A;  2O0Y A;  3B33 A;  1VB6 A;  4GS9 A;  3PR6 A;  3NHQ A;  2K31 A;  2B18 A;  4MN5 A;  1P97 A;  3GEC A;  3NOP C;  3KO6 A;  3BY9 A;  4NXG A;  3OLO A;  1MKM A;  4Y2F A;  1F5M A;  1UWN X;  4JGO A;  1STZ A;  1P9W A;  4EW7 A;  2A24 A;  1JNU A;  4OOM A;  3LR5 A;  4HQA A;  4HP4 A;  2W3D A;  4ARZ B;  3OC2 A;  4WEL A;  1V9Y A;  2M1C A;  3MXQ A;  3MQQ A;  2GNX A;  4HP9 A;  3ULF A;  4PHT A;  3LIB A;  2V1A A;  4NEE D;  2D02 A;  3FC7 A;  4YWZ A;  2W1T B;  5HD3 A;  2NUT C;  3JVV A;  3FG8 A;  4O01 A;  3VV4 A;  2H28 A;  1OTI A;  1N9N A;  4ETX A;  3TJZ C;  1H8M A;  1V9Z A;  1F9I A;  5KIZ A;  4GHI B;  2J3T D;  4HHD A;  4FOF A;  4IUH A;  2W3F A;  2V1B A;  4R3A A;  4L9E A;  4UEY A;  5TBM B;  2V9A A;  4YNR A;  3F1O A;  1LT0 A;  4KQO A;  1DRM A;  1S66 L;  4G3K A;  2PYR A;  4WEK A;  3BWL A;  1YSQ A;  3OOV A;  3BW6 A;  3PBO A;  2OOL A;  3H82 B;  5DFX A;  3PBT A;  2ZMF A;  3KSI A;  1OT6 A;  5HPI A;  4F3L A;  4MN7 A;  5FL3 A;  5LBR A;  3B47 A;  4G3V A;  1X0O A;  4WN5 A;  1S1Y A;  3LIC A;  3T50 A;  3CWF A;  3EGX C;  2OWJ A;  5HL6 A;  3MJQ A;  2L4R A;  2ZOH A;  4I3I A;  5G4Y A;  1DP9 A;  2JHE A;  3OCN A;  4R38 A;  5DKL A;  3PBQ A;  4CLC A;  2O9A A;  2M7U A;  4H6J A;  3KSH A;  2JN7 A;  5IU1 A;  2HV1 A;  4ME4 A;  4Z1W A;  3R7W A;  3TE8 A;  1WA9 A;  3CLO A;  3IS2 B;  3H7W A;  4Y5F A;  3G6O A;  3EEH A;  3HJI A;  4YOF A;  3VE3 A;  5F69 A;  2K2N A;  3F1N A;  2VV8 A;  4BJP A;  5F5Y A;  3K2N A;  3E4Q A;  3S7O A;  4P6Z M;  2WKP A;  1XJ6 A;  2ZMV A;  3MF0 A;  3F1P B;  2Y8H A;  4II7 A;  4NXF A;  2VLG A;  5TJJ A;  1T19 A;  2D01 A;  3UMD A;  4E04 A;  5DJU A;  4FSF A;  1KOU A;  4L9G A;  1S4R A;  3ZYT A;  1OT9 A;  3PXP A;  3KYQ A;  2J3T C;  4LRX C;  4PKY G;  4MMN A;  3LUQ A;  4CQH A;  3ICY A;  3B42 A;  4GS9 B;  1GSV A;  4B9O A;  1T1A A;  1OJG A;  3FPV A;  1P9R A;  3BQA A;  2VV7 A;  5L8M A;  3S7N A;  4AFI A;  3H9W A;  2W27 A;  4HOI A;  3T4K A;  2XRO A;  5AVE A;  4BWI A;  2BAS A;  4EU0 A;  2VV6 A;  3D72 A;  2A24 B;  2PR5 A;  3CUE A;  3PYP A;  2EWV A;  1S4S A;  1IFQ A;  2JKR I;  4L9F A;  3NJA A;  1EW0 A;  4NXE A;  5MC7 A;  2HF6 A;  3P7N A;  2P7J A;  1XJ4 A;  2VX8 A;  1DP6 A;  2EA9 A;  4GLQ A;  3NOT C;  4HI4 A;  1XFQ A;  2HGV A;  4NKP A;  2XA7 S;  5HD5 A;  3OCL A;  4HY8 A;  3KX0 X;  1XJ3 A;  1OTA A;  3C38 A;  3LYX A;  3E98 A;  2GZA A;  4IHQ A;  2WKR A;  3NOU C;  3T4L A;  2J3W A;  2W0N A;  4CLC C;  1OTB A;  2XA7 M;  4HNB A;  1MC0 A;  3MQO A;  4Q0I A;  2OAQ 1;  2KDK A;  3F1O B;  2M7V A;  2VGL S;  3MQ0 A;  3SW1 A;  4I5S A;  5F6A A;  5IS1 A;  2QKP A;  1LSW A;  3PBS A;  4EER A;  3LID A;  2OWH A;  2VJW A;  1TS0 A;  2VGL M;  1D06 A;  3A0S A;  2WKQ A;  3LR3 A;  3W2Z A;  3V67 A;  3MFX A;  1T18 A;  2P04 A;  3P01 A;  2EWW A;  1YAX A;  4F3L B;  2O99 A;  2L1M A;  2I9V A;  4WLA A;  3UB9 A;  5A8B A;  1W63 M;  3LIF A;  5AJG A;  2PT7 A;  3KSG A;  4Q0J A;  5HWW A;  4GW9 A;  5DFY A;  2LB5 A;  1YSP A;  5I5L A;  4WL9 A;  1N9O A;  2HJE A;  4BBU A;  2VKS A;  3EWK A;  3PBN A;  5HWT A;  1ZTU A;  4CLC B;  4LLO B;  2IA2 A;  4H6J B;  5G4Z A;  1OPX A;  2PDR A;  3CUE C;  4LPZ A;  2GX5 A;  3R7W B;  2Y79 A;  1T1C A;  2QHK A;  3E4P A;  3H7W B;  4ZRR A;  2DMW A;  5F68 A;  5HDD A;  5HDS A;  1UGU A;  5HZH A;  2KLI A;  2VEA A;  3F1N B;  3PBR A;  3IBR A;  1TD5 A;  1OTD A;  3K3C A;  3HJK A;  2PD7 A;  1TS7 A;  3BY8 A;  3C2W A;  3TRC A;  5K5B A;  2JKT I;  2KOI A;  5DF9 A;  3A0V A;  3T4Q A;  5HWV A;  4Y3I A;  1IOU A;  4HH2 A;  5HDC A;  4EUV A;  3FPW A;  2LB9 A;  3C30 A;  4KQD A;  2V0W A;  2Z6D A;  4MDZ A;  3EGD C;  4JGR A;  4XT2 A;  2P08 A;  3EQU A;  4DJ2 A;  4O8G A;  4R6L A;  3UB8 A;  3VOL A;  1GSX A;  2G7U A;  2QJ5 A;  1P0Z A;  4MN6 A;  4EEP A;  2FZ0 A;  2O9B A;  4EES A;  4I3A A;  4NXB A;  2CMN A;  4M4X A;  2VZW A;  3MR0 A;  3LFV A;  4EQ1 A;  2QJ7 A;  4B93 A;  1XJ2 A;  1ZHH B;  1G28 A;  4WF0 A;  3KSF A;  1GSW A;  3S7P A;  3KYZ A;  4PKY A;  2HJ9 C;  3EOI A;  2R78 A;  2L0W A;  4BBT A;  2JKR M;  1LSV A;  4PAU A;  3T4T A;  3BJN A;  1F98 A;  4WUJ A;  4BBV A;  3IBJ A;  1TF1 A;  3UE3 A;  3OBF A;  3E0Y A;  3ZQ5 A;  3VE4 A;  5J3W A;  3T4S A;  4HH3 A;  3LIE A;  2PYP A;  1TS8 A;  3E4O A;  4OOL A;  1YKD A;  1NRJ A;  3O5Y A;  4I39 A;  3LR0 A;  4ARZ A;  4JGQ A;  4UQI S;  3BQ8 A;  2GJ3 A;  2QYB A;  3DBA A;  1BYW A;  4DN0 A;  2ZOI A;  3JVU A;  4RQ9 A;  4DMZ A;  3CAX A;  1T1B A;  4UQI M;  2W1T A;  1NWZ A;  2FH5 A;  1NLZ A;  4LRZ E;  1XFN A;  1ODV A;  1N9L A;  3CI6 A;  4MCW A;  4GHI A;  2MJ6 A;  3EQV A;  5J4E A;  3GDI A;  4I3J A;  2B02 A;  5DJT A;  2W3E A;  5TBM A;  1TS6 A;  1D7E A;  5HSQ A;  1OJ5 A;  4O0P A;  3A0R A;  1W63 Q;  1OTE A;  3RFB A;  2VA0 A;  3RTY A;  4GJ4 A;  5AVF A;  4HJ6 A;  4IJG A;  3H82 A;  4EXO A;  4CLC E;  1Y28 A;  3HCY A;  2W3H A;  3LI9 A;  4KUK A;  2J80 A;  1DP8 A;  3UE6 A;  1UWP X;  3TW8 A;  3D3O A;  4HIA A;  4LRY C;  3K3D A;  2YKF A;  1H3Q A;  3LR4 A;  1LSX A;  2Z6C A;  2NUP C;  5IT5 A;  4WEJ A;  2A2L A;  2PR6 A;  1NLY A;  5EFW A;  4CLC D;  3MMH A;  3CIT A;  2V0U A;  1G6O A;  4Q0H A;  5DKK A;  4IUK A;  4K08 A;  1VHM A;  5C5K A;  4JGP A;  3LI8 A;  3S7Q A;  2O9C A;  2W3G A;  2K7S A;  1S67 L;  3LIA A;  3T4O A;  2INW A;  4I38 A;  4R70 A;  4XT2 B;  3UB6 A;  3IS2 A;  2YKH A;  4P6Z S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...