3O5YA

The crystal structure of the gaf domain of a two-component sensor histidine kinase from bacillus halodurans to 2.45a
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
142
Chain Sequence
MSLDDIINNMIDKLKLLVHFDRISFLLLANETLKLSHVYPKGSHSLDIGSTIPKEQSLYWSALDQRQTIFRSLTDTQDNFYEKQYLAILDLKSILVIPIYSKNKRVGVLSIGRKQQIDWSLDDLAFLEQLTDHLAVSIENVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Sensor protein
publication title The Crystal Structure of the GAF domain of a two-component sensor histidine kinase from Bacillus halodurans to 2.45A
rcsb
source organism Bacillus halodurans
total genus 38
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3o5yA00
4MN7A 2VZWA 4FOFA 4QPRA 4Q0HA 2XSSA 4YOFA 3C2WA 3O5YA 2LB5A 2W3EA 4Y3IA 4O01A 4MCWA 1TF1A 2VJWA 3KSGA 4ZRRA 3CITA 5LBRA 3S7PA 4LRYC 4EU0A 3EEAA 4IJGA 3D3OA 2O9AA 3NOUC 2XRNA 3W2ZA 5C5KA 3NHQA 1MKMA 4LRXC 2HGVA 2ZMFA 3S7QA 1TD5A 4Q0IA 2KLIA 2OOLA 4ETZA 2VEAA 3HCYA 5DFYA 3TRCA 2LB9A 1MC0A 2B18A 5HPFA 2O9CA 3S7OA 4DN0A 3KSHA 4ETXA 1VHMA 4O8GA 3IBRA 5HL6A 4MDZA 3IBJA 5HSQA 5K5BA 1YSQA 4EUVA 1ZTUA 4G3WA 4Y2FA 3RFBA 4ME4A 5I5LA 2O99A 4Y5FA 4BWIA 3E98A 2W1TA 3LFVA 3MQ0A 2W1TB 2O9BA 3NOPC 3OOVA 2GX5A 2XROA 2W3FA 2W3GA 4MMNA 2Y79A 2W1RA 4G3VA 3CI6A 4G3KA 2IA2A 3R4KA 5DFXA 2K31A 4GLQA 4O0PA 3KSFA 2O0YA 3K2NA 5HPIA 3KSIA 3MF0A 4CQHA 2QYBA 4GW9A 2M7VA 4DMZA 3DBAA 3MMHA 4IUKA 4YNRA 3VV4A 5AJGA 3G6OA 2VKSA 5TJJA 4R70A 1STZA 1YSPA 3E0YA 3NOTC 3BJNA 4LRZE 1F5MA 1YKDA 4Z1WA 4Q0JA 3OBFA 2K2NA 2W3HA 3ZQ5A 5L8MA 4PAUA 2W3DA 4IUHA 2M7UA 4E04A 2G7UA 3KO6A 4RQ9A 3S7NA 2KOIA 4R6LA 2Y8HA
chains in the Genus database with same CATH superfamily
3BRMA 1U60A 4LV1A 5FSRA 1MWSA 4P87A 1K38A 4R3BA 3E2KA 3GTCA 2X02A 1W63Q 2P7JA 2GJ3A 2WUQA 5KMWA 1Y54A 4E6WA 3NOUC 4LRXC 2HGVA 4NK3A 2ZMVA 2IWBA 3MZDA 2Y2LA 3Q82A 4MN5A 3HBRA 4EBPA 3BLSA 1KOUA 4ETXA 3CPTB 5TBMA 1W79A 4E3OA 2Z2MB 1K6SA 2WAEA 1PW8A 1MBLA 1K4FA 4LV3A 3BYDA 3E98A 3UE6A 2WGVA 4S2PA 4OLDA 4U0TA 1I5QA 1E25A 2Y55A 2W3GA 3V39A 2Y79A 3ZGAB 2H0YA 4G3VA 5DF9A 1CI9A 3CI6A 3MR0A 5EPHA 3MJQA 1NWZA 1MPLA 1FSWA 3VMAA 4KZ9A 3A3DA 2J9OA 2XF3A 5FQMA 1ESUA 5FEFA 3IHAA 4Y0OA 3BFCA 2Y4AA 3Q7ZA 4R0QA 4WBGA 3E4QA 2WKIA 3C7UA 4WMCA 4PM5A 2V0UA 1S4SA 1F98A 4KUOA 3T4JA 4XXRA 5F83A 3VFFA 2HF6A 1BTLA 1PZOA 5CGSA 2QPNA 3PBQA 1CQAA 1XP4A 5F5YA 4R38A 4ZJ1A 5E43A 4HI4A 2ZLYA 2GZAA 3CITA 4OOLA 2V1AA 2ZC5B 3GSGA 1TD5A 3MZFA 4M4XA 4HP9A 3HCYA 3KYEA 5FEGA 4BBTA 2GDNA 3H82A 1DJCA 4KG2A 4EBNA 4IEDA 5EVIC 4L9FA 4MDZA 4EERA 1CI8A 4BD0A 4JF5A 4UA9A 4DXCA 3CHWP 4OP8A 1IFQA 5CHMA 3VE3A 2IWCA 1ZG6A 2OLVA 1IYOA 4WZ5C 4F94A 4ZTKA 1L0GA 3B42A 3BEBA 1FOFA 1LL8A 3MQ0A 3QNCA 1NXYA 1VETB 1VM1A 3UB7A 3IX4A 2EX8A 2I72A 3O3VA 4JGRA 1W5DA 1K25A 3RTYA 1WYBA 4JF6A 4KG6A 3UB8A 1W63M 4NXEA 5HPIA 1QMFA 3DWKA 3V3SA 4X56A 2EFXA 4E3JA 1FSYA 3VV4A 3G6OA 4HBTA 4R70A 3SW1A 4F3LA 3GECA 2BTFP 1Q2PA 3KYZA 3IXBA 2M7UA 2JKTM 1MY8A 3BWLA 4OQ0A 5IS1A 1FR1A 5GLDA 2FFYA 5EM1A 1S0WA 4NG2A 1E4DA 4YOFA 4DF6A 1IOUA 1OT9A 5TBMB 2J3TD 1DJBA 5DVAA 3G2ZA 2VJWA 2ZQ7A 2XRNA 3W2ZA 4N1HA 1LLBA 2J3TC 4XUZA 4XT2A 3OC2A 2EXBA 5CTNA 2KLIA 3PBRA 1FR6A 4S2MA 1K54A 1GCEA 1A0KA 1ES3A 5HWVA 3C8CA 2Q9NA 3IBRA 4KQRA 3UPPA 4IBRA 3T1RA 3ZYTA 3VP2A 4DKIA 1SKFA 1XJ3A 2XROA 4P6ZM 3D9YA 1LI0A 4EEUA 3CLOA 5EM0A 4CLCE 5HDSA 4LPZA 5HD5A 2XGNA 2WAFA 4WZ4A 4DDSA 4X6TA 3EGXC 5FI7A 3V67A 3FC7A 1S1ZA 3RJUA 3HLWA 1P9RA 4PKYA 2PYRA 2PBDP 3UDFA 4II7A 4PKYG 1NJ4A 2W0NA 2W3HA 4HJ3A 3UDIA 5HWTA 3QP4A 4QY5A 5L8MA 5G4ZA 1ES5A 2ZC7A 4RQ9A 3LI9A 1YPRA 3ITBA 5TGFA 1K55C 1L2SA 4IVIA 3GDIA 3H82B 4Y7PA 1L0EA 2QHKA 3MFDA 1PWCA 5HAPA 3QNBA 2LB5A 1OPXA 1O7EA 1Q2QA 4JGPA 2ZQ9A 3D3OA 3IH9A 2VLGA 4I3AA 5F69A 3HJIA 1G6OA 3EGDC 4GKUA 3TRCA 4KZAA 2O9CA 4OVDA 3ISGA 4EUZA 3K3DA 2PRFA 3VOYA 1ZTUA 4ARZA 4QHCA 1PWDA 3RFBA 2EA9A 3SZTA 1ZG4A 1J3WA 3KYQA 3A3IA 4BENA 2PU2A 1P97A 3E4PA 2WADA 2Y2GA 4HHDA 4Y0UA 3P98A 2O9BA 3BY8A 4JKTA 3OOVA 2XA7S 2B5RA 1S66L 4F3LB 3AGFA 1JWPA 4R4RA 3N7WA 5HWWA 4G3KA 3BM6A 3G34A 3NJAA 4PMAA 3CAXA 4GW9A 4DMZA 2Y2OA 5CEBA 4KZ6A 3Q7VA 5J7EA 4KUKA 1CK3A 4YNRA 5CGWA 1NLYA 1EI5A 4KZ7A 2HJ9C 3BJNA 4JXSA 4WF0A 3DTIA 1H8YA 2HP5A 2J3WA 2CC1A 1XGIA 1H8ZA 3VP0A 5HL1A 2D02A 2G7UA 4NXFA 5AQAA 2OAP1 3OCNA 5DKLA 2Q9MA 3EEHA 3UY6A 4XT2B 5AQ7A 2Y2HA 4DE0A 3LR0A 5EVEA 3A0SA 4GB7A 4Q0HA 3MZEA 4Y15A 5GLCA 2PHYA 2JE5A 1MWTA 1TS7A 2Y2KA 5LBRA 4H6JA 3BLMA 3SH7A 1ODVA 3BFEA 3U2AA 2PAVP 1Z6FA 1NYMA 2ZC3B 3JVUA 1W7FA 4WUJA 3DTKA 1BULA 2WKRA 4OKPA 2E8JA 3V5MA 1XJ4A 1K0KA 5K5BA 4CLCA 3GV9A 5BOHA 1KGGA 1HTZA 1T18A 4Y2FA 4GNUA 1TS8A 3M6BA 4BWIA 1MKIA 2KDKA 2XD5A 1HD8A 1PI4A 3UB9A 4OLGA 3ZVWA 1L3LA 5DJTA 3ZCZA 2ZM8A 3K3CA 1IKGA 5GHXA 1LHYA 3LCEA 1BLHA 4E3MA 3Q81A 2XD1A 2B02A 4R3JA 2HZ5A 3R4KA 2OSUA 3VP1A 1CEGA 3KSFA 2DRWA 3K2NA 2OWJA 1JTDA 1CF0A 3HREA 1K57C 3IXHA 3DTEA 1H3QA 3HLCA 3OLOA 1WA9A 4EW7A 4HEFA 1NRFA 1S4RA 2M1CA 3ZNYA 4JXVA 3VE4A 2L1MA 1TEMA 3UDXA 4O7DA 3GRJA 3PHYA 4KZ5A 4GCZA 3AGDA 4ZJ2A 3SH8A 1VEUA 3I7JA 5F1GA 1LSXA 1YM1A 2R9WA 2UV0E 1BLPA 1XA7A 3GR2A 2ZJ9A 5HW3A 1LL9A 1BUEA 4L9GA 4HBUA 2IWDA 5HDCA 1OTIA 3QHYA 3ZG7B 1XJ6A 1S6RA 2V1BA 2D01A 3LR4A 2ZMFA 5CGXA 2QJ7A 5EVIA 5A93A 2OOLA 1FCNA 3LIAA 1MC0A 5HD3A 1V9ZA 2RCXA 3T4SA 4ZDXA 2JCHA 4EQ1A 1E3UA 1DP8A 2WGWA 5U47A 1VQQA 4EESA 3Q7VB 2V2FF 3GQZA 3P7NA 4HNBA 5CECA 2GNXA 3F1NA 3LIDA 4KG5A 1TS0A 5E2GA 2HDRA 1NLZA 3B3XA 3CUEA 3VP3A 4KQDA 3OPPA 1L0DA 3TG9A 4GLQA 4O0PA 2CMNA 3C4OA 3NULA 2O0YA 4I3IA 3IHBA 4GD6A 1M6KA 1QMEA 2ZQCA 1ZC2A 4N9LA 3D72A 3NIAA 3IWOA 2JHEA 2HV1A 2EWVA 4Q8IA 4CLCD 1YLTA 2Z6CA 4H6JB 2EXAA 2P08A 2RL3A 1AWIA 5DTSA 4BJPA 1IEMA 1XXMA 4R6LA 1UWNX 3FZCA 5CTMA 3T4OA 3PTEA 4CLCB 2PR6A 3S7PA 2HP6A 3L9KA 2J8YA 2INWA 3LO7A 3PBOA 4RVAA 3SOIA 4YINA 2EX2A 5FASA 5EV0A 1IKIA 2LB9A 4DDYA 1TDLA 5AQBA 4U0XA 4D60A 1CEFA 4EWFA 3S7OA 3KSHA 4JXGA 1RGYA 3LEQA 4K08A 4UQIS 1ONHA 2DCFA 5FI2A 1ZHHB 4HH3A 1FIKA 4WN5A 4BQMA 2JKTI 2W3FA 4GDBA 5DTTA 3M2KA 1JVJA 4GZBA 2WKQA 3LY3A 4QY6A 3TSGA 1J9MA 3CZDA 3C30A 5DTKA 4X53A 1I2SA 2VGKA 3HVFA 1SKOA 1ACFA 3IS2A 1OJ5A 4D2OA 2J9PA 1VEUB 2R9XA 3C4PA 3IF5A 4P85A 5AJGA 4ZJ3A 3NY4A 4L0LA 5TJJA 3IH8A 2ZQAA 4LRZE 1YKDA 5DF7A 4OPQA 4BBUA 1VB6A 1MWRA 3PBSA 4AFIA 4I39A 4S2JA 1TVFA 5CEDA 2Y2PA 1T19A 4BLMA 2Y2IA 4BL3A 2V1ZA 1MZUA 3WRZA 2VGLS 3FG8A 4BMWA 5EVIB 1FQGA 4LGWA 3F1OA 4QJGA 1SDEA 3H9WA 3P09A 2VGJA 3IXDA 1DP6A 4YFMA 3N6IA 1BYWA 5CHJA 3VOLA 4MCWA 3EEAA 2O9AA 2PR5A 2L0WA 5JYPA 3LIFA 4JF4A 4MN6A 2X71A 3CG5A 1JWVA 4ZBEA 2XH9A 1EWZA 2VK3A 5DFYA 4S2NC 4EXOA 3C38A 2A49A 2B18A 3BW6A 4BD1A 5HPFA 4OQHA 2J80A 3O86A 4B93A 5HSQA 4E3IA 5FAQA 4G3WA 2EWWA 2ZOIA 1S67L 5J3WA 4UA7A 1PW1A 1PZPA 2W1TA 3LFVA 3UE0A 1N9BA 3M2JA 4WEJA 4MMNA 2NUPC 1RCJA 3CWFA 3T12B 1XFQA 4WMCD 2C6WB 1TDGA 3KSIA 4GN2A 4CQHA 3ULFA 4S2LA 4KZBA 5HDDA 4UAAA 2UWXA 3BFFA 3DW0A 2Y2MA 4OP5A 1YT4A 5A8BA 3L7HA 2K2NA 1PI5A 4WM9A 4HOIA 3FKWA 1OMEA 2L4RA 3HUOA 1DY6A 4IUHA 1OTEA 4PM8A 2NUTC 1SZVA 3D4FA 3VSLA 3A0RA 1N9NA 1KE3A 3ZVTA 2VX8A 4FOFA 5GLBA 4BL2A 1G6AA 3C7VA 3C2WA 2PD8A 4O01A 5EE8A 1GA0A 1OTBA 4HY8A 4E3NA 1CJFA 1XKZA 3O88A 3WWXA 1UGUA 3LIBA 1HZOA 5HZHA 4NXGA 3MXQA 4R1GA 3A3JA 3HLGA 3TJZC 4UHUA 3C5AA 1O07A 2A24A 3SH9A 2QWSA 3G2YA 3IS2B 2Q0OA 3G30A 5FA7A 1KE4A 1K57A 2YKFA 3G32A 2H10A 4NETA 4DE2A 1H0MA 4RYEA 2JKGA 4U3TA 4LCMA 3DBAA 4MLLA 2P04A 2XK1A 3F1OB 5EUAA 3M6HA 3E0YA 2VV7A 5FQJA 4Z1WA 3MXSA 3OBFA 4Q0JA 3SS3A 2EFUA 4X1MA 4X25A 4IHQA 3EQVA 1XPBA 3HLEA 1HVBA 5D3OA 2JKRI 4X68A 4JLFA 3QP6A 1Y4OA 1F2KA 3W8KA 2X01A 2OAQ1 4K0WA 2A3UA 3G4PA 3A0VA 4MEZA 1G5UA 1ES4A 4Y3IA 3FPVA 5FDSA 5IHVA 2Y91A 5TR7A 3LIEA 2ZC6B 3FYZA 4LLOB 1PYYA 1K56A 3UPNA 2EX9A 3V3RA 2Y2QA 3IQAA 1JWZA 4PM7A 1K6RA 3EQUA 4PM9A 1VHMA 4O8GA 3ZNTA 1ZKJA 5HARA 3IBJA 3MS6A 1GHIA 3BECA 4EV4A 2VV8A 2O99A 2WK0A 3T4KA 4MBHA 3H7WA 4NEED 1RP5A 2GX5A 1NRJA 3UB6A 3BY9A 4HJ4A 1T1BA 4DJ3A 3DTMA 3EOIA 2P9VA 1YMXA 5FL3A 2K7SA 5GHYA 2W27A 2V0WA 5CX7A 5E2FA 1KDWA 3OZHA 2PT7A 1FCOA 2V9AA 2XEPA 4K91A 3T1XA 4IUKA 3VFHA 4MBKA 3WS0A 3WS4A 4B4XA 2BLSA 5F68A 2HJEA 3PAEA 3BQAA 2OV5A 3Q07A 3WRTA 5AVFA 2XDMA 1T1AA 1KE0A 2XR0A 2H0TA 3QP2A 1PIOA 2VZWA 3LR3A 1YMSA 5KIZA 2Y2JA 5DJUA 2XSSA 4JBFA 1LT0A 5CXWA 1TF1A 2WKEA 3B33A 1YLJA 2WGIA 4GD8A 2A24B 3QP8A 2PYPA 4K0XA 3IF6C 5FQKA 3FKVA 4CJNA 1KGEA 4XUXA 3TOIA 4FD8A 3IXGA 1X0OA 4OPZA 1SCWA 4DN0A 2KX6A 3LICA 5HL6A 4B4ZA 1YSQA 2WZZA 3GVBA 4E6XA 1P9WA 4ARZB 5G4YA 4FTXA 3P01A 3AGEA 4GHIA 1P0ZA 5A90A 1OTAA 5HX9A 1EW0A 4KZ8A 5EVLA 2WKHA 3CJMA 1YQSA 2W1RA 5FQ9A 4LV0A 3VOZA 3MFXA 4WZ5A 1D06A 2OLUA 3G31A 3QP5A 5CERA 1KVLA 1ERMA 1RGZA 4RX2A 1N9OA 1W8YA 2VA0A 5EOOA 3ZG9B 1LSVA 4BBVA 3BFDA 2VKSA 1STZA 2P74A 2V8CA 2JBFA 5KSHA 3ZG5A 1IELA 2J7VA 3B47A 3MBZA 3LR5A 3ZQ5A 1IYQA 3LUQA 1YLYA 1S1YA 5GHZA 4E04A 1FCMA 4A5RA 4PHTA 4N92A 1BZAA 4B9OA 1OJGA 2XA7M 3N8SA 4HESA 2DMWA 1Z09A 3HL9A 1PWGA 4QPRA 4P6ZS 4CPKA 3UO9A 3LEZA 4HH2A 5JYOA 2Y2NA 3T4QA 3CMZA 2HDUA 4I38A 5L07A 5FDHA 1Y28A 4S2NA 2H28A 3JVVA 2BG1A 4KENB 5C5KA 5F6AA 3PAGA 4M3KA 2PD7A 1ES2A 4CLCC 1OT6A 5HAIA 3H7WB 2I9VA 1YLWA 2WKPA 4OPRA 2QZ6A 3W4OA 4RA7A 3LI8A 4OQIA 2P9VB 1BT5A 4MBFA 3RXWA 3O87A 4FH4A 2R78A 1LI9A 4GDNA 1TS6A 3IT9A 4H8RA 3RH8B 1PNEA 1KVMA 3NI9A 4N9KA 2ZQ8A 4S2KA 5L10A 3FPWA 3W4QA 2H5SA 4S2OA 4C6YA 5KSCA 3SS5A 2G2UA 2B95A 2QMIA 3S22A 5IT5A 1GSVA 3UB5P 3R7WA 1YLPA 4HQAA 3ZDJA 3DWZA 4GJ4A 1MWUA 4KZ4A 4PAUA 1GHPA 2KOIA 3KX0X 3NC8A 4QB8A 5EVID 4Y17A 2G2WA 4KQQA 4PPRA 4P0MA 1D1JA 2PDRA 4WEKA 2WZXA 2ZBBA 3MKFA 4EU0A 1K55A 1E3UD 4IJGA 2AVXA 4R3AA 4PM6A 1DRMA 1C3BA 4GHIB 2ZD8A 1JTGA 1BLSA 1MXOA 1AXBA 5L09A 3ICYA 2BASA 4EUVA 1ALQA 5I5LA 5E2HA 2WGWB 2ACGA 1HLUP 3CUEC 3LYXA 4FH2A 2PU4A 2V8FA 4R23A 3DAVA 3T4LA 3LY4A 4DJ2A 4EETB 4GS9A 1EROA 3F1NB 5M18A 1GSWA 3BFGA 2K31A 5I94A 3NECA 3MF0A 2QYBA 3FV7A 4OOMA 2E8IA 1ERQA 3UPOA 4I3JA 3HUMA 4E3LA 5KZHA 4I5SA 1BSGA 4QD4A 4ESPA 5A92A 3RXXA 5HFOA 2XQZA 3U4LP 1KGFA 2JC7A 2PBYA 2YKHA 4C75A 3T50A 2FH5A 4DE3A 5A91A 5M19A 1OTDA 3NBLA 2XFTA 4LCLA 3E4OA 2OWHA 4ZRRA 3KSGA 1PFLA 3NHQA 3MQQA 4FSFA 3S7QA 4OQGA 4EBLA 3UNWA 1IYPA 3LGOA 2ZM2A 1T1CA 1XGJA 2ZL1A 1KDSA 3HJKA 4Y0TA 4R4SA 1NYYA 4IVKA 3HLBA 1I2WA 5G18A 4ME4A 3EWKA 2FFFB 1IYSA 2ZOHA 4IBXA 1FILA 1UWPX 1M40A 5FQIA 4P6BA 3R7WB 2Y59A 4HIAA 1YAXA 4JGQA 1GHMA 4KQOA 4NKPA 2HP9A 4MNRA 5DFXA 1NY0A 3TW8A 1ONGA 5J4EA 4EEPA 4EQIA 1SKOB 2M7VA 1LSWA 3ITAA 4LV2A 5EECA 3F1PA 5L2FA 3ZG8B 1V9YA 4N1XA 3NOTC 1F5MA 1SDNA 1H5XA 4DRTA 2VV6A 3ZFZA 3BQ8A 4UQIM 4X69A 2JN7A 3NDGA 4LENA 3KO6A 4YWZA 2QKPA 2A2LA 1N4OA 4WL9A 3G35A 3PXPA 3HLFA 4MN7A 4FCFA 4X1LA 3ZG0A 3O5YA 4WELA 3IF6A 2W3EA 1G68A 1XX2A 5DF8A 3WS1A 5GLAA 3N4IA 1MKMA 2EX6A 4NXBA 4Q0IA 3UMEA 5FI6A 4WLAA 4FUWA 1L0FA 2VEAA 3VSKA 3WS2A 4GS9B 3V50A 3MQOA 5HAQA 3HLDA 2JKFA 3PR6A 3SS4A 3T4TA 3MXRA 1N9LA 3QP1A 1NZOA 5F1FA 1K54C 3OPLA 1GA9A 2VGLM 1XA1A 4QU3A 4KZ3A 3PBNA 4DE1A 3JYIA 4WYYA 2V20A 3IWIA 3S1YA 2W1TB 3NOPC 5AQ9A 4HJ6A 5FAOA 3UN7A 3CPTA 1F9IA 1K4EA 1LL5A 1NZUA 5FAPA 2ZC4B 3HUNA 5F82A 4Y13A 3OCLA 4S2IA 5EFWA 3WS5A 4JXWA 4OH0A 2ZM0A 2Z6DA 3FWLA 2Z2LB 3UE1A 2HDSA 3MMHA 1W8QA 3OPHA 1DP9A 2DNSA 3W4PA 4X55A 3MKEA 3NDEA 5FATA 5DKKA 1G28A 4GOGA 2W3DA 5FQQA 1PRQA 5AVEA 3PYPA 4LFUA 2HPBA 5E2EA 5CHUA 2XFSA 3N8LA 2ZQDA 5TFQA 3T1QB 3TE8A 2FZ0A 4DXBA 2JKRM 2C5WB 2ZL1B 4HP4A 1D7EA 1BLCA 3ZHHA 4JPMA 3OPRA 4LRYC 1JNUA 4QWOA 3Q1FA 3UMDA 3VP4A 4ETZA 3JPUA 5GL9A 5EOEA 1XJ2A 4UEYA 2ZMAA 4ID4A 4OOYA 1XFNA 3IWQA 4Z9QA 5IU1A 4Y5FA 2HDQA 4C3QA 2MJ6A 3F1PB 1WYCA 5J8XA 4OONA 3A3FA 3IX3A 2IA2A 4ZAMA 4UA6A 5CRFA 3GMWA 2WYXA 3T1SA 1GSXA 4RX3A 1WE4A 1VETA 2XLNA 3E2LA 5M1AA 4OPYA 5MC7A 1YSPA 3IX8A 1YLZA 2QJ5A 4JGOA 3UE3A 3IF6B 1DJAA 3MSHA 4E3KA 3A3EA 4B88A 3PBTA 1SHVA 1ESIA 3S7NA 4L9EA 1H8MA 1K56D 3S4XA 3N8RA 3NCKA 2Y8HA
chains in the Genus database with same CATH topology
1N9NA 2VX8A 4FOFA 3LR0A 3A0SA 4Q0HA 1W63Q 2P7JA 3C2WA 2PDRA 2GJ3A 4WEKA 2PHYA 2PD8A 4O01A 2ZBBA 1TS7A 1OTBA 5LBRA 4H6JA 4EU0A 4IJGA 3NOUC 4HY8A 4R3AA 1DRMA 4LRXC 4GHIB 2HGVA 2ZMVA 1UGUA 1ODVA 3LIBA 3U2AA 5HZHA 4NXGA 3JVUA 4WUJA 4MN5A 2WKRA 3ICYA 3MXQA 2BASA 1KOUA 1XJ4A 4ETXA 5TBMA 5K5BA 4EUVA 4CLCA 3TJZC 1T18A 4Y2FA 5I5LA 1TS8A 3CUEC 2A24A 3LYXA 2QWSA 4BWIA 3IS2B 2KDKA 3E98A 3UE6A 3UB9A 3T4LA 4DJ2A 4EETB 5DJTA 2W3GA 3K3CA 4GS9A 2Y79A 3F1NB 4G3VA 5DF9A 3MR0A 3CI6A 1GSWA 2YKFA 2B02A 3MJQA 1NWZA 3R4KA 2K31A 3KSFA 3K2NA 2OWJA 3MF0A 2QYBA 3DBAA 4OOMA 1H3QA 2P04A 3OLOA 1WA9A 3F1OB 4EW7A 4I3JA 3E0YA 2VV7A 4Z1WA 4Q0JA 3OBFA 1S4RA 2M1CA 4I5SA 4IHQA 3EQVA 3VE4A 3E4QA 2L1MA 2V0UA 2JKRI 1S4SA 1F98A 3PHYA 4KUOA 3T4JA 4GCZA 2YKHA 2HF6A 2OAQ1 3T50A 2FH5A 1LSXA 3PBQA 1OTDA 5F5YA 3E4OA 4R38A 3A0VA 4L9GA 4HI4A 5HDCA 1OTIA 4Y3IA 2OWHA 3FPVA 2GZAA 4ZRRA 3KSGA 3CITA 3LIEA 1XJ6A 4LLOB 4OOLA 2V1BA 2V1AA 2D01A 3NHQA 3MQQA 3LR4A 4FSFA 2ZMFA 3S7QA 1TD5A 2QJ7A 4M4XA 4HP9A 2OOLA 3LIAA 3HCYA 1MC0A 4BBTA 3H82A 5HD3A 3EQUA 1T1CA 1V9ZA 1VHMA 4O8GA 4L9FA 3HJKA 3T4SA 4MDZA 4EERA 3IBJA 4EQ1A 2VV8A 1DP8A 1IFQA 3VE3A 4ME4A 3EWKA 2O99A 2ZOHA 3B42A 3T4KA 4EESA 1UWPX 1LL8A 3MQ0A 3H7WA 3P7NA 4NEED 4HNBA 2GX5A 2GNXA 1NRJA 3UB6A 3BY9A 3F1NA 3LIDA 3UB7A 1TS0A 4HJ4A 1T1BA 3R7WB 1NLZA 4HIAA 1YAXA 3CUEA 4JGQA 4DJ3A 4KQOA 4NKPA 3EOIA 4JGRA 4KQDA 5FL3A 5DFXA 2K7SA 2W27A 2V0WA 4GLQA 4O0PA 5CX7A 3RTYA 3TW8A 3UB8A 2CMNA 4I3IA 1W63M 2O0YA 4NXEA 5HPIA 5J4EA 2PT7A 4EEPA 2V9AA 2M7VA 1LSWA 3D72A 4IUKA 3F1PA 3VV4A 3G6OA 4R70A 1V9YA 3SW1A 3NOTC 5F68A 2HJEA 1F5MA 4F3LA 3BQAA 3GECA 2JHEA 2VV6A 2HV1A 2EWVA 3BQ8A 4UQIM 4CLCD 2Z6CA 2JN7A 4H6JB 3KYZA 2M7UA 2P08A 3KO6A 5AVFA 2JKTM 4BJPA 4YWZA 4R6LA 2QKPA 1T1AA 3BWLA 2A2LA 1UWNX 5IS1A 4WL9A 3PXPA 4MN7A 2VZWA 3LR3A 5KIZA 5DJUA 2XSSA 4YOFA 3O5YA 4WELA 1IOUA 1LT0A 1OT9A 5TBMB 2W3EA 2J3TD 3T4OA 1TF1A 4CLCB 2PR6A 2VJWA 3S7PA 3B33A 2XRNA 3W2ZA 2A24B 1MKMA 2PYPA 2INWA 2J3TC 4NXBA 4Q0IA 4XT2A 3PBOA 3OC2A 3UMEA 2KLIA 4WLAA 3PBRA 2VEAA 2LB9A 4GS9B 1X0OA 5HWVA 3MQOA 3S7OA 3C8CA 3KSHA 2KX6A 3LICA 4DN0A 3PR6A 3IBRA 5HL6A 1YSQA 3T4TA 4K08A 4UQIS 1N9LA 1P9WA 3ZYTA 5G4YA 4ARZB 1ZHHB 2VGLM 3P01A 4GHIA 1P0ZA 3PBNA 4HH3A 1XJ3A 2W1TB 1OTAA 1EW0A 4WN5A 3NOPC 2XROA 4P6ZM 2JKTI 2W3FA 4HJ6A 3CLOA 4EEUA 4CLCE 5HDSA 2W1RA 4LPZA 3MFXA 1D06A 5HD5A 1F9IA 2WKQA 3C30A 3OCLA 5EFWA 2Z6DA 3EGXC 3V67A 3FC7A 3IS2A 1N9OA 1OJ5A 1S1ZA 3MMHA 2VA0A 1P9RA 1DP9A 4PKYA 1LSVA 5AJGA 4BBVA 4L0LA 2VKSA 5TJJA 1STZA 2PYRA 4LRZE 4II7A 1YKDA 2W0NA 4PKYG 5KSHA 5DKKA 1G28A 4BBUA 2W3HA 1VB6A 4HJ3A 5HWTA 3B47A 3PBSA 4AFIA 3LR5A 3ZQ5A 4I39A 5L8MA 3LUQA 5G4ZA 1S1YA 2W3DA 1T19A 4E04A 4RQ9A 1MZUA 4PHTA 5AVEA 4B9OA 3LI9A 1OJGA 3PYPA 2XA7M 2VGLS 3FG8A 4BMWA 2DMWA 3F1OA 3TE8A 3H9WA 3GDIA 2FZ0A 4QPRA 3H82B 2QHKA 2JKRM 4P6ZS 1DP6A 4HH2A 4HP4A 1BYWA 1D7EA 2LB5A 1OPXA 3T4QA 4I38A 3VOLA 4MCWA 1Y28A 4LRYC 3EEAA 1JNUA 4JGPA 2H28A 3D3OA 2O9AA 3JVVA 2PR5A 2VLGA 5C5KA 3UMDA 4I3AA 5F6AA 2L0WA 3LIFA 2PD7A 4MN6A 4CLCC 1OT6A 3H7WB 4ETZA 5F69A 3HJIA 2I9VA 5DFYA 1G6OA 3EGDC 4EXOA 3C38A 3TRCA 2B18A 2WKPA 3BW6A 1XJ2A 4UEYA 5HPFA 2O9CA 2J80A 3LI8A 3K3DA 4B93A 5HSQA 1XFNA 1ZTUA 4ARZA 4G3WA 5IU1A 3RFBA 2EA9A 2EWWA 2ZOIA 1S67L 4Y5FA 3KYQA 5J3WA 2R78A 1P97A 3E4PA 2W1TA 3LFVA 4HHDA 2O9BA 3BY8A 2MJ6A 3F1PB 3OOVA 2XA7S 1TS6A 1S66L 4WEJA 4MMNA 2NUPC 3RH8B 4F3LB 3CWFA 5HWWA 4G3KA 2IA2A 1XFQA 3FPWA 3NJAA 3KSIA 4CQHA 3ULFA 3CAXA 4GW9A 4DMZA 5HDDA 1GSXA 5J7EA 4KUKA 4YNRA 1NLYA 5IT5A 5A8BA 1GSVA 5MC7A 1YSPA 2HJ9C 3BJNA 4WF0A 3R7WA 2K2NA 2QJ5A 4JGOA 4HQAA 4HOIA 3UE3A 4GJ4A 2J3WA 2L4RA 4PAUA 4IUHA 3PBTA 2D02A 1OTEA 2G7UA 4NXFA 2OAP1 2KOIA 3S7NA 3OCNA 4L9EA 1H8MA 5DKLA 3EEHA 2NUTC 2Y8HA 4XT2B 3A0RA 3KX0X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MN7 A;  2VZW A;  4FOF A;  4QPR A;  4Q0H A;  2XSS A;  4YOF A;  3C2W A;  3O5Y A;  2LB5 A;  2W3E A;  4Y3I A;  4O01 A;  4MCW A;  1TF1 A;  2VJW A;  3KSG A;  4ZRR A;  3CIT A;  5LBR A;  3S7P A;  4LRY C;  4EU0 A;  3EEA A;  4IJG A;  3D3O A;  2O9A A;  3NOU C;  2XRN A;  3W2Z A;  5C5K A;  3NHQ A;  1MKM A;  4LRX C;  2HGV A;  2ZMF A;  3S7Q A;  1TD5 A;  4Q0I A;  2KLI A;  2OOL A;  4ETZ A;  2VEA A;  3HCY A;  5DFY A;  3TRC A;  2LB9 A;  1MC0 A;  2B18 A;  5HPF A;  2O9C A;  3S7O A;  4DN0 A;  3KSH A;  4ETX A;  1VHM A;  4O8G A;  3IBR A;  5HL6 A;  4MDZ A;  3IBJ A;  5HSQ A;  5K5B A;  1YSQ A;  4EUV A;  1ZTU A;  4G3W A;  4Y2F A;  3RFB A;  4ME4 A;  5I5L A;  2O99 A;  4Y5F A;  4BWI A;  3E98 A;  2W1T A;  3LFV A;  3MQ0 A;  2W1T B;  2O9B A;  3NOP C;  3OOV A;  2GX5 A;  2XRO A;  2W3F A;  2W3G A;  4MMN A;  2Y79 A;  2W1R A;  4G3V A;  3CI6 A;  4G3K A;  2IA2 A;  3R4K A;  5DFX A;  2K31 A;  4GLQ A;  4O0P A;  3KSF A;  2O0Y A;  3K2N A;  5HPI A;  3KSI A;  3MF0 A;  4CQH A;  2QYB A;  4GW9 A;  2M7V A;  4DMZ A;  3DBA A;  3MMH A;  4IUK A;  4YNR A;  3VV4 A;  5AJG A;  3G6O A;  2VKS A;  5TJJ A;  4R70 A;  1STZ A;  1YSP A;  3E0Y A;  3NOT C;  3BJN A;  4LRZ E;  1F5M A;  1YKD A;  4Z1W A;  4Q0J A;  3OBF A;  2K2N A;  2W3H A;  3ZQ5 A;  5L8M A;  4PAU A;  2W3D A;  4IUH A;  2M7U A;  4E04 A;  2G7U A;  3KO6 A;  4RQ9 A;  3S7N A;  2KOI A;  4R6L A;  2Y8H A; 
#chains in the Genus database with same CATH topology
 3BRM A;  1U60 A;  4LV1 A;  5FSR A;  1MWS A;  4P87 A;  1K38 A;  4R3B A;  3E2K A;  3GTC A;  2X02 A;  1W63 Q;  2P7J A;  2GJ3 A;  2WUQ A;  5KMW A;  1Y54 A;  4E6W A;  3NOU C;  4LRX C;  2HGV A;  4NK3 A;  2ZMV A;  2IWB A;  3MZD A;  2Y2L A;  3Q82 A;  4MN5 A;  3HBR A;  4EBP A;  3BLS A;  1KOU A;  4ETX A;  3CPT B;  5TBM A;  1W79 A;  4E3O A;  2Z2M B;  1K6S A;  2WAE A;  1PW8 A;  1MBL A;  1K4F A;  4LV3 A;  3BYD A;  3E98 A;  3UE6 A;  2WGV A;  4S2P A;  4OLD A;  4U0T A;  1I5Q A;  1E25 A;  2Y55 A;  2W3G A;  3V39 A;  2Y79 A;  3ZGA B;  2H0Y A;  4G3V A;  5DF9 A;  1CI9 A;  3CI6 A;  3MR0 A;  5EPH A;  3MJQ A;  1NWZ A;  1MPL A;  1FSW A;  3VMA A;  4KZ9 A;  3A3D A;  2J9O A;  2XF3 A;  5FQM A;  1ESU A;  5FEF A;  3IHA A;  4Y0O A;  3BFC A;  2Y4A A;  3Q7Z A;  4R0Q A;  4WBG A;  3E4Q A;  2WKI A;  3C7U A;  4WMC A;  4PM5 A;  2V0U A;  1S4S A;  1F98 A;  4KUO A;  3T4J A;  4XXR A;  5F83 A;  3VFF A;  2HF6 A;  1BTL A;  1PZO A;  5CGS A;  2QPN A;  3PBQ A;  1CQA A;  1XP4 A;  5F5Y A;  4R38 A;  4ZJ1 A;  5E43 A;  4HI4 A;  2ZLY A;  2GZA A;  3CIT A;  4OOL A;  2V1A A;  2ZC5 B;  3GSG A;  1TD5 A;  3MZF A;  4M4X A;  4HP9 A;  3HCY A;  3KYE A;  5FEG A;  4BBT A;  2GDN A;  3H82 A;  1DJC A;  4KG2 A;  4EBN A;  4IED A;  5EVI C;  4L9F A;  4MDZ A;  4EER A;  1CI8 A;  4BD0 A;  4JF5 A;  4UA9 A;  4DXC A;  3CHW P;  4OP8 A;  1IFQ A;  5CHM A;  3VE3 A;  2IWC A;  1ZG6 A;  2OLV A;  1IYO A;  4WZ5 C;  4F94 A;  4ZTK A;  1L0G A;  3B42 A;  3BEB A;  1FOF A;  1LL8 A;  3MQ0 A;  3QNC A;  1NXY A;  1VET B;  1VM1 A;  3UB7 A;  3IX4 A;  2EX8 A;  2I72 A;  3O3V A;  4JGR A;  1W5D A;  1K25 A;  3RTY A;  1WYB A;  4JF6 A;  4KG6 A;  3UB8 A;  1W63 M;  4NXE A;  5HPI A;  1QMF A;  3DWK A;  3V3S A;  4X56 A;  2EFX A;  4E3J A;  1FSY A;  3VV4 A;  3G6O A;  4HBT A;  4R70 A;  3SW1 A;  4F3L A;  3GEC A;  2BTF P;  1Q2P A;  3KYZ A;  3IXB A;  2M7U A;  2JKT M;  1MY8 A;  3BWL A;  4OQ0 A;  5IS1 A;  1FR1 A;  5GLD A;  2FFY A;  5EM1 A;  1S0W A;  4NG2 A;  1E4D A;  4YOF A;  4DF6 A;  1IOU A;  1OT9 A;  5TBM B;  2J3T D;  1DJB A;  5DVA A;  3G2Z A;  2VJW A;  2ZQ7 A;  2XRN A;  3W2Z A;  4N1H A;  1LLB A;  2J3T C;  4XUZ A;  4XT2 A;  3OC2 A;  2EXB A;  5CTN A;  2KLI A;  3PBR A;  1FR6 A;  4S2M A;  1K54 A;  1GCE A;  1A0K A;  1ES3 A;  5HWV A;  3C8C A;  2Q9N A;  3IBR A;  4KQR A;  3UPP A;  4IBR A;  3T1R A;  3ZYT A;  3VP2 A;  4DKI A;  1SKF A;  1XJ3 A;  2XRO A;  4P6Z M;  3D9Y A;  1LI0 A;  4EEU A;  3CLO A;  5EM0 A;  4CLC E;  5HDS A;  4LPZ A;  5HD5 A;  2XGN A;  2WAF A;  4WZ4 A;  4DDS A;  4X6T A;  3EGX C;  5FI7 A;  3V67 A;  3FC7 A;  1S1Z A;  3RJU A;  3HLW A;  1P9R A;  4PKY A;  2PYR A;  2PBD P;  3UDF A;  4II7 A;  4PKY G;  1NJ4 A;  2W0N A;  2W3H A;  4HJ3 A;  3UDI A;  5HWT A;  3QP4 A;  4QY5 A;  5L8M A;  5G4Z A;  1ES5 A;  2ZC7 A;  4RQ9 A;  3LI9 A;  1YPR A;  3ITB A;  5TGF A;  1K55 C;  1L2S A;  4IVI A;  3GDI A;  3H82 B;  4Y7P A;  1L0E A;  2QHK A;  3MFD A;  1PWC A;  5HAP A;  3QNB A;  2LB5 A;  1OPX A;  1O7E A;  1Q2Q A;  4JGP A;  2ZQ9 A;  3D3O A;  3IH9 A;  2VLG A;  4I3A A;  5F69 A;  3HJI A;  1G6O A;  3EGD C;  4GKU A;  3TRC A;  4KZA A;  2O9C A;  4OVD A;  3ISG A;  4EUZ A;  3K3D A;  2PRF A;  3VOY A;  1ZTU A;  4ARZ A;  4QHC A;  1PWD A;  3RFB A;  2EA9 A;  3SZT A;  1ZG4 A;  1J3W A;  3KYQ A;  3A3I A;  4BEN A;  2PU2 A;  1P97 A;  3E4P A;  2WAD A;  2Y2G A;  4HHD A;  4Y0U A;  3P98 A;  2O9B A;  3BY8 A;  4JKT A;  3OOV A;  2XA7 S;  2B5R A;  1S66 L;  4F3L B;  3AGF A;  1JWP A;  4R4R A;  3N7W A;  5HWW A;  4G3K A;  3BM6 A;  3G34 A;  3NJA A;  4PMA A;  3CAX A;  4GW9 A;  4DMZ A;  2Y2O A;  5CEB A;  4KZ6 A;  3Q7V A;  5J7E A;  4KUK A;  1CK3 A;  4YNR A;  5CGW A;  1NLY A;  1EI5 A;  4KZ7 A;  2HJ9 C;  3BJN A;  4JXS A;  4WF0 A;  3DTI A;  1H8Y A;  2HP5 A;  2J3W A;  2CC1 A;  1XGI A;  1H8Z A;  3VP0 A;  5HL1 A;  2D02 A;  2G7U A;  4NXF A;  5AQA A;  2OAP 1;  3OCN A;  5DKL A;  2Q9M A;  3EEH A;  3UY6 A;  4XT2 B;  5AQ7 A;  2Y2H A;  4DE0 A;  3LR0 A;  5EVE A;  3A0S A;  4GB7 A;  4Q0H A;  3MZE A;  4Y15 A;  5GLC A;  2PHY A;  2JE5 A;  1MWT A;  1TS7 A;  2Y2K A;  5LBR A;  4H6J A;  3BLM A;  3SH7 A;  1ODV A;  3BFE A;  3U2A A;  2PAV P;  1Z6F A;  1NYM A;  2ZC3 B;  3JVU A;  1W7F A;  4WUJ A;  3DTK A;  1BUL A;  2WKR A;  4OKP A;  2E8J A;  3V5M A;  1XJ4 A;  1K0K A;  5K5B A;  4CLC A;  3GV9 A;  5BOH A;  1KGG A;  1HTZ A;  1T18 A;  4Y2F A;  4GNU A;  1TS8 A;  3M6B A;  4BWI A;  1MKI A;  2KDK A;  2XD5 A;  1HD8 A;  1PI4 A;  3UB9 A;  4OLG A;  3ZVW A;  1L3L A;  5DJT A;  3ZCZ A;  2ZM8 A;  3K3C A;  1IKG A;  5GHX A;  1LHY A;  3LCE A;  1BLH A;  4E3M A;  3Q81 A;  2XD1 A;  2B02 A;  4R3J A;  2HZ5 A;  3R4K A;  2OSU A;  3VP1 A;  1CEG A;  3KSF A;  2DRW A;  3K2N A;  2OWJ A;  1JTD A;  1CF0 A;  3HRE A;  1K57 C;  3IXH A;  3DTE A;  1H3Q A;  3HLC A;  3OLO A;  1WA9 A;  4EW7 A;  4HEF A;  1NRF A;  1S4R A;  2M1C A;  3ZNY A;  4JXV A;  3VE4 A;  2L1M A;  1TEM A;  3UDX A;  4O7D A;  3GRJ A;  3PHY A;  4KZ5 A;  4GCZ A;  3AGD A;  4ZJ2 A;  3SH8 A;  1VEU A;  3I7J A;  5F1G A;  1LSX A;  1YM1 A;  2R9W A;  2UV0 E;  1BLP A;  1XA7 A;  3GR2 A;  2ZJ9 A;  5HW3 A;  1LL9 A;  1BUE A;  4L9G A;  4HBU A;  2IWD A;  5HDC A;  1OTI A;  3QHY A;  3ZG7 B;  1XJ6 A;  1S6R A;  2V1B A;  2D01 A;  3LR4 A;  2ZMF A;  5CGX A;  2QJ7 A;  5EVI A;  5A93 A;  2OOL A;  1FCN A;  3LIA A;  1MC0 A;  5HD3 A;  1V9Z A;  2RCX A;  3T4S A;  4ZDX A;  2JCH A;  4EQ1 A;  1E3U A;  1DP8 A;  2WGW A;  5U47 A;  1VQQ A;  4EES A;  3Q7V B;  2V2F F;  3GQZ A;  3P7N A;  4HNB A;  5CEC A;  2GNX A;  3F1N A;  3LID A;  4KG5 A;  1TS0 A;  5E2G A;  2HDR A;  1NLZ A;  3B3X A;  3CUE A;  3VP3 A;  4KQD A;  3OPP A;  1L0D A;  3TG9 A;  4GLQ A;  4O0P A;  2CMN A;  3C4O A;  3NUL A;  2O0Y A;  4I3I A;  3IHB A;  4GD6 A;  1M6K A;  1QME A;  2ZQC A;  1ZC2 A;  4N9L A;  3D72 A;  3NIA A;  3IWO A;  2JHE A;  2HV1 A;  2EWV A;  4Q8I A;  4CLC D;  1YLT A;  2Z6C A;  4H6J B;  2EXA A;  2P08 A;  2RL3 A;  1AWI A;  5DTS A;  4BJP A;  1IEM A;  1XXM A;  4R6L A;  1UWN X;  3FZC A;  5CTM A;  3T4O A;  3PTE A;  4CLC B;  2PR6 A;  3S7P A;  2HP6 A;  3L9K A;  2J8Y A;  2INW A;  3LO7 A;  3PBO A;  4RVA A;  3SOI A;  4YIN A;  2EX2 A;  5FAS A;  5EV0 A;  1IKI A;  2LB9 A;  4DDY A;  1TDL A;  5AQB A;  4U0X A;  4D60 A;  1CEF A;  4EWF A;  3S7O A;  3KSH A;  4JXG A;  1RGY A;  3LEQ A;  4K08 A;  4UQI S;  1ONH A;  2DCF A;  5FI2 A;  1ZHH B;  4HH3 A;  1FIK A;  4WN5 A;  4BQM A;  2JKT I;  2W3F A;  4GDB A;  5DTT A;  3M2K A;  1JVJ A;  4GZB A;  2WKQ A;  3LY3 A;  4QY6 A;  3TSG A;  1J9M A;  3CZD A;  3C30 A;  5DTK A;  4X53 A;  1I2S A;  2VGK A;  3HVF A;  1SKO A;  1ACF A;  3IS2 A;  1OJ5 A;  4D2O A;  2J9P A;  1VEU B;  2R9X A;  3C4P A;  3IF5 A;  4P85 A;  5AJG A;  4ZJ3 A;  3NY4 A;  4L0L A;  5TJJ A;  3IH8 A;  2ZQA A;  4LRZ E;  1YKD A;  5DF7 A;  4OPQ A;  4BBU A;  1VB6 A;  1MWR A;  3PBS A;  4AFI A;  4I39 A;  4S2J A;  1TVF A;  5CED A;  2Y2P A;  1T19 A;  4BLM A;  2Y2I A;  4BL3 A;  2V1Z A;  1MZU A;  3WRZ A;  2VGL S;  3FG8 A;  4BMW A;  5EVI B;  1FQG A;  4LGW A;  3F1O A;  4QJG A;  1SDE A;  3H9W A;  3P09 A;  2VGJ A;  3IXD A;  1DP6 A;  4YFM A;  3N6I A;  1BYW A;  5CHJ A;  3VOL A;  4MCW A;  3EEA A;  2O9A A;  2PR5 A;  2L0W A;  5JYP A;  3LIF A;  4JF4 A;  4MN6 A;  2X71 A;  3CG5 A;  1JWV A;  4ZBE A;  2XH9 A;  1EWZ A;  2VK3 A;  5DFY A;  4S2N C;  4EXO A;  3C38 A;  2A49 A;  2B18 A;  3BW6 A;  4BD1 A;  5HPF A;  4OQH A;  2J80 A;  3O86 A;  4B93 A;  5HSQ A;  4E3I A;  5FAQ A;  4G3W A;  2EWW A;  2ZOI A;  1S67 L;  5J3W A;  4UA7 A;  1PW1 A;  1PZP A;  2W1T A;  3LFV A;  3UE0 A;  1N9B A;  3M2J A;  4WEJ A;  4MMN A;  2NUP C;  1RCJ A;  3CWF A;  3T12 B;  1XFQ A;  4WMC D;  2C6W B;  1TDG A;  3KSI A;  4GN2 A;  4CQH A;  3ULF A;  4S2L A;  4KZB A;  5HDD A;  4UAA A;  2UWX A;  3BFF A;  3DW0 A;  2Y2M A;  4OP5 A;  1YT4 A;  5A8B A;  3L7H A;  2K2N A;  1PI5 A;  4WM9 A;  4HOI A;  3FKW A;  1OME A;  2L4R A;  3HUO A;  1DY6 A;  4IUH A;  1OTE A;  4PM8 A;  2NUT C;  1SZV A;  3D4F A;  3VSL A;  3A0R A;  1N9N A;  1KE3 A;  3ZVT A;  2VX8 A;  4FOF A;  5GLB A;  4BL2 A;  1G6A A;  3C7V A;  3C2W A;  2PD8 A;  4O01 A;  5EE8 A;  1GA0 A;  1OTB A;  4HY8 A;  4E3N A;  1CJF A;  1XKZ A;  3O88 A;  3WWX A;  1UGU A;  3LIB A;  1HZO A;  5HZH A;  4NXG A;  3MXQ A;  4R1G A;  3A3J A;  3HLG A;  3TJZ C;  4UHU A;  3C5A A;  1O07 A;  2A24 A;  3SH9 A;  2QWS A;  3G2Y A;  3IS2 B;  2Q0O A;  3G30 A;  5FA7 A;  1KE4 A;  1K57 A;  2YKF A;  3G32 A;  2H10 A;  4NET A;  4DE2 A;  1H0M A;  4RYE A;  2JKG A;  4U3T A;  4LCM A;  3DBA A;  4MLL A;  2P04 A;  2XK1 A;  3F1O B;  5EUA A;  3M6H A;  3E0Y A;  2VV7 A;  5FQJ A;  4Z1W A;  3MXS A;  3OBF A;  4Q0J A;  3SS3 A;  2EFU A;  4X1M A;  4X25 A;  4IHQ A;  3EQV A;  1XPB A;  3HLE A;  1HVB A;  5D3O A;  2JKR I;  4X68 A;  4JLF A;  3QP6 A;  1Y4O A;  1F2K A;  3W8K A;  2X01 A;  2OAQ 1;  4K0W A;  2A3U A;  3G4P A;  3A0V A;  4MEZ A;  1G5U A;  1ES4 A;  4Y3I A;  3FPV A;  5FDS A;  5IHV A;  2Y91 A;  5TR7 A;  3LIE A;  2ZC6 B;  3FYZ A;  4LLO B;  1PYY A;  1K56 A;  3UPN A;  2EX9 A;  3V3R A;  2Y2Q A;  3IQA A;  1JWZ A;  4PM7 A;  1K6R A;  3EQU A;  4PM9 A;  1VHM A;  4O8G A;  3ZNT A;  1ZKJ A;  5HAR A;  3IBJ A;  3MS6 A;  1GHI A;  3BEC A;  4EV4 A;  2VV8 A;  2O99 A;  2WK0 A;  3T4K A;  4MBH A;  3H7W A;  4NEE D;  1RP5 A;  2GX5 A;  1NRJ A;  3UB6 A;  3BY9 A;  4HJ4 A;  1T1B A;  4DJ3 A;  3DTM A;  3EOI A;  2P9V A;  1YMX A;  5FL3 A;  2K7S A;  5GHY A;  2W27 A;  2V0W A;  5CX7 A;  5E2F A;  1KDW A;  3OZH A;  2PT7 A;  1FCO A;  2V9A A;  2XEP A;  4K91 A;  3T1X A;  4IUK A;  3VFH A;  4MBK A;  3WS0 A;  3WS4 A;  4B4X A;  2BLS A;  5F68 A;  2HJE A;  3PAE A;  3BQA A;  2OV5 A;  3Q07 A;  3WRT A;  5AVF A;  2XDM A;  1T1A A;  1KE0 A;  2XR0 A;  2H0T A;  3QP2 A;  1PIO A;  2VZW A;  3LR3 A;  1YMS A;  5KIZ A;  2Y2J A;  5DJU A;  2XSS A;  4JBF A;  1LT0 A;  5CXW A;  1TF1 A;  2WKE A;  3B33 A;  1YLJ A;  2WGI A;  4GD8 A;  2A24 B;  3QP8 A;  2PYP A;  4K0X A;  3IF6 C;  5FQK A;  3FKV A;  4CJN A;  1KGE A;  4XUX A;  3TOI A;  4FD8 A;  3IXG A;  1X0O A;  4OPZ A;  1SCW A;  4DN0 A;  2KX6 A;  3LIC A;  5HL6 A;  4B4Z A;  1YSQ A;  2WZZ A;  3GVB A;  4E6X A;  1P9W A;  4ARZ B;  5G4Y A;  4FTX A;  3P01 A;  3AGE A;  4GHI A;  1P0Z A;  5A90 A;  1OTA A;  5HX9 A;  1EW0 A;  4KZ8 A;  5EVL A;  2WKH A;  3CJM A;  1YQS A;  2W1R A;  5FQ9 A;  4LV0 A;  3VOZ A;  3MFX A;  4WZ5 A;  1D06 A;  2OLU A;  3G31 A;  3QP5 A;  5CER A;  1KVL A;  1ERM A;  1RGZ A;  4RX2 A;  1N9O A;  1W8Y A;  2VA0 A;  5EOO A;  3ZG9 B;  1LSV A;  4BBV A;  3BFD A;  2VKS A;  1STZ A;  2P74 A;  2V8C A;  2JBF A;  5KSH A;  3ZG5 A;  1IEL A;  2J7V A;  3B47 A;  3MBZ A;  3LR5 A;  3ZQ5 A;  1IYQ A;  3LUQ A;  1YLY A;  1S1Y A;  5GHZ A;  4E04 A;  1FCM A;  4A5R A;  4PHT A;  4N92 A;  1BZA A;  4B9O A;  1OJG A;  2XA7 M;  3N8S A;  4HES A;  2DMW A;  1Z09 A;  3HL9 A;  1PWG A;  4QPR A;  4P6Z S;  4CPK A;  3UO9 A;  3LEZ A;  4HH2 A;  5JYO A;  2Y2N A;  3T4Q A;  3CMZ A;  2HDU A;  4I38 A;  5L07 A;  5FDH A;  1Y28 A;  4S2N A;  2H28 A;  3JVV A;  2BG1 A;  4KEN B;  5C5K A;  5F6A A;  3PAG A;  4M3K A;  2PD7 A;  1ES2 A;  4CLC C;  1OT6 A;  5HAI A;  3H7W B;  2I9V A;  1YLW A;  2WKP A;  4OPR A;  2QZ6 A;  3W4O A;  4RA7 A;  3LI8 A;  4OQI A;  2P9V B;  1BT5 A;  4MBF A;  3RXW A;  3O87 A;  4FH4 A;  2R78 A;  1LI9 A;  4GDN A;  1TS6 A;  3IT9 A;  4H8R A;  3RH8 B;  1PNE A;  1KVM A;  3NI9 A;  4N9K A;  2ZQ8 A;  4S2K A;  5L10 A;  3FPW A;  3W4Q A;  2H5S A;  4S2O A;  4C6Y A;  5KSC A;  3SS5 A;  2G2U A;  2B95 A;  2QMI A;  3S22 A;  5IT5 A;  1GSV A;  3UB5 P;  3R7W A;  1YLP A;  4HQA A;  3ZDJ A;  3DWZ A;  4GJ4 A;  1MWU A;  4KZ4 A;  4PAU A;  1GHP A;  2KOI A;  3KX0 X;  3NC8 A;  4QB8 A;  5EVI D;  4Y17 A;  2G2W A;  4KQQ A;  4PPR A;  4P0M A;  1D1J A;  2PDR A;  4WEK A;  2WZX A;  2ZBB A;  3MKF A;  4EU0 A;  1K55 A;  1E3U D;  4IJG A;  2AVX A;  4R3A A;  4PM6 A;  1DRM A;  1C3B A;  4GHI B;  2ZD8 A;  1JTG A;  1BLS A;  1MXO A;  1AXB A;  5L09 A;  3ICY A;  2BAS A;  4EUV A;  1ALQ A;  5I5L A;  5E2H A;  2WGW B;  2ACG A;  1HLU P;  3CUE C;  3LYX A;  4FH2 A;  2PU4 A;  2V8F A;  4R23 A;  3DAV A;  3T4L A;  3LY4 A;  4DJ2 A;  4EET B;  4GS9 A;  1ERO A;  3F1N B;  5M18 A;  1GSW A;  3BFG A;  2K31 A;  5I94 A;  3NEC A;  3MF0 A;  2QYB A;  3FV7 A;  4OOM A;  2E8I A;  1ERQ A;  3UPO A;  4I3J A;  3HUM A;  4E3L A;  5KZH A;  4I5S A;  1BSG A;  4QD4 A;  4ESP A;  5A92 A;  3RXX A;  5HFO A;  2XQZ A;  3U4L P;  1KGF A;  2JC7 A;  2PBY A;  2YKH A;  4C75 A;  3T50 A;  2FH5 A;  4DE3 A;  5A91 A;  5M19 A;  1OTD A;  3NBL A;  2XFT A;  4LCL A;  3E4O A;  2OWH A;  4ZRR A;  3KSG A;  1PFL A;  3NHQ A;  3MQQ A;  4FSF A;  3S7Q A;  4OQG A;  4EBL A;  3UNW A;  1IYP A;  3LGO A;  2ZM2 A;  1T1C A;  1XGJ A;  2ZL1 A;  1KDS A;  3HJK A;  4Y0T A;  4R4S A;  1NYY A;  4IVK A;  3HLB A;  1I2W A;  5G18 A;  4ME4 A;  3EWK A;  2FFF B;  1IYS A;  2ZOH A;  4IBX A;  1FIL A;  1UWP X;  1M40 A;  5FQI A;  4P6B A;  3R7W B;  2Y59 A;  4HIA A;  1YAX A;  4JGQ A;  1GHM A;  4KQO A;  4NKP A;  2HP9 A;  4MNR A;  5DFX A;  1NY0 A;  3TW8 A;  1ONG A;  5J4E A;  4EEP A;  4EQI A;  1SKO B;  2M7V A;  1LSW A;  3ITA A;  4LV2 A;  5EEC A;  3F1P A;  5L2F A;  3ZG8 B;  1V9Y A;  4N1X A;  3NOT C;  1F5M A;  1SDN A;  1H5X A;  4DRT A;  2VV6 A;  3ZFZ A;  3BQ8 A;  4UQI M;  4X69 A;  2JN7 A;  3NDG A;  4LEN A;  3KO6 A;  4YWZ A;  2QKP A;  2A2L A;  1N4O A;  4WL9 A;  3G35 A;  3PXP A;  3HLF A;  4MN7 A;  4FCF A;  4X1L A;  3ZG0 A;  3O5Y A;  4WEL A;  3IF6 A;  2W3E A;  1G68 A;  1XX2 A;  5DF8 A;  3WS1 A;  5GLA A;  3N4I A;  1MKM A;  2EX6 A;  4NXB A;  4Q0I A;  3UME A;  5FI6 A;  4WLA A;  4FUW A;  1L0F A;  2VEA A;  3VSK A;  3WS2 A;  4GS9 B;  3V50 A;  3MQO A;  5HAQ A;  3HLD A;  2JKF A;  3PR6 A;  3SS4 A;  3T4T A;  3MXR A;  1N9L A;  3QP1 A;  1NZO A;  5F1F A;  1K54 C;  3OPL A;  1GA9 A;  2VGL M;  1XA1 A;  4QU3 A;  4KZ3 A;  3PBN A;  4DE1 A;  3JYI A;  4WYY A;  2V20 A;  3IWI A;  3S1Y A;  2W1T B;  3NOP C;  5AQ9 A;  4HJ6 A;  5FAO A;  3UN7 A;  3CPT A;  1F9I A;  1K4E A;  1LL5 A;  1NZU A;  5FAP A;  2ZC4 B;  3HUN A;  5F82 A;  4Y13 A;  3OCL A;  4S2I A;  5EFW A;  3WS5 A;  4JXW A;  4OH0 A;  2ZM0 A;  2Z6D A;  3FWL A;  2Z2L B;  3UE1 A;  2HDS A;  3MMH A;  1W8Q A;  3OPH A;  1DP9 A;  2DNS A;  3W4P A;  4X55 A;  3MKE A;  3NDE A;  5FAT A;  5DKK A;  1G28 A;  4GOG A;  2W3D A;  5FQQ A;  1PRQ A;  5AVE A;  3PYP A;  4LFU A;  2HPB A;  5E2E A;  5CHU A;  2XFS A;  3N8L A;  2ZQD A;  5TFQ A;  3T1Q B;  3TE8 A;  2FZ0 A;  4DXB A;  2JKR M;  2C5W B;  2ZL1 B;  4HP4 A;  1D7E A;  1BLC A;  3ZHH A;  4JPM A;  3OPR A;  4LRY C;  1JNU A;  4QWO A;  3Q1F A;  3UMD A;  3VP4 A;  4ETZ A;  3JPU A;  5GL9 A;  5EOE A;  1XJ2 A;  4UEY A;  2ZMA A;  4ID4 A;  4OOY A;  1XFN A;  3IWQ A;  4Z9Q A;  5IU1 A;  4Y5F A;  2HDQ A;  4C3Q A;  2MJ6 A;  3F1P B;  1WYC A;  5J8X A;  4OON A;  3A3F A;  3IX3 A;  2IA2 A;  4ZAM A;  4UA6 A;  5CRF A;  3GMW A;  2WYX A;  3T1S A;  1GSX A;  4RX3 A;  1WE4 A;  1VET A;  2XLN A;  3E2L A;  5M1A A;  4OPY A;  5MC7 A;  1YSP A;  3IX8 A;  1YLZ A;  2QJ5 A;  4JGO A;  3UE3 A;  3IF6 B;  1DJA A;  3MSH A;  4E3K A;  3A3E A;  4B88 A;  3PBT A;  1SHV A;  1ESI A;  3S7N A;  4L9E A;  1H8M A;  1K56 D;  3S4X A;  3N8R A;  3NCK A;  2Y8H A; 
#chains in the Genus database with same CATH homology
 1N9N A;  2VX8 A;  4FOF A;  3LR0 A;  3A0S A;  4Q0H A;  1W63 Q;  2P7J A;  3C2W A;  2PDR A;  2GJ3 A;  4WEK A;  2PHY A;  2PD8 A;  4O01 A;  2ZBB A;  1TS7 A;  1OTB A;  5LBR A;  4H6J A;  4EU0 A;  4IJG A;  3NOU C;  4HY8 A;  4R3A A;  1DRM A;  4LRX C;  4GHI B;  2HGV A;  2ZMV A;  1UGU A;  1ODV A;  3LIB A;  3U2A A;  5HZH A;  4NXG A;  3JVU A;  4WUJ A;  4MN5 A;  2WKR A;  3ICY A;  3MXQ A;  2BAS A;  1KOU A;  1XJ4 A;  4ETX A;  5TBM A;  5K5B A;  4EUV A;  4CLC A;  3TJZ C;  1T18 A;  4Y2F A;  5I5L A;  1TS8 A;  3CUE C;  2A24 A;  3LYX A;  2QWS A;  4BWI A;  3IS2 B;  2KDK A;  3E98 A;  3UE6 A;  3UB9 A;  3T4L A;  4DJ2 A;  4EET B;  5DJT A;  2W3G A;  3K3C A;  4GS9 A;  2Y79 A;  3F1N B;  4G3V A;  5DF9 A;  3MR0 A;  3CI6 A;  1GSW A;  2YKF A;  2B02 A;  3MJQ A;  1NWZ A;  3R4K A;  2K31 A;  3KSF A;  3K2N A;  2OWJ A;  3MF0 A;  2QYB A;  3DBA A;  4OOM A;  1H3Q A;  2P04 A;  3OLO A;  1WA9 A;  3F1O B;  4EW7 A;  4I3J A;  3E0Y A;  2VV7 A;  4Z1W A;  4Q0J A;  3OBF A;  1S4R A;  2M1C A;  4I5S A;  4IHQ A;  3EQV A;  3VE4 A;  3E4Q A;  2L1M A;  2V0U A;  2JKR I;  1S4S A;  1F98 A;  3PHY A;  4KUO A;  3T4J A;  4GCZ A;  2YKH A;  2HF6 A;  2OAQ 1;  3T50 A;  2FH5 A;  1LSX A;  3PBQ A;  1OTD A;  5F5Y A;  3E4O A;  4R38 A;  3A0V A;  4L9G A;  4HI4 A;  5HDC A;  1OTI A;  4Y3I A;  2OWH A;  3FPV A;  2GZA A;  4ZRR A;  3KSG A;  3CIT A;  3LIE A;  1XJ6 A;  4LLO B;  4OOL A;  2V1B A;  2V1A A;  2D01 A;  3NHQ A;  3MQQ A;  3LR4 A;  4FSF A;  2ZMF A;  3S7Q A;  1TD5 A;  2QJ7 A;  4M4X A;  4HP9 A;  2OOL A;  3LIA A;  3HCY A;  1MC0 A;  4BBT A;  3H82 A;  5HD3 A;  3EQU A;  1T1C A;  1V9Z A;  1VHM A;  4O8G A;  4L9F A;  3HJK A;  3T4S A;  4MDZ A;  4EER A;  3IBJ A;  4EQ1 A;  2VV8 A;  1DP8 A;  1IFQ A;  3VE3 A;  4ME4 A;  3EWK A;  2O99 A;  2ZOH A;  3B42 A;  3T4K A;  4EES A;  1UWP X;  1LL8 A;  3MQ0 A;  3H7W A;  3P7N A;  4NEE D;  4HNB A;  2GX5 A;  2GNX A;  1NRJ A;  3UB6 A;  3BY9 A;  3F1N A;  3LID A;  3UB7 A;  1TS0 A;  4HJ4 A;  1T1B A;  3R7W B;  1NLZ A;  4HIA A;  1YAX A;  3CUE A;  4JGQ A;  4DJ3 A;  4KQO A;  4NKP A;  3EOI A;  4JGR A;  4KQD A;  5FL3 A;  5DFX A;  2K7S A;  2W27 A;  2V0W A;  4GLQ A;  4O0P A;  5CX7 A;  3RTY A;  3TW8 A;  3UB8 A;  2CMN A;  4I3I A;  1W63 M;  2O0Y A;  4NXE A;  5HPI A;  5J4E A;  2PT7 A;  4EEP A;  2V9A A;  2M7V A;  1LSW A;  3D72 A;  4IUK A;  3F1P A;  3VV4 A;  3G6O A;  4R70 A;  1V9Y A;  3SW1 A;  3NOT C;  5F68 A;  2HJE A;  1F5M A;  4F3L A;  3BQA A;  3GEC A;  2JHE A;  2VV6 A;  2HV1 A;  2EWV A;  3BQ8 A;  4UQI M;  4CLC D;  2Z6C A;  2JN7 A;  4H6J B;  3KYZ A;  2M7U A;  2P08 A;  3KO6 A;  5AVF A;  2JKT M;  4BJP A;  4YWZ A;  4R6L A;  2QKP A;  1T1A A;  3BWL A;  2A2L A;  1UWN X;  5IS1 A;  4WL9 A;  3PXP A;  4MN7 A;  2VZW A;  3LR3 A;  5KIZ A;  5DJU A;  2XSS A;  4YOF A;  3O5Y A;  4WEL A;  1IOU A;  1LT0 A;  1OT9 A;  5TBM B;  2W3E A;  2J3T D;  3T4O A;  1TF1 A;  4CLC B;  2PR6 A;  2VJW A;  3S7P A;  3B33 A;  2XRN A;  3W2Z A;  2A24 B;  1MKM A;  2PYP A;  2INW A;  2J3T C;  4NXB A;  4Q0I A;  4XT2 A;  3PBO A;  3OC2 A;  3UME A;  2KLI A;  4WLA A;  3PBR A;  2VEA A;  2LB9 A;  4GS9 B;  1X0O A;  5HWV A;  3MQO A;  3S7O A;  3C8C A;  3KSH A;  2KX6 A;  3LIC A;  4DN0 A;  3PR6 A;  3IBR A;  5HL6 A;  1YSQ A;  3T4T A;  4K08 A;  4UQI S;  1N9L A;  1P9W A;  3ZYT A;  5G4Y A;  4ARZ B;  1ZHH B;  2VGL M;  3P01 A;  4GHI A;  1P0Z A;  3PBN A;  4HH3 A;  1XJ3 A;  2W1T B;  1OTA A;  1EW0 A;  4WN5 A;  3NOP C;  2XRO A;  4P6Z M;  2JKT I;  2W3F A;  4HJ6 A;  3CLO A;  4EEU A;  4CLC E;  5HDS A;  2W1R A;  4LPZ A;  3MFX A;  1D06 A;  5HD5 A;  1F9I A;  2WKQ A;  3C30 A;  3OCL A;  5EFW A;  2Z6D A;  3EGX C;  3V67 A;  3FC7 A;  3IS2 A;  1N9O A;  1OJ5 A;  1S1Z A;  3MMH A;  2VA0 A;  1P9R A;  1DP9 A;  4PKY A;  1LSV A;  5AJG A;  4BBV A;  4L0L A;  2VKS A;  5TJJ A;  1STZ A;  2PYR A;  4LRZ E;  4II7 A;  1YKD A;  2W0N A;  4PKY G;  5KSH A;  5DKK A;  1G28 A;  4BBU A;  2W3H A;  1VB6 A;  4HJ3 A;  5HWT A;  3B47 A;  3PBS A;  4AFI A;  3LR5 A;  3ZQ5 A;  4I39 A;  5L8M A;  3LUQ A;  5G4Z A;  1S1Y A;  2W3D A;  1T19 A;  4E04 A;  4RQ9 A;  1MZU A;  4PHT A;  5AVE A;  4B9O A;  3LI9 A;  1OJG A;  3PYP A;  2XA7 M;  2VGL S;  3FG8 A;  4BMW A;  2DMW A;  3F1O A;  3TE8 A;  3H9W A;  3GDI A;  2FZ0 A;  4QPR A;  3H82 B;  2QHK A;  2JKR M;  4P6Z S;  1DP6 A;  4HH2 A;  4HP4 A;  1BYW A;  1D7E A;  2LB5 A;  1OPX A;  3T4Q A;  4I38 A;  3VOL A;  4MCW A;  1Y28 A;  4LRY C;  3EEA A;  1JNU A;  4JGP A;  2H28 A;  3D3O A;  2O9A A;  3JVV A;  2PR5 A;  2VLG A;  5C5K A;  3UMD A;  4I3A A;  5F6A A;  2L0W A;  3LIF A;  2PD7 A;  4MN6 A;  4CLC C;  1OT6 A;  3H7W B;  4ETZ A;  5F69 A;  3HJI A;  2I9V A;  5DFY A;  1G6O A;  3EGD C;  4EXO A;  3C38 A;  3TRC A;  2B18 A;  2WKP A;  3BW6 A;  1XJ2 A;  4UEY A;  5HPF A;  2O9C A;  2J80 A;  3LI8 A;  3K3D A;  4B93 A;  5HSQ A;  1XFN A;  1ZTU A;  4ARZ A;  4G3W A;  5IU1 A;  3RFB A;  2EA9 A;  2EWW A;  2ZOI A;  1S67 L;  4Y5F A;  3KYQ A;  5J3W A;  2R78 A;  1P97 A;  3E4P A;  2W1T A;  3LFV A;  4HHD A;  2O9B A;  3BY8 A;  2MJ6 A;  3F1P B;  3OOV A;  2XA7 S;  1TS6 A;  1S66 L;  4WEJ A;  4MMN A;  2NUP C;  3RH8 B;  4F3L B;  3CWF A;  5HWW A;  4G3K A;  2IA2 A;  1XFQ A;  3FPW A;  3NJA A;  3KSI A;  4CQH A;  3ULF A;  3CAX A;  4GW9 A;  4DMZ A;  5HDD A;  1GSX A;  5J7E A;  4KUK A;  4YNR A;  1NLY A;  5IT5 A;  5A8B A;  1GSV A;  5MC7 A;  1YSP A;  2HJ9 C;  3BJN A;  4WF0 A;  3R7W A;  2K2N A;  2QJ5 A;  4JGO A;  4HQA A;  4HOI A;  3UE3 A;  4GJ4 A;  2J3W A;  2L4R A;  4PAU A;  4IUH A;  3PBT A;  2D02 A;  1OTE A;  2G7U A;  4NXF A;  2OAP 1;  2KOI A;  3S7N A;  3OCN A;  4L9E A;  1H8M A;  5DKL A;  3EEH A;  2NUT C;  2Y8H A;  4XT2 B;  3A0R A;  3KX0 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...