3O5YA

The crystal structure of the gaf domain of a two-component sensor histidine kinase from bacillus halodurans to 2.45a
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
142
Chain Sequence
MSLDDIINNMIDKLKLLVHFDRISFLLLANETLKLSHVYPKGSHSLDIGSTIPKEQSLYWSALDQRQTIFRSLTDTQDNFYEKQYLAILDLKSILVIPIYSKNKRVGVLSIGRKQQIDWSLDDLAFLEQLTDHLAVSIENVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein
publication title The Crystal Structure of the GAF domain of a two-component sensor histidine kinase from Bacillus halodurans to 2.45A
rcsb
source organism Bacillus halodurans
molecule tags Transcription regulator
total genus 38
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3o5yA00
5DFYA 4EU0A 2B18A 2W3GA 4O0PA 4ZRRA 2W3EA 3KSGA 2VEAA 3CITA 4MN7A 5K5BA 4R6LA 1F5MA 4ETXA 3HCYA 4E04A 2LB5A 5AJGA 5HL6A 1STZA 2K31A 3TRCA 3NHQA 3IBRA 5LBRA 1TD5A 4Y2FA 2G7UA 4FOFA 5HPFA 4QPRA 4ME4A 2O0YA 4RQ9A 2XROA 4LRYC 4LRZE 4CQHA 4IUHA 4Q0IA 1MC0A 3OBFA 5L8MA 2O9AA 4PAUA 3MMHA 3KSIA 2LB9A 2W1TB 4O8GA 4Y5FA 2O9CA 4R70A 5I5LA 3R4KA 3G6OA 3O5YA 3RFBA 1YKDA 2QYBA 4YNRA 3S7PA 3VV4A 4YOFA 3BJNA 2W3HA 3KSHA 3ZQ5A 1YSQA 3C2WA 2XSSA 4MCWA 5HPIA 2M7UA 2W1RA 4G3VA 4MDZA 2KOIA 2VZWA 3E98A 4Q0JA 4Q0HA 2K2NA 2IA2A 2XRNA 3LFVA 2Y8HA 4IJGA 1TF1A 2ZMFA 3E0YA 2O9BA 4GW9A 3D3OA 2Y79A 4MMNA 4G3KA 4G3WA 3NOPC 4Z1WA 3MF0A 4ETZA 2O99A 2KLIA 1ZTUA 3KSFA 4Y3IA 4LRXC 4IUKA 2GX5A 5HSQA 2VKSA 4DMZA 3KO6A 2W1TA 2M7VA 3MQ0A 3S7NA 4BWIA 3NOUC 3K2NA 3NOTC 4DN0A 2HGVA 3S7OA 2VJWA 1MKMA 3W2ZA 2OOLA 5C5KA 1VHMA 2W3DA 5TJJA 3EEAA 4GLQA 1YSPA 5DFXA 3DBAA 3OOVA 4O01A 2W3FA 3CI6A 4EUVA 3S7QA 3IBJA
chains in the Genus database with same CATH superfamily
1GA9A 1PFLA 4X56A 2H0TA 4S2PA 2ZQCA 2HF6A 4EWFA 3E4QA 1KGGA 5K5BA 1F5MA 1T1BA 1LL5A 2EX6A 3AGDA 3F1OA 3GMWA 3IBRA 3PBNA 1ODVA 2DCFA 3HUMA 4OH0A 2ZBBA 3QNBA 4L9EA 4LPZA 2ZOIA 5GHZA 2XH9A 2ZQDA 3A0SA 1LSXA 1WYBA 4EQ1A 5HWTA 2ZQ9A 1SKOB 2X71A 4O8GA 1LLBA 5A90A 1YKDA 4DDYA 3C7VA 4R3JA 3I7JA 5CTMA 2WKPA 2PDRA 5GLBA 4LV0A 2VGJA 3IQAA 2Y59A 2O9BA 3D3OA 3TSGA 4GS9B 5DVAA 2Y2KA 4GDBA 1BT5A 3LYXA 5EVIC 1ZTUA 4PM7A 2VKSA 4R4RA 4P6ZS 3QHYA 3QP5A 1MKMA 1J9MA 5FEFA 3ZNTA 1BZAA 4OPZA 2P04A 4DXCA 3HL9A 5CHUA 1L0GA 4EUVA 2KDKA 5FQJA 1XJ3A 2HJEA 2JKGA 1UGUA 1FR1A 3CG5A 2V1BA 3UE6A 4R0QA 1ZG4A 4JF5A 1FIKA 3E2LA 1D7EA 3N8RA 4UA7A 4QB8A 4KZ9A 4ETXA 1Q2PA 3N6IA 5AQBA 2HDSA 3GDIA 2Y2GA 3ULFA 2EFUA 2PR6A 4NEED 4Y13A 5HPFA 3OBFA 1K54C 2O9AA 1KDSA 3KSIA 4P87A 4HBUA 5HFOA 2QYBA 4P6ZM 1SKFA 3UNWA 1ES2A 3W4QA 4QD4A 2WK0A 3C2WA 3DWZA 2Y2HA 5F1FA 4XUXA 3E98A 1LI0A 4BBUA 1G68A 2PD7A 3BFCA 3QP4A 2B02A 2Y8HA 1NZUA 1YLTA 1OJ5A 4GN2A 1MWRA 3GR2A 4PHTA 3HUNA 5F83A 2V8CA 5FA7A 3DTMA 2ZOHA 3MR0A 4RX3A 3ZHHA 4JXVA 2PD8A 3C30A 2E8IA 2FFYA 3HJKA 3OPRA 4I3JA 3VP4A 4PKYA 1VHMA 4WBGA 1VM1A 5DFXA 1FCNA 1S0WA 2GNXA 3LIFA 5KSCA 2Y2NA 2JCHA 3FPVA 3OOVA 1I5QA 3MBZA 2V20A 1XJ6A 4F3LB 4S2NA 1VQQA 1OTEA 2E8JA 3LIBA 2VGLS 2WGIA 1Z09A 2JKRM 1H8ZA 5IT5A 5FI2A 4GB7A 3ZG9B 2EWWA 3IX8A 5A8BA 4HJ3A 4WEKA 1U60A 4OQGA 3T1RA 2WYXA 5CEDA 2DNSA 4NXBA 2EX2A 4II7A 3BW6A 4LRZE 4EUZA 4JXWA 1BSGA 1S4SA 3A3EA 5FQ9A 4DE3A 1H0MA 5EVEA 5GLCA 1KDWA 3DWKA 1N4OA 3U2AA 3LIAA 4R70A 3UE3A 3RFBA 2WGWB 3IF6C 4Y17A 3V50A 3FKVA 1G5UA 3EWKA 3ITBA 3ZG5A 4MCWA 4HQAA 1K57C 4UA9A 4Q0JA 1SDEA 3JVVA 3PXPA 1K56A 3G32A 3Q7VA 3BWLA 5A91A 2EXAA 2XA7S 2R9XA 1S6RA 1SZVA 4NETA 1TF1A 3A0RA 1JNUA 2VGLM 4CLCB 4G3KA 3O88A 3UB6A 3O86A 5BOHA 5HWWA 3VE4A 1DJCA 2G2UA 5EE8A 2MJ6A 3K2NA 5DKKA 2OOLA 3FYZA 4R3BA 1ACFA 2EX8A 3A0VA 1ONGA 2B95A 3IXGA 4R38A 1KVLA 3FKWA 1MWTA 3RXXA 1T18A 4GZBA 3VP0A 1D06A 1WE4A 5L10A 2PYRA 1MY8A 5EPHA 5FI7A 1YMSA 4LCLA 3TRCA 2K31A 5LBRA 4K0WA 3SW1A 3MSHA 2BLSA 2XA7M 2EWVA 1KE0A 3K3CA 4LRYC 3WS2A 1XGJA 1WA9A 1LSVA 3PTEA 3BFFA 3DTIA 2ZC5B 5I5LA 3N8LA 3O5YA 1QMEA 3DAVA 5AQ9A 3SOIA 4JGRA 3VV4A 1L0EA 2XK1A 1L3LA 4NG2A 4GJ4A 4MN6A 3UO9A 4PPRA 4DRTA 2PT7A 4NXFA 2VZWA 4X55A 2H10A 4X53A 3D9YA 1QMFA 2V9AA 1DP6A 5CERA 1Q2QA 1S66L 4NKPA 4KZAA 2QMIA 1L2SA 3MXSA 3P98A 2JHEA 3UB8A 4WLAA 3UE1A 2HDUA 1CI8A 2Y91A 4DN0A 5GLAA 1PWGA 1IELA 2VJWA 4JGOA 5HX9A 1ESIA 5M1AA 2ZQAA 3N7WA 3IHBA 2JKFA 3LEZA 4JF6A 5TBMA 3B33A 3G31A 3IBJA 5FQKA 1AXBA 4MN5A 2W3EA 1NYYA 3L7HA 1IYOA 2R78A 2A49A 2G2WA 3VP2A 2LB5A 4WELA 2PYPA 2PU4A 4Y2FA 3EQVA 4IHQA 4H6JB 4EEUA 1NLZA 4E3OA 2O0YA 3EGXC 1HZOA 2JE5A 4EESA 4EQIA 4OPRA 1YLZA 4EV4A 5EFWA 1L0FA 5FQMA 3BJNA 1K55C 4QU3A 3HLWA 1ES3A 2JN7A 4NK3A 3ZDJA 3IF5A 1K6RA 4OONA 1JTGA 3BQ8A 1OPXA 3W4PA 1X0OA 3LIEA 2ZMFA 4C6YA 1GSVA 1K56D 4FCFA 3BECA 4E3IA 3G2YA 3IXDA 1DJBA 1MWUA 1GHPA 1K4EA 4HP4A 1DJAA 5HSQA 4ZDXA 1BLCA 1P0ZA 2A2LA 3NOTC 1OMEA 3BM6A 2Q9NA 1RP5A 2YKFA 3H7WB 4L0LA 1H3QA 5DTKA 1IYQA 3N4IA 2J9PA 2P08A 4I39A 2XFSA 3MZDA 4E6WA 3SH8A 2H5SA 1YLYA 2HP6A 4Q8IA 5HAPA 3T50A 2W3GA 1TDLA 4LV1A 4U0TA 3CHWP 4KZ7A 2ZC7A 2Q9MA 3FWLA 1PNEA 1T19A 3HVFA 4MBFA 4BLMA 3VFHA 1CJFA 3NDGA 2J3TD 1PZPA 5EVIA 5HDCA 1OTAA 4XUZA 4RQ9A 5CXWA 5L8MA 3VSKA 4QHCA 3H7WA 2PR5A 3GTCA 4Y5FA 4LENA 2ZQ8A 1AWIA 1N9BA 3G6OA 3S7PA 4BBVA 3UN7A 4FH2A 5HPIA 2I9VA 3M2JA 5F5YA 1OT6A 2V2FF 1K0KA 1ZG6A 3KYQA 2L0WA 1XX2A 4BL3A 2XRNA 5F1GA 3C7UA 2H0YA 4DJ3A 1IYSA 4DKIA 5E2GA 3GV9A 1JVJA 2ZJ9A 2ZC4B 2DMWA 3WS4A 1KOUA 2XGNA 5EM0A 1ZHHB 3WWXA 1K54A 1MPLA 2XEPA 4DMZA 3QP8A 3MQ0A 1VB6A 3NIAA 2WKRA 3ZVWA 4N1HA 1PIOA 5AQ7A 1HD8A 5CHMA 3V3RA 1H5XA 4IVIA 1YSPA 4LLOB 2I72A 2WADA 3S7QA 2ZMAA 2CC1A 5DFYA 3HLDA 4KZBA 2B18A 1JTDA 4KQDA 4ZRRA 3Q7ZA 3LR4A 4WL9A 3MQOA 2Z6DA 1YPRA 3IHAA 4M3KA 4R6LA 1CQAA 2ZM2A 2Y4AA 1STZA 1ESUA 1W8QA 1YMXA 4K91A 3M2KA 1PW1A 3UPNA 3UMEA 1KE3A 3PBSA 4K0XA 4S2LA 3ZYTA 3CAXA 3Q81A 1W5DA 2HP5A 1BULA 3QP2A 2RL3A 5J8XA 2OSUA 3F1NB 3LY4A 4C3QA 3WS5A 1XPBA 5KIZA 3UPPA 4JLFA 3L9KA 3ITAA 3CUEA 2J9OA 4UEYA 1LL8A 3F1PA 4GW9A 4S2MA 3S1YA 2VV7A 4L9GA 3MZFA 3GSGA 1Y4OA 1LL9A 5EOEA 1KE4A 2Y2LA 2FH5A 2HDRA 2K7SA 3DW0A 3Q07A 2Y2QA 2M7VA 3HREA 2HZ5A 1KVMA 3W2ZA 5C5KA 2BTFP 5GHYA 1BLSA 3CJMA 3IF6A 2WZZA 1TEMA 3F1NA 3BYDA 4D2OA 2XF3A 1OTBA 2D01A 1K57A 4S2KA 4LFUA 5U47A 4OOYA 2FZ0A 3E2KA 5L2FA 2VEAA 3VMAA 3HLCA 3IXBA 1BLPA 3HCYA 1YQSA 4GKUA 4JPMA 1FSYA 2ZMVA 3CZDA 1K25A 2Z6CA 3ZG7B 3IH8A 1O07A 5DF7A 3MJQA 5FI6A 5EVID 5EM1A 5IU1A 3T4JA 4EXOA 4KENB 4S2OA 3Q7VB 4NXEA 1TDGA 3EOIA 4ID4A 3C4PA 4HY8A 2ZM0A 3G30A 2ZL1A 3NECA 5DJUA 3ZG8B 1NZOA 4N9KA 1ALQA 4G3VA 1DP8A 3W4OA 3TG9A 4LV3A 5DJTA 1CF0A 3G35A 4GD8A 3E0YA 1VEUA 4FSFA 2PU2A 1PI4A 3T12B 4H8RA 4DF6A 4P0MA 3LUQA 2X02A 1YAXA 1XA1A 1UWNX 3ZG0A 3S7OA 3BY9A 3BFDA 1G6OA 5TFQA 3U4LP 5DTSA 5TJJA 3PAGA 5F82A 5EOOA 3D72A 3EQUA 5FASA 1GHIA 5F69A 4R1GA 1NRJA 2Y2PA 2J8YA 3O87A 5DF8A 4PMAA 3AGFA 2PAVP 2PBDP 1S1ZA 3HBRA 2GZAA 3GECA 5FATA 4CPKA 5E2FA 1EROA 4I3AA 3VP1A 3QP1A 5FAPA 4UAAA 3RXWA 4S2NC 4ME4A 1HLUP 4IUHA 4JXSA 3KX0X 4EEPA 1GSWA 2W1TB 3FG8A 1IYPA 1G6AA 1W63M 4MBKA 1EI5A 3TOIA 1GA0A 4PKYG 3LIDA 3GVBA 3LGOA 3IT9A 3OZHA 4ZAMA 2UV0E 3OPHA 4E3MA 3KSHA 1K6SA 1V9YA 1N9LA 4FH4A 4CJNA 5CGSA 4Q0HA 2K2NA 3HLEA 1H8MA 5FL3A 3CWFA 1I2SA 4KG5A 1NYMA 1T1AA 2JKTI 3UPOA 4PM8A 1IKIA 1IFQA 1PZOA 4G3WA 5FQQA 3KYZA 2O99A 1BLHA 3BRMA 4WM9A 4WMCA 1Z6FA 5DTTA 5TBMB 3T4OA 3IX4A 2W1TA 4I3IA 2QKPA 5E2EA 3UY6A 2HGVA 4KUKA 4R23A 3T4SA 1LHYA 1S4RA 2OAQ1 1P9RA 4MBHA 1CI9A 5HDDA 4BL2A 3WS1A 1K55A 4EBNA 3LI9A 4JGQA 4ZJ1A 2Y55A 3ZGAB 3PBTA 2A3UA 4X25A 4GOGA 1TVFA 4HHDA 4I5SA 4B93A 3GQZA 2WZXA 2C5WB 4HJ4A 3VE3A 3T1QB 2AVXA 4OP5A 3CITA 4MN7A 3UB5P 4FTXA 4OPQA 1LI9A 2OV5A 3NHQA 1NLYA 4P6BA 2PHYA 3UMDA 3ZFZA 4WUJA 4PM9A 4A5RA 2HP9A 4Q0IA 4WZ5A 2XDMA 4FD8A 4F94A 4OLGA 3MMHA 5HAQA 2J3TC 4KZ3A 3NCKA 1NXYA 1YM1A 4CLCC 1C3BA 3IWIA 5F6AA 3TJZC 2ZLYA 2IWDA 4UA6A 1F9IA 5J4EA 2XSSA 3JYIA 4KZ6A 1XA7A 2IA2A 3IS2A 1FCOA 3LFVA 4IJGA 4JKTA 4DE2A 4KZ4A 4E3NA 3TW8A 3PBRA 1PYYA 4BD1A 2IWCA 5TR7A 2XD5A 1OTDA 3NI9A 4KG2A 4E3LA 4QY5A 1CEGA 2M1CA 2WAFA 4OOMA 5CRFA 3DTEA 5A92A 3V5MA 1L0DA 4HNBA 2HDQA 3NOUC 3V67A 4N9LA 5JYPA 3A3IA 4MLLA 2H28A 2W3DA 5AQAA 3UDFA 3T4KA 3CI6A 3N8SA 1EWZA 4FOFA 5HD3A 2L4RA 1BYWA 3LCEA 5EVIB 4C75A 1S1YA 1W8YA 2Y2IA 1MBLA 4ZBEA 1N9OA 4EBLA 3LO7A 4DJ2A 4I38A 3LEQA 3ISGA 4X1MA 5JYOA 4U3TA 5CX7A 3A3DA 4QPRA 5CEBA 2XROA 3ZVTA 2Z2LB 2P74A 1E3UA 1ERQA 2VLGA 2XLNA 2FFFB 4OLDA 3JPUA 2O9CA 1ERMA 1TS7A 5EUAA 4R3AA 3OCNA 1CEFA 2ZQ7A 1XJ2A 2W3HA 2Z2MB 2VGKA 1LT0A 3NY4A 3PBOA 3QP6A 1JWPA 1SHVA 3HLBA 3A3FA 2Y2OA 4HOIA 5A93A 1PWDA 1MXOA 1FCMA 4S2JA 1DP9A 1M6KA 3UB9A 1JWZA 1PI5A 1HVBA 3OPPA 2ZM8A 4MMNA 1O7EA 3PR6A 4IEDA 4UHUA 3D4FA 2GDNA 4RA7A 4D60A 5KSHA 4LRXC 3IX3A 3E4OA 4K08A 3MFXA 1PRQA 4E3JA 4WMCD 3NC8A 4X6TA 2Y2JA 4ZJ3A 3B3XA 5FSRA 4YWZA 3DBAA 5FEGA 4N92A 3BEBA 5CGXA 4CLCE 3P7NA 2D02A 5L09A 4PM6A 3T4TA 3GRJA 2XD1A 3HUOA 4OQ0A 5EV0A 4U0XA 4EU0A 1RGZA 1TS8A 2QJ7A 4KG6A 3KSGA 1TS6A 5J3WA 2HV1A 2WAEA 4E04A 2BG1A 2L1MA 5M18A 3SH7A 2EXBA 5G4ZA 4B4ZA 4MNRA 2EFXA 1ONHA 2V0UA 5KZHA 4B4XA 1K4FA 4BQMA 1KGEA 2JBFA 3FZCA 1OTIA 3PAEA 3CPTB 4Y0UA 1CK3A 2PBYA 1NWZA 4UQIS 5HWVA 2GJ3A 4KZ8A 4KQOA 3F1PB 2B5RA 4OQIA 1NY0A 3BFGA 3ZQ5A 2YKHA 2M7UA 3W8KA 2W1RA 1SKOA 4DXBA 3A3JA 4RX2A 3TE8A 1FSWA 5IS1A 3KYEA 1HTZA 3OLOA 1FILA 2V1AA 3VOYA 1A0KA 4ARZB 1I2WA 2QZ6A 4HI4A 1W79A 5CTNA 4KUOA 3V39A 4ETZA 3V3SA 3IF6B 1DY6A 2OWJA 2WKEA 4WYYA 2OLVA 1BTLA 1XP4A 3VSLA 3CPTA 4IBXA 1RCJA 4GS9A 1FQGA 3HJIA 3EEAA 2XR0A 5AVEA 4HP9A 4LGWA 3IWOA 3SH9A 4XXRA 5TGFA 2HJ9C 1MWSA 1FOFA 4E6XA 5HARA 3B47A 1W63Q 4BENA 5FAOA 3MZEA 4UQIM 4LV2A 2ZC6B 1K38A 2W0NA 3VOLA 5EECA 4ARZA 2HPBA 3JVUA 1ZC2A 3G34A 3S22A 2JKTM 5AJGA 5G18A 1KGFA 4O7DA 3MQQA 3WRZA 3UDIA 4EBPA 1NJ4A 1S67L 4CQHA 2ZL1B 4Y0TA 1RGYA 2C6WB 3C4OA 2LB9A 3NULA 3IXHA 4GDNA 4BMWA 1E3UD 3R4KA 3AGEA 3M6BA 1BUEA 4HIAA 1VEUB 4IVKA 2RCXA 3LI8A 4OOLA 1YSQA 3G4PA 2BASA 2VX8A 4JBFA 4E3KA 5GHXA 4JXGA 3DTKA 3FC7A 1T1CA 3H82B 2QWSA 2WKQA 2KX6A 5FQIA 4BBTA 4GCZA 3SS5A 5GLDA 5F68A 1V9ZA 3BY8A 3PYPA 1F98A 3K3DA 3UB7A 3LY3A 4IUKA 3G2ZA 5FDHA 3BLMA 4HH3A 4BWIA 3C38A 1GSXA 3CUEC 2V8FA 1MKIA 1M40A 3NJAA 3BLSA 5J7EA 5FDSA 2UWXA 3OC2A 4GNUA 3EEHA 3LR3A 2X01A 4YFMA 3MXRA 3P09A 2J7VA 4HJ6A 4O0PA 3MFDA 4Y0OA 4ZTKA 3FPWA 3H82A 4OVDA 1GCEA 2J80A 5CGWA 3MS6A 3CMZA 2CMNA 1XFQA 1N9NA 3NBLA 2ZD8A 4F3LA 1XJ4A 5HZHA 4EETB 4WZ4A 2G7UA 5FAQA 1D1JA 2XFTA 1MC0A 4WF0A 4B88A 1LSWA 4HH2A 5GL9A 4KQQA 4N1XA 3T1XA 4HBTA 3Q1FA 4NXGA 1VETB 1F2KA 1ES5A 3UE0A 4YOFA 4JGPA 4RVAA 3VP3A 4JF4A 1JWVA 3S4XA 3ZNYA 3IH9A 1IOUA 2VA0A 3HLGA 3UDXA 3T1SA 3Q82A 4WN5A 2WGWA 4QWOA 3EGDC 1Y54A 1OT9A 5E2HA 2Y79A 5E43A 4Z1WA 2NUTC 3BFEA 3SS3A 2P7JA 2WKIA 1XXMA 3MKFA 3KO6A 3R7WB 4S2IA 1VETA 4CLCA 1MZUA 3HLFA 2W3FA 4AFIA 4HEFA 4KQRA 2WUQA 5HDSA 1YT4A 2WGVA 3BQAA 2Y2MA 4OPYA 5EVLA 1E25A 5DF9A 4EW7A 4HESA 4OQHA 1W7FA 3P01A 5DKLA 2QHKA 2OLUA 4YINA 2OAP1 3R7WA 1XKZA 3PHYA 3T4QA 3H9WA 3SS4A 4GHIB 3C5AA 1PWCA 2V1ZA 5HD5A 3OPLA 1DRMA 3IS2B 1ZKJA 3IWQA 4RYEA 4BD0A 1SCWA 4YNRA 4B9OA 5KMWA 2ACGA 4OKPA 2NUPC 2JKRI 4MDZA 5IHVA 5L07A 1P97A 3RH8B 1EW0A 4DE1A 1IKGA 4XT2B 1XFNA 3WS0A 5HW3A 5MC7A 4R4SA 3MF0A 2V0WA 4P85A 2KLIA 4X1LA 1FR6A 4GHIA 1YLWA 1NRFA 3SZTA 3S7NA 2W27A 1ES4A 4LCMA 3C8CA 4GLQA 4EERA 3NDEA 3VOZA 4O01A 2J3WA 3MXQA 2ZC3B 1Y28A 2Q0OA 1J3WA 2P9VB 5AVFA 2XQZA 4Z9QA 1E4DA 3QNCA 2JC7A 2VV6A 2DRWA 3E4PA 4XT2A 3MKEA 4WEJA 3CLOA 5HL6A 3OCLA 1SDNA 3M6HA 4QJGA 1TD5A 4X69A 3B42A 3VFFA 4L9FA 1YLJA 4GD6A 2QJ5A 1WYCA 5CHJA 4M4XA 2A24B 5D3OA 2QPNA 4PAUA 3RTYA 3O3VA 4ZJ2A 3ZCZA 2VV8A 4Y15A 4H6JA 3T4LA 5HAIA 4PM5A 4MEZA 1XGIA 2P9VA 2INWA 2PRFA 1GHMA 1H8YA 2EX9A 1YLPA 2KOIA 4OP8A 4WZ5C 1UWPX 5M19A 4Y7PA 4BJPA 2OWHA 4IBRA 2R9WA 4ESPA 5I94A 4DDSA 3NOPC 1TS0A 3WRTA 3LR0A 3LR5A 3RJUA 4KZ5A 3KSFA 4Y3IA 3F1OB 2A24A 2GX5A 5CECA 1IEMA 2WKHA 1OJGA 2EA9A 3ICYA 5G4YA 2VK3A 4QY6A 1P9WA 5HL1A 4DE0A 4FUWA 4CLCD 1PW8A 2IWBA 3LICA 3PBQA 1G28A 4X68A 3FV7A
chains in the Genus database with same CATH topology
3B47A 1W63Q 4UQIM 4MN5A 2W0NA 3VOLA 2W3EA 2HF6A 3E4QA 4ARZA 1S1ZA 2R78A 5K5BA 3JVUA 1F5MA 1T1BA 2GZAA 3GECA 2JKTM 2LB5A 5AJGA 4WELA 2PYPA 3F1OA 3IBRA 3PBNA 4I3AA 4Y2FA 1ODVA 3EQVA 4IHQA 3MQQA 2ZBBA 4L9EA 4LPZA 2ZOIA 4H6JB 4EEUA 1NLZA 4ME4A 2O0YA 1S67L 4CQHA 4IUHA 3EGXC 3A0SA 3KX0X 1LSXA 4EQ1A 5HWTA 4EEPA 1GSWA 4EESA 2LB9A 2W1TB 4O8GA 3FG8A 4BMWA 1W63M 5EFWA 3R4KA 1YKDA 4PKYG 3LIDA 4HIAA 3LI8A 3BJNA 4OOLA 3KSHA 1V9YA 1YSQA 2BASA 2JN7A 2VX8A 1N9LA 2WKPA 4Q0HA 3BQ8A 2K2NA 3FC7A 1OPXA 1H8MA 1X0OA 3CWFA 5FL3A 1T1CA 2PDRA 3LIEA 1T1AA 2ZMFA 3H82B 2JKTI 2QWSA 2KX6A 2WKQA 4BBTA 2O9BA 3D3OA 1IFQA 4GCZA 1GSVA 4G3WA 4GS9B 5F68A 3KYZA 2O99A 1V9ZA 3BY8A 3LYXA 3PYPA 1F98A 1ZTUA 3K3DA 3UB7A 4HP4A 5TBMB 3T4OA 5HSQA 4IUKA 2VKSA 1P0ZA 4P6ZS 2W1TA 4HH3A 4I3IA 4BWIA 2A2LA 2QKPA 3C38A 3NOTC 1GSXA 2HGVA 3CUEC 4KUKA 1MKMA 3T4SA 2YKFA 3H7WB 4L0LA 1H3QA 1S4RA 3NJAA 2P04A 2OAQ1 1P9RA 5J7EA 3OC2A 2P08A 5HDDA 4I39A 3EEHA 3LR3A 3LI9A 4JGQA 4EUVA 2KDKA 4HJ6A 1XJ3A 2HJEA 3PBTA 1UGUA 3T50A 2W3GA 4O0PA 2V1BA 3UE6A 4HHDA 3FPWA 3H82A 4I5SA 4B93A 2J80A 4HJ4A 3VE3A 1D7EA 3CITA 4MN7A 1T19A 2CMNA 1XFQA 4ETXA 1N9NA 3NHQA 1NLYA 3UMDA 2PHYA 1XJ4A 4F3LA 2J3TD 5HZHA 4WUJA 3GDIA 5HDCA 4EETB 3ULFA 1OTAA 2G7UA 2PR6A 4NEED 5HPFA 4RQ9A 4Q0IA 1MC0A 4WF0A 3OBFA 1LSWA 4HH2A 5L8MA 2O9AA 3MMHA 3KSIA 2J3TC 2PR5A 3H7WA 4Y5FA 4CLCC 4NXGA 3G6OA 5F6AA 3TJZC 2QYBA 4P6ZM 3S7PA 4BBVA 4YOFA 1F9IA 5J4EA 4JGPA 2XSSA 3C2WA 5HPIA 2I9VA 5F5YA 1OT6A 1IOUA 3KYQA 3E98A 2L0WA 2VA0A 2IA2A 2XRNA 4BBUA 3IS2A 2PD7A 4WN5A 3LFVA 2B02A 2Y8HA 4IJGA 3EGDC 1OJ5A 1OT9A 4DJ3A 2Y79A 3TW8A 4PHTA 3PBRA 4Z1WA 2DMWA 2NUTC 2ZOHA 1KOUA 1OTDA 3MR0A 2P7JA 2M1CA 2PD8A 3C30A 1ZHHB 4OOMA 3HJKA 3KO6A 4DMZA 3MQ0A 4HNBA 3R7WB 3NOUC 3V67A 1VB6A 4I3JA 4CLCA 1MZUA 2WKRA 4PKYA 1VHMA 2H28A 2W3DA 4LLOB 1YSPA 5DFXA 2GNXA 3LIFA 3OOVA 3FPVA 3T4KA 2W3FA 3CI6A 4AFIA 1XJ6A 3S7QA 4FOFA 4F3LB 5HD3A 2L4RA 1OTEA 1BYWA 3LIBA 5DFYA 5HDSA 1S1YA 2VGLS 2B18A 2JKRM 3BQAA 4KQDA 4ZRRA 5IT5A 3LR4A 4WL9A 1N9OA 2EWWA 3MQOA 5A8BA 4HJ3A 2Z6DA 4R6LA 5DF9A 4EW7A 4DJ2A 1STZA 4I38A 4WEKA 3P01A 5DKLA 2QHKA 5CX7A 4QPRA 3UMEA 2XROA 2OAP1 4NXBA 4II7A 4LRZE 3BW6A 3PBSA 3R7WA 3PHYA 1S4SA 2VLGA 3T4QA 3H9WA 3ZYTA 3CAXA 4GHIB 2O9CA 3U2AA 5HD5A 3LIAA 4R70A 1DRMA 1TS7A 3UE3A 3IS2B 4R3AA 3OCNA 3RFBA 4YNRA 4B9OA 1XJ2A 2W3HA 3EWKA 1LT0A 3F1NB 3PBOA 4MCWA 2NUPC 5KIZA 2JKRI 4MDZA 4HOIA 4HQAA 4Q0JA 3JVVA 1P97A 3PXPA 3RH8B 3CUEA 1DP9A 1EW0A 3UB9A 3BWLA 2XA7S 4UEYA 4XT2B 1XFNA 1TF1A 1LL8A 3F1PA 3A0RA 1JNUA 4GW9A 5MC7A 2VGLM 4MMNA 4CLCB 4G3KA 3PR6A 2VV7A 3MF0A 4L9GA 2V0WA 3UB6A 5HWWA 2KLIA 3VE4A 5KSHA 2FH5A 2K7SA 4LRXC 3E4OA 4K08A 3MFXA 4GHIA 2M7VA 3S7NA 2W27A 2MJ6A 3K2NA 5DKKA 3W2ZA 2OOLA 5C5KA 3C8CA 4GLQA 4YWZA 3A0VA 4EERA 3DBAA 3F1NA 4O01A 2J3WA 3MXQA 1Y28A 4CLCE 3P7NA 2D02A 4R38A 3T4TA 1OTBA 2D01A 5AVFA 2VV6A 4EU0A 1T18A 3E4PA 1TS8A 2QJ7A 4XT2A 1D06A 2FZ0A 2PYRA 3KSGA 2VEAA 1TS6A 5J3WA 2HV1A 4WEJA 3CLOA 3HCYA 4E04A 5HL6A 3TRCA 2K31A 3OCLA 2L1MA 2ZMVA 5LBRA 1TD5A 2Z6CA 3SW1A 2XA7M 3B42A 2EWVA 5G4ZA 4L9FA 2QJ5A 3K3CA 2V0UA 4LRYC 3MJQA 4M4XA 1WA9A 2A24B 5IU1A 4PAUA 1LSVA 3RTYA 3T4JA 1OTIA 4EXOA 5I5LA 2VV8A 3O5YA 1NWZA 4NXEA 4UQIS 5HWVA 3EOIA 4H6JA 3T4LA 4JGRA 3VV4A 2GJ3A 4HY8A 4KQOA 3F1PB 2INWA 4GJ4A 3ZQ5A 4MN6A 5DJUA 2YKHA 2M7UA 2W1RA 4G3VA 2PT7A 4NXFA 2KOIA 2VZWA 1DP8A 1UWPX 3TE8A 5IS1A 5DJTA 4BJPA 3OLOA 2OWHA 2V9AA 1DP6A 2V1AA 3E0YA 1S66L 4FSFA 4ARZB 4NKPA 4HI4A 3NOPC 1TS0A 4KUOA 3LR0A 3LR5A 4ETZA 3KSFA 4Y3IA 3F1OB 2OWJA 3LUQA 2JHEA 3UB8A 2A24A 2GX5A 4WLAA 1OJGA 1YAXA 4DN0A 2EA9A 3ICYA 1UWNX 5G4YA 3S7OA 3BY9A 2VJWA 4GS9A 1G6OA 4JGOA 1P9WA 3HJIA 5TJJA 3EEAA 5AVEA 4HP9A 5TBMA 3D72A 4CLCD 3B33A 3EQUA 3LICA 3PBQA 1G28A 5F69A 2HJ9C 1NRJA 3IBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DFY A;  4EU0 A;  2B18 A;  2W3G A;  4O0P A;  4ZRR A;  2W3E A;  3KSG A;  2VEA A;  3CIT A;  4MN7 A;  5K5B A;  4R6L A;  1F5M A;  4ETX A;  3HCY A;  4E04 A;  2LB5 A;  5AJG A;  5HL6 A;  1STZ A;  2K31 A;  3TRC A;  3NHQ A;  3IBR A;  5LBR A;  1TD5 A;  4Y2F A;  2G7U A;  4FOF A;  5HPF A;  4QPR A;  4ME4 A;  2O0Y A;  4RQ9 A;  2XRO A;  4LRY C;  4LRZ E;  4CQH A;  4IUH A;  4Q0I A;  1MC0 A;  3OBF A;  5L8M A;  2O9A A;  4PAU A;  3MMH A;  3KSI A;  2LB9 A;  2W1T B;  4O8G A;  4Y5F A;  2O9C A;  4R70 A;  5I5L A;  3R4K A;  3G6O A;  3O5Y A;  3RFB A;  1YKD A;  2QYB A;  4YNR A;  3S7P A;  3VV4 A;  4YOF A;  3BJN A;  2W3H A;  3KSH A;  3ZQ5 A;  1YSQ A;  3C2W A;  2XSS A;  4MCW A;  5HPI A;  2M7U A;  2W1R A;  4G3V A;  4MDZ A;  2KOI A;  2VZW A;  3E98 A;  4Q0J A;  4Q0H A;  2K2N A;  2IA2 A;  2XRN A;  3LFV A;  2Y8H A;  4IJG A;  1TF1 A;  2ZMF A;  3E0Y A;  2O9B A;  4GW9 A;  3D3O A;  2Y79 A;  4MMN A;  4G3K A;  4G3W A;  3NOP C;  4Z1W A;  3MF0 A;  4ETZ A;  2O99 A;  2KLI A;  1ZTU A;  3KSF A;  4Y3I A;  4LRX C;  4IUK A;  2GX5 A;  5HSQ A;  2VKS A;  4DMZ A;  3KO6 A;  2W1T A;  2M7V A;  3MQ0 A;  3S7N A;  4BWI A;  3NOU C;  3K2N A;  3NOT C;  4DN0 A;  2HGV A;  3S7O A;  2VJW A;  1MKM A;  3W2Z A;  2OOL A;  5C5K A;  1VHM A;  2W3D A;  5TJJ A;  3EEA A;  4GLQ A;  1YSP A;  5DFX A;  3DBA A;  3OOV A;  4O01 A;  2W3F A;  3CI6 A;  4EUV A;  3S7Q A;  3IBJ A; 
#chains in the Genus database with same CATH topology
 1GA9 A;  1PFL A;  4X56 A;  2H0T A;  4S2P A;  2ZQC A;  2HF6 A;  4EWF A;  3E4Q A;  1KGG A;  5K5B A;  1F5M A;  1T1B A;  1LL5 A;  2EX6 A;  3AGD A;  3F1O A;  3GMW A;  3IBR A;  3PBN A;  1ODV A;  2DCF A;  3HUM A;  4OH0 A;  2ZBB A;  3QNB A;  4L9E A;  4LPZ A;  2ZOI A;  5GHZ A;  2XH9 A;  2ZQD A;  3A0S A;  1LSX A;  1WYB A;  4EQ1 A;  5HWT A;  2ZQ9 A;  1SKO B;  2X71 A;  4O8G A;  1LLB A;  5A90 A;  1YKD A;  4DDY A;  3C7V A;  4R3J A;  3I7J A;  5CTM A;  2WKP A;  2PDR A;  5GLB A;  4LV0 A;  2VGJ A;  3IQA A;  2Y59 A;  2O9B A;  3D3O A;  3TSG A;  4GS9 B;  5DVA A;  2Y2K A;  4GDB A;  1BT5 A;  3LYX A;  5EVI C;  1ZTU A;  4PM7 A;  2VKS A;  4R4R A;  4P6Z S;  3QHY A;  3QP5 A;  1MKM A;  1J9M A;  5FEF A;  3ZNT A;  1BZA A;  4OPZ A;  2P04 A;  4DXC A;  3HL9 A;  5CHU A;  1L0G A;  4EUV A;  2KDK A;  5FQJ A;  1XJ3 A;  2HJE A;  2JKG A;  1UGU A;  1FR1 A;  3CG5 A;  2V1B A;  3UE6 A;  4R0Q A;  1ZG4 A;  4JF5 A;  1FIK A;  3E2L A;  1D7E A;  3N8R A;  4UA7 A;  4QB8 A;  4KZ9 A;  4ETX A;  1Q2P A;  3N6I A;  5AQB A;  2HDS A;  3GDI A;  2Y2G A;  3ULF A;  2EFU A;  2PR6 A;  4NEE D;  4Y13 A;  5HPF A;  3OBF A;  1K54 C;  2O9A A;  1KDS A;  3KSI A;  4P87 A;  4HBU A;  5HFO A;  2QYB A;  4P6Z M;  1SKF A;  3UNW A;  1ES2 A;  3W4Q A;  4QD4 A;  2WK0 A;  3C2W A;  3DWZ A;  2Y2H A;  5F1F A;  4XUX A;  3E98 A;  1LI0 A;  4BBU A;  1G68 A;  2PD7 A;  3BFC A;  3QP4 A;  2B02 A;  2Y8H A;  1NZU A;  1YLT A;  1OJ5 A;  4GN2 A;  1MWR A;  3GR2 A;  4PHT A;  3HUN A;  5F83 A;  2V8C A;  5FA7 A;  3DTM A;  2ZOH A;  3MR0 A;  4RX3 A;  3ZHH A;  4JXV A;  2PD8 A;  3C30 A;  2E8I A;  2FFY A;  3HJK A;  3OPR A;  4I3J A;  3VP4 A;  4PKY A;  1VHM A;  4WBG A;  1VM1 A;  5DFX A;  1FCN A;  1S0W A;  2GNX A;  3LIF A;  5KSC A;  2Y2N A;  2JCH A;  3FPV A;  3OOV A;  1I5Q A;  3MBZ A;  2V20 A;  1XJ6 A;  4F3L B;  4S2N A;  1VQQ A;  1OTE A;  2E8J A;  3LIB A;  2VGL S;  2WGI A;  1Z09 A;  2JKR M;  1H8Z A;  5IT5 A;  5FI2 A;  4GB7 A;  3ZG9 B;  2EWW A;  3IX8 A;  5A8B A;  4HJ3 A;  4WEK A;  1U60 A;  4OQG A;  3T1R A;  2WYX A;  5CED A;  2DNS A;  4NXB A;  2EX2 A;  4II7 A;  3BW6 A;  4LRZ E;  4EUZ A;  4JXW A;  1BSG A;  1S4S A;  3A3E A;  5FQ9 A;  4DE3 A;  1H0M A;  5EVE A;  5GLC A;  1KDW A;  3DWK A;  1N4O A;  3U2A A;  3LIA A;  4R70 A;  3UE3 A;  3RFB A;  2WGW B;  3IF6 C;  4Y17 A;  3V50 A;  3FKV A;  1G5U A;  3EWK A;  3ITB A;  3ZG5 A;  4MCW A;  4HQA A;  1K57 C;  4UA9 A;  4Q0J A;  1SDE A;  3JVV A;  3PXP A;  1K56 A;  3G32 A;  3Q7V A;  3BWL A;  5A91 A;  2EXA A;  2XA7 S;  2R9X A;  1S6R A;  1SZV A;  4NET A;  1TF1 A;  3A0R A;  1JNU A;  2VGL M;  4CLC B;  4G3K A;  3O88 A;  3UB6 A;  3O86 A;  5BOH A;  5HWW A;  3VE4 A;  1DJC A;  2G2U A;  5EE8 A;  2MJ6 A;  3K2N A;  5DKK A;  2OOL A;  3FYZ A;  4R3B A;  1ACF A;  2EX8 A;  3A0V A;  1ONG A;  2B95 A;  3IXG A;  4R38 A;  1KVL A;  3FKW A;  1MWT A;  3RXX A;  1T18 A;  4GZB A;  3VP0 A;  1D06 A;  1WE4 A;  5L10 A;  2PYR A;  1MY8 A;  5EPH A;  5FI7 A;  1YMS A;  4LCL A;  3TRC A;  2K31 A;  5LBR A;  4K0W A;  3SW1 A;  3MSH A;  2BLS A;  2XA7 M;  2EWV A;  1KE0 A;  3K3C A;  4LRY C;  3WS2 A;  1XGJ A;  1WA9 A;  1LSV A;  3PTE A;  3BFF A;  3DTI A;  2ZC5 B;  5I5L A;  3N8L A;  3O5Y A;  1QME A;  3DAV A;  5AQ9 A;  3SOI A;  4JGR A;  3VV4 A;  1L0E A;  2XK1 A;  1L3L A;  4NG2 A;  4GJ4 A;  4MN6 A;  3UO9 A;  4PPR A;  4DRT A;  2PT7 A;  4NXF A;  2VZW A;  4X55 A;  2H10 A;  4X53 A;  3D9Y A;  1QMF A;  2V9A A;  1DP6 A;  5CER A;  1Q2Q A;  1S66 L;  4NKP A;  4KZA A;  2QMI A;  1L2S A;  3MXS A;  3P98 A;  2JHE A;  3UB8 A;  4WLA A;  3UE1 A;  2HDU A;  1CI8 A;  2Y91 A;  4DN0 A;  5GLA A;  1PWG A;  1IEL A;  2VJW A;  4JGO A;  5HX9 A;  1ESI A;  5M1A A;  2ZQA A;  3N7W A;  3IHB A;  2JKF A;  3LEZ A;  4JF6 A;  5TBM A;  3B33 A;  3G31 A;  3IBJ A;  5FQK A;  1AXB A;  4MN5 A;  2W3E A;  1NYY A;  3L7H A;  1IYO A;  2R78 A;  2A49 A;  2G2W A;  3VP2 A;  2LB5 A;  4WEL A;  2PYP A;  2PU4 A;  4Y2F A;  3EQV A;  4IHQ A;  4H6J B;  4EEU A;  1NLZ A;  4E3O A;  2O0Y A;  3EGX C;  1HZO A;  2JE5 A;  4EES A;  4EQI A;  4OPR A;  1YLZ A;  4EV4 A;  5EFW A;  1L0F A;  5FQM A;  3BJN A;  1K55 C;  4QU3 A;  3HLW A;  1ES3 A;  2JN7 A;  4NK3 A;  3ZDJ A;  3IF5 A;  1K6R A;  4OON A;  1JTG A;  3BQ8 A;  1OPX A;  3W4P A;  1X0O A;  3LIE A;  2ZMF A;  4C6Y A;  1GSV A;  1K56 D;  4FCF A;  3BEC A;  4E3I A;  3G2Y A;  3IXD A;  1DJB A;  1MWU A;  1GHP A;  1K4E A;  4HP4 A;  1DJA A;  5HSQ A;  4ZDX A;  1BLC A;  1P0Z A;  2A2L A;  3NOT C;  1OME A;  3BM6 A;  2Q9N A;  1RP5 A;  2YKF A;  3H7W B;  4L0L A;  1H3Q A;  5DTK A;  1IYQ A;  3N4I A;  2J9P A;  2P08 A;  4I39 A;  2XFS A;  3MZD A;  4E6W A;  3SH8 A;  2H5S A;  1YLY A;  2HP6 A;  4Q8I A;  5HAP A;  3T50 A;  2W3G A;  1TDL A;  4LV1 A;  4U0T A;  3CHW P;  4KZ7 A;  2ZC7 A;  2Q9M A;  3FWL A;  1PNE A;  1T19 A;  3HVF A;  4MBF A;  4BLM A;  3VFH A;  1CJF A;  3NDG A;  2J3T D;  1PZP A;  5EVI A;  5HDC A;  1OTA A;  4XUZ A;  4RQ9 A;  5CXW A;  5L8M A;  3VSK A;  4QHC A;  3H7W A;  2PR5 A;  3GTC A;  4Y5F A;  4LEN A;  2ZQ8 A;  1AWI A;  1N9B A;  3G6O A;  3S7P A;  4BBV A;  3UN7 A;  4FH2 A;  5HPI A;  2I9V A;  3M2J A;  5F5Y A;  1OT6 A;  2V2F F;  1K0K A;  1ZG6 A;  3KYQ A;  2L0W A;  1XX2 A;  4BL3 A;  2XRN A;  5F1G A;  3C7U A;  2H0Y A;  4DJ3 A;  1IYS A;  4DKI A;  5E2G A;  3GV9 A;  1JVJ A;  2ZJ9 A;  2ZC4 B;  2DMW A;  3WS4 A;  1KOU A;  2XGN A;  5EM0 A;  1ZHH B;  3WWX A;  1K54 A;  1MPL A;  2XEP A;  4DMZ A;  3QP8 A;  3MQ0 A;  1VB6 A;  3NIA A;  2WKR A;  3ZVW A;  4N1H A;  1PIO A;  5AQ7 A;  1HD8 A;  5CHM A;  3V3R A;  1H5X A;  4IVI A;  1YSP A;  4LLO B;  2I72 A;  2WAD A;  3S7Q A;  2ZMA A;  2CC1 A;  5DFY A;  3HLD A;  4KZB A;  2B18 A;  1JTD A;  4KQD A;  4ZRR A;  3Q7Z A;  3LR4 A;  4WL9 A;  3MQO A;  2Z6D A;  1YPR A;  3IHA A;  4M3K A;  4R6L A;  1CQA A;  2ZM2 A;  2Y4A A;  1STZ A;  1ESU A;  1W8Q A;  1YMX A;  4K91 A;  3M2K A;  1PW1 A;  3UPN A;  3UME A;  1KE3 A;  3PBS A;  4K0X A;  4S2L A;  3ZYT A;  3CAX A;  3Q81 A;  1W5D A;  2HP5 A;  1BUL A;  3QP2 A;  2RL3 A;  5J8X A;  2OSU A;  3F1N B;  3LY4 A;  4C3Q A;  3WS5 A;  1XPB A;  5KIZ A;  3UPP A;  4JLF A;  3L9K A;  3ITA A;  3CUE A;  2J9O A;  4UEY A;  1LL8 A;  3F1P A;  4GW9 A;  4S2M A;  3S1Y A;  2VV7 A;  4L9G A;  3MZF A;  3GSG A;  1Y4O A;  1LL9 A;  5EOE A;  1KE4 A;  2Y2L A;  2FH5 A;  2HDR A;  2K7S A;  3DW0 A;  3Q07 A;  2Y2Q A;  2M7V A;  3HRE A;  2HZ5 A;  1KVM A;  3W2Z A;  5C5K A;  2BTF P;  5GHY A;  1BLS A;  3CJM A;  3IF6 A;  2WZZ A;  1TEM A;  3F1N A;  3BYD A;  4D2O A;  2XF3 A;  1OTB A;  2D01 A;  1K57 A;  4S2K A;  4LFU A;  5U47 A;  4OOY A;  2FZ0 A;  3E2K A;  5L2F A;  2VEA A;  3VMA A;  3HLC A;  3IXB A;  1BLP A;  3HCY A;  1YQS A;  4GKU A;  4JPM A;  1FSY A;  2ZMV A;  3CZD A;  1K25 A;  2Z6C A;  3ZG7 B;  3IH8 A;  1O07 A;  5DF7 A;  3MJQ A;  5FI6 A;  5EVI D;  5EM1 A;  5IU1 A;  3T4J A;  4EXO A;  4KEN B;  4S2O A;  3Q7V B;  4NXE A;  1TDG A;  3EOI A;  4ID4 A;  3C4P A;  4HY8 A;  2ZM0 A;  3G30 A;  2ZL1 A;  3NEC A;  5DJU A;  3ZG8 B;  1NZO A;  4N9K A;  1ALQ A;  4G3V A;  1DP8 A;  3W4O A;  3TG9 A;  4LV3 A;  5DJT A;  1CF0 A;  3G35 A;  4GD8 A;  3E0Y A;  1VEU A;  4FSF A;  2PU2 A;  1PI4 A;  3T12 B;  4H8R A;  4DF6 A;  4P0M A;  3LUQ A;  2X02 A;  1YAX A;  1XA1 A;  1UWN X;  3ZG0 A;  3S7O A;  3BY9 A;  3BFD A;  1G6O A;  5TFQ A;  3U4L P;  5DTS A;  5TJJ A;  3PAG A;  5F82 A;  5EOO A;  3D72 A;  3EQU A;  5FAS A;  1GHI A;  5F69 A;  4R1G A;  1NRJ A;  2Y2P A;  2J8Y A;  3O87 A;  5DF8 A;  4PMA A;  3AGF A;  2PAV P;  2PBD P;  1S1Z A;  3HBR A;  2GZA A;  3GEC A;  5FAT A;  4CPK A;  5E2F A;  1ERO A;  4I3A A;  3VP1 A;  3QP1 A;  5FAP A;  4UAA A;  3RXW A;  4S2N C;  4ME4 A;  1HLU P;  4IUH A;  4JXS A;  3KX0 X;  4EEP A;  1GSW A;  2W1T B;  3FG8 A;  1IYP A;  1G6A A;  1W63 M;  4MBK A;  1EI5 A;  3TOI A;  1GA0 A;  4PKY G;  3LID A;  3GVB A;  3LGO A;  3IT9 A;  3OZH A;  4ZAM A;  2UV0 E;  3OPH A;  4E3M A;  3KSH A;  1K6S A;  1V9Y A;  1N9L A;  4FH4 A;  4CJN A;  5CGS A;  4Q0H A;  2K2N A;  3HLE A;  1H8M A;  5FL3 A;  3CWF A;  1I2S A;  4KG5 A;  1NYM A;  1T1A A;  2JKT I;  3UPO A;  4PM8 A;  1IKI A;  1IFQ A;  1PZO A;  4G3W A;  5FQQ A;  3KYZ A;  2O99 A;  1BLH A;  3BRM A;  4WM9 A;  4WMC A;  1Z6F A;  5DTT A;  5TBM B;  3T4O A;  3IX4 A;  2W1T A;  4I3I A;  2QKP A;  5E2E A;  3UY6 A;  2HGV A;  4KUK A;  4R23 A;  3T4S A;  1LHY A;  1S4R A;  2OAQ 1;  1P9R A;  4MBH A;  1CI9 A;  5HDD A;  4BL2 A;  3WS1 A;  1K55 A;  4EBN A;  3LI9 A;  4JGQ A;  4ZJ1 A;  2Y55 A;  3ZGA B;  3PBT A;  2A3U A;  4X25 A;  4GOG A;  1TVF A;  4HHD A;  4I5S A;  4B93 A;  3GQZ A;  2WZX A;  2C5W B;  4HJ4 A;  3VE3 A;  3T1Q B;  2AVX A;  4OP5 A;  3CIT A;  4MN7 A;  3UB5 P;  4FTX A;  4OPQ A;  1LI9 A;  2OV5 A;  3NHQ A;  1NLY A;  4P6B A;  2PHY A;  3UMD A;  3ZFZ A;  4WUJ A;  4PM9 A;  4A5R A;  2HP9 A;  4Q0I A;  4WZ5 A;  2XDM A;  4FD8 A;  4F94 A;  4OLG A;  3MMH A;  5HAQ A;  2J3T C;  4KZ3 A;  3NCK A;  1NXY A;  1YM1 A;  4CLC C;  1C3B A;  3IWI A;  5F6A A;  3TJZ C;  2ZLY A;  2IWD A;  4UA6 A;  1F9I A;  5J4E A;  2XSS A;  3JYI A;  4KZ6 A;  1XA7 A;  2IA2 A;  3IS2 A;  1FCO A;  3LFV A;  4IJG A;  4JKT A;  4DE2 A;  4KZ4 A;  4E3N A;  3TW8 A;  3PBR A;  1PYY A;  4BD1 A;  2IWC A;  5TR7 A;  2XD5 A;  1OTD A;  3NI9 A;  4KG2 A;  4E3L A;  4QY5 A;  1CEG A;  2M1C A;  2WAF A;  4OOM A;  5CRF A;  3DTE A;  5A92 A;  3V5M A;  1L0D A;  4HNB A;  2HDQ A;  3NOU C;  3V67 A;  4N9L A;  5JYP A;  3A3I A;  4MLL A;  2H28 A;  2W3D A;  5AQA A;  3UDF A;  3T4K A;  3CI6 A;  3N8S A;  1EWZ A;  4FOF A;  5HD3 A;  2L4R A;  1BYW A;  3LCE A;  5EVI B;  4C75 A;  1S1Y A;  1W8Y A;  2Y2I A;  1MBL A;  4ZBE A;  1N9O A;  4EBL A;  3LO7 A;  4DJ2 A;  4I38 A;  3LEQ A;  3ISG A;  4X1M A;  5JYO A;  4U3T A;  5CX7 A;  3A3D A;  4QPR A;  5CEB A;  2XRO A;  3ZVT A;  2Z2L B;  2P74 A;  1E3U A;  1ERQ A;  2VLG A;  2XLN A;  2FFF B;  4OLD A;  3JPU A;  2O9C A;  1ERM A;  1TS7 A;  5EUA A;  4R3A A;  3OCN A;  1CEF A;  2ZQ7 A;  1XJ2 A;  2W3H A;  2Z2M B;  2VGK A;  1LT0 A;  3NY4 A;  3PBO A;  3QP6 A;  1JWP A;  1SHV A;  3HLB A;  3A3F A;  2Y2O A;  4HOI A;  5A93 A;  1PWD A;  1MXO A;  1FCM A;  4S2J A;  1DP9 A;  1M6K A;  3UB9 A;  1JWZ A;  1PI5 A;  1HVB A;  3OPP A;  2ZM8 A;  4MMN A;  1O7E A;  3PR6 A;  4IED A;  4UHU A;  3D4F A;  2GDN A;  4RA7 A;  4D60 A;  5KSH A;  4LRX C;  3IX3 A;  3E4O A;  4K08 A;  3MFX A;  1PRQ A;  4E3J A;  4WMC D;  3NC8 A;  4X6T A;  2Y2J A;  4ZJ3 A;  3B3X A;  5FSR A;  4YWZ A;  3DBA A;  5FEG A;  4N92 A;  3BEB A;  5CGX A;  4CLC E;  3P7N A;  2D02 A;  5L09 A;  4PM6 A;  3T4T A;  3GRJ A;  2XD1 A;  3HUO A;  4OQ0 A;  5EV0 A;  4U0X A;  4EU0 A;  1RGZ A;  1TS8 A;  2QJ7 A;  4KG6 A;  3KSG A;  1TS6 A;  5J3W A;  2HV1 A;  2WAE A;  4E04 A;  2BG1 A;  2L1M A;  5M18 A;  3SH7 A;  2EXB A;  5G4Z A;  4B4Z A;  4MNR A;  2EFX A;  1ONH A;  2V0U A;  5KZH A;  4B4X A;  1K4F A;  4BQM A;  1KGE A;  2JBF A;  3FZC A;  1OTI A;  3PAE A;  3CPT B;  4Y0U A;  1CK3 A;  2PBY A;  1NWZ A;  4UQI S;  5HWV A;  2GJ3 A;  4KZ8 A;  4KQO A;  3F1P B;  2B5R A;  4OQI A;  1NY0 A;  3BFG A;  3ZQ5 A;  2YKH A;  2M7U A;  3W8K A;  2W1R A;  1SKO A;  4DXB A;  3A3J A;  4RX2 A;  3TE8 A;  1FSW A;  5IS1 A;  3KYE A;  1HTZ A;  3OLO A;  1FIL A;  2V1A A;  3VOY A;  1A0K A;  4ARZ B;  1I2W A;  2QZ6 A;  4HI4 A;  1W79 A;  5CTN A;  4KUO A;  3V39 A;  4ETZ A;  3V3S A;  3IF6 B;  1DY6 A;  2OWJ A;  2WKE A;  4WYY A;  2OLV A;  1BTL A;  1XP4 A;  3VSL A;  3CPT A;  4IBX A;  1RCJ A;  4GS9 A;  1FQG A;  3HJI A;  3EEA A;  2XR0 A;  5AVE A;  4HP9 A;  4LGW A;  3IWO A;  3SH9 A;  4XXR A;  5TGF A;  2HJ9 C;  1MWS A;  1FOF A;  4E6X A;  5HAR A;  3B47 A;  1W63 Q;  4BEN A;  5FAO A;  3MZE A;  4UQI M;  4LV2 A;  2ZC6 B;  1K38 A;  2W0N A;  3VOL A;  5EEC A;  4ARZ A;  2HPB A;  3JVU A;  1ZC2 A;  3G34 A;  3S22 A;  2JKT M;  5AJG A;  5G18 A;  1KGF A;  4O7D A;  3MQQ A;  3WRZ A;  3UDI A;  4EBP A;  1NJ4 A;  1S67 L;  4CQH A;  2ZL1 B;  4Y0T A;  1RGY A;  2C6W B;  3C4O A;  2LB9 A;  3NUL A;  3IXH A;  4GDN A;  4BMW A;  1E3U D;  3R4K A;  3AGE A;  3M6B A;  1BUE A;  4HIA A;  1VEU B;  4IVK A;  2RCX A;  3LI8 A;  4OOL A;  1YSQ A;  3G4P A;  2BAS A;  2VX8 A;  4JBF A;  4E3K A;  5GHX A;  4JXG A;  3DTK A;  3FC7 A;  1T1C A;  3H82 B;  2QWS A;  2WKQ A;  2KX6 A;  5FQI A;  4BBT A;  4GCZ A;  3SS5 A;  5GLD A;  5F68 A;  1V9Z A;  3BY8 A;  3PYP A;  1F98 A;  3K3D A;  3UB7 A;  3LY3 A;  4IUK A;  3G2Z A;  5FDH A;  3BLM A;  4HH3 A;  4BWI A;  3C38 A;  1GSX A;  3CUE C;  2V8F A;  1MKI A;  1M40 A;  3NJA A;  3BLS A;  5J7E A;  5FDS A;  2UWX A;  3OC2 A;  4GNU A;  3EEH A;  3LR3 A;  2X01 A;  4YFM A;  3MXR A;  3P09 A;  2J7V A;  4HJ6 A;  4O0P A;  3MFD A;  4Y0O A;  4ZTK A;  3FPW A;  3H82 A;  4OVD A;  1GCE A;  2J80 A;  5CGW A;  3MS6 A;  3CMZ A;  2CMN A;  1XFQ A;  1N9N A;  3NBL A;  2ZD8 A;  4F3L A;  1XJ4 A;  5HZH A;  4EET B;  4WZ4 A;  2G7U A;  5FAQ A;  1D1J A;  2XFT A;  1MC0 A;  4WF0 A;  4B88 A;  1LSW A;  4HH2 A;  5GL9 A;  4KQQ A;  4N1X A;  3T1X A;  4HBT A;  3Q1F A;  4NXG A;  1VET B;  1F2K A;  1ES5 A;  3UE0 A;  4YOF A;  4JGP A;  4RVA A;  3VP3 A;  4JF4 A;  1JWV A;  3S4X A;  3ZNY A;  3IH9 A;  1IOU A;  2VA0 A;  3HLG A;  3UDX A;  3T1S A;  3Q82 A;  4WN5 A;  2WGW A;  4QWO A;  3EGD C;  1Y54 A;  1OT9 A;  5E2H A;  2Y79 A;  5E43 A;  4Z1W A;  2NUT C;  3BFE A;  3SS3 A;  2P7J A;  2WKI A;  1XXM A;  3MKF A;  3KO6 A;  3R7W B;  4S2I A;  1VET A;  4CLC A;  1MZU A;  3HLF A;  2W3F A;  4AFI A;  4HEF A;  4KQR A;  2WUQ A;  5HDS A;  1YT4 A;  2WGV A;  3BQA A;  2Y2M A;  4OPY A;  5EVL A;  1E25 A;  5DF9 A;  4EW7 A;  4HES A;  4OQH A;  1W7F A;  3P01 A;  5DKL A;  2QHK A;  2OLU A;  4YIN A;  2OAP 1;  3R7W A;  1XKZ A;  3PHY A;  3T4Q A;  3H9W A;  3SS4 A;  4GHI B;  3C5A A;  1PWC A;  2V1Z A;  5HD5 A;  3OPL A;  1DRM A;  3IS2 B;  1ZKJ A;  3IWQ A;  4RYE A;  4BD0 A;  1SCW A;  4YNR A;  4B9O A;  5KMW A;  2ACG A;  4OKP A;  2NUP C;  2JKR I;  4MDZ A;  5IHV A;  5L07 A;  1P97 A;  3RH8 B;  1EW0 A;  4DE1 A;  1IKG A;  4XT2 B;  1XFN A;  3WS0 A;  5HW3 A;  5MC7 A;  4R4S A;  3MF0 A;  2V0W A;  4P85 A;  2KLI A;  4X1L A;  1FR6 A;  4GHI A;  1YLW A;  1NRF A;  3SZT A;  3S7N A;  2W27 A;  1ES4 A;  4LCM A;  3C8C A;  4GLQ A;  4EER A;  3NDE A;  3VOZ A;  4O01 A;  2J3W A;  3MXQ A;  2ZC3 B;  1Y28 A;  2Q0O A;  1J3W A;  2P9V B;  5AVF A;  2XQZ A;  4Z9Q A;  1E4D A;  3QNC A;  2JC7 A;  2VV6 A;  2DRW A;  3E4P A;  4XT2 A;  3MKE A;  4WEJ A;  3CLO A;  5HL6 A;  3OCL A;  1SDN A;  3M6H A;  4QJG A;  1TD5 A;  4X69 A;  3B42 A;  3VFF A;  4L9F A;  1YLJ A;  4GD6 A;  2QJ5 A;  1WYC A;  5CHJ A;  4M4X A;  2A24 B;  5D3O A;  2QPN A;  4PAU A;  3RTY A;  3O3V A;  4ZJ2 A;  3ZCZ A;  2VV8 A;  4Y15 A;  4H6J A;  3T4L A;  5HAI A;  4PM5 A;  4MEZ A;  1XGI A;  2P9V A;  2INW A;  2PRF A;  1GHM A;  1H8Y A;  2EX9 A;  1YLP A;  2KOI A;  4OP8 A;  4WZ5 C;  1UWP X;  5M19 A;  4Y7P A;  4BJP A;  2OWH A;  4IBR A;  2R9W A;  4ESP A;  5I94 A;  4DDS A;  3NOP C;  1TS0 A;  3WRT A;  3LR0 A;  3LR5 A;  3RJU A;  4KZ5 A;  3KSF A;  4Y3I A;  3F1O B;  2A24 A;  2GX5 A;  5CEC A;  1IEM A;  2WKH A;  1OJG A;  2EA9 A;  3ICY A;  5G4Y A;  2VK3 A;  4QY6 A;  1P9W A;  5HL1 A;  4DE0 A;  4FUW A;  4CLC D;  1PW8 A;  2IWB A;  3LIC A;  3PBQ A;  1G28 A;  4X68 A;  3FV7 A; 
#chains in the Genus database with same CATH homology
 3B47 A;  1W63 Q;  4UQI M;  4MN5 A;  2W0N A;  3VOL A;  2W3E A;  2HF6 A;  3E4Q A;  4ARZ A;  1S1Z A;  2R78 A;  5K5B A;  3JVU A;  1F5M A;  1T1B A;  2GZA A;  3GEC A;  2JKT M;  2LB5 A;  5AJG A;  4WEL A;  2PYP A;  3F1O A;  3IBR A;  3PBN A;  4I3A A;  4Y2F A;  1ODV A;  3EQV A;  4IHQ A;  3MQQ A;  2ZBB A;  4L9E A;  4LPZ A;  2ZOI A;  4H6J B;  4EEU A;  1NLZ A;  4ME4 A;  2O0Y A;  1S67 L;  4CQH A;  4IUH A;  3EGX C;  3A0S A;  3KX0 X;  1LSX A;  4EQ1 A;  5HWT A;  4EEP A;  1GSW A;  4EES A;  2LB9 A;  2W1T B;  4O8G A;  3FG8 A;  4BMW A;  1W63 M;  5EFW A;  3R4K A;  1YKD A;  4PKY G;  3LID A;  4HIA A;  3LI8 A;  3BJN A;  4OOL A;  3KSH A;  1V9Y A;  1YSQ A;  2BAS A;  2JN7 A;  2VX8 A;  1N9L A;  2WKP A;  4Q0H A;  3BQ8 A;  2K2N A;  3FC7 A;  1OPX A;  1H8M A;  1X0O A;  3CWF A;  5FL3 A;  1T1C A;  2PDR A;  3LIE A;  1T1A A;  2ZMF A;  3H82 B;  2JKT I;  2QWS A;  2KX6 A;  2WKQ A;  4BBT A;  2O9B A;  3D3O A;  1IFQ A;  4GCZ A;  1GSV A;  4G3W A;  4GS9 B;  5F68 A;  3KYZ A;  2O99 A;  1V9Z A;  3BY8 A;  3LYX A;  3PYP A;  1F98 A;  1ZTU A;  3K3D A;  3UB7 A;  4HP4 A;  5TBM B;  3T4O A;  5HSQ A;  4IUK A;  2VKS A;  1P0Z A;  4P6Z S;  2W1T A;  4HH3 A;  4I3I A;  4BWI A;  2A2L A;  2QKP A;  3C38 A;  3NOT C;  1GSX A;  2HGV A;  3CUE C;  4KUK A;  1MKM A;  3T4S A;  2YKF A;  3H7W B;  4L0L A;  1H3Q A;  1S4R A;  3NJA A;  2P04 A;  2OAQ 1;  1P9R A;  5J7E A;  3OC2 A;  2P08 A;  5HDD A;  4I39 A;  3EEH A;  3LR3 A;  3LI9 A;  4JGQ A;  4EUV A;  2KDK A;  4HJ6 A;  1XJ3 A;  2HJE A;  3PBT A;  1UGU A;  3T50 A;  2W3G A;  4O0P A;  2V1B A;  3UE6 A;  4HHD A;  3FPW A;  3H82 A;  4I5S A;  4B93 A;  2J80 A;  4HJ4 A;  3VE3 A;  1D7E A;  3CIT A;  4MN7 A;  1T19 A;  2CMN A;  1XFQ A;  4ETX A;  1N9N A;  3NHQ A;  1NLY A;  3UMD A;  2PHY A;  1XJ4 A;  4F3L A;  2J3T D;  5HZH A;  4WUJ A;  3GDI A;  5HDC A;  4EET B;  3ULF A;  1OTA A;  2G7U A;  2PR6 A;  4NEE D;  5HPF A;  4RQ9 A;  4Q0I A;  1MC0 A;  4WF0 A;  3OBF A;  1LSW A;  4HH2 A;  5L8M A;  2O9A A;  3MMH A;  3KSI A;  2J3T C;  2PR5 A;  3H7W A;  4Y5F A;  4CLC C;  4NXG A;  3G6O A;  5F6A A;  3TJZ C;  2QYB A;  4P6Z M;  3S7P A;  4BBV A;  4YOF A;  1F9I A;  5J4E A;  4JGP A;  2XSS A;  3C2W A;  5HPI A;  2I9V A;  5F5Y A;  1OT6 A;  1IOU A;  3KYQ A;  3E98 A;  2L0W A;  2VA0 A;  2IA2 A;  2XRN A;  4BBU A;  3IS2 A;  2PD7 A;  4WN5 A;  3LFV A;  2B02 A;  2Y8H A;  4IJG A;  3EGD C;  1OJ5 A;  1OT9 A;  4DJ3 A;  2Y79 A;  3TW8 A;  4PHT A;  3PBR A;  4Z1W A;  2DMW A;  2NUT C;  2ZOH A;  1KOU A;  1OTD A;  3MR0 A;  2P7J A;  2M1C A;  2PD8 A;  3C30 A;  1ZHH B;  4OOM A;  3HJK A;  3KO6 A;  4DMZ A;  3MQ0 A;  4HNB A;  3R7W B;  3NOU C;  3V67 A;  1VB6 A;  4I3J A;  4CLC A;  1MZU A;  2WKR A;  4PKY A;  1VHM A;  2H28 A;  2W3D A;  4LLO B;  1YSP A;  5DFX A;  2GNX A;  3LIF A;  3OOV A;  3FPV A;  3T4K A;  2W3F A;  3CI6 A;  4AFI A;  1XJ6 A;  3S7Q A;  4FOF A;  4F3L B;  5HD3 A;  2L4R A;  1OTE A;  1BYW A;  3LIB A;  5DFY A;  5HDS A;  1S1Y A;  2VGL S;  2B18 A;  2JKR M;  3BQA A;  4KQD A;  4ZRR A;  5IT5 A;  3LR4 A;  4WL9 A;  1N9O A;  2EWW A;  3MQO A;  5A8B A;  4HJ3 A;  2Z6D A;  4R6L A;  5DF9 A;  4EW7 A;  4DJ2 A;  1STZ A;  4I38 A;  4WEK A;  3P01 A;  5DKL A;  2QHK A;  5CX7 A;  4QPR A;  3UME A;  2XRO A;  2OAP 1;  4NXB A;  4II7 A;  4LRZ E;  3BW6 A;  3PBS A;  3R7W A;  3PHY A;  1S4S A;  2VLG A;  3T4Q A;  3H9W A;  3ZYT A;  3CAX A;  4GHI B;  2O9C A;  3U2A A;  5HD5 A;  3LIA A;  4R70 A;  1DRM A;  1TS7 A;  3UE3 A;  3IS2 B;  4R3A A;  3OCN A;  3RFB A;  4YNR A;  4B9O A;  1XJ2 A;  2W3H A;  3EWK A;  1LT0 A;  3F1N B;  3PBO A;  4MCW A;  2NUP C;  5KIZ A;  2JKR I;  4MDZ A;  4HOI A;  4HQA A;  4Q0J A;  3JVV A;  1P97 A;  3PXP A;  3RH8 B;  3CUE A;  1DP9 A;  1EW0 A;  3UB9 A;  3BWL A;  2XA7 S;  4UEY A;  4XT2 B;  1XFN A;  1TF1 A;  1LL8 A;  3F1P A;  3A0R A;  1JNU A;  4GW9 A;  5MC7 A;  2VGL M;  4MMN A;  4CLC B;  4G3K A;  3PR6 A;  2VV7 A;  3MF0 A;  4L9G A;  2V0W A;  3UB6 A;  5HWW A;  2KLI A;  3VE4 A;  5KSH A;  2FH5 A;  2K7S A;  4LRX C;  3E4O A;  4K08 A;  3MFX A;  4GHI A;  2M7V A;  3S7N A;  2W27 A;  2MJ6 A;  3K2N A;  5DKK A;  3W2Z A;  2OOL A;  5C5K A;  3C8C A;  4GLQ A;  4YWZ A;  3A0V A;  4EER A;  3DBA A;  3F1N A;  4O01 A;  2J3W A;  3MXQ A;  1Y28 A;  4CLC E;  3P7N A;  2D02 A;  4R38 A;  3T4T A;  1OTB A;  2D01 A;  5AVF A;  2VV6 A;  4EU0 A;  1T18 A;  3E4P A;  1TS8 A;  2QJ7 A;  4XT2 A;  1D06 A;  2FZ0 A;  2PYR A;  3KSG A;  2VEA A;  1TS6 A;  5J3W A;  2HV1 A;  4WEJ A;  3CLO A;  3HCY A;  4E04 A;  5HL6 A;  3TRC A;  2K31 A;  3OCL A;  2L1M A;  2ZMV A;  5LBR A;  1TD5 A;  2Z6C A;  3SW1 A;  2XA7 M;  3B42 A;  2EWV A;  5G4Z A;  4L9F A;  2QJ5 A;  3K3C A;  2V0U A;  4LRY C;  3MJQ A;  4M4X A;  1WA9 A;  2A24 B;  5IU1 A;  4PAU A;  1LSV A;  3RTY A;  3T4J A;  1OTI A;  4EXO A;  5I5L A;  2VV8 A;  3O5Y A;  1NWZ A;  4NXE A;  4UQI S;  5HWV A;  3EOI A;  4H6J A;  3T4L A;  4JGR A;  3VV4 A;  2GJ3 A;  4HY8 A;  4KQO A;  3F1P B;  2INW A;  4GJ4 A;  3ZQ5 A;  4MN6 A;  5DJU A;  2YKH A;  2M7U A;  2W1R A;  4G3V A;  2PT7 A;  4NXF A;  2KOI A;  2VZW A;  1DP8 A;  1UWP X;  3TE8 A;  5IS1 A;  5DJT A;  4BJP A;  3OLO A;  2OWH A;  2V9A A;  1DP6 A;  2V1A A;  3E0Y A;  1S66 L;  4FSF A;  4ARZ B;  4NKP A;  4HI4 A;  3NOP C;  1TS0 A;  4KUO A;  3LR0 A;  3LR5 A;  4ETZ A;  3KSF A;  4Y3I A;  3F1O B;  2OWJ A;  3LUQ A;  2JHE A;  3UB8 A;  2A24 A;  2GX5 A;  4WLA A;  1OJG A;  1YAX A;  4DN0 A;  2EA9 A;  3ICY A;  1UWN X;  5G4Y A;  3S7O A;  3BY9 A;  2VJW A;  4GS9 A;  1G6O A;  4JGO A;  1P9W A;  3HJI A;  5TJJ A;  3EEA A;  5AVE A;  4HP9 A;  5TBM A;  3D72 A;  4CLC D;  3B33 A;  3EQU A;  3LIC A;  3PBQ A;  1G28 A;  5F69 A;  2HJ9 C;  1NRJ A;  3IBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...