3O5YA

The crystal structure of the gaf domain of a two-component sensor histidine kinase from bacillus halodurans to 2.45a
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
142
Chain Sequence
b'MSLDDIINNMIDKLKLLVHFDRISFLLLANETLKLSHVYPKGSHSLDIGSTIPKEQSLYWSALDQRQTIFRSLTDTQDNFYEKQYLAILDLKSILVIPIYSKNKRVGVLSIGRKQQIDWSLDDLAFLEQLTDHLAVSIENVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein
publication title The Crystal Structure of the GAF domain of a two-component sensor histidine kinase from Bacillus halodurans to 2.45A
rcsb
source organism Bacillus halodurans
molecule tags Transcription regulator
total genus 38
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3o5yA00
3E98A 2OOLA 5AJGA 5HPIA 2HGVA 3E0YA 4R6LA 2G7UA 1STZA 2W1RA 3KSHA 4G3KA 4Y2FA 3RFBA 5HSQA 1ZTUA 5DFXA 3R4KA 1TD5A 3NOTC 2GX5A 2VZWA 2VEAA 5HL6A 3W2ZA 5C5KA 4IUHA 4CQHA 4Y5FA 2ZMFA 4LRZE 3TRCA 2O9CA 2M7VA 1YSQA 2KOIA 2VKSA 4MDZA 1TF1A 1YKDA 2XROA 5DFYA 2XSSA 1MKMA 4E04A 2K2NA 3S7OA 4ZRRA 2W3DA 3CITA 3OOVA 3BJNA 2M7UA 4MN7A 1F5MA 5LBRA 3ZQ5A 3EEAA 2B18A 2O99A 4QPRA 4Z1WA 2W1TA 2W3GA 4LRYC 2LB9A 2LB5A 2IA2A 3MQ0A 3LFVA 4G3WA 5L8MA 3C2WA 4ETZA 1MC0A 3O5YA 4ETXA 3G6OA 4DMZA 4Y3IA 3K2NA 4MMNA 5TJJA 4LRXC 4EU0A 4DN0A 3NOUC 3NOPC 1YSPA 5I5LA 4BWIA 2W1TB 2W3HA 3S7NA 2K31A 2Y8HA 3VV4A 2O9BA 2KLIA 4IJGA 4RQ9A 2VJWA 4IUKA 4O8GA 4FOFA 4O0PA 4YNRA 3S7QA 4GW9A 3HCYA 3MF0A 4G3VA 3KSGA 4GLQA 4EUVA 5HPFA 4MCWA 4Q0JA 3OBFA 1VHMA 3S7PA 4Q0HA 3CI6A 4Q0IA 2Y79A 2XRNA 2O0YA 3DBAA 2W3EA 3MMHA 3KSIA 4R70A 3IBJA 4YOFA 2W3FA 3IBRA 4ME4A 4PAUA 3NHQA 4O01A 3D3OA 3KO6A 5K5BA 2QYBA 3KSFA 2O9AA
chains in the Genus database with same CATH superfamily
2HDQA 1XJ3A 4PPRA 3CZDA 4QHCA 4FD8A 1WE4A 3RFBA 4X53A 5DFXA 1TD5A 2GNXA 2WZZA 2ZC4B 3EQUA 2J9PA 4IBRA 4IUHA 1TS6A 4Y5FA 4JLFA 2XFSA 3PAEA 2M7VA 2Z6DA 3T4TA 1LHYA 1N9LA 1EWZA 4EWFA 4LV0A 1XJ4A 4JGOA 2OLVA 4PHTA 5U47A 4P6BA 1K55C 1ES5A 1K54A 5F1GA 4HH2A 3MXRA 3V67A 3PBRA 4HI4A 2B02A 5L8MA 4ZAMA 1M6KA 4H6JA 1Y4OA 5TJJA 4K0XA 3S4XA 3OCNA 2WAEA 4Q8IA 5FAQA 1KGGA 4OQIA 2ZBBA 2RCXA 2GZAA 4U0XA 2PHYA 2Y8HA 1ONGA 4IJGA 1M40A 3T4SA 4NKPA 1VM1A 3MSHA 4EBPA 4G3VA 5TFQA 2Y2NA 5HDSA 1LL9A 1MKIA 1PNEA 2RL3A 3T12B 4S2LA 3W4OA 4ZJ1A 2JKRM 3H82A 1F9IA 1FOFA 3VP3A 1KE4A 4UQIM 5L10A 3UE6A 3NHQA 1GA9A 4KZBA 1YMSA 3UPNA 1A0KA 1IYSA 3QP5A 3TW8A 3V3SA 3RTYA 4OQHA 3H82B 3C38A 4AFIA 4G3KA 2A2LA 4X25A 1WYBA 2DCFA 4S2IA 4CQHA 1TS7A 1LT0A 1DP9A 2EA9A 4HJ4A 4U3TA 2XROA 4FUWA 5HWWA 2J9OA 4HJ3A 1XPBA 2K7SA 2HZ5A 3FKWA 4MN7A 4N1XA 3EEAA 4EEPA 2HJEA 3GR2A 2W3GA 2A3UA 4RX2A 3G2ZA 3C2WA 4OOMA 4X68A 3DWKA 3ZVTA 1SDNA 4OH0A 3K2NA 4OPQA 1IEMA 3IF6A 4UQIS 3OC2A 1YQSA 4I5SA 2Y2JA 5DF9A 1GHPA 1WYCA 3LI8A 1JWPA 2W3HA 4OQ0A 2Y2QA 4ID4A 4WMCD 3IH8A 3IF6B 3ZG8B 1BSGA 4HJ6A 1K6RA 2H28A 3N6IA 5FQJA 4RVAA 3IHAA 3NECA 2Y2HA 2GDNA 1L0EA 1RGYA 3CPTA 2W3FA 5AQ9A 2HPBA 4IHQA 3MXSA 2Y2LA 1S66L 2G2WA 1DY6A 2R78A 2P74A 1PZPA 3IS2A 5CGWA 4IBXA 4I3JA 2UV0E 2WUQA 4JXVA 2ZQDA 4BL3A 1LSVA 5L07A 4DXBA 3CPTB 1PWDA 3ZVWA 5J7EA 4KENB 2Y2KA 2O9CA 2H5SA 3K3DA 3IS2B 5CEBA 1MKMA 3UDFA 3Q7VA 1VQQA 4NEED 2HJ9C 4BJPA 5DJUA 4WUJA 2JE5A 2WKPA 3MQ0A 1MC0A 2ZMVA 3G6OA 4KQDA 4MNRA 5KIZA 4UAAA 3Q7VB 2Y4AA 2Z2LB 5JYPA 5CRFA 4CLCA 2DMWA 2DNSA 4LLOB 1LI9A 3EWKA 1GSVA 3ZGAB 4E6XA 3UB9A 4I3AA 4R3BA 5CGXA 1P9WA 3MZDA 4OP5A 3PTEA 3MQQA 4GDNA 4GW9A 4CLCB 3P01A 1ONHA 3T50A 3NULA 2L1MA 1PIOA 2EFUA 4LV3A 2O0YA 2WGVA 1MWTA 3DTMA 5AQAA 3A0VA 4BBVA 5HAPA 1DP6A 3PAGA 4GZBA 3ZNYA 3PBOA 3Q7ZA 3FV7A 1W63Q 5E2FA 4R3AA 3R4KA 4KQOA 4WEJA 3UPPA 1XP4A 5DVAA 1ACFA 5FA7A 5DTKA 2FZ0A 1LSWA 3GECA 4HP9A 3UMEA 4HBUA 3WS4A 4C3QA 5HFOA 3T1SA 3AGEA 4QPRA 4B9OA 4S2OA 5G18A 5HL1A 1PI4A 2Y2PA 5I94A 1Z6FA 2ZOIA 2NUTC 3F1PA 5EE8A 4B4XA 3G2YA 1W7FA 2WKHA 4BL2A 1KE3A 5I5LA 4FCFA 1K57C 2JBFA 2XLNA 3HLCA 1H5XA 4EQIA 3KYEA 5KZHA 4I3IA 2PT7A 3PBQA 3LICA 1BYWA 5IU1A 3MJQA 2XH9A 3F1PB 4MN6A 5GLDA 1NY0A 1X0OA 2L4RA 5M18A 4EUVA 5JYOA 3GSGA 1V9YA 3G32A 3PBSA 4R4SA 2V1BA 1HLUP 1WA9A 5DTTA 1FQGA 4CJNA 5GLBA 3V50A 3P09A 4GB7A 4ZJ3A 3UE3A 2XGNA 3KO6A 5A8BA 2QJ5A 2J3TD 3DW0A 5HARA 2OAQ1 4DE3A 4EW7A 3HLGA 5FQMA 1O7EA 5CHMA 4X69A 4Y2FA 3KSHA 1GHIA 3O88A 3C8CA 3UB5P 1J3WA 3RH8B 2Q9NA 1Q2QA 4WBGA 4C6YA 2KOIA 1TF1A 1ES3A 3F1NA 2K2NA 3S7OA 3LCEA 3CUEC 3BYDA 1K4FA 1PZOA 2P9VA 4JXGA 2R9XA 4H8RA 3T4OA 2JKTI 1W5DA 1XFQA 2Y55A 4OOLA 5DKLA 1OJGA 4WMCA 1N9OA 3WS0A 3IWQA 3F1NB 4DMZA 2BLSA 2ZOHA 4R3JA 1IYOA 3BFFA 2PYRA 4Y7PA 3IX4A 3LR4A 2P9VB 3B42A 3A3JA 2WADA 4OLDA 2D01A 5HD3A 2WKQA 3NI9A 3UY6A 3N7WA 4DKIA 3ITBA 4RA7A 3IXDA 3ZNTA 1NXYA 3VOYA 4FH2A 1YLPA 1YLZA 3E4PA 1N9BA 4MBFA 4BQMA 2J3WA 4OVDA 4HESA 3M2JA 1MZUA 1K0KA 4DJ2A 5FQQA 1XGJA 5FQIA 1C3BA 2HV1A 5GHYA 4F94A 3MQOA 2A24A 4GNUA 5HDDA 3LIDA 1S4RA 3PXPA 4YWZA 5K5BA 3LO7A 5TBMA 5FQKA 3LYXA 5HZHA 1J9MA 3HJIA 2OOLA 3D72A 1OTAA 4WLAA 2VK3A 3ULFA 1PFLA 4P6ZM 2A24B 2D02A 4KQQA 1FIKA 2V1ZA 5TBMB 5CGSA 3BECA 1FSWA 1CF0A 3IX3A 3H9WA 4XUZA 2B95A 3IXHA 4IEDA 5CECA 3C4PA 5FAOA 2OV5A 2ZM0A 1MXOA 3ZQ5A 4GD6A 4QJGA 4B93A 1PW8A 3KYZA 3E4QA 2HP9A 2IA2A 1LI0A 1EROA 3QP6A 4P85A 5J3WA 3GTCA 5FI6A 4ETXA 2A49A 3UB7A 3IHBA 5HD5A 4QY6A 5F1FA 4NG2A 5EOOA 3LY3A 2P08A 4KZ4A 1K6SA 1BTLA 5KSHA 4WEKA 5AQBA 1BUEA 3EEHA 3G31A 1KDWA 5CXWA 2QZ6A 4P6ZS 1IFQA 1OT9A 4Q0IA 2JHEA 3CMZA 1G5UA 4PM7A 2ZC6B 3D4FA 4N9LA 4E6WA 1H3QA 1OMEA 3Q07A 5E2HA 2ZQ8A 1K56D 3GDIA 3VSLA 1D06A 3OPRA 5L2FA 2XA7M 3MZEA 1MBLA 4GCZA 3SS5A 5EUAA 3LIFA 3SS4A 2QJ7A 3QP4A 5F6AA 4E3KA 3IWOA 5HL6A 4Y0UA 3UDIA 5DJTA 1KVMA 2WKRA 3F1OB 1L2SA 1E3UA 3VFHA 3HJKA 3WRTA 4JGPA 2FH5A 1L3LA 4WF0A 3BY8A 1DP8A 2B18A 2H0TA 2WAFA 1TDGA 2QPNA 5FATA 3EOIA 3SW1A 4GDBA 4A5RA 4DDSA 3NC8A 3WRZA 5L09A 1ZC2A 3E2LA 1TDLA 1MWRA 1YLTA 2OWHA 3Q1FA 1QMEA 2Y2IA 3S22A 4B4ZA 4E3MA 3BW6A 2WYXA 1Z09A 3NOPC 1H8ZA 1IOUA 4KZ9A 3QP1A 4KZ8A 2K31A 2XA7S 2O9BA 1F98A 2VGLM 3E4OA 1FR6A 5M19A 3SOIA 1JNUA 4K08A 2ZD8A 4K91A 4YNRA 4S2NC 4GKUA 3T4KA 4EESA 1FCNA 3IXGA 4MCWA 3OBFA 3W8KA 3GRJA 3CI6A 1MWSA 1NRJA 1ZKJA 2XRNA 1YT4A 4FSFA 1PRQA 3MXQA 3RXXA 4N1HA 4WYYA 1IELA 3D3OA 2HP5A 2G2UA 3EGXC 2EFXA 1OT6A 4ZTKA 3E98A 3IXBA 1SKOA 4PM9A 2W1RA 1STZA 3NOTC 2GX5A 3KYQA 5CERA 1NJ4A 1K55A 3PBNA 4OPRA 3TRCA 1H8YA 3AGFA 3BY9A 4R38A 3O3VA 4MDZA 4LV2A 1ESIA 1SKOB 3HLWA 1TVFA 4ZRRA 4KUOA 3HUMA 3BWLA 1BLCA 2VGLS 4XUXA 4WL9A 2FFFB 2Z6CA 4EBNA 2PU2A 3JVVA 3SH9A 2O99A 4S2PA 3ZG9B 4Y0OA 5GHZA 1T1AA 1UGUA 2EX2A 3LFVA 4G3WA 1D1JA 3W4QA 5HAQA 3HL9A 4BLMA 4KZ6A 1YAXA 5EVIC 4UA9A 2PR5A 4JF6A 5FQ9A 4HIAA 1JTGA 5E43A 5BOHA 3PR6A 4HQAA 3M6HA 5KSCA 3UB8A 4JF5A 3ICYA 2EXAA 5E2GA 3PHYA 1TS8A 1H8MA 1GCEA 2JKTM 4O0PA 2PYPA 1VEUA 3A3DA 2V0WA 1OPXA 1RP5A 3IF5A 2IWDA 3MFDA 3WWXA 1OJ5A 2Y79A 5DTSA 1DJBA 3NDGA 1CEFA 4PM6A 3GMWA 1W63M 1Q2PA 4GOGA 1VEUB 3KSFA 3FG8A 2P04A 4JKTA 2O9AA 5FAPA 2W27A 5GLAA 4Y17A 2JCHA 5GLCA 5HAIA 2JN7A 3G34A 3ZG5A 2PBYA 4E3LA 3NIAA 2V2FF 2JKRI 4MN5A 1V9ZA 2PRFA 3NBLA 4S2NA 5HWVA 4FH4A 3MFXA 4O7DA 3OOVA 2W0NA 1SKFA 2JC7A 5LBRA 3HLEA 2KX6A 4E3IA 4K0WA 3FPWA 4BBUA 1O07A 3BLMA 1NRFA 1Y28A 2H0YA 3LI9A 1QMFA 3R7WA 3C30A 4KZ3A 4EXOA 3LR0A 3A3IA 2CMNA 3QP2A 1RCJA 2JKGA 3V3RA 3BM6A 2Z2MB 1IYPA 3C5AA 1YSPA 4JPMA 3OPPA 3T4LA 4WM9A 2ZM8A 3N8LA 2KLIA 5CHJA 3R7WB 4E3JA 4PMAA 2V20A 4DE1A 1EW0A 1IKGA 1P9RA 4GLQA 3N8SA 2NUPC 1LLBA 1K4EA 3WS2A 5KMWA 1T19A 4KG2A 4C75A 2BASA 4LPZA 2ZC5B 4CLCE 1CI8A 4OPZA 3B47A 1YLJA 4S2JA 4WZ5C 4GD8A 4YOFA 1FCOA 3HBRA 4LFUA 1G6OA 4PM5A 2MJ6A 1L0DA 1OTBA 3G4PA 5IT5A 4X55A 1EI5A 3LIBA 5FEFA 3U2AA 1XA1A 4RYEA 3JVUA 3PYPA 5HPIA 2WGWA 1BLSA 4LENA 4NXGA 2ZC7A 4UA7A 1ZTUA 4ZBEA 5TGFA 3PBTA 3HLFA 5G4ZA 3HREA 5C5KA 3FC7A 3O86A 3CWFA 2HDSA 2EX9A 1YSQA 1XX2A 3P7NA 3C4OA 4XT2A 1UWPX 2WGWB 3MZFA 4LCLA 4GS9A 4B88A 1F5MA 4ZDXA 1MY8A 1YLWA 2LB9A 3QNCA 4X1MA 2ZQAA 1JTDA 1I5QA 1KGFA 2ZL1A 4XT2B 4NETA 1YPRA 1ERQA 3GVBA 1K54C 4GS9B 3HUNA 2E8JA 5FI7A 4OONA 4OLGA 1Y54A 1N4OA 1MPLA 3BLSA 1S1ZA 2QMIA 3EGDC 1G28A 1RGZA 3A3FA 2ZL1B 2PD7A 1ES2A 2VGJA 4RQ9A 3S1YA 3LR3A 1CEGA 2C6WB 3VE4A 4EETB 3HCYA 3HVFA 4OOYA 2Y91A 1VHMA 1T1CA 3CG5A 1JWVA 2QKPA 1BZAA 2EX8A 3MMHA 1ESUA 4R70A 3TE8A 2ZC3B 5CTNA 2XQZA 4PAUA 3H7WA 1HTZA 3UMDA 3IH9A 2C5WB 2XEPA 3LIEA 5FSRA 3MBZA 2M7UA 1BULA 2Y59A 1BLPA 1SHVA 3I7JA 2G7UA 3ZG7B 2VA0A 3EQVA 3H7WB 3W2ZA 4I39A 4YFMA 3VP4A 1KE0A 5EPHA 3W4PA 1TS0A 1YKDA 3U4LP 3Q81A 4BBTA 1JVJA 1IKIA 5HDCA 4N9KA 3DAVA 2I72A 4F3LA 4BENA 4Z1WA 1S4SA 4Y0TA 3LEZA 4DRTA 1SDEA 1K57A 2PDRA 4X6TA 2EXBA 3A3EA 3UN7A 3MKEA 2ZM2A 2VV6A 4MMNA 5TR7A 1AXBA 1GSXA 4LRXC 1I2WA 4F3LB 3DWZA 5MC7A 4XXRA 3FYZA 3FWLA 3S7NA 3OLOA 5A91A 5EM0A 4II7A 4JXWA 3IF6C 3OCLA 2J7VA 4IUKA 4O8GA 4FOFA 1U60A 3UE0A 2PBDP 3BFEA 4I38A 3UE1A 3CJMA 4Q0JA 1L0FA 1S1YA 3VP1A 4Y13A 1XKZA 2QHKA 4QWOA 2WKEA 1N9NA 4UEYA 4LGWA 3L7HA 1GA0A 5AJGA 3IX8A 4NXBA 3M2KA 3SH8A 4Y15A 5D3OA 3N8RA 3CUEA 3OPLA 4OKPA 4WN5A 4HHDA 4KQRA 3ITAA 4KG6A 5M1AA 1ERMA 2BG1A 2Q0OA 3F1OA 3K3CA 1CQAA 2XR0A 4MLLA 1LL8A 3JPUA 4OPYA 2LB5A 2PR6A 5EOEA 4H6JB 2X02A 2Q9MA 4BD0A 2V8FA 1YM1A 2ACGA 5CHUA 5F5YA 3JYIA 4DN0A 5EVID 3DTEA 4E3NA 4KZAA 2Y2MA 3TJZC 1CJFA 1XXMA 4DDYA 3VV4A 1ES4A 4Z9QA 2HP6A 2XFTA 1NYMA 4L0LA 1GSWA 1YMXA 4CLCC 2EWWA 3KSGA 4ESPA 1SZVA 3VOZA 4Q0HA 3V5MA 1OTDA 3C7VA 5HWTA 3T4JA 1GHMA 2J8YA 1NZUA 4M3KA 2YKHA 3G35A 4ME4A 5E2EA 4E3OA 3SZTA 1SCWA 2P7JA 4ARZA 2X71A 5IS1A 2XDMA 3ZG0A 1D7EA 1XA7A 1BT5A 5DF8A 4JBFA 2HGVA 1NWZA 1I2SA 2XK1A 1P0ZA 5FL3A 5HSQA 1PWGA 4PKYA 3T1QB 2VZWA 2ZQ7A 4HY8A 3N4IA 4OQGA 2ZMFA 4JF4A 4ARZB 3ZYTA 4R1GA 4NXFA 5DKKA 2PD8A 3V39A 1PWCA 4EEUA 3LUQA 3T1XA 4GN2A 5FDHA 3NY4A 3BFDA 4WZ4A 2WGIA 1HD8A 3O5YA 5A90A 1NLYA 2VLGA 4NK3A 2DRWA 1S0WA 5FASA 4EU0A 4JGQA 2VX8A 1OTEA 2JKFA 5AVEA 2VV7A 5A93A 2PAVP 4IVIA 4DE0A 3KX0X 5EV0A 1AWIA 3BFCA 4KZ7A 3BFGA 3P98A 4KUKA 3ISGA 3GV9A 4QY5A 2GJ3A 1K38A 4D60A 3FPVA 4R23A 3T1RA 3DBAA 5F68A 3IBJA 4P0MA 3IBRA 4MBKA 3BQAA 2V9AA 3WS5A 4HEFA 2PU4A 3ZDJA 2WZXA 1DJAA 5F82A 2X01A 3ZCZA 3E0YA 1XJ6A 2M1CA 3TG9A 1G68A 2ZQ9A 4S2KA 5EVEA 3FZCA 3UO9A 3VE3A 1W8YA 4LRZE 1NLZA 3WS1A 4YINA 1P97A 2IWCA 5GHXA 1K25A 1T18A 4DF6A 5G4YA 2XSSA 3ZHHA 4BMWA 4GJ4A 2OSUA 2IWBA 3CLOA 1T1BA 4LRYC 5FI2A 4L9GA 5GL9A 1ALQA 5CEDA 1ZG4A 2BTFP 4DJ3A 2XD1A 3VOLA 1CI9A 2E8IA 2WKIA 2L0WA 2OLUA 3A0SA 4EUZA 3HLBA 1KOUA 1CK3A 1ODVA 2Y2OA 4QB8A 3L9KA 1L0GA 4X56A 1PYYA 4FTXA 3LR5A 4D2OA 3S7PA 2AVXA 3TSGA 5J8XA 4MEZA 3HLDA 1HVBA 1HZOA 4U0TA 3KSIA 2YKFA 3LEQA 5IHVA 3ZFZA 3RJUA 4M4XA 4O01A 2XD5A 2XF3A 4R0QA 2OWJA 2QYBA 3VP2A 4HH3A 1K56A 4UA6A 2VGKA 4QU3A 1XJ2A 3AGDA 5DF7A 3FKVA 3QHYA 4S2MA 3IQAA 1VETA 1S67L 2VEAA 3MR0A 3TOIA 3OZHA 3T4QA 1E3UD 1ZHHB 1TEMA 2VKSA 4EERA 3VP0A 5DFYA 4LCMA 5F83A 2W3DA 5F69A 3VMAA 4EQ1A 2EWVA 1YLYA 1VETB 3BJNA 5EVIA 2WK0A 3BRMA 3QP8A 4PM8A 4CPKA 3B3XA 4L9EA 4KG5A 2W1TA 3OPHA 2UWXA 4ZJ2A 5EFWA 1S6RA 4ETZA 2Y2GA 5J4EA 3A0RA 3SH7A 5HX9A 1KVLA 3UPOA 3MKFA 5EVIB 3LGOA 4X1LA 1G6AA 5EM1A 2W1TB 4EV4A 2J80A 4N92A 2HF6A 2ZLYA 1LSXA 1W79A 1FSYA 2V1AA 3G30A 1DJCA 2KDKA 2ZQCA 4EBLA 4OP8A 1E4DA 2W3EA 5EECA 1IYQA 4BD1A 1UWNX 3MS6A 4MBHA 4HOIA 4LV1A 2ZMAA 3VSKA 3UB6A 5CTMA 3LIAA 3IWIA 1DRMA 4R6LA 1KGEA 3HUOA 2OAP1 3UDXA 1VB6A 2V0UA 3D9YA 1LL5A 2I9VA 3GQZA 1FILA 5EVLA 1F2KA 1FR1A 4WELA 3B33A 4QD4A 1BLHA 4KZ5A 4E04A 3VFFA 3CITA 4JXSA 2V8CA 3RXWA 3UNWA 4R4RA 3NDEA 3O87A 3QNBA 3IT9A 3NCKA 4JGRA 4HP4A 3SS3A 3BEBA 2EX6A 3M6BA 4Y3IA 1ZG6A 5A92A 3E2KA 1XFNA 5FDSA 1JWZA 1NZOA 4L9FA 3NOUC 5FEGA 4HNBA 1PW1A 2HDRA 4BWIA 4RX3A 3LY4A 3CHWP 5AQ7A 5CX7A 2QWSA 2VJWA 1OTIA 4WZ5A 1E25A 3Q82A 3DTIA 3S7QA 3MF0A 2R9WA 5HPFA 4CLCD 4GHIA 5HW3A 1H0MA 2ZJ9A 4HBTA 3BQ8A 4UHUA 4P87A 4DXCA 3NJAA 3CAXA 3DTKA 2FFYA 4NXEA 1KDSA 1W8QA 2CC1A 3C7UA 1FCMA 4IVKA 1PI5A 1NYYA 2H10A 2J3TC 4GHIB 1MWUA 2VV8A 5AVFA 4DE2A 2HDUA 2INWA 1XGIA 4PKYG 2B5RA
chains in the Genus database with same CATH topology
1D7EA 4EW7A 1XJ3A 2W27A 2HGVA 1NWZA 1P0ZA 4Y2FA 3RFBA 3KSHA 5FL3A 5HSQA 5DFXA 4PKYA 1TD5A 2GNXA 2VZWA 3C8CA 3EQUA 2JN7A 4HY8A 4IUHA 1TS6A 4Y5FA 3RH8B 2ZMFA 4ARZB 3ZYTA 2M7VA 2KOIA 4NXFA 1TF1A 5DKKA 2Z6DA 2PD8A 3T4TA 1N9LA 2JKRI 4MN5A 1V9ZA 3F1NA 2K2NA 3S7OA 5HWVA 3MFXA 3CUEC 1XJ4A 3OOVA 4JGOA 4EEUA 2W0NA 4PHTA 3LUQA 5LBRA 2KX6A 3T4OA 2JKTI 4HH2A 5IS1A 1XFQA 3FPWA 3V67A 4BBUA 3PBRA 4HI4A 4OOLA 5DKLA 2B02A 5L8MA 1OJGA 1Y28A 3LI9A 3R7WA 1N9OA 3O5YA 3F1NB 4DMZA 2ZOHA 3C30A 1NLYA 4H6JA 4EXOA 3LR0A 2VLGA 5TJJA 2CMNA 2PYRA 4EU0A 3LR4A 3OCNA 4JGQA 3B42A 1YSPA 2D01A 5HD3A 2ZBBA 2VX8A 1OTEA 2GZAA 2WKQA 5AVEA 2PHYA 2VV7A 3T4LA 2Y8HA 2KLIA 3KX0X 3R7WB 4IJGA 3T4SA 4NKPA 1EW0A 4KUKA 4G3VA 1P9RA 4GLQA 3E4PA 5HDSA 2NUPC 2GJ3A 2J3WA 1T19A 2BASA 4LPZA 3FPVA 4CLCE 2JKRM 3DBAA 1MZUA 3H82A 1F9IA 3B47A 4DJ2A 5F68A 3IBJA 4UQIM 4YOFA 2HV1A 3IBRA 3MQOA 3UE6A 3NHQA 2A24A 3BQAA 2V9AA 5HDDA 1G6OA 3LIDA 1S4RA 3PXPA 4YWZA 5K5BA 2MJ6A 1OTBA 5TBMA 5IT5A 3LIBA 3LYXA 3U2AA 5HZHA 3TW8A 3JVUA 3HJIA 3PYPA 2OOLA 3RTYA 5HPIA 3E0YA 4NXGA 1XJ6A 2M1CA 3H82B 3C38A 4AFIA 4G3KA 2A2LA 3D72A 1OTAA 1ZTUA 4WLAA 3PBTA 3ULFA 5G4ZA 4P6ZM 2A24B 2D02A 5C5KA 4CQHA 3FC7A 1TS7A 3VE3A 4LRZE 3CWFA 1LT0A 1NLZA 5TBMB 1DP9A 2EA9A 1P97A 1YSQA 4HJ4A 1T18A 3P7NA 2XROA 4XT2A 5G4YA 2XSSA 5HWWA 1UWPX 4HJ3A 4BMWA 3H9WA 2K7SA 4GS9A 4MN7A 1F5MA 4GJ4A 3ZQ5A 3EEAA 4EEPA 4B93A 2HJEA 3KYZA 2W3GA 3CLOA 1T1BA 4LRYC 2LB9A 4L9GA 3E4QA 2IA2A 3C2WA 4XT2B 5J3WA 4OOMA 4DJ3A 4ETXA 3K2NA 3VOLA 3UB7A 4GS9B 4UQIS 5HD5A 2L0WA 3OC2A 4I5SA 3A0SA 5DF9A 3LI8A 1S1ZA 2W3HA 2P08A 3EGDC 1G28A 1KOUA 1ODVA 2PD7A 5KSHA 4WEKA 4RQ9A 3LR3A 3EEHA 3VE4A 4EETB 4HJ6A 3HCYA 2H28A 3LR5A 4P6ZS 1VHMA 1IFQA 3S7PA 1OT9A 1T1CA 4Q0IA 2JHEA 2QKPA 3KSIA 3MMHA 2YKFA 4R70A 3TE8A 1H3QA 2W3FA 4IHQA 4M4XA 3H7WA 4PAUA 3UMDA 4O01A 1S66L 3GDIA 2OWJA 2QYBA 1D06A 3LIEA 2R78A 2XA7M 4HH3A 3IS2A 4GCZA 2M7UA 1XJ2A 4I3JA 3LIFA 2QJ7A 5F6AA 2G7UA 1LSVA 2VA0A 3EQVA 1S67L 2VEAA 3H7WB 3MR0A 5HL6A 3W2ZA 4I39A 5DJTA 5J7EA 3T4QA 2O9CA 2WKRA 3K3DA 1ZHHB 3F1OB 2VKSA 3IS2B 4EERA 1TS0A 3HJKA 1YKDA 5DFYA 4JGPA 1MKMA 2FH5A 2W3DA 5F69A 4BBTA 4EQ1A 2EWVA 4WF0A 5HDCA 3BJNA 4NEED 2HJ9C 3BY8A 4F3LA 4BJPA 5DJUA 1DP8A 2B18A 4WUJA 4Z1WA 4L9EA 2WKPA 1S4SA 2W1TA 3EOIA 3SW1A 2PDRA 3MQ0A 5EFWA 4ETZA 1MC0A 2ZMVA 5J4EA 3A0RA 3G6OA 4KQDA 2VV6A 4MMNA 5KIZA 2OWHA 1GSXA 4LRXC 4CLCA 2DMWA 4F3LB 4LLOB 3BW6A 3EWKA 1GSVA 5MC7A 3NOPC 1IOUA 3UB9A 2W1TB 4I3AA 3S7NA 2K31A 2XA7S 1P9WA 2O9BA 3OLOA 1F98A 2J80A 2VGLM 3E4OA 4II7A 2HF6A 3OCLA 1JNUA 3MQQA 4IUKA 4O8GA 4FOFA 4K08A 1LSXA 4YNRA 2V1AA 4GW9A 4I38A 4CLCB 3P01A 3T4KA 4EESA 4MCWA 4Q0JA 3T50A 2L1MA 3OBFA 2KDKA 3CI6A 1NRJA 1S1YA 2XRNA 2O0YA 2W3EA 2QHKA 4FSFA 3A0VA 1UWNX 4BBVA 3MXQA 1N9NA 4HOIA 1DP6A 3D3OA 4UEYA 3UB6A 3EGXC 3PBOA 1OT6A 3LIAA 3E98A 5AJGA 1W63Q 1DRMA 4R6LA 4NXBA 2W1RA 1STZA 4R3AA 3R4KA 3CUEA 4KQOA 2OAP1 1VB6A 2V0UA 3NOTC 2GX5A 3KYQA 4HHDA 4WN5A 4WEJA 2I9VA 3PBNA 3TRCA 2FZ0A 4WELA 1LSWA 3B33A 3BY9A 4R38A 4MDZA 3GECA 4HP9A 3UMEA 3F1OA 4E04A 3K3CA 4ZRRA 3CITA 4KUOA 3BWLA 2VGLS 4WL9A 2Z6CA 1LL8A 3JVVA 2O99A 4QPRA 1T1AA 1UGUA 4B9OA 2LB5A 2PR6A 4JGRA 4H6JB 3LFVA 4G3WA 4HP4A 2ZOIA 4Y3IA 2NUTC 3F1PA 1YAXA 2PR5A 1XFNA 5F5YA 4HIAA 4DN0A 4L9FA 3NOUC 2J3TD 5I5LA 3PR6A 4HNBA 4BWIA 4HQAA 3TJZC 3UB8A 3VV4A 3ICYA 3PHYA 1TS8A 1H8MA 4L0LA 5CX7A 4I3IA 2QWSA 2PT7A 1GSWA 3PBQA 3LICA 1BYWA 2VJWA 5IU1A 3MJQA 1OTIA 3F1PB 4MN6A 2JKTM 4CLCC 4O0PA 2PYPA 3S7QA 1X0OA 2EWWA 2L4RA 3MF0A 3KSGA 4EUVA 5HPFA 2O9AA 2V0WA 1OPXA 4GHIA 4CLCD 1V9YA 4Q0HA 3BQ8A 3PBSA 1OJ5A 2Y79A 2V1BA 3NJAA 1OTDA 3CAXA 5HWTA 3T4JA 1WA9A 4NXEA 1W63M 2YKHA 3UE3A 4ME4A 2J3TC 3KO6A 5A8BA 4GHIB 2QJ5A 2VV8A 2P7JA 3KSFA 3FG8A 5AVFA 4ARZA 2INWA 2P04A 4PKYG 2OAQ1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E98 A;  2OOL A;  5AJG A;  5HPI A;  2HGV A;  3E0Y A;  4R6L A;  2G7U A;  1STZ A;  2W1R A;  3KSH A;  4G3K A;  4Y2F A;  3RFB A;  5HSQ A;  1ZTU A;  5DFX A;  3R4K A;  1TD5 A;  3NOT C;  2GX5 A;  2VZW A;  2VEA A;  5HL6 A;  3W2Z A;  5C5K A;  4IUH A;  4CQH A;  4Y5F A;  2ZMF A;  4LRZ E;  3TRC A;  2O9C A;  2M7V A;  1YSQ A;  2KOI A;  2VKS A;  4MDZ A;  1TF1 A;  1YKD A;  2XRO A;  5DFY A;  2XSS A;  1MKM A;  4E04 A;  2K2N A;  3S7O A;  4ZRR A;  2W3D A;  3CIT A;  3OOV A;  3BJN A;  2M7U A;  4MN7 A;  1F5M A;  5LBR A;  3ZQ5 A;  3EEA A;  2B18 A;  2O99 A;  4QPR A;  4Z1W A;  2W1T A;  2W3G A;  4LRY C;  2LB9 A;  2LB5 A;  2IA2 A;  3MQ0 A;  3LFV A;  4G3W A;  5L8M A;  3C2W A;  4ETZ A;  1MC0 A;  3O5Y A;  4ETX A;  3G6O A;  4DMZ A;  4Y3I A;  3K2N A;  4MMN A;  5TJJ A;  4LRX C;  4EU0 A;  4DN0 A;  3NOU C;  3NOP C;  1YSP A;  5I5L A;  4BWI A;  2W1T B;  2W3H A;  3S7N A;  2K31 A;  2Y8H A;  3VV4 A;  2O9B A;  2KLI A;  4IJG A;  4RQ9 A;  2VJW A;  4IUK A;  4O8G A;  4FOF A;  4O0P A;  4YNR A;  3S7Q A;  4GW9 A;  3HCY A;  3MF0 A;  4G3V A;  3KSG A;  4GLQ A;  4EUV A;  5HPF A;  4MCW A;  4Q0J A;  3OBF A;  1VHM A;  3S7P A;  4Q0H A;  3CI6 A;  4Q0I A;  2Y79 A;  2XRN A;  2O0Y A;  3DBA A;  2W3E A;  3MMH A;  3KSI A;  4R70 A;  3IBJ A;  4YOF A;  2W3F A;  3IBR A;  4ME4 A;  4PAU A;  3NHQ A;  4O01 A;  3D3O A;  3KO6 A;  5K5B A;  2QYB A;  3KSF A;  2O9A A; 
#chains in the Genus database with same CATH topology
 2HDQ A;  1XJ3 A;  4PPR A;  3CZD A;  4QHC A;  4FD8 A;  1WE4 A;  3RFB A;  4X53 A;  5DFX A;  1TD5 A;  2GNX A;  2WZZ A;  2ZC4 B;  3EQU A;  2J9P A;  4IBR A;  4IUH A;  1TS6 A;  4Y5F A;  4JLF A;  2XFS A;  3PAE A;  2M7V A;  2Z6D A;  3T4T A;  1LHY A;  1N9L A;  1EWZ A;  4EWF A;  4LV0 A;  1XJ4 A;  4JGO A;  2OLV A;  4PHT A;  5U47 A;  4P6B A;  1K55 C;  1ES5 A;  1K54 A;  5F1G A;  4HH2 A;  3MXR A;  3V67 A;  3PBR A;  4HI4 A;  2B02 A;  5L8M A;  4ZAM A;  1M6K A;  4H6J A;  1Y4O A;  5TJJ A;  4K0X A;  3S4X A;  3OCN A;  2WAE A;  4Q8I A;  5FAQ A;  1KGG A;  4OQI A;  2ZBB A;  2RCX A;  2GZA A;  4U0X A;  2PHY A;  2Y8H A;  1ONG A;  4IJG A;  1M40 A;  3T4S A;  4NKP A;  1VM1 A;  3MSH A;  4EBP A;  4G3V A;  5TFQ A;  2Y2N A;  5HDS A;  1LL9 A;  1MKI A;  1PNE A;  2RL3 A;  3T12 B;  4S2L A;  3W4O A;  4ZJ1 A;  2JKR M;  3H82 A;  1F9I A;  1FOF A;  3VP3 A;  1KE4 A;  4UQI M;  5L10 A;  3UE6 A;  3NHQ A;  1GA9 A;  4KZB A;  1YMS A;  3UPN A;  1A0K A;  1IYS A;  3QP5 A;  3TW8 A;  3V3S A;  3RTY A;  4OQH A;  3H82 B;  3C38 A;  4AFI A;  4G3K A;  2A2L A;  4X25 A;  1WYB A;  2DCF A;  4S2I A;  4CQH A;  1TS7 A;  1LT0 A;  1DP9 A;  2EA9 A;  4HJ4 A;  4U3T A;  2XRO A;  4FUW A;  5HWW A;  2J9O A;  4HJ3 A;  1XPB A;  2K7S A;  2HZ5 A;  3FKW A;  4MN7 A;  4N1X A;  3EEA A;  4EEP A;  2HJE A;  3GR2 A;  2W3G A;  2A3U A;  4RX2 A;  3G2Z A;  3C2W A;  4OOM A;  4X68 A;  3DWK A;  3ZVT A;  1SDN A;  4OH0 A;  3K2N A;  4OPQ A;  1IEM A;  3IF6 A;  4UQI S;  3OC2 A;  1YQS A;  4I5S A;  2Y2J A;  5DF9 A;  1GHP A;  1WYC A;  3LI8 A;  1JWP A;  2W3H A;  4OQ0 A;  2Y2Q A;  4ID4 A;  4WMC D;  3IH8 A;  3IF6 B;  3ZG8 B;  1BSG A;  4HJ6 A;  1K6R A;  2H28 A;  3N6I A;  5FQJ A;  4RVA A;  3IHA A;  3NEC A;  2Y2H A;  2GDN A;  1L0E A;  1RGY A;  3CPT A;  2W3F A;  5AQ9 A;  2HPB A;  4IHQ A;  3MXS A;  2Y2L A;  1S66 L;  2G2W A;  1DY6 A;  2R78 A;  2P74 A;  1PZP A;  3IS2 A;  5CGW A;  4IBX A;  4I3J A;  2UV0 E;  2WUQ A;  4JXV A;  2ZQD A;  4BL3 A;  1LSV A;  5L07 A;  4DXB A;  3CPT B;  1PWD A;  3ZVW A;  5J7E A;  4KEN B;  2Y2K A;  2O9C A;  2H5S A;  3K3D A;  3IS2 B;  5CEB A;  1MKM A;  3UDF A;  3Q7V A;  1VQQ A;  4NEE D;  2HJ9 C;  4BJP A;  5DJU A;  4WUJ A;  2JE5 A;  2WKP A;  3MQ0 A;  1MC0 A;  2ZMV A;  3G6O A;  4KQD A;  4MNR A;  5KIZ A;  4UAA A;  3Q7V B;  2Y4A A;  2Z2L B;  5JYP A;  5CRF A;  4CLC A;  2DMW A;  2DNS A;  4LLO B;  1LI9 A;  3EWK A;  1GSV A;  3ZGA B;  4E6X A;  3UB9 A;  4I3A A;  4R3B A;  5CGX A;  1P9W A;  3MZD A;  4OP5 A;  3PTE A;  3MQQ A;  4GDN A;  4GW9 A;  4CLC B;  3P01 A;  1ONH A;  3T50 A;  3NUL A;  2L1M A;  1PIO A;  2EFU A;  4LV3 A;  2O0Y A;  2WGV A;  1MWT A;  3DTM A;  5AQA A;  3A0V A;  4BBV A;  5HAP A;  1DP6 A;  3PAG A;  4GZB A;  3ZNY A;  3PBO A;  3Q7Z A;  3FV7 A;  1W63 Q;  5E2F A;  4R3A A;  3R4K A;  4KQO A;  4WEJ A;  3UPP A;  1XP4 A;  5DVA A;  1ACF A;  5FA7 A;  5DTK A;  2FZ0 A;  1LSW A;  3GEC A;  4HP9 A;  3UME A;  4HBU A;  3WS4 A;  4C3Q A;  5HFO A;  3T1S A;  3AGE A;  4QPR A;  4B9O A;  4S2O A;  5G18 A;  5HL1 A;  1PI4 A;  2Y2P A;  5I94 A;  1Z6F A;  2ZOI A;  2NUT C;  3F1P A;  5EE8 A;  4B4X A;  3G2Y A;  1W7F A;  2WKH A;  4BL2 A;  1KE3 A;  5I5L A;  4FCF A;  1K57 C;  2JBF A;  2XLN A;  3HLC A;  1H5X A;  4EQI A;  3KYE A;  5KZH A;  4I3I A;  2PT7 A;  3PBQ A;  3LIC A;  1BYW A;  5IU1 A;  3MJQ A;  2XH9 A;  3F1P B;  4MN6 A;  5GLD A;  1NY0 A;  1X0O A;  2L4R A;  5M18 A;  4EUV A;  5JYO A;  3GSG A;  1V9Y A;  3G32 A;  3PBS A;  4R4S A;  2V1B A;  1HLU P;  1WA9 A;  5DTT A;  1FQG A;  4CJN A;  5GLB A;  3V50 A;  3P09 A;  4GB7 A;  4ZJ3 A;  3UE3 A;  2XGN A;  3KO6 A;  5A8B A;  2QJ5 A;  2J3T D;  3DW0 A;  5HAR A;  2OAQ 1;  4DE3 A;  4EW7 A;  3HLG A;  5FQM A;  1O7E A;  5CHM A;  4X69 A;  4Y2F A;  3KSH A;  1GHI A;  3O88 A;  3C8C A;  3UB5 P;  1J3W A;  3RH8 B;  2Q9N A;  1Q2Q A;  4WBG A;  4C6Y A;  2KOI A;  1TF1 A;  1ES3 A;  3F1N A;  2K2N A;  3S7O A;  3LCE A;  3CUE C;  3BYD A;  1K4F A;  1PZO A;  2P9V A;  4JXG A;  2R9X A;  4H8R A;  3T4O A;  2JKT I;  1W5D A;  1XFQ A;  2Y55 A;  4OOL A;  5DKL A;  1OJG A;  4WMC A;  1N9O A;  3WS0 A;  3IWQ A;  3F1N B;  4DMZ A;  2BLS A;  2ZOH A;  4R3J A;  1IYO A;  3BFF A;  2PYR A;  4Y7P A;  3IX4 A;  3LR4 A;  2P9V B;  3B42 A;  3A3J A;  2WAD A;  4OLD A;  2D01 A;  5HD3 A;  2WKQ A;  3NI9 A;  3UY6 A;  3N7W A;  4DKI A;  3ITB A;  4RA7 A;  3IXD A;  3ZNT A;  1NXY A;  3VOY A;  4FH2 A;  1YLP A;  1YLZ A;  3E4P A;  1N9B A;  4MBF A;  4BQM A;  2J3W A;  4OVD A;  4HES A;  3M2J A;  1MZU A;  1K0K A;  4DJ2 A;  5FQQ A;  1XGJ A;  5FQI A;  1C3B A;  2HV1 A;  5GHY A;  4F94 A;  3MQO A;  2A24 A;  4GNU A;  5HDD A;  3LID A;  1S4R A;  3PXP A;  4YWZ A;  5K5B A;  3LO7 A;  5TBM A;  5FQK A;  3LYX A;  5HZH A;  1J9M A;  3HJI A;  2OOL A;  3D72 A;  1OTA A;  4WLA A;  2VK3 A;  3ULF A;  1PFL A;  4P6Z M;  2A24 B;  2D02 A;  4KQQ A;  1FIK A;  2V1Z A;  5TBM B;  5CGS A;  3BEC A;  1FSW A;  1CF0 A;  3IX3 A;  3H9W A;  4XUZ A;  2B95 A;  3IXH A;  4IED A;  5CEC A;  3C4P A;  5FAO A;  2OV5 A;  2ZM0 A;  1MXO A;  3ZQ5 A;  4GD6 A;  4QJG A;  4B93 A;  1PW8 A;  3KYZ A;  3E4Q A;  2HP9 A;  2IA2 A;  1LI0 A;  1ERO A;  3QP6 A;  4P85 A;  5J3W A;  3GTC A;  5FI6 A;  4ETX A;  2A49 A;  3UB7 A;  3IHB A;  5HD5 A;  4QY6 A;  5F1F A;  4NG2 A;  5EOO A;  3LY3 A;  2P08 A;  4KZ4 A;  1K6S A;  1BTL A;  5KSH A;  4WEK A;  5AQB A;  1BUE A;  3EEH A;  3G31 A;  1KDW A;  5CXW A;  2QZ6 A;  4P6Z S;  1IFQ A;  1OT9 A;  4Q0I A;  2JHE A;  3CMZ A;  1G5U A;  4PM7 A;  2ZC6 B;  3D4F A;  4N9L A;  4E6W A;  1H3Q A;  1OME A;  3Q07 A;  5E2H A;  2ZQ8 A;  1K56 D;  3GDI A;  3VSL A;  1D06 A;  3OPR A;  5L2F A;  2XA7 M;  3MZE A;  1MBL A;  4GCZ A;  3SS5 A;  5EUA A;  3LIF A;  3SS4 A;  2QJ7 A;  3QP4 A;  5F6A A;  4E3K A;  3IWO A;  5HL6 A;  4Y0U A;  3UDI A;  5DJT A;  1KVM A;  2WKR A;  3F1O B;  1L2S A;  1E3U A;  3VFH A;  3HJK A;  3WRT A;  4JGP A;  2FH5 A;  1L3L A;  4WF0 A;  3BY8 A;  1DP8 A;  2B18 A;  2H0T A;  2WAF A;  1TDG A;  2QPN A;  5FAT A;  3EOI A;  3SW1 A;  4GDB A;  4A5R A;  4DDS A;  3NC8 A;  3WRZ A;  5L09 A;  1ZC2 A;  3E2L A;  1TDL A;  1MWR A;  1YLT A;  2OWH A;  3Q1F A;  1QME A;  2Y2I A;  3S22 A;  4B4Z A;  4E3M A;  3BW6 A;  2WYX A;  1Z09 A;  3NOP C;  1H8Z A;  1IOU A;  4KZ9 A;  3QP1 A;  4KZ8 A;  2K31 A;  2XA7 S;  2O9B A;  1F98 A;  2VGL M;  3E4O A;  1FR6 A;  5M19 A;  3SOI A;  1JNU A;  4K08 A;  2ZD8 A;  4K91 A;  4YNR A;  4S2N C;  4GKU A;  3T4K A;  4EES A;  1FCN A;  3IXG A;  4MCW A;  3OBF A;  3W8K A;  3GRJ A;  3CI6 A;  1MWS A;  1NRJ A;  1ZKJ A;  2XRN A;  1YT4 A;  4FSF A;  1PRQ A;  3MXQ A;  3RXX A;  4N1H A;  4WYY A;  1IEL A;  3D3O A;  2HP5 A;  2G2U A;  3EGX C;  2EFX A;  1OT6 A;  4ZTK A;  3E98 A;  3IXB A;  1SKO A;  4PM9 A;  2W1R A;  1STZ A;  3NOT C;  2GX5 A;  3KYQ A;  5CER A;  1NJ4 A;  1K55 A;  3PBN A;  4OPR A;  3TRC A;  1H8Y A;  3AGF A;  3BY9 A;  4R38 A;  3O3V A;  4MDZ A;  4LV2 A;  1ESI A;  1SKO B;  3HLW A;  1TVF A;  4ZRR A;  4KUO A;  3HUM A;  3BWL A;  1BLC A;  2VGL S;  4XUX A;  4WL9 A;  2FFF B;  2Z6C A;  4EBN A;  2PU2 A;  3JVV A;  3SH9 A;  2O99 A;  4S2P A;  3ZG9 B;  4Y0O A;  5GHZ A;  1T1A A;  1UGU A;  2EX2 A;  3LFV A;  4G3W A;  1D1J A;  3W4Q A;  5HAQ A;  3HL9 A;  4BLM A;  4KZ6 A;  1YAX A;  5EVI C;  4UA9 A;  2PR5 A;  4JF6 A;  5FQ9 A;  4HIA A;  1JTG A;  5E43 A;  5BOH A;  3PR6 A;  4HQA A;  3M6H A;  5KSC A;  3UB8 A;  4JF5 A;  3ICY A;  2EXA A;  5E2G A;  3PHY A;  1TS8 A;  1H8M A;  1GCE A;  2JKT M;  4O0P A;  2PYP A;  1VEU A;  3A3D A;  2V0W A;  1OPX A;  1RP5 A;  3IF5 A;  2IWD A;  3MFD A;  3WWX A;  1OJ5 A;  2Y79 A;  5DTS A;  1DJB A;  3NDG A;  1CEF A;  4PM6 A;  3GMW A;  1W63 M;  1Q2P A;  4GOG A;  1VEU B;  3KSF A;  3FG8 A;  2P04 A;  4JKT A;  2O9A A;  5FAP A;  2W27 A;  5GLA A;  4Y17 A;  2JCH A;  5GLC A;  5HAI A;  2JN7 A;  3G34 A;  3ZG5 A;  2PBY A;  4E3L A;  3NIA A;  2V2F F;  2JKR I;  4MN5 A;  1V9Z A;  2PRF A;  3NBL A;  4S2N A;  5HWV A;  4FH4 A;  3MFX A;  4O7D A;  3OOV A;  2W0N A;  1SKF A;  2JC7 A;  5LBR A;  3HLE A;  2KX6 A;  4E3I A;  4K0W A;  3FPW A;  4BBU A;  1O07 A;  3BLM A;  1NRF A;  1Y28 A;  2H0Y A;  3LI9 A;  1QMF A;  3R7W A;  3C30 A;  4KZ3 A;  4EXO A;  3LR0 A;  3A3I A;  2CMN A;  3QP2 A;  1RCJ A;  2JKG A;  3V3R A;  3BM6 A;  2Z2M B;  1IYP A;  3C5A A;  1YSP A;  4JPM A;  3OPP A;  3T4L A;  4WM9 A;  2ZM8 A;  3N8L A;  2KLI A;  5CHJ A;  3R7W B;  4E3J A;  4PMA A;  2V20 A;  4DE1 A;  1EW0 A;  1IKG A;  1P9R A;  4GLQ A;  3N8S A;  2NUP C;  1LLB A;  1K4E A;  3WS2 A;  5KMW A;  1T19 A;  4KG2 A;  4C75 A;  2BAS A;  4LPZ A;  2ZC5 B;  4CLC E;  1CI8 A;  4OPZ A;  3B47 A;  1YLJ A;  4S2J A;  4WZ5 C;  4GD8 A;  4YOF A;  1FCO A;  3HBR A;  4LFU A;  1G6O A;  4PM5 A;  2MJ6 A;  1L0D A;  1OTB A;  3G4P A;  5IT5 A;  4X55 A;  1EI5 A;  3LIB A;  5FEF A;  3U2A A;  1XA1 A;  4RYE A;  3JVU A;  3PYP A;  5HPI A;  2WGW A;  1BLS A;  4LEN A;  4NXG A;  2ZC7 A;  4UA7 A;  1ZTU A;  4ZBE A;  5TGF A;  3PBT A;  3HLF A;  5G4Z A;  3HRE A;  5C5K A;  3FC7 A;  3O86 A;  3CWF A;  2HDS A;  2EX9 A;  1YSQ A;  1XX2 A;  3P7N A;  3C4O A;  4XT2 A;  1UWP X;  2WGW B;  3MZF A;  4LCL A;  4GS9 A;  4B88 A;  1F5M A;  4ZDX A;  1MY8 A;  1YLW A;  2LB9 A;  3QNC A;  4X1M A;  2ZQA A;  1JTD A;  1I5Q A;  1KGF A;  2ZL1 A;  4XT2 B;  4NET A;  1YPR A;  1ERQ A;  3GVB A;  1K54 C;  4GS9 B;  3HUN A;  2E8J A;  5FI7 A;  4OON A;  4OLG A;  1Y54 A;  1N4O A;  1MPL A;  3BLS A;  1S1Z A;  2QMI A;  3EGD C;  1G28 A;  1RGZ A;  3A3F A;  2ZL1 B;  2PD7 A;  1ES2 A;  2VGJ A;  4RQ9 A;  3S1Y A;  3LR3 A;  1CEG A;  2C6W B;  3VE4 A;  4EET B;  3HCY A;  3HVF A;  4OOY A;  2Y91 A;  1VHM A;  1T1C A;  3CG5 A;  1JWV A;  2QKP A;  1BZA A;  2EX8 A;  3MMH A;  1ESU A;  4R70 A;  3TE8 A;  2ZC3 B;  5CTN A;  2XQZ A;  4PAU A;  3H7W A;  1HTZ A;  3UMD A;  3IH9 A;  2C5W B;  2XEP A;  3LIE A;  5FSR A;  3MBZ A;  2M7U A;  1BUL A;  2Y59 A;  1BLP A;  1SHV A;  3I7J A;  2G7U A;  3ZG7 B;  2VA0 A;  3EQV A;  3H7W B;  3W2Z A;  4I39 A;  4YFM A;  3VP4 A;  1KE0 A;  5EPH A;  3W4P A;  1TS0 A;  1YKD A;  3U4L P;  3Q81 A;  4BBT A;  1JVJ A;  1IKI A;  5HDC A;  4N9K A;  3DAV A;  2I72 A;  4F3L A;  4BEN A;  4Z1W A;  1S4S A;  4Y0T A;  3LEZ A;  4DRT A;  1SDE A;  1K57 A;  2PDR A;  4X6T A;  2EXB A;  3A3E A;  3UN7 A;  3MKE A;  2ZM2 A;  2VV6 A;  4MMN A;  5TR7 A;  1AXB A;  1GSX A;  4LRX C;  1I2W A;  4F3L B;  3DWZ A;  5MC7 A;  4XXR A;  3FYZ A;  3FWL A;  3S7N A;  3OLO A;  5A91 A;  5EM0 A;  4II7 A;  4JXW A;  3IF6 C;  3OCL A;  2J7V A;  4IUK A;  4O8G A;  4FOF A;  1U60 A;  3UE0 A;  2PBD P;  3BFE A;  4I38 A;  3UE1 A;  3CJM A;  4Q0J A;  1L0F A;  1S1Y A;  3VP1 A;  4Y13 A;  1XKZ A;  2QHK A;  4QWO A;  2WKE A;  1N9N A;  4UEY A;  4LGW A;  3L7H A;  1GA0 A;  5AJG A;  3IX8 A;  4NXB A;  3M2K A;  3SH8 A;  4Y15 A;  5D3O A;  3N8R A;  3CUE A;  3OPL A;  4OKP A;  4WN5 A;  4HHD A;  4KQR A;  3ITA A;  4KG6 A;  5M1A A;  1ERM A;  2BG1 A;  2Q0O A;  3F1O A;  3K3C A;  1CQA A;  2XR0 A;  4MLL A;  1LL8 A;  3JPU A;  4OPY A;  2LB5 A;  2PR6 A;  5EOE A;  4H6J B;  2X02 A;  2Q9M A;  4BD0 A;  2V8F A;  1YM1 A;  2ACG A;  5CHU A;  5F5Y A;  3JYI A;  4DN0 A;  5EVI D;  3DTE A;  4E3N A;  4KZA A;  2Y2M A;  3TJZ C;  1CJF A;  1XXM A;  4DDY A;  3VV4 A;  1ES4 A;  4Z9Q A;  2HP6 A;  2XFT A;  1NYM A;  4L0L A;  1GSW A;  1YMX A;  4CLC C;  2EWW A;  3KSG A;  4ESP A;  1SZV A;  3VOZ A;  4Q0H A;  3V5M A;  1OTD A;  3C7V A;  5HWT A;  3T4J A;  1GHM A;  2J8Y A;  1NZU A;  4M3K A;  2YKH A;  3G35 A;  4ME4 A;  5E2E A;  4E3O A;  3SZT A;  1SCW A;  2P7J A;  4ARZ A;  2X71 A;  5IS1 A;  2XDM A;  3ZG0 A;  1D7E A;  1XA7 A;  1BT5 A;  5DF8 A;  4JBF A;  2HGV A;  1NWZ A;  1I2S A;  2XK1 A;  1P0Z A;  5FL3 A;  5HSQ A;  1PWG A;  4PKY A;  3T1Q B;  2VZW A;  2ZQ7 A;  4HY8 A;  3N4I A;  4OQG A;  2ZMF A;  4JF4 A;  4ARZ B;  3ZYT A;  4R1G A;  4NXF A;  5DKK A;  2PD8 A;  3V39 A;  1PWC A;  4EEU A;  3LUQ A;  3T1X A;  4GN2 A;  5FDH A;  3NY4 A;  3BFD A;  4WZ4 A;  2WGI A;  1HD8 A;  3O5Y A;  5A90 A;  1NLY A;  2VLG A;  4NK3 A;  2DRW A;  1S0W A;  5FAS A;  4EU0 A;  4JGQ A;  2VX8 A;  1OTE A;  2JKF A;  5AVE A;  2VV7 A;  5A93 A;  2PAV P;  4IVI A;  4DE0 A;  3KX0 X;  5EV0 A;  1AWI A;  3BFC A;  4KZ7 A;  3BFG A;  3P98 A;  4KUK A;  3ISG A;  3GV9 A;  4QY5 A;  2GJ3 A;  1K38 A;  4D60 A;  3FPV A;  4R23 A;  3T1R A;  3DBA A;  5F68 A;  3IBJ A;  4P0M A;  3IBR A;  4MBK A;  3BQA A;  2V9A A;  3WS5 A;  4HEF A;  2PU4 A;  3ZDJ A;  2WZX A;  1DJA A;  5F82 A;  2X01 A;  3ZCZ A;  3E0Y A;  1XJ6 A;  2M1C A;  3TG9 A;  1G68 A;  2ZQ9 A;  4S2K A;  5EVE A;  3FZC A;  3UO9 A;  3VE3 A;  1W8Y A;  4LRZ E;  1NLZ A;  3WS1 A;  4YIN A;  1P97 A;  2IWC A;  5GHX A;  1K25 A;  1T18 A;  4DF6 A;  5G4Y A;  2XSS A;  3ZHH A;  4BMW A;  4GJ4 A;  2OSU A;  2IWB A;  3CLO A;  1T1B A;  4LRY C;  5FI2 A;  4L9G A;  5GL9 A;  1ALQ A;  5CED A;  1ZG4 A;  2BTF P;  4DJ3 A;  2XD1 A;  3VOL A;  1CI9 A;  2E8I A;  2WKI A;  2L0W A;  2OLU A;  3A0S A;  4EUZ A;  3HLB A;  1KOU A;  1CK3 A;  1ODV A;  2Y2O A;  4QB8 A;  3L9K A;  1L0G A;  4X56 A;  1PYY A;  4FTX A;  3LR5 A;  4D2O A;  3S7P A;  2AVX A;  3TSG A;  5J8X A;  4MEZ A;  3HLD A;  1HVB A;  1HZO A;  4U0T A;  3KSI A;  2YKF A;  3LEQ A;  5IHV A;  3ZFZ A;  3RJU A;  4M4X A;  4O01 A;  2XD5 A;  2XF3 A;  4R0Q A;  2OWJ A;  2QYB A;  3VP2 A;  4HH3 A;  1K56 A;  4UA6 A;  2VGK A;  4QU3 A;  1XJ2 A;  3AGD A;  5DF7 A;  3FKV A;  3QHY A;  4S2M A;  3IQA A;  1VET A;  1S67 L;  2VEA A;  3MR0 A;  3TOI A;  3OZH A;  3T4Q A;  1E3U D;  1ZHH B;  1TEM A;  2VKS A;  4EER A;  3VP0 A;  5DFY A;  4LCM A;  5F83 A;  2W3D A;  5F69 A;  3VMA A;  4EQ1 A;  2EWV A;  1YLY A;  1VET B;  3BJN A;  5EVI A;  2WK0 A;  3BRM A;  3QP8 A;  4PM8 A;  4CPK A;  3B3X A;  4L9E A;  4KG5 A;  2W1T A;  3OPH A;  2UWX A;  4ZJ2 A;  5EFW A;  1S6R A;  4ETZ A;  2Y2G A;  5J4E A;  3A0R A;  3SH7 A;  5HX9 A;  1KVL A;  3UPO A;  3MKF A;  5EVI B;  3LGO A;  4X1L A;  1G6A A;  5EM1 A;  2W1T B;  4EV4 A;  2J80 A;  4N92 A;  2HF6 A;  2ZLY A;  1LSX A;  1W79 A;  1FSY A;  2V1A A;  3G30 A;  1DJC A;  2KDK A;  2ZQC A;  4EBL A;  4OP8 A;  1E4D A;  2W3E A;  5EEC A;  1IYQ A;  4BD1 A;  1UWN X;  3MS6 A;  4MBH A;  4HOI A;  4LV1 A;  2ZMA A;  3VSK A;  3UB6 A;  5CTM A;  3LIA A;  3IWI A;  1DRM A;  4R6L A;  1KGE A;  3HUO A;  2OAP 1;  3UDX A;  1VB6 A;  2V0U A;  3D9Y A;  1LL5 A;  2I9V A;  3GQZ A;  1FIL A;  5EVL A;  1F2K A;  1FR1 A;  4WEL A;  3B33 A;  4QD4 A;  1BLH A;  4KZ5 A;  4E04 A;  3VFF A;  3CIT A;  4JXS A;  2V8C A;  3RXW A;  3UNW A;  4R4R A;  3NDE A;  3O87 A;  3QNB A;  3IT9 A;  3NCK A;  4JGR A;  4HP4 A;  3SS3 A;  3BEB A;  2EX6 A;  3M6B A;  4Y3I A;  1ZG6 A;  5A92 A;  3E2K A;  1XFN A;  5FDS A;  1JWZ A;  1NZO A;  4L9F A;  3NOU C;  5FEG A;  4HNB A;  1PW1 A;  2HDR A;  4BWI A;  4RX3 A;  3LY4 A;  3CHW P;  5AQ7 A;  5CX7 A;  2QWS A;  2VJW A;  1OTI A;  4WZ5 A;  1E25 A;  3Q82 A;  3DTI A;  3S7Q A;  3MF0 A;  2R9W A;  5HPF A;  4CLC D;  4GHI A;  5HW3 A;  1H0M A;  2ZJ9 A;  4HBT A;  3BQ8 A;  4UHU A;  4P87 A;  4DXC A;  3NJA A;  3CAX A;  3DTK A;  2FFY A;  4NXE A;  1KDS A;  1W8Q A;  2CC1 A;  3C7U A;  1FCM A;  4IVK A;  1PI5 A;  1NYY A;  2H10 A;  2J3T C;  4GHI B;  1MWU A;  2VV8 A;  5AVF A;  4DE2 A;  2HDU A;  2INW A;  1XGI A;  4PKY G;  2B5R A; 
#chains in the Genus database with same CATH homology
 1D7E A;  4EW7 A;  1XJ3 A;  2W27 A;  2HGV A;  1NWZ A;  1P0Z A;  4Y2F A;  3RFB A;  3KSH A;  5FL3 A;  5HSQ A;  5DFX A;  4PKY A;  1TD5 A;  2GNX A;  2VZW A;  3C8C A;  3EQU A;  2JN7 A;  4HY8 A;  4IUH A;  1TS6 A;  4Y5F A;  3RH8 B;  2ZMF A;  4ARZ B;  3ZYT A;  2M7V A;  2KOI A;  4NXF A;  1TF1 A;  5DKK A;  2Z6D A;  2PD8 A;  3T4T A;  1N9L A;  2JKR I;  4MN5 A;  1V9Z A;  3F1N A;  2K2N A;  3S7O A;  5HWV A;  3MFX A;  3CUE C;  1XJ4 A;  3OOV A;  4JGO A;  4EEU A;  2W0N A;  4PHT A;  3LUQ A;  5LBR A;  2KX6 A;  3T4O A;  2JKT I;  4HH2 A;  5IS1 A;  1XFQ A;  3FPW A;  3V67 A;  4BBU A;  3PBR A;  4HI4 A;  4OOL A;  5DKL A;  2B02 A;  5L8M A;  1OJG A;  1Y28 A;  3LI9 A;  3R7W A;  1N9O A;  3O5Y A;  3F1N B;  4DMZ A;  2ZOH A;  3C30 A;  1NLY A;  4H6J A;  4EXO A;  3LR0 A;  2VLG A;  5TJJ A;  2CMN A;  2PYR A;  4EU0 A;  3LR4 A;  3OCN A;  4JGQ A;  3B42 A;  1YSP A;  2D01 A;  5HD3 A;  2ZBB A;  2VX8 A;  1OTE A;  2GZA A;  2WKQ A;  5AVE A;  2PHY A;  2VV7 A;  3T4L A;  2Y8H A;  2KLI A;  3KX0 X;  3R7W B;  4IJG A;  3T4S A;  4NKP A;  1EW0 A;  4KUK A;  4G3V A;  1P9R A;  4GLQ A;  3E4P A;  5HDS A;  2NUP C;  2GJ3 A;  2J3W A;  1T19 A;  2BAS A;  4LPZ A;  3FPV A;  4CLC E;  2JKR M;  3DBA A;  1MZU A;  3H82 A;  1F9I A;  3B47 A;  4DJ2 A;  5F68 A;  3IBJ A;  4UQI M;  4YOF A;  2HV1 A;  3IBR A;  3MQO A;  3UE6 A;  3NHQ A;  2A24 A;  3BQA A;  2V9A A;  5HDD A;  1G6O A;  3LID A;  1S4R A;  3PXP A;  4YWZ A;  5K5B A;  2MJ6 A;  1OTB A;  5TBM A;  5IT5 A;  3LIB A;  3LYX A;  3U2A A;  5HZH A;  3TW8 A;  3JVU A;  3HJI A;  3PYP A;  2OOL A;  3RTY A;  5HPI A;  3E0Y A;  4NXG A;  1XJ6 A;  2M1C A;  3H82 B;  3C38 A;  4AFI A;  4G3K A;  2A2L A;  3D72 A;  1OTA A;  1ZTU A;  4WLA A;  3PBT A;  3ULF A;  5G4Z A;  4P6Z M;  2A24 B;  2D02 A;  5C5K A;  4CQH A;  3FC7 A;  1TS7 A;  3VE3 A;  4LRZ E;  3CWF A;  1LT0 A;  1NLZ A;  5TBM B;  1DP9 A;  2EA9 A;  1P97 A;  1YSQ A;  4HJ4 A;  1T18 A;  3P7N A;  2XRO A;  4XT2 A;  5G4Y A;  2XSS A;  5HWW A;  1UWP X;  4HJ3 A;  4BMW A;  3H9W A;  2K7S A;  4GS9 A;  4MN7 A;  1F5M A;  4GJ4 A;  3ZQ5 A;  3EEA A;  4EEP A;  4B93 A;  2HJE A;  3KYZ A;  2W3G A;  3CLO A;  1T1B A;  4LRY C;  2LB9 A;  4L9G A;  3E4Q A;  2IA2 A;  3C2W A;  4XT2 B;  5J3W A;  4OOM A;  4DJ3 A;  4ETX A;  3K2N A;  3VOL A;  3UB7 A;  4GS9 B;  4UQI S;  5HD5 A;  2L0W A;  3OC2 A;  4I5S A;  3A0S A;  5DF9 A;  3LI8 A;  1S1Z A;  2W3H A;  2P08 A;  3EGD C;  1G28 A;  1KOU A;  1ODV A;  2PD7 A;  5KSH A;  4WEK A;  4RQ9 A;  3LR3 A;  3EEH A;  3VE4 A;  4EET B;  4HJ6 A;  3HCY A;  2H28 A;  3LR5 A;  4P6Z S;  1VHM A;  1IFQ A;  3S7P A;  1OT9 A;  1T1C A;  4Q0I A;  2JHE A;  2QKP A;  3KSI A;  3MMH A;  2YKF A;  4R70 A;  3TE8 A;  1H3Q A;  2W3F A;  4IHQ A;  4M4X A;  3H7W A;  4PAU A;  3UMD A;  4O01 A;  1S66 L;  3GDI A;  2OWJ A;  2QYB A;  1D06 A;  3LIE A;  2R78 A;  2XA7 M;  4HH3 A;  3IS2 A;  4GCZ A;  2M7U A;  1XJ2 A;  4I3J A;  3LIF A;  2QJ7 A;  5F6A A;  2G7U A;  1LSV A;  2VA0 A;  3EQV A;  1S67 L;  2VEA A;  3H7W B;  3MR0 A;  5HL6 A;  3W2Z A;  4I39 A;  5DJT A;  5J7E A;  3T4Q A;  2O9C A;  2WKR A;  3K3D A;  1ZHH B;  3F1O B;  2VKS A;  3IS2 B;  4EER A;  1TS0 A;  3HJK A;  1YKD A;  5DFY A;  4JGP A;  1MKM A;  2FH5 A;  2W3D A;  5F69 A;  4BBT A;  4EQ1 A;  2EWV A;  4WF0 A;  5HDC A;  3BJN A;  4NEE D;  2HJ9 C;  3BY8 A;  4F3L A;  4BJP A;  5DJU A;  1DP8 A;  2B18 A;  4WUJ A;  4Z1W A;  4L9E A;  2WKP A;  1S4S A;  2W1T A;  3EOI A;  3SW1 A;  2PDR A;  3MQ0 A;  5EFW A;  4ETZ A;  1MC0 A;  2ZMV A;  5J4E A;  3A0R A;  3G6O A;  4KQD A;  2VV6 A;  4MMN A;  5KIZ A;  2OWH A;  1GSX A;  4LRX C;  4CLC A;  2DMW A;  4F3L B;  4LLO B;  3BW6 A;  3EWK A;  1GSV A;  5MC7 A;  3NOP C;  1IOU A;  3UB9 A;  2W1T B;  4I3A A;  3S7N A;  2K31 A;  2XA7 S;  1P9W A;  2O9B A;  3OLO A;  1F98 A;  2J80 A;  2VGL M;  3E4O A;  4II7 A;  2HF6 A;  3OCL A;  1JNU A;  3MQQ A;  4IUK A;  4O8G A;  4FOF A;  4K08 A;  1LSX A;  4YNR A;  2V1A A;  4GW9 A;  4I38 A;  4CLC B;  3P01 A;  3T4K A;  4EES A;  4MCW A;  4Q0J A;  3T50 A;  2L1M A;  3OBF A;  2KDK A;  3CI6 A;  1NRJ A;  1S1Y A;  2XRN A;  2O0Y A;  2W3E A;  2QHK A;  4FSF A;  3A0V A;  1UWN X;  4BBV A;  3MXQ A;  1N9N A;  4HOI A;  1DP6 A;  3D3O A;  4UEY A;  3UB6 A;  3EGX C;  3PBO A;  1OT6 A;  3LIA A;  3E98 A;  5AJG A;  1W63 Q;  1DRM A;  4R6L A;  4NXB A;  2W1R A;  1STZ A;  4R3A A;  3R4K A;  3CUE A;  4KQO A;  2OAP 1;  1VB6 A;  2V0U A;  3NOT C;  2GX5 A;  3KYQ A;  4HHD A;  4WN5 A;  4WEJ A;  2I9V A;  3PBN A;  3TRC A;  2FZ0 A;  4WEL A;  1LSW A;  3B33 A;  3BY9 A;  4R38 A;  4MDZ A;  3GEC A;  4HP9 A;  3UME A;  3F1O A;  4E04 A;  3K3C A;  4ZRR A;  3CIT A;  4KUO A;  3BWL A;  2VGL S;  4WL9 A;  2Z6C A;  1LL8 A;  3JVV A;  2O99 A;  4QPR A;  1T1A A;  1UGU A;  4B9O A;  2LB5 A;  2PR6 A;  4JGR A;  4H6J B;  3LFV A;  4G3W A;  4HP4 A;  2ZOI A;  4Y3I A;  2NUT C;  3F1P A;  1YAX A;  2PR5 A;  1XFN A;  5F5Y A;  4HIA A;  4DN0 A;  4L9F A;  3NOU C;  2J3T D;  5I5L A;  3PR6 A;  4HNB A;  4BWI A;  4HQA A;  3TJZ C;  3UB8 A;  3VV4 A;  3ICY A;  3PHY A;  1TS8 A;  1H8M A;  4L0L A;  5CX7 A;  4I3I A;  2QWS A;  2PT7 A;  1GSW A;  3PBQ A;  3LIC A;  1BYW A;  2VJW A;  5IU1 A;  3MJQ A;  1OTI A;  3F1P B;  4MN6 A;  2JKT M;  4CLC C;  4O0P A;  2PYP A;  3S7Q A;  1X0O A;  2EWW A;  2L4R A;  3MF0 A;  3KSG A;  4EUV A;  5HPF A;  2O9A A;  2V0W A;  1OPX A;  4GHI A;  4CLC D;  1V9Y A;  4Q0H A;  3BQ8 A;  3PBS A;  1OJ5 A;  2Y79 A;  2V1B A;  3NJA A;  1OTD A;  3CAX A;  5HWT A;  3T4J A;  1WA9 A;  4NXE A;  1W63 M;  2YKH A;  3UE3 A;  4ME4 A;  2J3T C;  3KO6 A;  5A8B A;  4GHI B;  2QJ5 A;  2VV8 A;  2P7J A;  3KSF A;  3FG8 A;  5AVF A;  4ARZ A;  2INW A;  2P04 A;  4PKY G;  2OAQ 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...