3T1SA

Mglb homodimer
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
133
structure length
133
Chain Sequence
SLVLYGAPYERAVEVLEETLRETGARYALLIDRKGFVLAHKEALWAPKPPPLDTLATLVASNAAATQALAKLLGEARFQEEVHQGERMGLYVDEAGEHALLVLVFDETAPLGKVKLHGKRAAEALARIAEEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Signaling protein
molecule keywords Gliding protein MglB
total genus 39
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3t1sA00
2B95A 1SZVA 4D60A 3CHWP 5EVEA 2JKFA 2V8FA 1VEUB 1SKOA 4QWOA 1CF0A 2ZL1B 4X1MA 1YPRA 5FEFA 1J3WA 4ESPA 1PNEA 4X1LA 3NULA 1VEUA 3MS6A 5EM1A 3L9KA 1PRQA 1A0KA 2E8JA 3CPTB 2PRFA 1AWIA 3NECA 3D9YA 3T12B 3U4LP 1FIKA 1FILA 3LGOA 5FEGA 3T1XA 3UB5P 1SKOB 1CJFA 1CQAA 2ZL1A 3CPTA 2PAVP 3DAVA 1D1JA 1G5UA 3KYEA 3MSHA 4FUWA 5EM0A 2HZ5A 2JKGA 1K0KA 1VETB 2ACGA 2VK3A 2V8CA 3LEQA 3T1RA 3T1QB 3T1SA 2PBDP 1VETA 5FDSA 3L7HA 1F2KA 1PFLA 4FTXA 4X25A 1Y4OA 1ACFA 1Z09A 5EV0A 2BTFP 1HLUP
chains in the Genus database with same CATH superfamily
4K0WA 5DTKA 1BULA 1MKIA 2DMWA 1IYSA 1VEUB 3NULA 5EM1A 2H5SA 1K6RA 3IXDA 4GNUA 5FAPA 4KZ6A 2Y91A 1YLPA 3EQUA 2I9VA 2O9AA 1BSGA 2QMIA 1GHMA 4CLCC 1IYOA 3E2LA 4MN6A 3TOIA 5L09A 3SOIA 4O01A 3FPVA 3MQ0A 1S4RA 1EI5A 3ZQ5A 3TW8A 1ZKJA 1SDEA 1H8MA 1L3LA 5TFQA 2Y2PA 3S22A 1NZOA 5F1FA 3UY6A 1K0KA 5AVEA 4S2IA 2X01A 3Q7VB 3IBRA 2XFSA 1UWNX 2X02A 4IVIA 1W7FA 3UE0A 3SS5A 4JF4A 1HVBA 1W63M 4IJGA 4PHTA 1FCOA 5CX7A 2Q9MA 1LL9A 1MWSA 4UHUA 2ZLYA 5CTMA 4U3TA 4C6YA 4U0TA 5FQQA 2WKQA 1BLPA 2UV0E 4KQDA 4QPRA 1O07A 1XKZA 4JF5A 4OLGA 1OTEA 4HQAA 3HBRA 4EESA 4HI4A 1Y28A 4R0QA 3HLWA 3OPLA 1UWPX 4UQIS 1DP9A 1TDLA 2FH5A 4OPZA 1ERQA 4NXBA 4D2OA 1YT4A 2EXAA 5AQBA 3UPOA 3ZHHA 4RQ9A 3TG9A 3ZG9B 2QYBA 3FZCA 1OT6A 3R4KA 2GX5A 3BQAA 1HLUP 3ZNYA 2B95A 4MBHA 1K6SA 2VGLS 2M1CA 2VX8A 3PTEA 5AQ7A 2EX2A 3EGXC 5FSRA 2H10A 3DBAA 4MMNA 1CJFA 1XJ3A 4I3JA 4PM7A 2VGKA 4C75A 4N1HA 1M6KA 5J8XA 1OTBA 3T4TA 1S67L 3VFFA 3IF5A 5CGWA 5AVFA 3G34A 1W79A 4PM9A 3LYXA 2HF6A 3QP4A 4I38A 3F1OB 4EBNA 3IT9A 4II7A 2PR6A 3T1RA 1T1AA 5KIZA 1VB6A 5FAOA 4ZRRA 3GMWA 5F83A 5GL9A 4L9FA 3MS6A 1K54A 1W63Q 3CPTA 3IF6B 1RGZA 4HH3A 1MKMA 1GHPA 5GHZA 3FC7A 3LICA 5IS1A 5KMWA 1YKDA 3H9WA 2PT7A 4QD4A 3IWIA 3B33A 2WGWB 1YPRA 5EUAA 3CLOA 2P9VB 4E3NA 3NOPC 5GHXA 5FATA 5L2FA 1LI0A 1F98A 3IHAA 3BW6A 4YOFA 3C7VA 4ZJ2A 3UMEA 1IKIA 5EPHA 3C38A 3V50A 2BTFP 1OJGA 2WKHA 4S2NA 2V8FA 4WUJA 5CTNA 2JCHA 3HCYA 3V5MA 2PRFA 5AQAA 4B9OA 4XXRA 3BEBA 2QHKA 4O0PA 5F69A 4GLQA 3CG5A 2GDNA 3MXRA 3VP1A 3V3RA 4E3KA 2KX6A 4CLCD 5CERA 2ZQCA 4PM5A 3FV7A 1JWVA 4KENB 2G2UA 1NWZA 1QMEA 2LB9A 2O9BA 3P09A 2ZQ8A 2QJ5A 5HWVA 5HWWA 3GRJA 3A3FA 3ZNTA 1S0WA 2M7VA 2A49A 3GDIA 2V8CA 2JN7A 4NXEA 3N8LA 3V39A 1U60A 2K31A 3F1PB 1YQSA 1YLZA 5DJUA 1H3QA 1IELA 2QPNA 5CRFA 3T4LA 1H5XA 3IXHA 4X69A 1L0EA 3CMZA 3PBNA 4Q8IA 3MZFA 4DXCA 3MR0A 4GHIB 2VV8A 4KZ5A 1JTGA 1XJ4A 4L0LA 4YWZA 4MDZA 3RXWA 3F1PA 1K4EA 4BQMA 4JXGA 2WKIA 4KQOA 2MJ6A 5HAPA 1NYYA 3MJQA 1MBLA 5I5LA 2A24A 3E0YA 3NIAA 3N8RA 5HARA 2CC1A 1H8ZA 4EWFA 1K55C 5CECA 4X25A 5FQ9A 2GNXA 5GLCA 1W8YA 1TS6A 1XXMA 2VV7A 1YMXA 1EWZA 3UB7A 4WZ5C 4N92A 4KQRA 5EM0A 3LIFA 3TSGA 2OV5A 4OOMA 5HAQA 2ZM8A 3Q7VA 4NEED 5E2HA 4Y0OA 3MF0A 2RCXA 1ZC2A 2WKEA 4L9EA 3MBZA 1PWGA 4OQGA 5FL3A 3PBOA 3BY8A 2ZC7A 4FD8A 3ZFZA 4BMWA 3FKWA 4UA9A 3S7OA 1YLWA 2YKHA 1LHYA 1YMSA 4DRTA 4IUKA 1KVLA 5M1AA 2HP6A 1HD8A 1P9WA 4DF6A 1L0GA 4EQ1A 1ALQA 2NUTC 1TEMA 1GA9A 2XA7M 1TS8A 4IHQA 3QP6A 4KG2A 4K91A 3QP8A 5M19A 1G28A 3KSHA 2ZC6B 5DVAA 1BLCA 5E2FA 1N9BA 5GLDA 1DJBA 3SS4A 1L0FA 2KLIA 4GS9B 4LRYC 3CUEC 5HDCA 4QJGA 2Y79A 3EWKA 4HESA 1KE3A 2Q9NA 4ZBEA 2OLUA 1GHIA 3G32A 3G30A 1P9RA 4WEJA 4ZJ3A 1PWDA 2YKFA 3T1XA 1N4OA 3VP4A 1G5UA 2P9VA 1RP5A 4NETA 2B5RA 4GB7A 1E25A 4DDSA 3OBFA 2P74A 4I3IA 3MXSA 3RFBA 3OC2A 5HPIA 2D01A 5IU1A 2EX9A 5TR7A 3D3OA 2J3TD 2JHEA 2PAVP 4QHCA 1NLYA 1LSVA 2JKGA 1VQQA 3LEQA 4MN7A 5FDSA 4XT2B 3NOTC 3LGOA 2WADA 4KG5A 3HUMA 3Q07A 2BLSA 4EU0A 2GZAA 4Y0UA 3IXGA 4HNBA 4RVAA 1MZUA 4NXGA 1E4DA 1T1BA 3VE3A 1PW1A 5FI2A 5EECA 3KSGA 4MBFA 3H7WA 4BL2A 3E2KA 4RX3A 2OAQ1 4HIAA 1JNUA 3IH8A 3WRZA 3BJNA 4RX2A 1PI5A 3IHBA 3G6OA 4E6XA 4HBTA 3SH9A 3UB9A 5HX9A 1D06A 2VGLM 4X1MA 5E2EA 1FQGA 4PMAA 4ZAMA 2HP9A 4WM9A 5CGXA 3DTIA 1KGGA 2LB5A 1ERMA 1LSXA 3C30A 1J9MA 1Q2QA 4BLMA 1KVMA 4KZ3A 4PM8A 4PKYA 3PAGA 4M4XA 2GJ3A 3BWLA 2WKRA 1TDGA 4OQHA 1A0KA 3BFEA 1GSWA 4ID4A 4GZBA 2AVXA 4CQHA 1WYCA 2Y8HA 1LL8A 3LIEA 4LRZE 4GW9A 1X0OA 1ZTUA 4UAAA 5A91A 3G2YA 2XQZA 2PD8A 3EGDC 2L4RA 1F2KA 4P6ZS 3GSGA 3QHYA 1KOUA 2ZMAA 3KSIA 4OONA 2ZM2A 4RYEA 3SS3A 3L9KA 3UNWA 1IKGA 3OZHA 1CQAA 4HH2A 3CWFA 3RJUA 5E2GA 3VMAA 3EEAA 4L9GA 3G2ZA 4D60A 2HDUA 2V0WA 3JYIA 1K57A 3N7WA 5MC7A 3N4IA 4OPRA 4ARZA 3BFDA 3NCKA 2KDKA 2PYRA 4LV0A 2HPBA 2H28A 1ONHA 1XA7A 5HFOA 5FAQA 1XP4A 4EV4A 5F5YA 4BBUA 3G31A 4OOLA 2Y2QA 3OPRA 5EVIA 2Y2NA 2XROA 2PU4A 3IH9A 3PBTA 2VLGA 3IF6C 1E3UA 2R9WA 4HP4A 1ES4A 3K3CA 4Y15A 5AQ9A 4JKTA 1PYYA 2PU2A 1S1ZA 4JXWA 4N9LA 4FSFA 1LLBA 3E4QA 3D9YA 1YAXA 4LCLA 1WYBA 3NHQA 5FDHA 5GHYA 3KYZA 4N9KA 3PR6A 4S2PA 2WUQA 4IBRA 4X56A 1T1CA 5CHUA 4CPKA 3ZDJA 1LT0A 4A5RA 2QJ7A 4R23A 2XFTA 1QMFA 3MFXA 3OLOA 3ISGA 4UQIM 5C5KA 3M2KA 3WS5A 3WRTA 3U4LP 2ZMVA 3H82B 1YLYA 3T50A 2WYXA 4O8GA 2G7UA 2O99A 4HBUA 5HD3A 4WMCD 2PBDP 3VP0A 1BUEA 2FFFB 5EFWA 4E3IA 1OMEA 5HW3A 3H82A 2HDQA 4LV2A 3O88A 4R4SA 4R3AA 4Y13A 1K57C 3VOLA 4DKIA 3N6IA 2OSUA 3BYDA 5TGFA 1K38A 1CK3A 2PDRA 3RXXA 3UPPA 3IX4A 4Y0TA 1PWCA 3MZDA 4CLCA 1JWZA 4MBKA 1ONGA 2VA0A 5FQJA 3NJAA 4WEKA 2ZQ9A 2PHYA 1CI8A 4KZ7A 4YNRA 4X68A 3ZVTA 4CLCB 4LRXC 4WBGA 3SZTA 1TS7A 3PBRA 1BYWA 1Y54A 1XGIA 3T4JA 1IOUA 4EW7A 4KQQA 2VEAA 3HLDA 3BECA 5EOOA 3HL9A 3T12B 4ME4A 1BLSA 4X6TA 1FCNA 1OTIA 3DTMA 2BASA 2XD5A 3L7HA 5J3WA 5HDSA 3FG8A 4S2OA 5DFYA 4YFMA 3IQAA 4DXBA 2XF3A 1C3BA 2WAFA 5HZHA 4JGOA 4BBVA 3D72A 5HDDA 1DJAA 4E3OA 3KO6A 5EVLA 4R38A 4FTXA 4WLAA 3ICYA 2INWA 3C7UA 5EE8A 3N8SA 3BLMA 1FOFA 1KDWA 3ZCZA 4OQ0A 3QNBA 2G2WA 2I72A 2HJEA 4PM6A 2J8YA 4S2LA 1CI9A 4DJ3A 4EETB 3VOZA 5DF9A 2HDRA 4H8RA 3GVBA 4MLLA 5HD5A 3IS2B 4N1XA 3PXPA 4GJ4A 4RA7A 3DTEA 3ITBA 2IWBA 4I5SA 3S7PA 3HJKA 1YM1A 4JXVA 1NY0A 3DWKA 3MQQA 1FSWA 2DNSA 3UDFA 3UO9A 2J7VA 2FFYA 1BT5A 4S2MA 2XK1A 1DY6A 3C2WA 2W0NA 4PKYG 3G4PA 3A0RA 3ZG5A 4ZJ1A 5K5BA 2PYPA 2J9OA 4EUVA 3VP2A 4BD1A 1OJ5A 2Y2JA 3VSKA 5HAIA 5L10A 5J4EA 4UEYA 1I5QA 5FI6A 3V3SA 2FZ0A 1AWIA 1FSYA 4HJ6A 4GN2A 4Y7PA 4U0XA 3GQZA 1VETA 3ULFA 3ZG7B 3DWZA 1FCMA 1XJ2A 1PFLA 1SCWA 4B4XA 5BOHA 2B02A 1N9LA 4DE2A 5CGSA 3KSFA 1DJCA 5JYPA 5A92A 2Y2IA 2OAP1 4LV3A 2X71A 2W3FA 2ZL1A 4OH0A 4JGPA 4JGRA 2L1MA 2W3EA 5CEBA 1SKFA 3HVFA 1KE0A 2ZMFA 5FI7A 1KGEA 4DE0A 3Q82A 4GHIA 1XJ6A 1ES3A 3Q1FA 1GSXA 3U2AA 1FR6A 3DAVA 3TJZC 3O86A 1N9NA 2UWXA 5DJTA 2A3UA 5TBMA 1MXOA 2V0UA 2Y2KA 1NXYA 3LUQA 5G4ZA 1K54C 3R7WB 4MNRA 3BFFA 4JPMA 2PBYA 4H6JA 5F82A 5TJJA 1DP6A 3NECA 2HP5A 2W27A 4FUWA 1AXBA 1D1JA 1GCEA 1K55A 2ZQAA 2DCFA 3R7WA 1SDNA 3PBQA 2XA7S 3O3VA 3KYQA 1PW8A 1LI9A 2O9CA 4GOGA 1XFQA 2B18A 2EA9A 4OPQA 3NBLA 3GTCA 1UGUA 4G3KA 2JC7A 1FILA 3UB5P 5HPFA 2JKTI 1EROA 3M2JA 4BL3A 3WS4A 3LR0A 4BBTA 5DF7A 2RL3A 3E4PA 2V1BA 3OCLA 2J9PA 5E43A 2C5WB 3JPUA 2JKTM 1S4SA 5IHVA 1G68A 3OOVA 4G3VA 1VHMA 4E04A 3S4XA 2ZOIA 3LR4A 4WMCA 3PBSA 1H0MA 3LIBA 4QY6A 4S2JA 3P98A 4LPZA 3A0VA 1K56A 1NYMA 3C4OA 4FH2A 3HLGA 2V1AA 3H7WB 4R3BA 2EWWA 4AFIA 2P08A 1Y4OA 4WZ4A 3CI6A 2ZC5B 4KZ9A 4HHDA 4X1LA 5DFXA 2Y2LA 4HEFA 1IFQA 2EX8A 1ESUA 3T4OA 3ZG8B 2XR0A 4F94A 4GD6A 2W1TA 2WZXA 2R9XA 3BY9A 4EUZA 3CHWP 2VV6A 4WF0A 3IWOA 4OVDA 1P97A 5AJGA 3VE4A 5F68A 2HDSA 2J3TC 3A3JA 1KGFA 2V9AA 2W1TB 4EERA 3UB6A 1H8YA 3UMDA 2HZ5A 2ZQDA 4Y5FA 4KG6A 3WS1A 5DKLA 4X53A 4IEDA 2L0WA 3W4QA 4Y2FA 1K56D 4ETXA 3K2NA 2VGJA 1T18A 2CMNA 3BQ8A 2OWHA 3NC8A 1ES5A 2ACGA 3W4OA 4K0XA 4GS9A 4BENA 4S2NC 3VP3A 1JTDA 3A3DA 1ZG4A 3W4PA 5KZHA 1L0DA 1O7EA 1OPXA 1I2WA 2OOLA 3WS0A 2HJ9C 4KZ8A 1STZA 2VKSA 4OP5A 3C8CA 4S2KA 2V1ZA 4NKPA 4WN5A 3LY3A 3UB8A 2H0TA 4KZAA 3HLBA 5CHJA 4DDYA 2XD1A 2R78A 3ZVWA 4QB8A 3FWLA 4R70A 2WK0A 1SZVA 1SHVA 5HWTA 4MEZA 1ES2A 1SKOA 5G18A 4JF6A 3EOIA 2V2FF 3SH8A 1IEMA 3F1NA 5DKKA 1W8QA 3GV9A 1F5MA 1YLTA 3NDGA 2ZOHA 1TVFA 1XPBA 3LY4A 5L8MA 2O0YA 2ZJ9A 2Q0OA 1XFNA 3IX3A 3F1NB 1MWTA 3LI8A 3V67A 1E3UD 2JKRM 2M7UA 4JGQA 5FQIA 3ZGAB 5KSHA 3W2ZA 5JYOA 2C6WB 3T4SA 5FA7A 3HLCA 5D3OA 2NUPC 1S66L 3GR2A 4KUOA 3MFDA 4E3JA 3TE8A 4NK3A 2Z2LB 1Q2PA 2ZM0A 4ARZB 3UN7A 1BZAA 3A3IA 3MMHA 3B3XA 3Q7ZA 1JWPA 1DRMA 2ZBBA 1NJ4A 3QP2A 4KUKA 1GSVA 5F6AA 4DE1A 2V20A 3D4FA 3VFHA 4LENA 3T1SA 4EQIA 2Y2HA 4WZ5A 1ZG6A 3S7QA 3HLFA 1FIKA 3CJMA 3AGFA 5A90A 4NG2A 1NRJA 1ESIA 2EFUA 1GA0A 4H6JB 1VETB 2Z6CA 4ZDXA 3EEHA 4Y3IA 1KDSA 3OPHA 1L2SA 1ODVA 1TF1A 1XGJA 1PI4A 4GKUA 4B88A 4HOIA 5FEFA 3BFCA 3HJIA 1PNEA 3IWQA 2OLVA 3CITA 3LFVA 3CPTB 3IF6A 2EX6A 4E6WA 4EBLA 2ZD8A 1PZPA 4BJPA 1CEFA 3IXBA 3EQVA 3RH8B 1IYQA 2H0YA 1TD5A 2XEPA 5J7EA 4QU3A 3VSLA 4OKPA 1BTLA 1VEUA 4IVKA 2HGVA 5GLAA 1VM1A 2VZWA 3LO7A 4ETZA 4ZTKA 4LGWA 1DP8A 4LLOB 3S7NA 1IYPA 4WL9A 2QWSA 3UPNA 2QZ6A 4X55A 3CUEA 2WKPA 4F3LB 4JLFA 3FKVA 2EXBA 3LR5A 3W8KA 4R4RA 2IA2A 3O5YA 1ACFA 2EFXA 5EV0A 4F3LA 3B42A 4O7DA 3KX0X 3AGDA 3LCEA 5HL6A 2XDMA 1OT9A 5A8BA 3WS2A 1OTDA 3IBJA 4EBPA 4HJ3A 2IWDA 4I39A 5HSQA 4P6ZM 3WWXA 4G3WA 4Z9QA 4QWOA 3NDEA 2JE5A 4ESPA 4Q0JA 3I7JA 3OCNA 2E8JA 5G4YA 2PD7A 4FOFA 3O87A 4EXOA 3E4OA 3BM6A 4XT2A 3SW1A 5IT5A 4JXSA 4OQIA 1WA9A 3UE1A 3ZYTA 3K3DA 4E3LA 3FYZA 3MKFA 4I3AA 3OPPA 1RGYA 1J3WA 1S1YA 4M3KA 1N9OA 5FEGA 4HY8A 2HV1A 3QP1A 1RCJA 3MSHA 4GCZA 5F1GA 4XUZA 2P04A 2WGIA 2Y55A 1JVJA 1G6AA 2BG1A 3LR3A 2K7SA 5FQMA 4XUXA 1YSPA 1P0ZA 1S6RA 3C4PA 1NLZA 4JBFA 1K4FA 4OP8A 3NI9A 1V9YA 3PYPA 4WYYA 1MC0A 4WELA 3T4KA 4P85A 3UDXA 3T1QB 3A0SA 3IS2A 3LIDA 4CJNA 4IBXA 2J80A 2JKFA 3LEZA 4GDBA 4HP9A 3CZDA 3DTKA 4Q0HA 3AGEA 4B93A 3S1YA 4UA7A 3LI9A 1SKOB 1I2SA 1YSQA 4MN5A 5I94A 1YLJA 1V9ZA 4YINA 5HL1A 1KE4A 4DN0A 4Z1WA 4B4ZA 4P87A 1MY8A 3CAXA 3BLSA 5EVID 3MXQA 3UDIA 5L07A 3ZG0A 1OTAA 2K2NA 1Z09A 2XSSA 2ZQ7A 5CHMA 3JVUA 3T4QA 2WGWA 2W3GA 4LFUA 2XRNA 1NZUA 1M40A 3KYEA 3VOYA 3QNCA 3NOUC 4OPYA 4QY5A 4R6LA 4NXFA 1TS0A 3MZEA 5DTSA 5TBMB 4C3QA 4PPRA 1HTZA 4MCWA 4GD8A 1BLHA 3B47A 1CF0A 2W1RA 5U47A 3E98A 5EOEA 1T19A 2DRWA 2P7JA 5CEDA 5FASA 1MPLA 3GECA 3UE6A 3LIAA 2J3WA 2VK3A 1MWUA 4LV1A 2KOIA 2EWVA 3PAEA 2D02A 4K08A 2PR5A 2ZL1B 3IX8A 4Y17A 2WZZA 3SH7A 3G35A 3PHYA 2ZC4B 2WAEA 5KSCA 1NRFA 4DMZA 4PAUA 1XA1A 2Y2MA 1LSWA 2VJWA 4E3MA 1MWRA 2XGNA 3ITAA 4OLDA 2ZC3B 2Y59A 5EVIB 2JBFA 2Y4AA 4EEUA 5CXWA 4OOYA 1PIOA 1PRQA 4P0MA 5FQKA 4BD0A 4DJ2A 3F1OA 2XLNA 4BWIA 2IWCA 5LBRA 1XX2A 2JKRI 2OWJA 4R3JA 2Z6DA 2A2LA 1W5DA 4KZ4A 5M18A 5GLBA 1PZOA 4Q0IA 2E8IA 3M6HA 3JVVA 3HLEA 3BRMA 2A24B 4FH4A 3FPWA 2WGVA 4R1GA 1CEGA 4IUHA 4HJ4A 3HUNA 1D7EA 4GDNA 4P6BA 3QP5A 3MKEA 5EVIC 5EVEA 1WE4A 3NY4A 2QKPA 4LCMA 1Z6FA 4CLCE 2Y2GA 1K25A 2XH9A 1EW0A 4UA6A 3RTYA 3DW0A 3P01A 3MQOA 3HUOA 2Z2MB 3A3EA 3M6BA 3VV4A 1LL5A 3TRCA 3C5AA 3UE3A 2W3DA 2Y2OA 1G6OA 5DTTA 1HZOA 2W3HA 5DF8A 1FR1A 4FCFA 3Q81A 3P7NA 5A93A 1F9IA 4EEPA 4DE3A 3BFGA 1ZHHB 3HREA 4KZBA
chains in the Genus database with same CATH topology
2B95A 1SZVA 4D60A 3CHWP 5EVEA 2JKFA 2V8FA 1VEUB 1SKOA 4QWOA 1CF0A 2ZL1B 4X1MA 1YPRA 5FEFA 1J3WA 4ESPA 1PNEA 4X1LA 3NULA 1VEUA 3MS6A 5EM1A 3L9KA 1PRQA 1A0KA 2E8JA 3CPTB 2PRFA 1AWIA 3NECA 3D9YA 3T12B 3U4LP 1FIKA 1FILA 3LGOA 5FEGA 3T1XA 3UB5P 1SKOB 1CJFA 1CQAA 2ZL1A 3CPTA 2PAVP 3DAVA 1D1JA 1G5UA 3KYEA 3MSHA 4FUWA 5EM0A 2HZ5A 2JKGA 1K0KA 1VETB 2ACGA 2VK3A 2V8CA 3LEQA 3T1RA 3T1QB 3T1SA 2PBDP 1VETA 5FDSA 3L7HA 1F2KA 1PFLA 4FTXA 4X25A 1Y4OA 1ACFA 1Z09A 5EV0A 2BTFP 1HLUP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B95 A;  1SZV A;  4D60 A;  3CHW P;  5EVE A;  2JKF A;  2V8F A;  1VEU B;  1SKO A;  4QWO A;  1CF0 A;  2ZL1 B;  4X1M A;  1YPR A;  5FEF A;  1J3W A;  4ESP A;  1PNE A;  4X1L A;  3NUL A;  1VEU A;  3MS6 A;  5EM1 A;  3L9K A;  1PRQ A;  1A0K A;  2E8J A;  3CPT B;  2PRF A;  1AWI A;  3NEC A;  3D9Y A;  3T12 B;  3U4L P;  1FIK A;  1FIL A;  3LGO A;  5FEG A;  3T1X A;  3UB5 P;  1SKO B;  1CJF A;  1CQA A;  2ZL1 A;  3CPT A;  2PAV P;  3DAV A;  1D1J A;  1G5U A;  3KYE A;  3MSH A;  4FUW A;  5EM0 A;  2HZ5 A;  2JKG A;  1K0K A;  1VET B;  2ACG A;  2VK3 A;  2V8C A;  3LEQ A;  3T1R A;  3T1Q B;  3T1S A;  2PBD P;  1VET A;  5FDS A;  3L7H A;  1F2K A;  1PFL A;  4FTX A;  4X25 A;  1Y4O A;  1ACF A;  1Z09 A;  5EV0 A;  2BTF P;  1HLU P; 
#chains in the Genus database with same CATH topology
 4K0W A;  5DTK A;  1BUL A;  1MKI A;  2DMW A;  1IYS A;  1VEU B;  3NUL A;  5EM1 A;  2H5S A;  1K6R A;  3IXD A;  4GNU A;  5FAP A;  4KZ6 A;  2Y91 A;  1YLP A;  3EQU A;  2I9V A;  2O9A A;  1BSG A;  2QMI A;  1GHM A;  4CLC C;  1IYO A;  3E2L A;  4MN6 A;  3TOI A;  5L09 A;  3SOI A;  4O01 A;  3FPV A;  3MQ0 A;  1S4R A;  1EI5 A;  3ZQ5 A;  3TW8 A;  1ZKJ A;  1SDE A;  1H8M A;  1L3L A;  5TFQ A;  2Y2P A;  3S22 A;  1NZO A;  5F1F A;  3UY6 A;  1K0K A;  5AVE A;  4S2I A;  2X01 A;  3Q7V B;  3IBR A;  2XFS A;  1UWN X;  2X02 A;  4IVI A;  1W7F A;  3UE0 A;  3SS5 A;  4JF4 A;  1HVB A;  1W63 M;  4IJG A;  4PHT A;  1FCO A;  5CX7 A;  2Q9M A;  1LL9 A;  1MWS A;  4UHU A;  2ZLY A;  5CTM A;  4U3T A;  4C6Y A;  4U0T A;  5FQQ A;  2WKQ A;  1BLP A;  2UV0 E;  4KQD A;  4QPR A;  1O07 A;  1XKZ A;  4JF5 A;  4OLG A;  1OTE A;  4HQA A;  3HBR A;  4EES A;  4HI4 A;  1Y28 A;  4R0Q A;  3HLW A;  3OPL A;  1UWP X;  4UQI S;  1DP9 A;  1TDL A;  2FH5 A;  4OPZ A;  1ERQ A;  4NXB A;  4D2O A;  1YT4 A;  2EXA A;  5AQB A;  3UPO A;  3ZHH A;  4RQ9 A;  3TG9 A;  3ZG9 B;  2QYB A;  3FZC A;  1OT6 A;  3R4K A;  2GX5 A;  3BQA A;  1HLU P;  3ZNY A;  2B95 A;  4MBH A;  1K6S A;  2VGL S;  2M1C A;  2VX8 A;  3PTE A;  5AQ7 A;  2EX2 A;  3EGX C;  5FSR A;  2H10 A;  3DBA A;  4MMN A;  1CJF A;  1XJ3 A;  4I3J A;  4PM7 A;  2VGK A;  4C75 A;  4N1H A;  1M6K A;  5J8X A;  1OTB A;  3T4T A;  1S67 L;  3VFF A;  3IF5 A;  5CGW A;  5AVF A;  3G34 A;  1W79 A;  4PM9 A;  3LYX A;  2HF6 A;  3QP4 A;  4I38 A;  3F1O B;  4EBN A;  3IT9 A;  4II7 A;  2PR6 A;  3T1R A;  1T1A A;  5KIZ A;  1VB6 A;  5FAO A;  4ZRR A;  3GMW A;  5F83 A;  5GL9 A;  4L9F A;  3MS6 A;  1K54 A;  1W63 Q;  3CPT A;  3IF6 B;  1RGZ A;  4HH3 A;  1MKM A;  1GHP A;  5GHZ A;  3FC7 A;  3LIC A;  5IS1 A;  5KMW A;  1YKD A;  3H9W A;  2PT7 A;  4QD4 A;  3IWI A;  3B33 A;  2WGW B;  1YPR A;  5EUA A;  3CLO A;  2P9V B;  4E3N A;  3NOP C;  5GHX A;  5FAT A;  5L2F A;  1LI0 A;  1F98 A;  3IHA A;  3BW6 A;  4YOF A;  3C7V A;  4ZJ2 A;  3UME A;  1IKI A;  5EPH A;  3C38 A;  3V50 A;  2BTF P;  1OJG A;  2WKH A;  4S2N A;  2V8F A;  4WUJ A;  5CTN A;  2JCH A;  3HCY A;  3V5M A;  2PRF A;  5AQA A;  4B9O A;  4XXR A;  3BEB A;  2QHK A;  4O0P A;  5F69 A;  4GLQ A;  3CG5 A;  2GDN A;  3MXR A;  3VP1 A;  3V3R A;  4E3K A;  2KX6 A;  4CLC D;  5CER A;  2ZQC A;  4PM5 A;  3FV7 A;  1JWV A;  4KEN B;  2G2U A;  1NWZ A;  1QME A;  2LB9 A;  2O9B A;  3P09 A;  2ZQ8 A;  2QJ5 A;  5HWV A;  5HWW A;  3GRJ A;  3A3F A;  3ZNT A;  1S0W A;  2M7V A;  2A49 A;  3GDI A;  2V8C A;  2JN7 A;  4NXE A;  3N8L A;  3V39 A;  1U60 A;  2K31 A;  3F1P B;  1YQS A;  1YLZ A;  5DJU A;  1H3Q A;  1IEL A;  2QPN A;  5CRF A;  3T4L A;  1H5X A;  3IXH A;  4X69 A;  1L0E A;  3CMZ A;  3PBN A;  4Q8I A;  3MZF A;  4DXC A;  3MR0 A;  4GHI B;  2VV8 A;  4KZ5 A;  1JTG A;  1XJ4 A;  4L0L A;  4YWZ A;  4MDZ A;  3RXW A;  3F1P A;  1K4E A;  4BQM A;  4JXG A;  2WKI A;  4KQO A;  2MJ6 A;  5HAP A;  1NYY A;  3MJQ A;  1MBL A;  5I5L A;  2A24 A;  3E0Y A;  3NIA A;  3N8R A;  5HAR A;  2CC1 A;  1H8Z A;  4EWF A;  1K55 C;  5CEC A;  4X25 A;  5FQ9 A;  2GNX A;  5GLC A;  1W8Y A;  1TS6 A;  1XXM A;  2VV7 A;  1YMX A;  1EWZ A;  3UB7 A;  4WZ5 C;  4N92 A;  4KQR A;  5EM0 A;  3LIF A;  3TSG A;  2OV5 A;  4OOM A;  5HAQ A;  2ZM8 A;  3Q7V A;  4NEE D;  5E2H A;  4Y0O A;  3MF0 A;  2RCX A;  1ZC2 A;  2WKE A;  4L9E A;  3MBZ A;  1PWG A;  4OQG A;  5FL3 A;  3PBO A;  3BY8 A;  2ZC7 A;  4FD8 A;  3ZFZ A;  4BMW A;  3FKW A;  4UA9 A;  3S7O A;  1YLW A;  2YKH A;  1LHY A;  1YMS A;  4DRT A;  4IUK A;  1KVL A;  5M1A A;  2HP6 A;  1HD8 A;  1P9W A;  4DF6 A;  1L0G A;  4EQ1 A;  1ALQ A;  2NUT C;  1TEM A;  1GA9 A;  2XA7 M;  1TS8 A;  4IHQ A;  3QP6 A;  4KG2 A;  4K91 A;  3QP8 A;  5M19 A;  1G28 A;  3KSH A;  2ZC6 B;  5DVA A;  1BLC A;  5E2F A;  1N9B A;  5GLD A;  1DJB A;  3SS4 A;  1L0F A;  2KLI A;  4GS9 B;  4LRY C;  3CUE C;  5HDC A;  4QJG A;  2Y79 A;  3EWK A;  4HES A;  1KE3 A;  2Q9N A;  4ZBE A;  2OLU A;  1GHI A;  3G32 A;  3G30 A;  1P9R A;  4WEJ A;  4ZJ3 A;  1PWD A;  2YKF A;  3T1X A;  1N4O A;  3VP4 A;  1G5U A;  2P9V A;  1RP5 A;  4NET A;  2B5R A;  4GB7 A;  1E25 A;  4DDS A;  3OBF A;  2P74 A;  4I3I A;  3MXS A;  3RFB A;  3OC2 A;  5HPI A;  2D01 A;  5IU1 A;  2EX9 A;  5TR7 A;  3D3O A;  2J3T D;  2JHE A;  2PAV P;  4QHC A;  1NLY A;  1LSV A;  2JKG A;  1VQQ A;  3LEQ A;  4MN7 A;  5FDS A;  4XT2 B;  3NOT C;  3LGO A;  2WAD A;  4KG5 A;  3HUM A;  3Q07 A;  2BLS A;  4EU0 A;  2GZA A;  4Y0U A;  3IXG A;  4HNB A;  4RVA A;  1MZU A;  4NXG A;  1E4D A;  1T1B A;  3VE3 A;  1PW1 A;  5FI2 A;  5EEC A;  3KSG A;  4MBF A;  3H7W A;  4BL2 A;  3E2K A;  4RX3 A;  2OAQ 1;  4HIA A;  1JNU A;  3IH8 A;  3WRZ A;  3BJN A;  4RX2 A;  1PI5 A;  3IHB A;  3G6O A;  4E6X A;  4HBT A;  3SH9 A;  3UB9 A;  5HX9 A;  1D06 A;  2VGL M;  4X1M A;  5E2E A;  1FQG A;  4PMA A;  4ZAM A;  2HP9 A;  4WM9 A;  5CGX A;  3DTI A;  1KGG A;  2LB5 A;  1ERM A;  1LSX A;  3C30 A;  1J9M A;  1Q2Q A;  4BLM A;  1KVM A;  4KZ3 A;  4PM8 A;  4PKY A;  3PAG A;  4M4X A;  2GJ3 A;  3BWL A;  2WKR A;  1TDG A;  4OQH A;  1A0K A;  3BFE A;  1GSW A;  4ID4 A;  4GZB A;  2AVX A;  4CQH A;  1WYC A;  2Y8H A;  1LL8 A;  3LIE A;  4LRZ E;  4GW9 A;  1X0O A;  1ZTU A;  4UAA A;  5A91 A;  3G2Y A;  2XQZ A;  2PD8 A;  3EGD C;  2L4R A;  1F2K A;  4P6Z S;  3GSG A;  3QHY A;  1KOU A;  2ZMA A;  3KSI A;  4OON A;  2ZM2 A;  4RYE A;  3SS3 A;  3L9K A;  3UNW A;  1IKG A;  3OZH A;  1CQA A;  4HH2 A;  3CWF A;  3RJU A;  5E2G A;  3VMA A;  3EEA A;  4L9G A;  3G2Z A;  4D60 A;  2HDU A;  2V0W A;  3JYI A;  1K57 A;  3N7W A;  5MC7 A;  3N4I A;  4OPR A;  4ARZ A;  3BFD A;  3NCK A;  2KDK A;  2PYR A;  4LV0 A;  2HPB A;  2H28 A;  1ONH A;  1XA7 A;  5HFO A;  5FAQ A;  1XP4 A;  4EV4 A;  5F5Y A;  4BBU A;  3G31 A;  4OOL A;  2Y2Q A;  3OPR A;  5EVI A;  2Y2N A;  2XRO A;  2PU4 A;  3IH9 A;  3PBT A;  2VLG A;  3IF6 C;  1E3U A;  2R9W A;  4HP4 A;  1ES4 A;  3K3C A;  4Y15 A;  5AQ9 A;  4JKT A;  1PYY A;  2PU2 A;  1S1Z A;  4JXW A;  4N9L A;  4FSF A;  1LLB A;  3E4Q A;  3D9Y A;  1YAX A;  4LCL A;  1WYB A;  3NHQ A;  5FDH A;  5GHY A;  3KYZ A;  4N9K A;  3PR6 A;  4S2P A;  2WUQ A;  4IBR A;  4X56 A;  1T1C A;  5CHU A;  4CPK A;  3ZDJ A;  1LT0 A;  4A5R A;  2QJ7 A;  4R23 A;  2XFT A;  1QMF A;  3MFX A;  3OLO A;  3ISG A;  4UQI M;  5C5K A;  3M2K A;  3WS5 A;  3WRT A;  3U4L P;  2ZMV A;  3H82 B;  1YLY A;  3T50 A;  2WYX A;  4O8G A;  2G7U A;  2O99 A;  4HBU A;  5HD3 A;  4WMC D;  2PBD P;  3VP0 A;  1BUE A;  2FFF B;  5EFW A;  4E3I A;  1OME A;  5HW3 A;  3H82 A;  2HDQ A;  4LV2 A;  3O88 A;  4R4S A;  4R3A A;  4Y13 A;  1K57 C;  3VOL A;  4DKI A;  3N6I A;  2OSU A;  3BYD A;  5TGF A;  1K38 A;  1CK3 A;  2PDR A;  3RXX A;  3UPP A;  3IX4 A;  4Y0T A;  1PWC A;  3MZD A;  4CLC A;  1JWZ A;  4MBK A;  1ONG A;  2VA0 A;  5FQJ A;  3NJA A;  4WEK A;  2ZQ9 A;  2PHY A;  1CI8 A;  4KZ7 A;  4YNR A;  4X68 A;  3ZVT A;  4CLC B;  4LRX C;  4WBG A;  3SZT A;  1TS7 A;  3PBR A;  1BYW A;  1Y54 A;  1XGI A;  3T4J A;  1IOU A;  4EW7 A;  4KQQ A;  2VEA A;  3HLD A;  3BEC A;  5EOO A;  3HL9 A;  3T12 B;  4ME4 A;  1BLS A;  4X6T A;  1FCN A;  1OTI A;  3DTM A;  2BAS A;  2XD5 A;  3L7H A;  5J3W A;  5HDS A;  3FG8 A;  4S2O A;  5DFY A;  4YFM A;  3IQA A;  4DXB A;  2XF3 A;  1C3B A;  2WAF A;  5HZH A;  4JGO A;  4BBV A;  3D72 A;  5HDD A;  1DJA A;  4E3O A;  3KO6 A;  5EVL A;  4R38 A;  4FTX A;  4WLA A;  3ICY A;  2INW A;  3C7U A;  5EE8 A;  3N8S A;  3BLM A;  1FOF A;  1KDW A;  3ZCZ A;  4OQ0 A;  3QNB A;  2G2W A;  2I72 A;  2HJE A;  4PM6 A;  2J8Y A;  4S2L A;  1CI9 A;  4DJ3 A;  4EET B;  3VOZ A;  5DF9 A;  2HDR A;  4H8R A;  3GVB A;  4MLL A;  5HD5 A;  3IS2 B;  4N1X A;  3PXP A;  4GJ4 A;  4RA7 A;  3DTE A;  3ITB A;  2IWB A;  4I5S A;  3S7P A;  3HJK A;  1YM1 A;  4JXV A;  1NY0 A;  3DWK A;  3MQQ A;  1FSW A;  2DNS A;  3UDF A;  3UO9 A;  2J7V A;  2FFY A;  1BT5 A;  4S2M A;  2XK1 A;  1DY6 A;  3C2W A;  2W0N A;  4PKY G;  3G4P A;  3A0R A;  3ZG5 A;  4ZJ1 A;  5K5B A;  2PYP A;  2J9O A;  4EUV A;  3VP2 A;  4BD1 A;  1OJ5 A;  2Y2J A;  3VSK A;  5HAI A;  5L10 A;  5J4E A;  4UEY A;  1I5Q A;  5FI6 A;  3V3S A;  2FZ0 A;  1AWI A;  1FSY A;  4HJ6 A;  4GN2 A;  4Y7P A;  4U0X A;  3GQZ A;  1VET A;  3ULF A;  3ZG7 B;  3DWZ A;  1FCM A;  1XJ2 A;  1PFL A;  1SCW A;  4B4X A;  5BOH A;  2B02 A;  1N9L A;  4DE2 A;  5CGS A;  3KSF A;  1DJC A;  5JYP A;  5A92 A;  2Y2I A;  2OAP 1;  4LV3 A;  2X71 A;  2W3F A;  2ZL1 A;  4OH0 A;  4JGP A;  4JGR A;  2L1M A;  2W3E A;  5CEB A;  1SKF A;  3HVF A;  1KE0 A;  2ZMF A;  5FI7 A;  1KGE A;  4DE0 A;  3Q82 A;  4GHI A;  1XJ6 A;  1ES3 A;  3Q1F A;  1GSX A;  3U2A A;  1FR6 A;  3DAV A;  3TJZ C;  3O86 A;  1N9N A;  2UWX A;  5DJT A;  2A3U A;  5TBM A;  1MXO A;  2V0U A;  2Y2K A;  1NXY A;  3LUQ A;  5G4Z A;  1K54 C;  3R7W B;  4MNR A;  3BFF A;  4JPM A;  2PBY A;  4H6J A;  5F82 A;  5TJJ A;  1DP6 A;  3NEC A;  2HP5 A;  2W27 A;  4FUW A;  1AXB A;  1D1J A;  1GCE A;  1K55 A;  2ZQA A;  2DCF A;  3R7W A;  1SDN A;  3PBQ A;  2XA7 S;  3O3V A;  3KYQ A;  1PW8 A;  1LI9 A;  2O9C A;  4GOG A;  1XFQ A;  2B18 A;  2EA9 A;  4OPQ A;  3NBL A;  3GTC A;  1UGU A;  4G3K A;  2JC7 A;  1FIL A;  3UB5 P;  5HPF A;  2JKT I;  1ERO A;  3M2J A;  4BL3 A;  3WS4 A;  3LR0 A;  4BBT A;  5DF7 A;  2RL3 A;  3E4P A;  2V1B A;  3OCL A;  2J9P A;  5E43 A;  2C5W B;  3JPU A;  2JKT M;  1S4S A;  5IHV A;  1G68 A;  3OOV A;  4G3V A;  1VHM A;  4E04 A;  3S4X A;  2ZOI A;  3LR4 A;  4WMC A;  3PBS A;  1H0M A;  3LIB A;  4QY6 A;  4S2J A;  3P98 A;  4LPZ A;  3A0V A;  1K56 A;  1NYM A;  3C4O A;  4FH2 A;  3HLG A;  2V1A A;  3H7W B;  4R3B A;  2EWW A;  4AFI A;  2P08 A;  1Y4O A;  4WZ4 A;  3CI6 A;  2ZC5 B;  4KZ9 A;  4HHD A;  4X1L A;  5DFX A;  2Y2L A;  4HEF A;  1IFQ A;  2EX8 A;  1ESU A;  3T4O A;  3ZG8 B;  2XR0 A;  4F94 A;  4GD6 A;  2W1T A;  2WZX A;  2R9X A;  3BY9 A;  4EUZ A;  3CHW P;  2VV6 A;  4WF0 A;  3IWO A;  4OVD A;  1P97 A;  5AJG A;  3VE4 A;  5F68 A;  2HDS A;  2J3T C;  3A3J A;  1KGF A;  2V9A A;  2W1T B;  4EER A;  3UB6 A;  1H8Y A;  3UMD A;  2HZ5 A;  2ZQD A;  4Y5F A;  4KG6 A;  3WS1 A;  5DKL A;  4X53 A;  4IED A;  2L0W A;  3W4Q A;  4Y2F A;  1K56 D;  4ETX A;  3K2N A;  2VGJ A;  1T18 A;  2CMN A;  3BQ8 A;  2OWH A;  3NC8 A;  1ES5 A;  2ACG A;  3W4O A;  4K0X A;  4GS9 A;  4BEN A;  4S2N C;  3VP3 A;  1JTD A;  3A3D A;  1ZG4 A;  3W4P A;  5KZH A;  1L0D A;  1O7E A;  1OPX A;  1I2W A;  2OOL A;  3WS0 A;  2HJ9 C;  4KZ8 A;  1STZ A;  2VKS A;  4OP5 A;  3C8C A;  4S2K A;  2V1Z A;  4NKP A;  4WN5 A;  3LY3 A;  3UB8 A;  2H0T A;  4KZA A;  3HLB A;  5CHJ A;  4DDY A;  2XD1 A;  2R78 A;  3ZVW A;  4QB8 A;  3FWL A;  4R70 A;  2WK0 A;  1SZV A;  1SHV A;  5HWT A;  4MEZ A;  1ES2 A;  1SKO A;  5G18 A;  4JF6 A;  3EOI A;  2V2F F;  3SH8 A;  1IEM A;  3F1N A;  5DKK A;  1W8Q A;  3GV9 A;  1F5M A;  1YLT A;  3NDG A;  2ZOH A;  1TVF A;  1XPB A;  3LY4 A;  5L8M A;  2O0Y A;  2ZJ9 A;  2Q0O A;  1XFN A;  3IX3 A;  3F1N B;  1MWT A;  3LI8 A;  3V67 A;  1E3U D;  2JKR M;  2M7U A;  4JGQ A;  5FQI A;  3ZGA B;  5KSH A;  3W2Z A;  5JYO A;  2C6W B;  3T4S A;  5FA7 A;  3HLC A;  5D3O A;  2NUP C;  1S66 L;  3GR2 A;  4KUO A;  3MFD A;  4E3J A;  3TE8 A;  4NK3 A;  2Z2L B;  1Q2P A;  2ZM0 A;  4ARZ B;  3UN7 A;  1BZA A;  3A3I A;  3MMH A;  3B3X A;  3Q7Z A;  1JWP A;  1DRM A;  2ZBB A;  1NJ4 A;  3QP2 A;  4KUK A;  1GSV A;  5F6A A;  4DE1 A;  2V20 A;  3D4F A;  3VFH A;  4LEN A;  3T1S A;  4EQI A;  2Y2H A;  4WZ5 A;  1ZG6 A;  3S7Q A;  3HLF A;  1FIK A;  3CJM A;  3AGF A;  5A90 A;  4NG2 A;  1NRJ A;  1ESI A;  2EFU A;  1GA0 A;  4H6J B;  1VET B;  2Z6C A;  4ZDX A;  3EEH A;  4Y3I A;  1KDS A;  3OPH A;  1L2S A;  1ODV A;  1TF1 A;  1XGJ A;  1PI4 A;  4GKU A;  4B88 A;  4HOI A;  5FEF A;  3BFC A;  3HJI A;  1PNE A;  3IWQ A;  2OLV A;  3CIT A;  3LFV A;  3CPT B;  3IF6 A;  2EX6 A;  4E6W A;  4EBL A;  2ZD8 A;  1PZP A;  4BJP A;  1CEF A;  3IXB A;  3EQV A;  3RH8 B;  1IYQ A;  2H0Y A;  1TD5 A;  2XEP A;  5J7E A;  4QU3 A;  3VSL A;  4OKP A;  1BTL A;  1VEU A;  4IVK A;  2HGV A;  5GLA A;  1VM1 A;  2VZW A;  3LO7 A;  4ETZ A;  4ZTK A;  4LGW A;  1DP8 A;  4LLO B;  3S7N A;  1IYP A;  4WL9 A;  2QWS A;  3UPN A;  2QZ6 A;  4X55 A;  3CUE A;  2WKP A;  4F3L B;  4JLF A;  3FKV A;  2EXB A;  3LR5 A;  3W8K A;  4R4R A;  2IA2 A;  3O5Y A;  1ACF A;  2EFX A;  5EV0 A;  4F3L A;  3B42 A;  4O7D A;  3KX0 X;  3AGD A;  3LCE A;  5HL6 A;  2XDM A;  1OT9 A;  5A8B A;  3WS2 A;  1OTD A;  3IBJ A;  4EBP A;  4HJ3 A;  2IWD A;  4I39 A;  5HSQ A;  4P6Z M;  3WWX A;  4G3W A;  4Z9Q A;  4QWO A;  3NDE A;  2JE5 A;  4ESP A;  4Q0J A;  3I7J A;  3OCN A;  2E8J A;  5G4Y A;  2PD7 A;  4FOF A;  3O87 A;  4EXO A;  3E4O A;  3BM6 A;  4XT2 A;  3SW1 A;  5IT5 A;  4JXS A;  4OQI A;  1WA9 A;  3UE1 A;  3ZYT A;  3K3D A;  4E3L A;  3FYZ A;  3MKF A;  4I3A A;  3OPP A;  1RGY A;  1J3W A;  1S1Y A;  4M3K A;  1N9O A;  5FEG A;  4HY8 A;  2HV1 A;  3QP1 A;  1RCJ A;  3MSH A;  4GCZ A;  5F1G A;  4XUZ A;  2P04 A;  2WGI A;  2Y55 A;  1JVJ A;  1G6A A;  2BG1 A;  3LR3 A;  2K7S A;  5FQM A;  4XUX A;  1YSP A;  1P0Z A;  1S6R A;  3C4P A;  1NLZ A;  4JBF A;  1K4F A;  4OP8 A;  3NI9 A;  1V9Y A;  3PYP A;  4WYY A;  1MC0 A;  4WEL A;  3T4K A;  4P85 A;  3UDX A;  3T1Q B;  3A0S A;  3IS2 A;  3LID A;  4CJN A;  4IBX A;  2J80 A;  2JKF A;  3LEZ A;  4GDB A;  4HP9 A;  3CZD A;  3DTK A;  4Q0H A;  3AGE A;  4B93 A;  3S1Y A;  4UA7 A;  3LI9 A;  1SKO B;  1I2S A;  1YSQ A;  4MN5 A;  5I94 A;  1YLJ A;  1V9Z A;  4YIN A;  5HL1 A;  1KE4 A;  4DN0 A;  4Z1W A;  4B4Z A;  4P87 A;  1MY8 A;  3CAX A;  3BLS A;  5EVI D;  3MXQ A;  3UDI A;  5L07 A;  3ZG0 A;  1OTA A;  2K2N A;  1Z09 A;  2XSS A;  2ZQ7 A;  5CHM A;  3JVU A;  3T4Q A;  2WGW A;  2W3G A;  4LFU A;  2XRN A;  1NZU A;  1M40 A;  3KYE A;  3VOY A;  3QNC A;  3NOU C;  4OPY A;  4QY5 A;  4R6L A;  4NXF A;  1TS0 A;  3MZE A;  5DTS A;  5TBM B;  4C3Q A;  4PPR A;  1HTZ A;  4MCW A;  4GD8 A;  1BLH A;  3B47 A;  1CF0 A;  2W1R A;  5U47 A;  3E98 A;  5EOE A;  1T19 A;  2DRW A;  2P7J A;  5CED A;  5FAS A;  1MPL A;  3GEC A;  3UE6 A;  3LIA A;  2J3W A;  2VK3 A;  1MWU A;  4LV1 A;  2KOI A;  2EWV A;  3PAE A;  2D02 A;  4K08 A;  2PR5 A;  2ZL1 B;  3IX8 A;  4Y17 A;  2WZZ A;  3SH7 A;  3G35 A;  3PHY A;  2ZC4 B;  2WAE A;  5KSC A;  1NRF A;  4DMZ A;  4PAU A;  1XA1 A;  2Y2M A;  1LSW A;  2VJW A;  4E3M A;  1MWR A;  2XGN A;  3ITA A;  4OLD A;  2ZC3 B;  2Y59 A;  5EVI B;  2JBF A;  2Y4A A;  4EEU A;  5CXW A;  4OOY A;  1PIO A;  1PRQ A;  4P0M A;  5FQK A;  4BD0 A;  4DJ2 A;  3F1O A;  2XLN A;  4BWI A;  2IWC A;  5LBR A;  1XX2 A;  2JKR I;  2OWJ A;  4R3J A;  2Z6D A;  2A2L A;  1W5D A;  4KZ4 A;  5M18 A;  5GLB A;  1PZO A;  4Q0I A;  2E8I A;  3M6H A;  3JVV A;  3HLE A;  3BRM A;  2A24 B;  4FH4 A;  3FPW A;  2WGV A;  4R1G A;  1CEG A;  4IUH A;  4HJ4 A;  3HUN A;  1D7E A;  4GDN A;  4P6B A;  3QP5 A;  3MKE A;  5EVI C;  5EVE A;  1WE4 A;  3NY4 A;  2QKP A;  4LCM A;  1Z6F A;  4CLC E;  2Y2G A;  1K25 A;  2XH9 A;  1EW0 A;  4UA6 A;  3RTY A;  3DW0 A;  3P01 A;  3MQO A;  3HUO A;  2Z2M B;  3A3E A;  3M6B A;  3VV4 A;  1LL5 A;  3TRC A;  3C5A A;  3UE3 A;  2W3D A;  2Y2O A;  1G6O A;  5DTT A;  1HZO A;  2W3H A;  5DF8 A;  1FR1 A;  4FCF A;  3Q81 A;  3P7N A;  5A93 A;  1F9I A;  4EEP A;  4DE3 A;  3BFG A;  1ZHH B;  3HRE A;  4KZB A; 
#chains in the Genus database with same CATH homology
 2B95 A;  1SZV A;  4D60 A;  3CHW P;  5EVE A;  2JKF A;  2V8F A;  1VEU B;  1SKO A;  4QWO A;  1CF0 A;  2ZL1 B;  4X1M A;  1YPR A;  5FEF A;  1J3W A;  4ESP A;  1PNE A;  4X1L A;  3NUL A;  1VEU A;  3MS6 A;  5EM1 A;  3L9K A;  1PRQ A;  1A0K A;  2E8J A;  3CPT B;  2PRF A;  1AWI A;  3NEC A;  3D9Y A;  3T12 B;  3U4L P;  1FIK A;  1FIL A;  3LGO A;  5FEG A;  3T1X A;  3UB5 P;  1SKO B;  1CJF A;  1CQA A;  2ZL1 A;  3CPT A;  2PAV P;  3DAV A;  1D1J A;  1G5U A;  3KYE A;  3MSH A;  4FUW A;  5EM0 A;  2HZ5 A;  2JKG A;  1K0K A;  1VET B;  2ACG A;  2VK3 A;  2V8C A;  3LEQ A;  3T1R A;  3T1Q B;  3T1S A;  2PBD P;  1VET A;  5FDS A;  3L7H A;  1F2K A;  1PFL A;  4FTX A;  4X25 A;  1Y4O A;  1ACF A;  1Z09 A;  5EV0 A;  2BTF P;  1HLU P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...