3T1SA

Mglb homodimer
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
133
structure length
133
Chain Sequence
SLVLYGAPYERAVEVLEETLRETGARYALLIDRKGFVLAHKEALWAPKPPPLDTLATLVASNAAATQALAKLLGEARFQEEVHQGERMGLYVDEAGEHALLVLVFDETAPLGKVKLHGKRAAEALARIAEEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Gliding protein MglB
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 39
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3t1sA00
3L9KA 5FEFA 3U4LP 1FILA 1G5UA 2PAVP 1CJFA 1PRQA 4FUWA 3L7HA 4X1MA 1FIKA 4ESPA 2V8FA 1Z09A 1D1JA 3T1RA 1CQAA 1VETA 2JKGA 2BTFP 2ZL1B 3CPTB 2B95A 1SKOA 2VK3A 1SZVA 2JKFA 3MSHA 1VEUB 2HZ5A 3T1QB 2PBDP 1A0KA 3LGOA 1CF0A 2V8CA 2PRFA 3MS6A 3T1XA 4X1LA 1VEUA 5FEGA 3DAVA 1PNEA 1F2KA 1AWIA 3D9YA 2ZL1A 3CPTA 2E8JA 1ACFA 3NULA 5FDSA 1K0KA 1PFLA 3T12B 1YPRA 1HLUP 4QWOA 5EM1A 5EV0A 3T1SA 1J3WA 4FTXA 3LEQA 1VETB 4X25A 1Y4OA 3KYEA 5EM0A 3UB5P 3NECA 4D60A 1SKOB 5EVEA 3CHWP 2ACGA
chains in the Genus database with same CATH superfamily
3ZG5A 5FEFA 4R4RA 1BSGA 3WRZA 3D3OA 4BJPA 1UWNX 1G5UA 3T4QA 1W63Q 4PM9A 1CJFA 3GRJA 4FUWA 4FSFA 4XUXA 4HY8A 5AJGA 4DRTA 4I5SA 4NETA 1Z09A 2R9WA 3IF5A 1H8MA 3IS2B 3EEAA 4BWIA 3IWOA 5FQKA 2ZQDA 4O01A 2JC7A 3UPNA 2Y2IA 4MCWA 4UAAA 4JF4A 3HREA 4JXVA 4GOGA 2XFTA 5E2GA 2Y2JA 1F9IA 1S67L 3T1XA 4IUHA 2JKRM 4Y0TA 2EWWA 1K6RA 4ZAMA 5FAQA 1CI9A 3DAVA 4I3JA 1PWDA 3MXSA 5HZHA 1YLZA 2QWSA 3A3IA 1KGFA 5FI2A 3SW1A 3NDGA 3TJZC 4EW7A 1T1AA 2WKPA 4BMWA 1U60A 4HI4A 1K0KA 3AGEA 1KE3A 1GCEA 3ZG8B 3K2NA 2ZLYA 5EV0A 4KUKA 2HP9A 1Y54A 4HQAA 5CGWA 3BM6A 1PW1A 2WKHA 3CITA 2HJEA 4PM6A 5HARA 4YFMA 4EBLA 1E25A 2XEPA 3G35A 5DTSA 3MMHA 2X71A 3QP5A 2V0WA 5TBMA 4R0QA 4DXCA 3O88A 3B42A 3VP1A 2EX8A 1IFQA 3A0RA 2M7VA 5HWTA 5L07A 2EA9A 4KZ9A 5TGFA 1GSVA 3Q7VB 1J9MA 4QJGA 1VB6A 3QP6A 3CLOA 3CPTB 2XH9A 1D7EA 3QNCA 3RTYA 1P9WA 4BD0A 2A24A 4R3JA 3A0VA 4R6LA 4Y7PA 1MWRA 3JYIA 1L0GA 4LGWA 1LL5A 3AGDA 1G68A 4OLGA 1HTZA 4JLFA 2HDSA 2HPBA 3NDEA 1NZOA 1I5QA 3FC7A 5HWWA 4I39A 3F1OA 1BLHA 4H6JA 1TEMA 4P87A 2J3WA 4AFIA 4KZ6A 1YLPA 1RCJA 1AWIA 3HLCA 4HJ6A 5FQIA 2ZQAA 3E4QA 1GA9A 3ZCZA 3VE4A 4F3LB 4O8GA 2DRWA 3FV7A 3O5YA 3E4PA 1Q2PA 4S2IA 3DTMA 4WF0A 1VETB 2EFUA 1NZUA 2EWVA 5EVEA 1S0WA 3CHWP 2PDRA 3ZNYA 4Z1WA 3Q81A 4OKPA 4WLAA 3T4KA 2QHKA 4GD8A 3VFHA 3BW6A 4A5RA 3NCKA 5GLCA 3SZTA 3HL9A 2VA0A 2WKQA 4R38A 3EQUA 4BQMA 4E04A 3O3VA 2B95A 2P08A 4EUZA 3MKEA 4KZ3A 4BLMA 4JF5A 3T4JA 3A3DA 1A0KA 3GSGA 2Z6CA 3LGOA 3AGFA 1CF0A 3DBAA 3HBRA 2EX6A 2WYXA 1L3LA 5L8MA 3G30A 4JGRA 4OVDA 2H28A 3IF6C 3S4XA 2O99A 4L9FA 1O7EA 3A3FA 2I72A 3TG9A 1ERQA 3E2LA 1JWPA 1IELA 4PM5A 5C5KA 3ZG0A 4HHDA 5KIZA 2VV8A 3IS2A 3O87A 5AVEA 4OP8A 3HLGA 3MFXA 1IKGA 2CC1A 2JCHA 4ME4A 2P7JA 1NLYA 5L09A 3MZDA 4E3MA 3OLOA 1DP6A 4HBUA 4OPRA 3UB9A 3IXBA 4EXOA 1BZAA 3PTEA 3C30A 4WL9A 1FOFA 2PYPA 1KDWA 3UN7A 3IT9A 3MBZA 3EGDC 5I5LA 4PMAA 4EESA 5KSCA 4B4ZA 1M40A 1W8QA 3V50A 2ZQ7A 3LR4A 3OPHA 1XJ2A 4N9KA 3LEZA 3FZCA 3NOTC 1V9YA 2OLVA 3T50A 3GQZA 3S1YA 2ZM2A 3ZHHA 3CI6A 4KZAA 1KGEA 2V8FA 3DTEA 4GNUA 4G3VA 2JKTI 1LHYA 5J8XA 2PR5A 4YWZA 3PBQA 4C3QA 3IF6B 4MEZA 2RCXA 2BTFP 1OTEA 4NXEA 2P74A 1ES2A 1I2WA 3FYZA 1DP9A 1ONGA 3OCNA 5CTNA 1XPBA 2A3UA 3LUQA 4OQIA 1YLJA 4Q8IA 5GLBA 4O7DA 3LIBA 1MKMA 2XGNA 4WEJA 3PBSA 4KQOA 1YMSA 2VJWA 1ESUA 3Q7VA 2QMIA 1NRJA 3V39A 5JYOA 4F94A 3D9YA 4CLCD 4G3KA 1YKDA 3NJAA 3VP0A 3CPTA 3NULA 4WMCA 3UE0A 4UQIM 3V3RA 3UB6A 1DJAA 3C8CA 3ZQ5A 2VX8A 2Y2KA 1LL9A 5G4ZA 4MBFA 2ZD8A 4S2NC 4FCFA 4UHUA 4OPZA 1GSWA 1RP5A 3H82B 4CQHA 5M19A 1XFNA 4FOFA 2ZC7A 1OT6A 1K54C 3N8SA 4NXFA 4P6ZS 3VOLA 2OV5A 1XFQA 5CX7A 3MKFA 4DE1A 4FH4A 2GDNA 1K4EA 2QJ5A 3UE6A 2LB9A 1OPXA 2JBFA 3GMWA 4WZ5C 4Y5FA 3EGXC 1P97A 4F3LA 1T1BA 3SOIA 2PD8A 2UWXA 5EVID 4KG6A 2KDKA 2DCFA 1LL8A 1Q2QA 1ZKJA 3Q7ZA 3LR5A 3UDXA 3ZVWA 1VETA 2XA7S 3LY4A 3PR6A 4B4XA 4OOMA 2JKRI 3NBLA 2Y2NA 1OTDA 2ZMAA 3CAXA 5EVIC 3F1NB 2XR0A 1UWPX 1ZHHB 1MZUA 4X53A 3CUEC 3PAEA 1SDEA 1P9RA 4LENA 3OBFA 4PPRA 1H5XA 4LLOB 3VE3A 4GJ4A 2Q9MA 1FCMA 4OQHA 5HPIA 1SHVA 3UMDA 1OT9A 3KO6A 1CI8A 1WYCA 3IH8A 4Y2FA 5FAPA 1YLWA 2ZC6B 3BYDA 3BFFA 4ZJ1A 1XA1A 2WGWB 4GDNA 2ZJ9A 1VHMA 1H0MA 5EECA 3T4OA 4HEFA 2J3TD 5F6AA 4Q0IA 2G2WA 2Y2QA 1L2SA 1IYSA 1FQGA 1K55A 4IUKA 3VOZA 1X0OA 1FCOA 1ZC2A 4GKUA 4U3TA 4MBKA 2G7UA 4MLLA 1VQQA 3T4TA 1S1ZA 2WUQA 5IHVA 2EX9A 4JBFA 2ZQ9A 4MN7A 4NG2A 4ETZA 4UA7A 3HLBA 1RGYA 3UDIA 1EWZA 1CQAA 4EEPA 1PWCA 5FQJA 1NWZA 3H7WB 3RFBA 4N1XA 2HDQA 1LSWA 2XLNA 1XKZA 3C7UA 2J9PA 1ESIA 4QB8A 4RX2A 5A93A 4NEED 3BEBA 4DJ2A 1L0DA 2V8CA 1JTGA 3C5AA 1YQSA 2ZC5B 3NI9A 4MNRA 5M1AA 3WS1A 5FEGA 1YMXA 2VGJA 4Y13A 3MQOA 1EI5A 1K56D 5J7EA 3MFDA 5TJJA 4B93A 5EUAA 3OPRA 3ULFA 2W27A 4P6ZM 4K91A 1ES4A 3IF6A 1RGZA 4PAUA 2E8JA 4UA9A 5CGSA 2KLIA 2C6WB 4S2PA 4GB7A 4DF6A 1IKIA 4E3JA 5HPFA 4B88A 2JN7A 5EM0A 3KX0X 3P01A 1ERMA 2G2UA 4WZ4A 3VMAA 2XA7M 3N6IA 4II7A 1H8YA 1AXBA 1FILA 1F5MA 2Y2PA 1WA9A 2Z2MB 4IVIA 1GA0A 4Y0OA 3PXPA 5E2FA 4S2OA 3L7HA 4WELA 3KYZA 4LCLA 4OPQA 5EPHA 2Y91A 3T1RA 1IYQA 2X01A 1KVMA 1PYYA 2JKGA 2PT7A 4MDZA 1OTBA 2VGLS 4OONA 3W2ZA 3H82A 4GS9B 3W4OA 5CRFA 2W1TB 3MXQA 1SKFA 5FL3A 2VK3A 4Q0JA 2Y2MA 2NUPC 1K25A 5JYPA 3KYQA 1O07A 1E3UD 5DKKA 1NXYA 4H8RA 1OMEA 2KX6A 3WS4A 1IEMA 2W1RA 4ZJ3A 5A8BA 2HJ9C 3MR0A 3A3JA 3K3DA 4HH3A 4QHCA 4I3AA 4JGQA 3TE8A 5GLDA 1G28A 4RQ9A 1P0ZA 2XD1A 4MBHA 3F1NA 4QWOA 3SS3A 2R9XA 1XJ3A 5HDCA 4ZJ2A 3FG8A 4S2MA 4XXRA 3B3XA 3S7PA 4Y0UA 4GCZA 3SH8A 1KVLA 2J8YA 3EEHA 4E3KA 1CK3A 5CXWA 3PBTA 3FKVA 3BQAA 3LI8A 5E43A 5DFXA 4BL3A 5M18A 5CEBA 2HP6A 4S2NA 4XT2A 3BFEA 3EQVA 2HV1A 2XSSA 1K55C 3A0SA 1LLBA 1K54A 2GX5A 3LR0A 1V9ZA 3QP4A 2IWBA 1I2SA 4K0XA 5FASA 2WGWA 1YSQA 5DF7A 5KSHA 3HLFA 4WZ5A 4YNRA 3V5MA 1TDLA 5D3OA 3ZDJA 1MWUA 4UQIS 3S7NA 5FQMA 3N8RA 2XD5A 3SS4A 4FD8A 4KQRA 2LB5A 2NUTC 1OJ5A 3ICYA 2KOIA 1S4SA 3ITBA 2QZ6A 2JKFA 3MQ0A 3HUOA 1PWGA 1UGUA 3DWZA 5F83A 1BLSA 4GN2A 4HESA 5EVIA 1MWSA 2HDUA 1C3BA 1YLTA 2V20A 1VEUA 5AVFA 2GZAA 3CUEA 4I38A 1FSWA 3OCLA 5GHXA 3RJUA 5HL1A 3EOIA 2ZQCA 3BECA 1S6RA 3IWIA 4I3IA 1PI4A 1EROA 3H7WA 2VLGA 5FAOA 3V67A 5FDSA 2J80A 1HLUP 4LPZA 3UNWA 3CZDA 3DW0A 5E2EA 5FA7A 5KMWA 5L10A 4YINA 4X25A 1TD5A 2XROA 3MQQA 4GD6A 1GHIA 2WAEA 5F1GA 1ZG4A 5CHUA 3BQ8A 3VSKA 4CLCE 3RXWA 2VGLM 1WE4A 3U4LP 3TRCA 3WS5A 2WAFA 3BFGA 4X69A 4WM9A 5G4YA 1ALQA 1PRQA 1K6SA 4KQDA 3LO7A 5DF9A 4GDBA 3BY9A 1DJBA 1XGIA 2H0TA 4RA7A 4HJ4A 4EBNA 3T4LA 3KSFA 2D01A 5HW3A 5HL6A 3VOYA 1S66L 3QNBA 2EXAA 1K38A 5IS1A 2W3HA 1XJ4A 3GV9A 3IXHA 4R1GA 1LI0A 3GECA 2K2NA 4EU0A 3RXXA 2O0YA 4KENB 1N9BA 3KSIA 4X1LA 1MKIA 3ZFZA 3W8KA 4E3NA 3M6BA 2XK1A 4R3BA 4LRYC 1MC0A 4EQ1A 3R7WB 1BLPA 1W7FA 2JE5A 4GS9A 2XFSA 4NXGA 1XP4A 1JVJA 2FFFB 2W1TA 3NHQA 2GNXA 3G6OA 2Z6DA 2ZBBA 3M6HA 3LIFA 4KZ8A 2Y59A 5AQ7A 5DTTA 3UB8A 1BLCA 2QYBA 1ZTUA 3M2JA 2ACGA 1EW0A 2QPNA 1IYOA 4DDSA 1FR6A 1LSXA 4FH2A 2K7SA 4GHIB 5DVAA 3LIEA 4QD4A 2FZ0A 3VP3A 1T1CA 3IQAA 4CLCC 4X6TA 1GHPA 5HX9A 3ZYTA 4U0TA 2B18A 5TFQA 2JHEA 2VEAA 1LT0A 2Y79A 4M4XA 3BWLA 4QY6A 5DFYA 4ARZB 1N4OA 2B02A 1QMFA 1KDSA 2HF6A 1DRMA 3ISGA 2Y2GA 5GHYA 2PBYA 3MZFA 3HLDA 4IEDA 3Q07A 4M3KA 4RYEA 3UDFA 1PW8A 1S4RA 3IXDA 3IX8A 4GLQA 1M6KA 2OWHA 3QP2A 3T4SA 3N8LA 4PHTA 2IWCA 1LI9A 1QMEA 2YKFA 4UA6A 1F2KA 4PKYA 1DY6A 2DMWA 3F1PB 3LY3A 3VP2A 3LR3A 3DWKA 3VSLA 4BBTA 1NY0A 5AQ9A 1LSVA 3BLMA 2V1BA 2B5RA 5HFOA 5U47A 1ES3A 4JKTA 1E3UA 2PHYA 2V1AA 5HSQA 1YPRA 2Y2LA 4IVKA 3IXGA 4BD1A 1JNUA 2ZMFA 4CLCB 5HDSA 2ZM0A 4XT2B 3HJIA 1KE4A 3NECA 2BLSA 5CHMA 3S7OA 3PBOA 1L0FA 4QPRA 2AVXA 1PI5A 1Z6FA 2OSUA 3JVUA 5G18A 3W4QA 3Q82A 1NJ4A 3Q1FA 2IA2A 3FKWA 4K0WA 4S2KA 1DJCA 3C38A 2P9VB 1OTIA 1HZOA 4UEYA 2INWA 3LIDA 1GHMA 4Q0HA 2J7VA 3MZEA 1YM1A 2ZL1B 2J3TC 2OWJA 4KG2A 1CEGA 5I94A 1DP8A 5EVIB 3VFFA 1VEUB 4JXSA 3GTCA 3FPWA 5MC7A 3FPVA 5FQQA 4ZRRA 1TS7A 4DKIA 3MJQA 3D4FA 4HIAA 3WWXA 3QHYA 5DKLA 2YKHA 2W3EA 3HLEA 3IBRA 5HD3A 1MPLA 4DJ3A 2A49A 4EWFA 3G4PA 3P98A 1J3WA 3BRMA 4FTXA 4JF6A 5EE8A 4EV4A 4IBRA 3G34A 5DTKA 3KYEA 4D2OA 1YAXA 4N92A 2A2LA 5LBRA 1BUEA 2DNSA 4BBUA 2O9CA 4CJNA 5CGXA 4RVAA 3ZGAB 4GZBA 4ETXA 2WZXA 4NKPA 3FWLA 3WS0A 4EQIA 4QU3A 2QKPA 2W3DA 4U0XA 2IWDA 1K4FA 3R7WA 4LFUA 4DE3A 4ESPA 4WMCD 4EEUA 3R4KA 2W3GA 1WYBA 4N9LA 3I7JA 3C7VA 3O86A 4JXGA 2ZOIA 3CMZA 5CEDA 4MMNA 3NC8A 2ZC4B 3D72A 4C6YA 4GHIA 2HZ5A 1BYWA 3T1QB 2PBDP 2VV6A 2L1MA 4JGOA 5F5YA 3PBRA 1JWVA 3U2AA 1TDGA 4DDYA 5FQ9A 2BASA 2EX2A 2X02A 4LRXC 3IHBA 3A3EA 4MN6A 3NIAA 1G6AA 4OQGA 1IOUA 3IH9A 4ZTKA 4ARZA 2V2FF 1MY8A 1N9NA 3DTIA 4X56A 2Y2OA 5L2FA 3NY4A 1W79A 2M7UA 3P09A 2EXBA 2L4RA 2ZMVA 4HOIA 4KG5A 4OPYA 2XRNA 4HJ3A 3KSGA 2H5SA 1SKOB 4HBTA 1NRFA 1S1YA 3ZNTA 2C5WB 4IHQA 2PD7A 3ZVTA 3SH9A 4R4SA 1ONHA 5HAQA 2Q0OA 2PAVP 4EERA 3F1PA 5HAPA 3ZG9B 4JXWA 5CHJA 2VGKA 4Y17A 2GJ3A 4CPKA 4KQQA 2WZZA 1W8YA 4DN0A 3JVVA 4HH2A 3W4PA 4CLCA 3IX3A 4WEKA 3S7QA 1MBLA 1KOUA 1T19A 4P6BA 3MF0A 3UE3A 3OOVA 5HDDA 4DE2A 3H9WA 4BENA 3IWQA 2W0NA 5GHZA 4X55A 2PRFA 3ZG7B 2OAQ1 1K57C 1N9OA 5J4EA 2P9VA 1MWTA 4DXBA 1BT5A 3GVBA 2RL3A 3TOIA 5AQAA 3CJMA 5F69A 3G32A 5CERA 1VM1A 5F68A 4KZ4A 3G31A 3HLWA 5AQBA 2ZL1A 4E3IA 3QP1A 4L9GA 3TW8A 3HCYA 1KE0A 3V3SA 2QJ7A 4Y15A 5F1FA 2Y4AA 1PFLA 5F82A 3PBNA 4DMZA 4P0MA 1OJGA 5K5BA 1BULA 2D02A 4E3LA 1NYMA 2K31A 3KSHA 2V9AA 4E6XA 3L9KA 3UB7A 2PYRA 4S2LA 4OP5A 1ZG6A 3K3CA 2Y2HA 4PM7A 2WK0A 2Y55A 4OOLA 1XGJA 4NK3A 1ODVA 3BFCA 2OOLA 2HP5A 5TR7A 4KUOA 3BLSA 2PU4A 4WBGA 3RH8B 3CWFA 2EFXA 2Z2LB 5EVLA 4QY5A 5BOHA 3OC2A 3N4IA 2ZM8A 4ID4A 1TS6A 4BL2A 4EUVA 3P7NA 1BTLA 5DJUA 1TF1A 2WKIA 5FATA 5HWVA 2ZOHA 5KZHA 3QP8A 3LIAA 2M1CA 4KZBA 2UV0E 3OPLA 2FH5A 3C4PA 3SH7A 2HGVA 3G2YA 3UMEA 3IX4A 3N7WA 3PHYA 2BG1A 1YSPA 3BFDA 2OAP1 3IBJA 1PZPA 3EWKA 2PU2A 2J9OA 5J3WA 2Q9NA 4G3WA 4EETB 3LI9A 1E4DA 1OTAA 2R78A 2WKRA 5EOOA 2WGVA 2VKSA 4RX3A 3JPUA 1HVBA 1SCWA 4EBPA 4LV2A 5DF8A 2Y8HA 1MXOA 1PIOA 2W3FA 2H0YA 5E2HA 2ZC3B 1KGGA 3SS5A 3B47A 3MXRA 4R23A 4L9EA 3B33A 5A91A 3IHAA 2XF3A 4HP4A 3DTKA 4PKYG 3UPOA 3C2WA 3HJKA 4LV1A 1JTDA 2ZQ8A 1FIKA 5EFWA 4LV0A 4Y3IA 5FDHA 2V0UA 1K56A 3VV4A 3LYXA 3WRTA 3E98A 5FSRA 1HD8A 3ITAA 5HAIA 1XA7A 3VP4A 3OPPA 1SKOA 4P85A 5HD5A 1H3QA 4B9OA 1XXMA 1YT4A 4HNBA 4OLDA 1SZVA 3MSHA 3HVFA 3UE1A 4WN5A 4IJGA 1FCNA 4WUJA 1F98A 1GSXA 4K08A 1D06A 3HUMA 5TBMB 4JPMA 3BY8A 4OOYA 2FFYA 4O0PA 5IU1A 1ACFA 4KZ7A 3HUNA 3CG5A 4HP9A 1NYYA 1TS0A 5EM1A 5DJTA 5CTMA 5FI7A 3UPPA 4C75A 1TS8A 4ZBEA 4KZ5A 1XX2A 2A24B 3BJNA 5GLAA 4E6WA 4OH0A 2O9BA 4NXBA 1PZOA 1FR1A 4OQ0A 3M2KA 2L0WA 4R3AA 2P04A 2OLUA 3PAGA 5FI6A 1SDNA 1H8ZA 3OZHA 3WS2A 4LRZE 3E0YA 4X1MA 1FSYA 1IYPA 3E4OA 4GW9A 3F1OB 4BBVA 4H6JB 4R70A 1G6OA 3PYPA 2WKEA 5EOEA 1D1JA 3NOPC 3NOUC 4LV3A 2VZWA 1N9LA 5A90A 3UO9A 4N1HA 3C4OA 5A92A 1NLZA 4ZDXA 1L0EA 2HDRA 2E8IA 1TVFA 2JKTM 4IBXA 4S2JA 4Z9QA 3MS6A 1XJ6A 1JWZA 4MN5A 4PM8A 4E3OA 2CMNA 1PNEA 1STZA 2PR6A 4WYYA 4YOFA 5GL9A 1T18A 1K57A 3GDIA 4X68A 1Y28A 2O9AA 2VV7A 4DE0A 3LFVA 1W63M 1YLYA 4L0LA 3S22A 3LICA 4JGPA 3T12B 2H10A 1ES5A 5CECA 1CEFA 3T1SA 3GR2A 2XDMA 3E2KA 3LEQA 2WADA 3G2ZA 3TSGA 2MJ6A 2XQZA 1Y4OA 5IT5A 2V1ZA 3UB5P 1W5DA 3LCEA 3UY6A 4D60A 4LCMA 2I9VA 2WGIA 4XUZA
chains in the Genus database with same CATH topology
3L9KA 5FEFA 3U4LP 1FILA 1G5UA 2PAVP 1CJFA 1PRQA 4FUWA 3L7HA 4X1MA 1FIKA 4ESPA 2V8FA 1Z09A 1D1JA 3T1RA 1CQAA 1VETA 2JKGA 2BTFP 2ZL1B 3CPTB 2B95A 1SKOA 2VK3A 1SZVA 2JKFA 3MSHA 1VEUB 2HZ5A 3T1QB 2PBDP 1A0KA 3LGOA 1CF0A 2V8CA 2PRFA 3MS6A 3T1XA 4X1LA 1VEUA 5FEGA 3DAVA 1PNEA 1F2KA 1AWIA 3D9YA 2ZL1A 3CPTA 2E8JA 1ACFA 3NULA 5FDSA 1K0KA 1PFLA 3T12B 1YPRA 1HLUP 4QWOA 5EM1A 5EV0A 3T1SA 1J3WA 4FTXA 3LEQA 1VETB 4X25A 1Y4OA 3KYEA 5EM0A 3UB5P 3NECA 4D60A 1SKOB 5EVEA 3CHWP 2ACGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L9K A;  5FEF A;  3U4L P;  1FIL A;  1G5U A;  2PAV P;  1CJF A;  1PRQ A;  4FUW A;  3L7H A;  4X1M A;  1FIK A;  4ESP A;  2V8F A;  1Z09 A;  1D1J A;  3T1R A;  1CQA A;  1VET A;  2JKG A;  2BTF P;  2ZL1 B;  3CPT B;  2B95 A;  1SKO A;  2VK3 A;  1SZV A;  2JKF A;  3MSH A;  1VEU B;  2HZ5 A;  3T1Q B;  2PBD P;  1A0K A;  3LGO A;  1CF0 A;  2V8C A;  2PRF A;  3MS6 A;  3T1X A;  4X1L A;  1VEU A;  5FEG A;  3DAV A;  1PNE A;  1F2K A;  1AWI A;  3D9Y A;  2ZL1 A;  3CPT A;  2E8J A;  1ACF A;  3NUL A;  5FDS A;  1K0K A;  1PFL A;  3T12 B;  1YPR A;  1HLU P;  4QWO A;  5EM1 A;  5EV0 A;  3T1S A;  1J3W A;  4FTX A;  3LEQ A;  1VET B;  4X25 A;  1Y4O A;  3KYE A;  5EM0 A;  3UB5 P;  3NEC A;  4D60 A;  1SKO B;  5EVE A;  3CHW P;  2ACG A; 
#chains in the Genus database with same CATH topology
 3ZG5 A;  5FEF A;  4R4R A;  1BSG A;  3WRZ A;  3D3O A;  4BJP A;  1UWN X;  1G5U A;  3T4Q A;  1W63 Q;  4PM9 A;  1CJF A;  3GRJ A;  4FUW A;  4FSF A;  4XUX A;  4HY8 A;  5AJG A;  4DRT A;  4I5S A;  4NET A;  1Z09 A;  2R9W A;  3IF5 A;  1H8M A;  3IS2 B;  3EEA A;  4BWI A;  3IWO A;  5FQK A;  2ZQD A;  4O01 A;  2JC7 A;  3UPN A;  2Y2I A;  4MCW A;  4UAA A;  4JF4 A;  3HRE A;  4JXV A;  4GOG A;  2XFT A;  5E2G A;  2Y2J A;  1F9I A;  1S67 L;  3T1X A;  4IUH A;  2JKR M;  4Y0T A;  2EWW A;  1K6R A;  4ZAM A;  5FAQ A;  1CI9 A;  3DAV A;  4I3J A;  1PWD A;  3MXS A;  5HZH A;  1YLZ A;  2QWS A;  3A3I A;  1KGF A;  5FI2 A;  3SW1 A;  3NDG A;  3TJZ C;  4EW7 A;  1T1A A;  2WKP A;  4BMW A;  1U60 A;  4HI4 A;  1K0K A;  3AGE A;  1KE3 A;  1GCE A;  3ZG8 B;  3K2N A;  2ZLY A;  5EV0 A;  4KUK A;  2HP9 A;  1Y54 A;  4HQA A;  5CGW A;  3BM6 A;  1PW1 A;  2WKH A;  3CIT A;  2HJE A;  4PM6 A;  5HAR A;  4YFM A;  4EBL A;  1E25 A;  2XEP A;  3G35 A;  5DTS A;  3MMH A;  2X71 A;  3QP5 A;  2V0W A;  5TBM A;  4R0Q A;  4DXC A;  3O88 A;  3B42 A;  3VP1 A;  2EX8 A;  1IFQ A;  3A0R A;  2M7V A;  5HWT A;  5L07 A;  2EA9 A;  4KZ9 A;  5TGF A;  1GSV A;  3Q7V B;  1J9M A;  4QJG A;  1VB6 A;  3QP6 A;  3CLO A;  3CPT B;  2XH9 A;  1D7E A;  3QNC A;  3RTY A;  1P9W A;  4BD0 A;  2A24 A;  4R3J A;  3A0V A;  4R6L A;  4Y7P A;  1MWR A;  3JYI A;  1L0G A;  4LGW A;  1LL5 A;  3AGD A;  1G68 A;  4OLG A;  1HTZ A;  4JLF A;  2HDS A;  2HPB A;  3NDE A;  1NZO A;  1I5Q A;  3FC7 A;  5HWW A;  4I39 A;  3F1O A;  1BLH A;  4H6J A;  1TEM A;  4P87 A;  2J3W A;  4AFI A;  4KZ6 A;  1YLP A;  1RCJ A;  1AWI A;  3HLC A;  4HJ6 A;  5FQI A;  2ZQA A;  3E4Q A;  1GA9 A;  3ZCZ A;  3VE4 A;  4F3L B;  4O8G A;  2DRW A;  3FV7 A;  3O5Y A;  3E4P A;  1Q2P A;  4S2I A;  3DTM A;  4WF0 A;  1VET B;  2EFU A;  1NZU A;  2EWV A;  5EVE A;  1S0W A;  3CHW P;  2PDR A;  3ZNY A;  4Z1W A;  3Q81 A;  4OKP A;  4WLA A;  3T4K A;  2QHK A;  4GD8 A;  3VFH A;  3BW6 A;  4A5R A;  3NCK A;  5GLC A;  3SZT A;  3HL9 A;  2VA0 A;  2WKQ A;  4R38 A;  3EQU A;  4BQM A;  4E04 A;  3O3V A;  2B95 A;  2P08 A;  4EUZ A;  3MKE A;  4KZ3 A;  4BLM A;  4JF5 A;  3T4J A;  3A3D A;  1A0K A;  3GSG A;  2Z6C A;  3LGO A;  3AGF A;  1CF0 A;  3DBA A;  3HBR A;  2EX6 A;  2WYX A;  1L3L A;  5L8M A;  3G30 A;  4JGR A;  4OVD A;  2H28 A;  3IF6 C;  3S4X A;  2O99 A;  4L9F A;  1O7E A;  3A3F A;  2I72 A;  3TG9 A;  1ERQ A;  3E2L A;  1JWP A;  1IEL A;  4PM5 A;  5C5K A;  3ZG0 A;  4HHD A;  5KIZ A;  2VV8 A;  3IS2 A;  3O87 A;  5AVE A;  4OP8 A;  3HLG A;  3MFX A;  1IKG A;  2CC1 A;  2JCH A;  4ME4 A;  2P7J A;  1NLY A;  5L09 A;  3MZD A;  4E3M A;  3OLO A;  1DP6 A;  4HBU A;  4OPR A;  3UB9 A;  3IXB A;  4EXO A;  1BZA A;  3PTE A;  3C30 A;  4WL9 A;  1FOF A;  2PYP A;  1KDW A;  3UN7 A;  3IT9 A;  3MBZ A;  3EGD C;  5I5L A;  4PMA A;  4EES A;  5KSC A;  4B4Z A;  1M40 A;  1W8Q A;  3V50 A;  2ZQ7 A;  3LR4 A;  3OPH A;  1XJ2 A;  4N9K A;  3LEZ A;  3FZC A;  3NOT C;  1V9Y A;  2OLV A;  3T50 A;  3GQZ A;  3S1Y A;  2ZM2 A;  3ZHH A;  3CI6 A;  4KZA A;  1KGE A;  2V8F A;  3DTE A;  4GNU A;  4G3V A;  2JKT I;  1LHY A;  5J8X A;  2PR5 A;  4YWZ A;  3PBQ A;  4C3Q A;  3IF6 B;  4MEZ A;  2RCX A;  2BTF P;  1OTE A;  4NXE A;  2P74 A;  1ES2 A;  1I2W A;  3FYZ A;  1DP9 A;  1ONG A;  3OCN A;  5CTN A;  1XPB A;  2A3U A;  3LUQ A;  4OQI A;  1YLJ A;  4Q8I A;  5GLB A;  4O7D A;  3LIB A;  1MKM A;  2XGN A;  4WEJ A;  3PBS A;  4KQO A;  1YMS A;  2VJW A;  1ESU A;  3Q7V A;  2QMI A;  1NRJ A;  3V39 A;  5JYO A;  4F94 A;  3D9Y A;  4CLC D;  4G3K A;  1YKD A;  3NJA A;  3VP0 A;  3CPT A;  3NUL A;  4WMC A;  3UE0 A;  4UQI M;  3V3R A;  3UB6 A;  1DJA A;  3C8C A;  3ZQ5 A;  2VX8 A;  2Y2K A;  1LL9 A;  5G4Z A;  4MBF A;  2ZD8 A;  4S2N C;  4FCF A;  4UHU A;  4OPZ A;  1GSW A;  1RP5 A;  3H82 B;  4CQH A;  5M19 A;  1XFN A;  4FOF A;  2ZC7 A;  1OT6 A;  1K54 C;  3N8S A;  4NXF A;  4P6Z S;  3VOL A;  2OV5 A;  1XFQ A;  5CX7 A;  3MKF A;  4DE1 A;  4FH4 A;  2GDN A;  1K4E A;  2QJ5 A;  3UE6 A;  2LB9 A;  1OPX A;  2JBF A;  3GMW A;  4WZ5 C;  4Y5F A;  3EGX C;  1P97 A;  4F3L A;  1T1B A;  3SOI A;  2PD8 A;  2UWX A;  5EVI D;  4KG6 A;  2KDK A;  2DCF A;  1LL8 A;  1Q2Q A;  1ZKJ A;  3Q7Z A;  3LR5 A;  3UDX A;  3ZVW A;  1VET A;  2XA7 S;  3LY4 A;  3PR6 A;  4B4X A;  4OOM A;  2JKR I;  3NBL A;  2Y2N A;  1OTD A;  2ZMA A;  3CAX A;  5EVI C;  3F1N B;  2XR0 A;  1UWP X;  1ZHH B;  1MZU A;  4X53 A;  3CUE C;  3PAE A;  1SDE A;  1P9R A;  4LEN A;  3OBF A;  4PPR A;  1H5X A;  4LLO B;  3VE3 A;  4GJ4 A;  2Q9M A;  1FCM A;  4OQH A;  5HPI A;  1SHV A;  3UMD A;  1OT9 A;  3KO6 A;  1CI8 A;  1WYC A;  3IH8 A;  4Y2F A;  5FAP A;  1YLW A;  2ZC6 B;  3BYD A;  3BFF A;  4ZJ1 A;  1XA1 A;  2WGW B;  4GDN A;  2ZJ9 A;  1VHM A;  1H0M A;  5EEC A;  3T4O A;  4HEF A;  2J3T D;  5F6A A;  4Q0I A;  2G2W A;  2Y2Q A;  1L2S A;  1IYS A;  1FQG A;  1K55 A;  4IUK A;  3VOZ A;  1X0O A;  1FCO A;  1ZC2 A;  4GKU A;  4U3T A;  4MBK A;  2G7U A;  4MLL A;  1VQQ A;  3T4T A;  1S1Z A;  2WUQ A;  5IHV A;  2EX9 A;  4JBF A;  2ZQ9 A;  4MN7 A;  4NG2 A;  4ETZ A;  4UA7 A;  3HLB A;  1RGY A;  3UDI A;  1EWZ A;  1CQA A;  4EEP A;  1PWC A;  5FQJ A;  1NWZ A;  3H7W B;  3RFB A;  4N1X A;  2HDQ A;  1LSW A;  2XLN A;  1XKZ A;  3C7U A;  2J9P A;  1ESI A;  4QB8 A;  4RX2 A;  5A93 A;  4NEE D;  3BEB A;  4DJ2 A;  1L0D A;  2V8C A;  1JTG A;  3C5A A;  1YQS A;  2ZC5 B;  3NI9 A;  4MNR A;  5M1A A;  3WS1 A;  5FEG A;  1YMX A;  2VGJ A;  4Y13 A;  3MQO A;  1EI5 A;  1K56 D;  5J7E A;  3MFD A;  5TJJ A;  4B93 A;  5EUA A;  3OPR A;  3ULF A;  2W27 A;  4P6Z M;  4K91 A;  1ES4 A;  3IF6 A;  1RGZ A;  4PAU A;  2E8J A;  4UA9 A;  5CGS A;  2KLI A;  2C6W B;  4S2P A;  4GB7 A;  4DF6 A;  1IKI A;  4E3J A;  5HPF A;  4B88 A;  2JN7 A;  5EM0 A;  3KX0 X;  3P01 A;  1ERM A;  2G2U A;  4WZ4 A;  3VMA A;  2XA7 M;  3N6I A;  4II7 A;  1H8Y A;  1AXB A;  1FIL A;  1F5M A;  2Y2P A;  1WA9 A;  2Z2M B;  4IVI A;  1GA0 A;  4Y0O A;  3PXP A;  5E2F A;  4S2O A;  3L7H A;  4WEL A;  3KYZ A;  4LCL A;  4OPQ A;  5EPH A;  2Y91 A;  3T1R A;  1IYQ A;  2X01 A;  1KVM A;  1PYY A;  2JKG A;  2PT7 A;  4MDZ A;  1OTB A;  2VGL S;  4OON A;  3W2Z A;  3H82 A;  4GS9 B;  3W4O A;  5CRF A;  2W1T B;  3MXQ A;  1SKF A;  5FL3 A;  2VK3 A;  4Q0J A;  2Y2M A;  2NUP C;  1K25 A;  5JYP A;  3KYQ A;  1O07 A;  1E3U D;  5DKK A;  1NXY A;  4H8R A;  1OME A;  2KX6 A;  3WS4 A;  1IEM A;  2W1R A;  4ZJ3 A;  5A8B A;  2HJ9 C;  3MR0 A;  3A3J A;  3K3D A;  4HH3 A;  4QHC A;  4I3A A;  4JGQ A;  3TE8 A;  5GLD A;  1G28 A;  4RQ9 A;  1P0Z A;  2XD1 A;  4MBH A;  3F1N A;  4QWO A;  3SS3 A;  2R9X A;  1XJ3 A;  5HDC A;  4ZJ2 A;  3FG8 A;  4S2M A;  4XXR A;  3B3X A;  3S7P A;  4Y0U A;  4GCZ A;  3SH8 A;  1KVL A;  2J8Y A;  3EEH A;  4E3K A;  1CK3 A;  5CXW A;  3PBT A;  3FKV A;  3BQA A;  3LI8 A;  5E43 A;  5DFX A;  4BL3 A;  5M18 A;  5CEB A;  2HP6 A;  4S2N A;  4XT2 A;  3BFE A;  3EQV A;  2HV1 A;  2XSS A;  1K55 C;  3A0S A;  1LLB A;  1K54 A;  2GX5 A;  3LR0 A;  1V9Z A;  3QP4 A;  2IWB A;  1I2S A;  4K0X A;  5FAS A;  2WGW A;  1YSQ A;  5DF7 A;  5KSH A;  3HLF A;  4WZ5 A;  4YNR A;  3V5M A;  1TDL A;  5D3O A;  3ZDJ A;  1MWU A;  4UQI S;  3S7N A;  5FQM A;  3N8R A;  2XD5 A;  3SS4 A;  4FD8 A;  4KQR A;  2LB5 A;  2NUT C;  1OJ5 A;  3ICY A;  2KOI A;  1S4S A;  3ITB A;  2QZ6 A;  2JKF A;  3MQ0 A;  3HUO A;  1PWG A;  1UGU A;  3DWZ A;  5F83 A;  1BLS A;  4GN2 A;  4HES A;  5EVI A;  1MWS A;  2HDU A;  1C3B A;  1YLT A;  2V20 A;  1VEU A;  5AVF A;  2GZA A;  3CUE A;  4I38 A;  1FSW A;  3OCL A;  5GHX A;  3RJU A;  5HL1 A;  3EOI A;  2ZQC A;  3BEC A;  1S6R A;  3IWI A;  4I3I A;  1PI4 A;  1ERO A;  3H7W A;  2VLG A;  5FAO A;  3V67 A;  5FDS A;  2J80 A;  1HLU P;  4LPZ A;  3UNW A;  3CZD A;  3DW0 A;  5E2E A;  5FA7 A;  5KMW A;  5L10 A;  4YIN A;  4X25 A;  1TD5 A;  2XRO A;  3MQQ A;  4GD6 A;  1GHI A;  2WAE A;  5F1G A;  1ZG4 A;  5CHU A;  3BQ8 A;  3VSK A;  4CLC E;  3RXW A;  2VGL M;  1WE4 A;  3U4L P;  3TRC A;  3WS5 A;  2WAF A;  3BFG A;  4X69 A;  4WM9 A;  5G4Y A;  1ALQ A;  1PRQ A;  1K6S A;  4KQD A;  3LO7 A;  5DF9 A;  4GDB A;  3BY9 A;  1DJB A;  1XGI A;  2H0T A;  4RA7 A;  4HJ4 A;  4EBN A;  3T4L A;  3KSF A;  2D01 A;  5HW3 A;  5HL6 A;  3VOY A;  1S66 L;  3QNB A;  2EXA A;  1K38 A;  5IS1 A;  2W3H A;  1XJ4 A;  3GV9 A;  3IXH A;  4R1G A;  1LI0 A;  3GEC A;  2K2N A;  4EU0 A;  3RXX A;  2O0Y A;  4KEN B;  1N9B A;  3KSI A;  4X1L A;  1MKI A;  3ZFZ A;  3W8K A;  4E3N A;  3M6B A;  2XK1 A;  4R3B A;  4LRY C;  1MC0 A;  4EQ1 A;  3R7W B;  1BLP A;  1W7F A;  2JE5 A;  4GS9 A;  2XFS A;  4NXG A;  1XP4 A;  1JVJ A;  2FFF B;  2W1T A;  3NHQ A;  2GNX A;  3G6O A;  2Z6D A;  2ZBB A;  3M6H A;  3LIF A;  4KZ8 A;  2Y59 A;  5AQ7 A;  5DTT A;  3UB8 A;  1BLC A;  2QYB A;  1ZTU A;  3M2J A;  2ACG A;  1EW0 A;  2QPN A;  1IYO A;  4DDS A;  1FR6 A;  1LSX A;  4FH2 A;  2K7S A;  4GHI B;  5DVA A;  3LIE A;  4QD4 A;  2FZ0 A;  3VP3 A;  1T1C A;  3IQA A;  4CLC C;  4X6T A;  1GHP A;  5HX9 A;  3ZYT A;  4U0T A;  2B18 A;  5TFQ A;  2JHE A;  2VEA A;  1LT0 A;  2Y79 A;  4M4X A;  3BWL A;  4QY6 A;  5DFY A;  4ARZ B;  1N4O A;  2B02 A;  1QMF A;  1KDS A;  2HF6 A;  1DRM A;  3ISG A;  2Y2G A;  5GHY A;  2PBY A;  3MZF A;  3HLD A;  4IED A;  3Q07 A;  4M3K A;  4RYE A;  3UDF A;  1PW8 A;  1S4R A;  3IXD A;  3IX8 A;  4GLQ A;  1M6K A;  2OWH A;  3QP2 A;  3T4S A;  3N8L A;  4PHT A;  2IWC A;  1LI9 A;  1QME A;  2YKF A;  4UA6 A;  1F2K A;  4PKY A;  1DY6 A;  2DMW A;  3F1P B;  3LY3 A;  3VP2 A;  3LR3 A;  3DWK A;  3VSL A;  4BBT A;  1NY0 A;  5AQ9 A;  1LSV A;  3BLM A;  2V1B A;  2B5R A;  5HFO A;  5U47 A;  1ES3 A;  4JKT A;  1E3U A;  2PHY A;  2V1A A;  5HSQ A;  1YPR A;  2Y2L A;  4IVK A;  3IXG A;  4BD1 A;  1JNU A;  2ZMF A;  4CLC B;  5HDS A;  2ZM0 A;  4XT2 B;  3HJI A;  1KE4 A;  3NEC A;  2BLS A;  5CHM A;  3S7O A;  3PBO A;  1L0F A;  4QPR A;  2AVX A;  1PI5 A;  1Z6F A;  2OSU A;  3JVU A;  5G18 A;  3W4Q A;  3Q82 A;  1NJ4 A;  3Q1F A;  2IA2 A;  3FKW A;  4K0W A;  4S2K A;  1DJC A;  3C38 A;  2P9V B;  1OTI A;  1HZO A;  4UEY A;  2INW A;  3LID A;  1GHM A;  4Q0H A;  2J7V A;  3MZE A;  1YM1 A;  2ZL1 B;  2J3T C;  2OWJ A;  4KG2 A;  1CEG A;  5I94 A;  1DP8 A;  5EVI B;  3VFF A;  1VEU B;  4JXS A;  3GTC A;  3FPW A;  5MC7 A;  3FPV A;  5FQQ A;  4ZRR A;  1TS7 A;  4DKI A;  3MJQ A;  3D4F A;  4HIA A;  3WWX A;  3QHY A;  5DKL A;  2YKH A;  2W3E A;  3HLE A;  3IBR A;  5HD3 A;  1MPL A;  4DJ3 A;  2A49 A;  4EWF A;  3G4P A;  3P98 A;  1J3W A;  3BRM A;  4FTX A;  4JF6 A;  5EE8 A;  4EV4 A;  4IBR A;  3G34 A;  5DTK A;  3KYE A;  4D2O A;  1YAX A;  4N92 A;  2A2L A;  5LBR A;  1BUE A;  2DNS A;  4BBU A;  2O9C A;  4CJN A;  5CGX A;  4RVA A;  3ZGA B;  4GZB A;  4ETX A;  2WZX A;  4NKP A;  3FWL A;  3WS0 A;  4EQI A;  4QU3 A;  2QKP A;  2W3D A;  4U0X A;  2IWD A;  1K4F A;  3R7W A;  4LFU A;  4DE3 A;  4ESP A;  4WMC D;  4EEU A;  3R4K A;  2W3G A;  1WYB A;  4N9L A;  3I7J A;  3C7V A;  3O86 A;  4JXG A;  2ZOI A;  3CMZ A;  5CED A;  4MMN A;  3NC8 A;  2ZC4 B;  3D72 A;  4C6Y A;  4GHI A;  2HZ5 A;  1BYW A;  3T1Q B;  2PBD P;  2VV6 A;  2L1M A;  4JGO A;  5F5Y A;  3PBR A;  1JWV A;  3U2A A;  1TDG A;  4DDY A;  5FQ9 A;  2BAS A;  2EX2 A;  2X02 A;  4LRX C;  3IHB A;  3A3E A;  4MN6 A;  3NIA A;  1G6A A;  4OQG A;  1IOU A;  3IH9 A;  4ZTK A;  4ARZ A;  2V2F F;  1MY8 A;  1N9N A;  3DTI A;  4X56 A;  2Y2O A;  5L2F A;  3NY4 A;  1W79 A;  2M7U A;  3P09 A;  2EXB A;  2L4R A;  2ZMV A;  4HOI A;  4KG5 A;  4OPY A;  2XRN A;  4HJ3 A;  3KSG A;  2H5S A;  1SKO B;  4HBT A;  1NRF A;  1S1Y A;  3ZNT A;  2C5W B;  4IHQ A;  2PD7 A;  3ZVT A;  3SH9 A;  4R4S A;  1ONH A;  5HAQ A;  2Q0O A;  2PAV P;  4EER A;  3F1P A;  5HAP A;  3ZG9 B;  4JXW A;  5CHJ A;  2VGK A;  4Y17 A;  2GJ3 A;  4CPK A;  4KQQ A;  2WZZ A;  1W8Y A;  4DN0 A;  3JVV A;  4HH2 A;  3W4P A;  4CLC A;  3IX3 A;  4WEK A;  3S7Q A;  1MBL A;  1KOU A;  1T19 A;  4P6B A;  3MF0 A;  3UE3 A;  3OOV A;  5HDD A;  4DE2 A;  3H9W A;  4BEN A;  3IWQ A;  2W0N A;  5GHZ A;  4X55 A;  2PRF A;  3ZG7 B;  2OAQ 1;  1K57 C;  1N9O A;  5J4E A;  2P9V A;  1MWT A;  4DXB A;  1BT5 A;  3GVB A;  2RL3 A;  3TOI A;  5AQA A;  3CJM A;  5F69 A;  3G32 A;  5CER A;  1VM1 A;  5F68 A;  4KZ4 A;  3G31 A;  3HLW A;  5AQB A;  2ZL1 A;  4E3I A;  3QP1 A;  4L9G A;  3TW8 A;  3HCY A;  1KE0 A;  3V3S A;  2QJ7 A;  4Y15 A;  5F1F A;  2Y4A A;  1PFL A;  5F82 A;  3PBN A;  4DMZ A;  4P0M A;  1OJG A;  5K5B A;  1BUL A;  2D02 A;  4E3L A;  1NYM A;  2K31 A;  3KSH A;  2V9A A;  4E6X A;  3L9K A;  3UB7 A;  2PYR A;  4S2L A;  4OP5 A;  1ZG6 A;  3K3C A;  2Y2H A;  4PM7 A;  2WK0 A;  2Y55 A;  4OOL A;  1XGJ A;  4NK3 A;  1ODV A;  3BFC A;  2OOL A;  2HP5 A;  5TR7 A;  4KUO A;  3BLS A;  2PU4 A;  4WBG A;  3RH8 B;  3CWF A;  2EFX A;  2Z2L B;  5EVL A;  4QY5 A;  5BOH A;  3OC2 A;  3N4I A;  2ZM8 A;  4ID4 A;  1TS6 A;  4BL2 A;  4EUV A;  3P7N A;  1BTL A;  5DJU A;  1TF1 A;  2WKI A;  5FAT A;  5HWV A;  2ZOH A;  5KZH A;  3QP8 A;  3LIA A;  2M1C A;  4KZB A;  2UV0 E;  3OPL A;  2FH5 A;  3C4P A;  3SH7 A;  2HGV A;  3G2Y A;  3UME A;  3IX4 A;  3N7W A;  3PHY A;  2BG1 A;  1YSP A;  3BFD A;  2OAP 1;  3IBJ A;  1PZP A;  3EWK A;  2PU2 A;  2J9O A;  5J3W A;  2Q9N A;  4G3W A;  4EET B;  3LI9 A;  1E4D A;  1OTA A;  2R78 A;  2WKR A;  5EOO A;  2WGV A;  2VKS A;  4RX3 A;  3JPU A;  1HVB A;  1SCW A;  4EBP A;  4LV2 A;  5DF8 A;  2Y8H A;  1MXO A;  1PIO A;  2W3F A;  2H0Y A;  5E2H A;  2ZC3 B;  1KGG A;  3SS5 A;  3B47 A;  3MXR A;  4R23 A;  4L9E A;  3B33 A;  5A91 A;  3IHA A;  2XF3 A;  4HP4 A;  3DTK A;  4PKY G;  3UPO A;  3C2W A;  3HJK A;  4LV1 A;  1JTD A;  2ZQ8 A;  1FIK A;  5EFW A;  4LV0 A;  4Y3I A;  5FDH A;  2V0U A;  1K56 A;  3VV4 A;  3LYX A;  3WRT A;  3E98 A;  5FSR A;  1HD8 A;  3ITA A;  5HAI A;  1XA7 A;  3VP4 A;  3OPP A;  1SKO A;  4P85 A;  5HD5 A;  1H3Q A;  4B9O A;  1XXM A;  1YT4 A;  4HNB A;  4OLD A;  1SZV A;  3MSH A;  3HVF A;  3UE1 A;  4WN5 A;  4IJG A;  1FCN A;  4WUJ A;  1F98 A;  1GSX A;  4K08 A;  1D06 A;  3HUM A;  5TBM B;  4JPM A;  3BY8 A;  4OOY A;  2FFY A;  4O0P A;  5IU1 A;  1ACF A;  4KZ7 A;  3HUN A;  3CG5 A;  4HP9 A;  1NYY A;  1TS0 A;  5EM1 A;  5DJT A;  5CTM A;  5FI7 A;  3UPP A;  4C75 A;  1TS8 A;  4ZBE A;  4KZ5 A;  1XX2 A;  2A24 B;  3BJN A;  5GLA A;  4E6W A;  4OH0 A;  2O9B A;  4NXB A;  1PZO A;  1FR1 A;  4OQ0 A;  3M2K A;  2L0W A;  4R3A A;  2P04 A;  2OLU A;  3PAG A;  5FI6 A;  1SDN A;  1H8Z A;  3OZH A;  3WS2 A;  4LRZ E;  3E0Y A;  4X1M A;  1FSY A;  1IYP A;  3E4O A;  4GW9 A;  3F1O B;  4BBV A;  4H6J B;  4R70 A;  1G6O A;  3PYP A;  2WKE A;  5EOE A;  1D1J A;  3NOP C;  3NOU C;  4LV3 A;  2VZW A;  1N9L A;  5A90 A;  3UO9 A;  4N1H A;  3C4O A;  5A92 A;  1NLZ A;  4ZDX A;  1L0E A;  2HDR A;  2E8I A;  1TVF A;  2JKT M;  4IBX A;  4S2J A;  4Z9Q A;  3MS6 A;  1XJ6 A;  1JWZ A;  4MN5 A;  4PM8 A;  4E3O A;  2CMN A;  1PNE A;  1STZ A;  2PR6 A;  4WYY A;  4YOF A;  5GL9 A;  1T18 A;  1K57 A;  3GDI A;  4X68 A;  1Y28 A;  2O9A A;  2VV7 A;  4DE0 A;  3LFV A;  1W63 M;  1YLY A;  4L0L A;  3S22 A;  3LIC A;  4JGP A;  3T12 B;  2H10 A;  1ES5 A;  5CEC A;  1CEF A;  3T1S A;  3GR2 A;  2XDM A;  3E2K A;  3LEQ A;  2WAD A;  3G2Z A;  3TSG A;  2MJ6 A;  2XQZ A;  1Y4O A;  5IT5 A;  2V1Z A;  3UB5 P;  1W5D A;  3LCE A;  3UY6 A;  4D60 A;  4LCM A;  2I9V A;  2WGI A;  4XUZ A; 
#chains in the Genus database with same CATH homology
 3L9K A;  5FEF A;  3U4L P;  1FIL A;  1G5U A;  2PAV P;  1CJF A;  1PRQ A;  4FUW A;  3L7H A;  4X1M A;  1FIK A;  4ESP A;  2V8F A;  1Z09 A;  1D1J A;  3T1R A;  1CQA A;  1VET A;  2JKG A;  2BTF P;  2ZL1 B;  3CPT B;  2B95 A;  1SKO A;  2VK3 A;  1SZV A;  2JKF A;  3MSH A;  1VEU B;  2HZ5 A;  3T1Q B;  2PBD P;  1A0K A;  3LGO A;  1CF0 A;  2V8C A;  2PRF A;  3MS6 A;  3T1X A;  4X1L A;  1VEU A;  5FEG A;  3DAV A;  1PNE A;  1F2K A;  1AWI A;  3D9Y A;  2ZL1 A;  3CPT A;  2E8J A;  1ACF A;  3NUL A;  5FDS A;  1K0K A;  1PFL A;  3T12 B;  1YPR A;  1HLU P;  4QWO A;  5EM1 A;  5EV0 A;  3T1S A;  1J3W A;  4FTX A;  3LEQ A;  1VET B;  4X25 A;  1Y4O A;  3KYE A;  5EM0 A;  3UB5 P;  3NEC A;  4D60 A;  1SKO B;  5EVE A;  3CHW P;  2ACG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...