3T1SA

Mglb homodimer
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
133
structure length
133
Chain Sequence
SLVLYGAPYERAVEVLEETLRETGARYALLIDRKGFVLAHKEALWAPKPPPLDTLATLVASNAAATQALAKLLGEARFQEEVHQGERMGLYVDEAGEHALLVLVFDETAPLGKVKLHGKRAAEALARIAEEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gliding protein MglB
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Signaling protein
total genus 39
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3t1sA00
4FTXA 1AWIA 2V8CA 2PRFA 3U4LP 5FEFA 2VK3A 4X25A 1SZVA 1HLUP 5EM1A 3MS6A 2JKFA 1Z09A 1G5UA 5EM0A 4D60A 3MSHA 3KYEA 3NECA 3T1SA 1A0KA 1PNEA 3UB5P 3D9YA 3DAVA 5EVEA 1J3WA 1VEUB 3T1QB 4ESPA 3LGOA 3T1RA 3NULA 1PFLA 2ACGA 2ZL1B 1VEUA 1CJFA 3CPTA 2ZL1A 4X1MA 1YPRA 1K0KA 3LEQA 5FEGA 1CF0A 2PAVP 2V8FA 3L9KA 1PRQA 1FILA 5FDSA 4QWOA 2JKGA 5EV0A 1F2KA 1SKOA 1D1JA 3T1XA 1VETB 4FUWA 2B95A 3T12B 3CPTB 2PBDP 1CQAA 2HZ5A 1ACFA 1VETA 3L7HA 1SKOB 3CHWP 1Y4OA 4X1LA 1FIKA 2BTFP 2E8JA
chains in the Genus database with same CATH superfamily
4FTXA 2L1MA 3KYZA 1MC0A 4PKYA 2HJ9C 2XDMA 4XUXA 1OJ5A 2WGVA 5E2FA 3UDFA 3LICA 1IOUA 2QJ7A 3LIEA 3A3FA 2ZMFA 4LENA 1PIOA 2FFFB 4LRZE 2EWVA 3TRCA 1OT6A 3MQOA 2WZXA 4EWFA 3UDIA 3NECA 3E2LA 4KZAA 1XJ3A 3VP4A 3T4QA 4ID4A 4B4XA 3UPNA 4LRYC 1YMXA 4H8RA 1BULA 2WYXA 4P6ZS 5DJUA 3QNCA 1KGEA 4Y3IA 1NLYA 1MKIA 2V20A 2P9VB 1O07A 4S2MA 1MWUA 3EWKA 1CF0A 2Y91A 3HREA 4BD0A 4PM5A 3LUQA 3IHAA 5KSHA 4KZ9A 3M2KA 4I3AA 1BLCA 1T1BA 2HDRA 3HJKA 4HY8A 1XJ2A 4UA6A 2GX5A 2PR6A 4U0TA 5TBMB 3IF6B 4ARZA 3BFEA 1LT0A 4NXFA 3NOPC 2JKTI 1LLBA 3QNBA 5A93A 1JWVA 3Q07A 2J3TC 1P9WA 4EXOA 2ZQCA 4GOGA 1ES5A 4ZJ1A 3OPHA 1CEFA 3VP3A 5FAPA 4PPRA 1SCWA 3N8SA 1YLYA 3BY9A 4EU0A 5HDSA 5EVIC 5I5LA 4BBUA 2QJ5A 5IS1A 4GS9A 2EA9A 1H0MA 5D3OA 2IWCA 2H28A 2O99A 3UE1A 1L2SA 2J80A 4S2NA 3M2JA 4BL3A 4P6BA 4B4ZA 4KZ4A 2KDKA 1XFNA 5LBRA 4HNBA 3LCEA 1NYMA 2E8IA 1GSXA 3GMWA 1GHPA 1NZUA 1NZOA 5F1GA 3T4KA 2C6WB 5HPIA 4HP4A 1FCNA 4EV4A 1TDGA 3C8CA 1XFQA 3C7VA 3LIAA 3SZTA 4ZDXA 4ETXA 1Y28A 4MN7A 4ZBEA 4X1MA 3PBOA 3SH8A 1YSPA 3CI6A 1EROA 3SH7A 1LSWA 3EOIA 2ZQ8A 1S0WA 3S1YA 5CXWA 4N9LA 2UV0E 3MKFA 4DF6A 1VETB 1W5DA 2Y2HA 3PBNA 3OZHA 4K0WA 4GW9A 1MPLA 2HZ5A 2W27A 4K0XA 5FQMA 2GJ3A 3IS2B 3ZNTA 2HPBA 4EBNA 2ZQ7A 1VQQA 3L7HA 1YM1A 3SS5A 2I72A 5E2HA 1FIKA 1TVFA 2PDRA 5J4EA 2XFSA 3CLOA 1IEMA 3UE6A 1SHVA 5J7EA 3IBRA 1XGJA 4WZ5C 3LI9A 1SZVA 1SDEA 3MZDA 2FFYA 2DRWA 1UWPX 3F1PB 4IVKA 5EFWA 3WS0A 3FPVA 2Y55A 3E4QA 1J9MA 4C3QA 3WS4A 1YLWA 3WS1A 5CGSA 4QHCA 5TJJA 3I7JA 2PR5A 3D9YA 2PD8A 1J3WA 2VGLS 1VEUB 1DJAA 4RX3A 2W3EA 3VMAA 3UPOA 5HWTA 2C5WB 3S22A 3P7NA 1SDNA 4JLFA 4Y7PA 4B93A 1YLZA 1AXBA 1KVMA 2VGJA 1ONGA 5HSQA 1RCJA 1W8QA 3HLWA 1ERMA 4S2IA 5HZHA 1JTDA 2Q9NA 4WEJA 3E2KA 1YLJA 2VEAA 3ZNYA 1DP6A 2XGNA 4E3KA 4LCMA 1XJ6A 4Q0HA 5IU1A 4S2JA 5DKLA 2K7SA 1N9BA 2OSUA 3VOYA 3LR0A 1TS8A 1TEMA 4HJ6A 3H82A 4MBKA 4KG2A 5DFYA 2FZ0A 4P6ZM 2L4RA 2PRFA 2M1CA 2D02A 4GDNA 4RQ9A 1XJ4A 5EM1A 2VA0A 3NDEA 1M40A 4IUHA 4H6JA 1XA7A 2XF3A 1ES3A 1BYWA 5EM0A 3GDIA 5FI7A 3IXBA 3FKWA 1V9ZA 1K57C 3OBFA 5TFQA 2EX9A 4OVDA 3RFBA 4AFIA 3TW8A 3T1QB 2EWWA 3FKVA 2EX2A 5EVIA 1TS6A 1FR1A 1PFLA 3IX8A 3B3XA 1STZA 2EXBA 3PXPA 4DDSA 3MXRA 4JXGA 4X68A 3Q7ZA 1QMFA 2XROA 2JKRM 3SS4A 1W63Q 3LEQA 1ERQA 2V8FA 3L9KA 2ZMVA 2J3TD 4U0XA 1L0GA 4IUKA 3BECA 4QU3A 3MXQA 2R78A 3K2NA 5FQ9A 5AVEA 1KE3A 3CPTB 3WS2A 1ES2A 1CI8A 4HOIA 3NCKA 3HUNA 1G6OA 3TJZC 2W1RA 2ZC3B 5DTSA 3CHWP 5EVID 1XP4A 4Y0TA 4NETA 3W8KA 3DTMA 1H3QA 1AWIA 3M6BA 1IYPA 3KX0X 1FSYA 2JKTM 3U4LP 1IYSA 4Y0UA 3LYXA 3P01A 3LY3A 4EQIA 4GHIA 3ICYA 3ZVTA 3PTEA 2WGWB 3PBTA 3MS6A 3H7WB 3MFXA 3E4PA 1Z09A 4BL2A 2VV7A 2QMIA 3ZVWA 1I5QA 4JXVA 1W8YA 2PD7A 2V0WA 2XK1A 4LV3A 4YNRA 3R7WB 3UO9A 3CG5A 2X71A 2Z6DA 5EOEA 4RVAA 1F5MA 2W3DA 1IELA 4WZ5A 1IYQA 4HI4A 1IKGA 4ZJ2A 1C3BA 4WMCA 2Y59A 5FDHA 4DXBA 1XX2A 3LGOA 4BQMA 2DMWA 3T1RA 4DRTA 4QJGA 4KQDA 2Y79A 1YAXA 2W1TB 5TR7A 2H0TA 3A0VA 5KIZA 2ZJ9A 1MKMA 1KGFA 2ZL1A 1K0KA 3WRZA 1N9NA 4BD1A 4YWZA 4QWOA 5AQ7A 2PU4A 4O0PA 5EV0A 3KO6A 2JN7A 5HFOA 5BOHA 3NY4A 2J9PA 3IX4A 3DWZA 1ZHHB 4XUZA 2G7UA 1K4FA 4WMCD 3D4FA 3IBJA 3W2ZA 4Z9QA 3PBRA 3MZFA 4IBRA 4F3LA 5FQIA 4S2PA 2P04A 4E6WA 2QKPA 3OPLA 2JC7A 3EQVA 2OWJA 3UE3A 2FH5A 1UGUA 2OOLA 4KQQA 1FR6A 4S2LA 4OH0A 2G2UA 4C6YA 1OT9A 3HCYA 4WLAA 4G3KA 5G4YA 5HD5A 4BBVA 3BLMA 3V3RA 2KLIA 5FA7A 2EXAA 3O87A 2KOIA 3IHBA 4R1GA 1T19A 5CEDA 2R9XA 4R0QA 3LR5A 4HESA 4R38A 1MWTA 1PWCA 3BQAA 5DF9A 1X0OA 4EUZA 2ZC7A 5A8BA 4WM9A 3FPWA 4OQIA 4HIAA 3ZG0A 1K57A 1K6RA 3O3VA 1IFQA 3LEZA 2H5SA 5GLCA 1LSXA 3GTCA 1YPRA 2A24B 1VHMA 2VLGA 4WF0A 3PBSA 1OMEA 1SKOA 3T1XA 2WKHA 4KG5A 5KSCA 1GSWA 4ARZB 1LI0A 4NXBA 4IEDA 1BTLA 2VJWA 1ZKJA 3JVUA 3RXWA 2PBDP 1W7FA 1L0EA 5HWVA 2EX8A 2XR0A 4DE0A 3H9WA 4DE2A 1GCEA 2Q0OA 3MZEA 1JNUA 4KZBA 1WYBA 4LPZA 1ODVA 5J3WA 5I94A 4S2KA 2VK3A 2V1ZA 2XLNA 3UN7A 3LR4A 4GS9B 4E3LA 3JVVA 3CJMA 1YLTA 1K6SA 3RTYA 4OKPA 3OCLA 2OV5A 1MWRA 5CEBA 5A91A 3NC8A 4PAUA 4I38A 3MKEA 4EETB 4GLQA 1DP9A 4PM7A 4KZ7A 3BYDA 3MF0A 3EEAA 1L0DA 2HP5A 5FL3A 3T4OA 1CK3A 2XRNA 2ZM2A 1HZOA 4CQHA 4JBFA 1GHIA 4GNUA 3UB9A 2QWSA 3DTKA 5E43A 4LLOB 4ME4A 2QYBA 2HV1A 3ZYTA 2Y2LA 5FDSA 2P08A 5K5BA 4MEZA 3V39A 3FV7A 1O7EA 4GN2A 2JBFA 3SS3A 3U2AA 1K4EA 4FD8A 2B18A 3S7OA 1OPXA 3DWKA 3UE0A 5EOOA 3ULFA 2E8JA 1K55C 2KX6A 3O88A 1PZPA 4IBXA 4R23A 4GJ4A 1LI9A 4EUVA 1E3UA 4KUOA 3UY6A 5AQBA 2B5RA 5C5KA 3BFGA 3IT9A 3G4PA 1ZG4A 5KZHA 4UQIM 1T1CA 3E0YA 4OPRA 1ZTUA 3VSLA 4D60A 3EGXC 4JF5A 5AJGA 3G35A 2YKFA 3NIAA 3BRMA 1S1YA 5IT5A 3SOIA 4CJNA 2IA2A 3GVBA 4ZTKA 2WKEA 2HP9A 4R3BA 4BJPA 4X6TA 5DJTA 2R9WA 4PM8A 1PZOA 4E3IA 3NULA 1KE4A 3N7WA 4K08A 3C5AA 1E3UD 2ZC4B 2VKSA 2P7JA 2Z2MB 5F6AA 5FAOA 3KYQA 2RL3A 5FEGA 3N8RA 2PAVP 4CLCB 1VB6A 1CI9A 3G2YA 1D06A 4DDYA 2XEPA 3OOVA 2X02A 5L2FA 4FUWA 3NBLA 3T12B 3CMZA 4DE1A 2A3UA 1NRJA 1RGZA 1BSGA 4R3JA 4U3TA 4OOLA 5F68A 1NYYA 4Q0IA 5EUAA 4K91A 1I2SA 3B33A 3H82B 4EESA 2VGKA 4MLLA 3KSHA 1Y4OA 5CGXA 3K3CA 4YOFA 4E3MA 3PYPA 1D7EA 5JYOA 5GHXA 5CX7A 3NOUC 4KZ3A 2JHEA 5G4ZA 3F1PA 2ZD8A 1G6AA 4H6JB 5A90A 2M7UA 4MBHA 4R3AA 1HLUP 2PYPA 4OOYA 3FZCA 2JKFA 3N4IA 3C4PA 5HAIA 4X55A 1MWSA 1XA1A 3UDXA 4CPKA 5HAQA 2OLUA 1TS7A 2PU2A 2ZLYA 2IWBA 3IWIA 2V1AA 1TF1A 2ZOHA 3V67A 1H8MA 1JTGA 5CGWA 1QMEA 5EVIB 3HUOA 4NXEA 3HLFA 1P97A 3GSGA 1DRMA 2ZQ9A 1RP5A 3IWQA 2Q9MA 5JYPA 5DFXA 1U60A 2HP6A 3CWFA 4KZ8A 2HDSA 2V9AA 2Y2OA 3A0RA 1G68A 5GLDA 3SH9A 1FQGA 3PR6A 4JGOA 3PHYA 5FAQA 1LL8A 1N9LA 5FATA 4HH3A 3HLGA 2JKGA 2NUTC 1FCMA 2O0YA 4OPYA 3HUMA 5AQ9A 1FCOA 4Y2FA 3T4LA 4HH2A 1RGYA 3WWXA 2MJ6A 3RJUA 4LRXC 1Y54A 1S4SA 3G2ZA 1K54C 1T1AA 4BWIA 3DTIA 3VOLA 2UWXA 3F1NA 3TG9A 1S66L 3BY8A 3F1OA 4OPZA 3W4PA 3C38A 1PWDA 3G32A 3G34A 3VSKA 4IHQA 2H0YA 4GHIB 1PW1A 3Q82A 4UA7A 4JGPA 4WBGA 1TS0A 4HHDA 3OLOA 1BT5A 3Q7VA 4Q8IA 1YSQA 2WAEA 3IF5A 2WUQA 5M1AA 4D2OA 4X53A 4E3NA 4FH4A 4Y17A 1K55A 1ESIA 1KDSA 2XSSA 3V50A 5E2EA 1LSVA 3RH8B 1PI4A 3UB7A 1DP8A 1XPBA 3UNWA 4P85A 2IWDA 1E4DA 4MNRA 3AGEA 3MFDA 2O9CA 3BM6A 1NXYA 1EI5A 2ZL1B 4C75A 1BUEA 2PBYA 2VZWA 3GRJA 1PYYA 4EBLA 3CPTA 3VFFA 5A92A 3S4XA 3T4JA 3HLBA 4PKYG 2W3HA 5HDCA 3IF6C 3QP6A 3A3EA 2D01A 5F83A 1DY6A 1KGGA 3BFCA 4N92A 1OTEA 5EE8A 5EECA 4X69A 2ZMAA 4OLGA 4BMWA 4F3LB 5FSRA 5TGFA 2WGIA 1S4RA 5CRFA 1IYOA 4BLMA 5F82A 3IXDA 2PYRA 4OQHA 5AVFA 4X1LA 2W3GA 2ZM0A 3C30A 3S7PA 5FASA 1M6KA 4II7A 4UA9A 4OLDA 4GZBA 2BG1A 2RCXA 3QP4A 4KZ5A 4DJ3A 1ZC2A 2Y2PA 3CITA 3R4KA 2ZBBA 3VP0A 4LV1A 3P09A 3TOIA 1K38A 2VGLM 1P9RA 4ZJ3A 3G6OA 4CLCE 5CECA 1GSVA 5DTTA 5HW3A 5F1FA 5HDDA 5U47A 4G3VA 1GHMA 1XGIA 2PT7A 2W1TA 3VE3A 3B47A 5L8MA 4L0LA 1A0KA 2L0WA 3V5MA 4XT2A 5G18A 1L0FA 1ES4A 1OTDA 3HLCA 3ZG9B 3OPPA 3ISGA 3BEBA 5DVAA 3NI9A 1W79A 4P0MA 4YFMA 2Z6CA 2CC1A 4O7DA 1H8YA 1EWZA 2I9VA 4WYYA 1EW0A 3A3JA 1Q2QA 1DJCA 5L10A 4KENB 1FILA 3A3DA 1KDWA 3W4OA 3IH8A 3IX3A 3QP2A 4NKPA 2VX8A 4NXGA 4NEED 3MR0A 4RYEA 5CHMA 4Y15A 3LIDA 1LL5A 4O01A 3GR2A 1BLSA 2O9BA 1P0ZA 4OP5A 4E3OA 3VP1A 4N1XA 4LV0A 1FOFA 2Y2GA 3JPUA 3ZCZA 3QP8A 2B02A 5M19A 3Q81A 4MBFA 3TSGA 3UMDA 4GCZA 3PBQA 4OPQA 1K54A 3KSFA 2X01A 1ONHA 3N6IA 2JKRI 4WL9A 4CLCC 1HVBA 2JE5A 3K3DA 3GECA 3IH9A 1OTIA 3ZG5A 3MSHA 4FOFA 3UMEA 3W4QA 3HLDA 5DF8A 2Y2IA 3EEHA 2LB9A 1ALQA 2V1BA 5FI6A 3E4OA 4FCFA 2A2LA 2A24A 1GA0A 5GL9A 3S7QA 1TD5A 2G2WA 5HX9A 1WYCA 4Y0OA 4LCLA 4DJ2A 4DMZA 4MDZA 5IHVA 4WEKA 5MC7A 3IXHA 3LI8A 1PRQA 1PWGA 2P9VA 3KSGA 4HBTA 3GQZA 1BZAA 2WK0A 3D72A 1D1JA 2J9OA 1JWPA 3VOZA 1GA9A 1Z6FA 2BLSA 4QD4A 3C7UA 4MN6A 1ACFA 2QPNA 2Y2NA 4I5SA 5M18A 2GZAA 2XQZA 3ITAA 2OWHA 1OJGA 3ITBA 3DBAA 2Y2QA 2WAFA 5TBMA 2Y2MA 3IF6A 5HARA 2BTFP 3FYZA 3LIBA 3EGDC 3B42A 4I39A 1TDLA 2XFTA 2V8CA 1NRFA 3WS5A 4M4XA 4EQ1A 3ZHHA 4KG6A 3HJIA 2XD5A 4F94A 2J7VA 1YT4A 3JYIA 3MXSA 4BBTA 5DTKA 2CMNA 4S2OA 2Y2KA 3LR3A 2J3WA 4WELA 1HD8A 2J8YA 4BENA 4X56A 3BQ8A 2INWA 2Y2JA 4NG2A 4O8GA 1K25A 3ZFZA 3HL9A 3MQ0A 2ZOIA 1H8ZA 3BJNA 1WE4A 3T1SA 3EQUA 5EVEA 2WKQA 3QP5A 5GHZA 4JPMA 1LL9A 1XKZA 3OC2A 2OLVA 1CJFA 5FQKA 4LFUA 4B88A 3BFFA 4HJ4A 3LY4A 4MN5A 1ZG6A 1MXOA 1MZUA 3CZDA 2XA7S 4E04A 3BFDA 3QP1A 2QZ6A 4OOMA 1OTAA 5FI2A 1DJBA 4PMAA 2WKPA 1VETA 4PM9A 3CAXA 4DXCA 1W63M 3A0SA 3IS2A 4KQRA 4R6LA 3T4SA 3QHYA 3M6HA 4DKIA 5KMWA 3OCNA 2Z2LB 5HD3A 1HTZA 1IKIA 1OTBA 3IXGA 5HPFA 2DCFA 2WKRA 2BASA 2ZM8A 5AQAA 3ZQ5A 3RXXA 2A49A 4HJ3A 3PAEA 1N9OA 3TE8A 2HDQA 4KQOA 3O86A 1KVLA 4MMNA 1FSWA 2K2NA 4KZ6A 1T18A 4GKUA 4UAAA 4JGQA 5F69A 5L09A 3UB5P 4KUKA 4E6XA 4EERA 1CEGA 2WZZA 1V9YA 2OAQ1 2HJEA 4HBUA 4CLCA 5CTNA 2EFXA 4UEYA 1F98A 2ACGA 5GHYA 1VEUA 3BW6A 3CUEC 3MQQA 4QB8A 3BWLA 2HDUA 3D3OA 5E2GA 2WKIA 1S67L 2ZC6B 3NHQA 3P98A 4JF4A 5GLBA 5J8XA 5FQJA 1F2KA 5CHJA 4MCWA 5EVLA 2V2FF 3NDGA 2B95A 1ESUA 4NK3A 1PI5A 3F1NB 1CQAA 3F1OB 4N1HA 4R70A 4Y13A 3LIFA 3FG8A 4I3IA 4Y5FA 1NJ4A 1KE0A 2LB5A 4CLCD 4LGWA 3G30A 4EEPA 3OPRA 3VP2A 1YMSA 1YLPA 3Q7VB 5FQQA 4B9OA 4M3KA 2WADA 2HF6A 4OP8A 1L3LA 1MY8A 4A5RA 4HP9A 2NUPC 2PHYA 2VV6A 4RX2A 2OAP1 3S7NA 1G5UA 4JF6A 2M7VA 4EEUA 2ZQDA 3C4OA 2JCHA 3Q1FA 4GD8A 4XXRA 4E3JA 1XXMA 4IJGA 4LV2A 4DE3A 5CERA 4I3JA 4DN0A 2O9AA 3KSIA 3T4TA 2YKHA 3UPPA 2ZQAA 3DAVA 3NJAA 4RA7A 1YQSA 1BLPA 1MBLA 2K31A 2QHKA 1JVJA 4GB7A 4ESPA 4Q0JA 4IVIA 2W3FA 2Y8HA 3HVFA 2P74A 3G31A 1E25A 1F9IA 3UB8A 2VV8A 3BLSA 4YINA 3VFHA 4R4SA 3A3IA 4WZ4A 3FC7A 4OQGA 4JKTA 1I2WA 2W0NA 4EW7A 3C2WA 4PM6A 1YKDA 2GNXA 3N8LA 4L9GA 3HLEA 4N9KA 5DKKA 1S6RA 5DF7A 3AGDA 3UB6A 1BLHA 2XD1A 5HWWA 4WN5A 3SW1A 3ZGAB 4PHTA 4G3WA 3IQAA 3AGFA 1S1ZA 3ZG8B 3VE4A 2Y4AA 5FEFA 4JXSA 1K56A 4GDBA 1H5XA 4QPRA 4S2NC 4ZAMA 5HL1A 4Z1WA 4X25A 5CHUA 3GV9A 4HEFA 1N4OA 3E98A 4HQAA 2XA7M 3ZDJA 4P87A 2WGWA 4QY6A 4JXWA 5L07A 3H7WA 2ZC5B 5HAPA 1JWZA 3MMHA 4XT2B 1PW8A 2XH9A 4JGRA 3MBZA 1SKFA 3PAGA 4ZRRA 2V0UA 3KYEA 1NLZA 3HBRA 1PNEA 3R7WA 4UQIS 2GDNA 3MJQA 5EPHA 2DNSA 3NOTC 1NY0A 1K56D 4OONA 5GLAA 4R4RA 4L9FA 1WA9A 2EFUA 3VV4A 4UHUA 3IWOA 3LO7A 1Q2PA 4OQ0A 3T50A 3DTEA 4L9EA 3O5YA 4QY5A 1NWZA 4FH2A 5CTMA 1UWNX 3DW0A 3WRTA 5F5YA 2EX6A 2H10A 1G28A 1KOUA 3CUEA 5HL6A 3ZG7B 4WUJA 4ETZA 1SKOB 4GD6A 4EBPA 2AVXA 3FWLA 1VM1A 3LFVA 1LHYA 4FSFA 3V3SA 2HGVA
chains in the Genus database with same CATH topology
4FTXA 1AWIA 2V8CA 2PRFA 3U4LP 5FEFA 2VK3A 4X25A 1SZVA 1HLUP 5EM1A 3MS6A 2JKFA 1Z09A 1G5UA 5EM0A 4D60A 3MSHA 3KYEA 3NECA 3T1SA 1A0KA 1PNEA 3UB5P 3D9YA 3DAVA 5EVEA 1J3WA 1VEUB 3T1QB 4ESPA 3LGOA 3T1RA 3NULA 1PFLA 2ACGA 2ZL1B 1VEUA 1CJFA 3CPTA 2ZL1A 4X1MA 1YPRA 1K0KA 3LEQA 5FEGA 1CF0A 2PAVP 2V8FA 3L9KA 1PRQA 1FILA 5FDSA 4QWOA 2JKGA 5EV0A 1F2KA 1SKOA 1D1JA 3T1XA 1VETB 4FUWA 2B95A 3T12B 3CPTB 2PBDP 1CQAA 2HZ5A 1ACFA 1VETA 3L7HA 1SKOB 3CHWP 1Y4OA 4X1LA 1FIKA 2BTFP 2E8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FTX A;  1AWI A;  2V8C A;  2PRF A;  3U4L P;  5FEF A;  2VK3 A;  4X25 A;  1SZV A;  1HLU P;  5EM1 A;  3MS6 A;  2JKF A;  1Z09 A;  1G5U A;  5EM0 A;  4D60 A;  3MSH A;  3KYE A;  3NEC A;  3T1S A;  1A0K A;  1PNE A;  3UB5 P;  3D9Y A;  3DAV A;  5EVE A;  1J3W A;  1VEU B;  3T1Q B;  4ESP A;  3LGO A;  3T1R A;  3NUL A;  1PFL A;  2ACG A;  2ZL1 B;  1VEU A;  1CJF A;  3CPT A;  2ZL1 A;  4X1M A;  1YPR A;  1K0K A;  3LEQ A;  5FEG A;  1CF0 A;  2PAV P;  2V8F A;  3L9K A;  1PRQ A;  1FIL A;  5FDS A;  4QWO A;  2JKG A;  5EV0 A;  1F2K A;  1SKO A;  1D1J A;  3T1X A;  1VET B;  4FUW A;  2B95 A;  3T12 B;  3CPT B;  2PBD P;  1CQA A;  2HZ5 A;  1ACF A;  1VET A;  3L7H A;  1SKO B;  3CHW P;  1Y4O A;  4X1L A;  1FIK A;  2BTF P;  2E8J A; 
#chains in the Genus database with same CATH topology
 4FTX A;  2L1M A;  3KYZ A;  1MC0 A;  4PKY A;  2HJ9 C;  2XDM A;  4XUX A;  1OJ5 A;  2WGV A;  5E2F A;  3UDF A;  3LIC A;  1IOU A;  2QJ7 A;  3LIE A;  3A3F A;  2ZMF A;  4LEN A;  1PIO A;  2FFF B;  4LRZ E;  2EWV A;  3TRC A;  1OT6 A;  3MQO A;  2WZX A;  4EWF A;  3UDI A;  3NEC A;  3E2L A;  4KZA A;  1XJ3 A;  3VP4 A;  3T4Q A;  4ID4 A;  4B4X A;  3UPN A;  4LRY C;  1YMX A;  4H8R A;  1BUL A;  2WYX A;  4P6Z S;  5DJU A;  3QNC A;  1KGE A;  4Y3I A;  1NLY A;  1MKI A;  2V20 A;  2P9V B;  1O07 A;  4S2M A;  1MWU A;  3EWK A;  1CF0 A;  2Y91 A;  3HRE A;  4BD0 A;  4PM5 A;  3LUQ A;  3IHA A;  5KSH A;  4KZ9 A;  3M2K A;  4I3A A;  1BLC A;  1T1B A;  2HDR A;  3HJK A;  4HY8 A;  1XJ2 A;  4UA6 A;  2GX5 A;  2PR6 A;  4U0T A;  5TBM B;  3IF6 B;  4ARZ A;  3BFE A;  1LT0 A;  4NXF A;  3NOP C;  2JKT I;  1LLB A;  3QNB A;  5A93 A;  1JWV A;  3Q07 A;  2J3T C;  1P9W A;  4EXO A;  2ZQC A;  4GOG A;  1ES5 A;  4ZJ1 A;  3OPH A;  1CEF A;  3VP3 A;  5FAP A;  4PPR A;  1SCW A;  3N8S A;  1YLY A;  3BY9 A;  4EU0 A;  5HDS A;  5EVI C;  5I5L A;  4BBU A;  2QJ5 A;  5IS1 A;  4GS9 A;  2EA9 A;  1H0M A;  5D3O A;  2IWC A;  2H28 A;  2O99 A;  3UE1 A;  1L2S A;  2J80 A;  4S2N A;  3M2J A;  4BL3 A;  4P6B A;  4B4Z A;  4KZ4 A;  2KDK A;  1XFN A;  5LBR A;  4HNB A;  3LCE A;  1NYM A;  2E8I A;  1GSX A;  3GMW A;  1GHP A;  1NZU A;  1NZO A;  5F1G A;  3T4K A;  2C6W B;  5HPI A;  4HP4 A;  1FCN A;  4EV4 A;  1TDG A;  3C8C A;  1XFQ A;  3C7V A;  3LIA A;  3SZT A;  4ZDX A;  4ETX A;  1Y28 A;  4MN7 A;  4ZBE A;  4X1M A;  3PBO A;  3SH8 A;  1YSP A;  3CI6 A;  1ERO A;  3SH7 A;  1LSW A;  3EOI A;  2ZQ8 A;  1S0W A;  3S1Y A;  5CXW A;  4N9L A;  2UV0 E;  3MKF A;  4DF6 A;  1VET B;  1W5D A;  2Y2H A;  3PBN A;  3OZH A;  4K0W A;  4GW9 A;  1MPL A;  2HZ5 A;  2W27 A;  4K0X A;  5FQM A;  2GJ3 A;  3IS2 B;  3ZNT A;  2HPB A;  4EBN A;  2ZQ7 A;  1VQQ A;  3L7H A;  1YM1 A;  3SS5 A;  2I72 A;  5E2H A;  1FIK A;  1TVF A;  2PDR A;  5J4E A;  2XFS A;  3CLO A;  1IEM A;  3UE6 A;  1SHV A;  5J7E A;  3IBR A;  1XGJ A;  4WZ5 C;  3LI9 A;  1SZV A;  1SDE A;  3MZD A;  2FFY A;  2DRW A;  1UWP X;  3F1P B;  4IVK A;  5EFW A;  3WS0 A;  3FPV A;  2Y55 A;  3E4Q A;  1J9M A;  4C3Q A;  3WS4 A;  1YLW A;  3WS1 A;  5CGS A;  4QHC A;  5TJJ A;  3I7J A;  2PR5 A;  3D9Y A;  2PD8 A;  1J3W A;  2VGL S;  1VEU B;  1DJA A;  4RX3 A;  2W3E A;  3VMA A;  3UPO A;  5HWT A;  2C5W B;  3S22 A;  3P7N A;  1SDN A;  4JLF A;  4Y7P A;  4B93 A;  1YLZ A;  1AXB A;  1KVM A;  2VGJ A;  1ONG A;  5HSQ A;  1RCJ A;  1W8Q A;  3HLW A;  1ERM A;  4S2I A;  5HZH A;  1JTD A;  2Q9N A;  4WEJ A;  3E2K A;  1YLJ A;  2VEA A;  3ZNY A;  1DP6 A;  2XGN A;  4E3K A;  4LCM A;  1XJ6 A;  4Q0H A;  5IU1 A;  4S2J A;  5DKL A;  2K7S A;  1N9B A;  2OSU A;  3VOY A;  3LR0 A;  1TS8 A;  1TEM A;  4HJ6 A;  3H82 A;  4MBK A;  4KG2 A;  5DFY A;  2FZ0 A;  4P6Z M;  2L4R A;  2PRF A;  2M1C A;  2D02 A;  4GDN A;  4RQ9 A;  1XJ4 A;  5EM1 A;  2VA0 A;  3NDE A;  1M40 A;  4IUH A;  4H6J A;  1XA7 A;  2XF3 A;  1ES3 A;  1BYW A;  5EM0 A;  3GDI A;  5FI7 A;  3IXB A;  3FKW A;  1V9Z A;  1K57 C;  3OBF A;  5TFQ A;  2EX9 A;  4OVD A;  3RFB A;  4AFI A;  3TW8 A;  3T1Q B;  2EWW A;  3FKV A;  2EX2 A;  5EVI A;  1TS6 A;  1FR1 A;  1PFL A;  3IX8 A;  3B3X A;  1STZ A;  2EXB A;  3PXP A;  4DDS A;  3MXR A;  4JXG A;  4X68 A;  3Q7Z A;  1QMF A;  2XRO A;  2JKR M;  3SS4 A;  1W63 Q;  3LEQ A;  1ERQ A;  2V8F A;  3L9K A;  2ZMV A;  2J3T D;  4U0X A;  1L0G A;  4IUK A;  3BEC A;  4QU3 A;  3MXQ A;  2R78 A;  3K2N A;  5FQ9 A;  5AVE A;  1KE3 A;  3CPT B;  3WS2 A;  1ES2 A;  1CI8 A;  4HOI A;  3NCK A;  3HUN A;  1G6O A;  3TJZ C;  2W1R A;  2ZC3 B;  5DTS A;  3CHW P;  5EVI D;  1XP4 A;  4Y0T A;  4NET A;  3W8K A;  3DTM A;  1H3Q A;  1AWI A;  3M6B A;  1IYP A;  3KX0 X;  1FSY A;  2JKT M;  3U4L P;  1IYS A;  4Y0U A;  3LYX A;  3P01 A;  3LY3 A;  4EQI A;  4GHI A;  3ICY A;  3ZVT A;  3PTE A;  2WGW B;  3PBT A;  3MS6 A;  3H7W B;  3MFX A;  3E4P A;  1Z09 A;  4BL2 A;  2VV7 A;  2QMI A;  3ZVW A;  1I5Q A;  4JXV A;  1W8Y A;  2PD7 A;  2V0W A;  2XK1 A;  4LV3 A;  4YNR A;  3R7W B;  3UO9 A;  3CG5 A;  2X71 A;  2Z6D A;  5EOE A;  4RVA A;  1F5M A;  2W3D A;  1IEL A;  4WZ5 A;  1IYQ A;  4HI4 A;  1IKG A;  4ZJ2 A;  1C3B A;  4WMC A;  2Y59 A;  5FDH A;  4DXB A;  1XX2 A;  3LGO A;  4BQM A;  2DMW A;  3T1R A;  4DRT A;  4QJG A;  4KQD A;  2Y79 A;  1YAX A;  2W1T B;  5TR7 A;  2H0T A;  3A0V A;  5KIZ A;  2ZJ9 A;  1MKM A;  1KGF A;  2ZL1 A;  1K0K A;  3WRZ A;  1N9N A;  4BD1 A;  4YWZ A;  4QWO A;  5AQ7 A;  2PU4 A;  4O0P A;  5EV0 A;  3KO6 A;  2JN7 A;  5HFO A;  5BOH A;  3NY4 A;  2J9P A;  3IX4 A;  3DWZ A;  1ZHH B;  4XUZ A;  2G7U A;  1K4F A;  4WMC D;  3D4F A;  3IBJ A;  3W2Z A;  4Z9Q A;  3PBR A;  3MZF A;  4IBR A;  4F3L A;  5FQI A;  4S2P A;  2P04 A;  4E6W A;  2QKP A;  3OPL A;  2JC7 A;  3EQV A;  2OWJ A;  3UE3 A;  2FH5 A;  1UGU A;  2OOL A;  4KQQ A;  1FR6 A;  4S2L A;  4OH0 A;  2G2U A;  4C6Y A;  1OT9 A;  3HCY A;  4WLA A;  4G3K A;  5G4Y A;  5HD5 A;  4BBV A;  3BLM A;  3V3R A;  2KLI A;  5FA7 A;  2EXA A;  3O87 A;  2KOI A;  3IHB A;  4R1G A;  1T19 A;  5CED A;  2R9X A;  4R0Q A;  3LR5 A;  4HES A;  4R38 A;  1MWT A;  1PWC A;  3BQA A;  5DF9 A;  1X0O A;  4EUZ A;  2ZC7 A;  5A8B A;  4WM9 A;  3FPW A;  4OQI A;  4HIA A;  3ZG0 A;  1K57 A;  1K6R A;  3O3V A;  1IFQ A;  3LEZ A;  2H5S A;  5GLC A;  1LSX A;  3GTC A;  1YPR A;  2A24 B;  1VHM A;  2VLG A;  4WF0 A;  3PBS A;  1OME A;  1SKO A;  3T1X A;  2WKH A;  4KG5 A;  5KSC A;  1GSW A;  4ARZ B;  1LI0 A;  4NXB A;  4IED A;  1BTL A;  2VJW A;  1ZKJ A;  3JVU A;  3RXW A;  2PBD P;  1W7F A;  1L0E A;  5HWV A;  2EX8 A;  2XR0 A;  4DE0 A;  3H9W A;  4DE2 A;  1GCE A;  2Q0O A;  3MZE A;  1JNU A;  4KZB A;  1WYB A;  4LPZ A;  1ODV A;  5J3W A;  5I94 A;  4S2K A;  2VK3 A;  2V1Z A;  2XLN A;  3UN7 A;  3LR4 A;  4GS9 B;  4E3L A;  3JVV A;  3CJM A;  1YLT A;  1K6S A;  3RTY A;  4OKP A;  3OCL A;  2OV5 A;  1MWR A;  5CEB A;  5A91 A;  3NC8 A;  4PAU A;  4I38 A;  3MKE A;  4EET B;  4GLQ A;  1DP9 A;  4PM7 A;  4KZ7 A;  3BYD A;  3MF0 A;  3EEA A;  1L0D A;  2HP5 A;  5FL3 A;  3T4O A;  1CK3 A;  2XRN A;  2ZM2 A;  1HZO A;  4CQH A;  4JBF A;  1GHI A;  4GNU A;  3UB9 A;  2QWS A;  3DTK A;  5E43 A;  4LLO B;  4ME4 A;  2QYB A;  2HV1 A;  3ZYT A;  2Y2L A;  5FDS A;  2P08 A;  5K5B A;  4MEZ A;  3V39 A;  3FV7 A;  1O7E A;  4GN2 A;  2JBF A;  3SS3 A;  3U2A A;  1K4E A;  4FD8 A;  2B18 A;  3S7O A;  1OPX A;  3DWK A;  3UE0 A;  5EOO A;  3ULF A;  2E8J A;  1K55 C;  2KX6 A;  3O88 A;  1PZP A;  4IBX A;  4R23 A;  4GJ4 A;  1LI9 A;  4EUV A;  1E3U A;  4KUO A;  3UY6 A;  5AQB A;  2B5R A;  5C5K A;  3BFG A;  3IT9 A;  3G4P A;  1ZG4 A;  5KZH A;  4UQI M;  1T1C A;  3E0Y A;  4OPR A;  1ZTU A;  3VSL A;  4D60 A;  3EGX C;  4JF5 A;  5AJG A;  3G35 A;  2YKF A;  3NIA A;  3BRM A;  1S1Y A;  5IT5 A;  3SOI A;  4CJN A;  2IA2 A;  3GVB A;  4ZTK A;  2WKE A;  2HP9 A;  4R3B A;  4BJP A;  4X6T A;  5DJT A;  2R9W A;  4PM8 A;  1PZO A;  4E3I A;  3NUL A;  1KE4 A;  3N7W A;  4K08 A;  3C5A A;  1E3U D;  2ZC4 B;  2VKS A;  2P7J A;  2Z2M B;  5F6A A;  5FAO A;  3KYQ A;  2RL3 A;  5FEG A;  3N8R A;  2PAV P;  4CLC B;  1VB6 A;  1CI9 A;  3G2Y A;  1D06 A;  4DDY A;  2XEP A;  3OOV A;  2X02 A;  5L2F A;  4FUW A;  3NBL A;  3T12 B;  3CMZ A;  4DE1 A;  2A3U A;  1NRJ A;  1RGZ A;  1BSG A;  4R3J A;  4U3T A;  4OOL A;  5F68 A;  1NYY A;  4Q0I A;  5EUA A;  4K91 A;  1I2S A;  3B33 A;  3H82 B;  4EES A;  2VGK A;  4MLL A;  3KSH A;  1Y4O A;  5CGX A;  3K3C A;  4YOF A;  4E3M A;  3PYP A;  1D7E A;  5JYO A;  5GHX A;  5CX7 A;  3NOU C;  4KZ3 A;  2JHE A;  5G4Z A;  3F1P A;  2ZD8 A;  1G6A A;  4H6J B;  5A90 A;  2M7U A;  4MBH A;  4R3A A;  1HLU P;  2PYP A;  4OOY A;  3FZC A;  2JKF A;  3N4I A;  3C4P A;  5HAI A;  4X55 A;  1MWS A;  1XA1 A;  3UDX A;  4CPK A;  5HAQ A;  2OLU A;  1TS7 A;  2PU2 A;  2ZLY A;  2IWB A;  3IWI A;  2V1A A;  1TF1 A;  2ZOH A;  3V67 A;  1H8M A;  1JTG A;  5CGW A;  1QME A;  5EVI B;  3HUO A;  4NXE A;  3HLF A;  1P97 A;  3GSG A;  1DRM A;  2ZQ9 A;  1RP5 A;  3IWQ A;  2Q9M A;  5JYP A;  5DFX A;  1U60 A;  2HP6 A;  3CWF A;  4KZ8 A;  2HDS A;  2V9A A;  2Y2O A;  3A0R A;  1G68 A;  5GLD A;  3SH9 A;  1FQG A;  3PR6 A;  4JGO A;  3PHY A;  5FAQ A;  1LL8 A;  1N9L A;  5FAT A;  4HH3 A;  3HLG A;  2JKG A;  2NUT C;  1FCM A;  2O0Y A;  4OPY A;  3HUM A;  5AQ9 A;  1FCO A;  4Y2F A;  3T4L A;  4HH2 A;  1RGY A;  3WWX A;  2MJ6 A;  3RJU A;  4LRX C;  1Y54 A;  1S4S A;  3G2Z A;  1K54 C;  1T1A A;  4BWI A;  3DTI A;  3VOL A;  2UWX A;  3F1N A;  3TG9 A;  1S66 L;  3BY8 A;  3F1O A;  4OPZ A;  3W4P A;  3C38 A;  1PWD A;  3G32 A;  3G34 A;  3VSK A;  4IHQ A;  2H0Y A;  4GHI B;  1PW1 A;  3Q82 A;  4UA7 A;  4JGP A;  4WBG A;  1TS0 A;  4HHD A;  3OLO A;  1BT5 A;  3Q7V A;  4Q8I A;  1YSQ A;  2WAE A;  3IF5 A;  2WUQ A;  5M1A A;  4D2O A;  4X53 A;  4E3N A;  4FH4 A;  4Y17 A;  1K55 A;  1ESI A;  1KDS A;  2XSS A;  3V50 A;  5E2E A;  1LSV A;  3RH8 B;  1PI4 A;  3UB7 A;  1DP8 A;  1XPB A;  3UNW A;  4P85 A;  2IWD A;  1E4D A;  4MNR A;  3AGE A;  3MFD A;  2O9C A;  3BM6 A;  1NXY A;  1EI5 A;  2ZL1 B;  4C75 A;  1BUE A;  2PBY A;  2VZW A;  3GRJ A;  1PYY A;  4EBL A;  3CPT A;  3VFF A;  5A92 A;  3S4X A;  3T4J A;  3HLB A;  4PKY G;  2W3H A;  5HDC A;  3IF6 C;  3QP6 A;  3A3E A;  2D01 A;  5F83 A;  1DY6 A;  1KGG A;  3BFC A;  4N92 A;  1OTE A;  5EE8 A;  5EEC A;  4X69 A;  2ZMA A;  4OLG A;  4BMW A;  4F3L B;  5FSR A;  5TGF A;  2WGI A;  1S4R A;  5CRF A;  1IYO A;  4BLM A;  5F82 A;  3IXD A;  2PYR A;  4OQH A;  5AVF A;  4X1L A;  2W3G A;  2ZM0 A;  3C30 A;  3S7P A;  5FAS A;  1M6K A;  4II7 A;  4UA9 A;  4OLD A;  4GZB A;  2BG1 A;  2RCX A;  3QP4 A;  4KZ5 A;  4DJ3 A;  1ZC2 A;  2Y2P A;  3CIT A;  3R4K A;  2ZBB A;  3VP0 A;  4LV1 A;  3P09 A;  3TOI A;  1K38 A;  2VGL M;  1P9R A;  4ZJ3 A;  3G6O A;  4CLC E;  5CEC A;  1GSV A;  5DTT A;  5HW3 A;  5F1F A;  5HDD A;  5U47 A;  4G3V A;  1GHM A;  1XGI A;  2PT7 A;  2W1T A;  3VE3 A;  3B47 A;  5L8M A;  4L0L A;  1A0K A;  2L0W A;  3V5M A;  4XT2 A;  5G18 A;  1L0F A;  1ES4 A;  1OTD A;  3HLC A;  3ZG9 B;  3OPP A;  3ISG A;  3BEB A;  5DVA A;  3NI9 A;  1W79 A;  4P0M A;  4YFM A;  2Z6C A;  2CC1 A;  4O7D A;  1H8Y A;  1EWZ A;  2I9V A;  4WYY A;  1EW0 A;  3A3J A;  1Q2Q A;  1DJC A;  5L10 A;  4KEN B;  1FIL A;  3A3D A;  1KDW A;  3W4O A;  3IH8 A;  3IX3 A;  3QP2 A;  4NKP A;  2VX8 A;  4NXG A;  4NEE D;  3MR0 A;  4RYE A;  5CHM A;  4Y15 A;  3LID A;  1LL5 A;  4O01 A;  3GR2 A;  1BLS A;  2O9B A;  1P0Z A;  4OP5 A;  4E3O A;  3VP1 A;  4N1X A;  4LV0 A;  1FOF A;  2Y2G A;  3JPU A;  3ZCZ A;  3QP8 A;  2B02 A;  5M19 A;  3Q81 A;  4MBF A;  3TSG A;  3UMD A;  4GCZ A;  3PBQ A;  4OPQ A;  1K54 A;  3KSF A;  2X01 A;  1ONH A;  3N6I A;  2JKR I;  4WL9 A;  4CLC C;  1HVB A;  2JE5 A;  3K3D A;  3GEC A;  3IH9 A;  1OTI A;  3ZG5 A;  3MSH A;  4FOF A;  3UME A;  3W4Q A;  3HLD A;  5DF8 A;  2Y2I A;  3EEH A;  2LB9 A;  1ALQ A;  2V1B A;  5FI6 A;  3E4O A;  4FCF A;  2A2L A;  2A24 A;  1GA0 A;  5GL9 A;  3S7Q A;  1TD5 A;  2G2W A;  5HX9 A;  1WYC A;  4Y0O A;  4LCL A;  4DJ2 A;  4DMZ A;  4MDZ A;  5IHV A;  4WEK A;  5MC7 A;  3IXH A;  3LI8 A;  1PRQ A;  1PWG A;  2P9V A;  3KSG A;  4HBT A;  3GQZ A;  1BZA A;  2WK0 A;  3D72 A;  1D1J A;  2J9O A;  1JWP A;  3VOZ A;  1GA9 A;  1Z6F A;  2BLS A;  4QD4 A;  3C7U A;  4MN6 A;  1ACF A;  2QPN A;  2Y2N A;  4I5S A;  5M18 A;  2GZA A;  2XQZ A;  3ITA A;  2OWH A;  1OJG A;  3ITB A;  3DBA A;  2Y2Q A;  2WAF A;  5TBM A;  2Y2M A;  3IF6 A;  5HAR A;  2BTF P;  3FYZ A;  3LIB A;  3EGD C;  3B42 A;  4I39 A;  1TDL A;  2XFT A;  2V8C A;  1NRF A;  3WS5 A;  4M4X A;  4EQ1 A;  3ZHH A;  4KG6 A;  3HJI A;  2XD5 A;  4F94 A;  2J7V A;  1YT4 A;  3JYI A;  3MXS A;  4BBT A;  5DTK A;  2CMN A;  4S2O A;  2Y2K A;  3LR3 A;  2J3W A;  4WEL A;  1HD8 A;  2J8Y A;  4BEN A;  4X56 A;  3BQ8 A;  2INW A;  2Y2J A;  4NG2 A;  4O8G A;  1K25 A;  3ZFZ A;  3HL9 A;  3MQ0 A;  2ZOI A;  1H8Z A;  3BJN A;  1WE4 A;  3T1S A;  3EQU A;  5EVE A;  2WKQ A;  3QP5 A;  5GHZ A;  4JPM A;  1LL9 A;  1XKZ A;  3OC2 A;  2OLV A;  1CJF A;  5FQK A;  4LFU A;  4B88 A;  3BFF A;  4HJ4 A;  3LY4 A;  4MN5 A;  1ZG6 A;  1MXO A;  1MZU A;  3CZD A;  2XA7 S;  4E04 A;  3BFD A;  3QP1 A;  2QZ6 A;  4OOM A;  1OTA A;  5FI2 A;  1DJB A;  4PMA A;  2WKP A;  1VET A;  4PM9 A;  3CAX A;  4DXC A;  1W63 M;  3A0S A;  3IS2 A;  4KQR A;  4R6L A;  3T4S A;  3QHY A;  3M6H A;  4DKI A;  5KMW A;  3OCN A;  2Z2L B;  5HD3 A;  1HTZ A;  1IKI A;  1OTB A;  3IXG A;  5HPF A;  2DCF A;  2WKR A;  2BAS A;  2ZM8 A;  5AQA A;  3ZQ5 A;  3RXX A;  2A49 A;  4HJ3 A;  3PAE A;  1N9O A;  3TE8 A;  2HDQ A;  4KQO A;  3O86 A;  1KVL A;  4MMN A;  1FSW A;  2K2N A;  4KZ6 A;  1T18 A;  4GKU A;  4UAA A;  4JGQ A;  5F69 A;  5L09 A;  3UB5 P;  4KUK A;  4E6X A;  4EER A;  1CEG A;  2WZZ A;  1V9Y A;  2OAQ 1;  2HJE A;  4HBU A;  4CLC A;  5CTN A;  2EFX A;  4UEY A;  1F98 A;  2ACG A;  5GHY A;  1VEU A;  3BW6 A;  3CUE C;  3MQQ A;  4QB8 A;  3BWL A;  2HDU A;  3D3O A;  5E2G A;  2WKI A;  1S67 L;  2ZC6 B;  3NHQ A;  3P98 A;  4JF4 A;  5GLB A;  5J8X A;  5FQJ A;  1F2K A;  5CHJ A;  4MCW A;  5EVL A;  2V2F F;  3NDG A;  2B95 A;  1ESU A;  4NK3 A;  1PI5 A;  3F1N B;  1CQA A;  3F1O B;  4N1H A;  4R70 A;  4Y13 A;  3LIF A;  3FG8 A;  4I3I A;  4Y5F A;  1NJ4 A;  1KE0 A;  2LB5 A;  4CLC D;  4LGW A;  3G30 A;  4EEP A;  3OPR A;  3VP2 A;  1YMS A;  1YLP A;  3Q7V B;  5FQQ A;  4B9O A;  4M3K A;  2WAD A;  2HF6 A;  4OP8 A;  1L3L A;  1MY8 A;  4A5R A;  4HP9 A;  2NUP C;  2PHY A;  2VV6 A;  4RX2 A;  2OAP 1;  3S7N A;  1G5U A;  4JF6 A;  2M7V A;  4EEU A;  2ZQD A;  3C4O A;  2JCH A;  3Q1F A;  4GD8 A;  4XXR A;  4E3J A;  1XXM A;  4IJG A;  4LV2 A;  4DE3 A;  5CER A;  4I3J A;  4DN0 A;  2O9A A;  3KSI A;  3T4T A;  2YKH A;  3UPP A;  2ZQA A;  3DAV A;  3NJA A;  4RA7 A;  1YQS A;  1BLP A;  1MBL A;  2K31 A;  2QHK A;  1JVJ A;  4GB7 A;  4ESP A;  4Q0J A;  4IVI A;  2W3F A;  2Y8H A;  3HVF A;  2P74 A;  3G31 A;  1E25 A;  1F9I A;  3UB8 A;  2VV8 A;  3BLS A;  4YIN A;  3VFH A;  4R4S A;  3A3I A;  4WZ4 A;  3FC7 A;  4OQG A;  4JKT A;  1I2W A;  2W0N A;  4EW7 A;  3C2W A;  4PM6 A;  1YKD A;  2GNX A;  3N8L A;  4L9G A;  3HLE A;  4N9K A;  5DKK A;  1S6R A;  5DF7 A;  3AGD A;  3UB6 A;  1BLH A;  2XD1 A;  5HWW A;  4WN5 A;  3SW1 A;  3ZGA B;  4PHT A;  4G3W A;  3IQA A;  3AGF A;  1S1Z A;  3ZG8 B;  3VE4 A;  2Y4A A;  5FEF A;  4JXS A;  1K56 A;  4GDB A;  1H5X A;  4QPR A;  4S2N C;  4ZAM A;  5HL1 A;  4Z1W A;  4X25 A;  5CHU A;  3GV9 A;  4HEF A;  1N4O A;  3E98 A;  4HQA A;  2XA7 M;  3ZDJ A;  4P87 A;  2WGW A;  4QY6 A;  4JXW A;  5L07 A;  3H7W A;  2ZC5 B;  5HAP A;  1JWZ A;  3MMH A;  4XT2 B;  1PW8 A;  2XH9 A;  4JGR A;  3MBZ A;  1SKF A;  3PAG A;  4ZRR A;  2V0U A;  3KYE A;  1NLZ A;  3HBR A;  1PNE A;  3R7W A;  4UQI S;  2GDN A;  3MJQ A;  5EPH A;  2DNS A;  3NOT C;  1NY0 A;  1K56 D;  4OON A;  5GLA A;  4R4R A;  4L9F A;  1WA9 A;  2EFU A;  3VV4 A;  4UHU A;  3IWO A;  3LO7 A;  1Q2P A;  4OQ0 A;  3T50 A;  3DTE A;  4L9E A;  3O5Y A;  4QY5 A;  1NWZ A;  4FH2 A;  5CTM A;  1UWN X;  3DW0 A;  3WRT A;  5F5Y A;  2EX6 A;  2H10 A;  1G28 A;  1KOU A;  3CUE A;  5HL6 A;  3ZG7 B;  4WUJ A;  4ETZ A;  1SKO B;  4GD6 A;  4EBP A;  2AVX A;  3FWL A;  1VM1 A;  3LFV A;  1LHY A;  4FSF A;  3V3S A;  2HGV A; 
#chains in the Genus database with same CATH homology
 4FTX A;  1AWI A;  2V8C A;  2PRF A;  3U4L P;  5FEF A;  2VK3 A;  4X25 A;  1SZV A;  1HLU P;  5EM1 A;  3MS6 A;  2JKF A;  1Z09 A;  1G5U A;  5EM0 A;  4D60 A;  3MSH A;  3KYE A;  3NEC A;  3T1S A;  1A0K A;  1PNE A;  3UB5 P;  3D9Y A;  3DAV A;  5EVE A;  1J3W A;  1VEU B;  3T1Q B;  4ESP A;  3LGO A;  3T1R A;  3NUL A;  1PFL A;  2ACG A;  2ZL1 B;  1VEU A;  1CJF A;  3CPT A;  2ZL1 A;  4X1M A;  1YPR A;  1K0K A;  3LEQ A;  5FEG A;  1CF0 A;  2PAV P;  2V8F A;  3L9K A;  1PRQ A;  1FIL A;  5FDS A;  4QWO A;  2JKG A;  5EV0 A;  1F2K A;  1SKO A;  1D1J A;  3T1X A;  1VET B;  4FUW A;  2B95 A;  3T12 B;  3CPT B;  2PBD P;  1CQA A;  2HZ5 A;  1ACF A;  1VET A;  3L7H A;  1SKO B;  3CHW P;  1Y4O A;  4X1L A;  1FIK A;  2BTF P;  2E8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...