3T1SA

Mglb homodimer
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
133
structure length
133
Chain Sequence
b'SLVLYGAPYERAVEVLEETLRETGARYALLIDRKGFVLAHKEALWAPKPPPLDTLATLVASNAAATQALAKLLGEARFQEEVHQGERMGLYVDEAGEHALLVLVFDETAPLGKVKLHGKRAAEALARIAEEAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gliding protein MglB
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Signaling protein
total genus 39
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3t1sA00
3LGOA 1HLUP 5EVEA 3T1QB 5FEGA 3L7HA 1J3WA 3L9KA 2HZ5A 2V8FA 3D9YA 1SKOB 1FIKA 4X25A 1VETB 3MS6A 3LEQA 2E8JA 2PRFA 4X1MA 1D1JA 3MSHA 1PRQA 2ACGA 5FEFA 3T1RA 1K0KA 1CF0A 5EM0A 3T12B 1Z09A 1SKOA 1VETA 3T1SA 2VK3A 1AWIA 1YPRA 2ZL1B 3CHWP 1ACFA 1PFLA 5EV0A 4D60A 1Y4OA 3NECA 1F2KA 5FDSA 4ESPA 3KYEA 2PBDP 3U4LP 3T1XA 1VEUB 1FILA 3CPTB 1SZVA 5EM1A 1A0KA 2ZL1A 4X1LA 3NULA 1VEUA 4FUWA 3CPTA 1CJFA 4FTXA 2BTFP 2JKFA 1G5UA 1PNEA 3UB5P 2V8CA 2PAVP 1CQAA 2JKGA 3DAVA 4QWOA 2B95A
chains in the Genus database with same CATH superfamily
3A0VA 5CEBA 4WZ5C 3LGOA 2HDSA 3IX3A 5TBMA 3TSGA 1TDGA 1P9WA 2ZOIA 4WEKA 4EXOA 4QY6A 5D3OA 2QWSA 1YKDA 5HDSA 4UHUA 3NBLA 5A8BA 2HZ5A 4O01A 2J9OA 1KGEA 3UE3A 3W4QA 1BYWA 1VETB 5HFOA 1YLPA 1ESUA 3GQZA 5HAQA 5J4EA 4X69A 4EW7A 2PRFA 3N7WA 2O9AA 4R4SA 5KSCA 3UDXA 1XPBA 3UNWA 4OOMA 4CLCB 1TS0A 3MXQA 5FI6A 1W5DA 2VV6A 3HLBA 4YWZA 5EVIB 1CI9A 1SKOA 3NOPC 3CJMA 2HDRA 2GNXA 1XA1A 4OQIA 3D72A 2Y2LA 4S2IA 3KYEA 4LV1A 1PYYA 3FV7A 3E0YA 2JKTM 1OJ5A 1I2WA 5HX9A 4EQIA 2Y2HA 2WKIA 3BECA 3VE3A 3KO6A 4OP8A 1OTDA 4R4RA 3QHYA 1NYMA 1FCOA 4IJGA 3CPTA 4ZTKA 4PMAA 4RQ9A 2AVXA 5TBMB 3RXWA 1SCWA 3DBAA 1KVMA 3BRMA 3IXDA 2EWWA 4NXFA 4X68A 3QP5A 2EX6A 4JXGA 3S22A 1KE3A 4P6BA 3ZYTA 4ZJ2A 4NEED 3PBNA 1QMFA 5HWWA 4GJ4A 4WBGA 2GJ3A 4HI4A 3P01A 1IEMA 4JBFA 5HL6A 1CEGA 1SKOB 1G28A 2WKPA 3KSFA 2V0UA 3HJIA 1NXYA 3O88A 4DJ2A 5AVEA 2O9BA 3Q7ZA 4S2PA 2OLVA 1ERMA 2VEAA 3IBRA 5FQIA 5L10A 4ZAMA 3LYXA 4JGOA 1DP6A 4UAAA 5J3WA 3NECA 2J3TD 4NG2A 2XR0A 4L9EA 4Y0TA 3SOIA 5FDHA 4HQAA 3C4PA 1HZOA 3CPTB 3DTKA 1O07A 4OPRA 2FFYA 4MN6A 4R70A 4EBLA 1KGFA 4R6LA 2QJ7A 1DY6A 3G2YA 3ZFZA 3IHBA 4NXEA 5L2FA 3P98A 1NWZA 4DE0A 4KUKA 4GZBA 1XKZA 4HBTA 4LRXC 4Y2FA 3FKVA 4KZ7A 2V8CA 4BBTA 1Q2PA 3IHAA 4BENA 4KQRA 5FL3A 2XF3A 3BWLA 1WYBA 5C5KA 3E4OA 3UE0A 1OJGA 1YSQA 2XDMA 3L9KA 3SS4A 4M4XA 1K54C 2DCFA 1FIKA 3ICYA 3UB6A 3FPWA 3V3RA 2W3FA 4MN7A 3NJAA 4GKUA 2KDKA 2QKPA 4CLCE 3U2AA 1YLTA 4X1MA 1PRQA 3T4KA 1NJ4A 1GHIA 3LIBA 1YM1A 3UO9A 1NLYA 3E2LA 3VOLA 2HP9A 1RGZA 2EWVA 3MR0A 1BTLA 5KIZA 1JVJA 5EV0A 2C6WB 3UE1A 4B4XA 4OQGA 2HPBA 2X71A 1F2KA 3M6BA 1OTBA 4E3MA 2M7VA 4OOLA 1L0FA 4WZ5A 3KSHA 1ESIA 4DDSA 3IF5A 4OPZA 3OPHA 4R1GA 1TS6A 4XXRA 1L2SA 2J80A 4PAUA 3E4PA 3T4SA 1C3BA 5DKKA 2VLGA 1VEUA 3NCKA 1E3UD 5L8MA 1NLZA 5FQ9A 3O5YA 1KVLA 3UPNA 3UE6A 5EUAA 5TGFA 3JPUA 3MFXA 4K08A 3CZDA 3IH9A 5FASA 5HAPA 3IH8A 4RYEA 3S1YA 1RP5A 3H7WA 4KZ8A 1PWDA 2ZQ7A 4UA9A 4DKIA 4EUVA 3FWLA 5I5LA 4E3JA 4P85A 2Z6CA 3A3DA 3M2KA 5EPHA 3L7HA 3A0SA 1ODVA 5DTSA 3BLMA 1J9MA 2KX6A 3PBOA 4C3QA 4L9FA 5G4ZA 3SZTA 2ZMAA 4E3NA 1LT0A 1VQQA 1S4RA 2V1BA 2ZMVA 3FYZA 2ACGA 4PHTA 4KZ6A 1K0KA 1H8MA 3IXGA 4P6ZS 1LI9A 1ZC2A 4DE1A 3HLEA 3HJKA 1LSWA 4X55A 3T1SA 4EQ1A 1ONGA 4EETB 4WEJA 1PFLA 1F5MA 5F68A 4GCZA 3OBFA 4HBUA 3WS4A 3K3CA 4OONA 1ZG6A 2ZJ9A 3O3VA 3JYIA 1VEUB 2G2UA 2NUTC 1K57C 3S7PA 5EM1A 2OLUA 1I5QA 1MC0A 4BWIA 3A3IA 4LRZE 3BFEA 4ID4A 5HPIA 5KSHA 3W4OA 1NZOA 4X6TA 5HD3A 3CLOA 4MBFA 3ZVTA 5FAOA 3SH7A 3H7WB 5AJGA 2J3WA 1BLCA 3TW8A 3C5AA 1JWVA 3IBJA 4ZRRA 5F82A 3KYZA 4WN5A 1PZPA 3D4FA 3NOTC 1CQAA 4KZ5A 4HH3A 1GSVA 3I7JA 1N9BA 4KZ4A 5EFWA 2O0YA 3LFVA 3LI8A 4OQ0A 1TF1A 4E3IA 3OPPA 2KOIA 3VSLA 2W3EA 1JWPA 3V50A 3LIDA 3E2KA 3FKWA 3R4KA 2QZ6A 3GMWA 1YT4A 4I5SA 4NXGA 4YINA 3S7NA 2ZC4B 3G31A 2BASA 2P08A 3BYDA 3LR4A 4FCFA 3MKEA 2HGVA 1VM1A 5EECA 1GSXA 3HLGA 3LY4A 3MQ0A 2WKQA 3GECA 4WELA 3V3SA 4MLLA 3PBSA 5CTMA 2RL3A 3D3OA 1Z6FA 3GDIA 1OTIA 1VB6A 4U0TA 3PBRA 1X0OA 4OPQA 3MKFA 1MPLA 1K54A 4NKPA 3RTYA 2LB9A 3C2WA 5HWTA 3SS3A 1F98A 4N1HA 3FPVA 2VZWA 3F1NA 5FI7A 4G3VA 5E2GA 2ZC7A 4JF6A 2Y55A 1VHMA 4DXCA 2M1CA 4IEDA 2B95A 2R78A 3LICA 3DTEA 4G3WA 3QNCA 4XUZA 1WE4A 1OMEA 2JKTI 2HP6A 1TS7A 2B18A 3P7NA 3MZDA 3A0RA 1HTZA 1STZA 2X02A 4E6XA 4H8RA 5F1FA 2GDNA 1W8YA 3QP1A 1ES4A 2UV0E 3LIFA 3IF6C 1MZUA 2FZ0A 1K56A 2VGJA 2V0WA 3NOUC 5DJUA 1IFQA 3F1PA 4KZAA 5GHYA 3C8CA 4I3JA 1MWUA 3A3EA 1GA0A 1EI5A 1P0ZA 1OT6A 4Y17A 2Y2MA 2X01A 2IWCA 4D60A 4EBPA 2A24A 1BLSA 2Y8HA 2OAQ1 1G6AA 2W3GA 3O87A 2WADA 2HP5A 4JXSA 1D7EA 4ZJ3A 1K6RA 1LHYA 2A2LA 3F1NB 2ZM2A 2UWXA 2HJ9C 1L3LA 4X53A 3BQ8A 3IX8A 5CTNA 4HY8A 2IA2A 3E98A 1DRMA 4WM9A 3N6IA 3ISGA 1ES5A 3CMZA 3W2ZA 3P09A 3UB5P 3BY8A 3CWFA 2OWJA 4LGWA 4ARZA 2YKHA 5FQQA 4F94A 5CECA 2W3HA 2JE5A 3IX4A 1YMSA 3BJNA 1IYOA 4BBUA 5DF8A 3OZHA 3EQUA 1FQGA 3F1PB 5CHMA 2QYBA 1K57A 1WYCA 3G6OA 4FH4A 2HDUA 3K2NA 1UWPX 5HDDA 3G4PA 4WUJA 5BOHA 3FZCA 3VFHA 2A24B 3AGFA 1S0WA 5F1GA 1TS8A 1FCNA 3HL9A 2DMWA 1FR6A 4QPRA 5GHZA 1AXBA 2LB5A 5CXWA 2Y79A 3SH9A 1YPRA 4H6JA 2XFSA 3N4IA 4GNUA 2Y2NA 4BJPA 3A3JA 5F5YA 4GD6A 3VFFA 4DDYA 1XJ6A 2PD7A 4MEZA 5DTTA 4WMCA 2VKSA 1EROA 1FCMA 4EV4A 3N8SA 3QP6A 2ZBBA 3ZG0A 5CEDA 1HD8A 1N9NA 1MY8A 2VV8A 2XSSA 3VP1A 3KSIA 4ARZB 2JC7A 3TJZC 1SDNA 4LV0A 1T1AA 2ZQ9A 1SHVA 5L09A 1DP8A 3LR3A 3MJQA 1V9YA 1W79A 3BW6A 2DNSA 2D01A 3HUOA 3G34A 1PWCA 4QD4A 5AQ9A 2WK0A 5K5BA 5TJJA 3IXBA 1I2SA 5CERA 2OSUA 3UN7A 3T4OA 2Y2OA 4I3AA 3HREA 5M19A 3JVUA 4EEUA 4DMZA 2H0TA 4HOIA 4S2OA 4IBRA 1XFQA 4R0QA 2NUPC 2WYXA 2I72A 3G30A 3EGXC 1XJ2A 1TEMA 4BD0A 3EGDC 2G2WA 4H6JB 1DJCA 1XJ3A 1ERQA 1D1JA 1IYPA 4LV2A 1GCEA 1L0EA 1Q2QA 3QP2A 3T12B 4PM5A 1JNUA 3BFDA 2XH9A 4R3JA 5CHJA 5IHVA 2J8YA 5DFYA 2WKEA 4EBNA 3BLSA 3NY4A 3NDEA 4KQOA 5A91A 1Y54A 2WZZA 4Y7PA 2IWDA 2HDQA 5KMWA 1S4SA 2EXBA 3B42A 2P9VA 5HL1A 3HVFA 1K38A 1W8QA 3F1OA 4OVDA 3VP4A 3C7UA 2Y2KA 3WRTA 4HP9A 4KZ9A 4E3OA 2BTFP 1WA9A 4DN0A 3IF6A 3DW0A 1XXMA 2VGLS 4S2MA 2JBFA 5HSQA 1LL5A 2PAVP 2ZQDA 3OPRA 3VOZA 1K55C 3ZG7B 5DKLA 4B88A 3A3FA 4KUOA 4GB7A 1P9RA 4KQDA 1NRJA 5F83A 1YLZA 5HZHA 3PHYA 4JF4A 4GLQA 2PDRA 4GN2A 2R9XA 3MQQA 5J8XA 2ZD8A 3QP4A 5MC7A 4N9KA 4LCMA 3DTMA 3MS6A 3MZEA 4ZBEA 4PM9A 3RJUA 2A49A 5FSRA 2Q9NA 4DF6A 1GA9A 4OLGA 4NK3A 5DF9A 3ZCZA 1D06A 4EU0A 2OV5A 3R7WA 3KX0X 3PR6A 2L0WA 1YAXA 4UA6A 2P9VB 2XROA 3F1OB 1KDWA 4PM7A 1E3UA 4DJ3A 5IT5A 1QMEA 4KENB 4OP5A 3EEAA 4II7A 3U4LP 3SH8A 2PD8A 4K0WA 2H28A 4N92A 3IF6B 2XA7S 3GR2A 4MMNA 2ZL1A 5AVFA 4GDBA 4DXBA 1U60A 4PM8A 5HWVA 1TD5A 1IYSA 4F3LA 5E2FA 1CJFA 3LCEA 4UA7A 4S2LA 3UB7A 3VE4A 5G4YA 3LY3A 4BMWA 3IWOA 2YKFA 3GTCA 5AQ7A 3ZG5A 4QJGA 2Y2GA 4ZDXA 5A90A 3TE8A 4YNRA 5CGXA 1L0DA 3ZG8B 1ZG4A 4LENA 2ZQCA 2PR5A 4R23A 4BQMA 2VJWA 2PBYA 2MJ6A 3M2JA 3R7WB 3OC2A 2VGKA 1W63Q 4N1XA 2IWBA 2ZC6B 2J9PA 1G68A 1DJAA 4OOYA 1T18A 2H10A 1LL9A 1KE0A 1FOFA 3RH8B 2FFFB 2ZL1B 2L4RA 1Y4OA 4HJ3A 1YLJA 3B47A 2VGLM 2XRNA 2EA9A 1FSWA 2W1RA 3BFGA 5TR7A 4R38A 4WL9A 4F3LB 3WS2A 4N9LA 5FATA 3ZNTA 3PBQA 3CITA 5CGWA 1M6KA 4HNBA 2P7JA 1S1YA 3S7QA 2VA0A 3MXSA 1H5XA 4GW9A 1E4DA 4Q8IA 2ZQAA 5FQMA 4C75A 4UEYA 2I9VA 4B93A 1BULA 1O7EA 4CLCD 2Z2MB 3HBRA 1G5UA 3FG8A 1ES2A 2RCXA 5EVID 4PKYG 4KZ3A 4ME4A 2J3TC 4QY5A 3UDFA 4LPZA 1K25A 5GLDA 2V20A 4LFUA 2O9CA 5JYPA 2V2FF 1MXOA 5AQAA 4GOGA 4RA7A 1HLUP 4QB8A 3PXPA 2W1TA 4P0MA 2WZXA 2W27A 1FR1A 2PYRA 2WKRA 4ETZA 5LBRA 3CI6A 4MBHA 1W7FA 3C30A 5DFXA 3OCLA 3TOIA 4Y3IA 5L07A 4AFIA 3B33A 3MXRA 2ZM8A 2E8JA 1N9OA 4P6ZM 2GZAA 2XA7M 2ZMFA 1S66L 2E8IA 1G6OA 3ZNYA 2EFUA 4K0XA 4JGRA 1ZKJA 5E2HA 2R9WA 5A93A 4EEPA 3UMEA 4E6WA 1XGJA 1XP4A 3E4QA 1ACFA 3VMAA 5F6AA 4I3IA 2XEPA 5FDSA 2PU4A 5KZHA 1LLBA 3UB8A 2ZQ8A 4FOFA 4O8GA 4MN5A 3PBTA 2M7UA 2JN7A 2B5RA 1IOUA 1NYYA 3M6HA 1M40A 3UY6A 4E04A 4QHCA 4MNRA 5EOOA 3VOYA 3T4JA 3CUEC 1PWGA 4WYYA 3WRZA 3O86A 2OOLA 2WGVA 3EQVA 1BT5A 4HHDA 3C38A 1PNEA 2Z2LB 4JXWA 4Q0JA 1PI4A 3LI9A 2EXAA 2W1TB 3PYPA 4X56A 1SKFA 3IQAA 3VP2A 1K6SA 1KOUA 4DRTA 3KYQA 5U47A 1KGGA 2Y2PA 3QP8A 1XGIA 4HP4A 5F69A 1UGUA 5GLCA 4MBKA 3V67A 2XGNA 1J3WA 3PTEA 4IBXA 2V8FA 5FAPA 3G32A 3LUQA 3FC7A 2VV7A 3VSKA 3LR5A 2WGIA 4WZ4A 4PM6A 4XUXA 5JYOA 3MSHA 1JTGA 3C4OA 3UMDA 3NHQA 3Q07A 3JVVA 1LSXA 2WAFA 1MKMA 1Z09A 4L0LA 2QMIA 3ZDJA 2VK3A 4RX2A 3CAXA 2W0NA 5GHXA 2CC1A 3W4PA 2KLIA 2XLNA 2P04A 4UQIS 3BY9A 1H8YA 3T4TA 4YOFA 4JGPA 4R3AA 1OPXA 3IT9A 1CK3A 4WMCD 1A0KA 1S67L 4LRYC 3EWKA 4IHQA 1JWZA 5FAQA 2PU2A 3HUMA 5TFQA 4FUWA 2WUQA 1KDSA 4JLFA 1SDEA 3DWKA 2L1MA 3ZGAB 3LIAA 4LLOB 3T50A 5DJTA 2WAEA 3VP0A 4IVKA 4B4ZA 4Y13A 2Q9MA 1ES3A 3PAGA 3WS0A 2CMNA 3DAVA 1ZTUA 3OLOA 2ZC3B 2INWA 5E43A 4BLMA 3HLDA 5EVEA 5FQJA 3WS1A 5FI2A 1T1CA 5FA7A 5M18A 4Q0HA 1E25A 3D9YA 1IYQA 1GHMA 4RVAA 4KG6A 4HIAA 2H0YA 3UPOA 4Y0UA 3Q7VA 5FEFA 3NI9A 4K91A 2P74A 4WLAA 4JXVA 3PAEA 4Z1WA 4NXBA 4EERA 2XQZA 3BFFA 3GV9A 2O99A 2EX9A 2Y59A 1EW0A 2K7SA 1MWTA 4O0PA 3ZVWA 1UWNX 2QJ5A 1LI0A 2JHEA 4G3KA 3SW1A 3HLFA 3LR0A 4KG5A 2Y4AA 1FILA 3NDGA 2J7VA 4IUHA 4JPMA 4U0XA 4S2NC 3HUNA 2C5WB 1H8ZA 5IU1A 1NRFA 1PW1A 5CRFA 2Y2QA 3SS5A 1YMXA 3S4XA 2XFTA 3NULA 2XD5A 3S7OA 4S2KA 3T4QA 3MZFA 5CHUA 5CGSA 1H0MA 1KE4A 3GVBA 2ZM0A 1PZOA 1NZUA 3G2ZA 2K2NA 2JKRI 2V9AA 3ITAA 3GRJA 1RCJA 4GDNA 1K4FA 3ITBA 4CLCC 3OCNA 2JKGA 1NY0A 5EVLA 4GS9A 3NIAA 1BLPA 3DWZA 3UPPA 3OOVA 1TVFA 5EVIC 3MBZA 1K4EA 3Q81A 4IVIA 3UDIA 4QU3A 4O7DA 1TDLA 2WGWA 3Q7VB 4KQQA 2QPNA 4BL3A 4CQHA 4UQIM 1N4OA 4OKPA 4X25A 4HJ4A 4Z9QA 3LEQA 5HARA 3BEBA 4RX3A 1YSPA 3H9WA 2HF6A 5I94A 3CUEA 2FH5A 3RXXA 1CF0A 4U3TA 2DRWA 3BQAA 2QHKA 4BBVA 3GSGA 3MFDA 3B3XA 3RFBA 4I39A 2Q0OA 5HD5A 1EWZA 5HW3A 1MBLA 1XFNA 4YFMA 4L9GA 4JKTA 1OTEA 4XT2A 2JKRM 2ZLYA 3MMHA 3IS2A 4MCWA 3ULFA 4OPYA 5HPFA 2ZC5B 4HJ6A 2B02A 3EOIA 3HLWA 1HVBA 2PYPA 3TRCA 4C6YA 4GS9B 3G35A 3H82A 2A3UA 1ALQA 1GHPA 1T19A 2Y2IA 2BG1A 1IKGA 2PR6A 2WGWB 4QWOA 3OPLA 5DTKA 2D02A 3N8LA 4KG2A 1BUEA 4Q0IA 3BM6A 4PPRA 1S1ZA 2ZOHA 3T1QB 3UB9A 4DE3A 1XX2A 3MQOA 5DF7A 4MDZA 3LO7A 4HEFA 4ZJ1A 4PKYA 2EFXA 1JTDA 2Y91A 1F9IA 4HESA 5HDCA 5IS1A 5G18A 1XA7A 3VP3A 3HCYA 1DJBA 2HJEA 1P97A 5EM0A 1Y28A 3V39A 1RGYA 4XT2B 5GLBA 1AWIA 3NC8A 1MWRA 4OLDA 4E3KA 3IS2B 1T1BA 1XJ4A 4DE2A 2EX8A 4JGQA 4ESPA 1FSYA 1IKIA 5GL9A 1MKIA 1YLYA 3V5MA 2XK1A 3ZG9B 4CJNA 1ONHA 3H82B 4OH0A 4E3LA 4OQHA 4R3BA 1PIOA 1DP9A 5A92A 3KSGA 1LSVA 3IWQA 3W8KA 1N9LA 4M3KA 3Q1FA 3LIEA 3C7VA 4ETXA 4D2OA 2OAP1 1ZHHB 2BLSA 2PHYA 3IXHA 2V1AA 2HV1A 4HH2A 1L0GA 1W63M 2PT7A 5E2EA 4GD8A 2XD1A 3QNBA 2JCHA 3DTIA 3K3DA 1CI8A 3MF0A 4NETA 3N8RA 4FH2A 3TG9A 3HLCA 3CG5A 4LCLA 5M1AA 4LV3A 4CPKA 1BZAA 4A5RA 1YQSA 4BD1A 4GHIA 3ZQ5A 2K31A 3WS5A 4KZBA 1OTAA 4FD8A 3ZHHA 5FEGA 1PI5A 4S2NA 4Y5FA 5GLAA 3BFCA 4JF5A 3VV4A 4EESA 3WWXA 5FQKA 1V9ZA 1GSWA 1YLWA 3LEZA 4I38A 1LL8A 4B9OA 3Q82A 3T1RA 1PW8A 4FSFA 5DVAA 2V1ZA 1VETA 3CHWP 1OT9A 3IWIA 4Y15A 4CLCA 1BSGA 4EUZA 2PBDP 4P87A 3T1XA 1BLHA 1K56D 5EVIA 5CX7A 3AGEA 1SZVA 1CEFA 5HAIA 4S2JA 4X1LA 2WKHA 4BL2A 2H5SA 2VX8A 2Z6DA 1K55A 4Y0OA 4FTXA 2GX5A 5J7EA 2JKFA 5AQBA 4WF0A 1MWSA 5EE8A 1IELA 2W3DA 1H3QA 4GHIB 4EWFA 2OWHA 3T4LA 3EEHA 4IUKA 1S6RA 2EX2A 5EOEA 2G7UA 2Y2JA 3AGDA
chains in the Genus database with same CATH topology
3LGOA 1HLUP 5EVEA 3T1QB 5FEGA 3L7HA 1J3WA 3L9KA 2HZ5A 2V8FA 3D9YA 1SKOB 1FIKA 4X25A 1VETB 3MS6A 3LEQA 2E8JA 2PRFA 4X1MA 1D1JA 3MSHA 1PRQA 2ACGA 5FEFA 3T1RA 1K0KA 1CF0A 5EM0A 3T12B 1Z09A 1SKOA 1VETA 3T1SA 2VK3A 1AWIA 1YPRA 2ZL1B 3CHWP 1ACFA 1PFLA 5EV0A 4D60A 1Y4OA 3NECA 1F2KA 5FDSA 4ESPA 3KYEA 2PBDP 3U4LP 3T1XA 1VEUB 1FILA 3CPTB 1SZVA 5EM1A 1A0KA 2ZL1A 4X1LA 3NULA 1VEUA 4FUWA 3CPTA 1CJFA 4FTXA 2BTFP 2JKFA 1G5UA 1PNEA 3UB5P 2V8CA 2PAVP 1CQAA 2JKGA 3DAVA 4QWOA 2B95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LGO A;  1HLU P;  5EVE A;  3T1Q B;  5FEG A;  3L7H A;  1J3W A;  3L9K A;  2HZ5 A;  2V8F A;  3D9Y A;  1SKO B;  1FIK A;  4X25 A;  1VET B;  3MS6 A;  3LEQ A;  2E8J A;  2PRF A;  4X1M A;  1D1J A;  3MSH A;  1PRQ A;  2ACG A;  5FEF A;  3T1R A;  1K0K A;  1CF0 A;  5EM0 A;  3T12 B;  1Z09 A;  1SKO A;  1VET A;  3T1S A;  2VK3 A;  1AWI A;  1YPR A;  2ZL1 B;  3CHW P;  1ACF A;  1PFL A;  5EV0 A;  4D60 A;  1Y4O A;  3NEC A;  1F2K A;  5FDS A;  4ESP A;  3KYE A;  2PBD P;  3U4L P;  3T1X A;  1VEU B;  1FIL A;  3CPT B;  1SZV A;  5EM1 A;  1A0K A;  2ZL1 A;  4X1L A;  3NUL A;  1VEU A;  4FUW A;  3CPT A;  1CJF A;  4FTX A;  2BTF P;  2JKF A;  1G5U A;  1PNE A;  3UB5 P;  2V8C A;  2PAV P;  1CQA A;  2JKG A;  3DAV A;  4QWO A;  2B95 A; 
#chains in the Genus database with same CATH topology
 3A0V A;  5CEB A;  4WZ5 C;  3LGO A;  2HDS A;  3IX3 A;  5TBM A;  3TSG A;  1TDG A;  1P9W A;  2ZOI A;  4WEK A;  4EXO A;  4QY6 A;  5D3O A;  2QWS A;  1YKD A;  5HDS A;  4UHU A;  3NBL A;  5A8B A;  2HZ5 A;  4O01 A;  2J9O A;  1KGE A;  3UE3 A;  3W4Q A;  1BYW A;  1VET B;  5HFO A;  1YLP A;  1ESU A;  3GQZ A;  5HAQ A;  5J4E A;  4X69 A;  4EW7 A;  2PRF A;  3N7W A;  2O9A A;  4R4S A;  5KSC A;  3UDX A;  1XPB A;  3UNW A;  4OOM A;  4CLC B;  1TS0 A;  3MXQ A;  5FI6 A;  1W5D A;  2VV6 A;  3HLB A;  4YWZ A;  5EVI B;  1CI9 A;  1SKO A;  3NOP C;  3CJM A;  2HDR A;  2GNX A;  1XA1 A;  4OQI A;  3D72 A;  2Y2L A;  4S2I A;  3KYE A;  4LV1 A;  1PYY A;  3FV7 A;  3E0Y A;  2JKT M;  1OJ5 A;  1I2W A;  5HX9 A;  4EQI A;  2Y2H A;  2WKI A;  3BEC A;  3VE3 A;  3KO6 A;  4OP8 A;  1OTD A;  4R4R A;  3QHY A;  1NYM A;  1FCO A;  4IJG A;  3CPT A;  4ZTK A;  4PMA A;  4RQ9 A;  2AVX A;  5TBM B;  3RXW A;  1SCW A;  3DBA A;  1KVM A;  3BRM A;  3IXD A;  2EWW A;  4NXF A;  4X68 A;  3QP5 A;  2EX6 A;  4JXG A;  3S22 A;  1KE3 A;  4P6B A;  3ZYT A;  4ZJ2 A;  4NEE D;  3PBN A;  1QMF A;  5HWW A;  4GJ4 A;  4WBG A;  2GJ3 A;  4HI4 A;  3P01 A;  1IEM A;  4JBF A;  5HL6 A;  1CEG A;  1SKO B;  1G28 A;  2WKP A;  3KSF A;  2V0U A;  3HJI A;  1NXY A;  3O88 A;  4DJ2 A;  5AVE A;  2O9B A;  3Q7Z A;  4S2P A;  2OLV A;  1ERM A;  2VEA A;  3IBR A;  5FQI A;  5L10 A;  4ZAM A;  3LYX A;  4JGO A;  1DP6 A;  4UAA A;  5J3W A;  3NEC A;  2J3T D;  4NG2 A;  2XR0 A;  4L9E A;  4Y0T A;  3SOI A;  5FDH A;  4HQA A;  3C4P A;  1HZO A;  3CPT B;  3DTK A;  1O07 A;  4OPR A;  2FFY A;  4MN6 A;  4R70 A;  4EBL A;  1KGF A;  4R6L A;  2QJ7 A;  1DY6 A;  3G2Y A;  3ZFZ A;  3IHB A;  4NXE A;  5L2F A;  3P98 A;  1NWZ A;  4DE0 A;  4KUK A;  4GZB A;  1XKZ A;  4HBT A;  4LRX C;  4Y2F A;  3FKV A;  4KZ7 A;  2V8C A;  4BBT A;  1Q2P A;  3IHA A;  4BEN A;  4KQR A;  5FL3 A;  2XF3 A;  3BWL A;  1WYB A;  5C5K A;  3E4O A;  3UE0 A;  1OJG A;  1YSQ A;  2XDM A;  3L9K A;  3SS4 A;  4M4X A;  1K54 C;  2DCF A;  1FIK A;  3ICY A;  3UB6 A;  3FPW A;  3V3R A;  2W3F A;  4MN7 A;  3NJA A;  4GKU A;  2KDK A;  2QKP A;  4CLC E;  3U2A A;  1YLT A;  4X1M A;  1PRQ A;  3T4K A;  1NJ4 A;  1GHI A;  3LIB A;  1YM1 A;  3UO9 A;  1NLY A;  3E2L A;  3VOL A;  2HP9 A;  1RGZ A;  2EWV A;  3MR0 A;  1BTL A;  5KIZ A;  1JVJ A;  5EV0 A;  2C6W B;  3UE1 A;  4B4X A;  4OQG A;  2HPB A;  2X71 A;  1F2K A;  3M6B A;  1OTB A;  4E3M A;  2M7V A;  4OOL A;  1L0F A;  4WZ5 A;  3KSH A;  1ESI A;  4DDS A;  3IF5 A;  4OPZ A;  3OPH A;  4R1G A;  1TS6 A;  4XXR A;  1L2S A;  2J80 A;  4PAU A;  3E4P A;  3T4S A;  1C3B A;  5DKK A;  2VLG A;  1VEU A;  3NCK A;  1E3U D;  5L8M A;  1NLZ A;  5FQ9 A;  3O5Y A;  1KVL A;  3UPN A;  3UE6 A;  5EUA A;  5TGF A;  3JPU A;  3MFX A;  4K08 A;  3CZD A;  3IH9 A;  5FAS A;  5HAP A;  3IH8 A;  4RYE A;  3S1Y A;  1RP5 A;  3H7W A;  4KZ8 A;  1PWD A;  2ZQ7 A;  4UA9 A;  4DKI A;  4EUV A;  3FWL A;  5I5L A;  4E3J A;  4P85 A;  2Z6C A;  3A3D A;  3M2K A;  5EPH A;  3L7H A;  3A0S A;  1ODV A;  5DTS A;  3BLM A;  1J9M A;  2KX6 A;  3PBO A;  4C3Q A;  4L9F A;  5G4Z A;  3SZT A;  2ZMA A;  4E3N A;  1LT0 A;  1VQQ A;  1S4R A;  2V1B A;  2ZMV A;  3FYZ A;  2ACG A;  4PHT A;  4KZ6 A;  1K0K A;  1H8M A;  3IXG A;  4P6Z S;  1LI9 A;  1ZC2 A;  4DE1 A;  3HLE A;  3HJK A;  1LSW A;  4X55 A;  3T1S A;  4EQ1 A;  1ONG A;  4EET B;  4WEJ A;  1PFL A;  1F5M A;  5F68 A;  4GCZ A;  3OBF A;  4HBU A;  3WS4 A;  3K3C A;  4OON A;  1ZG6 A;  2ZJ9 A;  3O3V A;  3JYI A;  1VEU B;  2G2U A;  2NUT C;  1K57 C;  3S7P A;  5EM1 A;  2OLU A;  1I5Q A;  1MC0 A;  4BWI A;  3A3I A;  4LRZ E;  3BFE A;  4ID4 A;  5HPI A;  5KSH A;  3W4O A;  1NZO A;  4X6T A;  5HD3 A;  3CLO A;  4MBF A;  3ZVT A;  5FAO A;  3SH7 A;  3H7W B;  5AJG A;  2J3W A;  1BLC A;  3TW8 A;  3C5A A;  1JWV A;  3IBJ A;  4ZRR A;  5F82 A;  3KYZ A;  4WN5 A;  1PZP A;  3D4F A;  3NOT C;  1CQA A;  4KZ5 A;  4HH3 A;  1GSV A;  3I7J A;  1N9B A;  4KZ4 A;  5EFW A;  2O0Y A;  3LFV A;  3LI8 A;  4OQ0 A;  1TF1 A;  4E3I A;  3OPP A;  2KOI A;  3VSL A;  2W3E A;  1JWP A;  3V50 A;  3LID A;  3E2K A;  3FKW A;  3R4K A;  2QZ6 A;  3GMW A;  1YT4 A;  4I5S A;  4NXG A;  4YIN A;  3S7N A;  2ZC4 B;  3G31 A;  2BAS A;  2P08 A;  3BYD A;  3LR4 A;  4FCF A;  3MKE A;  2HGV A;  1VM1 A;  5EEC A;  1GSX A;  3HLG A;  3LY4 A;  3MQ0 A;  2WKQ A;  3GEC A;  4WEL A;  3V3S A;  4MLL A;  3PBS A;  5CTM A;  2RL3 A;  3D3O A;  1Z6F A;  3GDI A;  1OTI A;  1VB6 A;  4U0T A;  3PBR A;  1X0O A;  4OPQ A;  3MKF A;  1MPL A;  1K54 A;  4NKP A;  3RTY A;  2LB9 A;  3C2W A;  5HWT A;  3SS3 A;  1F98 A;  4N1H A;  3FPV A;  2VZW A;  3F1N A;  5FI7 A;  4G3V A;  5E2G A;  2ZC7 A;  4JF6 A;  2Y55 A;  1VHM A;  4DXC A;  2M1C A;  4IED A;  2B95 A;  2R78 A;  3LIC A;  3DTE A;  4G3W A;  3QNC A;  4XUZ A;  1WE4 A;  1OME A;  2JKT I;  2HP6 A;  1TS7 A;  2B18 A;  3P7N A;  3MZD A;  3A0R A;  1HTZ A;  1STZ A;  2X02 A;  4E6X A;  4H8R A;  5F1F A;  2GDN A;  1W8Y A;  3QP1 A;  1ES4 A;  2UV0 E;  3LIF A;  3IF6 C;  1MZU A;  2FZ0 A;  1K56 A;  2VGJ A;  2V0W A;  3NOU C;  5DJU A;  1IFQ A;  3F1P A;  4KZA A;  5GHY A;  3C8C A;  4I3J A;  1MWU A;  3A3E A;  1GA0 A;  1EI5 A;  1P0Z A;  1OT6 A;  4Y17 A;  2Y2M A;  2X01 A;  2IWC A;  4D60 A;  4EBP A;  2A24 A;  1BLS A;  2Y8H A;  2OAQ 1;  1G6A A;  2W3G A;  3O87 A;  2WAD A;  2HP5 A;  4JXS A;  1D7E A;  4ZJ3 A;  1K6R A;  1LHY A;  2A2L A;  3F1N B;  2ZM2 A;  2UWX A;  2HJ9 C;  1L3L A;  4X53 A;  3BQ8 A;  3IX8 A;  5CTN A;  4HY8 A;  2IA2 A;  3E98 A;  1DRM A;  4WM9 A;  3N6I A;  3ISG A;  1ES5 A;  3CMZ A;  3W2Z A;  3P09 A;  3UB5 P;  3BY8 A;  3CWF A;  2OWJ A;  4LGW A;  4ARZ A;  2YKH A;  5FQQ A;  4F94 A;  5CEC A;  2W3H A;  2JE5 A;  3IX4 A;  1YMS A;  3BJN A;  1IYO A;  4BBU A;  5DF8 A;  3OZH A;  3EQU A;  1FQG A;  3F1P B;  5CHM A;  2QYB A;  1K57 A;  1WYC A;  3G6O A;  4FH4 A;  2HDU A;  3K2N A;  1UWP X;  5HDD A;  3G4P A;  4WUJ A;  5BOH A;  3FZC A;  3VFH A;  2A24 B;  3AGF A;  1S0W A;  5F1G A;  1TS8 A;  1FCN A;  3HL9 A;  2DMW A;  1FR6 A;  4QPR A;  5GHZ A;  1AXB A;  2LB5 A;  5CXW A;  2Y79 A;  3SH9 A;  1YPR A;  4H6J A;  2XFS A;  3N4I A;  4GNU A;  2Y2N A;  4BJP A;  3A3J A;  5F5Y A;  4GD6 A;  3VFF A;  4DDY A;  1XJ6 A;  2PD7 A;  4MEZ A;  5DTT A;  4WMC A;  2VKS A;  1ERO A;  1FCM A;  4EV4 A;  3N8S A;  3QP6 A;  2ZBB A;  3ZG0 A;  5CED A;  1HD8 A;  1N9N A;  1MY8 A;  2VV8 A;  2XSS A;  3VP1 A;  3KSI A;  4ARZ B;  2JC7 A;  3TJZ C;  1SDN A;  4LV0 A;  1T1A A;  2ZQ9 A;  1SHV A;  5L09 A;  1DP8 A;  3LR3 A;  3MJQ A;  1V9Y A;  1W79 A;  3BW6 A;  2DNS A;  2D01 A;  3HUO A;  3G34 A;  1PWC A;  4QD4 A;  5AQ9 A;  2WK0 A;  5K5B A;  5TJJ A;  3IXB A;  1I2S A;  5CER A;  2OSU A;  3UN7 A;  3T4O A;  2Y2O A;  4I3A A;  3HRE A;  5M19 A;  3JVU A;  4EEU A;  4DMZ A;  2H0T A;  4HOI A;  4S2O A;  4IBR A;  1XFQ A;  4R0Q A;  2NUP C;  2WYX A;  2I72 A;  3G30 A;  3EGX C;  1XJ2 A;  1TEM A;  4BD0 A;  3EGD C;  2G2W A;  4H6J B;  1DJC A;  1XJ3 A;  1ERQ A;  1D1J A;  1IYP A;  4LV2 A;  1GCE A;  1L0E A;  1Q2Q A;  3QP2 A;  3T12 B;  4PM5 A;  1JNU A;  3BFD A;  2XH9 A;  4R3J A;  5CHJ A;  5IHV A;  2J8Y A;  5DFY A;  2WKE A;  4EBN A;  3BLS A;  3NY4 A;  3NDE A;  4KQO A;  5A91 A;  1Y54 A;  2WZZ A;  4Y7P A;  2IWD A;  2HDQ A;  5KMW A;  1S4S A;  2EXB A;  3B42 A;  2P9V A;  5HL1 A;  3HVF A;  1K38 A;  1W8Q A;  3F1O A;  4OVD A;  3VP4 A;  3C7U A;  2Y2K A;  3WRT A;  4HP9 A;  4KZ9 A;  4E3O A;  2BTF P;  1WA9 A;  4DN0 A;  3IF6 A;  3DW0 A;  1XXM A;  2VGL S;  4S2M A;  2JBF A;  5HSQ A;  1LL5 A;  2PAV P;  2ZQD A;  3OPR A;  3VOZ A;  1K55 C;  3ZG7 B;  5DKL A;  4B88 A;  3A3F A;  4KUO A;  4GB7 A;  1P9R A;  4KQD A;  1NRJ A;  5F83 A;  1YLZ A;  5HZH A;  3PHY A;  4JF4 A;  4GLQ A;  2PDR A;  4GN2 A;  2R9X A;  3MQQ A;  5J8X A;  2ZD8 A;  3QP4 A;  5MC7 A;  4N9K A;  4LCM A;  3DTM A;  3MS6 A;  3MZE A;  4ZBE A;  4PM9 A;  3RJU A;  2A49 A;  5FSR A;  2Q9N A;  4DF6 A;  1GA9 A;  4OLG A;  4NK3 A;  5DF9 A;  3ZCZ A;  1D06 A;  4EU0 A;  2OV5 A;  3R7W A;  3KX0 X;  3PR6 A;  2L0W A;  1YAX A;  4UA6 A;  2P9V B;  2XRO A;  3F1O B;  1KDW A;  4PM7 A;  1E3U A;  4DJ3 A;  5IT5 A;  1QME A;  4KEN B;  4OP5 A;  3EEA A;  4II7 A;  3U4L P;  3SH8 A;  2PD8 A;  4K0W A;  2H28 A;  4N92 A;  3IF6 B;  2XA7 S;  3GR2 A;  4MMN A;  2ZL1 A;  5AVF A;  4GDB A;  4DXB A;  1U60 A;  4PM8 A;  5HWV A;  1TD5 A;  1IYS A;  4F3L A;  5E2F A;  1CJF A;  3LCE A;  4UA7 A;  4S2L A;  3UB7 A;  3VE4 A;  5G4Y A;  3LY3 A;  4BMW A;  3IWO A;  2YKF A;  3GTC A;  5AQ7 A;  3ZG5 A;  4QJG A;  2Y2G A;  4ZDX A;  5A90 A;  3TE8 A;  4YNR A;  5CGX A;  1L0D A;  3ZG8 B;  1ZG4 A;  4LEN A;  2ZQC A;  2PR5 A;  4R23 A;  4BQM A;  2VJW A;  2PBY A;  2MJ6 A;  3M2J A;  3R7W B;  3OC2 A;  2VGK A;  1W63 Q;  4N1X A;  2IWB A;  2ZC6 B;  2J9P A;  1G68 A;  1DJA A;  4OOY A;  1T18 A;  2H10 A;  1LL9 A;  1KE0 A;  1FOF A;  3RH8 B;  2FFF B;  2ZL1 B;  2L4R A;  1Y4O A;  4HJ3 A;  1YLJ A;  3B47 A;  2VGL M;  2XRN A;  2EA9 A;  1FSW A;  2W1R A;  3BFG A;  5TR7 A;  4R38 A;  4WL9 A;  4F3L B;  3WS2 A;  4N9L A;  5FAT A;  3ZNT A;  3PBQ A;  3CIT A;  5CGW A;  1M6K A;  4HNB A;  2P7J A;  1S1Y A;  3S7Q A;  2VA0 A;  3MXS A;  1H5X A;  4GW9 A;  1E4D A;  4Q8I A;  2ZQA A;  5FQM A;  4C75 A;  4UEY A;  2I9V A;  4B93 A;  1BUL A;  1O7E A;  4CLC D;  2Z2M B;  3HBR A;  1G5U A;  3FG8 A;  1ES2 A;  2RCX A;  5EVI D;  4PKY G;  4KZ3 A;  4ME4 A;  2J3T C;  4QY5 A;  3UDF A;  4LPZ A;  1K25 A;  5GLD A;  2V20 A;  4LFU A;  2O9C A;  5JYP A;  2V2F F;  1MXO A;  5AQA A;  4GOG A;  4RA7 A;  1HLU P;  4QB8 A;  3PXP A;  2W1T A;  4P0M A;  2WZX A;  2W27 A;  1FR1 A;  2PYR A;  2WKR A;  4ETZ A;  5LBR A;  3CI6 A;  4MBH A;  1W7F A;  3C30 A;  5DFX A;  3OCL A;  3TOI A;  4Y3I A;  5L07 A;  4AFI A;  3B33 A;  3MXR A;  2ZM8 A;  2E8J A;  1N9O A;  4P6Z M;  2GZA A;  2XA7 M;  2ZMF A;  1S66 L;  2E8I A;  1G6O A;  3ZNY A;  2EFU A;  4K0X A;  4JGR A;  1ZKJ A;  5E2H A;  2R9W A;  5A93 A;  4EEP A;  3UME A;  4E6W A;  1XGJ A;  1XP4 A;  3E4Q A;  1ACF A;  3VMA A;  5F6A A;  4I3I A;  2XEP A;  5FDS A;  2PU4 A;  5KZH A;  1LLB A;  3UB8 A;  2ZQ8 A;  4FOF A;  4O8G A;  4MN5 A;  3PBT A;  2M7U A;  2JN7 A;  2B5R A;  1IOU A;  1NYY A;  3M6H A;  1M40 A;  3UY6 A;  4E04 A;  4QHC A;  4MNR A;  5EOO A;  3VOY A;  3T4J A;  3CUE C;  1PWG A;  4WYY A;  3WRZ A;  3O86 A;  2OOL A;  2WGV A;  3EQV A;  1BT5 A;  4HHD A;  3C38 A;  1PNE A;  2Z2L B;  4JXW A;  4Q0J A;  1PI4 A;  3LI9 A;  2EXA A;  2W1T B;  3PYP A;  4X56 A;  1SKF A;  3IQA A;  3VP2 A;  1K6S A;  1KOU A;  4DRT A;  3KYQ A;  5U47 A;  1KGG A;  2Y2P A;  3QP8 A;  1XGI A;  4HP4 A;  5F69 A;  1UGU A;  5GLC A;  4MBK A;  3V67 A;  2XGN A;  1J3W A;  3PTE A;  4IBX A;  2V8F A;  5FAP A;  3G32 A;  3LUQ A;  3FC7 A;  2VV7 A;  3VSK A;  3LR5 A;  2WGI A;  4WZ4 A;  4PM6 A;  4XUX A;  5JYO A;  3MSH A;  1JTG A;  3C4O A;  3UMD A;  3NHQ A;  3Q07 A;  3JVV A;  1LSX A;  2WAF A;  1MKM A;  1Z09 A;  4L0L A;  2QMI A;  3ZDJ A;  2VK3 A;  4RX2 A;  3CAX A;  2W0N A;  5GHX A;  2CC1 A;  3W4P A;  2KLI A;  2XLN A;  2P04 A;  4UQI S;  3BY9 A;  1H8Y A;  3T4T A;  4YOF A;  4JGP A;  4R3A A;  1OPX A;  3IT9 A;  1CK3 A;  4WMC D;  1A0K A;  1S67 L;  4LRY C;  3EWK A;  4IHQ A;  1JWZ A;  5FAQ A;  2PU2 A;  3HUM A;  5TFQ A;  4FUW A;  2WUQ A;  1KDS A;  4JLF A;  1SDE A;  3DWK A;  2L1M A;  3ZGA B;  3LIA A;  4LLO B;  3T50 A;  5DJT A;  2WAE A;  3VP0 A;  4IVK A;  4B4Z A;  4Y13 A;  2Q9M A;  1ES3 A;  3PAG A;  3WS0 A;  2CMN A;  3DAV A;  1ZTU A;  3OLO A;  2ZC3 B;  2INW A;  5E43 A;  4BLM A;  3HLD A;  5EVE A;  5FQJ A;  3WS1 A;  5FI2 A;  1T1C A;  5FA7 A;  5M18 A;  4Q0H A;  1E25 A;  3D9Y A;  1IYQ A;  1GHM A;  4RVA A;  4KG6 A;  4HIA A;  2H0Y A;  3UPO A;  4Y0U A;  3Q7V A;  5FEF A;  3NI9 A;  4K91 A;  2P74 A;  4WLA A;  4JXV A;  3PAE A;  4Z1W A;  4NXB A;  4EER A;  2XQZ A;  3BFF A;  3GV9 A;  2O99 A;  2EX9 A;  2Y59 A;  1EW0 A;  2K7S A;  1MWT A;  4O0P A;  3ZVW A;  1UWN X;  2QJ5 A;  1LI0 A;  2JHE A;  4G3K A;  3SW1 A;  3HLF A;  3LR0 A;  4KG5 A;  2Y4A A;  1FIL A;  3NDG A;  2J7V A;  4IUH A;  4JPM A;  4U0X A;  4S2N C;  3HUN A;  2C5W B;  1H8Z A;  5IU1 A;  1NRF A;  1PW1 A;  5CRF A;  2Y2Q A;  3SS5 A;  1YMX A;  3S4X A;  2XFT A;  3NUL A;  2XD5 A;  3S7O A;  4S2K A;  3T4Q A;  3MZF A;  5CHU A;  5CGS A;  1H0M A;  1KE4 A;  3GVB A;  2ZM0 A;  1PZO A;  1NZU A;  3G2Z A;  2K2N A;  2JKR I;  2V9A A;  3ITA A;  3GRJ A;  1RCJ A;  4GDN A;  1K4F A;  3ITB A;  4CLC C;  3OCN A;  2JKG A;  1NY0 A;  5EVL A;  4GS9 A;  3NIA A;  1BLP A;  3DWZ A;  3UPP A;  3OOV A;  1TVF A;  5EVI C;  3MBZ A;  1K4E A;  3Q81 A;  4IVI A;  3UDI A;  4QU3 A;  4O7D A;  1TDL A;  2WGW A;  3Q7V B;  4KQQ A;  2QPN A;  4BL3 A;  4CQH A;  4UQI M;  1N4O A;  4OKP A;  4X25 A;  4HJ4 A;  4Z9Q A;  3LEQ A;  5HAR A;  3BEB A;  4RX3 A;  1YSP A;  3H9W A;  2HF6 A;  5I94 A;  3CUE A;  2FH5 A;  3RXX A;  1CF0 A;  4U3T A;  2DRW A;  3BQA A;  2QHK A;  4BBV A;  3GSG A;  3MFD A;  3B3X A;  3RFB A;  4I39 A;  2Q0O A;  5HD5 A;  1EWZ A;  5HW3 A;  1MBL A;  1XFN A;  4YFM A;  4L9G A;  4JKT A;  1OTE A;  4XT2 A;  2JKR M;  2ZLY A;  3MMH A;  3IS2 A;  4MCW A;  3ULF A;  4OPY A;  5HPF A;  2ZC5 B;  4HJ6 A;  2B02 A;  3EOI A;  3HLW A;  1HVB A;  2PYP A;  3TRC A;  4C6Y A;  4GS9 B;  3G35 A;  3H82 A;  2A3U A;  1ALQ A;  1GHP A;  1T19 A;  2Y2I A;  2BG1 A;  1IKG A;  2PR6 A;  2WGW B;  4QWO A;  3OPL A;  5DTK A;  2D02 A;  3N8L A;  4KG2 A;  1BUE A;  4Q0I A;  3BM6 A;  4PPR A;  1S1Z A;  2ZOH A;  3T1Q B;  3UB9 A;  4DE3 A;  1XX2 A;  3MQO A;  5DF7 A;  4MDZ A;  3LO7 A;  4HEF A;  4ZJ1 A;  4PKY A;  2EFX A;  1JTD A;  2Y91 A;  1F9I A;  4HES A;  5HDC A;  5IS1 A;  5G18 A;  1XA7 A;  3VP3 A;  3HCY A;  1DJB A;  2HJE A;  1P97 A;  5EM0 A;  1Y28 A;  3V39 A;  1RGY A;  4XT2 B;  5GLB A;  1AWI A;  3NC8 A;  1MWR A;  4OLD A;  4E3K A;  3IS2 B;  1T1B A;  1XJ4 A;  4DE2 A;  2EX8 A;  4JGQ A;  4ESP A;  1FSY A;  1IKI A;  5GL9 A;  1MKI A;  1YLY A;  3V5M A;  2XK1 A;  3ZG9 B;  4CJN A;  1ONH A;  3H82 B;  4OH0 A;  4E3L A;  4OQH A;  4R3B A;  1PIO A;  1DP9 A;  5A92 A;  3KSG A;  1LSV A;  3IWQ A;  3W8K A;  1N9L A;  4M3K A;  3Q1F A;  3LIE A;  3C7V A;  4ETX A;  4D2O A;  2OAP 1;  1ZHH B;  2BLS A;  2PHY A;  3IXH A;  2V1A A;  2HV1 A;  4HH2 A;  1L0G A;  1W63 M;  2PT7 A;  5E2E A;  4GD8 A;  2XD1 A;  3QNB A;  2JCH A;  3DTI A;  3K3D A;  1CI8 A;  3MF0 A;  4NET A;  3N8R A;  4FH2 A;  3TG9 A;  3HLC A;  3CG5 A;  4LCL A;  5M1A A;  4LV3 A;  4CPK A;  1BZA A;  4A5R A;  1YQS A;  4BD1 A;  4GHI A;  3ZQ5 A;  2K31 A;  3WS5 A;  4KZB A;  1OTA A;  4FD8 A;  3ZHH A;  5FEG A;  1PI5 A;  4S2N A;  4Y5F A;  5GLA A;  3BFC A;  4JF5 A;  3VV4 A;  4EES A;  3WWX A;  5FQK A;  1V9Z A;  1GSW A;  1YLW A;  3LEZ A;  4I38 A;  1LL8 A;  4B9O A;  3Q82 A;  3T1R A;  1PW8 A;  4FSF A;  5DVA A;  2V1Z A;  1VET A;  3CHW P;  1OT9 A;  3IWI A;  4Y15 A;  4CLC A;  1BSG A;  4EUZ A;  2PBD P;  4P87 A;  3T1X A;  1BLH A;  1K56 D;  5EVI A;  5CX7 A;  3AGE A;  1SZV A;  1CEF A;  5HAI A;  4S2J A;  4X1L A;  2WKH A;  4BL2 A;  2H5S A;  2VX8 A;  2Z6D A;  1K55 A;  4Y0O A;  4FTX A;  2GX5 A;  5J7E A;  2JKF A;  5AQB A;  4WF0 A;  1MWS A;  5EE8 A;  1IEL A;  2W3D A;  1H3Q A;  4GHI B;  4EWF A;  2OWH A;  3T4L A;  3EEH A;  4IUK A;  1S6R A;  2EX2 A;  5EOE A;  2G7U A;  2Y2J A;  3AGD A; 
#chains in the Genus database with same CATH homology
 3LGO A;  1HLU P;  5EVE A;  3T1Q B;  5FEG A;  3L7H A;  1J3W A;  3L9K A;  2HZ5 A;  2V8F A;  3D9Y A;  1SKO B;  1FIK A;  4X25 A;  1VET B;  3MS6 A;  3LEQ A;  2E8J A;  2PRF A;  4X1M A;  1D1J A;  3MSH A;  1PRQ A;  2ACG A;  5FEF A;  3T1R A;  1K0K A;  1CF0 A;  5EM0 A;  3T12 B;  1Z09 A;  1SKO A;  1VET A;  3T1S A;  2VK3 A;  1AWI A;  1YPR A;  2ZL1 B;  3CHW P;  1ACF A;  1PFL A;  5EV0 A;  4D60 A;  1Y4O A;  3NEC A;  1F2K A;  5FDS A;  4ESP A;  3KYE A;  2PBD P;  3U4L P;  3T1X A;  1VEU B;  1FIL A;  3CPT B;  1SZV A;  5EM1 A;  1A0K A;  2ZL1 A;  4X1L A;  3NUL A;  1VEU A;  4FUW A;  3CPT A;  1CJF A;  4FTX A;  2BTF P;  2JKF A;  1G5U A;  1PNE A;  3UB5 P;  2V8C A;  2PAV P;  1CQA A;  2JKG A;  3DAV A;  4QWO A;  2B95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...