4IVIA

Crystal structure of a family viii carboxylesterase.
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
404
structure length
404
Chain Sequence
AEGPVTATKPKEAGFTSEGLARIDAYLKNEIQAKTMPGAVMMIKRNGETAYFSSFGLRDPDTKEPMTAETIFRIYSMSKPITTVAAMMLVEEGKLQLDEPVSKYIPSFANVKVGVETKGENGMALETGPVKRAITIQDLMRHTSGITYGFVGDGLVKKAYIASNLFDGDFDNAEFAERIAKLPLVYQPGTTWDYGHSTDILGRVVEVVSGKSLYQFEKERLLDPLGMKDTGFYVTDPAKKSLVAEAMPNDRKIGGSEMFDPRVQKKWEPGGQGMVSTIGDYARFTQMVLNGGTLDGKRYLSPKTIAYMGSNHIPQASGIVPGAYYLPGPGVGFGLGFAVRTEAGVTPVEGSVGDLSWGGAGGTVFWIDPKENLTVVFMAPMVSPRARVWRTLRNIVYGAFDRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Carboxylesterase
publication title Structural basis for the beta-lactamase activity of EstU1, a family VIII carboxylesterase.
pubmed doi rcsb
total genus 125
structure length 404
sequence length 404
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2013-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4iviA00
1NJ4A 3VP2A 3OZHA 3BFFA 3AGFA 1MBLA 1SCWA 4R0QA 1ONGA 2C6WB 3PAEA 3UY6A 1YM1A 4KZ3A 4GDBA 1S6RA 4Y0TA 4CPKA 3ISGA 2A49A 3M6BA 1BUEA 3HLDA 5AQ7A 5GLCA 1YLJA 3AGDA 5FAOA 1C3BA 3BLMA 5CHUA 4B88A 5F1FA 3GTCA 1DJBA 4HESA 2WKIA 4YINA 5FQJA 2WK0A 4EBPA 3IF6C 3IXHA 1RCJA 3RXXA 3B3XA 4OLGA 1Q2QA 3IF6A 3QHYA 4S2NA 5GLBA 5CRFA 1L0EA 4B4XA 1L2SA 3S4XA 5CERA 2J8YA 4WEJA 3IWOA 1PW8A 5GHXA 3WS2A 1BLPA 1CI9A 3GVBA 5G18A 5E2GA 3VP4A 1FQGA 1NXYA 1S0WA 4QU3A 1NZUA 4EV4A 3QNCA 5CTMA 2ZM8A 4CJNA 3A3IA 3VP3A 1MWRA 2VGJA 4KZ5A 3OCLA 5D3OA 3BFCA 4GZBA 4JXGA 4FSFA 1XP4A 3BRMA 1I2WA 3TOIA 4KQOA 4U0XA 3HLFA 5M18A 4JXWA 4PM6A 4IVKA 4QHCA 4GD8A 4R3JA 4ZJ3A 3IHAA 4ZTKA 4E3OA 4OQHA 4BJPA 5HW3A 1DY6A 3D4FA 3BECA 4JPMA 3C7VA 1NYYA 3VP0A 1WYBA 1QMFA 2C5WB 1XPBA 2Y2JA 1PIOA 1E3UA 2XR0A 2BLSA 3IXGA 1ERQA 1FCOA 4DDSA 3NDGA 1LLBA 2E8IA 4R4SA 3IWIA 4Q8IA 3DTMA 3WRTA 1E3UD 1SDNA 2JE5A 1LL9A 3M2KA 4O7DA 3UO9A 1ALQA 3LO7A 3VP1A 1XGIA 4IEDA 1JWVA 1PZOA 3IXBA 3V50A 1Q2PA 1VM1A 1XX2A 3DWKA 3MZDA 3O86A 1K25A 4JXSA 1J9MA 3QNBA 5CXWA 4QJGA 2Y2IA 1LI0A 5J8XA 3C4OA 5FQMA 1CK3A 1K4EA 3RJUA 4FH2A 2A3UA 3MZFA 3PBQA 1PI4A 1ES4A 3E2LA 3HVFA 1IKGA 5A90A 2Y2OA 2Y2LA 4E3JA 2WZZA 5HAPA 1RGYA 1I2SA 4MBFA 1H5XA 3NBLA 1ZG6A 4WELA 4Z9QA 5IHVA 4HBTA 1O07A 1YLWA 3CJMA 4RA7A 5EECA 4X56A 5FATA 3G30A 2P9VB 4DDYA 1ZKJA 4OOMA 4XUZA 3W4PA 3ZHHA 1GHIA 1HD8A 5DF8A 1M6KA 4FH4A 5F82A 4RX3A 5F83A 3M6HA 3P09A 4DRTA 2XEPA 4UAAA 2HPBA 4S2MA 1XXMA 1IELA 5GHZA 3OPRA 1L0DA 2WKEA 2X02A 3P98A 4X69A 5E2FA 5AQBA 2HP5A 1YLYA 2IWBA 5A92A 4XUXA 4WZ5C 3Q1FA 4P87A 4ZDXA 3CMZA 3UNWA 4YFMA 4H8RA 4WZ5A 5FAQA 3PTEA 3G2ZA 4LENA 4OH0A 3UN7A 5I94A 2WYXA 4FCFA 1YQSA 4KG6A 4E3MA 4LV3A 3SS4A 2JCHA 4KENB 4X53A 5CGSA 5FQQA 3N6IA 3G2YA 2OLVA 4JF4A 1N9BA 3ZGAB 3C7UA 4S2LA 2Y59A 3V3RA 2UWXA 4KQQA 1RGZA 4N1HA 3EQVA 4LV1A 3BFDA 3CZDA 4LCLA 3ZG5A 2WAFA 1KGGA 5AQAA 1ES5A 2PU4A 3G35A 3IT9A 3PAGA 5EUAA 3BYDA 1EI5A 2OSUA 3JYIA 5EOOA 4ZJ2A 1BT5A 4JXVA 1BLSA 1TVFA 1WYCA 3BEBA 2XF3A 3E2KA 1KGFA 2DNSA 3HREA 3ITBA 4HEFA 4L0LA 5CHMA 4DE2A 1YLZA 1KVLA 5CGXA 4QB8A 3UPOA 1K6RA 4Y7PA 1DJCA 3FZCA 3HUMA 3HUNA 1BULA 3CG5A 2XK1A 3NDEA 4OPRA 3O3VA 3DWZA 2ZJ9A 4JKTA 1FSWA 2ZLYA 3HL9A 3NC8A 2ZM2A 3OCNA 4OQIA 5HARA 4X68A 4ZAMA 4S2OA 1IYSA 1NYMA 5JYOA 3S1YA 2WGWB 4QD4A 5E2EA 2EX2A 3GR2A 2QMIA 4MEZA 2J9PA 4GB7A 4RVAA 4WM9A 2V1ZA 3UDFA 3V39A 4BL3A 1AXBA 2GDNA 3GMWA 1K54C 5EVIB 4EBLA 3ITAA 2XH9A 5M19A 1KDWA 5HX9A 3Q7ZA 4N9LA 4PM5A 4WEKA 2QPNA 4ZBEA 2PBYA 3UE1A 4IVIA 1N4OA 3AGEA 4GNUA 2Q9NA 1ES3A 3LEZA 2PU2A 4IBXA 3LCEA 4OONA 5HL1A 3OPHA 3G31A 2XD5A 3Q7VA 4KZ4A 3IH8A 4OLDA 3VFFA 2H10A 4KG2A 1KVMA 5CECA 3SOIA 4E3NA 4C75A 1K4FA 5FASA 5KMWA 1CI8A 1W8YA 4E3LA 5CEDA 4RX2A 1NRFA 3HUOA 3UPPA 4N9KA 4NETA 1E4DA 1XKZA 1YLPA 3BFGA 4MBKA 2WGVA 3WS0A 2Y2NA 3ZNYA 1M40A 3A3FA 4S2KA 3O88A 4DKIA 3HLBA 1W79A 1H8YA 2CC1A 1KE4A 2Y2QA 5FQKA 5KZHA 2OLUA 2HP9A 4DXCA 3BM6A 4KG5A 4R3BA 5E2HA 4EWFA 1GA0A 2ZD8A 5DTKA 3BFEA 3N8RA 4PM7A 3LY3A 3HLEA 2Q9MA 1HTZA 3FV7A 5CTNA 2ZM0A 1LL5A 1SDEA 1G6AA 1VQQA 2Z2MB 4DE3A 1W5DA 1JVJA 4UA7A 1PWGA 2QZ6A 5FI6A 5JYPA 1RP5A 3IF6B 3IF5A 3PBOA 2Y2MA 3PBSA 4OOYA 5GHYA 5GLAA 1DJAA 2WUQA 3GV9A 4PM9A 4KZ9A 3SH7A 5EVLA 2RL3A 5HAQA 3PBNA 1ZG4A 1G68A 3UDXA 3FKVA 3ZFZA 5FQ9A 3WS4A 4PM8A 3N8LA 4LV0A 3OPLA 1KDSA 3VOZA 2BG1A 4Y0OA 2XQZA 3WWXA 4X6TA 3GSGA 1ZC2A 1NY0A 3MXRA 4C6YA 5GLDA 3G32A 5HFOA 3C4PA 3VMAA 3ZDJA 1YT4A 2Y2HA 3A3JA 4ZJ1A 4MLLA 3FWLA 3Q82A 3A3EA 1ESIA 2V2FF 5DF7A 1MKIA 4BENA 1OMEA 1K6SA 3NIAA 1GA9A 3O87A 4OPQA 1KE0A 2EX9A 3SH8A 5DTTA 2B5RA 2XDMA 1YMSA 4JBFA 4B4ZA 1EROA 1K56A 4PPRA 3FKWA 2HDRA 3VSLA 5FAPA 1HZOA 1L0GA 2WADA 3V5MA 5A93A 2EFXA 1K56D 1FR1A 1W7FA 5DF9A 5AQ9A 2ZC6B 3EQUA 4N92A 3N7WA 1MWSA 2J9OA 4ID4A 2R9XA 2IWCA 3HLCA 4MBHA 5E43A 3ZVTA 5GL9A 1KE3A 3WRZA 3HLGA 4OQGA 4R1GA 4Y0UA 1LI9A 4EUZA 1KGEA 1XA1A 4LCMA 3VSKA 1GCEA 3VFHA 1BSGA 3UPNA 3C5AA 1XGJA 1ES2A 1I5QA 2ZC3B 2Y2PA 1BZAA 4GD6A 1PWCA 1XA7A 2ZC5B 4U3TA 5EPHA 3MBZA 4X55A 3UE0A 2XFTA 2ZMAA 5KSCA 4OVDA 3ZVWA 4OP5A 5TFQA 2ZQ7A 3IWQA 3WS1A 3N8SA 2OV5A 1FSYA 1H8ZA 4S2JA 5DTSA 3NI9A 1PZPA 2G2WA 4KZAA 4OOLA 3Q81A 5HAIA 1TDGA 2X71A 5EOEA 1K54A 2XGNA 4S2NC 4K91A 2X01A 2J7VA 4QY6A 4K0XA 4KZ7A 4BD1A 2JBFA 2HDSA 3OC2A 4OP8A 3MKEA 1FCNA 2Y55A 4MNRA 4U0TA 2JC7A 4JF6A 2HP6A 1QMEA 5M1AA 1SKFA 2P9VA 4DE0A 1MWUA 4XXRA 1YMXA 2P74A 5CGWA 2Y2GA 3M2JA 4BD0A 4DF6A 1PI5A 3IQAA 3NY4A 2WKHA 3GQZA 3MKFA 3G4PA 4OKPA 4S2PA 3ZG0A 1BTLA 4BQMA 3W4QA 4DE1A 2ZQ9A 2H0YA 4C3QA 2V20A 1K55C 5CEBA 4UA9A 2HDQA 2IWDA 3IHBA 4FD8A 4OPYA 1K57C 4KZ8A 1K55A 3ZG8B 3PBRA 2Y91A 1CEFA 2G2UA 2XD1A 2ZQ8A 3HBRA 1JTGA 3W4OA 1GHPA 3UE3A 1K57A 5U47A 4D2OA 4WZ4A 4BL2A 4OQ0A 4R4RA 4BLMA 1MPLA 4IBRA 3MFDA 3W8KA 3WS5A 1W8QA 4E3KA 1TEMA 2H5SA 3SH9A 4E6WA 1CEGA 1WE4A 5TGFA 3ZG7B 2VGKA 1MY8A 1BLCA 1GHMA 1PWDA 2FFFB 2WGIA 4JLFA 1Z6FA 4M3KA 4WBGA 2R9WA 4S2IA 3IXDA 3I7JA 1HVBA 2H0TA 3ZCZA 5TR7A 1FOFA 4P6BA 2EXAA 5FI2A 4GN2A 4N1XA 1SHVA 5KSHA 4DXBA 3A3DA 4WYYA 4E6XA 1LHYA 1MXOA 4GOGA 5FQIA 3SS3A 2FFYA 4PMAA 5FDHA 1ONHA 1IYQA 1JTDA 1JWPA 4GKUA 5DVAA 3UDIA 3VOYA 3MZEA 1IEMA 4E3IA 1IYPA 2RCXA 4R23A 3NCKA 4JF5A 4EQIA 2EXBA 1BLHA 3DW0A 2Y4AA 4UHUA 1IKIA 1YLTA 4KZ6A 5CHJA 3N4IA 3BLSA 4LV2A 4NK3A 2WAEA 2ZC7A 3V3SA 3ZG9B 1Y54A 2XFSA 4QY5A 2WGWA 1TDLA 2Z2LB 4GDNA 5EE8A 3Q7VB 4P0MA 2EX8A 5EVIC 1ESUA 4OPZA 1E25A 1NZOA 1K38A 5BOHA 3IH9A 1FR6A 5A91A 2DCFA 3TSGA 5EVIA 3GRJA 1O7EA 4WMCA 2ZC4B 5FI7A 4UA6A 5L2FA 3TG9A 4P85A 2WZXA 4KZBA 2HDUA 5EVID 5F1GA 3RXWA 4A5RA 2ZQAA 1ERMA 3Q07A 4WMCD 3FYZA 4K0WA 1PW1A 3LY4A 2ZQDA 2I72A 1MWTA 5FSRA 1L0FA 1JWZA 2XLNA 3G34A 3S22A 3ZNTA 4F94A 3MXSA 3HLWA 4HBUA 1FCMA 2EFUA 1EWZA 3SS5A 1U60A 4RYEA 1PYYA 4KQRA 3OPPA 2Y2KA 2EX6A 2DRWA 1IYOA 2ZQCA 4EBNA 3PBTA 5FA7A
chains in the Genus database with same CATH superfamily
1NJ4A 3UE6A 2XROA 4GS9B 3IX3A 1MBLA 1SCWA 2C6WB 3PAEA 2A24A 3UY6A 1YM1A 1S6RA 5GLCA 4PAUA 4HP4A 3AGDA 1C3BA 4IUKA 1DJBA 4HESA 3F1PA 3UMEA 4YINA 4EBPA 3B3XA 1D7EA 5CRFA 1L0EA 3H7WA 1L2SA 5CERA 3IWOA 3WS2A 1LT0A 3VP4A 5CTMA 5EVEA 3VP3A 5D3OA 1DP8A 2JN7A 3TOIA 4R3AA 4U0XA 5M18A 4R38A 4IVKA 4GD8A 4OQHA 2NUTC 1HLUP 4JPMA 4X25A 2W3EA 1WYBA 2C5WB 2BLSA 5DJTA 4DDSA 3NDGA 1LL9A 2VV6A 1ALQA 1XGIA 1G6OA 1V9ZA 5AJGA 4LRYC 3MZDA 4QJGA 1VEUA 1J9MA 1LI0A 1CK3A 3RJUA 2A3UA 1ES4A 1IKGA 4NG2A 3NBLA 4ME4A 1ZG6A 3U4LP 4Z9QA 2WKQA 3D9YA 5IHVA 4HBTA 1O07A 4RA7A 2EA9A 1ZKJA 1T18A 3ZHHA 2I9VA 5DF8A 1M6KA 4FH4A 5F5YA 4RX3A 3M6HA 2KX6A 4S2MA 2WKEA 4X69A 5AQBA 1XJ4A 2O9BA 5LBRA 2ZL1B 3L9KA 3UNWA 4H8RA 5FAQA 2WKRA 5J3WA 5I94A 1YQSA 4KG6A 4LV3A 1G28A 2O99A 2OLVA 4JF4A 2J80A 4S2LA 4KQQA 3CZDA 4HH2A 1ES5A 3PAGA 2KLIA 2VGLM 1EI5A 4NXEA 4K08A 3S7NA 3JVVA 2DNSA 3HREA 1YLZA 1OT6A 3UPOA 3OLOA 2ACGA 3NDEA 4OPRA 1ZTUA 5HWTA 4JKTA 3CPTA 4ZAMA 3S1YA 1MC0A 4P6ZM 3GR2A 3SZTA 2V1ZA 2GDNA 4Y5FA 4EBLA 5F68A 1XJ2A 5M19A 1KDWA 5DFYA 4N9LA 3JPUA 2XA7M 5HL1A 4KG2A 5DJUA 4E3NA 4C75A 3S7QA 1K4FA 2Y79A 4Y15A 3BQAA 1N9NA 2Z6DA 4N9KA 1E4DA 4GLQA 4MBKA 1TF1A 3ZNYA 3O88A 3TJZC 3W2ZA 2Y2QA 2OWJA 3BM6A 4R3BA 4EWFA 1S1ZA 3N8RA 3KYZA 1VB6A 3CLOA 3F1PB 1IFQA 1OPXA 4BBTA 1G6AA 1VQQA 3H82A 1PWGA 2QZ6A 5FI6A 4JGRA 1S66L 3H7WB 3NJAA 2RL3A 3UDXA 2VX8A 3WS4A 1STZA 3N8LA 4I3AA 1TS0A 3VOZA 2BG1A 2XQZA 1NWZA 2P7JA 4X6TA 3GSGA 1ZC2A 4C6YA 3BQ8A 5K5BA 1G5UA 3DTIA 1MKIA 2QKPA 5DF7A 3IX4A 1K6SA 4MDZA 5DTTA 3FKWA 5DF9A 2ZC6B 4N92A 2J9OA 1VEUB 2R9XA 5GL9A 3LICA 3WRZA 3B47A 1KGEA 1XA1A 3C5AA 2ZC3B 3E0YA 1BZAA 4GD6A 1XA7A 3MXQA 4U3TA 3UE0A 4X55A 2IA2A 4LFUA 1NRJA 1F98A 3IWQA 3WS1A 3N8SA 4KUOA 1H8ZA 3CITA 5DTSA 2B95A 3NI9A 4KZAA 3Q81A 2X71A 2J7VA 2JBFA 2ZOHA 3OC2A 4DE0A 2P74A 2W3FA 3M2JA 3IQAA 3GQZA 5FL3A 3G4PA 2V20A 4UA9A 4Q0IA 2IWDA 1K57C 4B9OA 3W4OA 1K57A 5U47A 1YAXA 3BW6A 3HJIA 4BL2A 1MPLA 1TEMA 3SH9A 1JNUA 3E4PA 1BLCA 3QP6A 4JLFA 1Z6FA 1TD5A 1XJ3A 1FOFA 2VZWA 1NLZA 3CPTB 2G7UA 4GOGA 5HL6A 3LR5A 5I5LA 1ONHA 1JWPA 3UB9A 4GKUA 3VOYA 1IEMA 4DN0A 2VA0A 3VOLA 3PYPA 1YLTA 4NK3A 5HD5A 3V3SA 4LLOB 3IBJA 1TDLA 3KSHA 4PHTA 4Q0HA 3IH9A 1O7EA 2PBDP 5FI7A 5L2FA 4UA6A 2CMNA 3R7WA 4UQIS 2O9AA 2M1CA 4HP9A 2K7SA 3CUEC 2ZQAA 1SKOB 2GZAA 3FYZA 3CUEA 1PW1A 1UGUA 3BY9A 1L0FA 2XLNA 1Y4OA 4F94A 3SS5A 1U60A 4RYEA 2Y2KA 2DRWA 1IYOA 5HPFA 3H82B 5HPIA 4R0QA 4E04A 2VJWA 4GDBA 4Y0TA 2A49A 3M6BA 3HLDA 5AQ7A 1YLJA 4H6JA 5F1FA 1L3LA 1DP6A 5F6AA 1SZVA 3H9WA 5FQJA 3T1QB 3IF6C 4JGQA 1VETB 4OLGA 2XRNA 3IF6A 3QHYA 3S4XA 3LI9A 1CI9A 3GVBA 1DRMA 3KYEA 2ZM8A 5IU1A 1MWRA 3OCLA 4JXGA 4ARZA 3BRMA 4KQOA 2ZL1A 4PM6A 1X0OA 3KSFA 4R3JA 4ZJ3A 4ETXA 3C7VA 4R70A 1NYYA 1PIOA 1E3UA 2XR0A 3IXGA 1FCOA 4XT2A 2H28A 4R4SA 1T1BA 3IWIA 4Q8IA 3DTMA 1E3UD 3M2KA 4O7DA 3V50A 1VM1A 1XX2A 3F1NB 3O86A 5CXWA 2KDKA 2VK3A 5FQMA 4FH2A 3PBQA 1PI4A 3HVFA 2Y2OA 2Y2LA 4FTXA 5IT5A 3C2WA 1RGYA 2Y8HA 4JGOA 4MCWA 3CJMA 3G30A 1Y28A 4OOMA 3W4PA 1F5MA 1HD8A 4HY8A 3UMDA 3P09A 1YSPA 1XXMA 1IELA 3K3DA 5GHZA 4HOIA 1YLYA 4XUXA 4EQ1A 4WZ5C 3Q1FA 4L9GA 4G3WA 3CMZA 4WZ5A 1PNEA 1CQAA 1TS6A 4HNBA 4E3MA 4KENB 4X53A 5CGSA 3G2YA 1N9BA 3KO6A 3ZGAB 3V3RA 1RGZA 3T4JA 4FOFA 3BFDA 3ZG5A 2JKTM 2WAFA 1KGGA 5TGFA 2D02A 2PU4A 3IT9A 5EUAA 1T1AA 3JYIA 5EOOA 1BT5A 3E2KA 4DE2A 1KGFA 5CHMA 5CGXA 5EFWA 1DJCA 2V0UA 1BULA 1K0KA 4IJGA 3HL9A 3NC8A 3OCNA 4OQIA 1IYSA 5JYOA 4F3LA 3NECA 5HDDA 1OTIA 5E2EA 2EX2A 4WM9A 2QMIA 2J9PA 4BL3A 2QHKA 2EWVA 1LSVA 3ITAA 3R7WB 4DJ3A 2QPNA 3UE1A 4IVIA 3R4KA 4II7A 1ES3A 3LEZA 2PU2A 4IBXA 3LCEA 3OPHA 1N9OA 3T4KA 2KOIA 3VFFA 1KVMA 4X1LA 5KMWA 1CI8A 1W8YA 4E3LA 2ZMVA 1OTDA 4RX2A 1NRFA 3K3CA 3LR3A 2WGVA 4Y2FA 1M40A 4DKIA 3HLBA 1W79A 1ACFA 1YPRA 5FQKA 2HP9A 3LIAA 4PM7A 2Q9MA 4H6JB 4CLCE 1FIKA 5CTNA 4EETB 2ZM0A 4GHIA 1SDEA 3B33A 1JVJA 4UA7A 5JYPA 1RP5A 3IF6B 3EGXC 4CLCC 2Q0OA 3CAXA 3GV9A 3EWKA 5MC7A 1BYWA 2HF6A 5EVLA 1IOUA 3PBNA 5FQ9A 5TJJA 4HJ4A 3OPLA 1KDSA 4ARZB 3WWXA 1OTAA 4LRXC 5G4ZA 1PFLA 1NY0A 3G32A 5HFOA 3VMAA 5L09A 3MQQA 3ZDJA 2Y2HA 3A3JA 4ZJ1A 4AFIA 3Q82A 1H0MA 3A3EA 1ESIA 3LR0A 1YMSA 3LFVA 4XT2B 3T1XA 5FAPA 3S7OA 1W7FA 1MWSA 4WLAA 2IWCA 3HLCA 4MBHA 5E43A 3ZVTA 3DAVA 3HLGA 2GJ3A 4R1GA 4Y0UA 3VSKA 1BSGA 3E98A 3DTKA 4MN7A 2Y2PA 4EEUA 1GSXA 2W0NA 2ZC5B 3ZQ5A 3A0SA 4R6LA 2PD7A 4OP5A 2OV5A 3LGOA 3HJKA 4S2NC 4KZ7A 4OP8A 2JC7A 4WN5A 1QMEA 1F9IA 1SKFA 2HJ9C 1MWUA 2PD8A 5CGWA 3PXPA 3MKFA 3ZG0A 4DE1A 2ZQ9A 5CEBA 4OPYA 2B18A 1SKOA 1VHMA 2M7UA 3PBRA 3HBRA 1CEFA 2G2UA 2UV0E 4BLMA 3W8KA 3MFDA 3WS5A 1CEGA 1WE4A 4L9FA 1MY8A 1PWDA 3MQOA 5HZHA 1HVBA 5TR7A 3JVUA 5KSHA 4WYYA 4F3LB 1LHYA 1MXOA 3SS3A 5DVAA 3MZEA 1IYPA 4R23A 3NCKA 4JF5A 4RQ9A 5DKKA 1MZUA 3VE3A 5HD3A 4EQIA 2EXBA 1IKIA 1VETA 2PT7A 3ZG9B 2XFSA 2W3DA 4QY5A 2WGWA 5EE8A 3CWFA 1E25A 5A91A 2LB5A 1T1CA 4WMCA 4B93A 2PYRA 3TG9A 1UWNX 4P85A 2WZXA 2YKFA 1D06A 4WMCD 4PKYA 4EU0A 3O5YA 4IHQA 2OAP1 1MWTA 1JWZA 3G34A 3S22A 2J3TC 2EFUA 3B42A 4KQRA 4ETZA 1N9LA 4GHIB 1GSWA 4EBNA 4NXFA 2J3TD 5L8MA 3VP2A 3OZHA 2O0YA 1ONGA 4CPKA 3MS6A 3ISGA 3F1NA 4CLCB 2K2NA 5EM1A 3HCYA 4ESPA 3LIFA 5FAOA 3KSIA 4UQIM 2WKIA 2WK0A 3IXHA 1RCJA 4LPZA 4B4XA 4CQHA 2J8YA 4WEJA 2JKTI 1PW8A 1S67L 2VV8A 2W1TA 1BLPA 3IX8A 5E2GA 1S0WA 4QU3A 1DP9A 1NZUA 4NEED 3T12B 4CJNA 3A3IA 4KZ5A 2XSSA 3BFCA 4FSFA 1XP4A 3FG8A 3U2AA 4JXWA 5HDCA 4ZTKA 5HW3A 3D4FA 1FILA 3VP0A 1J3WA 2GNXA 4YNRA 1ERQA 2E8IA 3GECA 3WRTA 1LSWA 1SDNA 3LO7A 1S4RA 3T4SA 3VP1A 2QJ5A 4IEDA 1PZOA 1K25A 4HJ6A 3PHYA 2Y2IA 3C4OA 1K4EA 1OTEA 3MZFA 3E2LA 3ICYA 3KYQA 3FC7A 1I2SA 1H5XA 2GX5A 4BWIA 5EECA 4X56A 3BWLA 4KQDA 3QP5A 2PDRA 5FEGA 5F82A 2R78A 4DRTA 4UAAA 2HPBA 2B02A 1L0DA 5E2FA 2IWBA 3P98A 1KOUA 2HP5A 4O8GA 4ZDXA 2PR6A 4YFMA 3RH8B 3PTEA 3G2ZA 4LENA 2WYXA 4FCFA 3SS4A 2JCHA 1CF0A 5FEFA 4WL9A 3N6IA 3IS2A 4D60A 5A8BA 4QWOA 2Y59A 2UWXA 4HHDA 5DFXA 3CHWP 3EQVA 4LV1A 4HJ3A 4BBVA 1TS7A 3C30A 3BYDA 4ZJ2A 5F69A 4JXVA 1BLSA 1WYCA 2XF3A 4HEFA 1P97A 4QB8A 3FZCA 3HUMA 3HUNA 2XK1A 3O3VA 2ZJ9A 1FSWA 2ZM2A 5HARA 4S2OA 2JHEA 1NYMA 3UB8A 2WGWB 3QP4A 2JKRI 4DJ2A 4QD4A 5AVFA 4GB7A 3UDFA 3V39A 3DBAA 2PAVP 3LIBA 2P08A 1AXBA 3GMWA 1K54C 2P04A 2L0WA 2ZOIA 5KIZA 2XH9A 3Q7ZA 4PM5A 4YOFA 4WEKA 3IBRA 3LYXA 4ZBEA 4BBUA 2PBYA 5FDSA 3KSGA 5J7EA 4EXOA 3G31A 2XD5A 4KZ4A 3IH8A 2AVXA 5CECA 3SW1A 3ULFA 5FASA 3LI8A 2HJEA 3EGDC 3UPPA 4NETA 1XKZA 1YLPA 3BFGA 1XFQA 5G4YA 3E4QA 3T4QA 5DTKA 3P01A 3BFEA 3MFXA 4I5SA 1LL5A 2DMWA 5CX7A 2Z2MB 1W5DA 3TE8A 4DMZA 3EEHA 3T1RA 2Y2MA 4EESA 3C8CA 5GHYA 2QWSA 4PM9A 4KZ9A 3SH7A 1V9YA 2W1TB 5HAQA 4Z1WA 1G68A 3ZFZA 4ZRRA 3OOVA 1ODVA 4NKPA 3C38A 3F1OB 5GLDA 3C4PA 5HDSA 1YT4A 4MLLA 3FWLA 3E4OA 4BENA 1OMEA 1GA9A 3O87A 4OPQA 1KE0A 4YWZA 4JBFA 1EROA 2K31A 4IUHA 1K56A 4PPRA 3VV4A 2QJ7A 3BY8A 3VSLA 1TS8A 1HZOA 2QYBA 2WADA 3S7PA 3V5MA 3QP2A 5A93A 3D3OA 1K56D 1ZHHB 4PKYG 1GSVA 4ID4A 3A0RA 4OQGA 1LI9A 4LCMA 1F2KA 5IS1A 4FUWA 1H3QA 3NOTC 1ES2A 1I5QA 5EPHA 2V9AA 2ZMAA 5KSCA 4OVDA 2YKHA 3EEAA 5TFQA 4Y13A 2ZQ7A 1LSXA 1PZPA 2G2WA 4OOLA 4GJ4A 5HAIA 5EOEA 2XGNA 4K91A 4QY6A 4QPRA 4I3IA 4K0XA 4BD1A 2HDSA 3MKEA 1FCNA 2Y55A 4MNRA 4U0TA 1WA9A 2HP6A 1H8MA 5M1AA 2P9VA 3K2NA 4XXRA 1YMXA 2BTFP 2WKHA 3P7NA 3CI6A 1BTLA 3IS2B 3W4QA 1OTBA 4C3QA 3IHBA 4KZ8A 3ZG8B 2Y91A 2ZQ8A 1GHPA 3UE3A 4D2OA 4OQ0A 4R4RA 4IBRA 4NXBA 2VGKA 4UEYA 1NLYA 3DTEA 2FFFB 5EV0A 2R9WA 1PRQA 4MMNA 3IXDA 3I7JA 2OOLA 4P6BA 5DKLA 2EXAA 4GN2A 4DXBA 2VV7A 2JKGA 3A3DA 4E6XA 5L07A 2HZ5A 2FFYA 4CLCA 1IYQA 3UDIA 4E3IA 2RCXA 4CLCD 2Y4AA 4UHUA 3MSHA 3EOIA 3T4TA 5CHJA 3BLSA 4LV2A 2VEAA 4GDNA 4P0MA 5EVIC 1ESUA 5BOHA 1FR6A 2DCFA 3TSGA 3NOUC 5EVIA 3GRJA 5HWWA 2ZC4B 4KUKA 5EVID 3Q07A 1ERMA 2JKRM 4O01A 2V0WA 1EW0A 3NULA 3LY4A 4K0WA 2ZQDA 2I72A 5FSRA 3UB6A 3MXSA 3HLWA 4HBUA 4GCZA 1FCMA 4BMWA 1EWZA 3OPPA 4G3KA 3PBTA 2O9CA 5FA7A 1W63M 4M4XA 5EM0A 3BFFA 3AGFA 3T4LA 4KZ3A 1S4SA 1BUEA 1YKDA 4X1MA 3BLMA 5CHUA 1A0KA 4B88A 3GTCA 3RXXA 4EEPA 1Q2QA 4S2NA 5GLBA 4HI4A 1OT9A 4NXGA 5GHXA 2HV1A 5G18A 4Q0JA 1FQGA 1NXYA 4EV4A 3QNCA 2VGJA 1AWIA 4GZBA 3MMHA 1I2WA 3V67A 2W1RA 3HLFA 2BASA 4QHCA 3IHAA 4E3OA 4BJPA 1DY6A 3BECA 1QMFA 1XPBA 2Y2JA 3T1SA 4HQAA 1LLBA 2JE5A 3UO9A 3MR0A 2A24B 3TRCA 1JWVA 3IXBA 2V8FA 1Q2PA 3DWKA 4JXSA 3QNBA 5J8XA 5A90A 3FPVA 2V1AA 3RFBA 1XFNA 4E3JA 2INWA 2WZZA 5HAPA 1D1JA 4MBFA 2Z6CA 4WELA 1YSQA 1YLWA 2A2LA 5FATA 2EWWA 2P9VB 4DDYA 4XUZA 2VGLS 1GHIA 3QP8A 3PR6A 3RTYA 1CJFA 2PR5A 5F83A 2XEPA 3QP1A 3OPRA 2X02A 5A92A 3BJNA 4P87A 3UB7A 2OAQ1 3G6OA 4OH0A 4P6ZS 3UN7A 5FQQA 2PHYA 2PRFA 1S1YA 5L10A 3ZYTA 3C7UA 3OBFA 4N1HA 4LCLA 3MJQA 4I39A 5AQAA 3G35A 3KX0X 2OSUA 2XA7S 1TVFA 3BEBA 3ITBA 4L0LA 1KVLA 1K6RA 4Y7PA 3CG5A 2M7VA 3DWZA 2ZLYA 1P9RA 4X68A 4LGWA 2FH5A 3ZG7B 4MEZA 4RVAA 5TBMA 5EVIB 1OJGA 3LIDA 5HX9A 1N4OA 3AGEA 4GNUA 2Q9NA 3F1OA 4OONA 3LUQA 3Q7VA 4E6WA 4OLDA 2H10A 1UWPX 3SOIA 4EERA 5CEDA 1P0ZA 3HUOA 3WS0A 2Y2NA 3A3FA 4S2KA 3UB5P 1H8YA 2CC1A 1KE4A 5KZHA 2OLUA 4DXCA 4KG5A 5E2HA 3T50A 1GA0A 2ZD8A 3LY3A 3HLEA 1HTZA 3FV7A 4DE3A 4GS9A 3LR4A 3IF5A 3PBOA 2JKFA 3PBSA 4OOYA 5GLAA 1DJAA 2WUQA 1ZG4A 3FKVA 4PM8A 2W3GA 4LV0A 2E8JA 4LRZE 4Y0OA 3MXRA 3NHQA 5C5KA 2V2FF 3NIAA 2EX9A 3SH8A 4I38A 2B5RA 2XDMA 4B4ZA 1Z09A 4G3VA 4WF0A 4MN5A 2HDRA 1L0GA 4WUJA 4L9EA 1W63Q 2EFXA 1FR1A 2VLGA 5AQ9A 3EQUA 3N7WA 1KE3A 1MKMA 4EUZA 1GCEA 3VFHA 3UPNA 1XGJA 4EW7A 1PWCA 2D01A 3MBZA 2XFTA 5J4EA 3ZVWA 1P9WA 1FSYA 4S2JA 2PYPA 3MQ0A 1TDGA 5AVEA 1K54A 2X01A 4HIAA 4JF6A 2LB9A 4HH3A 2V8CA 2J3WA 2Y2GA 4BD0A 4DF6A 1PI5A 3NY4A 4EUVA 4S2PA 4OKPA 4BQMA 2NUPC 1OJ5A 2H0YA 1K55C 1LL8A 4MN6A 2W27A 2FZ0A 2HDQA 4FD8A 3D72A 4I3JA 1K55A 2XD1A 1JTGA 4GW9A 4WZ4A 2HGVA 4O0PA 1W8QA 4E3KA 2H5SA 3LIEA 1GHMA 2WGIA 2OWHA 4M3KA 4WBGA 4S2IA 2H0TA 3ZCZA 5FI2A 4N1XA 1SHVA 3MF0A 5FQIA 2L1MA 3VE4A 2W3HA 5HWVA 4PMAA 5FDHA 5TBMB 1JTDA 2ZMFA 1XJ6A 3T4OA 3GDIA 2MJ6A 1BLHA 3DW0A 2L4RA 2VKSA 4KZ6A 3N4IA 2WAEA 2ZC7A 3TW8A 5HSQA 1Y54A 4Y17A 3NOPC 2Z2LB 3Q7VB 2EX8A 4OPZA 2V1BA 1NZOA 1K38A 4KZBA 2HDUA 4Y3IA 5F1GA 3FPWA 3RXWA 2ZBBA 4A5RA 1T19A 4JGPA 3ZNTA 3A0VA 2WKPA 1PYYA 3L7HA 2EX6A 2ZQCA 3LEQA
chains in the Genus database with same CATH topology
1NJ4A 3VP2A 3OZHA 3BFFA 3AGFA 1MBLA 1SCWA 4R0QA 1ONGA 2C6WB 3PAEA 3UY6A 1YM1A 4KZ3A 4GDBA 1S6RA 4Y0TA 4CPKA 3ISGA 2A49A 3M6BA 1BUEA 3HLDA 5AQ7A 5GLCA 1YLJA 3AGDA 5FAOA 1C3BA 3BLMA 5CHUA 4B88A 5F1FA 3GTCA 1DJBA 4HESA 2WKIA 4YINA 5FQJA 2WK0A 4EBPA 3IF6C 3IXHA 1RCJA 3RXXA 3B3XA 4OLGA 1Q2QA 3IF6A 3QHYA 4S2NA 5GLBA 5CRFA 1L0EA 4B4XA 1L2SA 3S4XA 5CERA 2J8YA 4WEJA 3IWOA 1PW8A 5GHXA 3WS2A 1BLPA 1CI9A 3GVBA 5G18A 5E2GA 3VP4A 1FQGA 1NXYA 1S0WA 4QU3A 1NZUA 4EV4A 3QNCA 5CTMA 2ZM8A 4CJNA 3A3IA 3VP3A 1MWRA 2VGJA 4KZ5A 3OCLA 5D3OA 3BFCA 4GZBA 4JXGA 4FSFA 1XP4A 3BRMA 1I2WA 3TOIA 4KQOA 4U0XA 3HLFA 5M18A 4JXWA 4PM6A 4IVKA 4QHCA 4GD8A 4R3JA 4ZJ3A 3IHAA 4ZTKA 4E3OA 4OQHA 4BJPA 5HW3A 1DY6A 3D4FA 3BECA 4JPMA 3C7VA 1NYYA 3VP0A 1WYBA 1QMFA 2C5WB 1XPBA 2Y2JA 1PIOA 1E3UA 2XR0A 2BLSA 3IXGA 1ERQA 1FCOA 4DDSA 3NDGA 1LLBA 2E8IA 4R4SA 3IWIA 4Q8IA 3DTMA 3WRTA 1E3UD 1SDNA 2JE5A 1LL9A 3M2KA 4O7DA 3UO9A 1ALQA 3LO7A 3VP1A 1XGIA 4IEDA 1JWVA 1PZOA 3IXBA 3V50A 1Q2PA 1VM1A 1XX2A 3DWKA 3MZDA 3O86A 1K25A 4JXSA 1J9MA 3QNBA 5CXWA 4QJGA 2Y2IA 1LI0A 5J8XA 3C4OA 5FQMA 1CK3A 1K4EA 3RJUA 4FH2A 2A3UA 3MZFA 3PBQA 1PI4A 1ES4A 3E2LA 3HVFA 1IKGA 5A90A 2Y2OA 2Y2LA 4E3JA 2WZZA 5HAPA 1RGYA 1I2SA 4MBFA 1H5XA 3NBLA 1ZG6A 4WELA 4Z9QA 5IHVA 4HBTA 1O07A 1YLWA 3CJMA 4RA7A 5EECA 4X56A 5FATA 3G30A 2P9VB 4DDYA 1ZKJA 4OOMA 4XUZA 3W4PA 3ZHHA 1GHIA 1HD8A 5DF8A 1M6KA 4FH4A 5F82A 4RX3A 5F83A 3M6HA 3P09A 4DRTA 2XEPA 4UAAA 2HPBA 4S2MA 1XXMA 1IELA 5GHZA 3OPRA 1L0DA 2WKEA 2X02A 3P98A 4X69A 5E2FA 5AQBA 2HP5A 1YLYA 2IWBA 5A92A 4XUXA 4WZ5C 3Q1FA 4P87A 4ZDXA 3CMZA 3UNWA 4YFMA 4H8RA 4WZ5A 5FAQA 3PTEA 3G2ZA 4LENA 4OH0A 3UN7A 5I94A 2WYXA 4FCFA 1YQSA 4KG6A 4E3MA 4LV3A 3SS4A 2JCHA 4KENB 4X53A 5CGSA 5FQQA 3N6IA 3G2YA 2OLVA 4JF4A 1N9BA 3ZGAB 3C7UA 4S2LA 2Y59A 3V3RA 2UWXA 4KQQA 1RGZA 4N1HA 3EQVA 4LV1A 3BFDA 3CZDA 4LCLA 3ZG5A 2WAFA 1KGGA 5AQAA 1ES5A 2PU4A 3G35A 3IT9A 3PAGA 5EUAA 3BYDA 1EI5A 2OSUA 3JYIA 5EOOA 4ZJ2A 1BT5A 4JXVA 1BLSA 1TVFA 1WYCA 3BEBA 2XF3A 3E2KA 1KGFA 2DNSA 3HREA 3ITBA 4HEFA 4L0LA 5CHMA 4DE2A 1YLZA 1KVLA 5CGXA 4QB8A 3UPOA 1K6RA 4Y7PA 1DJCA 3FZCA 3HUMA 3HUNA 1BULA 3CG5A 2XK1A 3NDEA 4OPRA 3O3VA 3DWZA 2ZJ9A 4JKTA 1FSWA 2ZLYA 3HL9A 3NC8A 2ZM2A 3OCNA 4OQIA 5HARA 4X68A 4ZAMA 4S2OA 1IYSA 1NYMA 5JYOA 3S1YA 2WGWB 4QD4A 5E2EA 2EX2A 3GR2A 2QMIA 4MEZA 2J9PA 4GB7A 4RVAA 4WM9A 2V1ZA 3UDFA 3V39A 4BL3A 1AXBA 2GDNA 3GMWA 1K54C 5EVIB 4EBLA 3ITAA 2XH9A 5M19A 1KDWA 5HX9A 3Q7ZA 4N9LA 4PM5A 4WEKA 2QPNA 4ZBEA 2PBYA 3UE1A 4IVIA 1N4OA 3AGEA 4GNUA 2Q9NA 1ES3A 3LEZA 2PU2A 4IBXA 3LCEA 4OONA 5HL1A 3OPHA 3G31A 2XD5A 3Q7VA 4KZ4A 3IH8A 4OLDA 3VFFA 2H10A 4KG2A 1KVMA 5CECA 3SOIA 4E3NA 4C75A 1K4FA 5FASA 5KMWA 1CI8A 1W8YA 4E3LA 5CEDA 4RX2A 1NRFA 3HUOA 3UPPA 4N9KA 4NETA 1E4DA 1XKZA 1YLPA 3BFGA 4MBKA 2WGVA 3WS0A 2Y2NA 3ZNYA 1M40A 3A3FA 4S2KA 3O88A 4DKIA 3HLBA 1W79A 1H8YA 2CC1A 1KE4A 2Y2QA 5FQKA 5KZHA 2OLUA 2HP9A 4DXCA 3BM6A 4KG5A 4R3BA 5E2HA 4EWFA 1GA0A 2ZD8A 5DTKA 3BFEA 3N8RA 4PM7A 3LY3A 3HLEA 2Q9MA 1HTZA 3FV7A 5CTNA 2ZM0A 1LL5A 1SDEA 1G6AA 1VQQA 2Z2MB 4DE3A 1W5DA 1JVJA 4UA7A 1PWGA 2QZ6A 5FI6A 5JYPA 1RP5A 3IF6B 3IF5A 3PBOA 2Y2MA 3PBSA 4OOYA 5GHYA 5GLAA 1DJAA 2WUQA 3GV9A 4PM9A 4KZ9A 3SH7A 5EVLA 2RL3A 5HAQA 3PBNA 1ZG4A 1G68A 3UDXA 3FKVA 3ZFZA 5FQ9A 3WS4A 4PM8A 3N8LA 4LV0A 3OPLA 1KDSA 3VOZA 2BG1A 4Y0OA 2XQZA 3WWXA 4X6TA 3GSGA 1ZC2A 1NY0A 3MXRA 4C6YA 5GLDA 3G32A 5HFOA 3C4PA 3VMAA 3ZDJA 1YT4A 2Y2HA 3A3JA 4ZJ1A 4MLLA 3FWLA 3Q82A 3A3EA 1ESIA 2V2FF 5DF7A 1MKIA 4BENA 1OMEA 1K6SA 3NIAA 1GA9A 3O87A 4OPQA 1KE0A 2EX9A 3SH8A 5DTTA 2B5RA 2XDMA 1YMSA 4JBFA 4B4ZA 1EROA 1K56A 4PPRA 3FKWA 2HDRA 3VSLA 5FAPA 1HZOA 1L0GA 2WADA 3V5MA 5A93A 2EFXA 1K56D 1FR1A 1W7FA 5DF9A 5AQ9A 2ZC6B 3EQUA 4N92A 3N7WA 1MWSA 2J9OA 4ID4A 2R9XA 2IWCA 3HLCA 4MBHA 5E43A 3ZVTA 5GL9A 1KE3A 3WRZA 3HLGA 4OQGA 4R1GA 4Y0UA 1LI9A 4EUZA 1KGEA 1XA1A 4LCMA 3VSKA 1GCEA 3VFHA 1BSGA 3UPNA 3C5AA 1XGJA 1ES2A 1I5QA 2ZC3B 2Y2PA 1BZAA 4GD6A 1PWCA 1XA7A 2ZC5B 4U3TA 5EPHA 3MBZA 4X55A 3UE0A 2XFTA 2ZMAA 5KSCA 4OVDA 3ZVWA 4OP5A 5TFQA 2ZQ7A 3IWQA 3WS1A 3N8SA 2OV5A 1FSYA 1H8ZA 4S2JA 5DTSA 3NI9A 1PZPA 2G2WA 4KZAA 4OOLA 3Q81A 5HAIA 1TDGA 2X71A 5EOEA 1K54A 2XGNA 4S2NC 4K91A 2X01A 2J7VA 4QY6A 4K0XA 4KZ7A 4BD1A 2JBFA 2HDSA 3OC2A 4OP8A 3MKEA 1FCNA 2Y55A 4MNRA 4U0TA 2JC7A 4JF6A 2HP6A 1QMEA 5M1AA 1SKFA 2P9VA 4DE0A 1MWUA 4XXRA 1YMXA 2P74A 5CGWA 2Y2GA 3M2JA 4BD0A 4DF6A 1PI5A 3IQAA 3NY4A 2WKHA 3GQZA 3MKFA 3G4PA 4OKPA 4S2PA 3ZG0A 1BTLA 4BQMA 3W4QA 4DE1A 2ZQ9A 2H0YA 4C3QA 2V20A 1K55C 5CEBA 4UA9A 2HDQA 2IWDA 3IHBA 4FD8A 4OPYA 1K57C 4KZ8A 1K55A 3ZG8B 3PBRA 2Y91A 1CEFA 2G2UA 2XD1A 2ZQ8A 3HBRA 1JTGA 3W4OA 1GHPA 3UE3A 1K57A 5U47A 4D2OA 4WZ4A 4BL2A 4OQ0A 4R4RA 4BLMA 1MPLA 4IBRA 3MFDA 3W8KA 3WS5A 1W8QA 4E3KA 1TEMA 2H5SA 3SH9A 4E6WA 1CEGA 1WE4A 5TGFA 3ZG7B 2VGKA 1MY8A 1BLCA 1GHMA 1PWDA 2FFFB 2WGIA 4JLFA 1Z6FA 4M3KA 4WBGA 2R9WA 4S2IA 3IXDA 3I7JA 1HVBA 2H0TA 3ZCZA 5TR7A 1FOFA 4P6BA 2EXAA 5FI2A 4GN2A 4N1XA 1SHVA 5KSHA 4DXBA 3A3DA 4WYYA 4E6XA 1LHYA 1MXOA 4GOGA 5FQIA 3SS3A 2FFYA 4PMAA 5FDHA 1ONHA 1IYQA 1JTDA 1JWPA 4GKUA 5DVAA 3UDIA 3VOYA 3MZEA 1IEMA 4E3IA 1IYPA 2RCXA 4R23A 3NCKA 4JF5A 4EQIA 2EXBA 1BLHA 3DW0A 2Y4AA 4UHUA 1IKIA 1YLTA 4KZ6A 5CHJA 3N4IA 3BLSA 4LV2A 4NK3A 2WAEA 2ZC7A 3V3SA 3ZG9B 1Y54A 2XFSA 4QY5A 2WGWA 1TDLA 2Z2LB 4GDNA 5EE8A 3Q7VB 4P0MA 2EX8A 5EVIC 1ESUA 4OPZA 1E25A 1NZOA 1K38A 5BOHA 3IH9A 1FR6A 5A91A 2DCFA 3TSGA 5EVIA 3GRJA 1O7EA 4WMCA 2ZC4B 5FI7A 4UA6A 5L2FA 3TG9A 4P85A 2WZXA 4KZBA 2HDUA 5EVID 5F1GA 3RXWA 4A5RA 2ZQAA 1ERMA 3Q07A 4WMCD 3FYZA 4K0WA 1PW1A 3LY4A 2ZQDA 2I72A 1MWTA 5FSRA 1L0FA 1JWZA 2XLNA 3G34A 3S22A 3ZNTA 4F94A 3MXSA 3HLWA 4HBUA 1FCMA 2EFUA 1EWZA 3SS5A 1U60A 4RYEA 1PYYA 4KQRA 3OPPA 2Y2KA 2EX6A 2DRWA 1IYOA 2ZQCA 4EBNA 3PBTA 5FA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJ4 A;  3VP2 A;  3OZH A;  3BFF A;  3AGF A;  1MBL A;  1SCW A;  4R0Q A;  1ONG A;  2C6W B;  3PAE A;  3UY6 A;  1YM1 A;  4KZ3 A;  4GDB A;  1S6R A;  4Y0T A;  4CPK A;  3ISG A;  2A49 A;  3M6B A;  1BUE A;  3HLD A;  5AQ7 A;  5GLC A;  1YLJ A;  3AGD A;  5FAO A;  1C3B A;  3BLM A;  5CHU A;  4B88 A;  5F1F A;  3GTC A;  1DJB A;  4HES A;  2WKI A;  4YIN A;  5FQJ A;  2WK0 A;  4EBP A;  3IF6 C;  3IXH A;  1RCJ A;  3RXX A;  3B3X A;  4OLG A;  1Q2Q A;  3IF6 A;  3QHY A;  4S2N A;  5GLB A;  5CRF A;  1L0E A;  4B4X A;  1L2S A;  3S4X A;  5CER A;  2J8Y A;  4WEJ A;  3IWO A;  1PW8 A;  5GHX A;  3WS2 A;  1BLP A;  1CI9 A;  3GVB A;  5G18 A;  5E2G A;  3VP4 A;  1FQG A;  1NXY A;  1S0W A;  4QU3 A;  1NZU A;  4EV4 A;  3QNC A;  5CTM A;  2ZM8 A;  4CJN A;  3A3I A;  3VP3 A;  1MWR A;  2VGJ A;  4KZ5 A;  3OCL A;  5D3O A;  3BFC A;  4GZB A;  4JXG A;  4FSF A;  1XP4 A;  3BRM A;  1I2W A;  3TOI A;  4KQO A;  4U0X A;  3HLF A;  5M18 A;  4JXW A;  4PM6 A;  4IVK A;  4QHC A;  4GD8 A;  4R3J A;  4ZJ3 A;  3IHA A;  4ZTK A;  4E3O A;  4OQH A;  4BJP A;  5HW3 A;  1DY6 A;  3D4F A;  3BEC A;  4JPM A;  3C7V A;  1NYY A;  3VP0 A;  1WYB A;  1QMF A;  2C5W B;  1XPB A;  2Y2J A;  1PIO A;  1E3U A;  2XR0 A;  2BLS A;  3IXG A;  1ERQ A;  1FCO A;  4DDS A;  3NDG A;  1LLB A;  2E8I A;  4R4S A;  3IWI A;  4Q8I A;  3DTM A;  3WRT A;  1E3U D;  1SDN A;  2JE5 A;  1LL9 A;  3M2K A;  4O7D A;  3UO9 A;  1ALQ A;  3LO7 A;  3VP1 A;  1XGI A;  4IED A;  1JWV A;  1PZO A;  3IXB A;  3V50 A;  1Q2P A;  1VM1 A;  1XX2 A;  3DWK A;  3MZD A;  3O86 A;  1K25 A;  4JXS A;  1J9M A;  3QNB A;  5CXW A;  4QJG A;  2Y2I A;  1LI0 A;  5J8X A;  3C4O A;  5FQM A;  1CK3 A;  1K4E A;  3RJU A;  4FH2 A;  2A3U A;  3MZF A;  3PBQ A;  1PI4 A;  1ES4 A;  3E2L A;  3HVF A;  1IKG A;  5A90 A;  2Y2O A;  2Y2L A;  4E3J A;  2WZZ A;  5HAP A;  1RGY A;  1I2S A;  4MBF A;  1H5X A;  3NBL A;  1ZG6 A;  4WEL A;  4Z9Q A;  5IHV A;  4HBT A;  1O07 A;  1YLW A;  3CJM A;  4RA7 A;  5EEC A;  4X56 A;  5FAT A;  3G30 A;  2P9V B;  4DDY A;  1ZKJ A;  4OOM A;  4XUZ A;  3W4P A;  3ZHH A;  1GHI A;  1HD8 A;  5DF8 A;  1M6K A;  4FH4 A;  5F82 A;  4RX3 A;  5F83 A;  3M6H A;  3P09 A;  4DRT A;  2XEP A;  4UAA A;  2HPB A;  4S2M A;  1XXM A;  1IEL A;  5GHZ A;  3OPR A;  1L0D A;  2WKE A;  2X02 A;  3P98 A;  4X69 A;  5E2F A;  5AQB A;  2HP5 A;  1YLY A;  2IWB A;  5A92 A;  4XUX A;  4WZ5 C;  3Q1F A;  4P87 A;  4ZDX A;  3CMZ A;  3UNW A;  4YFM A;  4H8R A;  4WZ5 A;  5FAQ A;  3PTE A;  3G2Z A;  4LEN A;  4OH0 A;  3UN7 A;  5I94 A;  2WYX A;  4FCF A;  1YQS A;  4KG6 A;  4E3M A;  4LV3 A;  3SS4 A;  2JCH A;  4KEN B;  4X53 A;  5CGS A;  5FQQ A;  3N6I A;  3G2Y A;  2OLV A;  4JF4 A;  1N9B A;  3ZGA B;  3C7U A;  4S2L A;  2Y59 A;  3V3R A;  2UWX A;  4KQQ A;  1RGZ A;  4N1H A;  3EQV A;  4LV1 A;  3BFD A;  3CZD A;  4LCL A;  3ZG5 A;  2WAF A;  1KGG A;  5AQA A;  1ES5 A;  2PU4 A;  3G35 A;  3IT9 A;  3PAG A;  5EUA A;  3BYD A;  1EI5 A;  2OSU A;  3JYI A;  5EOO A;  4ZJ2 A;  1BT5 A;  4JXV A;  1BLS A;  1TVF A;  1WYC A;  3BEB A;  2XF3 A;  3E2K A;  1KGF A;  2DNS A;  3HRE A;  3ITB A;  4HEF A;  4L0L A;  5CHM A;  4DE2 A;  1YLZ A;  1KVL A;  5CGX A;  4QB8 A;  3UPO A;  1K6R A;  4Y7P A;  1DJC A;  3FZC A;  3HUM A;  3HUN A;  1BUL A;  3CG5 A;  2XK1 A;  3NDE A;  4OPR A;  3O3V A;  3DWZ A;  2ZJ9 A;  4JKT A;  1FSW A;  2ZLY A;  3HL9 A;  3NC8 A;  2ZM2 A;  3OCN A;  4OQI A;  5HAR A;  4X68 A;  4ZAM A;  4S2O A;  1IYS A;  1NYM A;  5JYO A;  3S1Y A;  2WGW B;  4QD4 A;  5E2E A;  2EX2 A;  3GR2 A;  2QMI A;  4MEZ A;  2J9P A;  4GB7 A;  4RVA A;  4WM9 A;  2V1Z A;  3UDF A;  3V39 A;  4BL3 A;  1AXB A;  2GDN A;  3GMW A;  1K54 C;  5EVI B;  4EBL A;  3ITA A;  2XH9 A;  5M19 A;  1KDW A;  5HX9 A;  3Q7Z A;  4N9L A;  4PM5 A;  4WEK A;  2QPN A;  4ZBE A;  2PBY A;  3UE1 A;  4IVI A;  1N4O A;  3AGE A;  4GNU A;  2Q9N A;  1ES3 A;  3LEZ A;  2PU2 A;  4IBX A;  3LCE A;  4OON A;  5HL1 A;  3OPH A;  3G31 A;  2XD5 A;  3Q7V A;  4KZ4 A;  3IH8 A;  4OLD A;  3VFF A;  2H10 A;  4KG2 A;  1KVM A;  5CEC A;  3SOI A;  4E3N A;  4C75 A;  1K4F A;  5FAS A;  5KMW A;  1CI8 A;  1W8Y A;  4E3L A;  5CED A;  4RX2 A;  1NRF A;  3HUO A;  3UPP A;  4N9K A;  4NET A;  1E4D A;  1XKZ A;  1YLP A;  3BFG A;  4MBK A;  2WGV A;  3WS0 A;  2Y2N A;  3ZNY A;  1M40 A;  3A3F A;  4S2K A;  3O88 A;  4DKI A;  3HLB A;  1W79 A;  1H8Y A;  2CC1 A;  1KE4 A;  2Y2Q A;  5FQK A;  5KZH A;  2OLU A;  2HP9 A;  4DXC A;  3BM6 A;  4KG5 A;  4R3B A;  5E2H A;  4EWF A;  1GA0 A;  2ZD8 A;  5DTK A;  3BFE A;  3N8R A;  4PM7 A;  3LY3 A;  3HLE A;  2Q9M A;  1HTZ A;  3FV7 A;  5CTN A;  2ZM0 A;  1LL5 A;  1SDE A;  1G6A A;  1VQQ A;  2Z2M B;  4DE3 A;  1W5D A;  1JVJ A;  4UA7 A;  1PWG A;  2QZ6 A;  5FI6 A;  5JYP A;  1RP5 A;  3IF6 B;  3IF5 A;  3PBO A;  2Y2M A;  3PBS A;  4OOY A;  5GHY A;  5GLA A;  1DJA A;  2WUQ A;  3GV9 A;  4PM9 A;  4KZ9 A;  3SH7 A;  5EVL A;  2RL3 A;  5HAQ A;  3PBN A;  1ZG4 A;  1G68 A;  3UDX A;  3FKV A;  3ZFZ A;  5FQ9 A;  3WS4 A;  4PM8 A;  3N8L A;  4LV0 A;  3OPL A;  1KDS A;  3VOZ A;  2BG1 A;  4Y0O A;  2XQZ A;  3WWX A;  4X6T A;  3GSG A;  1ZC2 A;  1NY0 A;  3MXR A;  4C6Y A;  5GLD A;  3G32 A;  5HFO A;  3C4P A;  3VMA A;  3ZDJ A;  1YT4 A;  2Y2H A;  3A3J A;  4ZJ1 A;  4MLL A;  3FWL A;  3Q82 A;  3A3E A;  1ESI A;  2V2F F;  5DF7 A;  1MKI A;  4BEN A;  1OME A;  1K6S A;  3NIA A;  1GA9 A;  3O87 A;  4OPQ A;  1KE0 A;  2EX9 A;  3SH8 A;  5DTT A;  2B5R A;  2XDM A;  1YMS A;  4JBF A;  4B4Z A;  1ERO A;  1K56 A;  4PPR A;  3FKW A;  2HDR A;  3VSL A;  5FAP A;  1HZO A;  1L0G A;  2WAD A;  3V5M A;  5A93 A;  2EFX A;  1K56 D;  1FR1 A;  1W7F A;  5DF9 A;  5AQ9 A;  2ZC6 B;  3EQU A;  4N92 A;  3N7W A;  1MWS A;  2J9O A;  4ID4 A;  2R9X A;  2IWC A;  3HLC A;  4MBH A;  5E43 A;  3ZVT A;  5GL9 A;  1KE3 A;  3WRZ A;  3HLG A;  4OQG A;  4R1G A;  4Y0U A;  1LI9 A;  4EUZ A;  1KGE A;  1XA1 A;  4LCM A;  3VSK A;  1GCE A;  3VFH A;  1BSG A;  3UPN A;  3C5A A;  1XGJ A;  1ES2 A;  1I5Q A;  2ZC3 B;  2Y2P A;  1BZA A;  4GD6 A;  1PWC A;  1XA7 A;  2ZC5 B;  4U3T A;  5EPH A;  3MBZ A;  4X55 A;  3UE0 A;  2XFT A;  2ZMA A;  5KSC A;  4OVD A;  3ZVW A;  4OP5 A;  5TFQ A;  2ZQ7 A;  3IWQ A;  3WS1 A;  3N8S A;  2OV5 A;  1FSY A;  1H8Z A;  4S2J A;  5DTS A;  3NI9 A;  1PZP A;  2G2W A;  4KZA A;  4OOL A;  3Q81 A;  5HAI A;  1TDG A;  2X71 A;  5EOE A;  1K54 A;  2XGN A;  4S2N C;  4K91 A;  2X01 A;  2J7V A;  4QY6 A;  4K0X A;  4KZ7 A;  4BD1 A;  2JBF A;  2HDS A;  3OC2 A;  4OP8 A;  3MKE A;  1FCN A;  2Y55 A;  4MNR A;  4U0T A;  2JC7 A;  4JF6 A;  2HP6 A;  1QME A;  5M1A A;  1SKF A;  2P9V A;  4DE0 A;  1MWU A;  4XXR A;  1YMX A;  2P74 A;  5CGW A;  2Y2G A;  3M2J A;  4BD0 A;  4DF6 A;  1PI5 A;  3IQA A;  3NY4 A;  2WKH A;  3GQZ A;  3MKF A;  3G4P A;  4OKP A;  4S2P A;  3ZG0 A;  1BTL A;  4BQM A;  3W4Q A;  4DE1 A;  2ZQ9 A;  2H0Y A;  4C3Q A;  2V20 A;  1K55 C;  5CEB A;  4UA9 A;  2HDQ A;  2IWD A;  3IHB A;  4FD8 A;  4OPY A;  1K57 C;  4KZ8 A;  1K55 A;  3ZG8 B;  3PBR A;  2Y91 A;  1CEF A;  2G2U A;  2XD1 A;  2ZQ8 A;  3HBR A;  1JTG A;  3W4O A;  1GHP A;  3UE3 A;  1K57 A;  5U47 A;  4D2O A;  4WZ4 A;  4BL2 A;  4OQ0 A;  4R4R A;  4BLM A;  1MPL A;  4IBR A;  3MFD A;  3W8K A;  3WS5 A;  1W8Q A;  4E3K A;  1TEM A;  2H5S A;  3SH9 A;  4E6W A;  1CEG A;  1WE4 A;  5TGF A;  3ZG7 B;  2VGK A;  1MY8 A;  1BLC A;  1GHM A;  1PWD A;  2FFF B;  2WGI A;  4JLF A;  1Z6F A;  4M3K A;  4WBG A;  2R9W A;  4S2I A;  3IXD A;  3I7J A;  1HVB A;  2H0T A;  3ZCZ A;  5TR7 A;  1FOF A;  4P6B A;  2EXA A;  5FI2 A;  4GN2 A;  4N1X A;  1SHV A;  5KSH A;  4DXB A;  3A3D A;  4WYY A;  4E6X A;  1LHY A;  1MXO A;  4GOG A;  5FQI A;  3SS3 A;  2FFY A;  4PMA A;  5FDH A;  1ONH A;  1IYQ A;  1JTD A;  1JWP A;  4GKU A;  5DVA A;  3UDI A;  3VOY A;  3MZE A;  1IEM A;  4E3I A;  1IYP A;  2RCX A;  4R23 A;  3NCK A;  4JF5 A;  4EQI A;  2EXB A;  1BLH A;  3DW0 A;  2Y4A A;  4UHU A;  1IKI A;  1YLT A;  4KZ6 A;  5CHJ A;  3N4I A;  3BLS A;  4LV2 A;  4NK3 A;  2WAE A;  2ZC7 A;  3V3S A;  3ZG9 B;  1Y54 A;  2XFS A;  4QY5 A;  2WGW A;  1TDL A;  2Z2L B;  4GDN A;  5EE8 A;  3Q7V B;  4P0M A;  2EX8 A;  5EVI C;  1ESU A;  4OPZ A;  1E25 A;  1NZO A;  1K38 A;  5BOH A;  3IH9 A;  1FR6 A;  5A91 A;  2DCF A;  3TSG A;  5EVI A;  3GRJ A;  1O7E A;  4WMC A;  2ZC4 B;  5FI7 A;  4UA6 A;  5L2F A;  3TG9 A;  4P85 A;  2WZX A;  4KZB A;  2HDU A;  5EVI D;  5F1G A;  3RXW A;  4A5R A;  2ZQA A;  1ERM A;  3Q07 A;  4WMC D;  3FYZ A;  4K0W A;  1PW1 A;  3LY4 A;  2ZQD A;  2I72 A;  1MWT A;  5FSR A;  1L0F A;  1JWZ A;  2XLN A;  3G34 A;  3S22 A;  3ZNT A;  4F94 A;  3MXS A;  3HLW A;  4HBU A;  1FCM A;  2EFU A;  1EWZ A;  3SS5 A;  1U60 A;  4RYE A;  1PYY A;  4KQR A;  3OPP A;  2Y2K A;  2EX6 A;  2DRW A;  1IYO A;  2ZQC A;  4EBN A;  3PBT A;  5FA7 A; 
#chains in the Genus database with same CATH topology
 1NJ4 A;  3UE6 A;  2XRO A;  4GS9 B;  3IX3 A;  1MBL A;  1SCW A;  2C6W B;  3PAE A;  2A24 A;  3UY6 A;  1YM1 A;  1S6R A;  5GLC A;  4PAU A;  4HP4 A;  3AGD A;  1C3B A;  4IUK A;  1DJB A;  4HES A;  3F1P A;  3UME A;  4YIN A;  4EBP A;  3B3X A;  1D7E A;  5CRF A;  1L0E A;  3H7W A;  1L2S A;  5CER A;  3IWO A;  3WS2 A;  1LT0 A;  3VP4 A;  5CTM A;  5EVE A;  3VP3 A;  5D3O A;  1DP8 A;  2JN7 A;  3TOI A;  4R3A A;  4U0X A;  5M18 A;  4R38 A;  4IVK A;  4GD8 A;  4OQH A;  2NUT C;  1HLU P;  4JPM A;  4X25 A;  2W3E A;  1WYB A;  2C5W B;  2BLS A;  5DJT A;  4DDS A;  3NDG A;  1LL9 A;  2VV6 A;  1ALQ A;  1XGI A;  1G6O A;  1V9Z A;  5AJG A;  4LRY C;  3MZD A;  4QJG A;  1VEU A;  1J9M A;  1LI0 A;  1CK3 A;  3RJU A;  2A3U A;  1ES4 A;  1IKG A;  4NG2 A;  3NBL A;  4ME4 A;  1ZG6 A;  3U4L P;  4Z9Q A;  2WKQ A;  3D9Y A;  5IHV A;  4HBT A;  1O07 A;  4RA7 A;  2EA9 A;  1ZKJ A;  1T18 A;  3ZHH A;  2I9V A;  5DF8 A;  1M6K A;  4FH4 A;  5F5Y A;  4RX3 A;  3M6H A;  2KX6 A;  4S2M A;  2WKE A;  4X69 A;  5AQB A;  1XJ4 A;  2O9B A;  5LBR A;  2ZL1 B;  3L9K A;  3UNW A;  4H8R A;  5FAQ A;  2WKR A;  5J3W A;  5I94 A;  1YQS A;  4KG6 A;  4LV3 A;  1G28 A;  2O99 A;  2OLV A;  4JF4 A;  2J80 A;  4S2L A;  4KQQ A;  3CZD A;  4HH2 A;  1ES5 A;  3PAG A;  2KLI A;  2VGL M;  1EI5 A;  4NXE A;  4K08 A;  3S7N A;  3JVV A;  2DNS A;  3HRE A;  1YLZ A;  1OT6 A;  3UPO A;  3OLO A;  2ACG A;  3NDE A;  4OPR A;  1ZTU A;  5HWT A;  4JKT A;  3CPT A;  4ZAM A;  3S1Y A;  1MC0 A;  4P6Z M;  3GR2 A;  3SZT A;  2V1Z A;  2GDN A;  4Y5F A;  4EBL A;  5F68 A;  1XJ2 A;  5M19 A;  1KDW A;  5DFY A;  4N9L A;  3JPU A;  2XA7 M;  5HL1 A;  4KG2 A;  5DJU A;  4E3N A;  4C75 A;  3S7Q A;  1K4F A;  2Y79 A;  4Y15 A;  3BQA A;  1N9N A;  2Z6D A;  4N9K A;  1E4D A;  4GLQ A;  4MBK A;  1TF1 A;  3ZNY A;  3O88 A;  3TJZ C;  3W2Z A;  2Y2Q A;  2OWJ A;  3BM6 A;  4R3B A;  4EWF A;  1S1Z A;  3N8R A;  3KYZ A;  1VB6 A;  3CLO A;  3F1P B;  1IFQ A;  1OPX A;  4BBT A;  1G6A A;  1VQQ A;  3H82 A;  1PWG A;  2QZ6 A;  5FI6 A;  4JGR A;  1S66 L;  3H7W B;  3NJA A;  2RL3 A;  3UDX A;  2VX8 A;  3WS4 A;  1STZ A;  3N8L A;  4I3A A;  1TS0 A;  3VOZ A;  2BG1 A;  2XQZ A;  1NWZ A;  2P7J A;  4X6T A;  3GSG A;  1ZC2 A;  4C6Y A;  3BQ8 A;  5K5B A;  1G5U A;  3DTI A;  1MKI A;  2QKP A;  5DF7 A;  3IX4 A;  1K6S A;  4MDZ A;  5DTT A;  3FKW A;  5DF9 A;  2ZC6 B;  4N92 A;  2J9O A;  1VEU B;  2R9X A;  5GL9 A;  3LIC A;  3WRZ A;  3B47 A;  1KGE A;  1XA1 A;  3C5A A;  2ZC3 B;  3E0Y A;  1BZA A;  4GD6 A;  1XA7 A;  3MXQ A;  4U3T A;  3UE0 A;  4X55 A;  2IA2 A;  4LFU A;  1NRJ A;  1F98 A;  3IWQ A;  3WS1 A;  3N8S A;  4KUO A;  1H8Z A;  3CIT A;  5DTS A;  2B95 A;  3NI9 A;  4KZA A;  3Q81 A;  2X71 A;  2J7V A;  2JBF A;  2ZOH A;  3OC2 A;  4DE0 A;  2P74 A;  2W3F A;  3M2J A;  3IQA A;  3GQZ A;  5FL3 A;  3G4P A;  2V20 A;  4UA9 A;  4Q0I A;  2IWD A;  1K57 C;  4B9O A;  3W4O A;  1K57 A;  5U47 A;  1YAX A;  3BW6 A;  3HJI A;  4BL2 A;  1MPL A;  1TEM A;  3SH9 A;  1JNU A;  3E4P A;  1BLC A;  3QP6 A;  4JLF A;  1Z6F A;  1TD5 A;  1XJ3 A;  1FOF A;  2VZW A;  1NLZ A;  3CPT B;  2G7U A;  4GOG A;  5HL6 A;  3LR5 A;  5I5L A;  1ONH A;  1JWP A;  3UB9 A;  4GKU A;  3VOY A;  1IEM A;  4DN0 A;  2VA0 A;  3VOL A;  3PYP A;  1YLT A;  4NK3 A;  5HD5 A;  3V3S A;  4LLO B;  3IBJ A;  1TDL A;  3KSH A;  4PHT A;  4Q0H A;  3IH9 A;  1O7E A;  2PBD P;  5FI7 A;  5L2F A;  4UA6 A;  2CMN A;  3R7W A;  4UQI S;  2O9A A;  2M1C A;  4HP9 A;  2K7S A;  3CUE C;  2ZQA A;  1SKO B;  2GZA A;  3FYZ A;  3CUE A;  1PW1 A;  1UGU A;  3BY9 A;  1L0F A;  2XLN A;  1Y4O A;  4F94 A;  3SS5 A;  1U60 A;  4RYE A;  2Y2K A;  2DRW A;  1IYO A;  5HPF A;  3H82 B;  5HPI A;  4R0Q A;  4E04 A;  2VJW A;  4GDB A;  4Y0T A;  2A49 A;  3M6B A;  3HLD A;  5AQ7 A;  1YLJ A;  4H6J A;  5F1F A;  1L3L A;  1DP6 A;  5F6A A;  1SZV A;  3H9W A;  5FQJ A;  3T1Q B;  3IF6 C;  4JGQ A;  1VET B;  4OLG A;  2XRN A;  3IF6 A;  3QHY A;  3S4X A;  3LI9 A;  1CI9 A;  3GVB A;  1DRM A;  3KYE A;  2ZM8 A;  5IU1 A;  1MWR A;  3OCL A;  4JXG A;  4ARZ A;  3BRM A;  4KQO A;  2ZL1 A;  4PM6 A;  1X0O A;  3KSF A;  4R3J A;  4ZJ3 A;  4ETX A;  3C7V A;  4R70 A;  1NYY A;  1PIO A;  1E3U A;  2XR0 A;  3IXG A;  1FCO A;  4XT2 A;  2H28 A;  4R4S A;  1T1B A;  3IWI A;  4Q8I A;  3DTM A;  1E3U D;  3M2K A;  4O7D A;  3V50 A;  1VM1 A;  1XX2 A;  3F1N B;  3O86 A;  5CXW A;  2KDK A;  2VK3 A;  5FQM A;  4FH2 A;  3PBQ A;  1PI4 A;  3HVF A;  2Y2O A;  2Y2L A;  4FTX A;  5IT5 A;  3C2W A;  1RGY A;  2Y8H A;  4JGO A;  4MCW A;  3CJM A;  3G30 A;  1Y28 A;  4OOM A;  3W4P A;  1F5M A;  1HD8 A;  4HY8 A;  3UMD A;  3P09 A;  1YSP A;  1XXM A;  1IEL A;  3K3D A;  5GHZ A;  4HOI A;  1YLY A;  4XUX A;  4EQ1 A;  4WZ5 C;  3Q1F A;  4L9G A;  4G3W A;  3CMZ A;  4WZ5 A;  1PNE A;  1CQA A;  1TS6 A;  4HNB A;  4E3M A;  4KEN B;  4X53 A;  5CGS A;  3G2Y A;  1N9B A;  3KO6 A;  3ZGA B;  3V3R A;  1RGZ A;  3T4J A;  4FOF A;  3BFD A;  3ZG5 A;  2JKT M;  2WAF A;  1KGG A;  5TGF A;  2D02 A;  2PU4 A;  3IT9 A;  5EUA A;  1T1A A;  3JYI A;  5EOO A;  1BT5 A;  3E2K A;  4DE2 A;  1KGF A;  5CHM A;  5CGX A;  5EFW A;  1DJC A;  2V0U A;  1BUL A;  1K0K A;  4IJG A;  3HL9 A;  3NC8 A;  3OCN A;  4OQI A;  1IYS A;  5JYO A;  4F3L A;  3NEC A;  5HDD A;  1OTI A;  5E2E A;  2EX2 A;  4WM9 A;  2QMI A;  2J9P A;  4BL3 A;  2QHK A;  2EWV A;  1LSV A;  3ITA A;  3R7W B;  4DJ3 A;  2QPN A;  3UE1 A;  4IVI A;  3R4K A;  4II7 A;  1ES3 A;  3LEZ A;  2PU2 A;  4IBX A;  3LCE A;  3OPH A;  1N9O A;  3T4K A;  2KOI A;  3VFF A;  1KVM A;  4X1L A;  5KMW A;  1CI8 A;  1W8Y A;  4E3L A;  2ZMV A;  1OTD A;  4RX2 A;  1NRF A;  3K3C A;  3LR3 A;  2WGV A;  4Y2F A;  1M40 A;  4DKI A;  3HLB A;  1W79 A;  1ACF A;  1YPR A;  5FQK A;  2HP9 A;  3LIA A;  4PM7 A;  2Q9M A;  4H6J B;  4CLC E;  1FIK A;  5CTN A;  4EET B;  2ZM0 A;  4GHI A;  1SDE A;  3B33 A;  1JVJ A;  4UA7 A;  5JYP A;  1RP5 A;  3IF6 B;  3EGX C;  4CLC C;  2Q0O A;  3CAX A;  3GV9 A;  3EWK A;  5MC7 A;  1BYW A;  2HF6 A;  5EVL A;  1IOU A;  3PBN A;  5FQ9 A;  5TJJ A;  4HJ4 A;  3OPL A;  1KDS A;  4ARZ B;  3WWX A;  1OTA A;  4LRX C;  5G4Z A;  1PFL A;  1NY0 A;  3G32 A;  5HFO A;  3VMA A;  5L09 A;  3MQQ A;  3ZDJ A;  2Y2H A;  3A3J A;  4ZJ1 A;  4AFI A;  3Q82 A;  1H0M A;  3A3E A;  1ESI A;  3LR0 A;  1YMS A;  3LFV A;  4XT2 B;  3T1X A;  5FAP A;  3S7O A;  1W7F A;  1MWS A;  4WLA A;  2IWC A;  3HLC A;  4MBH A;  5E43 A;  3ZVT A;  3DAV A;  3HLG A;  2GJ3 A;  4R1G A;  4Y0U A;  3VSK A;  1BSG A;  3E98 A;  3DTK A;  4MN7 A;  2Y2P A;  4EEU A;  1GSX A;  2W0N A;  2ZC5 B;  3ZQ5 A;  3A0S A;  4R6L A;  2PD7 A;  4OP5 A;  2OV5 A;  3LGO A;  3HJK A;  4S2N C;  4KZ7 A;  4OP8 A;  2JC7 A;  4WN5 A;  1QME A;  1F9I A;  1SKF A;  2HJ9 C;  1MWU A;  2PD8 A;  5CGW A;  3PXP A;  3MKF A;  3ZG0 A;  4DE1 A;  2ZQ9 A;  5CEB A;  4OPY A;  2B18 A;  1SKO A;  1VHM A;  2M7U A;  3PBR A;  3HBR A;  1CEF A;  2G2U A;  2UV0 E;  4BLM A;  3W8K A;  3MFD A;  3WS5 A;  1CEG A;  1WE4 A;  4L9F A;  1MY8 A;  1PWD A;  3MQO A;  5HZH A;  1HVB A;  5TR7 A;  3JVU A;  5KSH A;  4WYY A;  4F3L B;  1LHY A;  1MXO A;  3SS3 A;  5DVA A;  3MZE A;  1IYP A;  4R23 A;  3NCK A;  4JF5 A;  4RQ9 A;  5DKK A;  1MZU A;  3VE3 A;  5HD3 A;  4EQI A;  2EXB A;  1IKI A;  1VET A;  2PT7 A;  3ZG9 B;  2XFS A;  2W3D A;  4QY5 A;  2WGW A;  5EE8 A;  3CWF A;  1E25 A;  5A91 A;  2LB5 A;  1T1C A;  4WMC A;  4B93 A;  2PYR A;  3TG9 A;  1UWN X;  4P85 A;  2WZX A;  2YKF A;  1D06 A;  4WMC D;  4PKY A;  4EU0 A;  3O5Y A;  4IHQ A;  2OAP 1;  1MWT A;  1JWZ A;  3G34 A;  3S22 A;  2J3T C;  2EFU A;  3B42 A;  4KQR A;  4ETZ A;  1N9L A;  4GHI B;  1GSW A;  4EBN A;  4NXF A;  2J3T D;  5L8M A;  3VP2 A;  3OZH A;  2O0Y A;  1ONG A;  4CPK A;  3MS6 A;  3ISG A;  3F1N A;  4CLC B;  2K2N A;  5EM1 A;  3HCY A;  4ESP A;  3LIF A;  5FAO A;  3KSI A;  4UQI M;  2WKI A;  2WK0 A;  3IXH A;  1RCJ A;  4LPZ A;  4B4X A;  4CQH A;  2J8Y A;  4WEJ A;  2JKT I;  1PW8 A;  1S67 L;  2VV8 A;  2W1T A;  1BLP A;  3IX8 A;  5E2G A;  1S0W A;  4QU3 A;  1DP9 A;  1NZU A;  4NEE D;  3T12 B;  4CJN A;  3A3I A;  4KZ5 A;  2XSS A;  3BFC A;  4FSF A;  1XP4 A;  3FG8 A;  3U2A A;  4JXW A;  5HDC A;  4ZTK A;  5HW3 A;  3D4F A;  1FIL A;  3VP0 A;  1J3W A;  2GNX A;  4YNR A;  1ERQ A;  2E8I A;  3GEC A;  3WRT A;  1LSW A;  1SDN A;  3LO7 A;  1S4R A;  3T4S A;  3VP1 A;  2QJ5 A;  4IED A;  1PZO A;  1K25 A;  4HJ6 A;  3PHY A;  2Y2I A;  3C4O A;  1K4E A;  1OTE A;  3MZF A;  3E2L A;  3ICY A;  3KYQ A;  3FC7 A;  1I2S A;  1H5X A;  2GX5 A;  4BWI A;  5EEC A;  4X56 A;  3BWL A;  4KQD A;  3QP5 A;  2PDR A;  5FEG A;  5F82 A;  2R78 A;  4DRT A;  4UAA A;  2HPB A;  2B02 A;  1L0D A;  5E2F A;  2IWB A;  3P98 A;  1KOU A;  2HP5 A;  4O8G A;  4ZDX A;  2PR6 A;  4YFM A;  3RH8 B;  3PTE A;  3G2Z A;  4LEN A;  2WYX A;  4FCF A;  3SS4 A;  2JCH A;  1CF0 A;  5FEF A;  4WL9 A;  3N6I A;  3IS2 A;  4D60 A;  5A8B A;  4QWO A;  2Y59 A;  2UWX A;  4HHD A;  5DFX A;  3CHW P;  3EQV A;  4LV1 A;  4HJ3 A;  4BBV A;  1TS7 A;  3C30 A;  3BYD A;  4ZJ2 A;  5F69 A;  4JXV A;  1BLS A;  1WYC A;  2XF3 A;  4HEF A;  1P97 A;  4QB8 A;  3FZC A;  3HUM A;  3HUN A;  2XK1 A;  3O3V A;  2ZJ9 A;  1FSW A;  2ZM2 A;  5HAR A;  4S2O A;  2JHE A;  1NYM A;  3UB8 A;  2WGW B;  3QP4 A;  2JKR I;  4DJ2 A;  4QD4 A;  5AVF A;  4GB7 A;  3UDF A;  3V39 A;  3DBA A;  2PAV P;  3LIB A;  2P08 A;  1AXB A;  3GMW A;  1K54 C;  2P04 A;  2L0W A;  2ZOI A;  5KIZ A;  2XH9 A;  3Q7Z A;  4PM5 A;  4YOF A;  4WEK A;  3IBR A;  3LYX A;  4ZBE A;  4BBU A;  2PBY A;  5FDS A;  3KSG A;  5J7E A;  4EXO A;  3G31 A;  2XD5 A;  4KZ4 A;  3IH8 A;  2AVX A;  5CEC A;  3SW1 A;  3ULF A;  5FAS A;  3LI8 A;  2HJE A;  3EGD C;  3UPP A;  4NET A;  1XKZ A;  1YLP A;  3BFG A;  1XFQ A;  5G4Y A;  3E4Q A;  3T4Q A;  5DTK A;  3P01 A;  3BFE A;  3MFX A;  4I5S A;  1LL5 A;  2DMW A;  5CX7 A;  2Z2M B;  1W5D A;  3TE8 A;  4DMZ A;  3EEH A;  3T1R A;  2Y2M A;  4EES A;  3C8C A;  5GHY A;  2QWS A;  4PM9 A;  4KZ9 A;  3SH7 A;  1V9Y A;  2W1T B;  5HAQ A;  4Z1W A;  1G68 A;  3ZFZ A;  4ZRR A;  3OOV A;  1ODV A;  4NKP A;  3C38 A;  3F1O B;  5GLD A;  3C4P A;  5HDS A;  1YT4 A;  4MLL A;  3FWL A;  3E4O A;  4BEN A;  1OME A;  1GA9 A;  3O87 A;  4OPQ A;  1KE0 A;  4YWZ A;  4JBF A;  1ERO A;  2K31 A;  4IUH A;  1K56 A;  4PPR A;  3VV4 A;  2QJ7 A;  3BY8 A;  3VSL A;  1TS8 A;  1HZO A;  2QYB A;  2WAD A;  3S7P A;  3V5M A;  3QP2 A;  5A93 A;  3D3O A;  1K56 D;  1ZHH B;  4PKY G;  1GSV A;  4ID4 A;  3A0R A;  4OQG A;  1LI9 A;  4LCM A;  1F2K A;  5IS1 A;  4FUW A;  1H3Q A;  3NOT C;  1ES2 A;  1I5Q A;  5EPH A;  2V9A A;  2ZMA A;  5KSC A;  4OVD A;  2YKH A;  3EEA A;  5TFQ A;  4Y13 A;  2ZQ7 A;  1LSX A;  1PZP A;  2G2W A;  4OOL A;  4GJ4 A;  5HAI A;  5EOE A;  2XGN A;  4K91 A;  4QY6 A;  4QPR A;  4I3I A;  4K0X A;  4BD1 A;  2HDS A;  3MKE A;  1FCN A;  2Y55 A;  4MNR A;  4U0T A;  1WA9 A;  2HP6 A;  1H8M A;  5M1A A;  2P9V A;  3K2N A;  4XXR A;  1YMX A;  2BTF P;  2WKH A;  3P7N A;  3CI6 A;  1BTL A;  3IS2 B;  3W4Q A;  1OTB A;  4C3Q A;  3IHB A;  4KZ8 A;  3ZG8 B;  2Y91 A;  2ZQ8 A;  1GHP A;  3UE3 A;  4D2O A;  4OQ0 A;  4R4R A;  4IBR A;  4NXB A;  2VGK A;  4UEY A;  1NLY A;  3DTE A;  2FFF B;  5EV0 A;  2R9W A;  1PRQ A;  4MMN A;  3IXD A;  3I7J A;  2OOL A;  4P6B A;  5DKL A;  2EXA A;  4GN2 A;  4DXB A;  2VV7 A;  2JKG A;  3A3D A;  4E6X A;  5L07 A;  2HZ5 A;  2FFY A;  4CLC A;  1IYQ A;  3UDI A;  4E3I A;  2RCX A;  4CLC D;  2Y4A A;  4UHU A;  3MSH A;  3EOI A;  3T4T A;  5CHJ A;  3BLS A;  4LV2 A;  2VEA A;  4GDN A;  4P0M A;  5EVI C;  1ESU A;  5BOH A;  1FR6 A;  2DCF A;  3TSG A;  3NOU C;  5EVI A;  3GRJ A;  5HWW A;  2ZC4 B;  4KUK A;  5EVI D;  3Q07 A;  1ERM A;  2JKR M;  4O01 A;  2V0W A;  1EW0 A;  3NUL A;  3LY4 A;  4K0W A;  2ZQD A;  2I72 A;  5FSR A;  3UB6 A;  3MXS A;  3HLW A;  4HBU A;  4GCZ A;  1FCM A;  4BMW A;  1EWZ A;  3OPP A;  4G3K A;  3PBT A;  2O9C A;  5FA7 A;  1W63 M;  4M4X A;  5EM0 A;  3BFF A;  3AGF A;  3T4L A;  4KZ3 A;  1S4S A;  1BUE A;  1YKD A;  4X1M A;  3BLM A;  5CHU A;  1A0K A;  4B88 A;  3GTC A;  3RXX A;  4EEP A;  1Q2Q A;  4S2N A;  5GLB A;  4HI4 A;  1OT9 A;  4NXG A;  5GHX A;  2HV1 A;  5G18 A;  4Q0J A;  1FQG A;  1NXY A;  4EV4 A;  3QNC A;  2VGJ A;  1AWI A;  4GZB A;  3MMH A;  1I2W A;  3V67 A;  2W1R A;  3HLF A;  2BAS A;  4QHC A;  3IHA A;  4E3O A;  4BJP A;  1DY6 A;  3BEC A;  1QMF A;  1XPB A;  2Y2J A;  3T1S A;  4HQA A;  1LLB A;  2JE5 A;  3UO9 A;  3MR0 A;  2A24 B;  3TRC A;  1JWV A;  3IXB A;  2V8F A;  1Q2P A;  3DWK A;  4JXS A;  3QNB A;  5J8X A;  5A90 A;  3FPV A;  2V1A A;  3RFB A;  1XFN A;  4E3J A;  2INW A;  2WZZ A;  5HAP A;  1D1J A;  4MBF A;  2Z6C A;  4WEL A;  1YSQ A;  1YLW A;  2A2L A;  5FAT A;  2EWW A;  2P9V B;  4DDY A;  4XUZ A;  2VGL S;  1GHI A;  3QP8 A;  3PR6 A;  3RTY A;  1CJF A;  2PR5 A;  5F83 A;  2XEP A;  3QP1 A;  3OPR A;  2X02 A;  5A92 A;  3BJN A;  4P87 A;  3UB7 A;  2OAQ 1;  3G6O A;  4OH0 A;  4P6Z S;  3UN7 A;  5FQQ A;  2PHY A;  2PRF A;  1S1Y A;  5L10 A;  3ZYT A;  3C7U A;  3OBF A;  4N1H A;  4LCL A;  3MJQ A;  4I39 A;  5AQA A;  3G35 A;  3KX0 X;  2OSU A;  2XA7 S;  1TVF A;  3BEB A;  3ITB A;  4L0L A;  1KVL A;  1K6R A;  4Y7P A;  3CG5 A;  2M7V A;  3DWZ A;  2ZLY A;  1P9R A;  4X68 A;  4LGW A;  2FH5 A;  3ZG7 B;  4MEZ A;  4RVA A;  5TBM A;  5EVI B;  1OJG A;  3LID A;  5HX9 A;  1N4O A;  3AGE A;  4GNU A;  2Q9N A;  3F1O A;  4OON A;  3LUQ A;  3Q7V A;  4E6W A;  4OLD A;  2H10 A;  1UWP X;  3SOI A;  4EER A;  5CED A;  1P0Z A;  3HUO A;  3WS0 A;  2Y2N A;  3A3F A;  4S2K A;  3UB5 P;  1H8Y A;  2CC1 A;  1KE4 A;  5KZH A;  2OLU A;  4DXC A;  4KG5 A;  5E2H A;  3T50 A;  1GA0 A;  2ZD8 A;  3LY3 A;  3HLE A;  1HTZ A;  3FV7 A;  4DE3 A;  4GS9 A;  3LR4 A;  3IF5 A;  3PBO A;  2JKF A;  3PBS A;  4OOY A;  5GLA A;  1DJA A;  2WUQ A;  1ZG4 A;  3FKV A;  4PM8 A;  2W3G A;  4LV0 A;  2E8J A;  4LRZ E;  4Y0O A;  3MXR A;  3NHQ A;  5C5K A;  2V2F F;  3NIA A;  2EX9 A;  3SH8 A;  4I38 A;  2B5R A;  2XDM A;  4B4Z A;  1Z09 A;  4G3V A;  4WF0 A;  4MN5 A;  2HDR A;  1L0G A;  4WUJ A;  4L9E A;  1W63 Q;  2EFX A;  1FR1 A;  2VLG A;  5AQ9 A;  3EQU A;  3N7W A;  1KE3 A;  1MKM A;  4EUZ A;  1GCE A;  3VFH A;  3UPN A;  1XGJ A;  4EW7 A;  1PWC A;  2D01 A;  3MBZ A;  2XFT A;  5J4E A;  3ZVW A;  1P9W A;  1FSY A;  4S2J A;  2PYP A;  3MQ0 A;  1TDG A;  5AVE A;  1K54 A;  2X01 A;  4HIA A;  4JF6 A;  2LB9 A;  4HH3 A;  2V8C A;  2J3W A;  2Y2G A;  4BD0 A;  4DF6 A;  1PI5 A;  3NY4 A;  4EUV A;  4S2P A;  4OKP A;  4BQM A;  2NUP C;  1OJ5 A;  2H0Y A;  1K55 C;  1LL8 A;  4MN6 A;  2W27 A;  2FZ0 A;  2HDQ A;  4FD8 A;  3D72 A;  4I3J A;  1K55 A;  2XD1 A;  1JTG A;  4GW9 A;  4WZ4 A;  2HGV A;  4O0P A;  1W8Q A;  4E3K A;  2H5S A;  3LIE A;  1GHM A;  2WGI A;  2OWH A;  4M3K A;  4WBG A;  4S2I A;  2H0T A;  3ZCZ A;  5FI2 A;  4N1X A;  1SHV A;  3MF0 A;  5FQI A;  2L1M A;  3VE4 A;  2W3H A;  5HWV A;  4PMA A;  5FDH A;  5TBM B;  1JTD A;  2ZMF A;  1XJ6 A;  3T4O A;  3GDI A;  2MJ6 A;  1BLH A;  3DW0 A;  2L4R A;  2VKS A;  4KZ6 A;  3N4I A;  2WAE A;  2ZC7 A;  3TW8 A;  5HSQ A;  1Y54 A;  4Y17 A;  3NOP C;  2Z2L B;  3Q7V B;  2EX8 A;  4OPZ A;  2V1B A;  1NZO A;  1K38 A;  4KZB A;  2HDU A;  4Y3I A;  5F1G A;  3FPW A;  3RXW A;  2ZBB A;  4A5R A;  1T19 A;  4JGP A;  3ZNT A;  3A0V A;  2WKP A;  1PYY A;  3L7H A;  2EX6 A;  2ZQC A;  3LEQ A; 
#chains in the Genus database with same CATH homology
 1NJ4 A;  3VP2 A;  3OZH A;  3BFF A;  3AGF A;  1MBL A;  1SCW A;  4R0Q A;  1ONG A;  2C6W B;  3PAE A;  3UY6 A;  1YM1 A;  4KZ3 A;  4GDB A;  1S6R A;  4Y0T A;  4CPK A;  3ISG A;  2A49 A;  3M6B A;  1BUE A;  3HLD A;  5AQ7 A;  5GLC A;  1YLJ A;  3AGD A;  5FAO A;  1C3B A;  3BLM A;  5CHU A;  4B88 A;  5F1F A;  3GTC A;  1DJB A;  4HES A;  2WKI A;  4YIN A;  5FQJ A;  2WK0 A;  4EBP A;  3IF6 C;  3IXH A;  1RCJ A;  3RXX A;  3B3X A;  4OLG A;  1Q2Q A;  3IF6 A;  3QHY A;  4S2N A;  5GLB A;  5CRF A;  1L0E A;  4B4X A;  1L2S A;  3S4X A;  5CER A;  2J8Y A;  4WEJ A;  3IWO A;  1PW8 A;  5GHX A;  3WS2 A;  1BLP A;  1CI9 A;  3GVB A;  5G18 A;  5E2G A;  3VP4 A;  1FQG A;  1NXY A;  1S0W A;  4QU3 A;  1NZU A;  4EV4 A;  3QNC A;  5CTM A;  2ZM8 A;  4CJN A;  3A3I A;  3VP3 A;  1MWR A;  2VGJ A;  4KZ5 A;  3OCL A;  5D3O A;  3BFC A;  4GZB A;  4JXG A;  4FSF A;  1XP4 A;  3BRM A;  1I2W A;  3TOI A;  4KQO A;  4U0X A;  3HLF A;  5M18 A;  4JXW A;  4PM6 A;  4IVK A;  4QHC A;  4GD8 A;  4R3J A;  4ZJ3 A;  3IHA A;  4ZTK A;  4E3O A;  4OQH A;  4BJP A;  5HW3 A;  1DY6 A;  3D4F A;  3BEC A;  4JPM A;  3C7V A;  1NYY A;  3VP0 A;  1WYB A;  1QMF A;  2C5W B;  1XPB A;  2Y2J A;  1PIO A;  1E3U A;  2XR0 A;  2BLS A;  3IXG A;  1ERQ A;  1FCO A;  4DDS A;  3NDG A;  1LLB A;  2E8I A;  4R4S A;  3IWI A;  4Q8I A;  3DTM A;  3WRT A;  1E3U D;  1SDN A;  2JE5 A;  1LL9 A;  3M2K A;  4O7D A;  3UO9 A;  1ALQ A;  3LO7 A;  3VP1 A;  1XGI A;  4IED A;  1JWV A;  1PZO A;  3IXB A;  3V50 A;  1Q2P A;  1VM1 A;  1XX2 A;  3DWK A;  3MZD A;  3O86 A;  1K25 A;  4JXS A;  1J9M A;  3QNB A;  5CXW A;  4QJG A;  2Y2I A;  1LI0 A;  5J8X A;  3C4O A;  5FQM A;  1CK3 A;  1K4E A;  3RJU A;  4FH2 A;  2A3U A;  3MZF A;  3PBQ A;  1PI4 A;  1ES4 A;  3E2L A;  3HVF A;  1IKG A;  5A90 A;  2Y2O A;  2Y2L A;  4E3J A;  2WZZ A;  5HAP A;  1RGY A;  1I2S A;  4MBF A;  1H5X A;  3NBL A;  1ZG6 A;  4WEL A;  4Z9Q A;  5IHV A;  4HBT A;  1O07 A;  1YLW A;  3CJM A;  4RA7 A;  5EEC A;  4X56 A;  5FAT A;  3G30 A;  2P9V B;  4DDY A;  1ZKJ A;  4OOM A;  4XUZ A;  3W4P A;  3ZHH A;  1GHI A;  1HD8 A;  5DF8 A;  1M6K A;  4FH4 A;  5F82 A;  4RX3 A;  5F83 A;  3M6H A;  3P09 A;  4DRT A;  2XEP A;  4UAA A;  2HPB A;  4S2M A;  1XXM A;  1IEL A;  5GHZ A;  3OPR A;  1L0D A;  2WKE A;  2X02 A;  3P98 A;  4X69 A;  5E2F A;  5AQB A;  2HP5 A;  1YLY A;  2IWB A;  5A92 A;  4XUX A;  4WZ5 C;  3Q1F A;  4P87 A;  4ZDX A;  3CMZ A;  3UNW A;  4YFM A;  4H8R A;  4WZ5 A;  5FAQ A;  3PTE A;  3G2Z A;  4LEN A;  4OH0 A;  3UN7 A;  5I94 A;  2WYX A;  4FCF A;  1YQS A;  4KG6 A;  4E3M A;  4LV3 A;  3SS4 A;  2JCH A;  4KEN B;  4X53 A;  5CGS A;  5FQQ A;  3N6I A;  3G2Y A;  2OLV A;  4JF4 A;  1N9B A;  3ZGA B;  3C7U A;  4S2L A;  2Y59 A;  3V3R A;  2UWX A;  4KQQ A;  1RGZ A;  4N1H A;  3EQV A;  4LV1 A;  3BFD A;  3CZD A;  4LCL A;  3ZG5 A;  2WAF A;  1KGG A;  5AQA A;  1ES5 A;  2PU4 A;  3G35 A;  3IT9 A;  3PAG A;  5EUA A;  3BYD A;  1EI5 A;  2OSU A;  3JYI A;  5EOO A;  4ZJ2 A;  1BT5 A;  4JXV A;  1BLS A;  1TVF A;  1WYC A;  3BEB A;  2XF3 A;  3E2K A;  1KGF A;  2DNS A;  3HRE A;  3ITB A;  4HEF A;  4L0L A;  5CHM A;  4DE2 A;  1YLZ A;  1KVL A;  5CGX A;  4QB8 A;  3UPO A;  1K6R A;  4Y7P A;  1DJC A;  3FZC A;  3HUM A;  3HUN A;  1BUL A;  3CG5 A;  2XK1 A;  3NDE A;  4OPR A;  3O3V A;  3DWZ A;  2ZJ9 A;  4JKT A;  1FSW A;  2ZLY A;  3HL9 A;  3NC8 A;  2ZM2 A;  3OCN A;  4OQI A;  5HAR A;  4X68 A;  4ZAM A;  4S2O A;  1IYS A;  1NYM A;  5JYO A;  3S1Y A;  2WGW B;  4QD4 A;  5E2E A;  2EX2 A;  3GR2 A;  2QMI A;  4MEZ A;  2J9P A;  4GB7 A;  4RVA A;  4WM9 A;  2V1Z A;  3UDF A;  3V39 A;  4BL3 A;  1AXB A;  2GDN A;  3GMW A;  1K54 C;  5EVI B;  4EBL A;  3ITA A;  2XH9 A;  5M19 A;  1KDW A;  5HX9 A;  3Q7Z A;  4N9L A;  4PM5 A;  4WEK A;  2QPN A;  4ZBE A;  2PBY A;  3UE1 A;  4IVI A;  1N4O A;  3AGE A;  4GNU A;  2Q9N A;  1ES3 A;  3LEZ A;  2PU2 A;  4IBX A;  3LCE A;  4OON A;  5HL1 A;  3OPH A;  3G31 A;  2XD5 A;  3Q7V A;  4KZ4 A;  3IH8 A;  4OLD A;  3VFF A;  2H10 A;  4KG2 A;  1KVM A;  5CEC A;  3SOI A;  4E3N A;  4C75 A;  1K4F A;  5FAS A;  5KMW A;  1CI8 A;  1W8Y A;  4E3L A;  5CED A;  4RX2 A;  1NRF A;  3HUO A;  3UPP A;  4N9K A;  4NET A;  1E4D A;  1XKZ A;  1YLP A;  3BFG A;  4MBK A;  2WGV A;  3WS0 A;  2Y2N A;  3ZNY A;  1M40 A;  3A3F A;  4S2K A;  3O88 A;  4DKI A;  3HLB A;  1W79 A;  1H8Y A;  2CC1 A;  1KE4 A;  2Y2Q A;  5FQK A;  5KZH A;  2OLU A;  2HP9 A;  4DXC A;  3BM6 A;  4KG5 A;  4R3B A;  5E2H A;  4EWF A;  1GA0 A;  2ZD8 A;  5DTK A;  3BFE A;  3N8R A;  4PM7 A;  3LY3 A;  3HLE A;  2Q9M A;  1HTZ A;  3FV7 A;  5CTN A;  2ZM0 A;  1LL5 A;  1SDE A;  1G6A A;  1VQQ A;  2Z2M B;  4DE3 A;  1W5D A;  1JVJ A;  4UA7 A;  1PWG A;  2QZ6 A;  5FI6 A;  5JYP A;  1RP5 A;  3IF6 B;  3IF5 A;  3PBO A;  2Y2M A;  3PBS A;  4OOY A;  5GHY A;  5GLA A;  1DJA A;  2WUQ A;  3GV9 A;  4PM9 A;  4KZ9 A;  3SH7 A;  5EVL A;  2RL3 A;  5HAQ A;  3PBN A;  1ZG4 A;  1G68 A;  3UDX A;  3FKV A;  3ZFZ A;  5FQ9 A;  3WS4 A;  4PM8 A;  3N8L A;  4LV0 A;  3OPL A;  1KDS A;  3VOZ A;  2BG1 A;  4Y0O A;  2XQZ A;  3WWX A;  4X6T A;  3GSG A;  1ZC2 A;  1NY0 A;  3MXR A;  4C6Y A;  5GLD A;  3G32 A;  5HFO A;  3C4P A;  3VMA A;  3ZDJ A;  1YT4 A;  2Y2H A;  3A3J A;  4ZJ1 A;  4MLL A;  3FWL A;  3Q82 A;  3A3E A;  1ESI A;  2V2F F;  5DF7 A;  1MKI A;  4BEN A;  1OME A;  1K6S A;  3NIA A;  1GA9 A;  3O87 A;  4OPQ A;  1KE0 A;  2EX9 A;  3SH8 A;  5DTT A;  2B5R A;  2XDM A;  1YMS A;  4JBF A;  4B4Z A;  1ERO A;  1K56 A;  4PPR A;  3FKW A;  2HDR A;  3VSL A;  5FAP A;  1HZO A;  1L0G A;  2WAD A;  3V5M A;  5A93 A;  2EFX A;  1K56 D;  1FR1 A;  1W7F A;  5DF9 A;  5AQ9 A;  2ZC6 B;  3EQU A;  4N92 A;  3N7W A;  1MWS A;  2J9O A;  4ID4 A;  2R9X A;  2IWC A;  3HLC A;  4MBH A;  5E43 A;  3ZVT A;  5GL9 A;  1KE3 A;  3WRZ A;  3HLG A;  4OQG A;  4R1G A;  4Y0U A;  1LI9 A;  4EUZ A;  1KGE A;  1XA1 A;  4LCM A;  3VSK A;  1GCE A;  3VFH A;  1BSG A;  3UPN A;  3C5A A;  1XGJ A;  1ES2 A;  1I5Q A;  2ZC3 B;  2Y2P A;  1BZA A;  4GD6 A;  1PWC A;  1XA7 A;  2ZC5 B;  4U3T A;  5EPH A;  3MBZ A;  4X55 A;  3UE0 A;  2XFT A;  2ZMA A;  5KSC A;  4OVD A;  3ZVW A;  4OP5 A;  5TFQ A;  2ZQ7 A;  3IWQ A;  3WS1 A;  3N8S A;  2OV5 A;  1FSY A;  1H8Z A;  4S2J A;  5DTS A;  3NI9 A;  1PZP A;  2G2W A;  4KZA A;  4OOL A;  3Q81 A;  5HAI A;  1TDG A;  2X71 A;  5EOE A;  1K54 A;  2XGN A;  4S2N C;  4K91 A;  2X01 A;  2J7V A;  4QY6 A;  4K0X A;  4KZ7 A;  4BD1 A;  2JBF A;  2HDS A;  3OC2 A;  4OP8 A;  3MKE A;  1FCN A;  2Y55 A;  4MNR A;  4U0T A;  2JC7 A;  4JF6 A;  2HP6 A;  1QME A;  5M1A A;  1SKF A;  2P9V A;  4DE0 A;  1MWU A;  4XXR A;  1YMX A;  2P74 A;  5CGW A;  2Y2G A;  3M2J A;  4BD0 A;  4DF6 A;  1PI5 A;  3IQA A;  3NY4 A;  2WKH A;  3GQZ A;  3MKF A;  3G4P A;  4OKP A;  4S2P A;  3ZG0 A;  1BTL A;  4BQM A;  3W4Q A;  4DE1 A;  2ZQ9 A;  2H0Y A;  4C3Q A;  2V20 A;  1K55 C;  5CEB A;  4UA9 A;  2HDQ A;  2IWD A;  3IHB A;  4FD8 A;  4OPY A;  1K57 C;  4KZ8 A;  1K55 A;  3ZG8 B;  3PBR A;  2Y91 A;  1CEF A;  2G2U A;  2XD1 A;  2ZQ8 A;  3HBR A;  1JTG A;  3W4O A;  1GHP A;  3UE3 A;  1K57 A;  5U47 A;  4D2O A;  4WZ4 A;  4BL2 A;  4OQ0 A;  4R4R A;  4BLM A;  1MPL A;  4IBR A;  3MFD A;  3W8K A;  3WS5 A;  1W8Q A;  4E3K A;  1TEM A;  2H5S A;  3SH9 A;  4E6W A;  1CEG A;  1WE4 A;  5TGF A;  3ZG7 B;  2VGK A;  1MY8 A;  1BLC A;  1GHM A;  1PWD A;  2FFF B;  2WGI A;  4JLF A;  1Z6F A;  4M3K A;  4WBG A;  2R9W A;  4S2I A;  3IXD A;  3I7J A;  1HVB A;  2H0T A;  3ZCZ A;  5TR7 A;  1FOF A;  4P6B A;  2EXA A;  5FI2 A;  4GN2 A;  4N1X A;  1SHV A;  5KSH A;  4DXB A;  3A3D A;  4WYY A;  4E6X A;  1LHY A;  1MXO A;  4GOG A;  5FQI A;  3SS3 A;  2FFY A;  4PMA A;  5FDH A;  1ONH A;  1IYQ A;  1JTD A;  1JWP A;  4GKU A;  5DVA A;  3UDI A;  3VOY A;  3MZE A;  1IEM A;  4E3I A;  1IYP A;  2RCX A;  4R23 A;  3NCK A;  4JF5 A;  4EQI A;  2EXB A;  1BLH A;  3DW0 A;  2Y4A A;  4UHU A;  1IKI A;  1YLT A;  4KZ6 A;  5CHJ A;  3N4I A;  3BLS A;  4LV2 A;  4NK3 A;  2WAE A;  2ZC7 A;  3V3S A;  3ZG9 B;  1Y54 A;  2XFS A;  4QY5 A;  2WGW A;  1TDL A;  2Z2L B;  4GDN A;  5EE8 A;  3Q7V B;  4P0M A;  2EX8 A;  5EVI C;  1ESU A;  4OPZ A;  1E25 A;  1NZO A;  1K38 A;  5BOH A;  3IH9 A;  1FR6 A;  5A91 A;  2DCF A;  3TSG A;  5EVI A;  3GRJ A;  1O7E A;  4WMC A;  2ZC4 B;  5FI7 A;  4UA6 A;  5L2F A;  3TG9 A;  4P85 A;  2WZX A;  4KZB A;  2HDU A;  5EVI D;  5F1G A;  3RXW A;  4A5R A;  2ZQA A;  1ERM A;  3Q07 A;  4WMC D;  3FYZ A;  4K0W A;  1PW1 A;  3LY4 A;  2ZQD A;  2I72 A;  1MWT A;  5FSR A;  1L0F A;  1JWZ A;  2XLN A;  3G34 A;  3S22 A;  3ZNT A;  4F94 A;  3MXS A;  3HLW A;  4HBU A;  1FCM A;  2EFU A;  1EWZ A;  3SS5 A;  1U60 A;  4RYE A;  1PYY A;  4KQR A;  3OPP A;  2Y2K A;  2EX6 A;  2DRW A;  1IYO A;  2ZQC A;  4EBN A;  3PBT A;  5FA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...