4IVIA

Crystal structure of a family viii carboxylesterase.
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
404
structure length
404
Chain Sequence
AEGPVTATKPKEAGFTSEGLARIDAYLKNEIQAKTMPGAVMMIKRNGETAYFSSFGLRDPDTKEPMTAETIFRIYSMSKPITTVAAMMLVEEGKLQLDEPVSKYIPSFANVKVGVETKGENGMALETGPVKRAITIQDLMRHTSGITYGFVGDGLVKKAYIASNLFDGDFDNAEFAERIAKLPLVYQPGTTWDYGHSTDILGRVVEVVSGKSLYQFEKERLLDPLGMKDTGFYVTDPAKKSLVAEAMPNDRKIGGSEMFDPRVQKKWEPGGQGMVSTIGDYARFTQMVLNGGTLDGKRYLSPKTIAYMGSNHIPQASGIVPGAYYLPGPGVGFGLGFAVRTEAGVTPVEGSVGDLSWGGAGGTVFWIDPKENLTVVFMAPMVSPRARVWRTLRNIVYGAFDRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the beta-lactamase activity of EstU1, a family VIII carboxylesterase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Carboxylesterase
total genus 125
structure length 404
sequence length 404
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2013-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4iviA00
1MWTA 3CJMA 4JF5A 4S2NA 4DKIA 1BULA 4WM9A 4RX3A 4X53A 4IVIA 1HTZA 1FR6A 5FI2A 1EROA 4N92A 4BD0A 4OQ0A 2JBFA 5I94A 4RX2A 1JTDA 2PU4A 2Y2PA 4GNUA 2CC1A 4DE2A 3ITBA 4PM5A 1ZKJA 3SS4A 1ZC2A 2QMIA 4P87A 1DJBA 5JYOA 4S2JA 4K0XA 1QMEA 2BLSA 1W8YA 4WZ5A 4R3BA 1IKGA 5FQJA 1CI8A 2EX6A 4WMCA 2QPNA 2RL3A 1SDEA 2HP6A 1SCWA 5HFOA 3BFDA 3ISGA 3AGEA 3UN7A 5CECA 1LLBA 4OPRA 4OH0A 4FH4A 4QY5A 1K56A 1VQQA 4IBXA 5KSHA 4R23A 4S2IA 3VOYA 4WMCD 4E6XA 1S0WA 2ZQCA 5CEDA 2G2WA 3VP0A 3BLMA 2FFFB 4IBRA 3A3FA 4K91A 4QD4A 4Z9QA 5TFQA 4KZ8A 5TGFA 1GHIA 1K55C 2J9PA 4GZBA 3VP2A 5EE8A 1HZOA 3A3EA 5HL1A 4LCLA 3CMZA 2R9WA 1K56D 5DVAA 3UNWA 5EVIC 4O7DA 4RA7A 1FSWA 3AGFA 3HLDA 2WGWB 3TOIA 2ZJ9A 2WGVA 5E2HA 3LY3A 4X55A 2ZC5B 4ID4A 4JLFA 4KZ6A 4OLDA 2ZC6B 5FASA 1MBLA 3MKFA 5HARA 4E6WA 3IF6A 3FV7A 3SOIA 5FQMA 3Q7ZA 4N9KA 3Q07A 1ZG6A 4QHCA 3C4PA 5EVIA 5CHMA 2HPBA 4BQMA 1L0FA 5FQKA 2JCHA 2ZQ9A 3IF6B 4UA6A 1TEMA 2QZ6A 2ZMAA 4R1GA 3N7WA 3MZDA 4JBFA 4E3MA 1M6KA 4XXRA 3W4OA 1BTLA 3FZCA 1ES2A 3ZNTA 1GA0A 3G31A 1XX2A 1Y54A 1E3UD 4OOLA 2ZQAA 1PYYA 3G34A 5A92A 3CZDA 4HESA 4E3NA 1ES3A 3ZDJA 1H8YA 4GOGA 3BFGA 4PM9A 2Y91A 3FKWA 2WYXA 4DDSA 2OSUA 2Y2MA 3SH7A 5HX9A 2ZD8A 1RGYA 4BENA 4NK3A 5CERA 1RCJA 4BD1A 3OZHA 4JXWA 4ZAMA 3OPHA 3IH9A 4OVDA 3SH9A 2WKIA 2HDRA 1WYCA 4KG2A 3FWLA 1LI9A 1K54C 3E2LA 5F83A 4PPRA 3EQVA 4ZJ3A 1C3BA 5CRFA 1XP4A 3BYDA 5FA7A 3V3RA 1YMSA 3MZEA 2Z2LB 1J9MA 1GA9A 1NXYA 1RP5A 3HUMA 1N9BA 5FAQA 4KZ9A 3C5AA 5FATA 1YLZA 2WAFA 2Y2GA 4JKTA 2V1ZA 4S2NC 5M19A 4E3IA 4L0LA 3OC2A 1BLCA 4RYEA 2OLUA 3OPPA 4X69A 4YFMA 4B4ZA 4EBLA 4DXCA 4LV3A 2R9XA 2V20A 3N8SA 3P09A 4QB8A 5BOHA 4LCMA 4CPKA 5DF7A 4LV1A 5DTTA 5GHYA 2P9VA 4GB7A 4KENB 4BJPA 2WZXA 1ESUA 1Q2PA 3ZG0A 1YT4A 4OKPA 4JXGA 3WS2A 1PZOA 4PM6A 3GV9A 1ES4A 3UE0A 2A3UA 3ZGAB 1Q2QA 4HBUA 1XGJA 1L0DA 2A49A 2Y59A 4LV0A 3BECA 3SS5A 2X02A 5TR7A 1BLPA 1GCEA 2J9OA 2Y2QA 4MBFA 3PBNA 3M2KA 1EWZA 1MWRA 5FI6A 4B4XA 4EQIA 1G6AA 1NZUA 2WKHA 5CXWA 1SDNA 3W8KA 5GL9A 4XUXA 3MXRA 4BL3A 1ESIA 1LHYA 4OP8A 4DF6A 1ONHA 1BLHA 3WWXA 1MXOA 5GLDA 1MY8A 3V3SA 4R4RA 5F82A 1E3UA 2XK1A 3UDIA 2FFYA 5FAOA 4OPYA 3BEBA 5EOOA 4WZ5C 5EVLA 2DNSA 4N1XA 2XFSA 2WK0A 3PBRA 4Y0UA 3IF6C 3S4XA 1XA7A 1H5XA 3QNBA 1K55A 2EFXA 3NDGA 3BFCA 2OLVA 4OLGA 3HREA 1KE3A 4EBPA 5KZHA 2H0YA 2P74A 1HVBA 5DF8A 4C75A 5KMWA 3TSGA 1MWUA 5GLBA 4MBKA 4QU3A 3VFHA 1WE4A 3ZNYA 2IWBA 4KG5A 3HLEA 4B88A 5U47A 3IH8A 4UA7A 4IVKA 1HD8A 3RXWA 4S2OA 3ZHHA 1W8QA 3WRZA 2E8IA 3N4IA 4N1HA 5E43A 4KZBA 2Q9MA 4FCFA 3E2KA 2ZC7A 1TDGA 5HAQA 4DE1A 1I2SA 2V2FF 1TVFA 3NIAA 4EWFA 3G30A 5CHUA 1PW1A 3VP1A 4GKUA 1YLWA 3CG5A 1WYBA 1K4FA 4WBGA 1EI5A 1KDSA 5E2FA 4E3LA 3DWZA 1LI0A 4LENA 4BL2A 1SHVA 1K25A 5HAIA 2Z2MB 5L2FA 1FR1A 2XDMA 3IWOA 3MFDA 4EBNA 4KG6A 3PBTA 2EX9A 3AGDA 5HW3A 4HEFA 3OCNA 1FCOA 4FSFA 5F1GA 3O3VA 4OQHA 3ZG5A 2XD1A 1K57A 1W7FA 4KZ3A 2DCFA 1XPBA 2H10A 4MEZA 2XF3A 5CGXA 4GD8A 3Q82A 2J8YA 5A90A 1MKIA 3A3JA 3UDXA 4X68A 1IYOA 1O7EA 4X56A 4E3KA 3IXHA 4MNRA 4OQGA 2EFUA 1JTGA 4JXSA 5CTNA 3S22A 3WS5A 4EV4A 1ES5A 3BRMA 5E2EA 1IYSA 1K38A 1PI4A 4K0WA 3IHBA 1FCMA 4FH2A 3GSGA 5CTMA 3WS4A 4JXVA 5G18A 4PM8A 2WAEA 1KDWA 2C6WB 2XQZA 3HLFA 3LCEA 2VGJA 2B5RA 1KE0A 5GHXA 3ITAA 3IXGA 3ZG9B 1BT5A 1NYYA 5DTSA 3B3XA 1K4EA 3A3DA 3W4QA 2XD5A 3N8RA 1DJCA 2WADA 3M6HA 1IEMA 1FCNA 3UPPA 3LEZA 4KZAA 3VP3A 3BLSA 1PW8A 4DDYA 4U3TA 2XFTA 4XUZA 3IQAA 1PWDA 3HBRA 1JVJA 1YLTA 3G2ZA 5A91A 3VOZA 2ZQ8A 2ZQDA 2ZM0A 2C5WB 2Y2OA 3IXBA 3N8LA 1YLPA 1K6RA 2XGNA 4KQOA 1NYMA 3GMWA 5FQ9A 5FQIA 3V50A 4WEJA 2EXBA 3D4FA 3QHYA 2HDSA 4OP5A 4C3QA 1IKIA 4DE3A 3OPLA 3LO7A 1XGIA 2XR0A 4WZ4A 1PWGA 4NETA 3G35A 5FDHA 4BLMA 3DW0A 3RXXA 3S1YA 4JPMA 3WRTA 3ZVWA 1DY6A 4OOMA 4Y0TA 1ERMA 2J7VA 3C7UA 3PBQA 1FQGA 1NJ4A 3C7VA 2HP5A 3SS3A 3O86A 3GQZA 4Y0OA 2P9VB 1E4DA 3UO9A 2Y2HA 4P0MA 3DTMA 1CK3A 3M6BA 5EVID 1KVMA 2VGKA 4GN2A 4KQQA 1KVLA 2JC7A 4N9LA 5EOEA 2WKEA 2ZM8A 1FSYA 4R0QA 4WYYA 3ZCZA 2EX8A 4E3OA 1DJAA 2ZM2A 4HBTA 5FI7A 2Y55A 1G68A 3IWQA 4H8RA 5CEBA 2BG1A 4P6BA 1CEFA 4S2MA 3VSLA 3PAEA 3M2JA 3RJUA 1KGEA 3IXDA 4S2KA 3OCLA 1BUEA 5IHVA 1VM1A 3G4PA 5FAPA 4QJGA 1MPLA 1W5DA 1LL5A 3GR2A 2DRWA 3PTEA 3G32A 4Y7PA 3MKEA 1ALQA 4CJNA 1LL9A 1IELA 4OOYA 1CI9A 1PI5A 2X71A 3O88A 3VMAA 2ZC4B 2UWXA 4PMAA 2IWCA 2WZZA 3W4PA 3N6IA 5D3OA 4M3KA 4S2LA 3UPOA 5EPHA 1KGGA 2XLNA 4UAAA 3MZFA 1KGFA 1YM1A 2WUQA 3QNCA 1IYPA 3IT9A 3VP4A 5CGSA 4OPZA 4KZ7A 4UHUA 3GTCA 3HL9A 3Q7VA 2WGWA 2JE5A 2HP9A 2EX2A 2HDUA 4Q8IA 1YLJA 5E2GA 5HAPA 3JYIA 1K6SA 4JF4A 3WS0A 4GDNA 5AQBA 1I5QA 5JYPA 5EVIB 1CEGA 5AQAA 1YLYA 3Q1FA 2Y2JA 3NBLA 1BLSA 1JWPA 1K54A 2H5SA 3HLCA 3NCKA 3PAGA 4R4SA 1L2SA 2Y2KA 4ZJ2A 2Q9NA 3O87A 1RGZA 1IYQA 4MLLA 3UDFA 2RCXA 1OMEA 3A3IA 4LV2A 5EUAA 5FSRA 3I7JA 3IWIA 2G2UA 3HUOA 3NC8A 5EECA 2XEPA 4X6TA 4U0TA 4D2OA 3UE1A 2Y2LA 1M40A 4OONA 3UY6A 2PU2A 4FD8A 5FQQA 5KSCA 2HDQA 4R3JA 4QY6A 4ZDXA 2I72A 4UA9A 2H0TA 1N4OA 3HLWA 3FYZA 1PWCA 1YMXA 3P98A 3HLGA 4JF6A 3G2YA 4EUZA 3HLBA 1O07A 4GDBA 3SH8A 1PIOA 2EXAA 2Y2NA 1MWSA 3DWKA 4A5RA 3WS1A 3PBSA 4WELA 1E25A 3ZFZA 3LY4A 3OPRA 1GHMA 1GHPA 4MBHA 5AQ9A 3V39A 4ZJ1A 1L0GA 1KE4A 3NI9A 4OQIA 4OPQA 1JWZA 3NY4A 5AQ7A 3BFEA 4ZBEA 4RVAA 1NRFA 3VSKA 4E3JA 5J8XA 3GVBA 1JWVA 3BM6A 1BZAA 1K57C 1FOFA 2ZC3B 2PBYA 1ZG4A 1Z6FA 5DTKA 3V5MA 2ZQ7A 5M18A 3GRJA 4PM7A 3NDEA 3UE3A 3BFFA 4IEDA 3Q7VB 3VFFA 2IWDA 1QMFA 3EQUA 3MXSA 1SKFA 4ZTKA 4DRTA 2OV5A 4U0XA 2Y4AA 3Q81A 5A93A 5F1FA 1XA1A 4DE0A 4DXBA 4KQRA 4GD6A 1I2WA 4S2PA 5CHJA 3IHAA 3IF5A 1PZPA 1U60A 1XXMA 1NZOA 5M1AA 3ZVTA 2GDNA 1ERQA 3FKVA 1W79A 4KZ4A 3C4OA 4YINA 1TDLA 2XH9A 3TG9A 4KZ5A 5GHZA 4WEKA 1YQSA 3ZG8B 3PBOA 1AXBA 2WGIA 1ONGA 5DF9A 3HUNA 4P85A 1XKZA 5GLCA 2Y2IA 2X01A 2ZLYA 5GLAA 1NY0A 4F94A 1H8ZA 3UPNA 3ZG7B 5CGWA 4C6YA 1BSGA 3HVFA 3MBZA 1S6RA 1L0EA
chains in the Genus database with same CATH superfamily
3CJMA 4S2NA 2V8CA 1HTZA 5FI2A 1H3QA 1YSPA 5I94A 2PU4A 2CC1A 2VK3A 1ZC2A 5JYOA 2BLSA 5TJJA 3BQ8A 4R3BA 2QPNA 5HWTA 3F1NA 3AGEA 5FL3A 5CECA 2W3FA 4FH4A 3H82B 5KSHA 4R23A 3W2ZA 2PD7A 2G2WA 3VP0A 1OTBA 1JNUA 4QD4A 4Z9QA 5FEFA 2GX5A 4KZ8A 3EEAA 2J9PA 4GZBA 2V1BA 3A3EA 5DVAA 1FSWA 3HLDA 2WGWB 2WGVA 1TS8A 4JLFA 4KZ6A 5FASA 1S1YA 4E6WA 4BQMA 4HI4A 2ZMAA 4R1GA 3N7WA 3EOIA 3E4OA 1DP6A 4BBUA 1GA0A 2BASA 4Q0IA 4HH3A 4PAUA 4GOGA 2Y91A 1V9YA 2WYXA 4DDSA 1LSXA 1Y28A 1RGYA 5F69A 3SH9A 4KG2A 3FWLA 3E2LA 4PPRA 1C3BA 1XP4A 5FA7A 3QP4A 1GA9A 1NXYA 3T4JA 1RP5A 4IHQA 2B02A 3C5AA 2WAFA 4L0LA 2KLIA 3PXPA 3HJKA 3S7NA 4LV3A 3ZYTA 3N8SA 4LV1A 1PFLA 4ARZA 2BTFP 4NXEA 3T4SA 4IUKA 2P9VA 3KSFA 2WZXA 4NXGA 4PM6A 3GV9A 3UE0A 3UMDA 3BECA 2PDRA 2Y2QA 3M2KA 1EWZA 1MWRA 4EQIA 1SDNA 3W8KA 2K31A 1ESIA 1MXOA 1MY8A 3V3SA 5F82A 3UDIA 2FFYA 5FAOA 5EOOA 4WZ5C 1ZTUA 1XJ6A 2WK0A 2D01A 3IF6C 4CLCE 3S4XA 1XA7A 4GJ4A 2OLVA 2XA7S 2H0YA 3TRCA 4LFUA 1NLZA 4C75A 2INWA 2VGLM 3ZNYA 2IWBA 3HLEA 2V0WA 5HPFA 3IH8A 4GCZA 4FCFA 3E2KA 3CUEA 4DE1A 1I2SA 2V2FF 1N9OA 3NIAA 3QP8A 3G30A 3PHYA 5E2FA 4LENA 5HAIA 5TBMA 3IWOA 3MFDA 4EBNA 3PBTA 4H6JB 1S66L 2GZAA 4LRZE 4HEFA 1FCOA 3E0YA 4KZ3A 1K57A 2I9VA 1XPBA 3T4OA 4MEZA 2QWSA 2PD8A 4WLAA 3EEHA 4G3KA 3FG8A 4X68A 3IXHA 4OQGA 3C2WA 2PYPA 2EFUA 4JXSA 3LYXA 3WS5A 4JGOA 4EV4A 5L09A 1ES5A 3BRMA 3MMHA 3IHBA 2HJEA 4FH2A 3WS4A 2L1MA 2XQZA 1AWIA 2B5RA 1KE0A 3ITAA 2OOLA 1DJCA 3M6HA 3BY9A 3VP3A 1PW8A 4DDYA 3IQAA 3IS2A 2ZQDA 1UWNX 2Y2OA 5EM1A 4NXFA 1YLPA 2XGNA 1LL8A 3H7WA 3CAXA 3P01A 4OP5A 3MQQA 4DE3A 3LO7A 1XGIA 4WZ4A 4NETA 3G35A 5FDHA 4BLMA 2W3HA 3DW0A 3LI8A 3S1YA 1DY6A 1KOUA 1ERMA 3C7UA 1FQGA 1NJ4A 2HP5A 3IBJA 3O86A 4HJ3A 1OTDA 2P9VB 4P6ZS 1E4DA 2Y2HA 4P0MA 4Y15A 2JC7A 4N9LA 5EOEA 2JKFA 2EX8A 4E3OA 1DJAA 5FI7A 2Y55A 2KX6A 4S2MA 3VSLA 2W1TA 1BUEA 5IHVA 1VEUA 1LL5A 3G32A 1IELA 2YKFA 4OOYA 3JVUA 5D3OA 2R78A 3UPOA 5EPHA 3FPVA 1IYPA 3VP4A 2WGWA 3LIDA 1T19A 2HP9A 2VV6A 4Q8IA 5HAPA 3JYIA 4JF4A 1I5QA 5JYPA 4GLQA 5AQAA 3R7WB 1BLSA 1K54A 2H5SA 1XJ2A 3PAGA 1RGZA 4MLLA 2WKRA 1S1ZA 1OMEA 2G2UA 3HUOA 4NG2A 4EU0A 4U0TA 4HH2A 4H6JA 1M40A 2WKQA 2PU2A 5IT5A 5FQQA 2HDQA 4QY6A 4ZDXA 4UA9A 4QWOA 3FYZA 3P98A 3HLGA 4JF6A 2FZ0A 1S4SA 3CITA 5DKLA 4GDBA 3DWKA 3WS1A 2VV8A 1GHMA 3V39A 3A0SA 3NI9A 5AQ7A 3BFEA 4YNRA 3GVBA 1VETA 1XFNA 2L4RA 1FOFA 2PBYA 4KUKA 5DTKA 1YAXA 3MXSA 1SKFA 4DRTA 4U0XA 2Y4AA 5F1FA 5HL6A 4DXBA 5EFWA 5CHJA 1XXMA 3C4OA 1TDLA 4MCWA 2W3EA 3H7WB 1YQSA 1AXBA 2WGIA 5DF9A 4P85A 2LB9A 5A8BA 2Y2IA 3IS2B 3LIAA 4F94A 3UPNA 2PHYA 4C6YA 3HVFA 1MWTA 4JF5A 4X53A 1EROA 5L10A 3ITBA 1DP9A 2XRNA 3SS4A 2QMIA 4P87A 1DJBA 4S2JA 4K0XA 2PAVP 5FQJA 2JKGA 2RL3A 2HP6A 1SCWA 2ZMVA 2JHEA 1A0KA 2D02A 1V9ZA 3UN7A 2W1TB 3CWFA 4QY5A 4I3JA 4IBXA 4S2IA 3LUQA 3VOYA 4E6XA 2ZQCA 1VB6A 2KOIA 3BLMA 3A3FA 4HHDA 3LR4A 1HZOA 2VA0A 1W63Q 3AGFA 2OAP1 3TOIA 3LIFA 4X55A 4ID4A 3EWKA 3Q7ZA 4NXBA 1SKOB 3C4PA 1L0FA 5FQKA 3LICA 3IF6B 4UA6A 2QZ6A 1VETB 5C5KA 1GSWA 4XXRA 3W4OA 4RQ9A 4Q0HA 3R7WA 1ES2A 3ZNTA 3G31A 1Y54A 4OOLA 1PYYA 2P04A 3G34A 3CZDA 4E3NA 1ES3A 1H8YA 5IS1A 3H82A 2OSUA 4MN6A 2Y79A 2ZD8A 4ME4A 1RCJA 4ZAMA 3OPHA 2V0UA 3NJAA 3EQVA 4ZJ3A 1OT6A 3BYDA 2W0NA 1N9BA 4KZ9A 1XJ3A 4S2NC 4BWIA 3JVVA 3D9YA 3OC2A 1XJ4A 1BLCA 4B4ZA 4EBLA 4DXCA 4QB8A 4CPKA 3BQAA 4WF0A 4GB7A 4P6ZM 4HBUA 1XGJA 2Y59A 4LV0A 5EV0A 2X02A 1GCEA 4B4XA 1G6AA 5CXWA 4D60A 4B93A 1LHYA 1N9NA 3BW6A 3WWXA 5GLDA 4DJ3A 3ICYA 3BEBA 2ZOIA 4Y0UA 4N1XA 2MJ6A 3RTYA 4GW9A 3QNBA 3EGXC 3SZTA 4G3WA 3NDGA 4M4XA 1IOUA 4OLGA 5J7EA 1KE3A 2OAQ1 3T4LA 4EBPA 5KZHA 5KMWA 3TSGA 5GLBA 4MBKA 1TF1A 4PKYG 3ZHHA 3N4IA 5E43A 2Q9MA 3GECA 5AVEA 4K08A 3LGOA 5CHUA 4R38A 3CG5A 2XSSA 1K4FA 4WBGA 1EI5A 4E3LA 1LI0A 1K25A 5L2FA 1FR1A 4LGWA 2O9AA 5HW3A 3OCNA 1X0OA 2OWJA 4ARZB 5A90A 4FTXA 1MKIA 2EA9A 1ODVA 4Y17A 5EM0A 3ZQ5A 3UDXA 4X56A 5DJTA 4MNRA 3GDIA 1PI4A 1T18A 4FOFA 1FCMA 4MDZA 4JXVA 2B18A 5HD3A 2QKPA 2WAEA 4LRYC 3HLFA 3SW1A 2VGJA 3IXGA 1NYYA 3A3DA 3W4QA 2XD5A 4PKYA 1IEMA 3UPPA 3LEZA 4U3TA 1OTAA 2E8JA 5CX7A 3HBRA 3IX8A 5A91A 2KDKA 4I38A 1K6RA 1NYMA 3V50A 5TBMB 4C3QA 2XROA 2GJ3A 3A0VA 4EQ1A 1XFQA 5HPIA 3ZVWA 4HY8A 2J7VA 3PBQA 3SS3A 3QP5A 1CK3A 3C8CA 1KVMA 5MC7A 2VGKA 4KQQA 4NEED 2EWWA 2ZL1A 2K7SA 2WKEA 2ZM8A 1FSYA 4R0QA 2NUTC 4HBTA 5CEBA 2BG1A 2VX8A 2JKTI 3IXDA 3C38A 4GHIA 3G4PA 4HNBA 1W5DA 3GR2A 3PTEA 3NOPC 2X71A 3O88A 4BMWA 5EVEA 2PR5A 3E4QA 2UWXA 2Z6CA 4UQIS 2ZBBA 3BJNA 3HCYA 1NRJA 2WZZA 3W4PA 3N6IA 4M3KA 4L9EA 1KGGA 2XLNA 4UAAA 3MZFA 4KZ7A 3TJZC 2JE5A 5G4ZA 1YLJA 5E2GA 5HWWA 5AQBA 1W63M 4DN0A 1CEGA 3NBLA 5DKKA 1LSVA 3O87A 1IYQA 3IX4A 3UDFA 1P9WA 2RCXA 3A3IA 3LFVA 5EECA 4X6TA 3NULA 1F9IA 1TS6A 3UMEA 4OONA 4R3JA 4EETB 2I72A 2H0TA 3LR3A 1N4OA 1YSQA 1PWCA 1SZVA 4EUZA 3T1RA 1O07A 2HV1A 3ZFZA 3LY4A 1NWZA 1MC0A 3OPRA 3KYZA 1K0KA 2ZMFA 4I39A 1L0GA 2PRFA 1NRFA 5AVFA 2HF6A 1JWVA 1BZAA 3V5MA 4PM7A 3NDEA 3BFFA 4IEDA 2OV5A 5A93A 1XA1A 4DE0A 4GD6A 3IHAA 1U60A 1NZOA 3ZVTA 3MSHA 3OLOA 3LEQA 4YINA 3TG9A 4KZ5A 1D1JA 5GHZA 4JGQA 4WEKA 3HUNA 3T1XA 2ZLYA 1F2KA 2M7VA 3ZG7B 5LBRA 4GS9B 3MBZA 1S6RA 1OT9A 1L0EA 4DKIA 1BULA 4RX3A 4IVIA 3CI6A 3JPUA 2JBFA 2NUPC 2Y2PA 3NOUC 4GNUA 1CJFA 4PM5A 1ZKJA 1QMEA 1W8YA 3P7NA 4WZ5A 2EX6A 4WMCA 1SDEA 2UV0E 5HDSA 2W3GA 3ISGA 4EESA 4XT2A 4OPRA 5J3WA 4OH0A 3D72A 3FC7A 1PRQA 4WMCD 5CEDA 5HSQA 3EGDC 3LIEA 4HP9A 5TGFA 1K55C 3VP2A 1F5MA 5HL1A 1K56D 1D06A 4O7DA 4RA7A 2ZJ9A 5E2HA 2ZC5B 4OLDA 1MBLA 5HARA 4HIAA 4HOIA 3IF6A 3CPTA 4N9KA 2VGLS 4QHCA 5EVIA 1TS7A 5CHMA 2HPBA 2JCHA 4GS9A 3MZDA 2P08A 4JBFA 3ULFA 3T1QB 1E3UD 2ZQAA 5A92A 3MFXA 4EXOA 3FKWA 2A24B 2Y2MA 3UB5P 1NLYA 3SH7A 4LLOB 4BENA 4OVDA 2L0WA 2WKIA 2HDRA 3DBAA 1LI9A 5F83A 4EEPA 1IFQA 1YMSA 3MZEA 1J9MA 5FAQA 5FATA 2Y2GA 4JKTA 2V1ZA 5M19A 4E3IA 4Y5FA 2OLUA 3OPPA 4X69A 3E98A 4YFMA 4IUHA 2R9XA 5J4EA 5K5BA 1OJGA 5DF7A 5GHYA 4KENB 4BJPA 1ESUA 1YT4A 4OKPA 3WS2A 1ES4A 1L3LA 2A3UA 4AFIA 1Q2QA 2A49A 3LR0A 2J9OA 4MBFA 3PBNA 5FI6A 1NZUA 4XUXA 3MXRA 3KSIA 1GSXA 3RH8B 4BL3A 3MJQA 4I3AA 4R4RA 2A24A 1E3UA 4F3LA 4KUOA 1G6OA 1K55A 3BFCA 3HREA 3QP1A 4R70A 2P74A 1HVBA 1P0ZA 2PBDP 4QU3A 3VFHA 4KG5A 4B88A 4UEYA 5U47A 3RXWA 2XA7M 3WRZA 4N1HA 1HLUP 2ZC7A 1TDGA 5HAQA 3R4KA 4EWFA 5HWVA 2VJWA 3CUEC 1YLWA 3DWZA 1SHVA 2Z2MB 3T4QA 3B47A 4WN5A 4KG6A 2IA2A 2EX9A 4FSFA 5F1GA 4OQHA 2XD1A 3E4PA 1W7FA 4O01A 3IX3A 2H10A 2XF3A 4GD8A 3Q82A 2J8YA 1G5UA 3A3JA 1IYOA 1O7EA 1VHMA 5CTNA 3DAVA 1FILA 3VE4A 5E2EA 4GHIB 1K38A 4K0WA 2O9BA 3GSGA 5CTMA 5G18A 2C6WB 3LCEA 5G4YA 3ZG9B 5DTSA 3N8RA 4KZAA 2V9AA 3NECA 1JVJA 3T4KA 2JKRI 2ZM0A 2C5WB 1T1BA 3IXBA 3N8LA 3GMWA 1P97A 4WEJA 2EXBA 2HDSA 1IKIA 3UB7A 3OPLA 2XR0A 4UQIM 4CLCA 4L9GA 3FPWA 2O9CA 3RXXA 4JPMA 2O99A 4OOMA 4Y0TA 3GQZA 4Y0OA 4CLCC 3M6BA 5DFYA 4G3VA 4GN2A 1CF0A 2J3TD 4WYYA 3DTIA 2ZM2A 3KSGA 2V1AA 4IJGA 4NKPA 3MR0A 5HDCA 4H8RA 1MKMA 3PAEA 3T4TA 3RJUA 1KGEA 4S2KA 3OCLA 4Y3IA 4QJGA 1MPLA 5IU1A 2K2NA 3UE6A 3MKEA 1ALQA 4CJNA 1LL9A 4HQAA 1PI5A 4O8GA 2ZC4B 4PMAA 5FDSA 2IWCA 1T1CA 1BYWA 4S2LA 3K3CA 2V8FA 1YKDA 1KGFA 1YM1A 2VKSA 3QNCA 5CGSA 4OPZA 4I5SA 3HL9A 4BBTA 3Q7VA 3K3DA 2M7UA 3HJIA 2Y8HA 1K6SA 3WS0A 4GDNA 5F6AA 4CLCD 5EVIB 2WKPA 1YLYA 3Q1FA 1H0MA 4E04A 4R4SA 1L2SA 2Y2KA 4ZJ2A 1ZHHB 4EERA 3KYQA 4FUWA 3S7QA 5EUAA 3IWIA 4O0PA 4D2OA 2G7UA 1T1AA 3O5YA 3HLWA 3G2YA 3OBFA 2OWHA 3SH8A 4A5RA 1Y4OA 1MWSA 2Y2NA 2ZL1B 3PBSA 4WELA 1E25A 5AQ9A 2JN7A 1KE4A 4ZBEA 4OQIA 1JWZA 4OPQA 4LRXC 2HGVA 5DFXA 2ZQ7A 3GRJA 3VE3A 3UB8A 2VZWA 3Q7VB 2IWDA 4ZTKA 1J3WA 5HD5A 1UGUA 1I2WA 4S2PA 1PZPA 3UB6A 5M1AA 2GDNA 3FKVA 1W79A 1N9LA 3B42A 2XH9A 4X25A 3PBOA 1ONGA 4HJ4A 3MQOA 2X01A 1NY0A 1H8ZA 5CGWA 2VV7A 3K2NA 4WM9A 1FR6A 4BD0A 4N92A 4OQ0A 4RX2A 3A0RA 1JTDA 4DE2A 4MN5A 2HJ9C 4QPRA 1IKGA 1CI8A 1FIKA 2QYBA 5HFOA 3BFDA 3MF0A 1LLBA 3S7OA 3TE8A 1OTIA 2QHKA 1OPXA 1K56A 2YKHA 1VQQA 4I3IA 1S0WA 5F5YA 2FFFB 4IBRA 4K91A 5TFQA 1Z09A 1GHIA 5EE8A 4LCLA 3CMZA 2R9WA 3UNWA 5EVIC 1STZA 3LY3A 2ZC6B 3MKFA 3FV7A 3SOIA 5FQMA 4XT2B 3Q07A 1ZG6A 1OJ5A 2JKTM 2ZQ9A 1TEMA 3C30A 3U4LP 4CLCB 1M6KA 4E3MA 5KIZA 1BTLA 3FZCA 1MZUA 1XX2A 3G6OA 1GSVA 4HESA 3ZDJA 3BFGA 4PM9A 2W1RA 5HX9A 4NK3A 5CERA 4BD1A 3OZHA 4JXWA 3IH9A 1DRMA 1WYCA 2J3TC 1K54C 3L7HA 4L9FA 1PNEA 5CRFA 3IBRA 3V3RA 2Z2LB 3HUMA 3NHQA 1H8MA 1YLZA 1S4RA 3U2AA 4Y13A 4RYEA 2QJ5A 4YWZA 2V20A 3P09A 5BOHA 4LCMA 5L07A 5DTTA 1Q2PA 3ZG0A 4JXGA 2AVXA 1PZOA 3ZGAB 1OTEA 1L0DA 3S7PA 3SS5A 4HP4A 5TR7A 1BLPA 2O0YA 2ZOHA 3NOTC 2W3DA 1S67L 2WKHA 3LI9A 5GL9A 4F3LB 4OP8A 4DF6A 1ONHA 1BLHA 3KYEA 2XK1A 2A2LA 4OPYA 4Q0JA 2PR6A 1TD5A 4MMNA 5EVLA 2DNSA 2XFSA 3PBRA 2VLGA 1LSWA 3T1SA 2FH5A 1H5XA 1P9RA 2EFXA 2GNXA 4LPZA 5DF8A 2ACGA 1MWUA 1YPRA 1WE4A 1G28A 1ACFA 3F1PB 4UA7A 4IVKA 1HD8A 4S2OA 1W8QA 2E8IA 4KZBA 2P7JA 3OOVA 1TVFA 1PW1A 3VP1A 4GKUA 3DTEA 1WYBA 1KDSA 4BL2A 3LIBA 2JKRM 2XDMA 3UB9A 4YOFA 3AGDA 3O3VA 3ZG5A 3MQ0A 2DCFA 5CGXA 4Z1WA 3B33A 2H28A 4E3KA 1JTGA 3S22A 4MN7A 1IYSA 2DMWA 4II7A 4PM8A 3QP2A 4ETXA 1KDWA 3RFBA 4BBVA 5GHXA 2VEAA 2PYRA 1BT5A 3B3XA 1K4EA 3KSHA 2WADA 1FCNA 4X1MA 3BLSA 2XFTA 4R6LA 4WL9A 4XUZA 4DMZA 3KO6A 1PWDA 1YLTA 2EWVA 3G2ZA 2W27A 3VOZA 2ZQ8A 5HZHA 4KQOA 1F98A 5FQ9A 5FQIA 3D4FA 3QHYA 2J80A 2Q0OA 1PWGA 4DJ2A 5F68A 3F1OA 3WRTA 3CPTB 3T12B 3C7VA 5HDDA 3UO9A 3DTMA 1TS0A 2B95A 5EVID 4B9OA 1KVLA 3L9KA 3ZCZA 1G68A 3IWQA 4X1LA 4P6BA 1CEFA 3M2JA 3VV4A 1CQAA 1VM1A 5FAPA 2HZ5A 2DRWA 4Y7PA 1CI9A 3D3OA 4R3AA 1VEUB 3VMAA 4Y2FA 1WA9A 3PR6A 4JGPA 3KX0X 4EUVA 1LT0A 5I5LA 2WUQA 5AJGA 3V67A 3IT9A 3H9WA 4ETZA 4UHUA 3GTCA 2EX2A 2HDUA 3F1PA 2QJ7A 2Y2JA 5FEGA 1JWPA 3HLCA 3NCKA 3T50A 2CMNA 2Q9NA 4LV2A 5FSRA 3I7JA 3NC8A 1DP8A 2XEPA 2LB5A 3UE1A 2Y2LA 3UY6A 4FD8A 4EEUA 3QP6A 5KSCA 3CHWP 4HJ6A 3BY8A 1YMXA 3HLBA 1PIOA 2EXAA 3TW8A 2M1CA 3LR5A 4JGRA 4MBHA 1GHPA 4ZJ1A 2Z6DA 3NY4A 4EW7A 4RVAA 3VSKA 4E3JA 5J8XA 1UWPX 2J3WA 3BM6A 1K57C 2ZC3B 1ZG4A 1Z6FA 2PT7A 5M18A 3UE3A 4PHTA 3VFFA 1QMFA 3EQUA 4CQHA 3Q81A 3PYPA 4KQRA 3VOLA 3IF5A 3DTKA 4ZRRA 1ERQA 4KZ4A 5DJUA 1EW0A 1D7EA 3BWLA 3MS6A 4KQDA 3ZG8B 3MXQA 4ESPA 1SKOA 1XKZA 5GLCA 3F1NB 5GLAA 3F1OB 4WUJA 3CLOA 1BSGA 5L8MA
chains in the Genus database with same CATH topology
1MWTA 3CJMA 4JF5A 4S2NA 4DKIA 1BULA 4WM9A 4RX3A 4X53A 4IVIA 1HTZA 1FR6A 5FI2A 1EROA 4N92A 4BD0A 4OQ0A 2JBFA 5I94A 4RX2A 1JTDA 2PU4A 2Y2PA 4GNUA 2CC1A 4DE2A 3ITBA 4PM5A 1ZKJA 3SS4A 1ZC2A 2QMIA 4P87A 1DJBA 5JYOA 4S2JA 4K0XA 1QMEA 2BLSA 1W8YA 4WZ5A 4R3BA 1IKGA 5FQJA 1CI8A 2EX6A 4WMCA 2QPNA 2RL3A 1SDEA 2HP6A 1SCWA 5HFOA 3BFDA 3ISGA 3AGEA 3UN7A 5CECA 1LLBA 4OPRA 4OH0A 4FH4A 4QY5A 1K56A 1VQQA 4IBXA 5KSHA 4R23A 4S2IA 3VOYA 4WMCD 4E6XA 1S0WA 2ZQCA 5CEDA 2G2WA 3VP0A 3BLMA 2FFFB 4IBRA 3A3FA 4K91A 4QD4A 4Z9QA 5TFQA 4KZ8A 5TGFA 1GHIA 1K55C 2J9PA 4GZBA 3VP2A 5EE8A 1HZOA 3A3EA 5HL1A 4LCLA 3CMZA 2R9WA 1K56D 5DVAA 3UNWA 5EVIC 4O7DA 4RA7A 1FSWA 3AGFA 3HLDA 2WGWB 3TOIA 2ZJ9A 2WGVA 5E2HA 3LY3A 4X55A 2ZC5B 4ID4A 4JLFA 4KZ6A 4OLDA 2ZC6B 5FASA 1MBLA 3MKFA 5HARA 4E6WA 3IF6A 3FV7A 3SOIA 5FQMA 3Q7ZA 4N9KA 3Q07A 1ZG6A 4QHCA 3C4PA 5EVIA 5CHMA 2HPBA 4BQMA 1L0FA 5FQKA 2JCHA 2ZQ9A 3IF6B 4UA6A 1TEMA 2QZ6A 2ZMAA 4R1GA 3N7WA 3MZDA 4JBFA 4E3MA 1M6KA 4XXRA 3W4OA 1BTLA 3FZCA 1ES2A 3ZNTA 1GA0A 3G31A 1XX2A 1Y54A 1E3UD 4OOLA 2ZQAA 1PYYA 3G34A 5A92A 3CZDA 4HESA 4E3NA 1ES3A 3ZDJA 1H8YA 4GOGA 3BFGA 4PM9A 2Y91A 3FKWA 2WYXA 4DDSA 2OSUA 2Y2MA 3SH7A 5HX9A 2ZD8A 1RGYA 4BENA 4NK3A 5CERA 1RCJA 4BD1A 3OZHA 4JXWA 4ZAMA 3OPHA 3IH9A 4OVDA 3SH9A 2WKIA 2HDRA 1WYCA 4KG2A 3FWLA 1LI9A 1K54C 3E2LA 5F83A 4PPRA 3EQVA 4ZJ3A 1C3BA 5CRFA 1XP4A 3BYDA 5FA7A 3V3RA 1YMSA 3MZEA 2Z2LB 1J9MA 1GA9A 1NXYA 1RP5A 3HUMA 1N9BA 5FAQA 4KZ9A 3C5AA 5FATA 1YLZA 2WAFA 2Y2GA 4JKTA 2V1ZA 4S2NC 5M19A 4E3IA 4L0LA 3OC2A 1BLCA 4RYEA 2OLUA 3OPPA 4X69A 4YFMA 4B4ZA 4EBLA 4DXCA 4LV3A 2R9XA 2V20A 3N8SA 3P09A 4QB8A 5BOHA 4LCMA 4CPKA 5DF7A 4LV1A 5DTTA 5GHYA 2P9VA 4GB7A 4KENB 4BJPA 2WZXA 1ESUA 1Q2PA 3ZG0A 1YT4A 4OKPA 4JXGA 3WS2A 1PZOA 4PM6A 3GV9A 1ES4A 3UE0A 2A3UA 3ZGAB 1Q2QA 4HBUA 1XGJA 1L0DA 2A49A 2Y59A 4LV0A 3BECA 3SS5A 2X02A 5TR7A 1BLPA 1GCEA 2J9OA 2Y2QA 4MBFA 3PBNA 3M2KA 1EWZA 1MWRA 5FI6A 4B4XA 4EQIA 1G6AA 1NZUA 2WKHA 5CXWA 1SDNA 3W8KA 5GL9A 4XUXA 3MXRA 4BL3A 1ESIA 1LHYA 4OP8A 4DF6A 1ONHA 1BLHA 3WWXA 1MXOA 5GLDA 1MY8A 3V3SA 4R4RA 5F82A 1E3UA 2XK1A 3UDIA 2FFYA 5FAOA 4OPYA 3BEBA 5EOOA 4WZ5C 5EVLA 2DNSA 4N1XA 2XFSA 2WK0A 3PBRA 4Y0UA 3IF6C 3S4XA 1XA7A 1H5XA 3QNBA 1K55A 2EFXA 3NDGA 3BFCA 2OLVA 4OLGA 3HREA 1KE3A 4EBPA 5KZHA 2H0YA 2P74A 1HVBA 5DF8A 4C75A 5KMWA 3TSGA 1MWUA 5GLBA 4MBKA 4QU3A 3VFHA 1WE4A 3ZNYA 2IWBA 4KG5A 3HLEA 4B88A 5U47A 3IH8A 4UA7A 4IVKA 1HD8A 3RXWA 4S2OA 3ZHHA 1W8QA 3WRZA 2E8IA 3N4IA 4N1HA 5E43A 4KZBA 2Q9MA 4FCFA 3E2KA 2ZC7A 1TDGA 5HAQA 4DE1A 1I2SA 2V2FF 1TVFA 3NIAA 4EWFA 3G30A 5CHUA 1PW1A 3VP1A 4GKUA 1YLWA 3CG5A 1WYBA 1K4FA 4WBGA 1EI5A 1KDSA 5E2FA 4E3LA 3DWZA 1LI0A 4LENA 4BL2A 1SHVA 1K25A 5HAIA 2Z2MB 5L2FA 1FR1A 2XDMA 3IWOA 3MFDA 4EBNA 4KG6A 3PBTA 2EX9A 3AGDA 5HW3A 4HEFA 3OCNA 1FCOA 4FSFA 5F1GA 3O3VA 4OQHA 3ZG5A 2XD1A 1K57A 1W7FA 4KZ3A 2DCFA 1XPBA 2H10A 4MEZA 2XF3A 5CGXA 4GD8A 3Q82A 2J8YA 5A90A 1MKIA 3A3JA 3UDXA 4X68A 1IYOA 1O7EA 4X56A 4E3KA 3IXHA 4MNRA 4OQGA 2EFUA 1JTGA 4JXSA 5CTNA 3S22A 3WS5A 4EV4A 1ES5A 3BRMA 5E2EA 1IYSA 1K38A 1PI4A 4K0WA 3IHBA 1FCMA 4FH2A 3GSGA 5CTMA 3WS4A 4JXVA 5G18A 4PM8A 2WAEA 1KDWA 2C6WB 2XQZA 3HLFA 3LCEA 2VGJA 2B5RA 1KE0A 5GHXA 3ITAA 3IXGA 3ZG9B 1BT5A 1NYYA 5DTSA 3B3XA 1K4EA 3A3DA 3W4QA 2XD5A 3N8RA 1DJCA 2WADA 3M6HA 1IEMA 1FCNA 3UPPA 3LEZA 4KZAA 3VP3A 3BLSA 1PW8A 4DDYA 4U3TA 2XFTA 4XUZA 3IQAA 1PWDA 3HBRA 1JVJA 1YLTA 3G2ZA 5A91A 3VOZA 2ZQ8A 2ZQDA 2ZM0A 2C5WB 2Y2OA 3IXBA 3N8LA 1YLPA 1K6RA 2XGNA 4KQOA 1NYMA 3GMWA 5FQ9A 5FQIA 3V50A 4WEJA 2EXBA 3D4FA 3QHYA 2HDSA 4OP5A 4C3QA 1IKIA 4DE3A 3OPLA 3LO7A 1XGIA 2XR0A 4WZ4A 1PWGA 4NETA 3G35A 5FDHA 4BLMA 3DW0A 3RXXA 3S1YA 4JPMA 3WRTA 3ZVWA 1DY6A 4OOMA 4Y0TA 1ERMA 2J7VA 3C7UA 3PBQA 1FQGA 1NJ4A 3C7VA 2HP5A 3SS3A 3O86A 3GQZA 4Y0OA 2P9VB 1E4DA 3UO9A 2Y2HA 4P0MA 3DTMA 1CK3A 3M6BA 5EVID 1KVMA 2VGKA 4GN2A 4KQQA 1KVLA 2JC7A 4N9LA 5EOEA 2WKEA 2ZM8A 1FSYA 4R0QA 4WYYA 3ZCZA 2EX8A 4E3OA 1DJAA 2ZM2A 4HBTA 5FI7A 2Y55A 1G68A 3IWQA 4H8RA 5CEBA 2BG1A 4P6BA 1CEFA 4S2MA 3VSLA 3PAEA 3M2JA 3RJUA 1KGEA 3IXDA 4S2KA 3OCLA 1BUEA 5IHVA 1VM1A 3G4PA 5FAPA 4QJGA 1MPLA 1W5DA 1LL5A 3GR2A 2DRWA 3PTEA 3G32A 4Y7PA 3MKEA 1ALQA 4CJNA 1LL9A 1IELA 4OOYA 1CI9A 1PI5A 2X71A 3O88A 3VMAA 2ZC4B 2UWXA 4PMAA 2IWCA 2WZZA 3W4PA 3N6IA 5D3OA 4M3KA 4S2LA 3UPOA 5EPHA 1KGGA 2XLNA 4UAAA 3MZFA 1KGFA 1YM1A 2WUQA 3QNCA 1IYPA 3IT9A 3VP4A 5CGSA 4OPZA 4KZ7A 4UHUA 3GTCA 3HL9A 3Q7VA 2WGWA 2JE5A 2HP9A 2EX2A 2HDUA 4Q8IA 1YLJA 5E2GA 5HAPA 3JYIA 1K6SA 4JF4A 3WS0A 4GDNA 5AQBA 1I5QA 5JYPA 5EVIB 1CEGA 5AQAA 1YLYA 3Q1FA 2Y2JA 3NBLA 1BLSA 1JWPA 1K54A 2H5SA 3HLCA 3NCKA 3PAGA 4R4SA 1L2SA 2Y2KA 4ZJ2A 2Q9NA 3O87A 1RGZA 1IYQA 4MLLA 3UDFA 2RCXA 1OMEA 3A3IA 4LV2A 5EUAA 5FSRA 3I7JA 3IWIA 2G2UA 3HUOA 3NC8A 5EECA 2XEPA 4X6TA 4U0TA 4D2OA 3UE1A 2Y2LA 1M40A 4OONA 3UY6A 2PU2A 4FD8A 5FQQA 5KSCA 2HDQA 4R3JA 4QY6A 4ZDXA 2I72A 4UA9A 2H0TA 1N4OA 3HLWA 3FYZA 1PWCA 1YMXA 3P98A 3HLGA 4JF6A 3G2YA 4EUZA 3HLBA 1O07A 4GDBA 3SH8A 1PIOA 2EXAA 2Y2NA 1MWSA 3DWKA 4A5RA 3WS1A 3PBSA 4WELA 1E25A 3ZFZA 3LY4A 3OPRA 1GHMA 1GHPA 4MBHA 5AQ9A 3V39A 4ZJ1A 1L0GA 1KE4A 3NI9A 4OQIA 4OPQA 1JWZA 3NY4A 5AQ7A 3BFEA 4ZBEA 4RVAA 1NRFA 3VSKA 4E3JA 5J8XA 3GVBA 1JWVA 3BM6A 1BZAA 1K57C 1FOFA 2ZC3B 2PBYA 1ZG4A 1Z6FA 5DTKA 3V5MA 2ZQ7A 5M18A 3GRJA 4PM7A 3NDEA 3UE3A 3BFFA 4IEDA 3Q7VB 3VFFA 2IWDA 1QMFA 3EQUA 3MXSA 1SKFA 4ZTKA 4DRTA 2OV5A 4U0XA 2Y4AA 3Q81A 5A93A 5F1FA 1XA1A 4DE0A 4DXBA 4KQRA 4GD6A 1I2WA 4S2PA 5CHJA 3IHAA 3IF5A 1PZPA 1U60A 1XXMA 1NZOA 5M1AA 3ZVTA 2GDNA 1ERQA 3FKVA 1W79A 4KZ4A 3C4OA 4YINA 1TDLA 2XH9A 3TG9A 4KZ5A 5GHZA 4WEKA 1YQSA 3ZG8B 3PBOA 1AXBA 2WGIA 1ONGA 5DF9A 3HUNA 4P85A 1XKZA 5GLCA 2Y2IA 2X01A 2ZLYA 5GLAA 1NY0A 4F94A 1H8ZA 3UPNA 3ZG7B 5CGWA 4C6YA 1BSGA 3HVFA 3MBZA 1S6RA 1L0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MWT A;  3CJM A;  4JF5 A;  4S2N A;  4DKI A;  1BUL A;  4WM9 A;  4RX3 A;  4X53 A;  4IVI A;  1HTZ A;  1FR6 A;  5FI2 A;  1ERO A;  4N92 A;  4BD0 A;  4OQ0 A;  2JBF A;  5I94 A;  4RX2 A;  1JTD A;  2PU4 A;  2Y2P A;  4GNU A;  2CC1 A;  4DE2 A;  3ITB A;  4PM5 A;  1ZKJ A;  3SS4 A;  1ZC2 A;  2QMI A;  4P87 A;  1DJB A;  5JYO A;  4S2J A;  4K0X A;  1QME A;  2BLS A;  1W8Y A;  4WZ5 A;  4R3B A;  1IKG A;  5FQJ A;  1CI8 A;  2EX6 A;  4WMC A;  2QPN A;  2RL3 A;  1SDE A;  2HP6 A;  1SCW A;  5HFO A;  3BFD A;  3ISG A;  3AGE A;  3UN7 A;  5CEC A;  1LLB A;  4OPR A;  4OH0 A;  4FH4 A;  4QY5 A;  1K56 A;  1VQQ A;  4IBX A;  5KSH A;  4R23 A;  4S2I A;  3VOY A;  4WMC D;  4E6X A;  1S0W A;  2ZQC A;  5CED A;  2G2W A;  3VP0 A;  3BLM A;  2FFF B;  4IBR A;  3A3F A;  4K91 A;  4QD4 A;  4Z9Q A;  5TFQ A;  4KZ8 A;  5TGF A;  1GHI A;  1K55 C;  2J9P A;  4GZB A;  3VP2 A;  5EE8 A;  1HZO A;  3A3E A;  5HL1 A;  4LCL A;  3CMZ A;  2R9W A;  1K56 D;  5DVA A;  3UNW A;  5EVI C;  4O7D A;  4RA7 A;  1FSW A;  3AGF A;  3HLD A;  2WGW B;  3TOI A;  2ZJ9 A;  2WGV A;  5E2H A;  3LY3 A;  4X55 A;  2ZC5 B;  4ID4 A;  4JLF A;  4KZ6 A;  4OLD A;  2ZC6 B;  5FAS A;  1MBL A;  3MKF A;  5HAR A;  4E6W A;  3IF6 A;  3FV7 A;  3SOI A;  5FQM A;  3Q7Z A;  4N9K A;  3Q07 A;  1ZG6 A;  4QHC A;  3C4P A;  5EVI A;  5CHM A;  2HPB A;  4BQM A;  1L0F A;  5FQK A;  2JCH A;  2ZQ9 A;  3IF6 B;  4UA6 A;  1TEM A;  2QZ6 A;  2ZMA A;  4R1G A;  3N7W A;  3MZD A;  4JBF A;  4E3M A;  1M6K A;  4XXR A;  3W4O A;  1BTL A;  3FZC A;  1ES2 A;  3ZNT A;  1GA0 A;  3G31 A;  1XX2 A;  1Y54 A;  1E3U D;  4OOL A;  2ZQA A;  1PYY A;  3G34 A;  5A92 A;  3CZD A;  4HES A;  4E3N A;  1ES3 A;  3ZDJ A;  1H8Y A;  4GOG A;  3BFG A;  4PM9 A;  2Y91 A;  3FKW A;  2WYX A;  4DDS A;  2OSU A;  2Y2M A;  3SH7 A;  5HX9 A;  2ZD8 A;  1RGY A;  4BEN A;  4NK3 A;  5CER A;  1RCJ A;  4BD1 A;  3OZH A;  4JXW A;  4ZAM A;  3OPH A;  3IH9 A;  4OVD A;  3SH9 A;  2WKI A;  2HDR A;  1WYC A;  4KG2 A;  3FWL A;  1LI9 A;  1K54 C;  3E2L A;  5F83 A;  4PPR A;  3EQV A;  4ZJ3 A;  1C3B A;  5CRF A;  1XP4 A;  3BYD A;  5FA7 A;  3V3R A;  1YMS A;  3MZE A;  2Z2L B;  1J9M A;  1GA9 A;  1NXY A;  1RP5 A;  3HUM A;  1N9B A;  5FAQ A;  4KZ9 A;  3C5A A;  5FAT A;  1YLZ A;  2WAF A;  2Y2G A;  4JKT A;  2V1Z A;  4S2N C;  5M19 A;  4E3I A;  4L0L A;  3OC2 A;  1BLC A;  4RYE A;  2OLU A;  3OPP A;  4X69 A;  4YFM A;  4B4Z A;  4EBL A;  4DXC A;  4LV3 A;  2R9X A;  2V20 A;  3N8S A;  3P09 A;  4QB8 A;  5BOH A;  4LCM A;  4CPK A;  5DF7 A;  4LV1 A;  5DTT A;  5GHY A;  2P9V A;  4GB7 A;  4KEN B;  4BJP A;  2WZX A;  1ESU A;  1Q2P A;  3ZG0 A;  1YT4 A;  4OKP A;  4JXG A;  3WS2 A;  1PZO A;  4PM6 A;  3GV9 A;  1ES4 A;  3UE0 A;  2A3U A;  3ZGA B;  1Q2Q A;  4HBU A;  1XGJ A;  1L0D A;  2A49 A;  2Y59 A;  4LV0 A;  3BEC A;  3SS5 A;  2X02 A;  5TR7 A;  1BLP A;  1GCE A;  2J9O A;  2Y2Q A;  4MBF A;  3PBN A;  3M2K A;  1EWZ A;  1MWR A;  5FI6 A;  4B4X A;  4EQI A;  1G6A A;  1NZU A;  2WKH A;  5CXW A;  1SDN A;  3W8K A;  5GL9 A;  4XUX A;  3MXR A;  4BL3 A;  1ESI A;  1LHY A;  4OP8 A;  4DF6 A;  1ONH A;  1BLH A;  3WWX A;  1MXO A;  5GLD A;  1MY8 A;  3V3S A;  4R4R A;  5F82 A;  1E3U A;  2XK1 A;  3UDI A;  2FFY A;  5FAO A;  4OPY A;  3BEB A;  5EOO A;  4WZ5 C;  5EVL A;  2DNS A;  4N1X A;  2XFS A;  2WK0 A;  3PBR A;  4Y0U A;  3IF6 C;  3S4X A;  1XA7 A;  1H5X A;  3QNB A;  1K55 A;  2EFX A;  3NDG A;  3BFC A;  2OLV A;  4OLG A;  3HRE A;  1KE3 A;  4EBP A;  5KZH A;  2H0Y A;  2P74 A;  1HVB A;  5DF8 A;  4C75 A;  5KMW A;  3TSG A;  1MWU A;  5GLB A;  4MBK A;  4QU3 A;  3VFH A;  1WE4 A;  3ZNY A;  2IWB A;  4KG5 A;  3HLE A;  4B88 A;  5U47 A;  3IH8 A;  4UA7 A;  4IVK A;  1HD8 A;  3RXW A;  4S2O A;  3ZHH A;  1W8Q A;  3WRZ A;  2E8I A;  3N4I A;  4N1H A;  5E43 A;  4KZB A;  2Q9M A;  4FCF A;  3E2K A;  2ZC7 A;  1TDG A;  5HAQ A;  4DE1 A;  1I2S A;  2V2F F;  1TVF A;  3NIA A;  4EWF A;  3G30 A;  5CHU A;  1PW1 A;  3VP1 A;  4GKU A;  1YLW A;  3CG5 A;  1WYB A;  1K4F A;  4WBG A;  1EI5 A;  1KDS A;  5E2F A;  4E3L A;  3DWZ A;  1LI0 A;  4LEN A;  4BL2 A;  1SHV A;  1K25 A;  5HAI A;  2Z2M B;  5L2F A;  1FR1 A;  2XDM A;  3IWO A;  3MFD A;  4EBN A;  4KG6 A;  3PBT A;  2EX9 A;  3AGD A;  5HW3 A;  4HEF A;  3OCN A;  1FCO A;  4FSF A;  5F1G A;  3O3V A;  4OQH A;  3ZG5 A;  2XD1 A;  1K57 A;  1W7F A;  4KZ3 A;  2DCF A;  1XPB A;  2H10 A;  4MEZ A;  2XF3 A;  5CGX A;  4GD8 A;  3Q82 A;  2J8Y A;  5A90 A;  1MKI A;  3A3J A;  3UDX A;  4X68 A;  1IYO A;  1O7E A;  4X56 A;  4E3K A;  3IXH A;  4MNR A;  4OQG A;  2EFU A;  1JTG A;  4JXS A;  5CTN A;  3S22 A;  3WS5 A;  4EV4 A;  1ES5 A;  3BRM A;  5E2E A;  1IYS A;  1K38 A;  1PI4 A;  4K0W A;  3IHB A;  1FCM A;  4FH2 A;  3GSG A;  5CTM A;  3WS4 A;  4JXV A;  5G18 A;  4PM8 A;  2WAE A;  1KDW A;  2C6W B;  2XQZ A;  3HLF A;  3LCE A;  2VGJ A;  2B5R A;  1KE0 A;  5GHX A;  3ITA A;  3IXG A;  3ZG9 B;  1BT5 A;  1NYY A;  5DTS A;  3B3X A;  1K4E A;  3A3D A;  3W4Q A;  2XD5 A;  3N8R A;  1DJC A;  2WAD A;  3M6H A;  1IEM A;  1FCN A;  3UPP A;  3LEZ A;  4KZA A;  3VP3 A;  3BLS A;  1PW8 A;  4DDY A;  4U3T A;  2XFT A;  4XUZ A;  3IQA A;  1PWD A;  3HBR A;  1JVJ A;  1YLT A;  3G2Z A;  5A91 A;  3VOZ A;  2ZQ8 A;  2ZQD A;  2ZM0 A;  2C5W B;  2Y2O A;  3IXB A;  3N8L A;  1YLP A;  1K6R A;  2XGN A;  4KQO A;  1NYM A;  3GMW A;  5FQ9 A;  5FQI A;  3V50 A;  4WEJ A;  2EXB A;  3D4F A;  3QHY A;  2HDS A;  4OP5 A;  4C3Q A;  1IKI A;  4DE3 A;  3OPL A;  3LO7 A;  1XGI A;  2XR0 A;  4WZ4 A;  1PWG A;  4NET A;  3G35 A;  5FDH A;  4BLM A;  3DW0 A;  3RXX A;  3S1Y A;  4JPM A;  3WRT A;  3ZVW A;  1DY6 A;  4OOM A;  4Y0T A;  1ERM A;  2J7V A;  3C7U A;  3PBQ A;  1FQG A;  1NJ4 A;  3C7V A;  2HP5 A;  3SS3 A;  3O86 A;  3GQZ A;  4Y0O A;  2P9V B;  1E4D A;  3UO9 A;  2Y2H A;  4P0M A;  3DTM A;  1CK3 A;  3M6B A;  5EVI D;  1KVM A;  2VGK A;  4GN2 A;  4KQQ A;  1KVL A;  2JC7 A;  4N9L A;  5EOE A;  2WKE A;  2ZM8 A;  1FSY A;  4R0Q A;  4WYY A;  3ZCZ A;  2EX8 A;  4E3O A;  1DJA A;  2ZM2 A;  4HBT A;  5FI7 A;  2Y55 A;  1G68 A;  3IWQ A;  4H8R A;  5CEB A;  2BG1 A;  4P6B A;  1CEF A;  4S2M A;  3VSL A;  3PAE A;  3M2J A;  3RJU A;  1KGE A;  3IXD A;  4S2K A;  3OCL A;  1BUE A;  5IHV A;  1VM1 A;  3G4P A;  5FAP A;  4QJG A;  1MPL A;  1W5D A;  1LL5 A;  3GR2 A;  2DRW A;  3PTE A;  3G32 A;  4Y7P A;  3MKE A;  1ALQ A;  4CJN A;  1LL9 A;  1IEL A;  4OOY A;  1CI9 A;  1PI5 A;  2X71 A;  3O88 A;  3VMA A;  2ZC4 B;  2UWX A;  4PMA A;  2IWC A;  2WZZ A;  3W4P A;  3N6I A;  5D3O A;  4M3K A;  4S2L A;  3UPO A;  5EPH A;  1KGG A;  2XLN A;  4UAA A;  3MZF A;  1KGF A;  1YM1 A;  2WUQ A;  3QNC A;  1IYP A;  3IT9 A;  3VP4 A;  5CGS A;  4OPZ A;  4KZ7 A;  4UHU A;  3GTC A;  3HL9 A;  3Q7V A;  2WGW A;  2JE5 A;  2HP9 A;  2EX2 A;  2HDU A;  4Q8I A;  1YLJ A;  5E2G A;  5HAP A;  3JYI A;  1K6S A;  4JF4 A;  3WS0 A;  4GDN A;  5AQB A;  1I5Q A;  5JYP A;  5EVI B;  1CEG A;  5AQA A;  1YLY A;  3Q1F A;  2Y2J A;  3NBL A;  1BLS A;  1JWP A;  1K54 A;  2H5S A;  3HLC A;  3NCK A;  3PAG A;  4R4S A;  1L2S A;  2Y2K A;  4ZJ2 A;  2Q9N A;  3O87 A;  1RGZ A;  1IYQ A;  4MLL A;  3UDF A;  2RCX A;  1OME A;  3A3I A;  4LV2 A;  5EUA A;  5FSR A;  3I7J A;  3IWI A;  2G2U A;  3HUO A;  3NC8 A;  5EEC A;  2XEP A;  4X6T A;  4U0T A;  4D2O A;  3UE1 A;  2Y2L A;  1M40 A;  4OON A;  3UY6 A;  2PU2 A;  4FD8 A;  5FQQ A;  5KSC A;  2HDQ A;  4R3J A;  4QY6 A;  4ZDX A;  2I72 A;  4UA9 A;  2H0T A;  1N4O A;  3HLW A;  3FYZ A;  1PWC A;  1YMX A;  3P98 A;  3HLG A;  4JF6 A;  3G2Y A;  4EUZ A;  3HLB A;  1O07 A;  4GDB A;  3SH8 A;  1PIO A;  2EXA A;  2Y2N A;  1MWS A;  3DWK A;  4A5R A;  3WS1 A;  3PBS A;  4WEL A;  1E25 A;  3ZFZ A;  3LY4 A;  3OPR A;  1GHM A;  1GHP A;  4MBH A;  5AQ9 A;  3V39 A;  4ZJ1 A;  1L0G A;  1KE4 A;  3NI9 A;  4OQI A;  4OPQ A;  1JWZ A;  3NY4 A;  5AQ7 A;  3BFE A;  4ZBE A;  4RVA A;  1NRF A;  3VSK A;  4E3J A;  5J8X A;  3GVB A;  1JWV A;  3BM6 A;  1BZA A;  1K57 C;  1FOF A;  2ZC3 B;  2PBY A;  1ZG4 A;  1Z6F A;  5DTK A;  3V5M A;  2ZQ7 A;  5M18 A;  3GRJ A;  4PM7 A;  3NDE A;  3UE3 A;  3BFF A;  4IED A;  3Q7V B;  3VFF A;  2IWD A;  1QMF A;  3EQU A;  3MXS A;  1SKF A;  4ZTK A;  4DRT A;  2OV5 A;  4U0X A;  2Y4A A;  3Q81 A;  5A93 A;  5F1F A;  1XA1 A;  4DE0 A;  4DXB A;  4KQR A;  4GD6 A;  1I2W A;  4S2P A;  5CHJ A;  3IHA A;  3IF5 A;  1PZP A;  1U60 A;  1XXM A;  1NZO A;  5M1A A;  3ZVT A;  2GDN A;  1ERQ A;  3FKV A;  1W79 A;  4KZ4 A;  3C4O A;  4YIN A;  1TDL A;  2XH9 A;  3TG9 A;  4KZ5 A;  5GHZ A;  4WEK A;  1YQS A;  3ZG8 B;  3PBO A;  1AXB A;  2WGI A;  1ONG A;  5DF9 A;  3HUN A;  4P85 A;  1XKZ A;  5GLC A;  2Y2I A;  2X01 A;  2ZLY A;  5GLA A;  1NY0 A;  4F94 A;  1H8Z A;  3UPN A;  3ZG7 B;  5CGW A;  4C6Y A;  1BSG A;  3HVF A;  3MBZ A;  1S6R A;  1L0E A; 
#chains in the Genus database with same CATH topology
 3CJM A;  4S2N A;  2V8C A;  1HTZ A;  5FI2 A;  1H3Q A;  1YSP A;  5I94 A;  2PU4 A;  2CC1 A;  2VK3 A;  1ZC2 A;  5JYO A;  2BLS A;  5TJJ A;  3BQ8 A;  4R3B A;  2QPN A;  5HWT A;  3F1N A;  3AGE A;  5FL3 A;  5CEC A;  2W3F A;  4FH4 A;  3H82 B;  5KSH A;  4R23 A;  3W2Z A;  2PD7 A;  2G2W A;  3VP0 A;  1OTB A;  1JNU A;  4QD4 A;  4Z9Q A;  5FEF A;  2GX5 A;  4KZ8 A;  3EEA A;  2J9P A;  4GZB A;  2V1B A;  3A3E A;  5DVA A;  1FSW A;  3HLD A;  2WGW B;  2WGV A;  1TS8 A;  4JLF A;  4KZ6 A;  5FAS A;  1S1Y A;  4E6W A;  4BQM A;  4HI4 A;  2ZMA A;  4R1G A;  3N7W A;  3EOI A;  3E4O A;  1DP6 A;  4BBU A;  1GA0 A;  2BAS A;  4Q0I A;  4HH3 A;  4PAU A;  4GOG A;  2Y91 A;  1V9Y A;  2WYX A;  4DDS A;  1LSX A;  1Y28 A;  1RGY A;  5F69 A;  3SH9 A;  4KG2 A;  3FWL A;  3E2L A;  4PPR A;  1C3B A;  1XP4 A;  5FA7 A;  3QP4 A;  1GA9 A;  1NXY A;  3T4J A;  1RP5 A;  4IHQ A;  2B02 A;  3C5A A;  2WAF A;  4L0L A;  2KLI A;  3PXP A;  3HJK A;  3S7N A;  4LV3 A;  3ZYT A;  3N8S A;  4LV1 A;  1PFL A;  4ARZ A;  2BTF P;  4NXE A;  3T4S A;  4IUK A;  2P9V A;  3KSF A;  2WZX A;  4NXG A;  4PM6 A;  3GV9 A;  3UE0 A;  3UMD A;  3BEC A;  2PDR A;  2Y2Q A;  3M2K A;  1EWZ A;  1MWR A;  4EQI A;  1SDN A;  3W8K A;  2K31 A;  1ESI A;  1MXO A;  1MY8 A;  3V3S A;  5F82 A;  3UDI A;  2FFY A;  5FAO A;  5EOO A;  4WZ5 C;  1ZTU A;  1XJ6 A;  2WK0 A;  2D01 A;  3IF6 C;  4CLC E;  3S4X A;  1XA7 A;  4GJ4 A;  2OLV A;  2XA7 S;  2H0Y A;  3TRC A;  4LFU A;  1NLZ A;  4C75 A;  2INW A;  2VGL M;  3ZNY A;  2IWB A;  3HLE A;  2V0W A;  5HPF A;  3IH8 A;  4GCZ A;  4FCF A;  3E2K A;  3CUE A;  4DE1 A;  1I2S A;  2V2F F;  1N9O A;  3NIA A;  3QP8 A;  3G30 A;  3PHY A;  5E2F A;  4LEN A;  5HAI A;  5TBM A;  3IWO A;  3MFD A;  4EBN A;  3PBT A;  4H6J B;  1S66 L;  2GZA A;  4LRZ E;  4HEF A;  1FCO A;  3E0Y A;  4KZ3 A;  1K57 A;  2I9V A;  1XPB A;  3T4O A;  4MEZ A;  2QWS A;  2PD8 A;  4WLA A;  3EEH A;  4G3K A;  3FG8 A;  4X68 A;  3IXH A;  4OQG A;  3C2W A;  2PYP A;  2EFU A;  4JXS A;  3LYX A;  3WS5 A;  4JGO A;  4EV4 A;  5L09 A;  1ES5 A;  3BRM A;  3MMH A;  3IHB A;  2HJE A;  4FH2 A;  3WS4 A;  2L1M A;  2XQZ A;  1AWI A;  2B5R A;  1KE0 A;  3ITA A;  2OOL A;  1DJC A;  3M6H A;  3BY9 A;  3VP3 A;  1PW8 A;  4DDY A;  3IQA A;  3IS2 A;  2ZQD A;  1UWN X;  2Y2O A;  5EM1 A;  4NXF A;  1YLP A;  2XGN A;  1LL8 A;  3H7W A;  3CAX A;  3P01 A;  4OP5 A;  3MQQ A;  4DE3 A;  3LO7 A;  1XGI A;  4WZ4 A;  4NET A;  3G35 A;  5FDH A;  4BLM A;  2W3H A;  3DW0 A;  3LI8 A;  3S1Y A;  1DY6 A;  1KOU A;  1ERM A;  3C7U A;  1FQG A;  1NJ4 A;  2HP5 A;  3IBJ A;  3O86 A;  4HJ3 A;  1OTD A;  2P9V B;  4P6Z S;  1E4D A;  2Y2H A;  4P0M A;  4Y15 A;  2JC7 A;  4N9L A;  5EOE A;  2JKF A;  2EX8 A;  4E3O A;  1DJA A;  5FI7 A;  2Y55 A;  2KX6 A;  4S2M A;  3VSL A;  2W1T A;  1BUE A;  5IHV A;  1VEU A;  1LL5 A;  3G32 A;  1IEL A;  2YKF A;  4OOY A;  3JVU A;  5D3O A;  2R78 A;  3UPO A;  5EPH A;  3FPV A;  1IYP A;  3VP4 A;  2WGW A;  3LID A;  1T19 A;  2HP9 A;  2VV6 A;  4Q8I A;  5HAP A;  3JYI A;  4JF4 A;  1I5Q A;  5JYP A;  4GLQ A;  5AQA A;  3R7W B;  1BLS A;  1K54 A;  2H5S A;  1XJ2 A;  3PAG A;  1RGZ A;  4MLL A;  2WKR A;  1S1Z A;  1OME A;  2G2U A;  3HUO A;  4NG2 A;  4EU0 A;  4U0T A;  4HH2 A;  4H6J A;  1M40 A;  2WKQ A;  2PU2 A;  5IT5 A;  5FQQ A;  2HDQ A;  4QY6 A;  4ZDX A;  4UA9 A;  4QWO A;  3FYZ A;  3P98 A;  3HLG A;  4JF6 A;  2FZ0 A;  1S4S A;  3CIT A;  5DKL A;  4GDB A;  3DWK A;  3WS1 A;  2VV8 A;  1GHM A;  3V39 A;  3A0S A;  3NI9 A;  5AQ7 A;  3BFE A;  4YNR A;  3GVB A;  1VET A;  1XFN A;  2L4R A;  1FOF A;  2PBY A;  4KUK A;  5DTK A;  1YAX A;  3MXS A;  1SKF A;  4DRT A;  4U0X A;  2Y4A A;  5F1F A;  5HL6 A;  4DXB A;  5EFW A;  5CHJ A;  1XXM A;  3C4O A;  1TDL A;  4MCW A;  2W3E A;  3H7W B;  1YQS A;  1AXB A;  2WGI A;  5DF9 A;  4P85 A;  2LB9 A;  5A8B A;  2Y2I A;  3IS2 B;  3LIA A;  4F94 A;  3UPN A;  2PHY A;  4C6Y A;  3HVF A;  1MWT A;  4JF5 A;  4X53 A;  1ERO A;  5L10 A;  3ITB A;  1DP9 A;  2XRN A;  3SS4 A;  2QMI A;  4P87 A;  1DJB A;  4S2J A;  4K0X A;  2PAV P;  5FQJ A;  2JKG A;  2RL3 A;  2HP6 A;  1SCW A;  2ZMV A;  2JHE A;  1A0K A;  2D02 A;  1V9Z A;  3UN7 A;  2W1T B;  3CWF A;  4QY5 A;  4I3J A;  4IBX A;  4S2I A;  3LUQ A;  3VOY A;  4E6X A;  2ZQC A;  1VB6 A;  2KOI A;  3BLM A;  3A3F A;  4HHD A;  3LR4 A;  1HZO A;  2VA0 A;  1W63 Q;  3AGF A;  2OAP 1;  3TOI A;  3LIF A;  4X55 A;  4ID4 A;  3EWK A;  3Q7Z A;  4NXB A;  1SKO B;  3C4P A;  1L0F A;  5FQK A;  3LIC A;  3IF6 B;  4UA6 A;  2QZ6 A;  1VET B;  5C5K A;  1GSW A;  4XXR A;  3W4O A;  4RQ9 A;  4Q0H A;  3R7W A;  1ES2 A;  3ZNT A;  3G31 A;  1Y54 A;  4OOL A;  1PYY A;  2P04 A;  3G34 A;  3CZD A;  4E3N A;  1ES3 A;  1H8Y A;  5IS1 A;  3H82 A;  2OSU A;  4MN6 A;  2Y79 A;  2ZD8 A;  4ME4 A;  1RCJ A;  4ZAM A;  3OPH A;  2V0U A;  3NJA A;  3EQV A;  4ZJ3 A;  1OT6 A;  3BYD A;  2W0N A;  1N9B A;  4KZ9 A;  1XJ3 A;  4S2N C;  4BWI A;  3JVV A;  3D9Y A;  3OC2 A;  1XJ4 A;  1BLC A;  4B4Z A;  4EBL A;  4DXC A;  4QB8 A;  4CPK A;  3BQA A;  4WF0 A;  4GB7 A;  4P6Z M;  4HBU A;  1XGJ A;  2Y59 A;  4LV0 A;  5EV0 A;  2X02 A;  1GCE A;  4B4X A;  1G6A A;  5CXW A;  4D60 A;  4B93 A;  1LHY A;  1N9N A;  3BW6 A;  3WWX A;  5GLD A;  4DJ3 A;  3ICY A;  3BEB A;  2ZOI A;  4Y0U A;  4N1X A;  2MJ6 A;  3RTY A;  4GW9 A;  3QNB A;  3EGX C;  3SZT A;  4G3W A;  3NDG A;  4M4X A;  1IOU A;  4OLG A;  5J7E A;  1KE3 A;  2OAQ 1;  3T4L A;  4EBP A;  5KZH A;  5KMW A;  3TSG A;  5GLB A;  4MBK A;  1TF1 A;  4PKY G;  3ZHH A;  3N4I A;  5E43 A;  2Q9M A;  3GEC A;  5AVE A;  4K08 A;  3LGO A;  5CHU A;  4R38 A;  3CG5 A;  2XSS A;  1K4F A;  4WBG A;  1EI5 A;  4E3L A;  1LI0 A;  1K25 A;  5L2F A;  1FR1 A;  4LGW A;  2O9A A;  5HW3 A;  3OCN A;  1X0O A;  2OWJ A;  4ARZ B;  5A90 A;  4FTX A;  1MKI A;  2EA9 A;  1ODV A;  4Y17 A;  5EM0 A;  3ZQ5 A;  3UDX A;  4X56 A;  5DJT A;  4MNR A;  3GDI A;  1PI4 A;  1T18 A;  4FOF A;  1FCM A;  4MDZ A;  4JXV A;  2B18 A;  5HD3 A;  2QKP A;  2WAE A;  4LRY C;  3HLF A;  3SW1 A;  2VGJ A;  3IXG A;  1NYY A;  3A3D A;  3W4Q A;  2XD5 A;  4PKY A;  1IEM A;  3UPP A;  3LEZ A;  4U3T A;  1OTA A;  2E8J A;  5CX7 A;  3HBR A;  3IX8 A;  5A91 A;  2KDK A;  4I38 A;  1K6R A;  1NYM A;  3V50 A;  5TBM B;  4C3Q A;  2XRO A;  2GJ3 A;  3A0V A;  4EQ1 A;  1XFQ A;  5HPI A;  3ZVW A;  4HY8 A;  2J7V A;  3PBQ A;  3SS3 A;  3QP5 A;  1CK3 A;  3C8C A;  1KVM A;  5MC7 A;  2VGK A;  4KQQ A;  4NEE D;  2EWW A;  2ZL1 A;  2K7S A;  2WKE A;  2ZM8 A;  1FSY A;  4R0Q A;  2NUT C;  4HBT A;  5CEB A;  2BG1 A;  2VX8 A;  2JKT I;  3IXD A;  3C38 A;  4GHI A;  3G4P A;  4HNB A;  1W5D A;  3GR2 A;  3PTE A;  3NOP C;  2X71 A;  3O88 A;  4BMW A;  5EVE A;  2PR5 A;  3E4Q A;  2UWX A;  2Z6C A;  4UQI S;  2ZBB A;  3BJN A;  3HCY A;  1NRJ A;  2WZZ A;  3W4P A;  3N6I A;  4M3K A;  4L9E A;  1KGG A;  2XLN A;  4UAA A;  3MZF A;  4KZ7 A;  3TJZ C;  2JE5 A;  5G4Z A;  1YLJ A;  5E2G A;  5HWW A;  5AQB A;  1W63 M;  4DN0 A;  1CEG A;  3NBL A;  5DKK A;  1LSV A;  3O87 A;  1IYQ A;  3IX4 A;  3UDF A;  1P9W A;  2RCX A;  3A3I A;  3LFV A;  5EEC A;  4X6T A;  3NUL A;  1F9I A;  1TS6 A;  3UME A;  4OON A;  4R3J A;  4EET B;  2I72 A;  2H0T A;  3LR3 A;  1N4O A;  1YSQ A;  1PWC A;  1SZV A;  4EUZ A;  3T1R A;  1O07 A;  2HV1 A;  3ZFZ A;  3LY4 A;  1NWZ A;  1MC0 A;  3OPR A;  3KYZ A;  1K0K A;  2ZMF A;  4I39 A;  1L0G A;  2PRF A;  1NRF A;  5AVF A;  2HF6 A;  1JWV A;  1BZA A;  3V5M A;  4PM7 A;  3NDE A;  3BFF A;  4IED A;  2OV5 A;  5A93 A;  1XA1 A;  4DE0 A;  4GD6 A;  3IHA A;  1U60 A;  1NZO A;  3ZVT A;  3MSH A;  3OLO A;  3LEQ A;  4YIN A;  3TG9 A;  4KZ5 A;  1D1J A;  5GHZ A;  4JGQ A;  4WEK A;  3HUN A;  3T1X A;  2ZLY A;  1F2K A;  2M7V A;  3ZG7 B;  5LBR A;  4GS9 B;  3MBZ A;  1S6R A;  1OT9 A;  1L0E A;  4DKI A;  1BUL A;  4RX3 A;  4IVI A;  3CI6 A;  3JPU A;  2JBF A;  2NUP C;  2Y2P A;  3NOU C;  4GNU A;  1CJF A;  4PM5 A;  1ZKJ A;  1QME A;  1W8Y A;  3P7N A;  4WZ5 A;  2EX6 A;  4WMC A;  1SDE A;  2UV0 E;  5HDS A;  2W3G A;  3ISG A;  4EES A;  4XT2 A;  4OPR A;  5J3W A;  4OH0 A;  3D72 A;  3FC7 A;  1PRQ A;  4WMC D;  5CED A;  5HSQ A;  3EGD C;  3LIE A;  4HP9 A;  5TGF A;  1K55 C;  3VP2 A;  1F5M A;  5HL1 A;  1K56 D;  1D06 A;  4O7D A;  4RA7 A;  2ZJ9 A;  5E2H A;  2ZC5 B;  4OLD A;  1MBL A;  5HAR A;  4HIA A;  4HOI A;  3IF6 A;  3CPT A;  4N9K A;  2VGL S;  4QHC A;  5EVI A;  1TS7 A;  5CHM A;  2HPB A;  2JCH A;  4GS9 A;  3MZD A;  2P08 A;  4JBF A;  3ULF A;  3T1Q B;  1E3U D;  2ZQA A;  5A92 A;  3MFX A;  4EXO A;  3FKW A;  2A24 B;  2Y2M A;  3UB5 P;  1NLY A;  3SH7 A;  4LLO B;  4BEN A;  4OVD A;  2L0W A;  2WKI A;  2HDR A;  3DBA A;  1LI9 A;  5F83 A;  4EEP A;  1IFQ A;  1YMS A;  3MZE A;  1J9M A;  5FAQ A;  5FAT A;  2Y2G A;  4JKT A;  2V1Z A;  5M19 A;  4E3I A;  4Y5F A;  2OLU A;  3OPP A;  4X69 A;  3E98 A;  4YFM A;  4IUH A;  2R9X A;  5J4E A;  5K5B A;  1OJG A;  5DF7 A;  5GHY A;  4KEN B;  4BJP A;  1ESU A;  1YT4 A;  4OKP A;  3WS2 A;  1ES4 A;  1L3L A;  2A3U A;  4AFI A;  1Q2Q A;  2A49 A;  3LR0 A;  2J9O A;  4MBF A;  3PBN A;  5FI6 A;  1NZU A;  4XUX A;  3MXR A;  3KSI A;  1GSX A;  3RH8 B;  4BL3 A;  3MJQ A;  4I3A A;  4R4R A;  2A24 A;  1E3U A;  4F3L A;  4KUO A;  1G6O A;  1K55 A;  3BFC A;  3HRE A;  3QP1 A;  4R70 A;  2P74 A;  1HVB A;  1P0Z A;  2PBD P;  4QU3 A;  3VFH A;  4KG5 A;  4B88 A;  4UEY A;  5U47 A;  3RXW A;  2XA7 M;  3WRZ A;  4N1H A;  1HLU P;  2ZC7 A;  1TDG A;  5HAQ A;  3R4K A;  4EWF A;  5HWV A;  2VJW A;  3CUE C;  1YLW A;  3DWZ A;  1SHV A;  2Z2M B;  3T4Q A;  3B47 A;  4WN5 A;  4KG6 A;  2IA2 A;  2EX9 A;  4FSF A;  5F1G A;  4OQH A;  2XD1 A;  3E4P A;  1W7F A;  4O01 A;  3IX3 A;  2H10 A;  2XF3 A;  4GD8 A;  3Q82 A;  2J8Y A;  1G5U A;  3A3J A;  1IYO A;  1O7E A;  1VHM A;  5CTN A;  3DAV A;  1FIL A;  3VE4 A;  5E2E A;  4GHI B;  1K38 A;  4K0W A;  2O9B A;  3GSG A;  5CTM A;  5G18 A;  2C6W B;  3LCE A;  5G4Y A;  3ZG9 B;  5DTS A;  3N8R A;  4KZA A;  2V9A A;  3NEC A;  1JVJ A;  3T4K A;  2JKR I;  2ZM0 A;  2C5W B;  1T1B A;  3IXB A;  3N8L A;  3GMW A;  1P97 A;  4WEJ A;  2EXB A;  2HDS A;  1IKI A;  3UB7 A;  3OPL A;  2XR0 A;  4UQI M;  4CLC A;  4L9G A;  3FPW A;  2O9C A;  3RXX A;  4JPM A;  2O99 A;  4OOM A;  4Y0T A;  3GQZ A;  4Y0O A;  4CLC C;  3M6B A;  5DFY A;  4G3V A;  4GN2 A;  1CF0 A;  2J3T D;  4WYY A;  3DTI A;  2ZM2 A;  3KSG A;  2V1A A;  4IJG A;  4NKP A;  3MR0 A;  5HDC A;  4H8R A;  1MKM A;  3PAE A;  3T4T A;  3RJU A;  1KGE A;  4S2K A;  3OCL A;  4Y3I A;  4QJG A;  1MPL A;  5IU1 A;  2K2N A;  3UE6 A;  3MKE A;  1ALQ A;  4CJN A;  1LL9 A;  4HQA A;  1PI5 A;  4O8G A;  2ZC4 B;  4PMA A;  5FDS A;  2IWC A;  1T1C A;  1BYW A;  4S2L A;  3K3C A;  2V8F A;  1YKD A;  1KGF A;  1YM1 A;  2VKS A;  3QNC A;  5CGS A;  4OPZ A;  4I5S A;  3HL9 A;  4BBT A;  3Q7V A;  3K3D A;  2M7U A;  3HJI A;  2Y8H A;  1K6S A;  3WS0 A;  4GDN A;  5F6A A;  4CLC D;  5EVI B;  2WKP A;  1YLY A;  3Q1F A;  1H0M A;  4E04 A;  4R4S A;  1L2S A;  2Y2K A;  4ZJ2 A;  1ZHH B;  4EER A;  3KYQ A;  4FUW A;  3S7Q A;  5EUA A;  3IWI A;  4O0P A;  4D2O A;  2G7U A;  1T1A A;  3O5Y A;  3HLW A;  3G2Y A;  3OBF A;  2OWH A;  3SH8 A;  4A5R A;  1Y4O A;  1MWS A;  2Y2N A;  2ZL1 B;  3PBS A;  4WEL A;  1E25 A;  5AQ9 A;  2JN7 A;  1KE4 A;  4ZBE A;  4OQI A;  1JWZ A;  4OPQ A;  4LRX C;  2HGV A;  5DFX A;  2ZQ7 A;  3GRJ A;  3VE3 A;  3UB8 A;  2VZW A;  3Q7V B;  2IWD A;  4ZTK A;  1J3W A;  5HD5 A;  1UGU A;  1I2W A;  4S2P A;  1PZP A;  3UB6 A;  5M1A A;  2GDN A;  3FKV A;  1W79 A;  1N9L A;  3B42 A;  2XH9 A;  4X25 A;  3PBO A;  1ONG A;  4HJ4 A;  3MQO A;  2X01 A;  1NY0 A;  1H8Z A;  5CGW A;  2VV7 A;  3K2N A;  4WM9 A;  1FR6 A;  4BD0 A;  4N92 A;  4OQ0 A;  4RX2 A;  3A0R A;  1JTD A;  4DE2 A;  4MN5 A;  2HJ9 C;  4QPR A;  1IKG A;  1CI8 A;  1FIK A;  2QYB A;  5HFO A;  3BFD A;  3MF0 A;  1LLB A;  3S7O A;  3TE8 A;  1OTI A;  2QHK A;  1OPX A;  1K56 A;  2YKH A;  1VQQ A;  4I3I A;  1S0W A;  5F5Y A;  2FFF B;  4IBR A;  4K91 A;  5TFQ A;  1Z09 A;  1GHI A;  5EE8 A;  4LCL A;  3CMZ A;  2R9W A;  3UNW A;  5EVI C;  1STZ A;  3LY3 A;  2ZC6 B;  3MKF A;  3FV7 A;  3SOI A;  5FQM A;  4XT2 B;  3Q07 A;  1ZG6 A;  1OJ5 A;  2JKT M;  2ZQ9 A;  1TEM A;  3C30 A;  3U4L P;  4CLC B;  1M6K A;  4E3M A;  5KIZ A;  1BTL A;  3FZC A;  1MZU A;  1XX2 A;  3G6O A;  1GSV A;  4HES A;  3ZDJ A;  3BFG A;  4PM9 A;  2W1R A;  5HX9 A;  4NK3 A;  5CER A;  4BD1 A;  3OZH A;  4JXW A;  3IH9 A;  1DRM A;  1WYC A;  2J3T C;  1K54 C;  3L7H A;  4L9F A;  1PNE A;  5CRF A;  3IBR A;  3V3R A;  2Z2L B;  3HUM A;  3NHQ A;  1H8M A;  1YLZ A;  1S4R A;  3U2A A;  4Y13 A;  4RYE A;  2QJ5 A;  4YWZ A;  2V20 A;  3P09 A;  5BOH A;  4LCM A;  5L07 A;  5DTT A;  1Q2P A;  3ZG0 A;  4JXG A;  2AVX A;  1PZO A;  3ZGA B;  1OTE A;  1L0D A;  3S7P A;  3SS5 A;  4HP4 A;  5TR7 A;  1BLP A;  2O0Y A;  2ZOH A;  3NOT C;  2W3D A;  1S67 L;  2WKH A;  3LI9 A;  5GL9 A;  4F3L B;  4OP8 A;  4DF6 A;  1ONH A;  1BLH A;  3KYE A;  2XK1 A;  2A2L A;  4OPY A;  4Q0J A;  2PR6 A;  1TD5 A;  4MMN A;  5EVL A;  2DNS A;  2XFS A;  3PBR A;  2VLG A;  1LSW A;  3T1S A;  2FH5 A;  1H5X A;  1P9R A;  2EFX A;  2GNX A;  4LPZ A;  5DF8 A;  2ACG A;  1MWU A;  1YPR A;  1WE4 A;  1G28 A;  1ACF A;  3F1P B;  4UA7 A;  4IVK A;  1HD8 A;  4S2O A;  1W8Q A;  2E8I A;  4KZB A;  2P7J A;  3OOV A;  1TVF A;  1PW1 A;  3VP1 A;  4GKU A;  3DTE A;  1WYB A;  1KDS A;  4BL2 A;  3LIB A;  2JKR M;  2XDM A;  3UB9 A;  4YOF A;  3AGD A;  3O3V A;  3ZG5 A;  3MQ0 A;  2DCF A;  5CGX A;  4Z1W A;  3B33 A;  2H28 A;  4E3K A;  1JTG A;  3S22 A;  4MN7 A;  1IYS A;  2DMW A;  4II7 A;  4PM8 A;  3QP2 A;  4ETX A;  1KDW A;  3RFB A;  4BBV A;  5GHX A;  2VEA A;  2PYR A;  1BT5 A;  3B3X A;  1K4E A;  3KSH A;  2WAD A;  1FCN A;  4X1M A;  3BLS A;  2XFT A;  4R6L A;  4WL9 A;  4XUZ A;  4DMZ A;  3KO6 A;  1PWD A;  1YLT A;  2EWV A;  3G2Z A;  2W27 A;  3VOZ A;  2ZQ8 A;  5HZH A;  4KQO A;  1F98 A;  5FQ9 A;  5FQI A;  3D4F A;  3QHY A;  2J80 A;  2Q0O A;  1PWG A;  4DJ2 A;  5F68 A;  3F1O A;  3WRT A;  3CPT B;  3T12 B;  3C7V A;  5HDD A;  3UO9 A;  3DTM A;  1TS0 A;  2B95 A;  5EVI D;  4B9O A;  1KVL A;  3L9K A;  3ZCZ A;  1G68 A;  3IWQ A;  4X1L A;  4P6B A;  1CEF A;  3M2J A;  3VV4 A;  1CQA A;  1VM1 A;  5FAP A;  2HZ5 A;  2DRW A;  4Y7P A;  1CI9 A;  3D3O A;  4R3A A;  1VEU B;  3VMA A;  4Y2F A;  1WA9 A;  3PR6 A;  4JGP A;  3KX0 X;  4EUV A;  1LT0 A;  5I5L A;  2WUQ A;  5AJG A;  3V67 A;  3IT9 A;  3H9W A;  4ETZ A;  4UHU A;  3GTC A;  2EX2 A;  2HDU A;  3F1P A;  2QJ7 A;  2Y2J A;  5FEG A;  1JWP A;  3HLC A;  3NCK A;  3T50 A;  2CMN A;  2Q9N A;  4LV2 A;  5FSR A;  3I7J A;  3NC8 A;  1DP8 A;  2XEP A;  2LB5 A;  3UE1 A;  2Y2L A;  3UY6 A;  4FD8 A;  4EEU A;  3QP6 A;  5KSC A;  3CHW P;  4HJ6 A;  3BY8 A;  1YMX A;  3HLB A;  1PIO A;  2EXA A;  3TW8 A;  2M1C A;  3LR5 A;  4JGR A;  4MBH A;  1GHP A;  4ZJ1 A;  2Z6D A;  3NY4 A;  4EW7 A;  4RVA A;  3VSK A;  4E3J A;  5J8X A;  1UWP X;  2J3W A;  3BM6 A;  1K57 C;  2ZC3 B;  1ZG4 A;  1Z6F A;  2PT7 A;  5M18 A;  3UE3 A;  4PHT A;  3VFF A;  1QMF A;  3EQU A;  4CQH A;  3Q81 A;  3PYP A;  4KQR A;  3VOL A;  3IF5 A;  3DTK A;  4ZRR A;  1ERQ A;  4KZ4 A;  5DJU A;  1EW0 A;  1D7E A;  3BWL A;  3MS6 A;  4KQD A;  3ZG8 B;  3MXQ A;  4ESP A;  1SKO A;  1XKZ A;  5GLC A;  3F1N B;  5GLA A;  3F1O B;  4WUJ A;  3CLO A;  1BSG A;  5L8M A; 
#chains in the Genus database with same CATH homology
 1MWT A;  3CJM A;  4JF5 A;  4S2N A;  4DKI A;  1BUL A;  4WM9 A;  4RX3 A;  4X53 A;  4IVI A;  1HTZ A;  1FR6 A;  5FI2 A;  1ERO A;  4N92 A;  4BD0 A;  4OQ0 A;  2JBF A;  5I94 A;  4RX2 A;  1JTD A;  2PU4 A;  2Y2P A;  4GNU A;  2CC1 A;  4DE2 A;  3ITB A;  4PM5 A;  1ZKJ A;  3SS4 A;  1ZC2 A;  2QMI A;  4P87 A;  1DJB A;  5JYO A;  4S2J A;  4K0X A;  1QME A;  2BLS A;  1W8Y A;  4WZ5 A;  4R3B A;  1IKG A;  5FQJ A;  1CI8 A;  2EX6 A;  4WMC A;  2QPN A;  2RL3 A;  1SDE A;  2HP6 A;  1SCW A;  5HFO A;  3BFD A;  3ISG A;  3AGE A;  3UN7 A;  5CEC A;  1LLB A;  4OPR A;  4OH0 A;  4FH4 A;  4QY5 A;  1K56 A;  1VQQ A;  4IBX A;  5KSH A;  4R23 A;  4S2I A;  3VOY A;  4WMC D;  4E6X A;  1S0W A;  2ZQC A;  5CED A;  2G2W A;  3VP0 A;  3BLM A;  2FFF B;  4IBR A;  3A3F A;  4K91 A;  4QD4 A;  4Z9Q A;  5TFQ A;  4KZ8 A;  5TGF A;  1GHI A;  1K55 C;  2J9P A;  4GZB A;  3VP2 A;  5EE8 A;  1HZO A;  3A3E A;  5HL1 A;  4LCL A;  3CMZ A;  2R9W A;  1K56 D;  5DVA A;  3UNW A;  5EVI C;  4O7D A;  4RA7 A;  1FSW A;  3AGF A;  3HLD A;  2WGW B;  3TOI A;  2ZJ9 A;  2WGV A;  5E2H A;  3LY3 A;  4X55 A;  2ZC5 B;  4ID4 A;  4JLF A;  4KZ6 A;  4OLD A;  2ZC6 B;  5FAS A;  1MBL A;  3MKF A;  5HAR A;  4E6W A;  3IF6 A;  3FV7 A;  3SOI A;  5FQM A;  3Q7Z A;  4N9K A;  3Q07 A;  1ZG6 A;  4QHC A;  3C4P A;  5EVI A;  5CHM A;  2HPB A;  4BQM A;  1L0F A;  5FQK A;  2JCH A;  2ZQ9 A;  3IF6 B;  4UA6 A;  1TEM A;  2QZ6 A;  2ZMA A;  4R1G A;  3N7W A;  3MZD A;  4JBF A;  4E3M A;  1M6K A;  4XXR A;  3W4O A;  1BTL A;  3FZC A;  1ES2 A;  3ZNT A;  1GA0 A;  3G31 A;  1XX2 A;  1Y54 A;  1E3U D;  4OOL A;  2ZQA A;  1PYY A;  3G34 A;  5A92 A;  3CZD A;  4HES A;  4E3N A;  1ES3 A;  3ZDJ A;  1H8Y A;  4GOG A;  3BFG A;  4PM9 A;  2Y91 A;  3FKW A;  2WYX A;  4DDS A;  2OSU A;  2Y2M A;  3SH7 A;  5HX9 A;  2ZD8 A;  1RGY A;  4BEN A;  4NK3 A;  5CER A;  1RCJ A;  4BD1 A;  3OZH A;  4JXW A;  4ZAM A;  3OPH A;  3IH9 A;  4OVD A;  3SH9 A;  2WKI A;  2HDR A;  1WYC A;  4KG2 A;  3FWL A;  1LI9 A;  1K54 C;  3E2L A;  5F83 A;  4PPR A;  3EQV A;  4ZJ3 A;  1C3B A;  5CRF A;  1XP4 A;  3BYD A;  5FA7 A;  3V3R A;  1YMS A;  3MZE A;  2Z2L B;  1J9M A;  1GA9 A;  1NXY A;  1RP5 A;  3HUM A;  1N9B A;  5FAQ A;  4KZ9 A;  3C5A A;  5FAT A;  1YLZ A;  2WAF A;  2Y2G A;  4JKT A;  2V1Z A;  4S2N C;  5M19 A;  4E3I A;  4L0L A;  3OC2 A;  1BLC A;  4RYE A;  2OLU A;  3OPP A;  4X69 A;  4YFM A;  4B4Z A;  4EBL A;  4DXC A;  4LV3 A;  2R9X A;  2V20 A;  3N8S A;  3P09 A;  4QB8 A;  5BOH A;  4LCM A;  4CPK A;  5DF7 A;  4LV1 A;  5DTT A;  5GHY A;  2P9V A;  4GB7 A;  4KEN B;  4BJP A;  2WZX A;  1ESU A;  1Q2P A;  3ZG0 A;  1YT4 A;  4OKP A;  4JXG A;  3WS2 A;  1PZO A;  4PM6 A;  3GV9 A;  1ES4 A;  3UE0 A;  2A3U A;  3ZGA B;  1Q2Q A;  4HBU A;  1XGJ A;  1L0D A;  2A49 A;  2Y59 A;  4LV0 A;  3BEC A;  3SS5 A;  2X02 A;  5TR7 A;  1BLP A;  1GCE A;  2J9O A;  2Y2Q A;  4MBF A;  3PBN A;  3M2K A;  1EWZ A;  1MWR A;  5FI6 A;  4B4X A;  4EQI A;  1G6A A;  1NZU A;  2WKH A;  5CXW A;  1SDN A;  3W8K A;  5GL9 A;  4XUX A;  3MXR A;  4BL3 A;  1ESI A;  1LHY A;  4OP8 A;  4DF6 A;  1ONH A;  1BLH A;  3WWX A;  1MXO A;  5GLD A;  1MY8 A;  3V3S A;  4R4R A;  5F82 A;  1E3U A;  2XK1 A;  3UDI A;  2FFY A;  5FAO A;  4OPY A;  3BEB A;  5EOO A;  4WZ5 C;  5EVL A;  2DNS A;  4N1X A;  2XFS A;  2WK0 A;  3PBR A;  4Y0U A;  3IF6 C;  3S4X A;  1XA7 A;  1H5X A;  3QNB A;  1K55 A;  2EFX A;  3NDG A;  3BFC A;  2OLV A;  4OLG A;  3HRE A;  1KE3 A;  4EBP A;  5KZH A;  2H0Y A;  2P74 A;  1HVB A;  5DF8 A;  4C75 A;  5KMW A;  3TSG A;  1MWU A;  5GLB A;  4MBK A;  4QU3 A;  3VFH A;  1WE4 A;  3ZNY A;  2IWB A;  4KG5 A;  3HLE A;  4B88 A;  5U47 A;  3IH8 A;  4UA7 A;  4IVK A;  1HD8 A;  3RXW A;  4S2O A;  3ZHH A;  1W8Q A;  3WRZ A;  2E8I A;  3N4I A;  4N1H A;  5E43 A;  4KZB A;  2Q9M A;  4FCF A;  3E2K A;  2ZC7 A;  1TDG A;  5HAQ A;  4DE1 A;  1I2S A;  2V2F F;  1TVF A;  3NIA A;  4EWF A;  3G30 A;  5CHU A;  1PW1 A;  3VP1 A;  4GKU A;  1YLW A;  3CG5 A;  1WYB A;  1K4F A;  4WBG A;  1EI5 A;  1KDS A;  5E2F A;  4E3L A;  3DWZ A;  1LI0 A;  4LEN A;  4BL2 A;  1SHV A;  1K25 A;  5HAI A;  2Z2M B;  5L2F A;  1FR1 A;  2XDM A;  3IWO A;  3MFD A;  4EBN A;  4KG6 A;  3PBT A;  2EX9 A;  3AGD A;  5HW3 A;  4HEF A;  3OCN A;  1FCO A;  4FSF A;  5F1G A;  3O3V A;  4OQH A;  3ZG5 A;  2XD1 A;  1K57 A;  1W7F A;  4KZ3 A;  2DCF A;  1XPB A;  2H10 A;  4MEZ A;  2XF3 A;  5CGX A;  4GD8 A;  3Q82 A;  2J8Y A;  5A90 A;  1MKI A;  3A3J A;  3UDX A;  4X68 A;  1IYO A;  1O7E A;  4X56 A;  4E3K A;  3IXH A;  4MNR A;  4OQG A;  2EFU A;  1JTG A;  4JXS A;  5CTN A;  3S22 A;  3WS5 A;  4EV4 A;  1ES5 A;  3BRM A;  5E2E A;  1IYS A;  1K38 A;  1PI4 A;  4K0W A;  3IHB A;  1FCM A;  4FH2 A;  3GSG A;  5CTM A;  3WS4 A;  4JXV A;  5G18 A;  4PM8 A;  2WAE A;  1KDW A;  2C6W B;  2XQZ A;  3HLF A;  3LCE A;  2VGJ A;  2B5R A;  1KE0 A;  5GHX A;  3ITA A;  3IXG A;  3ZG9 B;  1BT5 A;  1NYY A;  5DTS A;  3B3X A;  1K4E A;  3A3D A;  3W4Q A;  2XD5 A;  3N8R A;  1DJC A;  2WAD A;  3M6H A;  1IEM A;  1FCN A;  3UPP A;  3LEZ A;  4KZA A;  3VP3 A;  3BLS A;  1PW8 A;  4DDY A;  4U3T A;  2XFT A;  4XUZ A;  3IQA A;  1PWD A;  3HBR A;  1JVJ A;  1YLT A;  3G2Z A;  5A91 A;  3VOZ A;  2ZQ8 A;  2ZQD A;  2ZM0 A;  2C5W B;  2Y2O A;  3IXB A;  3N8L A;  1YLP A;  1K6R A;  2XGN A;  4KQO A;  1NYM A;  3GMW A;  5FQ9 A;  5FQI A;  3V50 A;  4WEJ A;  2EXB A;  3D4F A;  3QHY A;  2HDS A;  4OP5 A;  4C3Q A;  1IKI A;  4DE3 A;  3OPL A;  3LO7 A;  1XGI A;  2XR0 A;  4WZ4 A;  1PWG A;  4NET A;  3G35 A;  5FDH A;  4BLM A;  3DW0 A;  3RXX A;  3S1Y A;  4JPM A;  3WRT A;  3ZVW A;  1DY6 A;  4OOM A;  4Y0T A;  1ERM A;  2J7V A;  3C7U A;  3PBQ A;  1FQG A;  1NJ4 A;  3C7V A;  2HP5 A;  3SS3 A;  3O86 A;  3GQZ A;  4Y0O A;  2P9V B;  1E4D A;  3UO9 A;  2Y2H A;  4P0M A;  3DTM A;  1CK3 A;  3M6B A;  5EVI D;  1KVM A;  2VGK A;  4GN2 A;  4KQQ A;  1KVL A;  2JC7 A;  4N9L A;  5EOE A;  2WKE A;  2ZM8 A;  1FSY A;  4R0Q A;  4WYY A;  3ZCZ A;  2EX8 A;  4E3O A;  1DJA A;  2ZM2 A;  4HBT A;  5FI7 A;  2Y55 A;  1G68 A;  3IWQ A;  4H8R A;  5CEB A;  2BG1 A;  4P6B A;  1CEF A;  4S2M A;  3VSL A;  3PAE A;  3M2J A;  3RJU A;  1KGE A;  3IXD A;  4S2K A;  3OCL A;  1BUE A;  5IHV A;  1VM1 A;  3G4P A;  5FAP A;  4QJG A;  1MPL A;  1W5D A;  1LL5 A;  3GR2 A;  2DRW A;  3PTE A;  3G32 A;  4Y7P A;  3MKE A;  1ALQ A;  4CJN A;  1LL9 A;  1IEL A;  4OOY A;  1CI9 A;  1PI5 A;  2X71 A;  3O88 A;  3VMA A;  2ZC4 B;  2UWX A;  4PMA A;  2IWC A;  2WZZ A;  3W4P A;  3N6I A;  5D3O A;  4M3K A;  4S2L A;  3UPO A;  5EPH A;  1KGG A;  2XLN A;  4UAA A;  3MZF A;  1KGF A;  1YM1 A;  2WUQ A;  3QNC A;  1IYP A;  3IT9 A;  3VP4 A;  5CGS A;  4OPZ A;  4KZ7 A;  4UHU A;  3GTC A;  3HL9 A;  3Q7V A;  2WGW A;  2JE5 A;  2HP9 A;  2EX2 A;  2HDU A;  4Q8I A;  1YLJ A;  5E2G A;  5HAP A;  3JYI A;  1K6S A;  4JF4 A;  3WS0 A;  4GDN A;  5AQB A;  1I5Q A;  5JYP A;  5EVI B;  1CEG A;  5AQA A;  1YLY A;  3Q1F A;  2Y2J A;  3NBL A;  1BLS A;  1JWP A;  1K54 A;  2H5S A;  3HLC A;  3NCK A;  3PAG A;  4R4S A;  1L2S A;  2Y2K A;  4ZJ2 A;  2Q9N A;  3O87 A;  1RGZ A;  1IYQ A;  4MLL A;  3UDF A;  2RCX A;  1OME A;  3A3I A;  4LV2 A;  5EUA A;  5FSR A;  3I7J A;  3IWI A;  2G2U A;  3HUO A;  3NC8 A;  5EEC A;  2XEP A;  4X6T A;  4U0T A;  4D2O A;  3UE1 A;  2Y2L A;  1M40 A;  4OON A;  3UY6 A;  2PU2 A;  4FD8 A;  5FQQ A;  5KSC A;  2HDQ A;  4R3J A;  4QY6 A;  4ZDX A;  2I72 A;  4UA9 A;  2H0T A;  1N4O A;  3HLW A;  3FYZ A;  1PWC A;  1YMX A;  3P98 A;  3HLG A;  4JF6 A;  3G2Y A;  4EUZ A;  3HLB A;  1O07 A;  4GDB A;  3SH8 A;  1PIO A;  2EXA A;  2Y2N A;  1MWS A;  3DWK A;  4A5R A;  3WS1 A;  3PBS A;  4WEL A;  1E25 A;  3ZFZ A;  3LY4 A;  3OPR A;  1GHM A;  1GHP A;  4MBH A;  5AQ9 A;  3V39 A;  4ZJ1 A;  1L0G A;  1KE4 A;  3NI9 A;  4OQI A;  4OPQ A;  1JWZ A;  3NY4 A;  5AQ7 A;  3BFE A;  4ZBE A;  4RVA A;  1NRF A;  3VSK A;  4E3J A;  5J8X A;  3GVB A;  1JWV A;  3BM6 A;  1BZA A;  1K57 C;  1FOF A;  2ZC3 B;  2PBY A;  1ZG4 A;  1Z6F A;  5DTK A;  3V5M A;  2ZQ7 A;  5M18 A;  3GRJ A;  4PM7 A;  3NDE A;  3UE3 A;  3BFF A;  4IED A;  3Q7V B;  3VFF A;  2IWD A;  1QMF A;  3EQU A;  3MXS A;  1SKF A;  4ZTK A;  4DRT A;  2OV5 A;  4U0X A;  2Y4A A;  3Q81 A;  5A93 A;  5F1F A;  1XA1 A;  4DE0 A;  4DXB A;  4KQR A;  4GD6 A;  1I2W A;  4S2P A;  5CHJ A;  3IHA A;  3IF5 A;  1PZP A;  1U60 A;  1XXM A;  1NZO A;  5M1A A;  3ZVT A;  2GDN A;  1ERQ A;  3FKV A;  1W79 A;  4KZ4 A;  3C4O A;  4YIN A;  1TDL A;  2XH9 A;  3TG9 A;  4KZ5 A;  5GHZ A;  4WEK A;  1YQS A;  3ZG8 B;  3PBO A;  1AXB A;  2WGI A;  1ONG A;  5DF9 A;  3HUN A;  4P85 A;  1XKZ A;  5GLC A;  2Y2I A;  2X01 A;  2ZLY A;  5GLA A;  1NY0 A;  4F94 A;  1H8Z A;  3UPN A;  3ZG7 B;  5CGW A;  4C6Y A;  1BSG A;  3HVF A;  3MBZ A;  1S6R A;  1L0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...