4IVIA

Crystal structure of a family viii carboxylesterase.
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
404
structure length
404
Chain Sequence
AEGPVTATKPKEAGFTSEGLARIDAYLKNEIQAKTMPGAVMMIKRNGETAYFSSFGLRDPDTKEPMTAETIFRIYSMSKPITTVAAMMLVEEGKLQLDEPVSKYIPSFANVKVGVETKGENGMALETGPVKRAITIQDLMRHTSGITYGFVGDGLVKKAYIASNLFDGDFDNAEFAERIAKLPLVYQPGTTWDYGHSTDILGRVVEVVSGKSLYQFEKERLLDPLGMKDTGFYVTDPAKKSLVAEAMPNDRKIGGSEMFDPRVQKKWEPGGQGMVSTIGDYARFTQMVLNGGTLDGKRYLSPKTIAYMGSNHIPQASGIVPGAYYLPGPGVGFGLGFAVRTEAGVTPVEGSVGDLSWGGAGGTVFWIDPKENLTVVFMAPMVSPRARVWRTLRNIVYGAFDRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxylesterase
publication title Structural basis for the beta-lactamase activity of EstU1, a family VIII carboxylesterase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 125
structure length 404
sequence length 404
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2013-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4iviA00
1JTDA 4LCMA 1XP4A 4E3IA 3LY3A 4IVKA 1XPBA 3P09A 4ZJ1A 1SCWA 3UY6A 4UAAA 1K57A 1MY8A 5FATA 3OZHA 3ZG0A 4WZ4A 3IT9A 1YMXA 2ZD8A 4GDNA 3GTCA 4JXVA 2OSUA 2Y91A 3HBRA 3ZCZA 5M19A 4BL3A 4QU3A 1ZG6A 1BLHA 5FI7A 3GVBA 1ONGA 4KQQA 3IF6A 1MWUA 3HUNA 2JC7A 3TSGA 5EVIB 4A5RA 3HLGA 3HLEA 3ISGA 3IF5A 4QB8A 3UDIA 5GLDA 3HUMA 3SH7A 1XGJA 1ES4A 1WYBA 2ZJ9A 2WAEA 1KGGA 1U60A 3LCEA 1K54A 3NDGA 2WUQA 3PBRA 1BZAA 1J9MA 1SKFA 3M2JA 3DWZA 3QHYA 1HZOA 3DTMA 1KVMA 3ITBA 3WS1A 4K0XA 1FQGA 3ZHHA 4Y0OA 5HL1A 1YLPA 1KE0A 4IEDA 4GN2A 1HTZA 4PM7A 4OOMA 1XGIA 5AQ7A 3G31A 4B4ZA 1N9BA 2BG1A 4LENA 4WEKA 1M40A 4LV0A 1JTGA 2WYXA 2ZC7A 1GHIA 1BSGA 1K38A 1RGZA 3Q07A 4E6WA 1PW1A 2P9VB 4CJNA 4R0QA 5EVLA 3FKVA 1TEMA 3V5MA 4UHUA 2JCHA 3DW0A 4DE1A 4GDBA 3TG9A 5EVIA 1W79A 3OPRA 3ZGAB 3SS5A 4OQ0A 2Y2KA 5CECA 1JWZA 5TR7A 3WS5A 4JPMA 3M6BA 2PU2A 4C75A 3VSLA 4GNUA 1SDNA 4N9LA 1Y54A 1MPLA 3B3XA 4LCLA 1PZOA 3O3VA 2V1ZA 4CPKA 2XFTA 4DE2A 2H0TA 1ERMA 4ZJ2A 1L0FA 1FSYA 3O86A 3C4PA 4FH2A 5FDHA 4OPZA 4HBTA 1EROA 3IWQA 1DJBA 5G18A 3AGFA 5AQ9A 2DRWA 4KZ8A 1NZUA 2ZC4B 2Z2MB 4DE3A 4QY6A 2R9WA 5E2EA 4M3KA 5EVIC 1N4OA 1KGFA 3CG5A 1K56A 1CEGA 2QMIA 2ZQDA 2HDUA 2P9VA 1KDWA 3SH9A 4DXBA 2XLNA 4ZAMA 3VP0A 3N8LA 2J7VA 4KG5A 4Y0UA 1NJ4A 3WS0A 3UDFA 4U0XA 4HBUA 3VP1A 4WZ5C 5FSRA 4OQGA 4R1GA 3SS4A 5CHJA 3IH9A 3MZDA 4QHCA 4MBKA 5FASA 1I5QA 3W8KA 3UE1A 1BLCA 3HLWA 3NBLA 5DF8A 3ZG9B 2B5RA 3Q7VB 3PAGA 4X55A 3C5AA 3BFFA 3P98A 4R23A 3ZNYA 4S2IA 4JF5A 1M6KA 4HEFA 3BECA 4X56A 3ZFZA 3OPLA 2H5SA 3HVFA 5E43A 2Q9NA 3SS3A 3VP4A 1MWRA 2Y2QA 2ZQCA 3LO7A 5FI2A 2QPNA 5EPHA 3M2KA 4JKTA 1XKZA 4OLGA 3BFGA 3GQZA 2XD5A 5CTMA 1ES5A 4H8RA 4KQRA 2ZC3B 4U3TA 3OC2A 3WS4A 3GRJA 1TDLA 3V50A 1E25A 1E3UA 2HDRA 2HPBA 2I72A 3JYIA 4BL2A 2Q9MA 5DVAA 1K4EA 2X71A 4IVIA 2H0YA 2XEPA 3FKWA 1SHVA 2WAFA 1ZG4A 5JYOA 5F1GA 4GB7A 2V20A 2WKIA 3AGDA 1NYYA 3WWXA 1RCJA 2WKEA 4JXWA 1QMEA 1G68A 3VP3A 3G35A 3ZVWA 4DF6A 1PI4A 3PAEA 5CTNA 3FZCA 4R4RA 3Q7VA 4KG6A 1GA0A 3HLCA 5F1FA 2ZM8A 1AXBA 5EVID 1NY0A 3C7UA 4OONA 1H8YA 2ZQAA 4GZBA 5KZHA 2EX6A 3BLMA 2XGNA 2IWDA 4EBLA 3UNWA 4E6XA 1KVLA 1O7EA 1VQQA 2Y55A 4YINA 4BD1A 2XDMA 2P74A 3HUOA 3MXRA 1FCMA 4KZBA 4OQHA 2OV5A 4Y0TA 4KZ6A 5A90A 5KSHA 1GHPA 1WYCA 3BFCA 3FYZA 2EFUA 3A3IA 2XQZA 4N1HA 2Y4AA 1IKGA 2ZLYA 2IWBA 2HP9A 1C3BA 3ZDJA 5GHZA 2BLSA 1Q2QA 1K57C 1I2WA 1IYSA 1YMSA 3IXDA 4P0MA 3G34A 1S6RA 2EX8A 4RYEA 2Y2JA 4KENB 3VSKA 1YT4A 2Y2MA 1PI5A 4ID4A 4WMCA 5GLCA 4OPQA 1ESIA 2EX2A 2XFSA 1K56D 3MFDA 4JXGA 4GD8A 4OPRA 2EFXA 1K55A 5CHMA 4IBRA 5GL9A 2R9XA 3G30A 1YQSA 3IF6C 1LI0A 1HD8A 3UPOA 3VP2A 5M18A 3GMWA 5A92A 4QJGA 3HLFA 2EXAA 4WELA 5FQ9A 1GCEA 4BD0A 3BRMA 3G2YA 5CERA 1FR6A 4KZAA 1K54C 5DTKA 3NIAA 3O88A 1Q2PA 4K0WA 1CEFA 3RJUA 4KZ7A 1PW8A 3UE3A 1I2SA 4PPRA 3S4XA 2DNSA 3E2KA 4QD4A 2XH9A 3PBSA 4PM6A 5F83A 1K6RA 1PWDA 1K4FA 2VGJA 3PTEA 3WRTA 4E3KA 5AQBA 3GR2A 4KQOA 5E2FA 2WGIA 4ZJ3A 4R4SA 5CGXA 3IHAA 5HAQA 4N92A 3UPNA 1E3UD 4P85A 3E2LA 1XA1A 3EQVA 4LV1A 5CEDA 4BJPA 1H8ZA 3QNCA 1PWGA 4LV2A 4UA6A 2J8YA 5HFOA 2E8IA 4E3NA 4OQIA 4Z9QA 3ZVTA 1XA7A 5FQMA 5I94A 2X01A 4Q8IA 4UA9A 3IXHA 3FWLA 1IYQA 3N8RA 5E2GA 4OOYA 4FCFA 4DKIA 3LY4A 4BQMA 1ZC2A 3IHBA 5HARA 4EV4A 1ES3A 2RL3A 5EE8A 4EBNA 5GLBA 3W4OA 5GHXA 4GD6A 1GHMA 2Y2NA 3CMZA 5EOEA 2ZMAA 4C3QA 4OP5A 1PWCA 2H10A 1YLJA 3GV9A 3BYDA 3M6HA 4KZ5A 4E3OA 3OPPA 4KZ4A 2WZXA 4XXRA 1EI5A 5FA7A 4RX2A 2OLVA 4LV3A 4RX3A 5BOHA 1XX2A 2EXBA 2Y2IA 4DDSA 3IXBA 5DTSA 3MZEA 2A49A 1NZOA 5F82A 5DTTA 4MBHA 3MKEA 5EUAA 4R3BA 1WE4A 5HW3A 1YLTA 3WRZA 4WMCD 1FCOA 4MNRA 3IWIA 2XR0A 3D4FA 4MEZA 5M1AA 3I7JA 4WBGA 2HDQA 4ZDXA 1NRFA 1DY6A 1L0EA 1FR1A 4X69A 3A3FA 4P87A 5EOOA 4KZ3A 4B88A 4FSFA 1ESUA 3BFEA 5A93A 5KMWA 4JLFA 4EBPA 2ZC6B 1KE3A 2X02A 3A3EA 3BEBA 2WKHA 4YFMA 4OVDA 4WYYA 5TFQA 3NDEA 2G2UA 2GDNA 2WK0A 1L0GA 3ZG5A 5JYPA 3BM6A 3W4PA 3NI9A 4OPYA 3O87A 5CXWA 1KE4A 1IKIA 3ZNTA 4L0LA 4U0TA 1IEMA 4FH4A 4O7DA 1LL5A 1NYMA 3IQAA 5GHYA 3MZFA 3PBTA 2HP5A 1MWSA 3TOIA 4GKUA 4E3LA 1BLPA 1GA9A 4OH0A 1FSWA 1PYYA 4D2OA 4RA7A 3BFDA 4XUXA 1YLZA 2ZQ8A 3N8SA 4HESA 1RGYA 4DDYA 3HL9A 1MBLA 2WGWA 3HLDA 4JF4A 3S1YA 4S2MA 4QY5A 3UDXA 3UN7A 1FOFA 2Y2HA 2PBYA 1CK3A 1BTLA 1BULA 1MXOA 4EWFA 3G2ZA 5FQQA 5IHVA 3ZG7B 1DJAA 5KSCA 1YLYA 3MKFA 1JVJA 5CHUA 1XXMA 3UO9A 1ZKJA 2Y2LA 4OKPA 1H5XA 1SDEA 2EX9A 3N6IA 4JXSA 3FV7A 3VOYA 1CI8A 2ZQ7A 5D3OA 2WZZA 2Y2OA 2J9OA 1QMFA 1IYPA 3OPHA 3S22A 4S2NA 2XD1A 2V2FF 1BUEA 2Y2PA 3VOZA 1ES2A 3V3RA 2PU4A 4WEJA 1RP5A 4NETA 1S0WA 4X53A 1MKIA 1BT5A 3BLSA 5FI6A 3ITAA 3Q81A 3Q7ZA 4NK3A 4OOLA 4JF6A 5FQKA 1W7FA 4MLLA 1HVBA 4XUZA 4OP8A 2FFYA 2DCFA 2Z2LB 4P6BA 1LLBA 3G32A 4WM9A 5HX9A 1K55C 4E3MA 1VM1A 2FFFB 1W8QA 5FQJA 4DE0A 4S2LA 4PMAA 5EECA 4S2KA 2C6WB 1KGEA 2ZC5B 3G4PA 1ERQA 3N7WA 2Y59A 1NXYA 3NC8A 4KZ9A 5CGSA 3OCLA 3MXSA 3UPPA 3VFFA 5DF9A 3CJMA 1O07A 4RVAA 1W5DA 2RCXA 3HREA 1DJCA 3RXXA 5GLAA 3NY4A 1LHYA 4S2NC 3DWKA 3N4IA 2QZ6A 4WZ5A 4Y7PA 1FCNA 1E4DA 3V39A 5U47A 3NCKA 4B4XA 2UWXA 3PBQA 5HAIA 4MBFA 2J9PA 4S2OA 1L2SA 1TDGA 4PM8A 2IWCA 2VGKA 1YM1A 4S2PA 1G6AA 2HP6A 3CZDA 3HLBA 5FAQA 3VFHA 3C4OA 1JWVA 5FAOA 2ZM0A 2Y2GA 4PM9A 5HAPA 1IYOA 1K6SA 1JWPA 1EWZA 1ALQA 4DRTA 1LI9A 4N9KA 3PBNA 4OLDA 4S2JA 5CEBA 1PIOA 3Q82A 4R3JA 3QNBA 3MBZA 1MWTA 3OCNA 2CC1A 1OMEA 3ZG8B 2JE5A 4K91A 5DF7A 5A91A 3V3SA 4PM5A 3VMAA 4F94A 4UA7A 3EQUA 2ZM2A 3GSGA 1W8YA 1K25A 3AGEA 4GOGA 4X68A 2C5WB 5TGFA 3IH8A 2WGWB 3IXGA 3Q1FA 4ZBEA 3IWOA 4EUZA 4IBXA 3A3DA 1KDSA 5E2HA 1IELA 4C6YA 1L0DA 5J8XA 5CRFA 3PBOA 1CI9A 4X6TA 4E3JA 2XF3A 4N1XA 3A3JA 4BLMA 3IF6B 2OLUA 5AQAA 4DXCA 1PZPA 2A3UA 4JBFA 4BENA 2WGVA 2ZQ9A 1LL9A 4FD8A 5FAPA 3SOIA 3WS2A 4ZTKA 2G2WA 2XK1A 3UE0A 5CGWA 3W4QA 2HDSA 4EQIA 1TVFA 1YLWA 2JBFA 2WADA 3LEZA 4KG2A 5FQIA 1BLSA 5L2FA 1Z6FA 3C7VA 3SH8A 3RXWA 1ONHA
chains in the Genus database with same CATH superfamily
3LY3A 3IS2A 1XPBA 4ZJ1A 1MY8A 3IT9A 1S4RA 4R6LA 5M19A 3GVBA 1ONGA 4Y5FA 3BW6A 3IF6A 4KQDA 3TSGA 3ZQ5A 2VJWA 2NUTC 3HLEA 4LLOB 2PR5A 3ISGA 4QB8A 2EWWA 2GNXA 2OAQ1 2ZJ9A 2WAEA 1U60A 3PBRA 1SKFA 2FZ0A 4X1MA 3TE8A 2JKRM 4Y0OA 2K2NA 1XGIA 4B4ZA 1N9BA 4EW7A 4LV0A 3Q07A 2V8CA 1BSGA 1RGZA 4FUWA 4E6WA 5EVLA 2JCHA 3DW0A 4GDBA 3A0RA 3OPRA 2QJ5A 3M6BA 4C75A 2Q0OA 3T1XA 3VSLA 1SDNA 1MPLA 4LCLA 4MN7A 4CPKA 4ZJ2A 1FSYA 3C4PA 4HY8A 4OPZA 4HBTA 3K2NA 3UB9A 2Z6DA 1DJBA 5AQ9A 4KZ8A 1UWNX 1L3LA 1G6OA 2QMIA 5HPFA 4Y0UA 4I3JA 4U0XA 2Z6CA 4OQGA 3SS4A 3P01A 1T1BA 2W3DA 3W8KA 3ZG9B 2PD8A 3BY8A 4JF5A 2W1RA 3VP4A 4K08A 3EGDC 3F1PB 4H8RA 4MN5A 2HPBA 2H0YA 3IBJA 1ZG4A 5A8BA 2WKIA 2HF6A 4JXWA 3ZVWA 3G35A 4DF6A 4EERA 4KG6A 1GA0A 1CQAA 1AWIA 1DP6A 1AXBA 2ZQAA 5KZHA 2EX6A 3BLMA 2XGNA 2IWDA 4EBLA 3UNWA 1A0KA 3F1PA 1VQQA 2XA7S 3MXRA 1FCMA 2OV5A 1GHPA 2XQZA 5DFXA 2ZLYA 1IYSA 4YWZA 1W63M 4RYEA 2Y2JA 4KENB 3VSKA 5GLCA 2J80A 1PI5A 4WMCA 4OPQA 1ESIA 2XFSA 1H3QA 2L4RA 2EFXA 1K55A 5GL9A 1Y4OA 1YQSA 3IF6C 3KX0X 3LFVA 1LI0A 5FEGA 3UPOA 5M18A 3CITA 3GMWA 3HLFA 4WELA 3CWFA 2VGLM 1UGUA 1OTEA 5CERA 5J4EA 3MJQA 4KZAA 5DTKA 1OTIA 2W27A 1Q2PA 4KZ7A 1PW8A 3UE3A 4PPRA 2W3EA 2DNSA 3E2KA 3O5YA 1OTDA 5E2FA 2WGIA 5CGXA 1K0KA 3E2LA 4QWOA 5K5BA 3EQVA 5HFOA 2E8IA 3JVUA 2VK3A 2PAVP 4EEPA 1DRMA 5FQMA 3IXHA 1IYQA 5E2GA 3LY4A 4BQMA 2VV6A 3DTEA 4EV4A 4I5SA 3GDIA 5GLBA 3CMZA 4E3OA 4FTXA 2OLVA 4WLAA 2VEAA 2PDRA 1YLTA 3D4FA 4WBGA 1L0EA 3A3FA 1NLYA 3BJNA 4FSFA 2ZC6B 3A3EA 2WKHA 3ZG5A 3T4SA 3W4PA 5CXWA 3R7WB 3NOUC 3IQAA 2L0WA 1MWSA 3TOIA 1T1AA 1BLPA 4E3LA 1FSWA 4HESA 1MBLA 2WGWA 4JF4A 3UDXA 4HNBA 1BULA 1MXOA 2XRNA 3G2ZA 5KSCA 1YLYA 1PRQA 2V9AA 5CHUA 2V0UA 3UO9A 1H5XA 4LPZA 3VOYA 1CI8A 2ZQ7A 5D3OA 3R7WA 4O0PA 2J9OA 1LSXA 3VOZA 2XD1A 1BUEA 3LIFA 5TBMB 2M7VA 1RP5A 2W1TB 3EEAA 1W7FA 4MLLA 1HVBA 4OP8A 1K55C 2CMNA 2ZBBA 4Y15A 3EOIA 5EECA 1KGEA 5IS1A 3LIBA 2ZC5B 3G4PA 2P04A 3N7WA 3NC8A 4KZ9A 3NOTC 1F2KA 2RCXA 2QWSA 3RXXA 1LHYA 3IX8A 3DWKA 2QZ6A 1XJ2A 3EEHA 2J9PA 5HZHA 1L2SA 4Y2FA 5TBMA 1YM1A 4PAUA 2HP6A 3HLBA 5AVFA 4GHIB 5CEBA 2OWHA 5EM1A 4R3JA 2V0WA 3OCNA 3V3SA 3VMAA 1OTAA 4UA7A 5DFYA 2BTFP 2ZM2A 3AGEA 1K25A 3VE4A 2C5WB 3Q1FA 4ZBEA 2WKPA 3A3DA 1WA9A 3PBOA 4X6TA 2OLUA 2V1AA 4GHIA 4UQIM 5L10A 4BENA 2WGVA 3SOIA 3WS2A 2G2WA 2XK1A 2HDSA 1YLWA 3BQAA 3ZYTA 2ZOIA 3E4OA 3SH8A 3RXWA 4LCMA 1G28A 5CX7A 4E3IA 4Y17A 4HJ6A 3UY6A 1K57A 4I39A 1TS7A 2OSUA 3ZCZA 4QU3A 1BLHA 4KQQA 2JN7A 3HUNA 3CPTB 2A2LA 3S7PA 5HPIA 5GLDA 3SH7A 1YSPA 3R4KA 1ES4A 4GLQA 5L09A 1KGGA 3QP8A 3DWZA 1VEUB 5KIZA 1FQGA 4EUVA 2FH5A 4NXBA 3PXPA 2Y79A 3HJKA 3T4JA 4OOMA 5AQ7A 3G31A 2BG1A 4LENA 4WEKA 2WYXA 3LI8A 1PW1A 3B33A 4CJNA 1VETB 3V5MA 4UHUA 3CPTA 4NXFA 1W79A 4L9EA 3SS5A 4OQ0A 5CECA 3WS5A 5TR7A 3E4QA 5HSQA 2PU2A 1S4SA 4N9LA 3B3XA 1PZOA 1HLUP 4DE2A 2H0TA 1SZVA 1FIKA 1VEUA 4IUHA 1L0FA 2VGLS 3MMHA 5FEFA 3IWQA 3AGFA 3H7WB 2ZC4B 2Z2MB 4QY6A 2R9WA 5E2EA 4M3KA 1K56A 1PFLA 1KDWA 1VETA 2XLNA 4ZAMA 4MMNA 2J7VA 3WS0A 3UDFA 3VP1A 5FSRA 5G4ZA 4MBKA 5G4YA 1BLCA 3HLWA 5DF8A 2B5RA 4X55A 3PAGA 1M6KA 3ZFZA 3OPLA 2NUPC 5IT5A 1XJ4A 3HCYA 5E43A 2Q9NA 3LO7A 3H7WA 4OLGA 3GQZA 4PKYA 2ZC3B 3OC2A 3IX4A 1TDLA 1E25A 1E3UA 2H28A 4BL2A 1SHVA 5F1GA 4GB7A 1V9ZA 1Z09A 3AGDA 2W3GA 2WKEA 1G68A 2J3WA 4M4XA 4O8GA 4CLCD 1PI4A 3PAEA 3FZCA 3ICYA 3HLCA 4PKYG 4DMZA 5EVID 1TS6A 3C7UA 1H8YA 4HI4A 2VLGA 3EWKA 3HUOA 3MQQA 2JKFA 4Y0TA 2PHYA 1WYCA 3BFCA 3FYZA 3BY9A 4N1HA 2Y4AA 5GHZA 1Q2QA 4IUKA 1K57C 1I2WA 4P0MA 2E8JA 1YT4A 2Y2MA 4ID4A 2EX2A 3MFDA 4OPRA 4GD8A 3LYXA 2P08A 3G30A 2ACGA 3P7NA 3VP2A 1UWPX 2EXAA 5FQ9A 3OLOA 3U2AA 4BD0A 1LSWA 3NIAA 3O88A 1CEFA 1I2SA 1J3WA 5HD3A 4PM6A 1K6RA 1PWDA 4HIAA 1TS8A 4KQOA 5F69A 2KDKA 4ZJ3A 4R4SA 3IHAA 5HAQA 2UV0E 1XA1A 2O9AA 5EVEA 4BJPA 1PWGA 3MSHA 5I94A 3LR0A 1YPRA 5I5LA 4BBTA 2AVXA 3N8RA 3IHBA 3TW8A 3MF0A 5EE8A 4EBNA 3W4OA 4GD6A 1GHMA 5EOEA 4E04A 2H10A 3GV9A 3M6HA 3DTIA 4KZ4A 4XXRA 4B9OA 3T4KA 4RX2A 1XX2A 2VZWA 2Y2IA 4L9GA 1GSXA 3MKEA 1OJGA 3KSIA 5HWVA 4MNRA 3IWIA 3C8CA 4NKPA 4ZDXA 1DY6A 4P87A 5A93A 2MJ6A 4MDZA 5TFQA 3OBFA 1L0GA 4ETXA 4OPYA 2V8FA 3O87A 1IKIA 1NLZA 1IEMA 1LL5A 2D01A 4JGQA 3UB5P 1GA9A 2HGVA 4ETZA 1PYYA 4UQIS 4D2OA 4RA7A 4XUXA 4BWIA 3MQ0A 4S2MA 3UN7A 1FOFA 1XFNA 1CK3A 4EWFA 4HQAA 5IHVA 3CUEC 1DJAA 1PNEA 3MKFA 3C38A 2EX9A 4JXSA 4PHTA 2WZZA 2Y2OA 4BBUA 1IYPA 3OPHA 3S22A 2V2FF 3V3RA 1W63Q 4NETA 1S0WA 4HOIA 3VE3A 4R70A 4OOLA 1N9LA 5FQKA 2DCFA 1LLBA 3G32A 4E3MA 2O9BA 2FFFB 1W8QA 4YOFA 3MXSA 5DF9A 4IHQA 1W5DA 4NXGA 4WL9A 4WZ5A 1FCNA 3HJIA 3NECA 1IOUA 2B02A 3NCKA 3PYPA 4DN0A 4B4XA 4GJ4A 2UWXA 5HAIA 4MBFA 4XT2B 4S2OA 2VGKA 1G6AA 3D3OA 3CZDA 1F9IA 5FAQA 5FAOA 2ZM0A 2Y2GA 4PM9A 5MC7A 1EWZA 1ALQA 4DRTA 3PBNA 4AFIA 3SW1A 1PIOA 1D7EA 5TJJA 3UB6A 2CC1A 1OMEA 2LB5A 4UEYA 3F1NB 3C30A 5DF7A 4PM5A 5EV0A 1GSVA 2M7UA 3QP4A 1W8YA 4X68A 4GOGA 1T18A 1GSWA 4XT2A 2WGWB 5HWWA 3U4LP 3VV4A 1S66L 5EFWA 5J8XA 1P9RA 4E3JA 4BLMA 4H6JB 1PZPA 2A3UA 4ZTKA 3UE0A 3E0YA 4EQIA 4F3LB 3LEZA 2HJEA 3F1NA 1JTDA 4ESPA 4IVKA 3CI6A 1SCWA 2HZ5A 3LR3A 5FATA 4WZ4A 3GTCA 4JXVA 2Y91A 1ZG6A 2JC7A 4H6JA 4A5RA 3HLGA 3DTKA 2QJ7A 3UDIA 4F3LA 3HUMA 1WYBA 3LCEA 3LIDA 1BZAA 4JGOA 1J9MA 4HP9A 3QHYA 3LI9A 3DTMA 3WS1A 4K0XA 2YKHA 4O01A 3K3CA 1KE0A 4PM7A 2K7SA 3A0VA 3T4QA 1M40A 1JTGA 1Y28A 2ZC7A 1GHIA 3UB8A 1K38A 4EESA 5HWTA 2P9VB 4R0QA 4G3KA 3TG9A 3ZGAB 2Y2KA 5DJTA 4JPMA 2XFTA 1ERMA 2PBDP 1EROA 2DRWA 5L8MA 1NZUA 1D1JA 3LICA 5HDSA 5DJUA 4CLCE 3CHWP 5EVIC 1N4OA 2HDUA 2P9VA 1YAXA 3SH9A 4KG5A 4ARZB 1NJ4A 3S7NA 4WZ5C 4R1GA 4EQ1A 3IH9A 4QHCA 4JGPA 5FASA 1I5QA 2PT7A 3QP6A 5L07A 4R23A 3ZNYA 1P0ZA 4X25A 4HEFA 3BECA 4X56A 3HVFA 3SS3A 3LEQA 2ZQCA 3M2KA 1S67L 3BFGA 5CTMA 5J3WA 4KQRA 3V67A 3WS4A 3GRJA 2HDRA 2I72A 3JYIA 1K4EA 2X71A 4IVIA 4ARZA 2WAFA 5JYOA 2XSSA 3D9YA 2OWJA 3WWXA 1RCJA 1QMEA 3QP5A 3VP3A 3RH8B 4R4RA 2ZM8A 4BBVA 3PR6A 3DBAA 1KVLA 2GX5A 4KUKA 3F1OB 4YINA 2W0NA 2XDMA 2P74A 4KZBA 4BD1A 5KSHA 2EFUA 3A3IA 2ZOHA 2JKTI 2IWBA 2HP9A 1C3BA 2BLSA 2PR6A 3G34A 1S6RA 2VKSA 4HP4A 5CHMA 4BMWA 1HD8A 2BASA 3CLOA 5HDCA 4QJGA 2I9VA 1GCEA 3BRMA 3FPVA 3F1OA 3KYEA 1FR6A 2PD7A 3TRCA 4GW9A 3RJUA 4QD4A 3PBSA 5F83A 2VGJA 3PTEA 4E3KA 4LGWA 1TS0A 3T1QB 3LIAA 4FOFA 1H8ZA 5FDSA 4LRZE 3QNCA 4UA6A 4LV2A 2INWA 4E3NA 4OQIA 4Z9QA 3T4OA 3ZVTA 3LIEA 1XA7A 3UB7A 4Q8IA 1ODVA 4OOYA 4DKIA 2W3FA 5HDDA 4R3AA 4KUOA 2Y2NA 2ZMAA 4OP5A 3BYDA 4KZ5A 4Z1WA 1EI5A 2EXBA 4HJ4A 5F6AA 4DDSA 4JGRA 4Y3IA 4EXOA 1NZOA 5DTTA 4MBHA 3MR0A 4WMCD 4MEZA 5M1AA 3I7JA 3KSHA 2HDQA 1NRFA 5EOOA 4X69A 4KZ3A 4B88A 1ESUA 3BFEA 4JLFA 4EBPA 1KE3A 2X02A 4YFMA 3T12B 4I3AA 4WYYA 2G2UA 2GDNA 2WK0A 5EM0A 3T4TA 3NI9A 3CUEA 4HHDA 3ZNTA 2PRFA 4U0TA 2J3TD 4FH4A 1NYMA 5GHYA 3MZFA 3D72A 4L9FA 3PBTA 2OAP1 2HP5A 3KYZA 4OH0A 3RTYA 3BFDA 1YLZA 2ZQ8A 3RFBA 2KLIA 3HL9A 3CAXA 3HLDA 3S1YA 3FC7A 2L1MA 5FQQA 4WN5A 1JVJA 1CJFA 2Y2LA 3H82B 3N6IA 3FV7A 1VHMA 2Y2PA 3TJZC 2PU4A 4WEJA 1MKIA 1BT5A 5FI6A 3ITAA 2FFYA 2Z2LB 4WM9A 4GCZA 3VOLA 4S2LA 3UE6A 1ZHHB 1NXYA 3OCLA 3CJMA 3H82A 2JHEA 5GLAA 3NY4A 4S2NC 4Y7PA 3V39A 3PBQA 1TDGA 2IWCA 4S2PA 1V9YA 3VFHA 3C4OA 1JWVA 5HAPA 1IYOA 1K6SA 1H0MA 1LI9A 4WF0A 2VV7A 2QKPA 1DP9A 4MN6A 3MBZA 2YKFA 1VB6A 2JE5A 4K91A 5A91A 3EQUA 3GSGA 3QP1A 5TGFA 3IH8A 4EUZA 3MQOA 1KDSA 2ZMFA 1IELA 5E2HA 1N9OA 1CI9A 2XF3A 4N1XA 3A3JA 3B42A 4DXCA 1T1CA 4JBFA 3EGXC 4ZRRA 4HJ3A 3S7OA 3UMEA 5CGWA 2WADA 2JKTM 3L9KA 4KG2A 1BLSA 3C7VA 2ZL1B 1ONHA 1XP4A 1MC0A 3P09A 1NWZA 3T50A 4EETB 4UAAA 3LR4A 5LBRA 2O0YA 3OZHA 3ZG0A 1YMXA 2ZD8A 4GDNA 4CLCB 1LSVA 2GJ3A 3BQ8A 3HBRA 4BL3A 5FI7A 4MCWA 1MWUA 5EVIB 2VV8A 3NHQA 4HH3A 3IF5A 4II7A 1XGJA 1K54A 3NDGA 2WUQA 3KYQA 5J7EA 3M2JA 2ZL1A 1HZOA 5AJGA 1KVMA 2EWVA 3ITBA 3KSFA 1MZUA 3ZHHA 5HL1A 1YLPA 4HH2A 4IEDA 4GN2A 1HTZA 3OOVA 4CLCA 2M1CA 1IFQA 3FKVA 1TEMA 4DE1A 5EVIA 4I38A 1JWZA 2B95A 1P9WA 4GNUA 1SKOB 1Y54A 3O3VA 4YNRA 2V1ZA 1H8MA 1T19A 2K31A 3ULFA 3O86A 4FH2A 5FDHA 1S1YA 5G18A 1ACFA 4DE3A 5IU1A 3PHYA 1KGFA 3CG5A 1CEGA 2ZQDA 4DXBA 3VP0A 3N8LA 1F98A 4HBUA 1N9NA 5CHJA 3H9WA 3MZDA 3A0SA 1SKOA 3UE1A 3NBLA 3Q7VB 3C5AA 1NRJA 3BFFA 3BWLA 3P98A 4S2IA 3E4PA 3W2ZA 2H5SA 1MWRA 2Y2QA 5FI2A 2QPNA 5EPHA 4JKTA 1XKZA 2QYBA 2XD5A 1ES5A 5AVEA 2VA0A 3KSGA 4U3TA 3V50A 2Q9MA 5DVAA 2XEPA 3FKWA 2V20A 1NYYA 4P6ZS 5HL6A 3T1SA 2EA9A 3T1RA 5CTNA 2PYPA 1CF0A 3Q7VA 3IX3A 3FPWA 5F1FA 1TD5A 4NEED 5C5KA 3G6OA 3SZTA 1NY0A 4OONA 4GZBA 1OJ5A 3LUQA 4E6XA 1O7EA 2Y55A 4OQHA 4KZ6A 5A90A 1TF1A 1OTBA 1IKGA 3MS6A 2O99A 4LRXC 3ZDJA 1LT0A 1YMSA 3IXDA 2EX8A 1OT6A 1S1ZA 3MFXA 5HD5A 1K56D 4JXGA 1YKDA 2VX8A 4IBRA 2R9XA 2QHKA 3NULA 2LB9A 5A92A 2V1BA 3G2YA 1ZTUA 4CQHA 4DJ2A 2P7JA 2XROA 1K54C 4K0WA 2IA2A 3S4XA 2XH9A 3WRTA 1K4FA 5AQBA 3GR2A 3LGOA 2JKRI 4N92A 4CLCC 4B93A 3UPNA 2HJ9C 1E3UD 4P85A 3L7HA 3E98A 2DMWA 4LFUA 4LV1A 5CEDA 1D06A 2Y8HA 2J8YA 1G5UA 1EW0A 4ME4A 2X01A 2J3TC 4UA9A 4X1LA 3FWLA 5FL3A 5F68A 4FCFA 1ZC2A 3LR5A 5HARA 1ES3A 2RL3A 2W1TA 1X0OA 2ZMVA 5GHXA 4C3QA 1PWCA 4WUJA 1YLJA 3OPPA 2WZXA 5FA7A 4RX3A 4LV3A 4D60A 5BOHA 4R38A 3IXBA 5DTSA 3MZEA 2A49A 1P97A 5F82A 5EUAA 4R3BA 1WE4A 5HW3A 3K3DA 3WRZA 1FCOA 2XR0A 1BYWA 1FR1A 2XA7M 4GS9B 5KMWA 4LRYC 3BEBA 4OVDA 3NDEA 3KO6A 4Q0HA 5JYPA 3BM6A 1KE4A 4L0LA 4O7DA 2KX6A 3NOPC 4GKUA 1FILA 4G3WA 2A24B 2JKGA 4Q0JA 3N8SA 4NXEA 1RGYA 4DDYA 4G3VA 4I3IA 4QY5A 2Y2HA 3FG8A 2PBYA 1BTLA 4GS9A 3QP2A 3ZG7B 1XXMA 1ZKJA 4OKPA 1SDEA 1QMFA 4QPRA 4DJ3A 2PYRA 1YSQA 4S2NA 1ES2A 4X53A 2A24A 3BLSA 1LL8A 3Q81A 3Q7ZA 4NK3A 4JF6A 4XUZA 5HX9A 4P6BA 1VM1A 5FQJA 4DE0A 2O9CA 2WKRA 4PMAA 4S2KA 2C6WB 1ERQA 2B18A 2Y59A 5CGSA 1JNUA 3DAVA 3UPPA 3VFFA 1O07A 4RVAA 4Y13A 3HREA 1DJCA 1MKMA 3N4IA 1E4DA 2G7UA 5U47A 2D02A 4EEUA 1XFQA 3C2WA 4PM8A 1JWPA 4RQ9A 4N9KA 4OLDA 4S2JA 3B47A 3Q82A 1KOUA 3QNBA 4P6ZM 5F5YA 1MWTA 2W3HA 1XJ3A 3NJAA 1STZA 3ZG8B 4IJGA 4F94A 1OT9A 2GZAA 3IS2B 3MXQA 1XJ6A 2WKQA 3IXGA 3IWOA 4IBXA 2OOLA 1OPXA 4C6YA 5DKKA 1L0DA 1F5MA 5CRFA 2R78A 3UMDA 3JVVA 3IF6B 4EU0A 3JPUA 5AQAA 2HV1A 2ZQ9A 5DKLA 1LL9A 2KOIA 4FD8A 5FAPA 3IBRA 3GECA 1DP8A 3W4QA 3S7QA 4NG2A 1TVFA 2JBFA 4Q0IA 3T4LA 5FQIA 5L2FA 1Z6FA
chains in the Genus database with same CATH topology
1JTDA 4LCMA 1XP4A 4E3IA 3LY3A 4IVKA 1XPBA 3P09A 4ZJ1A 1SCWA 3UY6A 4UAAA 1K57A 1MY8A 5FATA 3OZHA 3ZG0A 4WZ4A 3IT9A 1YMXA 2ZD8A 4GDNA 3GTCA 4JXVA 2OSUA 2Y91A 3HBRA 3ZCZA 5M19A 4BL3A 4QU3A 1ZG6A 1BLHA 5FI7A 3GVBA 1ONGA 4KQQA 3IF6A 1MWUA 3HUNA 2JC7A 3TSGA 5EVIB 4A5RA 3HLGA 3HLEA 3ISGA 3IF5A 4QB8A 3UDIA 5GLDA 3HUMA 3SH7A 1XGJA 1ES4A 1WYBA 2ZJ9A 2WAEA 1KGGA 1U60A 3LCEA 1K54A 3NDGA 2WUQA 3PBRA 1BZAA 1J9MA 1SKFA 3M2JA 3DWZA 3QHYA 1HZOA 3DTMA 1KVMA 3ITBA 3WS1A 4K0XA 1FQGA 3ZHHA 4Y0OA 5HL1A 1YLPA 1KE0A 4IEDA 4GN2A 1HTZA 4PM7A 4OOMA 1XGIA 5AQ7A 3G31A 4B4ZA 1N9BA 2BG1A 4LENA 4WEKA 1M40A 4LV0A 1JTGA 2WYXA 2ZC7A 1GHIA 1BSGA 1K38A 1RGZA 3Q07A 4E6WA 1PW1A 2P9VB 4CJNA 4R0QA 5EVLA 3FKVA 1TEMA 3V5MA 4UHUA 2JCHA 3DW0A 4DE1A 4GDBA 3TG9A 5EVIA 1W79A 3OPRA 3ZGAB 3SS5A 4OQ0A 2Y2KA 5CECA 1JWZA 5TR7A 3WS5A 4JPMA 3M6BA 2PU2A 4C75A 3VSLA 4GNUA 1SDNA 4N9LA 1Y54A 1MPLA 3B3XA 4LCLA 1PZOA 3O3VA 2V1ZA 4CPKA 2XFTA 4DE2A 2H0TA 1ERMA 4ZJ2A 1L0FA 1FSYA 3O86A 3C4PA 4FH2A 5FDHA 4OPZA 4HBTA 1EROA 3IWQA 1DJBA 5G18A 3AGFA 5AQ9A 2DRWA 4KZ8A 1NZUA 2ZC4B 2Z2MB 4DE3A 4QY6A 2R9WA 5E2EA 4M3KA 5EVIC 1N4OA 1KGFA 3CG5A 1K56A 1CEGA 2QMIA 2ZQDA 2HDUA 2P9VA 1KDWA 3SH9A 4DXBA 2XLNA 4ZAMA 3VP0A 3N8LA 2J7VA 4KG5A 4Y0UA 1NJ4A 3WS0A 3UDFA 4U0XA 4HBUA 3VP1A 4WZ5C 5FSRA 4OQGA 4R1GA 3SS4A 5CHJA 3IH9A 3MZDA 4QHCA 4MBKA 5FASA 1I5QA 3W8KA 3UE1A 1BLCA 3HLWA 3NBLA 5DF8A 3ZG9B 2B5RA 3Q7VB 3PAGA 4X55A 3C5AA 3BFFA 3P98A 4R23A 3ZNYA 4S2IA 4JF5A 1M6KA 4HEFA 3BECA 4X56A 3ZFZA 3OPLA 2H5SA 3HVFA 5E43A 2Q9NA 3SS3A 3VP4A 1MWRA 2Y2QA 2ZQCA 3LO7A 5FI2A 2QPNA 5EPHA 3M2KA 4JKTA 1XKZA 4OLGA 3BFGA 3GQZA 2XD5A 5CTMA 1ES5A 4H8RA 4KQRA 2ZC3B 4U3TA 3OC2A 3WS4A 3GRJA 1TDLA 3V50A 1E25A 1E3UA 2HDRA 2HPBA 2I72A 3JYIA 4BL2A 2Q9MA 5DVAA 1K4EA 2X71A 4IVIA 2H0YA 2XEPA 3FKWA 1SHVA 2WAFA 1ZG4A 5JYOA 5F1GA 4GB7A 2V20A 2WKIA 3AGDA 1NYYA 3WWXA 1RCJA 2WKEA 4JXWA 1QMEA 1G68A 3VP3A 3G35A 3ZVWA 4DF6A 1PI4A 3PAEA 5CTNA 3FZCA 4R4RA 3Q7VA 4KG6A 1GA0A 3HLCA 5F1FA 2ZM8A 1AXBA 5EVID 1NY0A 3C7UA 4OONA 1H8YA 2ZQAA 4GZBA 5KZHA 2EX6A 3BLMA 2XGNA 2IWDA 4EBLA 3UNWA 4E6XA 1KVLA 1O7EA 1VQQA 2Y55A 4YINA 4BD1A 2XDMA 2P74A 3HUOA 3MXRA 1FCMA 4KZBA 4OQHA 2OV5A 4Y0TA 4KZ6A 5A90A 5KSHA 1GHPA 1WYCA 3BFCA 3FYZA 2EFUA 3A3IA 2XQZA 4N1HA 2Y4AA 1IKGA 2ZLYA 2IWBA 2HP9A 1C3BA 3ZDJA 5GHZA 2BLSA 1Q2QA 1K57C 1I2WA 1IYSA 1YMSA 3IXDA 4P0MA 3G34A 1S6RA 2EX8A 4RYEA 2Y2JA 4KENB 3VSKA 1YT4A 2Y2MA 1PI5A 4ID4A 4WMCA 5GLCA 4OPQA 1ESIA 2EX2A 2XFSA 1K56D 3MFDA 4JXGA 4GD8A 4OPRA 2EFXA 1K55A 5CHMA 4IBRA 5GL9A 2R9XA 3G30A 1YQSA 3IF6C 1LI0A 1HD8A 3UPOA 3VP2A 5M18A 3GMWA 5A92A 4QJGA 3HLFA 2EXAA 4WELA 5FQ9A 1GCEA 4BD0A 3BRMA 3G2YA 5CERA 1FR6A 4KZAA 1K54C 5DTKA 3NIAA 3O88A 1Q2PA 4K0WA 1CEFA 3RJUA 4KZ7A 1PW8A 3UE3A 1I2SA 4PPRA 3S4XA 2DNSA 3E2KA 4QD4A 2XH9A 3PBSA 4PM6A 5F83A 1K6RA 1PWDA 1K4FA 2VGJA 3PTEA 3WRTA 4E3KA 5AQBA 3GR2A 4KQOA 5E2FA 2WGIA 4ZJ3A 4R4SA 5CGXA 3IHAA 5HAQA 4N92A 3UPNA 1E3UD 4P85A 3E2LA 1XA1A 3EQVA 4LV1A 5CEDA 4BJPA 1H8ZA 3QNCA 1PWGA 4LV2A 4UA6A 2J8YA 5HFOA 2E8IA 4E3NA 4OQIA 4Z9QA 3ZVTA 1XA7A 5FQMA 5I94A 2X01A 4Q8IA 4UA9A 3IXHA 3FWLA 1IYQA 3N8RA 5E2GA 4OOYA 4FCFA 4DKIA 3LY4A 4BQMA 1ZC2A 3IHBA 5HARA 4EV4A 1ES3A 2RL3A 5EE8A 4EBNA 5GLBA 3W4OA 5GHXA 4GD6A 1GHMA 2Y2NA 3CMZA 5EOEA 2ZMAA 4C3QA 4OP5A 1PWCA 2H10A 1YLJA 3GV9A 3BYDA 3M6HA 4KZ5A 4E3OA 3OPPA 4KZ4A 2WZXA 4XXRA 1EI5A 5FA7A 4RX2A 2OLVA 4LV3A 4RX3A 5BOHA 1XX2A 2EXBA 2Y2IA 4DDSA 3IXBA 5DTSA 3MZEA 2A49A 1NZOA 5F82A 5DTTA 4MBHA 3MKEA 5EUAA 4R3BA 1WE4A 5HW3A 1YLTA 3WRZA 4WMCD 1FCOA 4MNRA 3IWIA 2XR0A 3D4FA 4MEZA 5M1AA 3I7JA 4WBGA 2HDQA 4ZDXA 1NRFA 1DY6A 1L0EA 1FR1A 4X69A 3A3FA 4P87A 5EOOA 4KZ3A 4B88A 4FSFA 1ESUA 3BFEA 5A93A 5KMWA 4JLFA 4EBPA 2ZC6B 1KE3A 2X02A 3A3EA 3BEBA 2WKHA 4YFMA 4OVDA 4WYYA 5TFQA 3NDEA 2G2UA 2GDNA 2WK0A 1L0GA 3ZG5A 5JYPA 3BM6A 3W4PA 3NI9A 4OPYA 3O87A 5CXWA 1KE4A 1IKIA 3ZNTA 4L0LA 4U0TA 1IEMA 4FH4A 4O7DA 1LL5A 1NYMA 3IQAA 5GHYA 3MZFA 3PBTA 2HP5A 1MWSA 3TOIA 4GKUA 4E3LA 1BLPA 1GA9A 4OH0A 1FSWA 1PYYA 4D2OA 4RA7A 3BFDA 4XUXA 1YLZA 2ZQ8A 3N8SA 4HESA 1RGYA 4DDYA 3HL9A 1MBLA 2WGWA 3HLDA 4JF4A 3S1YA 4S2MA 4QY5A 3UDXA 3UN7A 1FOFA 2Y2HA 2PBYA 1CK3A 1BTLA 1BULA 1MXOA 4EWFA 3G2ZA 5FQQA 5IHVA 3ZG7B 1DJAA 5KSCA 1YLYA 3MKFA 1JVJA 5CHUA 1XXMA 3UO9A 1ZKJA 2Y2LA 4OKPA 1H5XA 1SDEA 2EX9A 3N6IA 4JXSA 3FV7A 3VOYA 1CI8A 2ZQ7A 5D3OA 2WZZA 2Y2OA 2J9OA 1QMFA 1IYPA 3OPHA 3S22A 4S2NA 2XD1A 2V2FF 1BUEA 2Y2PA 3VOZA 1ES2A 3V3RA 2PU4A 4WEJA 1RP5A 4NETA 1S0WA 4X53A 1MKIA 1BT5A 3BLSA 5FI6A 3ITAA 3Q81A 3Q7ZA 4NK3A 4OOLA 4JF6A 5FQKA 1W7FA 4MLLA 1HVBA 4XUZA 4OP8A 2FFYA 2DCFA 2Z2LB 4P6BA 1LLBA 3G32A 4WM9A 5HX9A 1K55C 4E3MA 1VM1A 2FFFB 1W8QA 5FQJA 4DE0A 4S2LA 4PMAA 5EECA 4S2KA 2C6WB 1KGEA 2ZC5B 3G4PA 1ERQA 3N7WA 2Y59A 1NXYA 3NC8A 4KZ9A 5CGSA 3OCLA 3MXSA 3UPPA 3VFFA 5DF9A 3CJMA 1O07A 4RVAA 1W5DA 2RCXA 3HREA 1DJCA 3RXXA 5GLAA 3NY4A 1LHYA 4S2NC 3DWKA 3N4IA 2QZ6A 4WZ5A 4Y7PA 1FCNA 1E4DA 3V39A 5U47A 3NCKA 4B4XA 2UWXA 3PBQA 5HAIA 4MBFA 2J9PA 4S2OA 1L2SA 1TDGA 4PM8A 2IWCA 2VGKA 1YM1A 4S2PA 1G6AA 2HP6A 3CZDA 3HLBA 5FAQA 3VFHA 3C4OA 1JWVA 5FAOA 2ZM0A 2Y2GA 4PM9A 5HAPA 1IYOA 1K6SA 1JWPA 1EWZA 1ALQA 4DRTA 1LI9A 4N9KA 3PBNA 4OLDA 4S2JA 5CEBA 1PIOA 3Q82A 4R3JA 3QNBA 3MBZA 1MWTA 3OCNA 2CC1A 1OMEA 3ZG8B 2JE5A 4K91A 5DF7A 5A91A 3V3SA 4PM5A 3VMAA 4F94A 4UA7A 3EQUA 2ZM2A 3GSGA 1W8YA 1K25A 3AGEA 4GOGA 4X68A 2C5WB 5TGFA 3IH8A 2WGWB 3IXGA 3Q1FA 4ZBEA 3IWOA 4EUZA 4IBXA 3A3DA 1KDSA 5E2HA 1IELA 4C6YA 1L0DA 5J8XA 5CRFA 3PBOA 1CI9A 4X6TA 4E3JA 2XF3A 4N1XA 3A3JA 4BLMA 3IF6B 2OLUA 5AQAA 4DXCA 1PZPA 2A3UA 4JBFA 4BENA 2WGVA 2ZQ9A 1LL9A 4FD8A 5FAPA 3SOIA 3WS2A 4ZTKA 2G2WA 2XK1A 3UE0A 5CGWA 3W4QA 2HDSA 4EQIA 1TVFA 1YLWA 2JBFA 2WADA 3LEZA 4KG2A 5FQIA 1BLSA 5L2FA 1Z6FA 3C7VA 3SH8A 3RXWA 1ONHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JTD A;  4LCM A;  1XP4 A;  4E3I A;  3LY3 A;  4IVK A;  1XPB A;  3P09 A;  4ZJ1 A;  1SCW A;  3UY6 A;  4UAA A;  1K57 A;  1MY8 A;  5FAT A;  3OZH A;  3ZG0 A;  4WZ4 A;  3IT9 A;  1YMX A;  2ZD8 A;  4GDN A;  3GTC A;  4JXV A;  2OSU A;  2Y91 A;  3HBR A;  3ZCZ A;  5M19 A;  4BL3 A;  4QU3 A;  1ZG6 A;  1BLH A;  5FI7 A;  3GVB A;  1ONG A;  4KQQ A;  3IF6 A;  1MWU A;  3HUN A;  2JC7 A;  3TSG A;  5EVI B;  4A5R A;  3HLG A;  3HLE A;  3ISG A;  3IF5 A;  4QB8 A;  3UDI A;  5GLD A;  3HUM A;  3SH7 A;  1XGJ A;  1ES4 A;  1WYB A;  2ZJ9 A;  2WAE A;  1KGG A;  1U60 A;  3LCE A;  1K54 A;  3NDG A;  2WUQ A;  3PBR A;  1BZA A;  1J9M A;  1SKF A;  3M2J A;  3DWZ A;  3QHY A;  1HZO A;  3DTM A;  1KVM A;  3ITB A;  3WS1 A;  4K0X A;  1FQG A;  3ZHH A;  4Y0O A;  5HL1 A;  1YLP A;  1KE0 A;  4IED A;  4GN2 A;  1HTZ A;  4PM7 A;  4OOM A;  1XGI A;  5AQ7 A;  3G31 A;  4B4Z A;  1N9B A;  2BG1 A;  4LEN A;  4WEK A;  1M40 A;  4LV0 A;  1JTG A;  2WYX A;  2ZC7 A;  1GHI A;  1BSG A;  1K38 A;  1RGZ A;  3Q07 A;  4E6W A;  1PW1 A;  2P9V B;  4CJN A;  4R0Q A;  5EVL A;  3FKV A;  1TEM A;  3V5M A;  4UHU A;  2JCH A;  3DW0 A;  4DE1 A;  4GDB A;  3TG9 A;  5EVI A;  1W79 A;  3OPR A;  3ZGA B;  3SS5 A;  4OQ0 A;  2Y2K A;  5CEC A;  1JWZ A;  5TR7 A;  3WS5 A;  4JPM A;  3M6B A;  2PU2 A;  4C75 A;  3VSL A;  4GNU A;  1SDN A;  4N9L A;  1Y54 A;  1MPL A;  3B3X A;  4LCL A;  1PZO A;  3O3V A;  2V1Z A;  4CPK A;  2XFT A;  4DE2 A;  2H0T A;  1ERM A;  4ZJ2 A;  1L0F A;  1FSY A;  3O86 A;  3C4P A;  4FH2 A;  5FDH A;  4OPZ A;  4HBT A;  1ERO A;  3IWQ A;  1DJB A;  5G18 A;  3AGF A;  5AQ9 A;  2DRW A;  4KZ8 A;  1NZU A;  2ZC4 B;  2Z2M B;  4DE3 A;  4QY6 A;  2R9W A;  5E2E A;  4M3K A;  5EVI C;  1N4O A;  1KGF A;  3CG5 A;  1K56 A;  1CEG A;  2QMI A;  2ZQD A;  2HDU A;  2P9V A;  1KDW A;  3SH9 A;  4DXB A;  2XLN A;  4ZAM A;  3VP0 A;  3N8L A;  2J7V A;  4KG5 A;  4Y0U A;  1NJ4 A;  3WS0 A;  3UDF A;  4U0X A;  4HBU A;  3VP1 A;  4WZ5 C;  5FSR A;  4OQG A;  4R1G A;  3SS4 A;  5CHJ A;  3IH9 A;  3MZD A;  4QHC A;  4MBK A;  5FAS A;  1I5Q A;  3W8K A;  3UE1 A;  1BLC A;  3HLW A;  3NBL A;  5DF8 A;  3ZG9 B;  2B5R A;  3Q7V B;  3PAG A;  4X55 A;  3C5A A;  3BFF A;  3P98 A;  4R23 A;  3ZNY A;  4S2I A;  4JF5 A;  1M6K A;  4HEF A;  3BEC A;  4X56 A;  3ZFZ A;  3OPL A;  2H5S A;  3HVF A;  5E43 A;  2Q9N A;  3SS3 A;  3VP4 A;  1MWR A;  2Y2Q A;  2ZQC A;  3LO7 A;  5FI2 A;  2QPN A;  5EPH A;  3M2K A;  4JKT A;  1XKZ A;  4OLG A;  3BFG A;  3GQZ A;  2XD5 A;  5CTM A;  1ES5 A;  4H8R A;  4KQR A;  2ZC3 B;  4U3T A;  3OC2 A;  3WS4 A;  3GRJ A;  1TDL A;  3V50 A;  1E25 A;  1E3U A;  2HDR A;  2HPB A;  2I72 A;  3JYI A;  4BL2 A;  2Q9M A;  5DVA A;  1K4E A;  2X71 A;  4IVI A;  2H0Y A;  2XEP A;  3FKW A;  1SHV A;  2WAF A;  1ZG4 A;  5JYO A;  5F1G A;  4GB7 A;  2V20 A;  2WKI A;  3AGD A;  1NYY A;  3WWX A;  1RCJ A;  2WKE A;  4JXW A;  1QME A;  1G68 A;  3VP3 A;  3G35 A;  3ZVW A;  4DF6 A;  1PI4 A;  3PAE A;  5CTN A;  3FZC A;  4R4R A;  3Q7V A;  4KG6 A;  1GA0 A;  3HLC A;  5F1F A;  2ZM8 A;  1AXB A;  5EVI D;  1NY0 A;  3C7U A;  4OON A;  1H8Y A;  2ZQA A;  4GZB A;  5KZH A;  2EX6 A;  3BLM A;  2XGN A;  2IWD A;  4EBL A;  3UNW A;  4E6X A;  1KVL A;  1O7E A;  1VQQ A;  2Y55 A;  4YIN A;  4BD1 A;  2XDM A;  2P74 A;  3HUO A;  3MXR A;  1FCM A;  4KZB A;  4OQH A;  2OV5 A;  4Y0T A;  4KZ6 A;  5A90 A;  5KSH A;  1GHP A;  1WYC A;  3BFC A;  3FYZ A;  2EFU A;  3A3I A;  2XQZ A;  4N1H A;  2Y4A A;  1IKG A;  2ZLY A;  2IWB A;  2HP9 A;  1C3B A;  3ZDJ A;  5GHZ A;  2BLS A;  1Q2Q A;  1K57 C;  1I2W A;  1IYS A;  1YMS A;  3IXD A;  4P0M A;  3G34 A;  1S6R A;  2EX8 A;  4RYE A;  2Y2J A;  4KEN B;  3VSK A;  1YT4 A;  2Y2M A;  1PI5 A;  4ID4 A;  4WMC A;  5GLC A;  4OPQ A;  1ESI A;  2EX2 A;  2XFS A;  1K56 D;  3MFD A;  4JXG A;  4GD8 A;  4OPR A;  2EFX A;  1K55 A;  5CHM A;  4IBR A;  5GL9 A;  2R9X A;  3G30 A;  1YQS A;  3IF6 C;  1LI0 A;  1HD8 A;  3UPO A;  3VP2 A;  5M18 A;  3GMW A;  5A92 A;  4QJG A;  3HLF A;  2EXA A;  4WEL A;  5FQ9 A;  1GCE A;  4BD0 A;  3BRM A;  3G2Y A;  5CER A;  1FR6 A;  4KZA A;  1K54 C;  5DTK A;  3NIA A;  3O88 A;  1Q2P A;  4K0W A;  1CEF A;  3RJU A;  4KZ7 A;  1PW8 A;  3UE3 A;  1I2S A;  4PPR A;  3S4X A;  2DNS A;  3E2K A;  4QD4 A;  2XH9 A;  3PBS A;  4PM6 A;  5F83 A;  1K6R A;  1PWD A;  1K4F A;  2VGJ A;  3PTE A;  3WRT A;  4E3K A;  5AQB A;  3GR2 A;  4KQO A;  5E2F A;  2WGI A;  4ZJ3 A;  4R4S A;  5CGX A;  3IHA A;  5HAQ A;  4N92 A;  3UPN A;  1E3U D;  4P85 A;  3E2L A;  1XA1 A;  3EQV A;  4LV1 A;  5CED A;  4BJP A;  1H8Z A;  3QNC A;  1PWG A;  4LV2 A;  4UA6 A;  2J8Y A;  5HFO A;  2E8I A;  4E3N A;  4OQI A;  4Z9Q A;  3ZVT A;  1XA7 A;  5FQM A;  5I94 A;  2X01 A;  4Q8I A;  4UA9 A;  3IXH A;  3FWL A;  1IYQ A;  3N8R A;  5E2G A;  4OOY A;  4FCF A;  4DKI A;  3LY4 A;  4BQM A;  1ZC2 A;  3IHB A;  5HAR A;  4EV4 A;  1ES3 A;  2RL3 A;  5EE8 A;  4EBN A;  5GLB A;  3W4O A;  5GHX A;  4GD6 A;  1GHM A;  2Y2N A;  3CMZ A;  5EOE A;  2ZMA A;  4C3Q A;  4OP5 A;  1PWC A;  2H10 A;  1YLJ A;  3GV9 A;  3BYD A;  3M6H A;  4KZ5 A;  4E3O A;  3OPP A;  4KZ4 A;  2WZX A;  4XXR A;  1EI5 A;  5FA7 A;  4RX2 A;  2OLV A;  4LV3 A;  4RX3 A;  5BOH A;  1XX2 A;  2EXB A;  2Y2I A;  4DDS A;  3IXB A;  5DTS A;  3MZE A;  2A49 A;  1NZO A;  5F82 A;  5DTT A;  4MBH A;  3MKE A;  5EUA A;  4R3B A;  1WE4 A;  5HW3 A;  1YLT A;  3WRZ A;  4WMC D;  1FCO A;  4MNR A;  3IWI A;  2XR0 A;  3D4F A;  4MEZ A;  5M1A A;  3I7J A;  4WBG A;  2HDQ A;  4ZDX A;  1NRF A;  1DY6 A;  1L0E A;  1FR1 A;  4X69 A;  3A3F A;  4P87 A;  5EOO A;  4KZ3 A;  4B88 A;  4FSF A;  1ESU A;  3BFE A;  5A93 A;  5KMW A;  4JLF A;  4EBP A;  2ZC6 B;  1KE3 A;  2X02 A;  3A3E A;  3BEB A;  2WKH A;  4YFM A;  4OVD A;  4WYY A;  5TFQ A;  3NDE A;  2G2U A;  2GDN A;  2WK0 A;  1L0G A;  3ZG5 A;  5JYP A;  3BM6 A;  3W4P A;  3NI9 A;  4OPY A;  3O87 A;  5CXW A;  1KE4 A;  1IKI A;  3ZNT A;  4L0L A;  4U0T A;  1IEM A;  4FH4 A;  4O7D A;  1LL5 A;  1NYM A;  3IQA A;  5GHY A;  3MZF A;  3PBT A;  2HP5 A;  1MWS A;  3TOI A;  4GKU A;  4E3L A;  1BLP A;  1GA9 A;  4OH0 A;  1FSW A;  1PYY A;  4D2O A;  4RA7 A;  3BFD A;  4XUX A;  1YLZ A;  2ZQ8 A;  3N8S A;  4HES A;  1RGY A;  4DDY A;  3HL9 A;  1MBL A;  2WGW A;  3HLD A;  4JF4 A;  3S1Y A;  4S2M A;  4QY5 A;  3UDX A;  3UN7 A;  1FOF A;  2Y2H A;  2PBY A;  1CK3 A;  1BTL A;  1BUL A;  1MXO A;  4EWF A;  3G2Z A;  5FQQ A;  5IHV A;  3ZG7 B;  1DJA A;  5KSC A;  1YLY A;  3MKF A;  1JVJ A;  5CHU A;  1XXM A;  3UO9 A;  1ZKJ A;  2Y2L A;  4OKP A;  1H5X A;  1SDE A;  2EX9 A;  3N6I A;  4JXS A;  3FV7 A;  3VOY A;  1CI8 A;  2ZQ7 A;  5D3O A;  2WZZ A;  2Y2O A;  2J9O A;  1QMF A;  1IYP A;  3OPH A;  3S22 A;  4S2N A;  2XD1 A;  2V2F F;  1BUE A;  2Y2P A;  3VOZ A;  1ES2 A;  3V3R A;  2PU4 A;  4WEJ A;  1RP5 A;  4NET A;  1S0W A;  4X53 A;  1MKI A;  1BT5 A;  3BLS A;  5FI6 A;  3ITA A;  3Q81 A;  3Q7Z A;  4NK3 A;  4OOL A;  4JF6 A;  5FQK A;  1W7F A;  4MLL A;  1HVB A;  4XUZ A;  4OP8 A;  2FFY A;  2DCF A;  2Z2L B;  4P6B A;  1LLB A;  3G32 A;  4WM9 A;  5HX9 A;  1K55 C;  4E3M A;  1VM1 A;  2FFF B;  1W8Q A;  5FQJ A;  4DE0 A;  4S2L A;  4PMA A;  5EEC A;  4S2K A;  2C6W B;  1KGE A;  2ZC5 B;  3G4P A;  1ERQ A;  3N7W A;  2Y59 A;  1NXY A;  3NC8 A;  4KZ9 A;  5CGS A;  3OCL A;  3MXS A;  3UPP A;  3VFF A;  5DF9 A;  3CJM A;  1O07 A;  4RVA A;  1W5D A;  2RCX A;  3HRE A;  1DJC A;  3RXX A;  5GLA A;  3NY4 A;  1LHY A;  4S2N C;  3DWK A;  3N4I A;  2QZ6 A;  4WZ5 A;  4Y7P A;  1FCN A;  1E4D A;  3V39 A;  5U47 A;  3NCK A;  4B4X A;  2UWX A;  3PBQ A;  5HAI A;  4MBF A;  2J9P A;  4S2O A;  1L2S A;  1TDG A;  4PM8 A;  2IWC A;  2VGK A;  1YM1 A;  4S2P A;  1G6A A;  2HP6 A;  3CZD A;  3HLB A;  5FAQ A;  3VFH A;  3C4O A;  1JWV A;  5FAO A;  2ZM0 A;  2Y2G A;  4PM9 A;  5HAP A;  1IYO A;  1K6S A;  1JWP A;  1EWZ A;  1ALQ A;  4DRT A;  1LI9 A;  4N9K A;  3PBN A;  4OLD A;  4S2J A;  5CEB A;  1PIO A;  3Q82 A;  4R3J A;  3QNB A;  3MBZ A;  1MWT A;  3OCN A;  2CC1 A;  1OME A;  3ZG8 B;  2JE5 A;  4K91 A;  5DF7 A;  5A91 A;  3V3S A;  4PM5 A;  3VMA A;  4F94 A;  4UA7 A;  3EQU A;  2ZM2 A;  3GSG A;  1W8Y A;  1K25 A;  3AGE A;  4GOG A;  4X68 A;  2C5W B;  5TGF A;  3IH8 A;  2WGW B;  3IXG A;  3Q1F A;  4ZBE A;  3IWO A;  4EUZ A;  4IBX A;  3A3D A;  1KDS A;  5E2H A;  1IEL A;  4C6Y A;  1L0D A;  5J8X A;  5CRF A;  3PBO A;  1CI9 A;  4X6T A;  4E3J A;  2XF3 A;  4N1X A;  3A3J A;  4BLM A;  3IF6 B;  2OLU A;  5AQA A;  4DXC A;  1PZP A;  2A3U A;  4JBF A;  4BEN A;  2WGV A;  2ZQ9 A;  1LL9 A;  4FD8 A;  5FAP A;  3SOI A;  3WS2 A;  4ZTK A;  2G2W A;  2XK1 A;  3UE0 A;  5CGW A;  3W4Q A;  2HDS A;  4EQI A;  1TVF A;  1YLW A;  2JBF A;  2WAD A;  3LEZ A;  4KG2 A;  5FQI A;  1BLS A;  5L2F A;  1Z6F A;  3C7V A;  3SH8 A;  3RXW A;  1ONH A; 
#chains in the Genus database with same CATH topology
 3LY3 A;  3IS2 A;  1XPB A;  4ZJ1 A;  1MY8 A;  3IT9 A;  1S4R A;  4R6L A;  5M19 A;  3GVB A;  1ONG A;  4Y5F A;  3BW6 A;  3IF6 A;  4KQD A;  3TSG A;  3ZQ5 A;  2VJW A;  2NUT C;  3HLE A;  4LLO B;  2PR5 A;  3ISG A;  4QB8 A;  2EWW A;  2GNX A;  2OAQ 1;  2ZJ9 A;  2WAE A;  1U60 A;  3PBR A;  1SKF A;  2FZ0 A;  4X1M A;  3TE8 A;  2JKR M;  4Y0O A;  2K2N A;  1XGI A;  4B4Z A;  1N9B A;  4EW7 A;  4LV0 A;  3Q07 A;  2V8C A;  1BSG A;  1RGZ A;  4FUW A;  4E6W A;  5EVL A;  2JCH A;  3DW0 A;  4GDB A;  3A0R A;  3OPR A;  2QJ5 A;  3M6B A;  4C75 A;  2Q0O A;  3T1X A;  3VSL A;  1SDN A;  1MPL A;  4LCL A;  4MN7 A;  4CPK A;  4ZJ2 A;  1FSY A;  3C4P A;  4HY8 A;  4OPZ A;  4HBT A;  3K2N A;  3UB9 A;  2Z6D A;  1DJB A;  5AQ9 A;  4KZ8 A;  1UWN X;  1L3L A;  1G6O A;  2QMI A;  5HPF A;  4Y0U A;  4I3J A;  4U0X A;  2Z6C A;  4OQG A;  3SS4 A;  3P01 A;  1T1B A;  2W3D A;  3W8K A;  3ZG9 B;  2PD8 A;  3BY8 A;  4JF5 A;  2W1R A;  3VP4 A;  4K08 A;  3EGD C;  3F1P B;  4H8R A;  4MN5 A;  2HPB A;  2H0Y A;  3IBJ A;  1ZG4 A;  5A8B A;  2WKI A;  2HF6 A;  4JXW A;  3ZVW A;  3G35 A;  4DF6 A;  4EER A;  4KG6 A;  1GA0 A;  1CQA A;  1AWI A;  1DP6 A;  1AXB A;  2ZQA A;  5KZH A;  2EX6 A;  3BLM A;  2XGN A;  2IWD A;  4EBL A;  3UNW A;  1A0K A;  3F1P A;  1VQQ A;  2XA7 S;  3MXR A;  1FCM A;  2OV5 A;  1GHP A;  2XQZ A;  5DFX A;  2ZLY A;  1IYS A;  4YWZ A;  1W63 M;  4RYE A;  2Y2J A;  4KEN B;  3VSK A;  5GLC A;  2J80 A;  1PI5 A;  4WMC A;  4OPQ A;  1ESI A;  2XFS A;  1H3Q A;  2L4R A;  2EFX A;  1K55 A;  5GL9 A;  1Y4O A;  1YQS A;  3IF6 C;  3KX0 X;  3LFV A;  1LI0 A;  5FEG A;  3UPO A;  5M18 A;  3CIT A;  3GMW A;  3HLF A;  4WEL A;  3CWF A;  2VGL M;  1UGU A;  1OTE A;  5CER A;  5J4E A;  3MJQ A;  4KZA A;  5DTK A;  1OTI A;  2W27 A;  1Q2P A;  4KZ7 A;  1PW8 A;  3UE3 A;  4PPR A;  2W3E A;  2DNS A;  3E2K A;  3O5Y A;  1OTD A;  5E2F A;  2WGI A;  5CGX A;  1K0K A;  3E2L A;  4QWO A;  5K5B A;  3EQV A;  5HFO A;  2E8I A;  3JVU A;  2VK3 A;  2PAV P;  4EEP A;  1DRM A;  5FQM A;  3IXH A;  1IYQ A;  5E2G A;  3LY4 A;  4BQM A;  2VV6 A;  3DTE A;  4EV4 A;  4I5S A;  3GDI A;  5GLB A;  3CMZ A;  4E3O A;  4FTX A;  2OLV A;  4WLA A;  2VEA A;  2PDR A;  1YLT A;  3D4F A;  4WBG A;  1L0E A;  3A3F A;  1NLY A;  3BJN A;  4FSF A;  2ZC6 B;  3A3E A;  2WKH A;  3ZG5 A;  3T4S A;  3W4P A;  5CXW A;  3R7W B;  3NOU C;  3IQA A;  2L0W A;  1MWS A;  3TOI A;  1T1A A;  1BLP A;  4E3L A;  1FSW A;  4HES A;  1MBL A;  2WGW A;  4JF4 A;  3UDX A;  4HNB A;  1BUL A;  1MXO A;  2XRN A;  3G2Z A;  5KSC A;  1YLY A;  1PRQ A;  2V9A A;  5CHU A;  2V0U A;  3UO9 A;  1H5X A;  4LPZ A;  3VOY A;  1CI8 A;  2ZQ7 A;  5D3O A;  3R7W A;  4O0P A;  2J9O A;  1LSX A;  3VOZ A;  2XD1 A;  1BUE A;  3LIF A;  5TBM B;  2M7V A;  1RP5 A;  2W1T B;  3EEA A;  1W7F A;  4MLL A;  1HVB A;  4OP8 A;  1K55 C;  2CMN A;  2ZBB A;  4Y15 A;  3EOI A;  5EEC A;  1KGE A;  5IS1 A;  3LIB A;  2ZC5 B;  3G4P A;  2P04 A;  3N7W A;  3NC8 A;  4KZ9 A;  3NOT C;  1F2K A;  2RCX A;  2QWS A;  3RXX A;  1LHY A;  3IX8 A;  3DWK A;  2QZ6 A;  1XJ2 A;  3EEH A;  2J9P A;  5HZH A;  1L2S A;  4Y2F A;  5TBM A;  1YM1 A;  4PAU A;  2HP6 A;  3HLB A;  5AVF A;  4GHI B;  5CEB A;  2OWH A;  5EM1 A;  4R3J A;  2V0W A;  3OCN A;  3V3S A;  3VMA A;  1OTA A;  4UA7 A;  5DFY A;  2BTF P;  2ZM2 A;  3AGE A;  1K25 A;  3VE4 A;  2C5W B;  3Q1F A;  4ZBE A;  2WKP A;  3A3D A;  1WA9 A;  3PBO A;  4X6T A;  2OLU A;  2V1A A;  4GHI A;  4UQI M;  5L10 A;  4BEN A;  2WGV A;  3SOI A;  3WS2 A;  2G2W A;  2XK1 A;  2HDS A;  1YLW A;  3BQA A;  3ZYT A;  2ZOI A;  3E4O A;  3SH8 A;  3RXW A;  4LCM A;  1G28 A;  5CX7 A;  4E3I A;  4Y17 A;  4HJ6 A;  3UY6 A;  1K57 A;  4I39 A;  1TS7 A;  2OSU A;  3ZCZ A;  4QU3 A;  1BLH A;  4KQQ A;  2JN7 A;  3HUN A;  3CPT B;  2A2L A;  3S7P A;  5HPI A;  5GLD A;  3SH7 A;  1YSP A;  3R4K A;  1ES4 A;  4GLQ A;  5L09 A;  1KGG A;  3QP8 A;  3DWZ A;  1VEU B;  5KIZ A;  1FQG A;  4EUV A;  2FH5 A;  4NXB A;  3PXP A;  2Y79 A;  3HJK A;  3T4J A;  4OOM A;  5AQ7 A;  3G31 A;  2BG1 A;  4LEN A;  4WEK A;  2WYX A;  3LI8 A;  1PW1 A;  3B33 A;  4CJN A;  1VET B;  3V5M A;  4UHU A;  3CPT A;  4NXF A;  1W79 A;  4L9E A;  3SS5 A;  4OQ0 A;  5CEC A;  3WS5 A;  5TR7 A;  3E4Q A;  5HSQ A;  2PU2 A;  1S4S A;  4N9L A;  3B3X A;  1PZO A;  1HLU P;  4DE2 A;  2H0T A;  1SZV A;  1FIK A;  1VEU A;  4IUH A;  1L0F A;  2VGL S;  3MMH A;  5FEF A;  3IWQ A;  3AGF A;  3H7W B;  2ZC4 B;  2Z2M B;  4QY6 A;  2R9W A;  5E2E A;  4M3K A;  1K56 A;  1PFL A;  1KDW A;  1VET A;  2XLN A;  4ZAM A;  4MMN A;  2J7V A;  3WS0 A;  3UDF A;  3VP1 A;  5FSR A;  5G4Z A;  4MBK A;  5G4Y A;  1BLC A;  3HLW A;  5DF8 A;  2B5R A;  4X55 A;  3PAG A;  1M6K A;  3ZFZ A;  3OPL A;  2NUP C;  5IT5 A;  1XJ4 A;  3HCY A;  5E43 A;  2Q9N A;  3LO7 A;  3H7W A;  4OLG A;  3GQZ A;  4PKY A;  2ZC3 B;  3OC2 A;  3IX4 A;  1TDL A;  1E25 A;  1E3U A;  2H28 A;  4BL2 A;  1SHV A;  5F1G A;  4GB7 A;  1V9Z A;  1Z09 A;  3AGD A;  2W3G A;  2WKE A;  1G68 A;  2J3W A;  4M4X A;  4O8G A;  4CLC D;  1PI4 A;  3PAE A;  3FZC A;  3ICY A;  3HLC A;  4PKY G;  4DMZ A;  5EVI D;  1TS6 A;  3C7U A;  1H8Y A;  4HI4 A;  2VLG A;  3EWK A;  3HUO A;  3MQQ A;  2JKF A;  4Y0T A;  2PHY A;  1WYC A;  3BFC A;  3FYZ A;  3BY9 A;  4N1H A;  2Y4A A;  5GHZ A;  1Q2Q A;  4IUK A;  1K57 C;  1I2W A;  4P0M A;  2E8J A;  1YT4 A;  2Y2M A;  4ID4 A;  2EX2 A;  3MFD A;  4OPR A;  4GD8 A;  3LYX A;  2P08 A;  3G30 A;  2ACG A;  3P7N A;  3VP2 A;  1UWP X;  2EXA A;  5FQ9 A;  3OLO A;  3U2A A;  4BD0 A;  1LSW A;  3NIA A;  3O88 A;  1CEF A;  1I2S A;  1J3W A;  5HD3 A;  4PM6 A;  1K6R A;  1PWD A;  4HIA A;  1TS8 A;  4KQO A;  5F69 A;  2KDK A;  4ZJ3 A;  4R4S A;  3IHA A;  5HAQ A;  2UV0 E;  1XA1 A;  2O9A A;  5EVE A;  4BJP A;  1PWG A;  3MSH A;  5I94 A;  3LR0 A;  1YPR A;  5I5L A;  4BBT A;  2AVX A;  3N8R A;  3IHB A;  3TW8 A;  3MF0 A;  5EE8 A;  4EBN A;  3W4O A;  4GD6 A;  1GHM A;  5EOE A;  4E04 A;  2H10 A;  3GV9 A;  3M6H A;  3DTI A;  4KZ4 A;  4XXR A;  4B9O A;  3T4K A;  4RX2 A;  1XX2 A;  2VZW A;  2Y2I A;  4L9G A;  1GSX A;  3MKE A;  1OJG A;  3KSI A;  5HWV A;  4MNR A;  3IWI A;  3C8C A;  4NKP A;  4ZDX A;  1DY6 A;  4P87 A;  5A93 A;  2MJ6 A;  4MDZ A;  5TFQ A;  3OBF A;  1L0G A;  4ETX A;  4OPY A;  2V8F A;  3O87 A;  1IKI A;  1NLZ A;  1IEM A;  1LL5 A;  2D01 A;  4JGQ A;  3UB5 P;  1GA9 A;  2HGV A;  4ETZ A;  1PYY A;  4UQI S;  4D2O A;  4RA7 A;  4XUX A;  4BWI A;  3MQ0 A;  4S2M A;  3UN7 A;  1FOF A;  1XFN A;  1CK3 A;  4EWF A;  4HQA A;  5IHV A;  3CUE C;  1DJA A;  1PNE A;  3MKF A;  3C38 A;  2EX9 A;  4JXS A;  4PHT A;  2WZZ A;  2Y2O A;  4BBU A;  1IYP A;  3OPH A;  3S22 A;  2V2F F;  3V3R A;  1W63 Q;  4NET A;  1S0W A;  4HOI A;  3VE3 A;  4R70 A;  4OOL A;  1N9L A;  5FQK A;  2DCF A;  1LLB A;  3G32 A;  4E3M A;  2O9B A;  2FFF B;  1W8Q A;  4YOF A;  3MXS A;  5DF9 A;  4IHQ A;  1W5D A;  4NXG A;  4WL9 A;  4WZ5 A;  1FCN A;  3HJI A;  3NEC A;  1IOU A;  2B02 A;  3NCK A;  3PYP A;  4DN0 A;  4B4X A;  4GJ4 A;  2UWX A;  5HAI A;  4MBF A;  4XT2 B;  4S2O A;  2VGK A;  1G6A A;  3D3O A;  3CZD A;  1F9I A;  5FAQ A;  5FAO A;  2ZM0 A;  2Y2G A;  4PM9 A;  5MC7 A;  1EWZ A;  1ALQ A;  4DRT A;  3PBN A;  4AFI A;  3SW1 A;  1PIO A;  1D7E A;  5TJJ A;  3UB6 A;  2CC1 A;  1OME A;  2LB5 A;  4UEY A;  3F1N B;  3C30 A;  5DF7 A;  4PM5 A;  5EV0 A;  1GSV A;  2M7U A;  3QP4 A;  1W8Y A;  4X68 A;  4GOG A;  1T18 A;  1GSW A;  4XT2 A;  2WGW B;  5HWW A;  3U4L P;  3VV4 A;  1S66 L;  5EFW A;  5J8X A;  1P9R A;  4E3J A;  4BLM A;  4H6J B;  1PZP A;  2A3U A;  4ZTK A;  3UE0 A;  3E0Y A;  4EQI A;  4F3L B;  3LEZ A;  2HJE A;  3F1N A;  1JTD A;  4ESP A;  4IVK A;  3CI6 A;  1SCW A;  2HZ5 A;  3LR3 A;  5FAT A;  4WZ4 A;  3GTC A;  4JXV A;  2Y91 A;  1ZG6 A;  2JC7 A;  4H6J A;  4A5R A;  3HLG A;  3DTK A;  2QJ7 A;  3UDI A;  4F3L A;  3HUM A;  1WYB A;  3LCE A;  3LID A;  1BZA A;  4JGO A;  1J9M A;  4HP9 A;  3QHY A;  3LI9 A;  3DTM A;  3WS1 A;  4K0X A;  2YKH A;  4O01 A;  3K3C A;  1KE0 A;  4PM7 A;  2K7S A;  3A0V A;  3T4Q A;  1M40 A;  1JTG A;  1Y28 A;  2ZC7 A;  1GHI A;  3UB8 A;  1K38 A;  4EES A;  5HWT A;  2P9V B;  4R0Q A;  4G3K A;  3TG9 A;  3ZGA B;  2Y2K A;  5DJT A;  4JPM A;  2XFT A;  1ERM A;  2PBD P;  1ERO A;  2DRW A;  5L8M A;  1NZU A;  1D1J A;  3LIC A;  5HDS A;  5DJU A;  4CLC E;  3CHW P;  5EVI C;  1N4O A;  2HDU A;  2P9V A;  1YAX A;  3SH9 A;  4KG5 A;  4ARZ B;  1NJ4 A;  3S7N A;  4WZ5 C;  4R1G A;  4EQ1 A;  3IH9 A;  4QHC A;  4JGP A;  5FAS A;  1I5Q A;  2PT7 A;  3QP6 A;  5L07 A;  4R23 A;  3ZNY A;  1P0Z A;  4X25 A;  4HEF A;  3BEC A;  4X56 A;  3HVF A;  3SS3 A;  3LEQ A;  2ZQC A;  3M2K A;  1S67 L;  3BFG A;  5CTM A;  5J3W A;  4KQR A;  3V67 A;  3WS4 A;  3GRJ A;  2HDR A;  2I72 A;  3JYI A;  1K4E A;  2X71 A;  4IVI A;  4ARZ A;  2WAF A;  5JYO A;  2XSS A;  3D9Y A;  2OWJ A;  3WWX A;  1RCJ A;  1QME A;  3QP5 A;  3VP3 A;  3RH8 B;  4R4R A;  2ZM8 A;  4BBV A;  3PR6 A;  3DBA A;  1KVL A;  2GX5 A;  4KUK A;  3F1O B;  4YIN A;  2W0N A;  2XDM A;  2P74 A;  4KZB A;  4BD1 A;  5KSH A;  2EFU A;  3A3I A;  2ZOH A;  2JKT I;  2IWB A;  2HP9 A;  1C3B A;  2BLS A;  2PR6 A;  3G34 A;  1S6R A;  2VKS A;  4HP4 A;  5CHM A;  4BMW A;  1HD8 A;  2BAS A;  3CLO A;  5HDC A;  4QJG A;  2I9V A;  1GCE A;  3BRM A;  3FPV A;  3F1O A;  3KYE A;  1FR6 A;  2PD7 A;  3TRC A;  4GW9 A;  3RJU A;  4QD4 A;  3PBS A;  5F83 A;  2VGJ A;  3PTE A;  4E3K A;  4LGW A;  1TS0 A;  3T1Q B;  3LIA A;  4FOF A;  1H8Z A;  5FDS A;  4LRZ E;  3QNC A;  4UA6 A;  4LV2 A;  2INW A;  4E3N A;  4OQI A;  4Z9Q A;  3T4O A;  3ZVT A;  3LIE A;  1XA7 A;  3UB7 A;  4Q8I A;  1ODV A;  4OOY A;  4DKI A;  2W3F A;  5HDD A;  4R3A A;  4KUO A;  2Y2N A;  2ZMA A;  4OP5 A;  3BYD A;  4KZ5 A;  4Z1W A;  1EI5 A;  2EXB A;  4HJ4 A;  5F6A A;  4DDS A;  4JGR A;  4Y3I A;  4EXO A;  1NZO A;  5DTT A;  4MBH A;  3MR0 A;  4WMC D;  4MEZ A;  5M1A A;  3I7J A;  3KSH A;  2HDQ A;  1NRF A;  5EOO A;  4X69 A;  4KZ3 A;  4B88 A;  1ESU A;  3BFE A;  4JLF A;  4EBP A;  1KE3 A;  2X02 A;  4YFM A;  3T12 B;  4I3A A;  4WYY A;  2G2U A;  2GDN A;  2WK0 A;  5EM0 A;  3T4T A;  3NI9 A;  3CUE A;  4HHD A;  3ZNT A;  2PRF A;  4U0T A;  2J3T D;  4FH4 A;  1NYM A;  5GHY A;  3MZF A;  3D72 A;  4L9F A;  3PBT A;  2OAP 1;  2HP5 A;  3KYZ A;  4OH0 A;  3RTY A;  3BFD A;  1YLZ A;  2ZQ8 A;  3RFB A;  2KLI A;  3HL9 A;  3CAX A;  3HLD A;  3S1Y A;  3FC7 A;  2L1M A;  5FQQ A;  4WN5 A;  1JVJ A;  1CJF A;  2Y2L A;  3H82 B;  3N6I A;  3FV7 A;  1VHM A;  2Y2P A;  3TJZ C;  2PU4 A;  4WEJ A;  1MKI A;  1BT5 A;  5FI6 A;  3ITA A;  2FFY A;  2Z2L B;  4WM9 A;  4GCZ A;  3VOL A;  4S2L A;  3UE6 A;  1ZHH B;  1NXY A;  3OCL A;  3CJM A;  3H82 A;  2JHE A;  5GLA A;  3NY4 A;  4S2N C;  4Y7P A;  3V39 A;  3PBQ A;  1TDG A;  2IWC A;  4S2P A;  1V9Y A;  3VFH A;  3C4O A;  1JWV A;  5HAP A;  1IYO A;  1K6S A;  1H0M A;  1LI9 A;  4WF0 A;  2VV7 A;  2QKP A;  1DP9 A;  4MN6 A;  3MBZ A;  2YKF A;  1VB6 A;  2JE5 A;  4K91 A;  5A91 A;  3EQU A;  3GSG A;  3QP1 A;  5TGF A;  3IH8 A;  4EUZ A;  3MQO A;  1KDS A;  2ZMF A;  1IEL A;  5E2H A;  1N9O A;  1CI9 A;  2XF3 A;  4N1X A;  3A3J A;  3B42 A;  4DXC A;  1T1C A;  4JBF A;  3EGX C;  4ZRR A;  4HJ3 A;  3S7O A;  3UME A;  5CGW A;  2WAD A;  2JKT M;  3L9K A;  4KG2 A;  1BLS A;  3C7V A;  2ZL1 B;  1ONH A;  1XP4 A;  1MC0 A;  3P09 A;  1NWZ A;  3T50 A;  4EET B;  4UAA A;  3LR4 A;  5LBR A;  2O0Y A;  3OZH A;  3ZG0 A;  1YMX A;  2ZD8 A;  4GDN A;  4CLC B;  1LSV A;  2GJ3 A;  3BQ8 A;  3HBR A;  4BL3 A;  5FI7 A;  4MCW A;  1MWU A;  5EVI B;  2VV8 A;  3NHQ A;  4HH3 A;  3IF5 A;  4II7 A;  1XGJ A;  1K54 A;  3NDG A;  2WUQ A;  3KYQ A;  5J7E A;  3M2J A;  2ZL1 A;  1HZO A;  5AJG A;  1KVM A;  2EWV A;  3ITB A;  3KSF A;  1MZU A;  3ZHH A;  5HL1 A;  1YLP A;  4HH2 A;  4IED A;  4GN2 A;  1HTZ A;  3OOV A;  4CLC A;  2M1C A;  1IFQ A;  3FKV A;  1TEM A;  4DE1 A;  5EVI A;  4I38 A;  1JWZ A;  2B95 A;  1P9W A;  4GNU A;  1SKO B;  1Y54 A;  3O3V A;  4YNR A;  2V1Z A;  1H8M A;  1T19 A;  2K31 A;  3ULF A;  3O86 A;  4FH2 A;  5FDH A;  1S1Y A;  5G18 A;  1ACF A;  4DE3 A;  5IU1 A;  3PHY A;  1KGF A;  3CG5 A;  1CEG A;  2ZQD A;  4DXB A;  3VP0 A;  3N8L A;  1F98 A;  4HBU A;  1N9N A;  5CHJ A;  3H9W A;  3MZD A;  3A0S A;  1SKO A;  3UE1 A;  3NBL A;  3Q7V B;  3C5A A;  1NRJ A;  3BFF A;  3BWL A;  3P98 A;  4S2I A;  3E4P A;  3W2Z A;  2H5S A;  1MWR A;  2Y2Q A;  5FI2 A;  2QPN A;  5EPH A;  4JKT A;  1XKZ A;  2QYB A;  2XD5 A;  1ES5 A;  5AVE A;  2VA0 A;  3KSG A;  4U3T A;  3V50 A;  2Q9M A;  5DVA A;  2XEP A;  3FKW A;  2V20 A;  1NYY A;  4P6Z S;  5HL6 A;  3T1S A;  2EA9 A;  3T1R A;  5CTN A;  2PYP A;  1CF0 A;  3Q7V A;  3IX3 A;  3FPW A;  5F1F A;  1TD5 A;  4NEE D;  5C5K A;  3G6O A;  3SZT A;  1NY0 A;  4OON A;  4GZB A;  1OJ5 A;  3LUQ A;  4E6X A;  1O7E A;  2Y55 A;  4OQH A;  4KZ6 A;  5A90 A;  1TF1 A;  1OTB A;  1IKG A;  3MS6 A;  2O99 A;  4LRX C;  3ZDJ A;  1LT0 A;  1YMS A;  3IXD A;  2EX8 A;  1OT6 A;  1S1Z A;  3MFX A;  5HD5 A;  1K56 D;  4JXG A;  1YKD A;  2VX8 A;  4IBR A;  2R9X A;  2QHK A;  3NUL A;  2LB9 A;  5A92 A;  2V1B A;  3G2Y A;  1ZTU A;  4CQH A;  4DJ2 A;  2P7J A;  2XRO A;  1K54 C;  4K0W A;  2IA2 A;  3S4X A;  2XH9 A;  3WRT A;  1K4F A;  5AQB A;  3GR2 A;  3LGO A;  2JKR I;  4N92 A;  4CLC C;  4B93 A;  3UPN A;  2HJ9 C;  1E3U D;  4P85 A;  3L7H A;  3E98 A;  2DMW A;  4LFU A;  4LV1 A;  5CED A;  1D06 A;  2Y8H A;  2J8Y A;  1G5U A;  1EW0 A;  4ME4 A;  2X01 A;  2J3T C;  4UA9 A;  4X1L A;  3FWL A;  5FL3 A;  5F68 A;  4FCF A;  1ZC2 A;  3LR5 A;  5HAR A;  1ES3 A;  2RL3 A;  2W1T A;  1X0O A;  2ZMV A;  5GHX A;  4C3Q A;  1PWC A;  4WUJ A;  1YLJ A;  3OPP A;  2WZX A;  5FA7 A;  4RX3 A;  4LV3 A;  4D60 A;  5BOH A;  4R38 A;  3IXB A;  5DTS A;  3MZE A;  2A49 A;  1P97 A;  5F82 A;  5EUA A;  4R3B A;  1WE4 A;  5HW3 A;  3K3D A;  3WRZ A;  1FCO A;  2XR0 A;  1BYW A;  1FR1 A;  2XA7 M;  4GS9 B;  5KMW A;  4LRY C;  3BEB A;  4OVD A;  3NDE A;  3KO6 A;  4Q0H A;  5JYP A;  3BM6 A;  1KE4 A;  4L0L A;  4O7D A;  2KX6 A;  3NOP C;  4GKU A;  1FIL A;  4G3W A;  2A24 B;  2JKG A;  4Q0J A;  3N8S A;  4NXE A;  1RGY A;  4DDY A;  4G3V A;  4I3I A;  4QY5 A;  2Y2H A;  3FG8 A;  2PBY A;  1BTL A;  4GS9 A;  3QP2 A;  3ZG7 B;  1XXM A;  1ZKJ A;  4OKP A;  1SDE A;  1QMF A;  4QPR A;  4DJ3 A;  2PYR A;  1YSQ A;  4S2N A;  1ES2 A;  4X53 A;  2A24 A;  3BLS A;  1LL8 A;  3Q81 A;  3Q7Z A;  4NK3 A;  4JF6 A;  4XUZ A;  5HX9 A;  4P6B A;  1VM1 A;  5FQJ A;  4DE0 A;  2O9C A;  2WKR A;  4PMA A;  4S2K A;  2C6W B;  1ERQ A;  2B18 A;  2Y59 A;  5CGS A;  1JNU A;  3DAV A;  3UPP A;  3VFF A;  1O07 A;  4RVA A;  4Y13 A;  3HRE A;  1DJC A;  1MKM A;  3N4I A;  1E4D A;  2G7U A;  5U47 A;  2D02 A;  4EEU A;  1XFQ A;  3C2W A;  4PM8 A;  1JWP A;  4RQ9 A;  4N9K A;  4OLD A;  4S2J A;  3B47 A;  3Q82 A;  1KOU A;  3QNB A;  4P6Z M;  5F5Y A;  1MWT A;  2W3H A;  1XJ3 A;  3NJA A;  1STZ A;  3ZG8 B;  4IJG A;  4F94 A;  1OT9 A;  2GZA A;  3IS2 B;  3MXQ A;  1XJ6 A;  2WKQ A;  3IXG A;  3IWO A;  4IBX A;  2OOL A;  1OPX A;  4C6Y A;  5DKK A;  1L0D A;  1F5M A;  5CRF A;  2R78 A;  3UMD A;  3JVV A;  3IF6 B;  4EU0 A;  3JPU A;  5AQA A;  2HV1 A;  2ZQ9 A;  5DKL A;  1LL9 A;  2KOI A;  4FD8 A;  5FAP A;  3IBR A;  3GEC A;  1DP8 A;  3W4Q A;  3S7Q A;  4NG2 A;  1TVF A;  2JBF A;  4Q0I A;  3T4L A;  5FQI A;  5L2F A;  1Z6F A; 
#chains in the Genus database with same CATH homology
 1JTD A;  4LCM A;  1XP4 A;  4E3I A;  3LY3 A;  4IVK A;  1XPB A;  3P09 A;  4ZJ1 A;  1SCW A;  3UY6 A;  4UAA A;  1K57 A;  1MY8 A;  5FAT A;  3OZH A;  3ZG0 A;  4WZ4 A;  3IT9 A;  1YMX A;  2ZD8 A;  4GDN A;  3GTC A;  4JXV A;  2OSU A;  2Y91 A;  3HBR A;  3ZCZ A;  5M19 A;  4BL3 A;  4QU3 A;  1ZG6 A;  1BLH A;  5FI7 A;  3GVB A;  1ONG A;  4KQQ A;  3IF6 A;  1MWU A;  3HUN A;  2JC7 A;  3TSG A;  5EVI B;  4A5R A;  3HLG A;  3HLE A;  3ISG A;  3IF5 A;  4QB8 A;  3UDI A;  5GLD A;  3HUM A;  3SH7 A;  1XGJ A;  1ES4 A;  1WYB A;  2ZJ9 A;  2WAE A;  1KGG A;  1U60 A;  3LCE A;  1K54 A;  3NDG A;  2WUQ A;  3PBR A;  1BZA A;  1J9M A;  1SKF A;  3M2J A;  3DWZ A;  3QHY A;  1HZO A;  3DTM A;  1KVM A;  3ITB A;  3WS1 A;  4K0X A;  1FQG A;  3ZHH A;  4Y0O A;  5HL1 A;  1YLP A;  1KE0 A;  4IED A;  4GN2 A;  1HTZ A;  4PM7 A;  4OOM A;  1XGI A;  5AQ7 A;  3G31 A;  4B4Z A;  1N9B A;  2BG1 A;  4LEN A;  4WEK A;  1M40 A;  4LV0 A;  1JTG A;  2WYX A;  2ZC7 A;  1GHI A;  1BSG A;  1K38 A;  1RGZ A;  3Q07 A;  4E6W A;  1PW1 A;  2P9V B;  4CJN A;  4R0Q A;  5EVL A;  3FKV A;  1TEM A;  3V5M A;  4UHU A;  2JCH A;  3DW0 A;  4DE1 A;  4GDB A;  3TG9 A;  5EVI A;  1W79 A;  3OPR A;  3ZGA B;  3SS5 A;  4OQ0 A;  2Y2K A;  5CEC A;  1JWZ A;  5TR7 A;  3WS5 A;  4JPM A;  3M6B A;  2PU2 A;  4C75 A;  3VSL A;  4GNU A;  1SDN A;  4N9L A;  1Y54 A;  1MPL A;  3B3X A;  4LCL A;  1PZO A;  3O3V A;  2V1Z A;  4CPK A;  2XFT A;  4DE2 A;  2H0T A;  1ERM A;  4ZJ2 A;  1L0F A;  1FSY A;  3O86 A;  3C4P A;  4FH2 A;  5FDH A;  4OPZ A;  4HBT A;  1ERO A;  3IWQ A;  1DJB A;  5G18 A;  3AGF A;  5AQ9 A;  2DRW A;  4KZ8 A;  1NZU A;  2ZC4 B;  2Z2M B;  4DE3 A;  4QY6 A;  2R9W A;  5E2E A;  4M3K A;  5EVI C;  1N4O A;  1KGF A;  3CG5 A;  1K56 A;  1CEG A;  2QMI A;  2ZQD A;  2HDU A;  2P9V A;  1KDW A;  3SH9 A;  4DXB A;  2XLN A;  4ZAM A;  3VP0 A;  3N8L A;  2J7V A;  4KG5 A;  4Y0U A;  1NJ4 A;  3WS0 A;  3UDF A;  4U0X A;  4HBU A;  3VP1 A;  4WZ5 C;  5FSR A;  4OQG A;  4R1G A;  3SS4 A;  5CHJ A;  3IH9 A;  3MZD A;  4QHC A;  4MBK A;  5FAS A;  1I5Q A;  3W8K A;  3UE1 A;  1BLC A;  3HLW A;  3NBL A;  5DF8 A;  3ZG9 B;  2B5R A;  3Q7V B;  3PAG A;  4X55 A;  3C5A A;  3BFF A;  3P98 A;  4R23 A;  3ZNY A;  4S2I A;  4JF5 A;  1M6K A;  4HEF A;  3BEC A;  4X56 A;  3ZFZ A;  3OPL A;  2H5S A;  3HVF A;  5E43 A;  2Q9N A;  3SS3 A;  3VP4 A;  1MWR A;  2Y2Q A;  2ZQC A;  3LO7 A;  5FI2 A;  2QPN A;  5EPH A;  3M2K A;  4JKT A;  1XKZ A;  4OLG A;  3BFG A;  3GQZ A;  2XD5 A;  5CTM A;  1ES5 A;  4H8R A;  4KQR A;  2ZC3 B;  4U3T A;  3OC2 A;  3WS4 A;  3GRJ A;  1TDL A;  3V50 A;  1E25 A;  1E3U A;  2HDR A;  2HPB A;  2I72 A;  3JYI A;  4BL2 A;  2Q9M A;  5DVA A;  1K4E A;  2X71 A;  4IVI A;  2H0Y A;  2XEP A;  3FKW A;  1SHV A;  2WAF A;  1ZG4 A;  5JYO A;  5F1G A;  4GB7 A;  2V20 A;  2WKI A;  3AGD A;  1NYY A;  3WWX A;  1RCJ A;  2WKE A;  4JXW A;  1QME A;  1G68 A;  3VP3 A;  3G35 A;  3ZVW A;  4DF6 A;  1PI4 A;  3PAE A;  5CTN A;  3FZC A;  4R4R A;  3Q7V A;  4KG6 A;  1GA0 A;  3HLC A;  5F1F A;  2ZM8 A;  1AXB A;  5EVI D;  1NY0 A;  3C7U A;  4OON A;  1H8Y A;  2ZQA A;  4GZB A;  5KZH A;  2EX6 A;  3BLM A;  2XGN A;  2IWD A;  4EBL A;  3UNW A;  4E6X A;  1KVL A;  1O7E A;  1VQQ A;  2Y55 A;  4YIN A;  4BD1 A;  2XDM A;  2P74 A;  3HUO A;  3MXR A;  1FCM A;  4KZB A;  4OQH A;  2OV5 A;  4Y0T A;  4KZ6 A;  5A90 A;  5KSH A;  1GHP A;  1WYC A;  3BFC A;  3FYZ A;  2EFU A;  3A3I A;  2XQZ A;  4N1H A;  2Y4A A;  1IKG A;  2ZLY A;  2IWB A;  2HP9 A;  1C3B A;  3ZDJ A;  5GHZ A;  2BLS A;  1Q2Q A;  1K57 C;  1I2W A;  1IYS A;  1YMS A;  3IXD A;  4P0M A;  3G34 A;  1S6R A;  2EX8 A;  4RYE A;  2Y2J A;  4KEN B;  3VSK A;  1YT4 A;  2Y2M A;  1PI5 A;  4ID4 A;  4WMC A;  5GLC A;  4OPQ A;  1ESI A;  2EX2 A;  2XFS A;  1K56 D;  3MFD A;  4JXG A;  4GD8 A;  4OPR A;  2EFX A;  1K55 A;  5CHM A;  4IBR A;  5GL9 A;  2R9X A;  3G30 A;  1YQS A;  3IF6 C;  1LI0 A;  1HD8 A;  3UPO A;  3VP2 A;  5M18 A;  3GMW A;  5A92 A;  4QJG A;  3HLF A;  2EXA A;  4WEL A;  5FQ9 A;  1GCE A;  4BD0 A;  3BRM A;  3G2Y A;  5CER A;  1FR6 A;  4KZA A;  1K54 C;  5DTK A;  3NIA A;  3O88 A;  1Q2P A;  4K0W A;  1CEF A;  3RJU A;  4KZ7 A;  1PW8 A;  3UE3 A;  1I2S A;  4PPR A;  3S4X A;  2DNS A;  3E2K A;  4QD4 A;  2XH9 A;  3PBS A;  4PM6 A;  5F83 A;  1K6R A;  1PWD A;  1K4F A;  2VGJ A;  3PTE A;  3WRT A;  4E3K A;  5AQB A;  3GR2 A;  4KQO A;  5E2F A;  2WGI A;  4ZJ3 A;  4R4S A;  5CGX A;  3IHA A;  5HAQ A;  4N92 A;  3UPN A;  1E3U D;  4P85 A;  3E2L A;  1XA1 A;  3EQV A;  4LV1 A;  5CED A;  4BJP A;  1H8Z A;  3QNC A;  1PWG A;  4LV2 A;  4UA6 A;  2J8Y A;  5HFO A;  2E8I A;  4E3N A;  4OQI A;  4Z9Q A;  3ZVT A;  1XA7 A;  5FQM A;  5I94 A;  2X01 A;  4Q8I A;  4UA9 A;  3IXH A;  3FWL A;  1IYQ A;  3N8R A;  5E2G A;  4OOY A;  4FCF A;  4DKI A;  3LY4 A;  4BQM A;  1ZC2 A;  3IHB A;  5HAR A;  4EV4 A;  1ES3 A;  2RL3 A;  5EE8 A;  4EBN A;  5GLB A;  3W4O A;  5GHX A;  4GD6 A;  1GHM A;  2Y2N A;  3CMZ A;  5EOE A;  2ZMA A;  4C3Q A;  4OP5 A;  1PWC A;  2H10 A;  1YLJ A;  3GV9 A;  3BYD A;  3M6H A;  4KZ5 A;  4E3O A;  3OPP A;  4KZ4 A;  2WZX A;  4XXR A;  1EI5 A;  5FA7 A;  4RX2 A;  2OLV A;  4LV3 A;  4RX3 A;  5BOH A;  1XX2 A;  2EXB A;  2Y2I A;  4DDS A;  3IXB A;  5DTS A;  3MZE A;  2A49 A;  1NZO A;  5F82 A;  5DTT A;  4MBH A;  3MKE A;  5EUA A;  4R3B A;  1WE4 A;  5HW3 A;  1YLT A;  3WRZ A;  4WMC D;  1FCO A;  4MNR A;  3IWI A;  2XR0 A;  3D4F A;  4MEZ A;  5M1A A;  3I7J A;  4WBG A;  2HDQ A;  4ZDX A;  1NRF A;  1DY6 A;  1L0E A;  1FR1 A;  4X69 A;  3A3F A;  4P87 A;  5EOO A;  4KZ3 A;  4B88 A;  4FSF A;  1ESU A;  3BFE A;  5A93 A;  5KMW A;  4JLF A;  4EBP A;  2ZC6 B;  1KE3 A;  2X02 A;  3A3E A;  3BEB A;  2WKH A;  4YFM A;  4OVD A;  4WYY A;  5TFQ A;  3NDE A;  2G2U A;  2GDN A;  2WK0 A;  1L0G A;  3ZG5 A;  5JYP A;  3BM6 A;  3W4P A;  3NI9 A;  4OPY A;  3O87 A;  5CXW A;  1KE4 A;  1IKI A;  3ZNT A;  4L0L A;  4U0T A;  1IEM A;  4FH4 A;  4O7D A;  1LL5 A;  1NYM A;  3IQA A;  5GHY A;  3MZF A;  3PBT A;  2HP5 A;  1MWS A;  3TOI A;  4GKU A;  4E3L A;  1BLP A;  1GA9 A;  4OH0 A;  1FSW A;  1PYY A;  4D2O A;  4RA7 A;  3BFD A;  4XUX A;  1YLZ A;  2ZQ8 A;  3N8S A;  4HES A;  1RGY A;  4DDY A;  3HL9 A;  1MBL A;  2WGW A;  3HLD A;  4JF4 A;  3S1Y A;  4S2M A;  4QY5 A;  3UDX A;  3UN7 A;  1FOF A;  2Y2H A;  2PBY A;  1CK3 A;  1BTL A;  1BUL A;  1MXO A;  4EWF A;  3G2Z A;  5FQQ A;  5IHV A;  3ZG7 B;  1DJA A;  5KSC A;  1YLY A;  3MKF A;  1JVJ A;  5CHU A;  1XXM A;  3UO9 A;  1ZKJ A;  2Y2L A;  4OKP A;  1H5X A;  1SDE A;  2EX9 A;  3N6I A;  4JXS A;  3FV7 A;  3VOY A;  1CI8 A;  2ZQ7 A;  5D3O A;  2WZZ A;  2Y2O A;  2J9O A;  1QMF A;  1IYP A;  3OPH A;  3S22 A;  4S2N A;  2XD1 A;  2V2F F;  1BUE A;  2Y2P A;  3VOZ A;  1ES2 A;  3V3R A;  2PU4 A;  4WEJ A;  1RP5 A;  4NET A;  1S0W A;  4X53 A;  1MKI A;  1BT5 A;  3BLS A;  5FI6 A;  3ITA A;  3Q81 A;  3Q7Z A;  4NK3 A;  4OOL A;  4JF6 A;  5FQK A;  1W7F A;  4MLL A;  1HVB A;  4XUZ A;  4OP8 A;  2FFY A;  2DCF A;  2Z2L B;  4P6B A;  1LLB A;  3G32 A;  4WM9 A;  5HX9 A;  1K55 C;  4E3M A;  1VM1 A;  2FFF B;  1W8Q A;  5FQJ A;  4DE0 A;  4S2L A;  4PMA A;  5EEC A;  4S2K A;  2C6W B;  1KGE A;  2ZC5 B;  3G4P A;  1ERQ A;  3N7W A;  2Y59 A;  1NXY A;  3NC8 A;  4KZ9 A;  5CGS A;  3OCL A;  3MXS A;  3UPP A;  3VFF A;  5DF9 A;  3CJM A;  1O07 A;  4RVA A;  1W5D A;  2RCX A;  3HRE A;  1DJC A;  3RXX A;  5GLA A;  3NY4 A;  1LHY A;  4S2N C;  3DWK A;  3N4I A;  2QZ6 A;  4WZ5 A;  4Y7P A;  1FCN A;  1E4D A;  3V39 A;  5U47 A;  3NCK A;  4B4X A;  2UWX A;  3PBQ A;  5HAI A;  4MBF A;  2J9P A;  4S2O A;  1L2S A;  1TDG A;  4PM8 A;  2IWC A;  2VGK A;  1YM1 A;  4S2P A;  1G6A A;  2HP6 A;  3CZD A;  3HLB A;  5FAQ A;  3VFH A;  3C4O A;  1JWV A;  5FAO A;  2ZM0 A;  2Y2G A;  4PM9 A;  5HAP A;  1IYO A;  1K6S A;  1JWP A;  1EWZ A;  1ALQ A;  4DRT A;  1LI9 A;  4N9K A;  3PBN A;  4OLD A;  4S2J A;  5CEB A;  1PIO A;  3Q82 A;  4R3J A;  3QNB A;  3MBZ A;  1MWT A;  3OCN A;  2CC1 A;  1OME A;  3ZG8 B;  2JE5 A;  4K91 A;  5DF7 A;  5A91 A;  3V3S A;  4PM5 A;  3VMA A;  4F94 A;  4UA7 A;  3EQU A;  2ZM2 A;  3GSG A;  1W8Y A;  1K25 A;  3AGE A;  4GOG A;  4X68 A;  2C5W B;  5TGF A;  3IH8 A;  2WGW B;  3IXG A;  3Q1F A;  4ZBE A;  3IWO A;  4EUZ A;  4IBX A;  3A3D A;  1KDS A;  5E2H A;  1IEL A;  4C6Y A;  1L0D A;  5J8X A;  5CRF A;  3PBO A;  1CI9 A;  4X6T A;  4E3J A;  2XF3 A;  4N1X A;  3A3J A;  4BLM A;  3IF6 B;  2OLU A;  5AQA A;  4DXC A;  1PZP A;  2A3U A;  4JBF A;  4BEN A;  2WGV A;  2ZQ9 A;  1LL9 A;  4FD8 A;  5FAP A;  3SOI A;  3WS2 A;  4ZTK A;  2G2W A;  2XK1 A;  3UE0 A;  5CGW A;  3W4Q A;  2HDS A;  4EQI A;  1TVF A;  1YLW A;  2JBF A;  2WAD A;  3LEZ A;  4KG2 A;  5FQI A;  1BLS A;  5L2F A;  1Z6F A;  3C7V A;  3SH8 A;  3RXW A;  1ONH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...