1V9YA

Crystal structure of the heme pas sensor domain of ec dos (ferric form)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
113
structure length
103
Chain Sequence
GIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNRERELQLEKKDGSKIWTRFALSKVSAEGKVYYLALVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A redox-controlled molecular switch revealed by the crystal structure of a bacterial heme PAS sensor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
molecule keywords Heme pas sensor protein
total genus 31
structure length 103
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2004-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1v9yA00
5HD5A 2GJ3A 2W27A 4GHIA 5J4EA 1V9ZA 3LIFA 2J80A 1MZUA 2VLGA 2ZBBA 4E04A 3A0RA 3OLOA 2L1MA 3PYPA 4LRZE 2ZOHA 3FG8A 3VE4A 3LYXA 1S67L 4HI4A 3LIBA 2WKQA 3F1PA 5F6AA 2L0WA 2Z6DA 3SW1A 1TS6A 2EA9A 3MQQA 3A0SA 1T1BA 2PD7A 4HJ3A 1XFQA 1XJ4A 2D01A 4L9GA 1LSVA 4LRYC 3NHQA 2JN7A 3LIEA 5I5LA 2M1CA 3IS2B 4WN5A 1OJGA 2L4RA 3LIDA 1N9OA 4RQ9A 4KQDA 3LICA 3EWKA 5A8BA 1OTBA 3C8CA 4NXBA 2V1AA 4NXEA 4B9OA 3ICYA 2W0NA 5AVFA 1X0OA 2ZOIA 3G6OA 3MR0A 3CWFA 3UE6A 3NOTC 5G4ZA 1WA9A 5IU1A 1OJ5A 2PYRA 2QKPA 4HP9A 4I38A 3MXQA 4WLAA 2VEAA 4EEUA 4EXOA 1Y28A 2A24A 1S4RA 3F1NB 3H82A 4HNBA 3FC7A 1F98A 4HOIA 3UMEA 2WKPA 4WL9A 1DRMA 1GSXA 1OT6A 1OT9A 2V0WA 2V1BA 4EETB 1DP6A 1V9YA 1VB6A 1OTDA 2KDKA 4PKYA 5HD3A 2YKHA 3C2WA 3H7WB 5HWTA 4DJ2A 4EQ1A 4I3JA 1JNUA 1OTEA 3BY8A 4L9EA 4DJ3A 4GCZA 5HWVA 2Z6CA 4H6JB 2JHEA 1UWPX 3K3CA 2QWSA 3NOPC 4L9FA 3IBRA 1T1CA 2QJ5A 4I5SA 3NJAA 4M4XA 5DKKA 1BYWA 1D06A 5KIZA 2OWHA 4HIAA 3CLOA 4HJ6A 2BASA 4EERA 2P7JA 2WKRA 3MQOA 4KUOA 4HQAA 1S1ZA 3H82B 4HJ4A 4PKYG 4MN5A 1NWZA 1S4SA 1GSWA 2QHKA 4JGQA 1T19A 3T50A 2HV1A 4R38A 5J7EA 3IS2A 3K3DA 4GS9B 2OOLA 3H7WA 1GSVA 3P7NA 5DJTA 4JGOA 5DKLA 4YWZA 1LT0A 4WF0A 3RTYA 1D7EA 4H6JA 4NXGA 4WUJA 1LSWA 2QJ7A 4HY8A 3GDIA 4KUKA 2VV8A 3HJKA 1LL8A 4K08A 4R6LA 5DJUA 5F69A 3UB6A 3KX0X 3E4QA 1OTAA 2CMNA 4HP4A 1P0ZA 1S66L 4LPZA 4R3AA 3NOUC 4XT2B 1TS0A 4XT2A 3UB8A 2I9VA 4JGRA 2V0UA 1N9LA 3E4PA 1DP9A 3LI8A 4GW9A 5F5YA 2PYPA 1T18A 3F1PB 5HDCA 1N9NA 3MJQA 5TBMB 2K7SA 5TBMA 3GECA 1T1AA 5F68A 5IS1A 4I3AA 1XJ6A 3B33A 3PHYA 4I3IA 3HJIA 4GS9A 3ULFA 3VE3A 1XJ3A 2PD8A 3RH8B 2B02A 4BBTA 2PR5A 3A0VA 5HZHA 4BBUA 1XFNA 4MN6A 2D02A 2PDRA 2VV7A 1KOUA 2R78A 3D72A 5HWWA 1P97A 2PHYA 4R70A 5HDSA 2OWJA 3MFXA 5AVEA 1G28A 1LSXA 1ODVA 3F1OB 3F1OA 3LIAA 3LI9A 2INWA 2V9AA 2VV6A 2PR6A 3E4OA 3LUQA 1F9IA 1DP8A 4HHDA 1XJ2A 1S1YA 4I39A 4NXFA 3CAXA 3UB9A 4LRXC 4EESA 2A24B 1TS8A 2H28A 3F1NA 3UB7A 3ZQ5A 4BBVA 4F3LB 4F3LA 1UWNX 3VOLA 5J3WA 5HDDA 4HH2A 5G4YA 1UGUA 3BY9A 4GHIB 1OTIA 2YKFA 3BWLA 1TS7A 1EW0A 5HSQA 2KX6A 4HH3A 3H9WA 4EEPA 5EFWA 3UMDA 4JGPA 3EEHA 4LLOB 4EW7A
chains in the Genus database with same CATH superfamily
1NLYA 3IQAA 1BLSA 3EEAA 5GLBA 4DE3A 2ZOHA 4CPKA 4P87A 1S67L 5F6AA 3G35A 4GLQA 2M1CA 1GA9A 1NRFA 5A8BA 3PBOA 3ZG5A 1BULA 2Y2IA 3PBTA 1KE3A 5JYOA 3G6OA 3ITAA 1WA9A 4BL3A 1OJ5A 3SOIA 4EEUA 4IJGA 1Y28A 4C6YA 3M2JA 1TDGA 2GX5A 2WYXA 4B93A 1O7EA 3BEBA 4LGWA 3AGDA 2GNXA 2JHEA 2QWSA 3GSGA 2PBYA 3LCEA 1EWZA 2WGIA 5CTMA 5L8MA 1YLYA 2ZC3B 1S4SA 3T4LA 4LV3A 4R38A 3K3DA 2K2NA 1PFLA 2OSUA 4YWZA 1XXMA 2VGJA 2Y2MA 3HREA 4KUKA 1IFQA 1O07A 4R3AA 3FV7A 4JGRA 1W63Q 3PBRA 1G6OA 3UN7A 5TGFA 1N9NA 1E25A 3OC2A 4UA7A 4MBKA 3B33A 1ES3A 3LY3A 1XJ3A 4MLLA 2R78A 1VQQA 3ZFZA 1MWRA 3UB5P 4F3LA 4F3LB 2X71A 5E2FA 1I5QA 5FDHA 5DFYA 3Q07A 4O7DA 5HD5A 3LIFA 1G6AA 4X1LA 3PR6A 3FG8A 4EBPA 1HLUP 4HI4A 5F82A 2WKQA 2L0WA 1PZPA 2Z6DA 3CMZA 1DY6A 3G2ZA 3TW8A 3LIEA 3BFDA 5EUAA 4X25A 3C8CA 3IXHA 3ICYA 3NBLA 5CGXA 4YOFA 4XUXA 5TJJA 2UV0E 5FQJA 2QKPA 1YSPA 5F1GA 5CGSA 4JKTA 2WKPA 2V1BA 1VB6A 4JBFA 1K38A 4OPQA 3NOPC 3KYEA 4ZTKA 1BUEA 4RX2A 4DE1A 4HJ4A 4PKYG 3W8KA 5HL1A 5EPHA 3T50A 3KYQA 1GSVA 3LR5A 4C3QA 4WF0A 2WK0A 3GMWA 3NULA 5GHXA 3FPVA 2EX6A 3BQAA 3UB8A 3ZG0A 2Y59A 2I9VA 1FR6A 1J9MA 3C7UA 3F1PB 1T18A 2P74A 4JF5A 5DTTA 3DTIA 3S7QA 2WKEA 1W8YA 5HZHA 2EWVA 3MMHA 2O99A 3VP1A 5CGWA 4P6ZS 1H8YA 1ESIA 1JWPA 1XA1A 1LSXA 2WGWA 4KZ5A 1BT5A 3LR0A 3UB7A 2IWBA 1NZUA 1OTIA 1EW0A 2Z2MB 1K57C 3EEHA 2XR0A 2J7VA 4Y15A 2W27A 4OQHA 1G5UA 1NJ4A 3L9KA 3BFFA 1SKFA 5CRFA 2HDQA 5KMWA 3ZG9B 2RCXA 5L07A 1MPLA 1OJGA 1N9OA 1CI9A 2Q0OA 4KZ4A 5AVFA 1LI0A 3T1SA 3G31A 3T4QA 4BQMA 1YLTA 2Y2HA 3VSKA 3JPUA 1F98A 3QP6A 3KSGA 4EETB 5EVIB 2PRFA 4GD6A 4L9EA 4K91A 3MF0A 2Z6CA 5DVAA 1YLJA 4OH0A 2OWHA 2PT7A 2HF6A 2BASA 5FQQA 2BG1A 1K25A 2OOLA 3QP5A 4HBUA 3BFGA 3SH9A 2QMIA 3BECA 2K31A 5DJUA 1MKMA 4B88A 3V39A 4S2IA 5CHUA 5AQBA 2K7SA 3OPPA 4DF6A 5FQMA 4GJ4A 4I3AA 5FI6A 5CECA 3IX8A 2V8FA 3A0VA 3AGFA 1P97A 5M18A 4F94A 4CLCA 4JXVA 4NETA 1DJAA 1IYQA 3T4SA 3E4OA 3CHWP 3LUQA 1CF0A 1S1YA 4PM9A 4KZ9A 3F1NA 3PBQA 2Y91A 1BTLA 4Y5FA 1KE0A 3C30A 1IYSA 3G2YA 3UE3A 2VKSA 1MXOA 2X02A 4JGPA 3QP8A 2XRNA 1SKOB 3M6BA 2HDUA 3WS2A 3F1PA 1DJBA 4WBGA 2WGWB 4IVIA 3N8SA 3NECA 3GQZA 1YSQA 5I5LA 3VP3A 5BOHA 3RJUA 3EWKA 5TFQA 1H8MA 3CZDA 3A3DA 4I38A 3VOYA 5EM1A 2ZC5B 3SS4A 1OT9A 1L0EA 1GHPA 3T4KA 3EQUA 2VK3A 4YFMA 4L9FA 1SCWA 4NKPA 4QU3A 1K4FA 1IELA 2XFSA 2W3GA 2QHKA 3DTKA 2AVXA 3ZG8B 5HFOA 5DKLA 1YMXA 4GKUA 1Y54A 2P9VA 3MKFA 4K0XA 5CERA 4UQIS 4GDBA 2JKGA 3HL9A 3KO6A 3OCLA 5FI2A 2V1ZA 2ZC6B 1BSGA 3MJQA 1ES5A 1L0DA 3O86A 3QNBA 3PHYA 1A0KA 3RH8B 1XP4A 2VGLS 3WS4A 1VM1A 4RX3A 3L7HA 2V9AA 3NCKA 1K4EA 2G2UA 4BBVA 3VOLA 4JF4A 4WYYA 3BWLA 1BLCA 1ZC2A 3IX4A 3MZDA 4O0PA 4ME4A 3V50A 5M1AA 2JKRI 3VE4A 2XLNA 4KZ7A 1LL5A 2J3TC 1K57A 3A0SA 2FFYA 1XFQA 1ES2A 2D01A 2FZ0A 2GZAA 1PI4A 3BRMA 3FPWA 4LRYC 4IVKA 2EXAA 3IWIA 1I2WA 2CC1A 1HZOA 4B9OA 3D9YA 3PXPA 5G4ZA 4KG5A 2B95A 4OQGA 3IWOA 2R9WA 4NG2A 3F1NB 1YM1A 4ETZA 5IHVA 3V3SA 3IF6C 1H0MA 2OLUA 4DJ2A 5EVID 1K54A 3LEQA 4JPMA 3NDEA 4O8GA 2QJ5A 4X55A 2PAVP 1S1ZA 1L2SA 4S2KA 3HVFA 5E43A 3T1RA 4GNUA 2IWCA 1P9RA 4Y3IA 5DTKA 4ZRRA 3IH9A 1OMEA 5DF9A 1KGGA 1ZG6A 1AXBA 2O9AA 3TRCA 3DWZA 2HPBA 4MN6A 4QY6A 4OPYA 5GHZA 2WKIA 1ESUA 3T12B 4KQRA 4WEKA 5I94A 4S2OA 1UWNX 4R4RA 3W4OA 4HH3A 4ESPA 1TVFA 1PNEA 4MDZA 4IBXA 2VLGA 4E04A 4Q0JA 4Q0IA 4WMCD 4WZ5C 4L9GA 2JN7A 3IS2B 4RVAA 4QB8A 2HGVA 2M7UA 2W0NA 1X0OA 4HP9A 4WLAA 2A24A 1XX2A 3DWKA 4HNBA 1W7FA 2RL3A 3NI9A 3PAGA 4YINA 3ZCZA 4RA7A 3O5YA 1MWTA 3ZYTA 3Q7VA 4P6BA 3C4OA 4KZ3A 2WZXA 1BYWA 1D06A 1K6SA 1EROA 5KIZA 4HIAA 4HJ6A 4H8RA 5DF7A 1GSWA 1E3UD 1FCMA 1Q2QA 4QPRA 1ONGA 4CLCB 2HZ5A 1PW8A 4AFIA 3VOZA 3VMAA 4XT2B 3Q7ZA 1DP9A 3CUEC 1QMFA 1CQAA 1JWZA 4RYEA 3RXWA 2EX8A 3JYIA 5HDSA 2OWJA 2NUTC 5FAQA 3A3JA 1HD8A 4R0QA 2IWDA 3D3OA 2H5SA 4EUVA 2EXBA 4QHCA 4EEPA 2XA7S 3CJMA 4GHIA 2WZZA 2J80A 1NYYA 2P08A 2XROA 1P9WA 3SW1A 1GHIA 5EV0A 4S2NA 5HPIA 3HLBA 2Y2GA 1RCJA 4BWIA 4N92A 3EGXC 2HP5A 2HDRA 2V1AA 2XGNA 3BLSA 1K55A 4Y0TA 3IF6B 3BJNA 4CQHA 3UDXA 2WAFA 4KQQA 1PRQA 3QP2A 5EVEA 4U0XA 3UY6A 4Q0HA 2Y2OA 3HLEA 4DXCA 2Y2LA 4GZBA 2X01A 4ZBEA 3IF6A 4G3KA 5HAIA 5K5BA 5FQIA 4EERA 4FCFA 2A2LA 1NWZA 3S22A 3WWXA 3IS2A 3ZDJA 4UA6A 3A3EA 4K08A 4IUHA 3NC8A 4LPZA 3UDIA 4CJNA 3R7WB 2V0UA 3IXGA 2DCFA 5HWVA 4GS9A 4GB7A 4BBUA 1IEMA 3D72A 3O3VA 1N9BA 1JWVA 3KSHA 4E3JA 2INWA 4ARZB 1F2KA 4EESA 5L09A 1Z09A 1MC0A 4HH2A 4E6WA 4DDSA 3BY9A 1GA0A 4MBHA 4E3MA 5CXWA 4HESA 4LLOB 2WUQA 5CHMA 1NYMA 4OKPA 3VP0A 3GTCA 2L1MA 3P98A 5HX9A 4D60A 1FQGA 3OPLA 4PM8A 3DTMA 1FCNA 3HLCA 1BLPA 2H0TA 2L4RA 1H8ZA 4ZJ1A 3NY4A 1OTBA 1FSWA 5EECA 3Q82A 1YKDA 1Y4OA 1C3BA 1SZVA 1DRMA 2KDKA 1OTDA 2E8JA 1HTZA 3IBRA 1N4OA 5DKKA 4X1MA 1DJCA 3CLOA 1S6RA 2M7VA 5M19A 4GS9B 5EVIA 3IX3A 5A90A 2ACGA 3C7VA 4BMWA 3CI6A 3SS5A 4IHQA 1OTAA 2VZWA 3HLWA 3OPRA 4GW9A 1E3UA 4X56A 5TBMB 4R3BA 4R1GA 1FILA 4DN0A 4JXSA 1WE4A 2XD1A 1FOFA 3HBRA 5FDSA 4CLCD 2VV7A 1KOUA 4WELA 5FAPA 1PYYA 2VV6A 4ID4A 4NXFA 3MFDA 1XGIA 4LENA 4I39A 3S7PA 5AQ9A 4UHUA 2OAQ1 2EWWA 3MSHA 1GCEA 3T1QB 2GJ3A 3OLOA 2W3HA 3E2LA 4OQ0A 1WYBA 2HJEA 4S2JA 3MXSA 2OV5A 3LIDA 5CTNA 2VGKA 1BZAA 4MN7A 3G34A 4EXOA 2VJWA 3DW0A 2W3DA 3N7WA 1LLBA 4WL9A 2W1TA 2I72A 1IYPA 4BD1A 4R4SA 1UWPX 3FKVA 2J8YA 2QZ6A 1Z6FA 1PW1A 4X6TA 1OPXA 3PAEA 1H3QA 2JKFA 1LI9A 4WM9A 5J7EA 4Y0UA 3UE0A 5F83A 4NK3A 3E0YA 3MZEA 4H6JA 1L0GA 2ZM8A 5L2FA 3EQVA 2ZQCA 2BLSA 3KX0X 4IUKA 3ZVTA 3S7OA 3UPPA 5G18A 5EVLA 2ZM2A 5F5YA 2PYPA 2DNSA 3QP1A 4BJPA 3G4PA 5D3OA 4UA9A 5EOOA 2J3TD 2VA0A 4OOYA 4N1XA 3MFXA 3OOVA 5AVEA 1FSYA 2Q9NA 1DP8A 1XJ2A 5A93A 1CEFA 2C6WB 2WKHA 1PI5A 1FR1A 1ZG4A 3ZNYA 2HP6A 2OLVA 4OONA 5FATA 4EW7A 4KG6A 2EFUA 5EVIC 1XGJA 5IT5A 4N1HA 2V8CA 4FH2A 3S1YA 3BQ8A 4KQDA 5HAPA 5KSHA 1NLZA 5A91A 4P0MA 4A5RA 3SS3A 1IKGA 3TJZC 3NOTC 3WS5A 1CI8A 2ZQAA 2J9OA 1NRJA 3NIAA 3H82A 1YPRA 3OZHA 3C4PA 1DP6A 1TD5A 2YKHA 3MS6A 5HWTA 3R4KA 3B47A 3BY8A 3FYZA 4GCZA 3Q7VB 2Y2QA 4M4XA 3WS0A 2XF3A 2JC7A 1E4DA 2WKRA 3LEZA 4HQAA 1PZOA 3Q1FA 2H0YA 2W3FA 1GHMA 4Y0OA 2HV1A 3C38A 3V3RA 3BFEA 2C5WB 1W8QA 4EBLA 3U4LP 4OVDA 3PBNA 3TG9A 2LB9A 4BD0A 3O87A 4EV4A 3E4QA 5FQ9A 1P0ZA 1S66L 2MJ6A 1QMEA 3WRZA 2G2WA 4FOFA 1VEUB 1XJ6A 2P04A 1ACFA 1ZTUA 1I2SA 3W4PA 3IT9A 3BYDA 4P6ZM 3LO7A 3CAXA 4JXWA 4LRXC 2A24B 1MY8A 1VETB 4Y17A 1KVLA 4EBNA 5HSQA 1G68A 4Z1WA 3IXBA 2W1RA 1SHVA 2Y2NA 1V9ZA 5J8XA 4LCLA 3LYXA 4GOGA 2ZLYA 2EA9A 4E3OA 1XA7A 3S7NA 5CEDA 5L10A 4NXEA 2LB5A 2PU2A 4G3VA 2EX2A 2XH9A 1AWIA 4FH4A 5EM0A 4QWOA 2Y2PA 3MXQA 2VEAA 5FI7A 1SKOA 4E3KA 2ZMAA 3BFCA 3FC7A 4GD8A 3V67A 1V9YA 4PKYA 3C2WA 3H7WB 3FWLA 4O01A 5HL6A 3K3CA 4ZJ3A 3QP4A 5AQAA 2ZQ7A 2P7JA 3U2AA 1W79A 3GRJA 4MBFA 4QD4A 3H7WA 5DJTA 5FAOA 1JVJA 5U47A 4C75A 1HVBA 4HY8A 4OPRA 3ZVWA 3T1XA 2B18A 1LL8A 5F69A 1ERMA 2GDNA 4EU0A 4X68A 1F5MA 2XK1A 2R9XA 1PIOA 4B4ZA 3DTEA 2XDMA 4N9KA 1YMSA 1K54C 4E6XA 2PR5A 5DFXA 3JVVA 1XFNA 3IHBA 2Y55A 3CITA 5C5KA 1G28A 3F1OB 2JKTM 3EGDC 3WRTA 2PR6A 1H5XA 2O0YA 3IBJA 2ZD8A 1KVMA 5HDDA 2YKFA 1VHMA 2Z2LB 1FCOA 1VETA 5CHJA 4OOMA 2ZL1B 3M2KA 1K56D 4ZJ2A 5FSRA 3E2KA 4E3IA 1J3WA 1MWUA 2Y4AA 4LFUA 3TSGA 4EQIA 1U60A 1TS6A 2VX8A 1LSVA 3NHQA 3KSFA 3VP4A 4E3NA 4NXBA 2UWXA 3UPOA 4S2MA 4WZ4A 3MR0A 4XUZA 1Q2PA 3A3FA 2QYBA 5LBRA 3R7WA 1CJFA 3ZGAB 1KDWA 4I3JA 4QJGA 3S4XA 5EOEA 4MEZA 3HLGA 1KGEA 3QHYA 2EFXA 5CEBA 1W63M 3MQOA 5FA7A 1BLHA 3V5MA 4OLGA 1TDLA 3M6HA 4PPRA 3P7NA 5GLDA 1D7EA 4IEDA 2H10A 4R6LA 2KLIA 4PM6A 2CMNA 4HP4A 2NUPC 3TOIA 5FASA 5HDCA 5TBMA 1T1AA 3IWQA 4DE0A 5GL9A 1K6RA 3T4OA 4LV2A 1EI5A 2O9BA 4HEFA 2ZC7A 4WN5A 1K55C 3C5AA 4LCMA 1TS8A 4UEYA 5J3WA 3FKWA 2PU4A 2ZC4B 1TS7A 3H9WA 3P09A 2XEPA 4WEJA 1K0KA 4R70A 5TR7A 2DMWA 3HUMA 3FZCA 3BW6A 1MZUA 3IXDA 3PYPA 2FH5A 2KOIA 3IF5A 2PD7A 4HJ3A 1W5DA 2JE5A 3G32A 3VV4A 4EWFA 1CK3A 2P9VB 1RGZA 4DRTA 2PYRA 1CEGA 3CPTB 4Y2FA 4UQIM 2BTFP 5E2EA 1GSXA 2V0WA 2WGVA 5HD3A 2V20A 2Y2JA 1JNUA 4H6JB 4D2OA 4Y7PA 1T1CA 3B42A 3Q81A 4DE2A 4CLCC 5FL3A 4BLMA 1SDNA 5E2GA 5KZHA 1LSWA 2Y79A 4ZAMA 3IHAA 3UPNA 4X69A 4P85A 2VV8A 3HJKA 5HAQA 4KG2A 3PBSA 1JTDA 3SZTA 3E4PA 2WAEA 3UMEA 3MXRA 3W4QA 4I3IA 3VE3A 1RGYA 2ZM0A 2PD8A 3VSLA 4II7A 3HCYA 3UE1A 2A49A 1TF1A 1F9IA 1ALQA 2H28A 3ZQ5A 3PTEA 3KYZA 1M40A 3EOIA 4ETXA 1K56A 1STZA 3ITBA 2A3UA 4LV1A 3K2NA 5J4EA 2ZMFA 3P01A 2ZQ9A 3A0RA 2Q9MA 2O9CA 1XKZA 3LIBA 5MC7A 1YLZA 5F1FA 4EUZA 1VEUA 3MQQA 4PAUA 3RXXA 1T1BA 1XJ4A 5DF8A 1LL9A 4KZ8A 4XXRA 2ZJ9A 4GDNA 4KZBA 2ZQ8A 3DBAA 5FEGA 3JVUA 5IU1A 2ZMVA 5AJGA 1FIKA 3OBFA 4GN2A 4HOIA 3HUOA 2J9PA 3B3XA 1OT6A 3VFHA 3LR3A 3HLDA 2XQZA 3O88A 1ZHHB 2OAP1 4JF6A 4KUOA 3D4FA 4KZAA 4JGQA 1S0WA 4ZDXA 2G7UA 1YQSA 1YAXA 1LT0A 3N6IA 2QJ7A 3UO9A 3UDFA 3UB6A 3CPTA 3SH8A 1TS0A 3KSIA 2FFFB 3LI8A 2Y8HA 5GLCA 1L3LA 5IS1A 3HJIA 4MMNA 1IKIA 1IOUA 2PDRA 4UAAA 3T4JA 2PHYA 3OCNA 4KZ6A 3GV9A 4BENA 3LIAA 4HHDA 3UB9A 4Z9QA 4ARZA 3T4TA 2B5RA 5G4YA 4MNRA 3NDGA 3BLMA 3N8LA 5EFWA 3UMDA 4E3LA 4MCWA 4S2PA 3N4IA 2XA7M 3MKEA 4QY5A 4R23A 2HJ9C 3LGOA 2WADA 5HW3A 5CX7A 4PM5A 1ZKJA 3LFVA 2HP9A 3BM6A 1M6KA 2ZOIA 4G3WA 5JYPA 3UE6A 3CWFA 2PBDP 1PWDA 4OP5A 3W2ZA 3TE8A 2JKRM 4WMCA 4DXBA 1WYCA 1TEMA 1LHYA 3ISGA 5GLAA 1OTEA 2J3WA 1KE4A 3GR2A 4JLFA 4I5SA 2ZQDA 3N8RA 3H82B 4MN5A 2V2FF 1T19A 3MBZA 4JGOA 4NXGA 4WUJA 4Y13A 3SH7A 4R3JA 4U3TA 5DTSA 4FUWA 4DDYA 1IYOA 4K0WA 3NOUC 3HUNA 1N9LA 1YLWA 4JXGA 1MWSA 4OP8A 2W3EA 3CG5A 3GECA 4YNRA 1ERQA 4N9LA 3ZG7B 4Q8IA 3HLFA 5HWWA 4DMZA 2XD5A 2ZL1A 3F1OA 1ODVA 4S2LA 2Y2KA 4U0TA 4PM7A 2DRWA 5E2HA 4DKIA 4B4XA 4LV0A 3I7JA 4GHIB 1D1JA 2VGLM 2KX6A 5HPFA 4OOLA 4OLDA 4OPZA 1NZOA 5AQ7A 2ZBBA 4LRZE 3VFFA 1PWCA 4FSFA 3ZNTA 3UNWA 4BL2A 1KGFA 4NEED 5KSCA 2EX9A 4RQ9A 3LICA 4WZ5A 1ES4A 3MZFA 1NXYA 1S4RA 4KENB 1MBLA 3ZHHA 4CLCE 4EQ1A 4DJ3A 2JBFA 4HBTA 4S2NC 2W1TB 1SDEA 1ONHA 3NJAA 2JCHA 1XPBA 3QNCA 2JKTI 3G30A 3DAVA 2XFTA 4PMAA 1PWGA 3RTYA 2HDSA 3GDIA 1JTGA 3CUEA 3IH8A 4X53A 1KDSA 1YT4A 4PHTA 4XT2A 5FEFA 4M3KA 3AGEA 2IA2A 5GHYA 5F68A 3A3IA 3ULFA 4BBTA 5EE8A 2B02A 3VP2A 2XSSA 2D02A 3RFBA 1L0FA 4OQIA 3GVBA 3OPHA 4IBRA 3MQ0A 4KQOA 5A92A 4FD8A 3LI9A 5HARA 1RP5A 1YLPA 2E8IA 1NY0A 1MKIA 3E98A 5FQKA 1UGUA 3LR4A 4FTXA 4L0LA 3WS1A 3LY4A 2QPNA
chains in the Genus database with same CATH topology
2GJ3A 1NLYA 3BW6A 1MZUA 3OLOA 2JKRI 3EEAA 3VE4A 2W3HA 3PYPA 2ZOHA 2FH5A 2KOIA 1S67L 5F6AA 2J3TC 2HJEA 3A0SA 2PD7A 4HJ3A 1XFQA 2FZ0A 2D01A 3FPWA 2GZAA 4LRYC 4GLQA 2M1CA 3LIDA 3VV4A 4MN7A 5A8BA 3PBOA 4B9OA 3PBTA 3PXPA 3G6OA 5G4ZA 1WA9A 1OJ5A 2PYRA 4EEUA 4EXOA 4IJGA 1Y28A 3F1NB 2VJWA 4ETZA 4Y2FA 4UQIM 2W3DA 2GX5A 4WL9A 1GSXA 2V0WA 4B93A 5HD3A 4DJ2A 2W1TA 1JNUA 2GNXA 4H6JB 2JHEA 1UWPX 2QWSA 4O8GA 1T1CA 2QJ5A 3B42A 4CLCC 1OPXA 5L8MA 5FL3A 1S1ZA 1H3QA 1S4SA 3T4LA 4R38A 5J7EA 3K3DA 2K2NA 4YWZA 3E0YA 4H6JA 1LSWA 2Y79A 1P9RA 3EQVA 4KUKA 2VV8A 3HJKA 4Y3IA 1IFQA 3KX0X 4IUKA 4R3AA 3PBSA 4ZRRA 3S7OA 4JGRA 1W63Q 3E4PA 5DF9A 5F5YA 3UMEA 2PYPA 1G6OA 3PBRA 1N9NA 3OC2A 2O9AA 4BJPA 4I3IA 3B33A 3TRCA 3VE3A 1XJ3A 2PD8A 2J3TD 2VA0A 4MN6A 4II7A 3HCYA 2R78A 1TF1A 3MFXA 3OOVA 5AVEA 1F9IA 1DP8A 1XJ2A 4WEKA 2H28A 3ZQ5A 4F3LA 4F3LB 3KYZA 1UWNX 3EOIA 4ETXA 1STZA 4HH3A 5DFYA 3K2NA 4MDZA 4EW7A 5HD5A 5J4EA 2ZMFA 3P01A 3LIFA 2VLGA 4E04A 3PR6A 3A0RA 3FG8A 2O9CA 4Q0JA 4Q0IA 4HI4A 3LIBA 5MC7A 5IT5A 2WKQA 2L0WA 2Z6DA 3MQQA 4PAUA 1T1BA 1XJ4A 4L9GA 2JN7A 3TW8A 3LIEA 3IS2B 3BQ8A 4KQDA 5KSHA 2HGVA 1NLZA 3C8CA 2M7UA 3DBAA 3ICYA 2W0NA 3JVUA 1X0OA 4YOFA 5TJJA 3TJZC 3NOTC 5IU1A 2ZMVA 2QKPA 4HP9A 5AJGA 4WLAA 1YSPA 1NRJA 2A24A 3H82A 3OBFA 4HNBA 4HOIA 2WKPA 1OT6A 2V1BA 1DP6A 1VB6A 1TD5A 2YKHA 5HWTA 3O5YA 3R4KA 3B47A 3BY8A 4GCZA 3LR3A 3ZYTA 3NOPC 1ZHHB 4M4XA 1BYWA 1D06A 5KIZA 4HIAA 2OAP1 4HJ6A 2WKRA 4KUOA 4HQAA 4HJ4A 4PKYG 2W3FA 1GSWA 4JGQA 3T50A 2HV1A 2G7UA 3C38A 3KYQA 1GSVA 3LR5A 1YAXA 4QPRA 1LT0A 4WF0A 4CLCB 2QJ7A 3PBNA 2LB9A 3FPVA 3UB6A 3BQAA 4AFIA 3E4QA 1P0ZA 1S66L 2MJ6A 3UB8A 4XT2B 1TS0A 3KSIA 2I9VA 1DP9A 3LI8A 3F1PB 1T18A 4FOFA 2Y8HA 3CUEC 5IS1A 3S7QA 1XJ6A 3HJIA 4MMNA 2P04A 5HZHA 2EWVA 3MMHA 2O99A 1IOUA 1ZTUA 2PDRA 3T4JA 4P6ZS 2PHYA 5HDSA 3OCNA 2OWJA 2NUTC 1LSXA 3LIAA 4HHDA 4P6ZM 3UB9A 3CAXA 4LRXC 2A24B 3D3OA 3LR0A 3UB7A 4ARZA 3T4TA 5G4YA 1OTIA 4EUVA 5HSQA 1EW0A 4Z1WA 4EEPA 5EFWA 3UMDA 2XA7S 3EEHA 4MCWA 2W1RA 2W27A 4GHIA 1V9ZA 2J80A 2XA7M 2P08A 3LYXA 2XROA 1P9WA 2HJ9C 3SW1A 2EA9A 3S7NA 5HPIA 1OJGA 1N9OA 5CX7A 4BWIA 3EGXC 3LFVA 2V1AA 2LB5A 4NXEA 5AVFA 2ZOIA 4G3WA 4G3VA 3UE6A 3CWFA 3T4QA 3W2ZA 3TE8A 3BJNA 3MXQA 2VEAA 4CQHA 3FC7A 2JKRM 1F98A 3V67A 3KSGA 4EETB 1V9YA 4PKYA 3C2WA 3H7WB 4O01A 1OTEA 4L9EA 4Q0HA 5HL6A 3MF0A 2Z6CA 3K3CA 2J3WA 4I5SA 4G3KA 5K5BA 2OWHA 2PT7A 2HF6A 2BASA 4EERA 2P7JA 3H82B 2A2LA 4MN5A 1NWZA 3U2AA 1T19A 3IS2A 2OOLA 3H7WA 5DJTA 4JGOA 4NXGA 4WUJA 4HY8A 2B18A 4K08A 5DJUA 1LL8A 2K31A 4IUHA 5F69A 1MKMA 4EU0A 4LPZA 3NOUC 1F5MA 3R7WB 2V0UA 1N9LA 2W3EA 2K7SA 3GECA 4GJ4A 4I3AA 4YNRA 5HWVA 4GS9A 2PR5A 3A0VA 5DFXA 4BBUA 3JVVA 1XFNA 5HWWA 3D72A 4DMZA 3CITA 1P97A 5C5KA 4CLCA 1G28A 1ODVA 2JKTM 3EGDC 3F1OB 3F1OA 3KSHA 3T4SA 2INWA 3E4OA 4ARZB 2PR6A 3LUQA 1S1YA 2O0YA 3IBJA 4EESA 3F1NA 3PBQA 5HDDA 1MC0A 4HH2A 4Y5FA 3C30A 3BY9A 4GHIB 2YKFA 3UE3A 1VHMA 2VGLM 2VKSA 2KX6A 5HPFA 4OOLA 4OOMA 4JGPA 4LLOB 2XRNA 2ZBBA 2L1MA 4LRZE 3F1PA 4FSFA 1TS6A 2VX8A 1LSVA 3NHQA 1YSQA 5I5LA 3KSFA 4NEED 2L4RA 4RQ9A 3LICA 3EWKA 1OTBA 4NXBA 1H8MA 3MR0A 1YKDA 4I38A 2QYBA 1S4RA 5LBRA 3R7WA 1DRMA 1OT9A 2KDKA 1OTDA 4CLCE 4EQ1A 3T4KA 4I3JA 4DJ3A 3EQUA 4L9FA 3IBRA 2W1TB 3NJAA 4NKPA 5DKKA 3CLOA 1W63M 3MQOA 2JKTI 2W3GA 2QHKA 2M7VA 4GS9B 3P7NA 5DKLA 3RTYA 1D7EA 4UQIS 3GDIA 3CUEA 4BMWA 3CI6A 4R6LA 2KLIA 4PHTA 4IHQA 1OTAA 2CMNA 4HP4A 2NUPC 2VZWA 4XT2A 3KO6A 3OCLA 4GW9A 2IA2A 5HDCA 5TBMA 3MJQA 5TBMB 1T1AA 5F68A 3PHYA 4DN0A 3ULFA 4BBTA 3RH8B 2B02A 2XSSA 2D02A 3RFBA 4CLCD 2VGLS 2VV7A 3T4OA 1KOUA 4WELA 4KQOA 3MQ0A 2O9BA 3LI9A 2V9AA 2VV6A 4WN5A 4NXFA 4I39A 3S7PA 1TS8A 4BBVA 3VOLA 2OAQ1 3E98A 4UEYA 5J3WA 2EWWA 1UGUA 3LR4A 4L0LA 3BWLA 1TS7A 3H9WA 4WEJA 4R70A 4O0PA 4ME4A 2DMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HD5 A;  2GJ3 A;  2W27 A;  4GHI A;  5J4E A;  1V9Z A;  3LIF A;  2J80 A;  1MZU A;  2VLG A;  2ZBB A;  4E04 A;  3A0R A;  3OLO A;  2L1M A;  3PYP A;  4LRZ E;  2ZOH A;  3FG8 A;  3VE4 A;  3LYX A;  1S67 L;  4HI4 A;  3LIB A;  2WKQ A;  3F1P A;  5F6A A;  2L0W A;  2Z6D A;  3SW1 A;  1TS6 A;  2EA9 A;  3MQQ A;  3A0S A;  1T1B A;  2PD7 A;  4HJ3 A;  1XFQ A;  1XJ4 A;  2D01 A;  4L9G A;  1LSV A;  4LRY C;  3NHQ A;  2JN7 A;  3LIE A;  5I5L A;  2M1C A;  3IS2 B;  4WN5 A;  1OJG A;  2L4R A;  3LID A;  1N9O A;  4RQ9 A;  4KQD A;  3LIC A;  3EWK A;  5A8B A;  1OTB A;  3C8C A;  4NXB A;  2V1A A;  4NXE A;  4B9O A;  3ICY A;  2W0N A;  5AVF A;  1X0O A;  2ZOI A;  3G6O A;  3MR0 A;  3CWF A;  3UE6 A;  3NOT C;  5G4Z A;  1WA9 A;  5IU1 A;  1OJ5 A;  2PYR A;  2QKP A;  4HP9 A;  4I38 A;  3MXQ A;  4WLA A;  2VEA A;  4EEU A;  4EXO A;  1Y28 A;  2A24 A;  1S4R A;  3F1N B;  3H82 A;  4HNB A;  3FC7 A;  1F98 A;  4HOI A;  3UME A;  2WKP A;  4WL9 A;  1DRM A;  1GSX A;  1OT6 A;  1OT9 A;  2V0W A;  2V1B A;  4EET B;  1DP6 A;  1V9Y A;  1VB6 A;  1OTD A;  2KDK A;  4PKY A;  5HD3 A;  2YKH A;  3C2W A;  3H7W B;  5HWT A;  4DJ2 A;  4EQ1 A;  4I3J A;  1JNU A;  1OTE A;  3BY8 A;  4L9E A;  4DJ3 A;  4GCZ A;  5HWV A;  2Z6C A;  4H6J B;  2JHE A;  1UWP X;  3K3C A;  2QWS A;  3NOP C;  4L9F A;  3IBR A;  1T1C A;  2QJ5 A;  4I5S A;  3NJA A;  4M4X A;  5DKK A;  1BYW A;  1D06 A;  5KIZ A;  2OWH A;  4HIA A;  3CLO A;  4HJ6 A;  2BAS A;  4EER A;  2P7J A;  2WKR A;  3MQO A;  4KUO A;  4HQA A;  1S1Z A;  3H82 B;  4HJ4 A;  4PKY G;  4MN5 A;  1NWZ A;  1S4S A;  1GSW A;  2QHK A;  4JGQ A;  1T19 A;  3T50 A;  2HV1 A;  4R38 A;  5J7E A;  3IS2 A;  3K3D A;  4GS9 B;  2OOL A;  3H7W A;  1GSV A;  3P7N A;  5DJT A;  4JGO A;  5DKL A;  4YWZ A;  1LT0 A;  4WF0 A;  3RTY A;  1D7E A;  4H6J A;  4NXG A;  4WUJ A;  1LSW A;  2QJ7 A;  4HY8 A;  3GDI A;  4KUK A;  2VV8 A;  3HJK A;  1LL8 A;  4K08 A;  4R6L A;  5DJU A;  5F69 A;  3UB6 A;  3KX0 X;  3E4Q A;  1OTA A;  2CMN A;  4HP4 A;  1P0Z A;  1S66 L;  4LPZ A;  4R3A A;  3NOU C;  4XT2 B;  1TS0 A;  4XT2 A;  3UB8 A;  2I9V A;  4JGR A;  2V0U A;  1N9L A;  3E4P A;  1DP9 A;  3LI8 A;  4GW9 A;  5F5Y A;  2PYP A;  1T18 A;  3F1P B;  5HDC A;  1N9N A;  3MJQ A;  5TBM B;  2K7S A;  5TBM A;  3GEC A;  1T1A A;  5F68 A;  5IS1 A;  4I3A A;  1XJ6 A;  3B33 A;  3PHY A;  4I3I A;  3HJI A;  4GS9 A;  3ULF A;  3VE3 A;  1XJ3 A;  2PD8 A;  3RH8 B;  2B02 A;  4BBT A;  2PR5 A;  3A0V A;  5HZH A;  4BBU A;  1XFN A;  4MN6 A;  2D02 A;  2PDR A;  2VV7 A;  1KOU A;  2R78 A;  3D72 A;  5HWW A;  1P97 A;  2PHY A;  4R70 A;  5HDS A;  2OWJ A;  3MFX A;  5AVE A;  1G28 A;  1LSX A;  1ODV A;  3F1O B;  3F1O A;  3LIA A;  3LI9 A;  2INW A;  2V9A A;  2VV6 A;  2PR6 A;  3E4O A;  3LUQ A;  1F9I A;  1DP8 A;  4HHD A;  1XJ2 A;  1S1Y A;  4I39 A;  4NXF A;  3CAX A;  3UB9 A;  4LRX C;  4EES A;  2A24 B;  1TS8 A;  2H28 A;  3F1N A;  3UB7 A;  3ZQ5 A;  4BBV A;  4F3L B;  4F3L A;  1UWN X;  3VOL A;  5J3W A;  5HDD A;  4HH2 A;  5G4Y A;  1UGU A;  3BY9 A;  4GHI B;  1OTI A;  2YKF A;  3BWL A;  1TS7 A;  1EW0 A;  5HSQ A;  2KX6 A;  4HH3 A;  3H9W A;  4EEP A;  5EFW A;  3UMD A;  4JGP A;  3EEH A;  4LLO B;  4EW7 A; 
#chains in the Genus database with same CATH topology
 1NLY A;  3IQA A;  1BLS A;  3EEA A;  5GLB A;  4DE3 A;  2ZOH A;  4CPK A;  4P87 A;  1S67 L;  5F6A A;  3G35 A;  4GLQ A;  2M1C A;  1GA9 A;  1NRF A;  5A8B A;  3PBO A;  3ZG5 A;  1BUL A;  2Y2I A;  3PBT A;  1KE3 A;  5JYO A;  3G6O A;  3ITA A;  1WA9 A;  4BL3 A;  1OJ5 A;  3SOI A;  4EEU A;  4IJG A;  1Y28 A;  4C6Y A;  3M2J A;  1TDG A;  2GX5 A;  2WYX A;  4B93 A;  1O7E A;  3BEB A;  4LGW A;  3AGD A;  2GNX A;  2JHE A;  2QWS A;  3GSG A;  2PBY A;  3LCE A;  1EWZ A;  2WGI A;  5CTM A;  5L8M A;  1YLY A;  2ZC3 B;  1S4S A;  3T4L A;  4LV3 A;  4R38 A;  3K3D A;  2K2N A;  1PFL A;  2OSU A;  4YWZ A;  1XXM A;  2VGJ A;  2Y2M A;  3HRE A;  4KUK A;  1IFQ A;  1O07 A;  4R3A A;  3FV7 A;  4JGR A;  1W63 Q;  3PBR A;  1G6O A;  3UN7 A;  5TGF A;  1N9N A;  1E25 A;  3OC2 A;  4UA7 A;  4MBK A;  3B33 A;  1ES3 A;  3LY3 A;  1XJ3 A;  4MLL A;  2R78 A;  1VQQ A;  3ZFZ A;  1MWR A;  3UB5 P;  4F3L A;  4F3L B;  2X71 A;  5E2F A;  1I5Q A;  5FDH A;  5DFY A;  3Q07 A;  4O7D A;  5HD5 A;  3LIF A;  1G6A A;  4X1L A;  3PR6 A;  3FG8 A;  4EBP A;  1HLU P;  4HI4 A;  5F82 A;  2WKQ A;  2L0W A;  1PZP A;  2Z6D A;  3CMZ A;  1DY6 A;  3G2Z A;  3TW8 A;  3LIE A;  3BFD A;  5EUA A;  4X25 A;  3C8C A;  3IXH A;  3ICY A;  3NBL A;  5CGX A;  4YOF A;  4XUX A;  5TJJ A;  2UV0 E;  5FQJ A;  2QKP A;  1YSP A;  5F1G A;  5CGS A;  4JKT A;  2WKP A;  2V1B A;  1VB6 A;  4JBF A;  1K38 A;  4OPQ A;  3NOP C;  3KYE A;  4ZTK A;  1BUE A;  4RX2 A;  4DE1 A;  4HJ4 A;  4PKY G;  3W8K A;  5HL1 A;  5EPH A;  3T50 A;  3KYQ A;  1GSV A;  3LR5 A;  4C3Q A;  4WF0 A;  2WK0 A;  3GMW A;  3NUL A;  5GHX A;  3FPV A;  2EX6 A;  3BQA A;  3UB8 A;  3ZG0 A;  2Y59 A;  2I9V A;  1FR6 A;  1J9M A;  3C7U A;  3F1P B;  1T18 A;  2P74 A;  4JF5 A;  5DTT A;  3DTI A;  3S7Q A;  2WKE A;  1W8Y A;  5HZH A;  2EWV A;  3MMH A;  2O99 A;  3VP1 A;  5CGW A;  4P6Z S;  1H8Y A;  1ESI A;  1JWP A;  1XA1 A;  1LSX A;  2WGW A;  4KZ5 A;  1BT5 A;  3LR0 A;  3UB7 A;  2IWB A;  1NZU A;  1OTI A;  1EW0 A;  2Z2M B;  1K57 C;  3EEH A;  2XR0 A;  2J7V A;  4Y15 A;  2W27 A;  4OQH A;  1G5U A;  1NJ4 A;  3L9K A;  3BFF A;  1SKF A;  5CRF A;  2HDQ A;  5KMW A;  3ZG9 B;  2RCX A;  5L07 A;  1MPL A;  1OJG A;  1N9O A;  1CI9 A;  2Q0O A;  4KZ4 A;  5AVF A;  1LI0 A;  3T1S A;  3G31 A;  3T4Q A;  4BQM A;  1YLT A;  2Y2H A;  3VSK A;  3JPU A;  1F98 A;  3QP6 A;  3KSG A;  4EET B;  5EVI B;  2PRF A;  4GD6 A;  4L9E A;  4K91 A;  3MF0 A;  2Z6C A;  5DVA A;  1YLJ A;  4OH0 A;  2OWH A;  2PT7 A;  2HF6 A;  2BAS A;  5FQQ A;  2BG1 A;  1K25 A;  2OOL A;  3QP5 A;  4HBU A;  3BFG A;  3SH9 A;  2QMI A;  3BEC A;  2K31 A;  5DJU A;  1MKM A;  4B88 A;  3V39 A;  4S2I A;  5CHU A;  5AQB A;  2K7S A;  3OPP A;  4DF6 A;  5FQM A;  4GJ4 A;  4I3A A;  5FI6 A;  5CEC A;  3IX8 A;  2V8F A;  3A0V A;  3AGF A;  1P97 A;  5M18 A;  4F94 A;  4CLC A;  4JXV A;  4NET A;  1DJA A;  1IYQ A;  3T4S A;  3E4O A;  3CHW P;  3LUQ A;  1CF0 A;  1S1Y A;  4PM9 A;  4KZ9 A;  3F1N A;  3PBQ A;  2Y91 A;  1BTL A;  4Y5F A;  1KE0 A;  3C30 A;  1IYS A;  3G2Y A;  3UE3 A;  2VKS A;  1MXO A;  2X02 A;  4JGP A;  3QP8 A;  2XRN A;  1SKO B;  3M6B A;  2HDU A;  3WS2 A;  3F1P A;  1DJB A;  4WBG A;  2WGW B;  4IVI A;  3N8S A;  3NEC A;  3GQZ A;  1YSQ A;  5I5L A;  3VP3 A;  5BOH A;  3RJU A;  3EWK A;  5TFQ A;  1H8M A;  3CZD A;  3A3D A;  4I38 A;  3VOY A;  5EM1 A;  2ZC5 B;  3SS4 A;  1OT9 A;  1L0E A;  1GHP A;  3T4K A;  3EQU A;  2VK3 A;  4YFM A;  4L9F A;  1SCW A;  4NKP A;  4QU3 A;  1K4F A;  1IEL A;  2XFS A;  2W3G A;  2QHK A;  3DTK A;  2AVX A;  3ZG8 B;  5HFO A;  5DKL A;  1YMX A;  4GKU A;  1Y54 A;  2P9V A;  3MKF A;  4K0X A;  5CER A;  4UQI S;  4GDB A;  2JKG A;  3HL9 A;  3KO6 A;  3OCL A;  5FI2 A;  2V1Z A;  2ZC6 B;  1BSG A;  3MJQ A;  1ES5 A;  1L0D A;  3O86 A;  3QNB A;  3PHY A;  1A0K A;  3RH8 B;  1XP4 A;  2VGL S;  3WS4 A;  1VM1 A;  4RX3 A;  3L7H A;  2V9A A;  3NCK A;  1K4E A;  2G2U A;  4BBV A;  3VOL A;  4JF4 A;  4WYY A;  3BWL A;  1BLC A;  1ZC2 A;  3IX4 A;  3MZD A;  4O0P A;  4ME4 A;  3V50 A;  5M1A A;  2JKR I;  3VE4 A;  2XLN A;  4KZ7 A;  1LL5 A;  2J3T C;  1K57 A;  3A0S A;  2FFY A;  1XFQ A;  1ES2 A;  2D01 A;  2FZ0 A;  2GZA A;  1PI4 A;  3BRM A;  3FPW A;  4LRY C;  4IVK A;  2EXA A;  3IWI A;  1I2W A;  2CC1 A;  1HZO A;  4B9O A;  3D9Y A;  3PXP A;  5G4Z A;  4KG5 A;  2B95 A;  4OQG A;  3IWO A;  2R9W A;  4NG2 A;  3F1N B;  1YM1 A;  4ETZ A;  5IHV A;  3V3S A;  3IF6 C;  1H0M A;  2OLU A;  4DJ2 A;  5EVI D;  1K54 A;  3LEQ A;  4JPM A;  3NDE A;  4O8G A;  2QJ5 A;  4X55 A;  2PAV P;  1S1Z A;  1L2S A;  4S2K A;  3HVF A;  5E43 A;  3T1R A;  4GNU A;  2IWC A;  1P9R A;  4Y3I A;  5DTK A;  4ZRR A;  3IH9 A;  1OME A;  5DF9 A;  1KGG A;  1ZG6 A;  1AXB A;  2O9A A;  3TRC A;  3DWZ A;  2HPB A;  4MN6 A;  4QY6 A;  4OPY A;  5GHZ A;  2WKI A;  1ESU A;  3T12 B;  4KQR A;  4WEK A;  5I94 A;  4S2O A;  1UWN X;  4R4R A;  3W4O A;  4HH3 A;  4ESP A;  1TVF A;  1PNE A;  4MDZ A;  4IBX A;  2VLG A;  4E04 A;  4Q0J A;  4Q0I A;  4WMC D;  4WZ5 C;  4L9G A;  2JN7 A;  3IS2 B;  4RVA A;  4QB8 A;  2HGV A;  2M7U A;  2W0N A;  1X0O A;  4HP9 A;  4WLA A;  2A24 A;  1XX2 A;  3DWK A;  4HNB A;  1W7F A;  2RL3 A;  3NI9 A;  3PAG A;  4YIN A;  3ZCZ A;  4RA7 A;  3O5Y A;  1MWT A;  3ZYT A;  3Q7V A;  4P6B A;  3C4O A;  4KZ3 A;  2WZX A;  1BYW A;  1D06 A;  1K6S A;  1ERO A;  5KIZ A;  4HIA A;  4HJ6 A;  4H8R A;  5DF7 A;  1GSW A;  1E3U D;  1FCM A;  1Q2Q A;  4QPR A;  1ONG A;  4CLC B;  2HZ5 A;  1PW8 A;  4AFI A;  3VOZ A;  3VMA A;  4XT2 B;  3Q7Z A;  1DP9 A;  3CUE C;  1QMF A;  1CQA A;  1JWZ A;  4RYE A;  3RXW A;  2EX8 A;  3JYI A;  5HDS A;  2OWJ A;  2NUT C;  5FAQ A;  3A3J A;  1HD8 A;  4R0Q A;  2IWD A;  3D3O A;  2H5S A;  4EUV A;  2EXB A;  4QHC A;  4EEP A;  2XA7 S;  3CJM A;  4GHI A;  2WZZ A;  2J80 A;  1NYY A;  2P08 A;  2XRO A;  1P9W A;  3SW1 A;  1GHI A;  5EV0 A;  4S2N A;  5HPI A;  3HLB A;  2Y2G A;  1RCJ A;  4BWI A;  4N92 A;  3EGX C;  2HP5 A;  2HDR A;  2V1A A;  2XGN A;  3BLS A;  1K55 A;  4Y0T A;  3IF6 B;  3BJN A;  4CQH A;  3UDX A;  2WAF A;  4KQQ A;  1PRQ A;  3QP2 A;  5EVE A;  4U0X A;  3UY6 A;  4Q0H A;  2Y2O A;  3HLE A;  4DXC A;  2Y2L A;  4GZB A;  2X01 A;  4ZBE A;  3IF6 A;  4G3K A;  5HAI A;  5K5B A;  5FQI A;  4EER A;  4FCF A;  2A2L A;  1NWZ A;  3S22 A;  3WWX A;  3IS2 A;  3ZDJ A;  4UA6 A;  3A3E A;  4K08 A;  4IUH A;  3NC8 A;  4LPZ A;  3UDI A;  4CJN A;  3R7W B;  2V0U A;  3IXG A;  2DCF A;  5HWV A;  4GS9 A;  4GB7 A;  4BBU A;  1IEM A;  3D72 A;  3O3V A;  1N9B A;  1JWV A;  3KSH A;  4E3J A;  2INW A;  4ARZ B;  1F2K A;  4EES A;  5L09 A;  1Z09 A;  1MC0 A;  4HH2 A;  4E6W A;  4DDS A;  3BY9 A;  1GA0 A;  4MBH A;  4E3M A;  5CXW A;  4HES A;  4LLO B;  2WUQ A;  5CHM A;  1NYM A;  4OKP A;  3VP0 A;  3GTC A;  2L1M A;  3P98 A;  5HX9 A;  4D60 A;  1FQG A;  3OPL A;  4PM8 A;  3DTM A;  1FCN A;  3HLC A;  1BLP A;  2H0T A;  2L4R A;  1H8Z A;  4ZJ1 A;  3NY4 A;  1OTB A;  1FSW A;  5EEC A;  3Q82 A;  1YKD A;  1Y4O A;  1C3B A;  1SZV A;  1DRM A;  2KDK A;  1OTD A;  2E8J A;  1HTZ A;  3IBR A;  1N4O A;  5DKK A;  4X1M A;  1DJC A;  3CLO A;  1S6R A;  2M7V A;  5M19 A;  4GS9 B;  5EVI A;  3IX3 A;  5A90 A;  2ACG A;  3C7V A;  4BMW A;  3CI6 A;  3SS5 A;  4IHQ A;  1OTA A;  2VZW A;  3HLW A;  3OPR A;  4GW9 A;  1E3U A;  4X56 A;  5TBM B;  4R3B A;  4R1G A;  1FIL A;  4DN0 A;  4JXS A;  1WE4 A;  2XD1 A;  1FOF A;  3HBR A;  5FDS A;  4CLC D;  2VV7 A;  1KOU A;  4WEL A;  5FAP A;  1PYY A;  2VV6 A;  4ID4 A;  4NXF A;  3MFD A;  1XGI A;  4LEN A;  4I39 A;  3S7P A;  5AQ9 A;  4UHU A;  2OAQ 1;  2EWW A;  3MSH A;  1GCE A;  3T1Q B;  2GJ3 A;  3OLO A;  2W3H A;  3E2L A;  4OQ0 A;  1WYB A;  2HJE A;  4S2J A;  3MXS A;  2OV5 A;  3LID A;  5CTN A;  2VGK A;  1BZA A;  4MN7 A;  3G34 A;  4EXO A;  2VJW A;  3DW0 A;  2W3D A;  3N7W A;  1LLB A;  4WL9 A;  2W1T A;  2I72 A;  1IYP A;  4BD1 A;  4R4S A;  1UWP X;  3FKV A;  2J8Y A;  2QZ6 A;  1Z6F A;  1PW1 A;  4X6T A;  1OPX A;  3PAE A;  1H3Q A;  2JKF A;  1LI9 A;  4WM9 A;  5J7E A;  4Y0U A;  3UE0 A;  5F83 A;  4NK3 A;  3E0Y A;  3MZE A;  4H6J A;  1L0G A;  2ZM8 A;  5L2F A;  3EQV A;  2ZQC A;  2BLS A;  3KX0 X;  4IUK A;  3ZVT A;  3S7O A;  3UPP A;  5G18 A;  5EVL A;  2ZM2 A;  5F5Y A;  2PYP A;  2DNS A;  3QP1 A;  4BJP A;  3G4P A;  5D3O A;  4UA9 A;  5EOO A;  2J3T D;  2VA0 A;  4OOY A;  4N1X A;  3MFX A;  3OOV A;  5AVE A;  1FSY A;  2Q9N A;  1DP8 A;  1XJ2 A;  5A93 A;  1CEF A;  2C6W B;  2WKH A;  1PI5 A;  1FR1 A;  1ZG4 A;  3ZNY A;  2HP6 A;  2OLV A;  4OON A;  5FAT A;  4EW7 A;  4KG6 A;  2EFU A;  5EVI C;  1XGJ A;  5IT5 A;  4N1H A;  2V8C A;  4FH2 A;  3S1Y A;  3BQ8 A;  4KQD A;  5HAP A;  5KSH A;  1NLZ A;  5A91 A;  4P0M A;  4A5R A;  3SS3 A;  1IKG A;  3TJZ C;  3NOT C;  3WS5 A;  1CI8 A;  2ZQA A;  2J9O A;  1NRJ A;  3NIA A;  3H82 A;  1YPR A;  3OZH A;  3C4P A;  1DP6 A;  1TD5 A;  2YKH A;  3MS6 A;  5HWT A;  3R4K A;  3B47 A;  3BY8 A;  3FYZ A;  4GCZ A;  3Q7V B;  2Y2Q A;  4M4X A;  3WS0 A;  2XF3 A;  2JC7 A;  1E4D A;  2WKR A;  3LEZ A;  4HQA A;  1PZO A;  3Q1F A;  2H0Y A;  2W3F A;  1GHM A;  4Y0O A;  2HV1 A;  3C38 A;  3V3R A;  3BFE A;  2C5W B;  1W8Q A;  4EBL A;  3U4L P;  4OVD A;  3PBN A;  3TG9 A;  2LB9 A;  4BD0 A;  3O87 A;  4EV4 A;  3E4Q A;  5FQ9 A;  1P0Z A;  1S66 L;  2MJ6 A;  1QME A;  3WRZ A;  2G2W A;  4FOF A;  1VEU B;  1XJ6 A;  2P04 A;  1ACF A;  1ZTU A;  1I2S A;  3W4P A;  3IT9 A;  3BYD A;  4P6Z M;  3LO7 A;  3CAX A;  4JXW A;  4LRX C;  2A24 B;  1MY8 A;  1VET B;  4Y17 A;  1KVL A;  4EBN A;  5HSQ A;  1G68 A;  4Z1W A;  3IXB A;  2W1R A;  1SHV A;  2Y2N A;  1V9Z A;  5J8X A;  4LCL A;  3LYX A;  4GOG A;  2ZLY A;  2EA9 A;  4E3O A;  1XA7 A;  3S7N A;  5CED A;  5L10 A;  4NXE A;  2LB5 A;  2PU2 A;  4G3V A;  2EX2 A;  2XH9 A;  1AWI A;  4FH4 A;  5EM0 A;  4QWO A;  2Y2P A;  3MXQ A;  2VEA A;  5FI7 A;  1SKO A;  4E3K A;  2ZMA A;  3BFC A;  3FC7 A;  4GD8 A;  3V67 A;  1V9Y A;  4PKY A;  3C2W A;  3H7W B;  3FWL A;  4O01 A;  5HL6 A;  3K3C A;  4ZJ3 A;  3QP4 A;  5AQA A;  2ZQ7 A;  2P7J A;  3U2A A;  1W79 A;  3GRJ A;  4MBF A;  4QD4 A;  3H7W A;  5DJT A;  5FAO A;  1JVJ A;  5U47 A;  4C75 A;  1HVB A;  4HY8 A;  4OPR A;  3ZVW A;  3T1X A;  2B18 A;  1LL8 A;  5F69 A;  1ERM A;  2GDN A;  4EU0 A;  4X68 A;  1F5M A;  2XK1 A;  2R9X A;  1PIO A;  4B4Z A;  3DTE A;  2XDM A;  4N9K A;  1YMS A;  1K54 C;  4E6X A;  2PR5 A;  5DFX A;  3JVV A;  1XFN A;  3IHB A;  2Y55 A;  3CIT A;  5C5K A;  1G28 A;  3F1O B;  2JKT M;  3EGD C;  3WRT A;  2PR6 A;  1H5X A;  2O0Y A;  3IBJ A;  2ZD8 A;  1KVM A;  5HDD A;  2YKF A;  1VHM A;  2Z2L B;  1FCO A;  1VET A;  5CHJ A;  4OOM A;  2ZL1 B;  3M2K A;  1K56 D;  4ZJ2 A;  5FSR A;  3E2K A;  4E3I A;  1J3W A;  1MWU A;  2Y4A A;  4LFU A;  3TSG A;  4EQI A;  1U60 A;  1TS6 A;  2VX8 A;  1LSV A;  3NHQ A;  3KSF A;  3VP4 A;  4E3N A;  4NXB A;  2UWX A;  3UPO A;  4S2M A;  4WZ4 A;  3MR0 A;  4XUZ A;  1Q2P A;  3A3F A;  2QYB A;  5LBR A;  3R7W A;  1CJF A;  3ZGA B;  1KDW A;  4I3J A;  4QJG A;  3S4X A;  5EOE A;  4MEZ A;  3HLG A;  1KGE A;  3QHY A;  2EFX A;  5CEB A;  1W63 M;  3MQO A;  5FA7 A;  1BLH A;  3V5M A;  4OLG A;  1TDL A;  3M6H A;  4PPR A;  3P7N A;  5GLD A;  1D7E A;  4IED A;  2H10 A;  4R6L A;  2KLI A;  4PM6 A;  2CMN A;  4HP4 A;  2NUP C;  3TOI A;  5FAS A;  5HDC A;  5TBM A;  1T1A A;  3IWQ A;  4DE0 A;  5GL9 A;  1K6R A;  3T4O A;  4LV2 A;  1EI5 A;  2O9B A;  4HEF A;  2ZC7 A;  4WN5 A;  1K55 C;  3C5A A;  4LCM A;  1TS8 A;  4UEY A;  5J3W A;  3FKW A;  2PU4 A;  2ZC4 B;  1TS7 A;  3H9W A;  3P09 A;  2XEP A;  4WEJ A;  1K0K A;  4R70 A;  5TR7 A;  2DMW A;  3HUM A;  3FZC A;  3BW6 A;  1MZU A;  3IXD A;  3PYP A;  2FH5 A;  2KOI A;  3IF5 A;  2PD7 A;  4HJ3 A;  1W5D A;  2JE5 A;  3G32 A;  3VV4 A;  4EWF A;  1CK3 A;  2P9V B;  1RGZ A;  4DRT A;  2PYR A;  1CEG A;  3CPT B;  4Y2F A;  4UQI M;  2BTF P;  5E2E A;  1GSX A;  2V0W A;  2WGV A;  5HD3 A;  2V20 A;  2Y2J A;  1JNU A;  4H6J B;  4D2O A;  4Y7P A;  1T1C A;  3B42 A;  3Q81 A;  4DE2 A;  4CLC C;  5FL3 A;  4BLM A;  1SDN A;  5E2G A;  5KZH A;  1LSW A;  2Y79 A;  4ZAM A;  3IHA A;  3UPN A;  4X69 A;  4P85 A;  2VV8 A;  3HJK A;  5HAQ A;  4KG2 A;  3PBS A;  1JTD A;  3SZT A;  3E4P A;  2WAE A;  3UME A;  3MXR A;  3W4Q A;  4I3I A;  3VE3 A;  1RGY A;  2ZM0 A;  2PD8 A;  3VSL A;  4II7 A;  3HCY A;  3UE1 A;  2A49 A;  1TF1 A;  1F9I A;  1ALQ A;  2H28 A;  3ZQ5 A;  3PTE A;  3KYZ A;  1M40 A;  3EOI A;  4ETX A;  1K56 A;  1STZ A;  3ITB A;  2A3U A;  4LV1 A;  3K2N A;  5J4E A;  2ZMF A;  3P01 A;  2ZQ9 A;  3A0R A;  2Q9M A;  2O9C A;  1XKZ A;  3LIB A;  5MC7 A;  1YLZ A;  5F1F A;  4EUZ A;  1VEU A;  3MQQ A;  4PAU A;  3RXX A;  1T1B A;  1XJ4 A;  5DF8 A;  1LL9 A;  4KZ8 A;  4XXR A;  2ZJ9 A;  4GDN A;  4KZB A;  2ZQ8 A;  3DBA A;  5FEG A;  3JVU A;  5IU1 A;  2ZMV A;  5AJG A;  1FIK A;  3OBF A;  4GN2 A;  4HOI A;  3HUO A;  2J9P A;  3B3X A;  1OT6 A;  3VFH A;  3LR3 A;  3HLD A;  2XQZ A;  3O88 A;  1ZHH B;  2OAP 1;  4JF6 A;  4KUO A;  3D4F A;  4KZA A;  4JGQ A;  1S0W A;  4ZDX A;  2G7U A;  1YQS A;  1YAX A;  1LT0 A;  3N6I A;  2QJ7 A;  3UO9 A;  3UDF A;  3UB6 A;  3CPT A;  3SH8 A;  1TS0 A;  3KSI A;  2FFF B;  3LI8 A;  2Y8H A;  5GLC A;  1L3L A;  5IS1 A;  3HJI A;  4MMN A;  1IKI A;  1IOU A;  2PDR A;  4UAA A;  3T4J A;  2PHY A;  3OCN A;  4KZ6 A;  3GV9 A;  4BEN A;  3LIA A;  4HHD A;  3UB9 A;  4Z9Q A;  4ARZ A;  3T4T A;  2B5R A;  5G4Y A;  4MNR A;  3NDG A;  3BLM A;  3N8L A;  5EFW A;  3UMD A;  4E3L A;  4MCW A;  4S2P A;  3N4I A;  2XA7 M;  3MKE A;  4QY5 A;  4R23 A;  2HJ9 C;  3LGO A;  2WAD A;  5HW3 A;  5CX7 A;  4PM5 A;  1ZKJ A;  3LFV A;  2HP9 A;  3BM6 A;  1M6K A;  2ZOI A;  4G3W A;  5JYP A;  3UE6 A;  3CWF A;  2PBD P;  1PWD A;  4OP5 A;  3W2Z A;  3TE8 A;  2JKR M;  4WMC A;  4DXB A;  1WYC A;  1TEM A;  1LHY A;  3ISG A;  5GLA A;  1OTE A;  2J3W A;  1KE4 A;  3GR2 A;  4JLF A;  4I5S A;  2ZQD A;  3N8R A;  3H82 B;  4MN5 A;  2V2F F;  1T19 A;  3MBZ A;  4JGO A;  4NXG A;  4WUJ A;  4Y13 A;  3SH7 A;  4R3J A;  4U3T A;  5DTS A;  4FUW A;  4DDY A;  1IYO A;  4K0W A;  3NOU C;  3HUN A;  1N9L A;  1YLW A;  4JXG A;  1MWS A;  4OP8 A;  2W3E A;  3CG5 A;  3GEC A;  4YNR A;  1ERQ A;  4N9L A;  3ZG7 B;  4Q8I A;  3HLF A;  5HWW A;  4DMZ A;  2XD5 A;  2ZL1 A;  3F1O A;  1ODV A;  4S2L A;  2Y2K A;  4U0T A;  4PM7 A;  2DRW A;  5E2H A;  4DKI A;  4B4X A;  4LV0 A;  3I7J A;  4GHI B;  1D1J A;  2VGL M;  2KX6 A;  5HPF A;  4OOL A;  4OLD A;  4OPZ A;  1NZO A;  5AQ7 A;  2ZBB A;  4LRZ E;  3VFF A;  1PWC A;  4FSF A;  3ZNT A;  3UNW A;  4BL2 A;  1KGF A;  4NEE D;  5KSC A;  2EX9 A;  4RQ9 A;  3LIC A;  4WZ5 A;  1ES4 A;  3MZF A;  1NXY A;  1S4R A;  4KEN B;  1MBL A;  3ZHH A;  4CLC E;  4EQ1 A;  4DJ3 A;  2JBF A;  4HBT A;  4S2N C;  2W1T B;  1SDE A;  1ONH A;  3NJA A;  2JCH A;  1XPB A;  3QNC A;  2JKT I;  3G30 A;  3DAV A;  2XFT A;  4PMA A;  1PWG A;  3RTY A;  2HDS A;  3GDI A;  1JTG A;  3CUE A;  3IH8 A;  4X53 A;  1KDS A;  1YT4 A;  4PHT A;  4XT2 A;  5FEF A;  4M3K A;  3AGE A;  2IA2 A;  5GHY A;  5F68 A;  3A3I A;  3ULF A;  4BBT A;  5EE8 A;  2B02 A;  3VP2 A;  2XSS A;  2D02 A;  3RFB A;  1L0F A;  4OQI A;  3GVB A;  3OPH A;  4IBR A;  3MQ0 A;  4KQO A;  5A92 A;  4FD8 A;  3LI9 A;  5HAR A;  1RP5 A;  1YLP A;  2E8I A;  1NY0 A;  1MKI A;  3E98 A;  5FQK A;  1UGU A;  3LR4 A;  4FTX A;  4L0L A;  3WS1 A;  3LY4 A;  2QPN A; 
#chains in the Genus database with same CATH homology
 2GJ3 A;  1NLY A;  3BW6 A;  1MZU A;  3OLO A;  2JKR I;  3EEA A;  3VE4 A;  2W3H A;  3PYP A;  2ZOH A;  2FH5 A;  2KOI A;  1S67 L;  5F6A A;  2J3T C;  2HJE A;  3A0S A;  2PD7 A;  4HJ3 A;  1XFQ A;  2FZ0 A;  2D01 A;  3FPW A;  2GZA A;  4LRY C;  4GLQ A;  2M1C A;  3LID A;  3VV4 A;  4MN7 A;  5A8B A;  3PBO A;  4B9O A;  3PBT A;  3PXP A;  3G6O A;  5G4Z A;  1WA9 A;  1OJ5 A;  2PYR A;  4EEU A;  4EXO A;  4IJG A;  1Y28 A;  3F1N B;  2VJW A;  4ETZ A;  4Y2F A;  4UQI M;  2W3D A;  2GX5 A;  4WL9 A;  1GSX A;  2V0W A;  4B93 A;  5HD3 A;  4DJ2 A;  2W1T A;  1JNU A;  2GNX A;  4H6J B;  2JHE A;  1UWP X;  2QWS A;  4O8G A;  1T1C A;  2QJ5 A;  3B42 A;  4CLC C;  1OPX A;  5L8M A;  5FL3 A;  1S1Z A;  1H3Q A;  1S4S A;  3T4L A;  4R38 A;  5J7E A;  3K3D A;  2K2N A;  4YWZ A;  3E0Y A;  4H6J A;  1LSW A;  2Y79 A;  1P9R A;  3EQV A;  4KUK A;  2VV8 A;  3HJK A;  4Y3I A;  1IFQ A;  3KX0 X;  4IUK A;  4R3A A;  3PBS A;  4ZRR A;  3S7O A;  4JGR A;  1W63 Q;  3E4P A;  5DF9 A;  5F5Y A;  3UME A;  2PYP A;  1G6O A;  3PBR A;  1N9N A;  3OC2 A;  2O9A A;  4BJP A;  4I3I A;  3B33 A;  3TRC A;  3VE3 A;  1XJ3 A;  2PD8 A;  2J3T D;  2VA0 A;  4MN6 A;  4II7 A;  3HCY A;  2R78 A;  1TF1 A;  3MFX A;  3OOV A;  5AVE A;  1F9I A;  1DP8 A;  1XJ2 A;  4WEK A;  2H28 A;  3ZQ5 A;  4F3L A;  4F3L B;  3KYZ A;  1UWN X;  3EOI A;  4ETX A;  1STZ A;  4HH3 A;  5DFY A;  3K2N A;  4MDZ A;  4EW7 A;  5HD5 A;  5J4E A;  2ZMF A;  3P01 A;  3LIF A;  2VLG A;  4E04 A;  3PR6 A;  3A0R A;  3FG8 A;  2O9C A;  4Q0J A;  4Q0I A;  4HI4 A;  3LIB A;  5MC7 A;  5IT5 A;  2WKQ A;  2L0W A;  2Z6D A;  3MQQ A;  4PAU A;  1T1B A;  1XJ4 A;  4L9G A;  2JN7 A;  3TW8 A;  3LIE A;  3IS2 B;  3BQ8 A;  4KQD A;  5KSH A;  2HGV A;  1NLZ A;  3C8C A;  2M7U A;  3DBA A;  3ICY A;  2W0N A;  3JVU A;  1X0O A;  4YOF A;  5TJJ A;  3TJZ C;  3NOT C;  5IU1 A;  2ZMV A;  2QKP A;  4HP9 A;  5AJG A;  4WLA A;  1YSP A;  1NRJ A;  2A24 A;  3H82 A;  3OBF A;  4HNB A;  4HOI A;  2WKP A;  1OT6 A;  2V1B A;  1DP6 A;  1VB6 A;  1TD5 A;  2YKH A;  5HWT A;  3O5Y A;  3R4K A;  3B47 A;  3BY8 A;  4GCZ A;  3LR3 A;  3ZYT A;  3NOP C;  1ZHH B;  4M4X A;  1BYW A;  1D06 A;  5KIZ A;  4HIA A;  2OAP 1;  4HJ6 A;  2WKR A;  4KUO A;  4HQA A;  4HJ4 A;  4PKY G;  2W3F A;  1GSW A;  4JGQ A;  3T50 A;  2HV1 A;  2G7U A;  3C38 A;  3KYQ A;  1GSV A;  3LR5 A;  1YAX A;  4QPR A;  1LT0 A;  4WF0 A;  4CLC B;  2QJ7 A;  3PBN A;  2LB9 A;  3FPV A;  3UB6 A;  3BQA A;  4AFI A;  3E4Q A;  1P0Z A;  1S66 L;  2MJ6 A;  3UB8 A;  4XT2 B;  1TS0 A;  3KSI A;  2I9V A;  1DP9 A;  3LI8 A;  3F1P B;  1T18 A;  4FOF A;  2Y8H A;  3CUE C;  5IS1 A;  3S7Q A;  1XJ6 A;  3HJI A;  4MMN A;  2P04 A;  5HZH A;  2EWV A;  3MMH A;  2O99 A;  1IOU A;  1ZTU A;  2PDR A;  3T4J A;  4P6Z S;  2PHY A;  5HDS A;  3OCN A;  2OWJ A;  2NUT C;  1LSX A;  3LIA A;  4HHD A;  4P6Z M;  3UB9 A;  3CAX A;  4LRX C;  2A24 B;  3D3O A;  3LR0 A;  3UB7 A;  4ARZ A;  3T4T A;  5G4Y A;  1OTI A;  4EUV A;  5HSQ A;  1EW0 A;  4Z1W A;  4EEP A;  5EFW A;  3UMD A;  2XA7 S;  3EEH A;  4MCW A;  2W1R A;  2W27 A;  4GHI A;  1V9Z A;  2J80 A;  2XA7 M;  2P08 A;  3LYX A;  2XRO A;  1P9W A;  2HJ9 C;  3SW1 A;  2EA9 A;  3S7N A;  5HPI A;  1OJG A;  1N9O A;  5CX7 A;  4BWI A;  3EGX C;  3LFV A;  2V1A A;  2LB5 A;  4NXE A;  5AVF A;  2ZOI A;  4G3W A;  4G3V A;  3UE6 A;  3CWF A;  3T4Q A;  3W2Z A;  3TE8 A;  3BJN A;  3MXQ A;  2VEA A;  4CQH A;  3FC7 A;  2JKR M;  1F98 A;  3V67 A;  3KSG A;  4EET B;  1V9Y A;  4PKY A;  3C2W A;  3H7W B;  4O01 A;  1OTE A;  4L9E A;  4Q0H A;  5HL6 A;  3MF0 A;  2Z6C A;  3K3C A;  2J3W A;  4I5S A;  4G3K A;  5K5B A;  2OWH A;  2PT7 A;  2HF6 A;  2BAS A;  4EER A;  2P7J A;  3H82 B;  2A2L A;  4MN5 A;  1NWZ A;  3U2A A;  1T19 A;  3IS2 A;  2OOL A;  3H7W A;  5DJT A;  4JGO A;  4NXG A;  4WUJ A;  4HY8 A;  2B18 A;  4K08 A;  5DJU A;  1LL8 A;  2K31 A;  4IUH A;  5F69 A;  1MKM A;  4EU0 A;  4LPZ A;  3NOU C;  1F5M A;  3R7W B;  2V0U A;  1N9L A;  2W3E A;  2K7S A;  3GEC A;  4GJ4 A;  4I3A A;  4YNR A;  5HWV A;  4GS9 A;  2PR5 A;  3A0V A;  5DFX A;  4BBU A;  3JVV A;  1XFN A;  5HWW A;  3D72 A;  4DMZ A;  3CIT A;  1P97 A;  5C5K A;  4CLC A;  1G28 A;  1ODV A;  2JKT M;  3EGD C;  3F1O B;  3F1O A;  3KSH A;  3T4S A;  2INW A;  3E4O A;  4ARZ B;  2PR6 A;  3LUQ A;  1S1Y A;  2O0Y A;  3IBJ A;  4EES A;  3F1N A;  3PBQ A;  5HDD A;  1MC0 A;  4HH2 A;  4Y5F A;  3C30 A;  3BY9 A;  4GHI B;  2YKF A;  3UE3 A;  1VHM A;  2VGL M;  2VKS A;  2KX6 A;  5HPF A;  4OOL A;  4OOM A;  4JGP A;  4LLO B;  2XRN A;  2ZBB A;  2L1M A;  4LRZ E;  3F1P A;  4FSF A;  1TS6 A;  2VX8 A;  1LSV A;  3NHQ A;  1YSQ A;  5I5L A;  3KSF A;  4NEE D;  2L4R A;  4RQ9 A;  3LIC A;  3EWK A;  1OTB A;  4NXB A;  1H8M A;  3MR0 A;  1YKD A;  4I38 A;  2QYB A;  1S4R A;  5LBR A;  3R7W A;  1DRM A;  1OT9 A;  2KDK A;  1OTD A;  4CLC E;  4EQ1 A;  3T4K A;  4I3J A;  4DJ3 A;  3EQU A;  4L9F A;  3IBR A;  2W1T B;  3NJA A;  4NKP A;  5DKK A;  3CLO A;  1W63 M;  3MQO A;  2JKT I;  2W3G A;  2QHK A;  2M7V A;  4GS9 B;  3P7N A;  5DKL A;  3RTY A;  1D7E A;  4UQI S;  3GDI A;  3CUE A;  4BMW A;  3CI6 A;  4R6L A;  2KLI A;  4PHT A;  4IHQ A;  1OTA A;  2CMN A;  4HP4 A;  2NUP C;  2VZW A;  4XT2 A;  3KO6 A;  3OCL A;  4GW9 A;  2IA2 A;  5HDC A;  5TBM A;  3MJQ A;  5TBM B;  1T1A A;  5F68 A;  3PHY A;  4DN0 A;  3ULF A;  4BBT A;  3RH8 B;  2B02 A;  2XSS A;  2D02 A;  3RFB A;  4CLC D;  2VGL S;  2VV7 A;  3T4O A;  1KOU A;  4WEL A;  4KQO A;  3MQ0 A;  2O9B A;  3LI9 A;  2V9A A;  2VV6 A;  4WN5 A;  4NXF A;  4I39 A;  3S7P A;  1TS8 A;  4BBV A;  3VOL A;  2OAQ 1;  3E98 A;  4UEY A;  5J3W A;  2EWW A;  1UGU A;  3LR4 A;  4L0L A;  3BWL A;  1TS7 A;  3H9W A;  4WEJ A;  4R70 A;  4O0P A;  4ME4 A;  2DMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...