1V9YA

Crystal structure of the heme pas sensor domain of ec dos (ferric form)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
113
structure length
103
Chain Sequence
GIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNRERELQLEKKDGSKIWTRFALSKVSAEGKVYYLALVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heme pas sensor protein
publication title A redox-controlled molecular switch revealed by the crystal structure of a bacterial heme PAS sensor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 31
structure length 103
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2004-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1v9yA00
4GS9A 3B33A 4R6LA 4GHIA 4HH2A 2GJ3A 3F1NA 1XFQA 5DKLA 3RH8B 5HDSA 3LIDA 5DKKA 4BBVA 2INWA 5HWWA 4EERA 4E04A 4I39A 3E4QA 2VLGA 3UB9A 2QHKA 3LIBA 4DJ3A 3VE4A 3H82B 1N9NA 4KUOA 2B02A 1OTEA 1X0OA 4HI4A 5J3WA 1OTAA 1TS7A 5EFWA 2D01A 3FG8A 4R38A 2A24B 1BYWA 3EWKA 1GSWA 4F3LB 3NOPC 2KX6A 4I3IA 4NXGA 4PKYG 4HQAA 2QWSA 2HV1A 1LT0A 1GSVA 3CWFA 4KQDA 4HP4A 2P7JA 5F6AA 2K7SA 1S4SA 3MR0A 3MFXA 1NWZA 3C2WA 5HDCA 3UMDA 1OTIA 2VV7A 3SW1A 2W0NA 1LSXA 2Z6CA 1T1CA 2D02A 4JGPA 3LIFA 3UB6A 2PD7A 1G28A 1V9ZA 2V0WA 4H6JA 5AVFA 1F9IA 2V1BA 1DP8A 3PYPA 4EETB 3K3CA 3E4PA 2V0UA 4WLAA 2ZBBA 5J4EA 1S66L 5HZHA 1OT9A 3F1OB 5DJTA 4EQ1A 4GS9B 2W27A 5HDDA 4HJ3A 2L4RA 3H7WB 3D72A 1ODVA 2PR5A 3F1NB 4I5SA 4DJ2A 3UB8A 1V9YA 2KDKA 1P97A 4HJ6A 3VOLA 5TBMB 4K08A 3IS2B 5G4YA 3BY9A 1OTDA 1OTBA 2WKRA 4I38A 4YWZA 4R3AA 2WKQA 4HIAA 4EESA 1OJ5A 5DJUA 1KOUA 3P7NA 1DP6A 4BBUA 2QJ5A 1TS6A 1EW0A 2Z6DA 1D7EA 1MZUA 4PKYA 3IBRA 2ZOIA 1N9OA 2QKPA 3H82A 4EW7A 3BY8A 4B9OA 3NOTC 1S67L 1UGUA 4XT2B 4LLOB 1LSVA 5KIZA 3BWLA 2EA9A 3NOUC 4LRZE 2A24A 4HJ4A 3PHYA 4HOIA 4R70A 4HP9A 1VB6A 2ZOHA 5IS1A 4JGQA 3GECA 4JGOA 2QJ7A 2YKHA 3LUQA 5F5YA 2OOLA 4I3AA 5HD3A 5AVEA 3H9WA 3LI9A 1TS0A 5HWVA 3LIAA 2PR6A 1UWNX 4LPZA 4EXOA 4MN5A 2YKFA 3C8CA 4LRXC 4MN6A 1T18A 4HHDA 1LSWA 1T1AA 3HJKA 1WA9A 1GSXA 3F1PA 2CMNA 2L1MA 3ICYA 2J80A 1T1BA 4GHIB 2VEAA 4NXFA 3MXQA 4WL9A 4HNBA 2JN7A 4JGRA 3F1OA 3VE3A 2VV8A 3LI8A 1S4RA 4LRYC 4I3JA 5F68A 3H7WA 3NHQA 4GW9A 2WKPA 5HD5A 3LYXA 1OJGA 1S1YA 1XJ6A 2L0WA 2OWJA 1P0ZA 5J7EA 5TBMA 3OLOA 3IS2A 1XJ2A 4WUJA 3G6OA 1UWPX 3EEHA 4L9FA 2PDRA 1TS8A 3K3DA 3CLOA 3A0RA 2V1AA 4WF0A 4L9GA 4RQ9A 3A0SA 3GDIA 1XJ4A 1T19A 1LL8A 1JNUA 3CAXA 2VV6A 4M4XA 2H28A 1DP9A 3ULFA 2I9VA 4HY8A 5HSQA 4EEPA 3ZQ5A 4XT2A 4F3LA 3LIEA 3T50A 3FC7A 3MJQA 3A0VA 2PYPA 3NJAA 2OWHA 3UMEA 3RTYA 5IU1A 1N9LA 4KUKA 5G4ZA 2JHEA 2M1CA 4L9EA 4WN5A 1OT6A 2V9AA 1XFNA 2BASA 4GCZA 3LICA 1DRMA 4HH3A 1Y28A 5I5LA 4H6JB 3UE6A 4EEUA 3KX0X 3MQOA 2PHYA 1XJ3A 2R78A 1D06A 1F98A 3UB7A 4BBTA 5F69A 2PD8A 5HWTA 4NXBA 3F1PB 4NXEA 3MQQA 2PYRA 3HJIA 1S1ZA 3E4OA 5A8BA
chains in the Genus database with same CATH superfamily
1LI0A 1A0KA 2JKTM 3IHAA 3B42A 3SS5A 5EOEA 1W8YA 5M1AA 3A3FA 1XP4A 3P09A 2R9XA 1G6OA 1SZVA 2XA7M 4DKIA 4GZBA 4C3QA 4BBVA 2HDUA 2INWA 3IWOA 3ZCZA 5DTSA 2VLGA 1C3BA 1N4OA 4Y7PA 3I7JA 3VFFA 3UE1A 1N9NA 4WMCD 1PWDA 2B02A 4WZ5C 3RJUA 3EGDC 4HI4A 2ACGA 5J3WA 3Q7ZA 1OTAA 2LB5A 4BL2A 3FG8A 3IQAA 3BRMA 3HUMA 2A24B 3C4PA 3MF0A 1BYWA 2IWCA 3EWKA 3A3DA 3CZDA 4F3LB 1ERQA 3SS3A 3P98A 3CITA 4G3WA 4HQAA 1YLTA 1YLZA 2QWSA 5AQAA 2VGLS 2DRWA 3ZG0A 1YSPA 2HPBA 2K7SA 3MFXA 1NWZA 3C2WA 5HDCA 1YLWA 4NKPA 3P01A 4QB8A 3TW8A 4R4RA 2JKFA 1K6SA 4IEDA 3T4OA 4OKPA 3UB6A 2P74A 1K57A 3R4KA 4CLCA 5M18A 5D3OA 1F9IA 1YLJA 5E2HA 1DP8A 3OPLA 2ZC5B 3K3CA 3E4PA 4NG2A 3IH8A 3E0YA 1ERMA 1PW1A 3C38A 3JVUA 3W2ZA 5DJTA 4OONA 3M2JA 3OPRA 2G7UA 5TFQA 1ODVA 1DJCA 3WS5A 3S7OA 4DJ2A 4P87A 3A3IA 1P97A 4HJ6A 2A2LA 4Y3IA 3VOLA 2FH5A 4PM7A 3T12B 3PAGA 1OMEA 1OTBA 4PM8A 2EX9A 4IBRA 3IBJA 2WKRA 4YWZA 2PAVP 3LO7A 1JTDA 3MZFA 2WKQA 2QMIA 4YFMA 1K38A 1L0EA 1OJ5A 4KZ9A 3ITBA 4JKTA 1L2SA 2EXBA 1IKGA 3VSKA 1TS6A 1EW0A 4OOMA 1KGGA 2XR0A 4PHTA 3BQAA 1NZUA 3RFBA 4QU3A 3PTEA 2AVXA 4DXCA 1HD8A 3CPTA 2K31A 4JXGA 3VP3A 4CLCE 3BW6A 3TOIA 5EE8A 5GHYA 4R70A 2NUTC 4HP9A 1FILA 4CPKA 4JGOA 1RGYA 1SKOA 3GMWA 5F5YA 2HP9A 1G6AA 5EOOA 4E3JA 4FD8A 4I3AA 1K54C 3WS1A 2VGJA 4S2JA 3QP5A 5A92A 1PFLA 5HWVA 1NLYA 3T1QB 4E3LA 1ZC2A 5GLCA 4KZBA 1S0WA 1FR1A 2PR6A 3LEQA 5EVEA 1PRQA 3S4XA 3QNBA 3O88A 3ITAA 4EXOA 3LR4A 5BOHA 2Y2OA 3C8CA 4KQOA 3BEBA 3G31A 2XGNA 2XD5A 1T18A 5EECA 1JWVA 3HJKA 2VGLM 1KGEA 3DBAA 2ZL1A 1J9MA 4R23A 3F1PA 1L0FA 3NI9A 2J80A 3LR5A 3NDEA 1VQQA 4DF6A 4GHIB 5FAOA 3HLCA 3CMZA 2IWBA 1XXMA 1K55A 4ZJ2A 1SHVA 3BFGA 4MBFA 2O9AA 3FWLA 3UPNA 3GV9A 3UDIA 2WGWA 2J9OA 1BUEA 3NHQA 1W5DA 2WKPA 5HD5A 3A3JA 4S2NA 2L0WA 3IXGA 2OWJA 5J7EA 2VZWA 3IS2A 4WUJA 3G6OA 1NJ4A 2P04A 2PDRA 1TS8A 4KZ3A 4FH2A 3A0RA 2QYBA 4L9GA 2Y2NA 3IXBA 4UAAA 3GDIA 5CHUA 1T19A 3Q07A 1YLYA 3N8LA 2VV6A 4M4XA 2H28A 4X1MA 1FIKA 4QY6A 1XPBA 4OOLA 4HBUA 3PAEA 1YAXA 4KENB 5CEDA 1H8ZA 4FCFA 4WMCA 1K4EA 5CXWA 3G2YA 3FC7A 4ZDXA 1MWTA 3VP4A 4E3NA 1VEUA 3LCEA 1VETA 3UMEA 4GD8A 2ZMFA 5G4ZA 1F5MA 2M1CA 3Q7VB 1STZA 1MPLA 2K2NA 2ZQAA 3C4OA 4DDSA 4DN0A 4WN5A 4E3OA 1OT6A 2V9AA 1IYSA 1RCJA 3T4KA 5EVIB 3SH8A 2BASA 4MDZA 3LICA 4ARZA 1NLZA 3G34A 5I5LA 4H6JB 2X01A 2HDRA 2W3FA 4S2IA 1MWSA 5HFOA 2G2UA 3MQOA 4DRTA 4C6YA 2PHYA 3D9YA 3ZG8B 2R78A 1J3WA 2ZLYA 4JPMA 1ZG4A 5F83A 4LCMA 1E25A 4NETA 4EUZA 3MQQA 1Y54A 2ZM0A 1GCEA 4O8GA 2Y91A 1F2KA 3B33A 3D3OA 4R6LA 3WS4A 1K25A 3ZVWA 1FR6A 3FKVA 2J8YA 3F1NA 5CGSA 3G30A 4Q0HA 3HVFA 3WS0A 2O0YA 5HDSA 1VM1A 4PAUA 4GDBA 5DKKA 5L07A 2B18A 5EV0A 5FAQA 3DW0A 3UB9A 2QHKA 2ZC6B 3ZG9B 4FOFA 4DJ3A 3VE4A 4OPQA 2ZJ9A 3R7WB 1Q2PA 2B95A 4OVDA 5KMWA 1CI9A 1FCNA 3QNCA 2XH9A 3NC8A 4X55A 4Q0IA 2P9VA 2ZQ7A 1CEFA 1X0OA 4PMAA 4EUVA 3ZVTA 2I72A 2D01A 1E3UD 5GLDA 1WE4A 1L0GA 1ACFA 2FZ0A 5IHVA 1GSWA 3KYZA 3NOPC 1H8MA 3Q82A 5J8XA 1LT0A 5F6AA 4MMNA 3G35A 3V3RA 3MR0A 1W8QA 3UMDA 3N8SA 1OTIA 4OP8A 3SW1A 2H0TA 2W0NA 3B3XA 4G3VA 4MNRA 1LSXA 3EQUA 1T1CA 3EOIA 4JGPA 2Z2MB 5CEBA 3LIFA 2PD7A 1G28A 2ZC3B 3UN7A 1V9ZA 1LI9A 4RX3A 2V1BA 3UE0A 1K4FA 5HX9A 3PYPA 5FQJA 4OH0A 3KSIA 2ZMAA 3MKEA 3A3EA 1EI5A 4FUWA 4WLAA 5HL6A 3L9KA 3IHBA 4DMZA 5HZHA 3BFFA 3IF6B 4S2MA 1GHMA 5HDDA 2WZZA 3D72A 5FDSA 4R3BA 2QZ6A 1GHPA 3FV7A 3DAVA 5CX7A 3LFVA 1YLPA 5K5BA 3G32A 4WEJA 4K08A 1IYOA 1NRJA 3HUNA 5G4YA 5AQ7A 3BY9A 4QHCA 4R1GA 1OTDA 4PM6A 3IT9A 1YT4A 2Q0OA 3EEAA 3S7PA 4KG6A 4I38A 2Y79A 1LLBA 3BLMA 3MZEA 1PW8A 2UWXA 3CUEC 5DJUA 2GNXA 4P85A 1DP6A 1K56D 4BBUA 2Q9MA 2QJ5A 3M2KA 2Z6DA 3HBRA 1D7EA 4Z9QA 3IXHA 3NECA 4PKYA 2XLNA 4JBFA 4B93A 4EW7A 1TEMA 3U2AA 1H5XA 2H0YA 4UA6A 1LSVA 4IUKA 3BWLA 3NOUC 4LRZE 2A24A 4X56A 4WZ5A 2KLIA 2WGVA 4QWOA 4ETXA 2O9CA 2ZOHA 5EVID 3BFEA 4JGQA 4JF5A 2HF6A 2VKSA 3WS2A 3GECA 2YKHA 3LUQA 2OOLA 2OV5A 5HD3A 5CHMA 4K0WA 1ONHA 3KSGA 2Y59A 2Y2LA 4IUHA 3LI9A 3VOYA 4GD6A 3VP2A 4D60A 4CLCB 2M7UA 3HUOA 4HEFA 5DF9A 3RXWA 4LPZA 4UQIS 4X1LA 4MN5A 3G2ZA 2XROA 4LRXC 5TGFA 4D2OA 1K6RA 3EQVA 4HHDA 1AXBA 5FI6A 1TVFA 1T1AA 5HAPA 1GSXA 1KE3A 4CQHA 4EBLA 1T1BA 2OAQ1 3MFDA 2HP6A 2V8CA 3O3VA 2JN7A 5FQKA 4JGRA 3VE3A 2VA0A 1WYBA 1S4RA 4LRYC 1SDNA 4I3JA 5F68A 3VP1A 3CG5A 5E2EA 1D1JA 2GZAA 5HW3A 3PBQA 4MN7A 2NUPC 4MBKA 2H10A 1W63Q 5G18A 2Y2IA 5E43A 3UB5P 1QMEA 3TSGA 1CEGA 4KG2A 1P0ZA 4BD0A 3QP6A 1PYYA 5FI2A 2Y4AA 1XJ2A 1TDLA 2EWVA 1BULA 3T4LA 2KOIA 3EEHA 1W63M 3K3DA 3CI6A 3OPPA 3SS4A 1GA9A 4WELA 1O7EA 4IHQA 2O9BA 2C6WB 1N9BA 1XJ4A 3OCNA 2Y2HA 4GNUA 4S2KA 4JF4A 2XD1A 2HJ9C 1DP9A 3D4FA 2OLVA 3IH9A 4HY8A 1FQGA 3GTCA 5HSQA 4EEPA 3ZQ5A 4II7A 4OLGA 2EWWA 3C7UA 4N1XA 1LL5A 3MJQA 1RP5A 5HL1A 5DFYA 3CHWP 3KYQA 2J7VA 2X71A 5L09A 1E3UA 4EQIA 4RX2A 1JWZA 2FFFB 5FAPA 1S6RA 5FI7A 1YQSA 3RTYA 2JHEA 1K0KA 4GB7A 4L9EA 4E6XA 2XFTA 3Q81A 3BLSA 3ISGA 1XFNA 2W1TB 3DWKA 4GCZA 3BECA 4AFIA 1DRMA 1Y28A 3UE6A 1XKZA 1ZHHB 2Y2JA 3S7NA 5HPIA 3W8KA 1EWZA 3BM6A 1PZOA 1W79A 5L2FA 2JCHA 1D06A 1KE4A 1KDSA 3UB7A 4BBTA 2C5WB 1K54A 2XDMA 4KQQA 5F69A 3ZYTA 3KO6A 2ZL1B 5HWTA 4NXBA 3F1PB 2CC1A 4F94A 3HJIA 1S1ZA 3E4OA 4GS9A 2JKTI 2ZM2A 4KZ8A 4FTXA 2Y8HA 3GR2A 4GHIA 5E2GA 4UA9A 4GOGA 1IELA 4XUXA 1KVLA 3ZNYA 2IA2A 1NYYA 5DKLA 3RH8B 4M3KA 2EX8A 4QJGA 3O86A 3M6BA 3LIDA 3AGDA 5HWWA 4E04A 4I39A 4U0TA 1LHYA 5DFXA 3SH7A 4X6TA 2IWDA 1YSQA 3LIBA 3NULA 3S22A 1L0DA 3MMHA 3BFDA 4B4XA 1ESUA 1SKFA 3H82B 4BENA 5L8MA 3MXSA 2HZ5A 3ZHHA 1OTEA 2WYXA 1H8YA 3T4TA 5EFWA 2ZC7A 4H8RA 1K56A 1NRFA 4R38A 2J3WA 3GSGA 1MY8A 3GVBA 2WUQA 3UE3A 4I3IA 4PM9A 5DVAA 4PKYG 3V5MA 5EVIC 2E8IA 2HV1A 4P6ZS 3CWFA 5FL3A 4KQDA 4HP4A 5F1GA 2XRNA 2P7JA 3FPWA 3ZNTA 1U60A 3NDGA 1VHMA 1S4SA 3E2LA 1Q2QA 4N1HA 4MBHA 4OQHA 2VV7A 4CLCD 3HLFA 2JE5A 4P0MA 4WYYA 1ZG6A 5EVIA 3OC2A 4IVIA 3EGXC 4BD1A 4UEYA 4E3IA 2V0WA 2J9PA 4H6JA 1FCOA 4EETB 3LY3A 3JVVA 4G3KA 4OPZA 4DXBA 3TE8A 2XA7S 3SH9A 2ZBBA 4BLMA 5J4EA 3UNWA 2OAP1 2HDQA 1S66L 4X25A 5FQ9A 3F1OB 4JLFA 4EQ1A 2W27A 1NXYA 3Q1FA 1RGZA 2Q9NA 3IX8A 2L4RA 3H7WB 1WYCA 3WRTA 1HZOA 2EX6A 4WBGA 4ZTKA 3F1NB 4O0PA 4I5SA 3V39A 4S2PA 1YPRA 2KDKA 4Y0TA 5IT5A 4FH4A 4PPRA 3UPPA 5TBMB 3C5AA 1TDGA 4R3JA 4Z1WA 3JPUA 1ZTUA 2VJWA 2VGKA 4HIAA 4EESA 2E8JA 5GHXA 3N6IA 1XA7A 1LL9A 1OPXA 5JYPA 5AJGA 4U3TA 1TF1A 3P7NA 2PBYA 5I94A 3N8RA 3LGOA 3MSHA 2ZOIA 5DTTA 2P9VB 5FA7A 3NOTC 4CJNA 1IEMA 1UGUA 1CK3A 3BJNA 4XT2B 2ZQ8A 4OPYA 3PBRA 4LLOB 3T1XA 2JC7A 5GLAA 5KSHA 2PT7A 3PHYA 5CERA 4L0LA 4QPRA 4ZJ1A 1VB6A 5IS1A 2QJ7A 2JKRM 3AGFA 4KZ4A 2UV0E 1DJAA 4O01A 2ZMVA 3MS6A 2Y2QA 1G68A 5AVEA 3O87A 2HDSA 2XEPA 1TS0A 4ZJ3A 3K2NA 1UWNX 3C30A 1MKIA 5AQ9A 1I5QA 2XK1A 5HAIA 1JWPA 3IF6C 4JXSA 2YKFA 4MN6A 4Y0UA 2W3HA 4QY5A 3OPHA 4EV4A 5CGWA 4E3KA 4S2OA 2RL3A 1I2WA 4P6ZM 2CMNA 2MJ6A 4DE1A 2BG1A 3N7WA 3ICYA 5FATA 4OP5A 5F82A 1BT5A 4ZBEA 2EX2A 3GRJA 4E3MA 3N4IA 2VEAA 3KSFA 2VX8A 4WL9A 1GHIA 3ZDJA 3IF6A 2WGIA 2VV8A 3LI8A 5FQQA 3W4QA 3ZG5A 3VSLA 5HAQA 4Q8IA 4RVAA 4ZRRA 5FASA 4GW9A 4DDYA 1MC0A 1OJGA 2XQZA 1S1YA 4BWIA 1HTZA 4MLLA 4IJGA 4FSFA 1FOFA 4DE2A 4MEZA 4KZ5A 1UWPX 4WZ4A 4L9FA 3RXXA 2WAFA 3DWZA 3CLOA 1BLCA 4JXVA 2V1AA 3G4PA 4EWFA 4OQ0A 4EU0A 3HLDA 5CHJA 3M6HA 2HP5A 4IBXA 3CJMA 3HLEA 3BQ8A 5E2FA 3CUEA 3SZTA 1CI8A 3ULFA 5GLBA 4KZAA 4LGWA 1CF0A 5LBRA 1KGFA 2I9VA 4F3LA 3T50A 3A0VA 1ESIA 2V20A 1XGIA 2Y2PA 2ZQ9A 2W1RA 2H5SA 3O5YA 3HLWA 4Y2FA 4LV1A 3UPOA 4LV2A 1M6KA 1K57C 4CLCC 1CJFA 1N9LA 4KUKA 2WKIA 1MBLA 1BTLA 3QP8A 4LENA 5EM0A 4DE0A 4YOFA 4R0QA 1XJ3A 1MKMA 3T1SA 4X69A 4X53A 1F98A 4HESA 3LY4A 2WK0A 1KDWA 5HARA 4E6WA 2PD8A 4NXEA 5A90A 1BSGA 3W4PA 2PBDP 5CTNA 4NK3A 1XX2A 3WWXA 3E2KA 4O7DA 2FFYA 4HH2A 3TG9A 2P08A 2GJ3A 3VOZA 1XFQA 4WM9A 2WZXA 2GX5A 3NIAA 3ZFZA 1ES5A 3SOIA 2XFSA 4Y0OA 5F1FA 1SCWA 1JVJA 1FSWA 4ME4A 2M7VA 4EERA 3E4QA 4GDNA 1H3QA 2Y2KA 2A3UA 1QMFA 1FCMA 1BLSA 3MBZA 2WAEA 4HBTA 3NBLA 3OCLA 1W7FA 3MKFA 1DJBA 4KUOA 3ZG7B 5C5KA 3IWIA 1TS7A 1MWUA 2B5RA 3CPTB 3VFHA 5DF8A 3IX4A 3LEZA 2KX6A 2ZQCA 4NXGA 1GSVA 1G5UA 2DCFA 4EBPA 1SKOB 1L3LA 3OOVA 3T4SA 1ES3A 4OLDA 5FQMA 3T4JA 2G2WA 5EVLA 4N92A 1ES2A 2JKGA 3IWQA 3OBFA 5TJJA 5CRFA 1PNEA 4BL3A 2Z6CA 4JXWA 2D02A 2JKRI 2XF3A 2W3DA 2W1TA 4LCLA 4P6BA 1IKIA 4JF6A 2J3TD 3WRZA 5AVFA 4MCWA 3HLBA 1KE0A 2V0UA 4Y17A 1P9WA 2GDNA 3HCYA 3NCKA 1MWRA 1XA1A 1K55C 1NZOA 1ALQA 1YMSA 4XUZA 1AWIA 3GQZA 1OT9A 3HREA 3T1RA 3IF5A 4GS9B 1PZPA 3QP1A 4S2NC 4OPRA 4HJ3A 1IOUA 5M19A 2PR5A 2WGWB 2V2FF 4UQIM 4OQIA 1FSYA 3UB8A 1V9YA 3MXRA 4EBNA 4K91A 3S7QA 1PWGA 5A93A 5FEGA 3PBOA 3IS2B 5DF7A 5GL9A 2PRFA 1Z09A 4YINA 1PIOA 1BLPA 4R3AA 3OZHA 1YKDA 4YNRA 1BLHA 1YMXA 1KOUA 5CECA 3DTEA 4OQGA 2V8FA 1EROA 1MZUA 4U0XA 5EM1A 3IBRA 2ZM8A 1N9OA 3KSHA 3FKWA 2QKPA 2EFXA 3H82A 3BY8A 4B9OA 2EXAA 3LR0A 2HJEA 4R4SA 1S67L 1XGJA 3UDXA 1IYQA 4QD4A 2BLSA 1KVMA 4ZAMA 3JYIA 3VV4A 1JTGA 5KIZA 4GLQA 2EA9A 1VEUB 4GN2A 3IXDA 4S2LA 4LV3A 3V3SA 4HJ4A 4KZ7A 1VETB 3PBSA 1IYPA 4HOIA 1DY6A 3BFCA 2A49A 3KYEA 4GJ4A 1ZKJA 5FEFA 2XSSA 3PBTA 2ZC4B 2RCXA 5KZHA 3Q7VA 2Z2LB 3VMAA 4C75A 3MZDA 4ARZB 3AGEA 3PBNA 4KQRA 5GHZA 2DNSA 2BTFP 1P9RA 3LR3A 2EFUA 2WKHA 3H9WA 3FPVA 1IFQA 2Y2MA 3ZGAB 3LIAA 3PR6A 4WEKA 4RA7A 1HVBA 2W3GA 1LSWA 1WA9A 2O99A 4B4ZA 4GKUA 3PXPA 4KZ6A 2VK3A 2L1MA 1ES4A 3TRCA 5JYOA 3DTMA 3DTIA 3BYDA 3HLGA 4ESPA 5KSCA 3TJZC 1NYMA 1YM1A 4ID4A 4NXFA 3MXQA 4K0XA 4HNBA 4UA7A 1M40A 2R9WA 3F1OA 2JBFA 4Y5FA 2W3EA 4OOYA 2ZD8A 3H7WA 3HL9A 4N9LA 5CTMA 3LYXA 3UO9A 1XJ6A 2LB9A 5TR7A 1MXOA 3MQ0A 4Y15A 1CQAA 5U47A 5TBMA 3S1YA 3OLOA 3T4QA 1ONGA 5EUAA 4N9KA 1TD5A 3UY6A 1Z6FA 2V1ZA 1H0MA 1NY0A 2PU4A 5L10A 4PM5A 5FSRA 5AQBA 4BMWA 3R7WA 4WF0A 3IX3A 2WADA 1I2SA 4RQ9A 5FQIA 3A0SA 5A91A 1PWCA 4LFUA 4X68A 1LL8A 1JNUA 3CAXA 4Y13A 4A5RA 4BJPA 5HPFA 4XT2A 3LIEA 1Y4OA 3VP0A 1GA0A 3FYZA 5MC7A 3V67A 3DTKA 3L7HA 1HLUP 1PI4A 2HGVA 2PYPA 3NJAA 2Y2GA 2OWHA 2ZQDA 4B88A 1E4DA 5IU1A 2OLUA 3QHYA 4KG5A 5EPHA 3V50A 3C7VA 3E98A 2DMWA 2WKEA 2J3TC 4Q0JA 4HH3A 5FDHA 3QP4A 3U4LP 4EEUA 3KX0X 2QPNA 4DE3A 3W4OA 1BZAA 5CGXA 2X02A 2PU2A 4IVKA 3FZCA 3NY4A 2OSUA 4XXRA 3B47A 4BQMA 1PI5A 1SDEA 3QP2A 4LV0A 4ETZA 2Y55A 1O07A 2PYRA 3UDFA 4RYEA 5A8BA 5DTKA 4UHUA 4NEED
chains in the Genus database with same CATH topology
2JKTM 4GS9A 2JKTI 3B33A 2Y8HA 3D3OA 4R6LA 4GHIA 4HH2A 3B42A 2P08A 2GJ3A 3F1NA 1XFQA 2GX5A 2IA2A 5DKLA 4Q0HA 3RH8B 2O0YA 5HDSA 4PAUA 1G6OA 3LIDA 2XA7M 5DKKA 4BBVA 2B18A 2INWA 4ME4A 2M7VA 5HWWA 4EERA 4E04A 4I39A 3E4QA 5DFXA 1H3QA 2VLGA 3UB9A 1YSQA 2QHKA 3LIBA 4FOFA 4DJ3A 3VE4A 3R7WB 3MMHA 3OCLA 3H82B 5L8MA 1N9NA 4KUOA 2B02A 4Q0IA 1OTEA 1X0OA 3EGDC 4HI4A 5J3WA 5C5KA 4EUVA 1OTAA 1TS7A 2LB5A 3T4TA 5EFWA 2D01A 3FG8A 4R38A 2J3WA 2A24B 3MF0A 1BYWA 3EWKA 2FZ0A 1GSWA 4F3LB 3KYZA 3NOPC 1H8MA 3UE3A 2KX6A 4I3IA 3CITA 4NXGA 4G3WA 4PKYG 4HQAA 2QWSA 2VGLS 2HV1A 1LT0A 1GSVA 4P6ZS 3CWFA 5FL3A 4KQDA 4HP4A 2XRNA 2P7JA 5F6AA 1YSPA 3OOVA 4MMNA 3FPWA 3T4SA 3T4JA 1VHMA 1S4SA 2K7SA 3MR0A 3MFXA 1NWZA 3C2WA 5HDCA 3UMDA 4NKPA 3OBFA 3P01A 1OTIA 3TW8A 2VV7A 5TJJA 4CLCD 3SW1A 2W0NA 4G3VA 1LSXA 2Z6CA 3EQUA 1T1CA 3T4OA 2D02A 3EOIA 4JGPA 2JKRI 3LIFA 2W3DA 3UB6A 2PD7A 1G28A 2W1TA 3OC2A 1V9ZA 3R4KA 4CLCA 3EGXC 4UEYA 2V0WA 2J3TD 4H6JA 5AVFA 4MCWA 1F9IA 2V1BA 1DP8A 3PYPA 4EETB 3KSIA 3K3CA 3JVVA 3E4PA 2V0UA 4G3KA 3TE8A 2XA7S 1P9WA 3HCYA 4WLAA 2ZBBA 5HL6A 5J4EA 2OAP1 1S66L 4DMZA 3E0YA 5HZHA 3W2ZA 3JVUA 3C38A 1OT9A 3F1OB 5DJTA 4EQ1A 4GS9B 2W27A 5HDDA 4HJ3A 1IOUA 2L4RA 3H7WB 2G7UA 3D72A 1ODVA 2PR5A 3F1NB 4O0PA 4UQIM 3S7OA 4I5SA 4DJ2A 5CX7A 3UB8A 1V9YA 3LFVA 2KDKA 3S7QA 5IT5A 5K5BA 1P97A 4HJ6A 2A2LA 4WEJA 4Y3IA 3VOLA 2FH5A 3PBOA 5TBMB 4K08A 3IS2B 1NRJA 5G4YA 3BY9A 1OTDA 1OTBA 3EEAA 3S7PA 4Z1WA 3IBJA 2WKRA 4I38A 2Y79A 4YWZA 1ZTUA 4R3AA 2VJWA 2WKQA 4HIAA 4EESA 1YKDA 3CUEC 4YNRA 1OJ5A 1OPXA 5AJGA 1TF1A 5DJUA 1KOUA 2GNXA 3P7NA 1DP6A 4BBUA 2QJ5A 1TS6A 1EW0A 2Z6DA 1D7EA 4OOMA 4PHTA 3BQAA 1MZUA 4PKYA 3IBRA 2ZOIA 1N9OA 3KSHA 3RFBA 2QKPA 3H82A 4B93A 4EW7A 3BY8A 4B9OA 3NOTC 3U2AA 3LR0A 2HJEA 1S67L 1UGUA 3BJNA 4XT2B 3PBRA 4LLOB 3VV4A 1LSVA 4IUKA 5KIZA 5KSHA 4GLQA 2K31A 3BWLA 2EA9A 3NOUC 2PT7A 4LRZE 2A24A 4CLCE 3BW6A 4HJ4A 3PHYA 3PBSA 2KLIA 4HOIA 4L0LA 4GJ4A 4QPRA 4R70A 2NUTC 4HP9A 2XSSA 3PBTA 4ETXA 1VB6A 2O9CA 2ZOHA 5IS1A 4JGQA 2HF6A 2VKSA 3GECA 4JGOA 2QJ7A 2YKHA 2JKRM 3LUQA 5F5YA 2OOLA 4ARZB 4O01A 4I3AA 2ZMVA 5HD3A 3PBNA 5AVEA 3KSGA 1P9RA 3LR3A 4IUHA 3H9WA 3LI9A 3FPVA 1TS0A 5HWVA 1NLYA 1IFQA 4CLCB 2M7UA 3LIAA 2PR6A 1UWNX 3C30A 3K2NA 3PR6A 4WEKA 5DF9A 4LPZA 4UQIS 4EXOA 3LR4A 2W3GA 4MN5A 2XROA 2YKFA 3C8CA 4LRXC 4MN6A 4KQOA 2W3HA 1T18A 3EQVA 4HHDA 1LSWA 1T1AA 3HJKA 2VGLM 1WA9A 1GSXA 2O99A 3DBAA 3PXPA 4P6ZM 3F1PA 2CMNA 2MJ6A 2L1MA 3TRCA 3ICYA 4CQHA 2J80A 1T1BA 3LR5A 2OAQ1 3TJZC 4GHIB 2VEAA 3KSFA 2VX8A 4NXFA 3MXQA 4WL9A 4HNBA 2JN7A 4JGRA 3F1OA 2VA0A 3VE3A 2VV8A 3LI8A 1S4RA 4LRYC 2W3EA 4Y5FA 4I3JA 5F68A 2O9AA 3H7WA 2GZAA 3PBQA 4ZRRA 4MN7A 3NHQA 4GW9A 2NUPC 2WKPA 1W63Q 5HD5A 1MC0A 3LYXA 1OJGA 1S1YA 1XJ6A 2LB9A 4BWIA 2L0WA 2OWJA 1P0ZA 3MQ0A 5J7EA 2VZWA 5TBMA 3T4QA 3OLOA 4IJGA 4FSFA 3IS2A 1XJ2A 2EWVA 4WUJA 3G6OA 3T4LA 1UWPX 2KOIA 3EEHA 1TD5A 4L9FA 2P04A 2PDRA 1TS8A 1W63M 3K3DA 3CLOA 3CI6A 4BMWA 3A0RA 2V1AA 3R7WA 4WF0A 4WELA 2QYBA 4L9GA 4IHQA 4RQ9A 4EU0A 2O9BA 3A0SA 3GDIA 1XJ4A 1T19A 1LL8A 3OCNA 1JNUA 3CAXA 2VV6A 4M4XA 2H28A 3BQ8A 3CUEA 2HJ9C 1DP9A 3ULFA 4BJPA 4OOLA 5HPFA 5LBRA 1YAXA 2I9VA 4HY8A 5HSQA 4EEPA 3ZQ5A 4XT2A 4II7A 4F3LA 2EWWA 3LIEA 3T50A 3FC7A 5MC7A 3V67A 3MJQA 3A0VA 5DFYA 3KYQA 2W1RA 3O5YA 4Y2FA 2HGVA 2PYPA 3NJAA 2OWHA 3UMEA 4CLCC 3RTYA 2ZMFA 1N9LA 4KUKA 5G4ZA 5IU1A 1F5MA 2JHEA 2M1CA 1STZA 4L9EA 2K2NA 4DN0A 4WN5A 3E98A 1OT6A 2V9AA 3T4KA 1XFNA 2BASA 2W1TB 4GCZA 4MDZA 2DMWA 3LICA 4AFIA 4ARZA 1DRMA 2J3TC 4Q0JA 4HH3A 1Y28A 1NLZA 5I5LA 4H6JB 2W3FA 3UE6A 1ZHHB 3S7NA 5HPIA 4EEUA 4YOFA 3KX0X 3MQOA 2PHYA 1XJ3A 1MKMA 2R78A 1D06A 1F98A 3UB7A 4BBTA 3B47A 5F69A 3ZYTA 3KO6A 2PD8A 4ETZA 5HWTA 4NXBA 3F1PB 4NXEA 3MQQA 2PYRA 3HJIA 1S1ZA 3E4OA 5A8BA 4NEED 4O8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GS9 A;  3B33 A;  4R6L A;  4GHI A;  4HH2 A;  2GJ3 A;  3F1N A;  1XFQ A;  5DKL A;  3RH8 B;  5HDS A;  3LID A;  5DKK A;  4BBV A;  2INW A;  5HWW A;  4EER A;  4E04 A;  4I39 A;  3E4Q A;  2VLG A;  3UB9 A;  2QHK A;  3LIB A;  4DJ3 A;  3VE4 A;  3H82 B;  1N9N A;  4KUO A;  2B02 A;  1OTE A;  1X0O A;  4HI4 A;  5J3W A;  1OTA A;  1TS7 A;  5EFW A;  2D01 A;  3FG8 A;  4R38 A;  2A24 B;  1BYW A;  3EWK A;  1GSW A;  4F3L B;  3NOP C;  2KX6 A;  4I3I A;  4NXG A;  4PKY G;  4HQA A;  2QWS A;  2HV1 A;  1LT0 A;  1GSV A;  3CWF A;  4KQD A;  4HP4 A;  2P7J A;  5F6A A;  2K7S A;  1S4S A;  3MR0 A;  3MFX A;  1NWZ A;  3C2W A;  5HDC A;  3UMD A;  1OTI A;  2VV7 A;  3SW1 A;  2W0N A;  1LSX A;  2Z6C A;  1T1C A;  2D02 A;  4JGP A;  3LIF A;  3UB6 A;  2PD7 A;  1G28 A;  1V9Z A;  2V0W A;  4H6J A;  5AVF A;  1F9I A;  2V1B A;  1DP8 A;  3PYP A;  4EET B;  3K3C A;  3E4P A;  2V0U A;  4WLA A;  2ZBB A;  5J4E A;  1S66 L;  5HZH A;  1OT9 A;  3F1O B;  5DJT A;  4EQ1 A;  4GS9 B;  2W27 A;  5HDD A;  4HJ3 A;  2L4R A;  3H7W B;  3D72 A;  1ODV A;  2PR5 A;  3F1N B;  4I5S A;  4DJ2 A;  3UB8 A;  1V9Y A;  2KDK A;  1P97 A;  4HJ6 A;  3VOL A;  5TBM B;  4K08 A;  3IS2 B;  5G4Y A;  3BY9 A;  1OTD A;  1OTB A;  2WKR A;  4I38 A;  4YWZ A;  4R3A A;  2WKQ A;  4HIA A;  4EES A;  1OJ5 A;  5DJU A;  1KOU A;  3P7N A;  1DP6 A;  4BBU A;  2QJ5 A;  1TS6 A;  1EW0 A;  2Z6D A;  1D7E A;  1MZU A;  4PKY A;  3IBR A;  2ZOI A;  1N9O A;  2QKP A;  3H82 A;  4EW7 A;  3BY8 A;  4B9O A;  3NOT C;  1S67 L;  1UGU A;  4XT2 B;  4LLO B;  1LSV A;  5KIZ A;  3BWL A;  2EA9 A;  3NOU C;  4LRZ E;  2A24 A;  4HJ4 A;  3PHY A;  4HOI A;  4R70 A;  4HP9 A;  1VB6 A;  2ZOH A;  5IS1 A;  4JGQ A;  3GEC A;  4JGO A;  2QJ7 A;  2YKH A;  3LUQ A;  5F5Y A;  2OOL A;  4I3A A;  5HD3 A;  5AVE A;  3H9W A;  3LI9 A;  1TS0 A;  5HWV A;  3LIA A;  2PR6 A;  1UWN X;  4LPZ A;  4EXO A;  4MN5 A;  2YKF A;  3C8C A;  4LRX C;  4MN6 A;  1T18 A;  4HHD A;  1LSW A;  1T1A A;  3HJK A;  1WA9 A;  1GSX A;  3F1P A;  2CMN A;  2L1M A;  3ICY A;  2J80 A;  1T1B A;  4GHI B;  2VEA A;  4NXF A;  3MXQ A;  4WL9 A;  4HNB A;  2JN7 A;  4JGR A;  3F1O A;  3VE3 A;  2VV8 A;  3LI8 A;  1S4R A;  4LRY C;  4I3J A;  5F68 A;  3H7W A;  3NHQ A;  4GW9 A;  2WKP A;  5HD5 A;  3LYX A;  1OJG A;  1S1Y A;  1XJ6 A;  2L0W A;  2OWJ A;  1P0Z A;  5J7E A;  5TBM A;  3OLO A;  3IS2 A;  1XJ2 A;  4WUJ A;  3G6O A;  1UWP X;  3EEH A;  4L9F A;  2PDR A;  1TS8 A;  3K3D A;  3CLO A;  3A0R A;  2V1A A;  4WF0 A;  4L9G A;  4RQ9 A;  3A0S A;  3GDI A;  1XJ4 A;  1T19 A;  1LL8 A;  1JNU A;  3CAX A;  2VV6 A;  4M4X A;  2H28 A;  1DP9 A;  3ULF A;  2I9V A;  4HY8 A;  5HSQ A;  4EEP A;  3ZQ5 A;  4XT2 A;  4F3L A;  3LIE A;  3T50 A;  3FC7 A;  3MJQ A;  3A0V A;  2PYP A;  3NJA A;  2OWH A;  3UME A;  3RTY A;  5IU1 A;  1N9L A;  4KUK A;  5G4Z A;  2JHE A;  2M1C A;  4L9E A;  4WN5 A;  1OT6 A;  2V9A A;  1XFN A;  2BAS A;  4GCZ A;  3LIC A;  1DRM A;  4HH3 A;  1Y28 A;  5I5L A;  4H6J B;  3UE6 A;  4EEU A;  3KX0 X;  3MQO A;  2PHY A;  1XJ3 A;  2R78 A;  1D06 A;  1F98 A;  3UB7 A;  4BBT A;  5F69 A;  2PD8 A;  5HWT A;  4NXB A;  3F1P B;  4NXE A;  3MQQ A;  2PYR A;  3HJI A;  1S1Z A;  3E4O A;  5A8B A; 
#chains in the Genus database with same CATH topology
 1LI0 A;  1A0K A;  2JKT M;  3IHA A;  3B42 A;  3SS5 A;  5EOE A;  1W8Y A;  5M1A A;  3A3F A;  1XP4 A;  3P09 A;  2R9X A;  1G6O A;  1SZV A;  2XA7 M;  4DKI A;  4GZB A;  4C3Q A;  4BBV A;  2HDU A;  2INW A;  3IWO A;  3ZCZ A;  5DTS A;  2VLG A;  1C3B A;  1N4O A;  4Y7P A;  3I7J A;  3VFF A;  3UE1 A;  1N9N A;  4WMC D;  1PWD A;  2B02 A;  4WZ5 C;  3RJU A;  3EGD C;  4HI4 A;  2ACG A;  5J3W A;  3Q7Z A;  1OTA A;  2LB5 A;  4BL2 A;  3FG8 A;  3IQA A;  3BRM A;  3HUM A;  2A24 B;  3C4P A;  3MF0 A;  1BYW A;  2IWC A;  3EWK A;  3A3D A;  3CZD A;  4F3L B;  1ERQ A;  3SS3 A;  3P98 A;  3CIT A;  4G3W A;  4HQA A;  1YLT A;  1YLZ A;  2QWS A;  5AQA A;  2VGL S;  2DRW A;  3ZG0 A;  1YSP A;  2HPB A;  2K7S A;  3MFX A;  1NWZ A;  3C2W A;  5HDC A;  1YLW A;  4NKP A;  3P01 A;  4QB8 A;  3TW8 A;  4R4R A;  2JKF A;  1K6S A;  4IED A;  3T4O A;  4OKP A;  3UB6 A;  2P74 A;  1K57 A;  3R4K A;  4CLC A;  5M18 A;  5D3O A;  1F9I A;  1YLJ A;  5E2H A;  1DP8 A;  3OPL A;  2ZC5 B;  3K3C A;  3E4P A;  4NG2 A;  3IH8 A;  3E0Y A;  1ERM A;  1PW1 A;  3C38 A;  3JVU A;  3W2Z A;  5DJT A;  4OON A;  3M2J A;  3OPR A;  2G7U A;  5TFQ A;  1ODV A;  1DJC A;  3WS5 A;  3S7O A;  4DJ2 A;  4P87 A;  3A3I A;  1P97 A;  4HJ6 A;  2A2L A;  4Y3I A;  3VOL A;  2FH5 A;  4PM7 A;  3T12 B;  3PAG A;  1OME A;  1OTB A;  4PM8 A;  2EX9 A;  4IBR A;  3IBJ A;  2WKR A;  4YWZ A;  2PAV P;  3LO7 A;  1JTD A;  3MZF A;  2WKQ A;  2QMI A;  4YFM A;  1K38 A;  1L0E A;  1OJ5 A;  4KZ9 A;  3ITB A;  4JKT A;  1L2S A;  2EXB A;  1IKG A;  3VSK A;  1TS6 A;  1EW0 A;  4OOM A;  1KGG A;  2XR0 A;  4PHT A;  3BQA A;  1NZU A;  3RFB A;  4QU3 A;  3PTE A;  2AVX A;  4DXC A;  1HD8 A;  3CPT A;  2K31 A;  4JXG A;  3VP3 A;  4CLC E;  3BW6 A;  3TOI A;  5EE8 A;  5GHY A;  4R70 A;  2NUT C;  4HP9 A;  1FIL A;  4CPK A;  4JGO A;  1RGY A;  1SKO A;  3GMW A;  5F5Y A;  2HP9 A;  1G6A A;  5EOO A;  4E3J A;  4FD8 A;  4I3A A;  1K54 C;  3WS1 A;  2VGJ A;  4S2J A;  3QP5 A;  5A92 A;  1PFL A;  5HWV A;  1NLY A;  3T1Q B;  4E3L A;  1ZC2 A;  5GLC A;  4KZB A;  1S0W A;  1FR1 A;  2PR6 A;  3LEQ A;  5EVE A;  1PRQ A;  3S4X A;  3QNB A;  3O88 A;  3ITA A;  4EXO A;  3LR4 A;  5BOH A;  2Y2O A;  3C8C A;  4KQO A;  3BEB A;  3G31 A;  2XGN A;  2XD5 A;  1T18 A;  5EEC A;  1JWV A;  3HJK A;  2VGL M;  1KGE A;  3DBA A;  2ZL1 A;  1J9M A;  4R23 A;  3F1P A;  1L0F A;  3NI9 A;  2J80 A;  3LR5 A;  3NDE A;  1VQQ A;  4DF6 A;  4GHI B;  5FAO A;  3HLC A;  3CMZ A;  2IWB A;  1XXM A;  1K55 A;  4ZJ2 A;  1SHV A;  3BFG A;  4MBF A;  2O9A A;  3FWL A;  3UPN A;  3GV9 A;  3UDI A;  2WGW A;  2J9O A;  1BUE A;  3NHQ A;  1W5D A;  2WKP A;  5HD5 A;  3A3J A;  4S2N A;  2L0W A;  3IXG A;  2OWJ A;  5J7E A;  2VZW A;  3IS2 A;  4WUJ A;  3G6O A;  1NJ4 A;  2P04 A;  2PDR A;  1TS8 A;  4KZ3 A;  4FH2 A;  3A0R A;  2QYB A;  4L9G A;  2Y2N A;  3IXB A;  4UAA A;  3GDI A;  5CHU A;  1T19 A;  3Q07 A;  1YLY A;  3N8L A;  2VV6 A;  4M4X A;  2H28 A;  4X1M A;  1FIK A;  4QY6 A;  1XPB A;  4OOL A;  4HBU A;  3PAE A;  1YAX A;  4KEN B;  5CED A;  1H8Z A;  4FCF A;  4WMC A;  1K4E A;  5CXW A;  3G2Y A;  3FC7 A;  4ZDX A;  1MWT A;  3VP4 A;  4E3N A;  1VEU A;  3LCE A;  1VET A;  3UME A;  4GD8 A;  2ZMF A;  5G4Z A;  1F5M A;  2M1C A;  3Q7V B;  1STZ A;  1MPL A;  2K2N A;  2ZQA A;  3C4O A;  4DDS A;  4DN0 A;  4WN5 A;  4E3O A;  1OT6 A;  2V9A A;  1IYS A;  1RCJ A;  3T4K A;  5EVI B;  3SH8 A;  2BAS A;  4MDZ A;  3LIC A;  4ARZ A;  1NLZ A;  3G34 A;  5I5L A;  4H6J B;  2X01 A;  2HDR A;  2W3F A;  4S2I A;  1MWS A;  5HFO A;  2G2U A;  3MQO A;  4DRT A;  4C6Y A;  2PHY A;  3D9Y A;  3ZG8 B;  2R78 A;  1J3W A;  2ZLY A;  4JPM A;  1ZG4 A;  5F83 A;  4LCM A;  1E25 A;  4NET A;  4EUZ A;  3MQQ A;  1Y54 A;  2ZM0 A;  1GCE A;  4O8G A;  2Y91 A;  1F2K A;  3B33 A;  3D3O A;  4R6L A;  3WS4 A;  1K25 A;  3ZVW A;  1FR6 A;  3FKV A;  2J8Y A;  3F1N A;  5CGS A;  3G30 A;  4Q0H A;  3HVF A;  3WS0 A;  2O0Y A;  5HDS A;  1VM1 A;  4PAU A;  4GDB A;  5DKK A;  5L07 A;  2B18 A;  5EV0 A;  5FAQ A;  3DW0 A;  3UB9 A;  2QHK A;  2ZC6 B;  3ZG9 B;  4FOF A;  4DJ3 A;  3VE4 A;  4OPQ A;  2ZJ9 A;  3R7W B;  1Q2P A;  2B95 A;  4OVD A;  5KMW A;  1CI9 A;  1FCN A;  3QNC A;  2XH9 A;  3NC8 A;  4X55 A;  4Q0I A;  2P9V A;  2ZQ7 A;  1CEF A;  1X0O A;  4PMA A;  4EUV A;  3ZVT A;  2I72 A;  2D01 A;  1E3U D;  5GLD A;  1WE4 A;  1L0G A;  1ACF A;  2FZ0 A;  5IHV A;  1GSW A;  3KYZ A;  3NOP C;  1H8M A;  3Q82 A;  5J8X A;  1LT0 A;  5F6A A;  4MMN A;  3G35 A;  3V3R A;  3MR0 A;  1W8Q A;  3UMD A;  3N8S A;  1OTI A;  4OP8 A;  3SW1 A;  2H0T A;  2W0N A;  3B3X A;  4G3V A;  4MNR A;  1LSX A;  3EQU A;  1T1C A;  3EOI A;  4JGP A;  2Z2M B;  5CEB A;  3LIF A;  2PD7 A;  1G28 A;  2ZC3 B;  3UN7 A;  1V9Z A;  1LI9 A;  4RX3 A;  2V1B A;  3UE0 A;  1K4F A;  5HX9 A;  3PYP A;  5FQJ A;  4OH0 A;  3KSI A;  2ZMA A;  3MKE A;  3A3E A;  1EI5 A;  4FUW A;  4WLA A;  5HL6 A;  3L9K A;  3IHB A;  4DMZ A;  5HZH A;  3BFF A;  3IF6 B;  4S2M A;  1GHM A;  5HDD A;  2WZZ A;  3D72 A;  5FDS A;  4R3B A;  2QZ6 A;  1GHP A;  3FV7 A;  3DAV A;  5CX7 A;  3LFV A;  1YLP A;  5K5B A;  3G32 A;  4WEJ A;  4K08 A;  1IYO A;  1NRJ A;  3HUN A;  5G4Y A;  5AQ7 A;  3BY9 A;  4QHC A;  4R1G A;  1OTD A;  4PM6 A;  3IT9 A;  1YT4 A;  2Q0O A;  3EEA A;  3S7P A;  4KG6 A;  4I38 A;  2Y79 A;  1LLB A;  3BLM A;  3MZE A;  1PW8 A;  2UWX A;  3CUE C;  5DJU A;  2GNX A;  4P85 A;  1DP6 A;  1K56 D;  4BBU A;  2Q9M A;  2QJ5 A;  3M2K A;  2Z6D A;  3HBR A;  1D7E A;  4Z9Q A;  3IXH A;  3NEC A;  4PKY A;  2XLN A;  4JBF A;  4B93 A;  4EW7 A;  1TEM A;  3U2A A;  1H5X A;  2H0Y A;  4UA6 A;  1LSV A;  4IUK A;  3BWL A;  3NOU C;  4LRZ E;  2A24 A;  4X56 A;  4WZ5 A;  2KLI A;  2WGV A;  4QWO A;  4ETX A;  2O9C A;  2ZOH A;  5EVI D;  3BFE A;  4JGQ A;  4JF5 A;  2HF6 A;  2VKS A;  3WS2 A;  3GEC A;  2YKH A;  3LUQ A;  2OOL A;  2OV5 A;  5HD3 A;  5CHM A;  4K0W A;  1ONH A;  3KSG A;  2Y59 A;  2Y2L A;  4IUH A;  3LI9 A;  3VOY A;  4GD6 A;  3VP2 A;  4D60 A;  4CLC B;  2M7U A;  3HUO A;  4HEF A;  5DF9 A;  3RXW A;  4LPZ A;  4UQI S;  4X1L A;  4MN5 A;  3G2Z A;  2XRO A;  4LRX C;  5TGF A;  4D2O A;  1K6R A;  3EQV A;  4HHD A;  1AXB A;  5FI6 A;  1TVF A;  1T1A A;  5HAP A;  1GSX A;  1KE3 A;  4CQH A;  4EBL A;  1T1B A;  2OAQ 1;  3MFD A;  2HP6 A;  2V8C A;  3O3V A;  2JN7 A;  5FQK A;  4JGR A;  3VE3 A;  2VA0 A;  1WYB A;  1S4R A;  4LRY C;  1SDN A;  4I3J A;  5F68 A;  3VP1 A;  3CG5 A;  5E2E A;  1D1J A;  2GZA A;  5HW3 A;  3PBQ A;  4MN7 A;  2NUP C;  4MBK A;  2H10 A;  1W63 Q;  5G18 A;  2Y2I A;  5E43 A;  3UB5 P;  1QME A;  3TSG A;  1CEG A;  4KG2 A;  1P0Z A;  4BD0 A;  3QP6 A;  1PYY A;  5FI2 A;  2Y4A A;  1XJ2 A;  1TDL A;  2EWV A;  1BUL A;  3T4L A;  2KOI A;  3EEH A;  1W63 M;  3K3D A;  3CI6 A;  3OPP A;  3SS4 A;  1GA9 A;  4WEL A;  1O7E A;  4IHQ A;  2O9B A;  2C6W B;  1N9B A;  1XJ4 A;  3OCN A;  2Y2H A;  4GNU A;  4S2K A;  4JF4 A;  2XD1 A;  2HJ9 C;  1DP9 A;  3D4F A;  2OLV A;  3IH9 A;  4HY8 A;  1FQG A;  3GTC A;  5HSQ A;  4EEP A;  3ZQ5 A;  4II7 A;  4OLG A;  2EWW A;  3C7U A;  4N1X A;  1LL5 A;  3MJQ A;  1RP5 A;  5HL1 A;  5DFY A;  3CHW P;  3KYQ A;  2J7V A;  2X71 A;  5L09 A;  1E3U A;  4EQI A;  4RX2 A;  1JWZ A;  2FFF B;  5FAP A;  1S6R A;  5FI7 A;  1YQS A;  3RTY A;  2JHE A;  1K0K A;  4GB7 A;  4L9E A;  4E6X A;  2XFT A;  3Q81 A;  3BLS A;  3ISG A;  1XFN A;  2W1T B;  3DWK A;  4GCZ A;  3BEC A;  4AFI A;  1DRM A;  1Y28 A;  3UE6 A;  1XKZ A;  1ZHH B;  2Y2J A;  3S7N A;  5HPI A;  3W8K A;  1EWZ A;  3BM6 A;  1PZO A;  1W79 A;  5L2F A;  2JCH A;  1D06 A;  1KE4 A;  1KDS A;  3UB7 A;  4BBT A;  2C5W B;  1K54 A;  2XDM A;  4KQQ A;  5F69 A;  3ZYT A;  3KO6 A;  2ZL1 B;  5HWT A;  4NXB A;  3F1P B;  2CC1 A;  4F94 A;  3HJI A;  1S1Z A;  3E4O A;  4GS9 A;  2JKT I;  2ZM2 A;  4KZ8 A;  4FTX A;  2Y8H A;  3GR2 A;  4GHI A;  5E2G A;  4UA9 A;  4GOG A;  1IEL A;  4XUX A;  1KVL A;  3ZNY A;  2IA2 A;  1NYY A;  5DKL A;  3RH8 B;  4M3K A;  2EX8 A;  4QJG A;  3O86 A;  3M6B A;  3LID A;  3AGD A;  5HWW A;  4E04 A;  4I39 A;  4U0T A;  1LHY A;  5DFX A;  3SH7 A;  4X6T A;  2IWD A;  1YSQ A;  3LIB A;  3NUL A;  3S22 A;  1L0D A;  3MMH A;  3BFD A;  4B4X A;  1ESU A;  1SKF A;  3H82 B;  4BEN A;  5L8M A;  3MXS A;  2HZ5 A;  3ZHH A;  1OTE A;  2WYX A;  1H8Y A;  3T4T A;  5EFW A;  2ZC7 A;  4H8R A;  1K56 A;  1NRF A;  4R38 A;  2J3W A;  3GSG A;  1MY8 A;  3GVB A;  2WUQ A;  3UE3 A;  4I3I A;  4PM9 A;  5DVA A;  4PKY G;  3V5M A;  5EVI C;  2E8I A;  2HV1 A;  4P6Z S;  3CWF A;  5FL3 A;  4KQD A;  4HP4 A;  5F1G A;  2XRN A;  2P7J A;  3FPW A;  3ZNT A;  1U60 A;  3NDG A;  1VHM A;  1S4S A;  3E2L A;  1Q2Q A;  4N1H A;  4MBH A;  4OQH A;  2VV7 A;  4CLC D;  3HLF A;  2JE5 A;  4P0M A;  4WYY A;  1ZG6 A;  5EVI A;  3OC2 A;  4IVI A;  3EGX C;  4BD1 A;  4UEY A;  4E3I A;  2V0W A;  2J9P A;  4H6J A;  1FCO A;  4EET B;  3LY3 A;  3JVV A;  4G3K A;  4OPZ A;  4DXB A;  3TE8 A;  2XA7 S;  3SH9 A;  2ZBB A;  4BLM A;  5J4E A;  3UNW A;  2OAP 1;  2HDQ A;  1S66 L;  4X25 A;  5FQ9 A;  3F1O B;  4JLF A;  4EQ1 A;  2W27 A;  1NXY A;  3Q1F A;  1RGZ A;  2Q9N A;  3IX8 A;  2L4R A;  3H7W B;  1WYC A;  3WRT A;  1HZO A;  2EX6 A;  4WBG A;  4ZTK A;  3F1N B;  4O0P A;  4I5S A;  3V39 A;  4S2P A;  1YPR A;  2KDK A;  4Y0T A;  5IT5 A;  4FH4 A;  4PPR A;  3UPP A;  5TBM B;  3C5A A;  1TDG A;  4R3J A;  4Z1W A;  3JPU A;  1ZTU A;  2VJW A;  2VGK A;  4HIA A;  4EES A;  2E8J A;  5GHX A;  3N6I A;  1XA7 A;  1LL9 A;  1OPX A;  5JYP A;  5AJG A;  4U3T A;  1TF1 A;  3P7N A;  2PBY A;  5I94 A;  3N8R A;  3LGO A;  3MSH A;  2ZOI A;  5DTT A;  2P9V B;  5FA7 A;  3NOT C;  4CJN A;  1IEM A;  1UGU A;  1CK3 A;  3BJN A;  4XT2 B;  2ZQ8 A;  4OPY A;  3PBR A;  4LLO B;  3T1X A;  2JC7 A;  5GLA A;  5KSH A;  2PT7 A;  3PHY A;  5CER A;  4L0L A;  4QPR A;  4ZJ1 A;  1VB6 A;  5IS1 A;  2QJ7 A;  2JKR M;  3AGF A;  4KZ4 A;  2UV0 E;  1DJA A;  4O01 A;  2ZMV A;  3MS6 A;  2Y2Q A;  1G68 A;  5AVE A;  3O87 A;  2HDS A;  2XEP A;  1TS0 A;  4ZJ3 A;  3K2N A;  1UWN X;  3C30 A;  1MKI A;  5AQ9 A;  1I5Q A;  2XK1 A;  5HAI A;  1JWP A;  3IF6 C;  4JXS A;  2YKF A;  4MN6 A;  4Y0U A;  2W3H A;  4QY5 A;  3OPH A;  4EV4 A;  5CGW A;  4E3K A;  4S2O A;  2RL3 A;  1I2W A;  4P6Z M;  2CMN A;  2MJ6 A;  4DE1 A;  2BG1 A;  3N7W A;  3ICY A;  5FAT A;  4OP5 A;  5F82 A;  1BT5 A;  4ZBE A;  2EX2 A;  3GRJ A;  4E3M A;  3N4I A;  2VEA A;  3KSF A;  2VX8 A;  4WL9 A;  1GHI A;  3ZDJ A;  3IF6 A;  2WGI A;  2VV8 A;  3LI8 A;  5FQQ A;  3W4Q A;  3ZG5 A;  3VSL A;  5HAQ A;  4Q8I A;  4RVA A;  4ZRR A;  5FAS A;  4GW9 A;  4DDY A;  1MC0 A;  1OJG A;  2XQZ A;  1S1Y A;  4BWI A;  1HTZ A;  4MLL A;  4IJG A;  4FSF A;  1FOF A;  4DE2 A;  4MEZ A;  4KZ5 A;  1UWP X;  4WZ4 A;  4L9F A;  3RXX A;  2WAF A;  3DWZ A;  3CLO A;  1BLC A;  4JXV A;  2V1A A;  3G4P A;  4EWF A;  4OQ0 A;  4EU0 A;  3HLD A;  5CHJ A;  3M6H A;  2HP5 A;  4IBX A;  3CJM A;  3HLE A;  3BQ8 A;  5E2F A;  3CUE A;  3SZT A;  1CI8 A;  3ULF A;  5GLB A;  4KZA A;  4LGW A;  1CF0 A;  5LBR A;  1KGF A;  2I9V A;  4F3L A;  3T50 A;  3A0V A;  1ESI A;  2V20 A;  1XGI A;  2Y2P A;  2ZQ9 A;  2W1R A;  2H5S A;  3O5Y A;  3HLW A;  4Y2F A;  4LV1 A;  3UPO A;  4LV2 A;  1M6K A;  1K57 C;  4CLC C;  1CJF A;  1N9L A;  4KUK A;  2WKI A;  1MBL A;  1BTL A;  3QP8 A;  4LEN A;  5EM0 A;  4DE0 A;  4YOF A;  4R0Q A;  1XJ3 A;  1MKM A;  3T1S A;  4X69 A;  4X53 A;  1F98 A;  4HES A;  3LY4 A;  2WK0 A;  1KDW A;  5HAR A;  4E6W A;  2PD8 A;  4NXE A;  5A90 A;  1BSG A;  3W4P A;  2PBD P;  5CTN A;  4NK3 A;  1XX2 A;  3WWX A;  3E2K A;  4O7D A;  2FFY A;  4HH2 A;  3TG9 A;  2P08 A;  2GJ3 A;  3VOZ A;  1XFQ A;  4WM9 A;  2WZX A;  2GX5 A;  3NIA A;  3ZFZ A;  1ES5 A;  3SOI A;  2XFS A;  4Y0O A;  5F1F A;  1SCW A;  1JVJ A;  1FSW A;  4ME4 A;  2M7V A;  4EER A;  3E4Q A;  4GDN A;  1H3Q A;  2Y2K A;  2A3U A;  1QMF A;  1FCM A;  1BLS A;  3MBZ A;  2WAE A;  4HBT A;  3NBL A;  3OCL A;  1W7F A;  3MKF A;  1DJB A;  4KUO A;  3ZG7 B;  5C5K A;  3IWI A;  1TS7 A;  1MWU A;  2B5R A;  3CPT B;  3VFH A;  5DF8 A;  3IX4 A;  3LEZ A;  2KX6 A;  2ZQC A;  4NXG A;  1GSV A;  1G5U A;  2DCF A;  4EBP A;  1SKO B;  1L3L A;  3OOV A;  3T4S A;  1ES3 A;  4OLD A;  5FQM A;  3T4J A;  2G2W A;  5EVL A;  4N92 A;  1ES2 A;  2JKG A;  3IWQ A;  3OBF A;  5TJJ A;  5CRF A;  1PNE A;  4BL3 A;  2Z6C A;  4JXW A;  2D02 A;  2JKR I;  2XF3 A;  2W3D A;  2W1T A;  4LCL A;  4P6B A;  1IKI A;  4JF6 A;  2J3T D;  3WRZ A;  5AVF A;  4MCW A;  3HLB A;  1KE0 A;  2V0U A;  4Y17 A;  1P9W A;  2GDN A;  3HCY A;  3NCK A;  1MWR A;  1XA1 A;  1K55 C;  1NZO A;  1ALQ A;  1YMS A;  4XUZ A;  1AWI A;  3GQZ A;  1OT9 A;  3HRE A;  3T1R A;  3IF5 A;  4GS9 B;  1PZP A;  3QP1 A;  4S2N C;  4OPR A;  4HJ3 A;  1IOU A;  5M19 A;  2PR5 A;  2WGW B;  2V2F F;  4UQI M;  4OQI A;  1FSY A;  3UB8 A;  1V9Y A;  3MXR A;  4EBN A;  4K91 A;  3S7Q A;  1PWG A;  5A93 A;  5FEG A;  3PBO A;  3IS2 B;  5DF7 A;  5GL9 A;  2PRF A;  1Z09 A;  4YIN A;  1PIO A;  1BLP A;  4R3A A;  3OZH A;  1YKD A;  4YNR A;  1BLH A;  1YMX A;  1KOU A;  5CEC A;  3DTE A;  4OQG A;  2V8F A;  1ERO A;  1MZU A;  4U0X A;  5EM1 A;  3IBR A;  2ZM8 A;  1N9O A;  3KSH A;  3FKW A;  2QKP A;  2EFX A;  3H82 A;  3BY8 A;  4B9O A;  2EXA A;  3LR0 A;  2HJE A;  4R4S A;  1S67 L;  1XGJ A;  3UDX A;  1IYQ A;  4QD4 A;  2BLS A;  1KVM A;  4ZAM A;  3JYI A;  3VV4 A;  1JTG A;  5KIZ A;  4GLQ A;  2EA9 A;  1VEU B;  4GN2 A;  3IXD A;  4S2L A;  4LV3 A;  3V3S A;  4HJ4 A;  4KZ7 A;  1VET B;  3PBS A;  1IYP A;  4HOI A;  1DY6 A;  3BFC A;  2A49 A;  3KYE A;  4GJ4 A;  1ZKJ A;  5FEF A;  2XSS A;  3PBT A;  2ZC4 B;  2RCX A;  5KZH A;  3Q7V A;  2Z2L B;  3VMA A;  4C75 A;  3MZD A;  4ARZ B;  3AGE A;  3PBN A;  4KQR A;  5GHZ A;  2DNS A;  2BTF P;  1P9R A;  3LR3 A;  2EFU A;  2WKH A;  3H9W A;  3FPV A;  1IFQ A;  2Y2M A;  3ZGA B;  3LIA A;  3PR6 A;  4WEK A;  4RA7 A;  1HVB A;  2W3G A;  1LSW A;  1WA9 A;  2O99 A;  4B4Z A;  4GKU A;  3PXP A;  4KZ6 A;  2VK3 A;  2L1M A;  1ES4 A;  3TRC A;  5JYO A;  3DTM A;  3DTI A;  3BYD A;  3HLG A;  4ESP A;  5KSC A;  3TJZ C;  1NYM A;  1YM1 A;  4ID4 A;  4NXF A;  3MXQ A;  4K0X A;  4HNB A;  4UA7 A;  1M40 A;  2R9W A;  3F1O A;  2JBF A;  4Y5F A;  2W3E A;  4OOY A;  2ZD8 A;  3H7W A;  3HL9 A;  4N9L A;  5CTM A;  3LYX A;  3UO9 A;  1XJ6 A;  2LB9 A;  5TR7 A;  1MXO A;  3MQ0 A;  4Y15 A;  1CQA A;  5U47 A;  5TBM A;  3S1Y A;  3OLO A;  3T4Q A;  1ONG A;  5EUA A;  4N9K A;  1TD5 A;  3UY6 A;  1Z6F A;  2V1Z A;  1H0M A;  1NY0 A;  2PU4 A;  5L10 A;  4PM5 A;  5FSR A;  5AQB A;  4BMW A;  3R7W A;  4WF0 A;  3IX3 A;  2WAD A;  1I2S A;  4RQ9 A;  5FQI A;  3A0S A;  5A91 A;  1PWC A;  4LFU A;  4X68 A;  1LL8 A;  1JNU A;  3CAX A;  4Y13 A;  4A5R A;  4BJP A;  5HPF A;  4XT2 A;  3LIE A;  1Y4O A;  3VP0 A;  1GA0 A;  3FYZ A;  5MC7 A;  3V67 A;  3DTK A;  3L7H A;  1HLU P;  1PI4 A;  2HGV A;  2PYP A;  3NJA A;  2Y2G A;  2OWH A;  2ZQD A;  4B88 A;  1E4D A;  5IU1 A;  2OLU A;  3QHY A;  4KG5 A;  5EPH A;  3V50 A;  3C7V A;  3E98 A;  2DMW A;  2WKE A;  2J3T C;  4Q0J A;  4HH3 A;  5FDH A;  3QP4 A;  3U4L P;  4EEU A;  3KX0 X;  2QPN A;  4DE3 A;  3W4O A;  1BZA A;  5CGX A;  2X02 A;  2PU2 A;  4IVK A;  3FZC A;  3NY4 A;  2OSU A;  4XXR A;  3B47 A;  4BQM A;  1PI5 A;  1SDE A;  3QP2 A;  4LV0 A;  4ETZ A;  2Y55 A;  1O07 A;  2PYR A;  3UDF A;  4RYE A;  5A8B A;  5DTK A;  4UHU A;  4NEE D; 
#chains in the Genus database with same CATH homology
 2JKT M;  4GS9 A;  2JKT I;  3B33 A;  2Y8H A;  3D3O A;  4R6L A;  4GHI A;  4HH2 A;  3B42 A;  2P08 A;  2GJ3 A;  3F1N A;  1XFQ A;  2GX5 A;  2IA2 A;  5DKL A;  4Q0H A;  3RH8 B;  2O0Y A;  5HDS A;  4PAU A;  1G6O A;  3LID A;  2XA7 M;  5DKK A;  4BBV A;  2B18 A;  2INW A;  4ME4 A;  2M7V A;  5HWW A;  4EER A;  4E04 A;  4I39 A;  3E4Q A;  5DFX A;  1H3Q A;  2VLG A;  3UB9 A;  1YSQ A;  2QHK A;  3LIB A;  4FOF A;  4DJ3 A;  3VE4 A;  3R7W B;  3MMH A;  3OCL A;  3H82 B;  5L8M A;  1N9N A;  4KUO A;  2B02 A;  4Q0I A;  1OTE A;  1X0O A;  3EGD C;  4HI4 A;  5J3W A;  5C5K A;  4EUV A;  1OTA A;  1TS7 A;  2LB5 A;  3T4T A;  5EFW A;  2D01 A;  3FG8 A;  4R38 A;  2J3W A;  2A24 B;  3MF0 A;  1BYW A;  3EWK A;  2FZ0 A;  1GSW A;  4F3L B;  3KYZ A;  3NOP C;  1H8M A;  3UE3 A;  2KX6 A;  4I3I A;  3CIT A;  4NXG A;  4G3W A;  4PKY G;  4HQA A;  2QWS A;  2VGL S;  2HV1 A;  1LT0 A;  1GSV A;  4P6Z S;  3CWF A;  5FL3 A;  4KQD A;  4HP4 A;  2XRN A;  2P7J A;  5F6A A;  1YSP A;  3OOV A;  4MMN A;  3FPW A;  3T4S A;  3T4J A;  1VHM A;  1S4S A;  2K7S A;  3MR0 A;  3MFX A;  1NWZ A;  3C2W A;  5HDC A;  3UMD A;  4NKP A;  3OBF A;  3P01 A;  1OTI A;  3TW8 A;  2VV7 A;  5TJJ A;  4CLC D;  3SW1 A;  2W0N A;  4G3V A;  1LSX A;  2Z6C A;  3EQU A;  1T1C A;  3T4O A;  2D02 A;  3EOI A;  4JGP A;  2JKR I;  3LIF A;  2W3D A;  3UB6 A;  2PD7 A;  1G28 A;  2W1T A;  3OC2 A;  1V9Z A;  3R4K A;  4CLC A;  3EGX C;  4UEY A;  2V0W A;  2J3T D;  4H6J A;  5AVF A;  4MCW A;  1F9I A;  2V1B A;  1DP8 A;  3PYP A;  4EET B;  3KSI A;  3K3C A;  3JVV A;  3E4P A;  2V0U A;  4G3K A;  3TE8 A;  2XA7 S;  1P9W A;  3HCY A;  4WLA A;  2ZBB A;  5HL6 A;  5J4E A;  2OAP 1;  1S66 L;  4DMZ A;  3E0Y A;  5HZH A;  3W2Z A;  3JVU A;  3C38 A;  1OT9 A;  3F1O B;  5DJT A;  4EQ1 A;  4GS9 B;  2W27 A;  5HDD A;  4HJ3 A;  1IOU A;  2L4R A;  3H7W B;  2G7U A;  3D72 A;  1ODV A;  2PR5 A;  3F1N B;  4O0P A;  4UQI M;  3S7O A;  4I5S A;  4DJ2 A;  5CX7 A;  3UB8 A;  1V9Y A;  3LFV A;  2KDK A;  3S7Q A;  5IT5 A;  5K5B A;  1P97 A;  4HJ6 A;  2A2L A;  4WEJ A;  4Y3I A;  3VOL A;  2FH5 A;  3PBO A;  5TBM B;  4K08 A;  3IS2 B;  1NRJ A;  5G4Y A;  3BY9 A;  1OTD A;  1OTB A;  3EEA A;  3S7P A;  4Z1W A;  3IBJ A;  2WKR A;  4I38 A;  2Y79 A;  4YWZ A;  1ZTU A;  4R3A A;  2VJW A;  2WKQ A;  4HIA A;  4EES A;  1YKD A;  3CUE C;  4YNR A;  1OJ5 A;  1OPX A;  5AJG A;  1TF1 A;  5DJU A;  1KOU A;  2GNX A;  3P7N A;  1DP6 A;  4BBU A;  2QJ5 A;  1TS6 A;  1EW0 A;  2Z6D A;  1D7E A;  4OOM A;  4PHT A;  3BQA A;  1MZU A;  4PKY A;  3IBR A;  2ZOI A;  1N9O A;  3KSH A;  3RFB A;  2QKP A;  3H82 A;  4B93 A;  4EW7 A;  3BY8 A;  4B9O A;  3NOT C;  3U2A A;  3LR0 A;  2HJE A;  1S67 L;  1UGU A;  3BJN A;  4XT2 B;  3PBR A;  4LLO B;  3VV4 A;  1LSV A;  4IUK A;  5KIZ A;  5KSH A;  4GLQ A;  2K31 A;  3BWL A;  2EA9 A;  3NOU C;  2PT7 A;  4LRZ E;  2A24 A;  4CLC E;  3BW6 A;  4HJ4 A;  3PHY A;  3PBS A;  2KLI A;  4HOI A;  4L0L A;  4GJ4 A;  4QPR A;  4R70 A;  2NUT C;  4HP9 A;  2XSS A;  3PBT A;  4ETX A;  1VB6 A;  2O9C A;  2ZOH A;  5IS1 A;  4JGQ A;  2HF6 A;  2VKS A;  3GEC A;  4JGO A;  2QJ7 A;  2YKH A;  2JKR M;  3LUQ A;  5F5Y A;  2OOL A;  4ARZ B;  4O01 A;  4I3A A;  2ZMV A;  5HD3 A;  3PBN A;  5AVE A;  3KSG A;  1P9R A;  3LR3 A;  4IUH A;  3H9W A;  3LI9 A;  3FPV A;  1TS0 A;  5HWV A;  1NLY A;  1IFQ A;  4CLC B;  2M7U A;  3LIA A;  2PR6 A;  1UWN X;  3C30 A;  3K2N A;  3PR6 A;  4WEK A;  5DF9 A;  4LPZ A;  4UQI S;  4EXO A;  3LR4 A;  2W3G A;  4MN5 A;  2XRO A;  2YKF A;  3C8C A;  4LRX C;  4MN6 A;  4KQO A;  2W3H A;  1T18 A;  3EQV A;  4HHD A;  1LSW A;  1T1A A;  3HJK A;  2VGL M;  1WA9 A;  1GSX A;  2O99 A;  3DBA A;  3PXP A;  4P6Z M;  3F1P A;  2CMN A;  2MJ6 A;  2L1M A;  3TRC A;  3ICY A;  4CQH A;  2J80 A;  1T1B A;  3LR5 A;  2OAQ 1;  3TJZ C;  4GHI B;  2VEA A;  3KSF A;  2VX8 A;  4NXF A;  3MXQ A;  4WL9 A;  4HNB A;  2JN7 A;  4JGR A;  3F1O A;  2VA0 A;  3VE3 A;  2VV8 A;  3LI8 A;  1S4R A;  4LRY C;  2W3E A;  4Y5F A;  4I3J A;  5F68 A;  2O9A A;  3H7W A;  2GZA A;  3PBQ A;  4ZRR A;  4MN7 A;  3NHQ A;  4GW9 A;  2NUP C;  2WKP A;  1W63 Q;  5HD5 A;  1MC0 A;  3LYX A;  1OJG A;  1S1Y A;  1XJ6 A;  2LB9 A;  4BWI A;  2L0W A;  2OWJ A;  1P0Z A;  3MQ0 A;  5J7E A;  2VZW A;  5TBM A;  3T4Q A;  3OLO A;  4IJG A;  4FSF A;  3IS2 A;  1XJ2 A;  2EWV A;  4WUJ A;  3G6O A;  3T4L A;  1UWP X;  2KOI A;  3EEH A;  1TD5 A;  4L9F A;  2P04 A;  2PDR A;  1TS8 A;  1W63 M;  3K3D A;  3CLO A;  3CI6 A;  4BMW A;  3A0R A;  2V1A A;  3R7W A;  4WF0 A;  4WEL A;  2QYB A;  4L9G A;  4IHQ A;  4RQ9 A;  4EU0 A;  2O9B A;  3A0S A;  3GDI A;  1XJ4 A;  1T19 A;  1LL8 A;  3OCN A;  1JNU A;  3CAX A;  2VV6 A;  4M4X A;  2H28 A;  3BQ8 A;  3CUE A;  2HJ9 C;  1DP9 A;  3ULF A;  4BJP A;  4OOL A;  5HPF A;  5LBR A;  1YAX A;  2I9V A;  4HY8 A;  5HSQ A;  4EEP A;  3ZQ5 A;  4XT2 A;  4II7 A;  4F3L A;  2EWW A;  3LIE A;  3T50 A;  3FC7 A;  5MC7 A;  3V67 A;  3MJQ A;  3A0V A;  5DFY A;  3KYQ A;  2W1R A;  3O5Y A;  4Y2F A;  2HGV A;  2PYP A;  3NJA A;  2OWH A;  3UME A;  4CLC C;  3RTY A;  2ZMF A;  1N9L A;  4KUK A;  5G4Z A;  5IU1 A;  1F5M A;  2JHE A;  2M1C A;  1STZ A;  4L9E A;  2K2N A;  4DN0 A;  4WN5 A;  3E98 A;  1OT6 A;  2V9A A;  3T4K A;  1XFN A;  2BAS A;  2W1T B;  4GCZ A;  4MDZ A;  2DMW A;  3LIC A;  4AFI A;  4ARZ A;  1DRM A;  2J3T C;  4Q0J A;  4HH3 A;  1Y28 A;  1NLZ A;  5I5L A;  4H6J B;  2W3F A;  3UE6 A;  1ZHH B;  3S7N A;  5HPI A;  4EEU A;  4YOF A;  3KX0 X;  3MQO A;  2PHY A;  1XJ3 A;  1MKM A;  2R78 A;  1D06 A;  1F98 A;  3UB7 A;  4BBT A;  3B47 A;  5F69 A;  3ZYT A;  3KO6 A;  2PD8 A;  4ETZ A;  5HWT A;  4NXB A;  3F1P B;  4NXE A;  3MQQ A;  2PYR A;  3HJI A;  1S1Z A;  3E4O A;  5A8B A;  4NEE D;  4O8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...