1V9YA

Crystal structure of the heme pas sensor domain of ec dos (ferric form)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
113
structure length
103
Chain Sequence
GIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNRERELQLEKKDGSKIWTRFALSKVSAEGKVYYLALVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A redox-controlled molecular switch revealed by the crystal structure of a bacterial heme PAS sensor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
molecule keywords Heme pas sensor protein
total genus 31
structure length 103
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2004-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1v9yA00
3IBRA 1D7EA 3NOTC 4GCZA 3LICA 3LIEA 1S4SA 2P7JA 3RH8B 1EW0A 3FC7A 1GSXA 3F1PA 4JGOA 3MQQA 5DKKA 5DJTA 4R3AA 2VLGA 4LLOB 4KUKA 1OT9A 3E4OA 3UMDA 3NHQA 3IS2B 2J80A 1T1AA 3B33A 1TS6A 2PYPA 4K08A 4B9OA 3SW1A 1S1ZA 2GJ3A 4HJ3A 4PKYG 2WKQA 2D02A 2A24B 4WL9A 1OTAA 1WA9A 4HJ6A 4HI4A 5G4YA 1GSVA 3ULFA 3F1OB 2QWSA 2VV8A 5F6AA 4EERA 1VB6A 4F3LB 4PKYA 3MR0A 3CLOA 4R38A 1LL8A 3PYPA 3PHYA 4WF0A 3UE6A 1T18A 3NOPC 4NXGA 4LRYC 4NXEA 3F1NA 4EEUA 1XJ3A 3OLOA 4NXFA 3UB9A 2QJ7A 3H82B 3KX0X 2VEAA 3GECA 3LI8A 4EESA 3C2WA 3E4QA 4KQDA 1X0OA 3H7WB 5AVEA 1TS0A 4GS9A 4NXBA 5HWTA 5AVFA 1LSXA 1N9OA 1ODVA 5HD5A 2KX6A 4GHIA 4M4XA 5J4EA 1OTEA 2PHYA 4GW9A 4EW7A 4WUJA 3LI9A 2HV1A 2W27A 3LUQA 1XJ4A 2PD8A 1F9IA 3NJAA 4WN5A 2JHEA 3UB7A 2ZOHA 3K3CA 3EWKA 2K7SA 3CAXA 4I5SA 5IS1A 5J7EA 3MFXA 4MN5A 3A0VA 4JGRA 1OTDA 2VV6A 4HHDA 2JN7A 5TBMB 4BBUA 2V0WA 4HIAA 2KDKA 1OT6A 2YKHA 4H6JA 4E04A 5HDSA 3MJQA 5HWWA 2QJ5A 1UWNX 2ZOIA 4BBTA 4MN6A 3F1OA 3GDIA 2PR5A 3G6OA 3NOUC 4HH3A 3UB6A 1GSWA 3CWFA 4LRZE 1N9LA 1P97A 1KOUA 1S66L 2D01A 2W0NA 2Z6CA 1T19A 1XJ2A 1OTIA 3E4PA 3BY8A 3IS2A 2CMNA 3MQOA 2YKFA 1P0ZA 5DJUA 5F5YA 3UMEA 1LT0A 4EQ1A 2Z6DA 5G4ZA 3ZQ5A 1S67L 1LSVA 3A0SA 4I3AA 1DRMA 2A24A 4HJ4A 1F98A 3H9WA 1G28A 4JGQA 3VOLA 5HZHA 2L1MA 3F1PB 5HD3A 2PDRA 1D06A 2BASA 2L4RA 3C8CA 2PYRA 3D72A 4I38A 1XJ6A 3HJKA 3K3DA 4I3JA 4R6LA 4HQAA 1OJ5A 2L0WA 4HP4A 4R70A 3VE3A 4EETB 4F3LA 4RQ9A 4HNBA 2H28A 3FG8A 1DP6A 5IU1A 1JNUA 2M1CA 2QKPA 4I39A 1NWZA 4XT2A 1N9NA 2INWA 5F69A 5J3WA 4L9EA 3BY9A 5HDCA 2I9VA 1TS8A 4DJ3A 2R78A 4KUOA 1S4RA 1V9YA 2V1BA 2V9AA 1BYWA 4GS9B 4L9GA 2V1AA 5EFWA 1OTBA 1UGUA 4WLAA 5KIZA 4LPZA 2OWHA 3ICYA 4I3IA 3H82A 4HH2A 3T50A 1TS7A 4HY8A 4EEPA 1XFQA 2PD7A 3VE4A 1DP8A 2WKPA 2B02A 2VV7A 3H7WA 3LIFA 5HSQA 1XFNA 3LIAA 2PR6A 2V0UA 1V9ZA 3RTYA 3P7NA 3LIBA 4GHIB 4HOIA 4L9FA 3LYXA 2ZBBA 5I5LA 5TBMA 1OJGA 4BBVA 5HWVA 1MZUA 1T1CA 3A0RA 5F68A 2EA9A 2OWJA 1T1BA 2WKRA 3EEHA 4H6JB 4XT2B 5HDDA 3LIDA 3MXQA 2OOLA 5A8BA 3F1NB 5DKLA 2QHKA 3HJIA 1LSWA 4HP9A 4EXOA 1DP9A 3UB8A 3BWLA 4JGPA 1UWPX 4LRXC 4YWZA 4DJ2A 1S1YA 1Y28A
chains in the Genus database with same CATH superfamily
4LENA 2EFUA 5CHMA 3IHBA 3NDGA 1ERMA 5J8XA 2CC1A 2IA2A 3FWLA 3T4TA 1WA9A 3T1XA 2V2FF 1NYMA 2Y2JA 2QWSA 3PBNA 1XX2A 2Z2LB 5GLCA 2Y2OA 3UE6A 2XGNA 4UA6A 4BJPA 2HZ5A 3UB9A 3KX0X 2FFFB 1X0OA 3EOIA 5HD5A 4UEYA 2JC7A 3LY3A 1G6AA 4I5SA 1SDEA 4MBFA 2HF6A 3IWIA 3MQ0A 3CHWP 5CECA 2PAVP 1S66L 5EUAA 3P98A 3N4IA 1U60A 3A0SA 3TG9A 5CERA 2HDRA 2G2UA 4C3QA 4L0LA 4R70A 1BT5A 2P04A 2ZC3B 2WGWB 4B88A 5U47A 3HUNA 4IHQA 3UN7A 5FEGA 4R4RA 3LGOA 4GZBA 4LPZA 3LO7A 3ICYA 4HH2A 1TS7A 1G5UA 2XA7M 3HLCA 3HLDA 2PR6A 4H8RA 4BENA 3LYXA 4Y0OA 5FASA 1PI4A 3A0RA 4WEJA 2A3UA 3UDXA 4H6JB 1EI5A 2P9VB 3LIDA 3MXQA 4OPRA 3MKEA 3V5MA 3GQZA 4ETXA 5TR7A 5A93A 1KGGA 4DJ2A 2WGVA 4R0QA 5DF8A 5K5BA 1HVBA 4GCZA 1GA9A 1EW0A 3F1PA 3IXHA 4KUKA 3E4OA 1ESUA 4PHTA 5CTMA 4K08A 4JXGA 1DJAA 2WKQA 4X1MA 1OTAA 4ZBEA 2XLNA 1PIOA 1LL8A 3PYPA 3OZHA 4BL3A 4S2KA 2J3TD 4ARZB 4GN2A 2WGIA 3GR2A 3VFHA 3IXBA 3S7OA 4GHIA 4CLCD 3LI9A 2FFYA 3BM6A 4KG6A 3C5AA 1F9IA 3IQAA 2VJWA 3UB7A 2ZOHA 2JKFA 4XXRA 5TGFA 1JWVA 4S2IA 4E3LA 3S4XA 2H5SA 2EX2A 5EVIA 1W7FA 1K25A 3FKWA 4CPKA 3IHAA 4Q0JA 4YNRA 1P97A 2Z6CA 2IWBA 4I3JA 3LFVA 1OTIA 4IUHA 3Q7VB 3LR5A 1LSVA 2HP6A 4RVAA 3LEQA 4OP8A 3F1PB 3PXPA 4Y7PA 3WRTA 4HQAA 3O87A 1BZAA 1HD8A 1ACFA 1PFLA 4GS9B 4UA7A 2VX8A 1K54C 1LLBA 4JF4A 4GDBA 5EPHA 2V0UA 4OPYA 4L9FA 5HWVA 5TBMA 4DRTA 4FD8A 3NULA 3HLWA 5DKLA 2XH9A 3BEBA 2QMIA 1ESIA 2W3EA 5KSCA 2WZXA 4NEED 3FYZA 3MQQA 2WYXA 5DJTA 4CLCB 4BL2A 1LI9A 4JLFA 3QNCA 2EWWA 4KENB 3R7WB 4B4ZA 1PWDA 3IXDA 3IWOA 2WUQA 3LCEA 3ZGAB 1XJ3A 4NXFA 4KQDA 1KVMA 2XFSA 1K54A 1PWGA 2JKGA 3WS5A 1N9OA 4S2JA 4FTXA 3GTCA 1JVJA 5FQJA 4MDZA 2HV1A 4DXBA 5DTKA 1YSQA 1GHIA 3WS0A 4R1GA 2ZOIA 3CWFA 2VGKA 2Y2NA 1KOUA 2BLSA 4DN0A 5HAPA 3IXGA 5HL6A 3UPOA 1HZOA 1IFQA 3UPPA 3MF0A 1GHMA 3RXXA 2B95A 4IVKA 3W4PA 2PDRA 2J9PA 4Z9QA 2WAFA 1W8QA 2VGJA 4X55A 2X71A 2QYBA 2J3WA 1TS8A 3R7WA 2Q9NA 3Q07A 2LB9A 2ZQDA 2W1RA 4PM5A 2ZBBA 4S2NC 3HLGA 1CI8A 4JXVA 3VFFA 2WKIA 4ZJ3A 1FOFA 3IF6C 3SS5A 3ZFZA 3G2YA 3M6BA 4GJ4A 3JPUA 3PBOA 3VOZA 4JGOA 4GDNA 2VLGA 2WADA 1CK3A 2O9AA 2G7UA 2H0YA 3D9YA 4X68A 2HDSA 4JBFA 5G4YA 1GSVA 1BLPA 5G18A 2X02A 3CLOA 2ZMAA 1T18A 5E2EA 3F1NA 2QZ6A 4PPRA 3VP1A 2VEAA 3T4KA 3RJUA 2KOIA 4NXBA 4P6BA 2KX6A 3Q7VA 5HX9A 2VZWA 3UB5P 3LUQA 4Y2FA 3T4JA 1CF0A 1K55C 1FCNA 3V67A 4PM9A 4H6JA 5HDSA 1UWNX 3TE8A 4WZ4A 3UB6A 4QJGA 3OCNA 2GX5A 3CITA 2W1TA 5J4EA 2Z6DA 3ITBA 4Y13A 3O5YA 2UV0E 3VE3A 2DNSA 3S7QA 1NZOA 4JXSA 5HDCA 1NZUA 3ZVWA 1XA7A 2PBDP 1IYQA 1YLZA 2OLVA 1S0WA 4NETA 4AFIA 5GLDA 2Y59A 4K0XA 3BFFA 4E3MA 1LSWA 1WE4A 4R4SA 2O0YA 4MLLA 1D7EA 3MBZA 3LIEA 1L2SA 3FC7A 1CEGA 5DKKA 3ZG9B 2GJ3A 2IWCA 4PAUA 4DE1A 1L0FA 4HI4A 1OPXA 1FR6A 1NLYA 2A2LA 5GHXA 5M19A 1E3UD 5EOOA 4HBTA 5A90A 1ES5A 4GS9A 5AVFA 3LR3A 5F82A 1EROA 3ZG7B 1F5MA 5CGXA 3ISGA 5FQQA 3S7PA 3ZYTA 1N4OA 4FH4A 3LY4A 2NUPC 3W2ZA 2PU4A 4KZ4A 4P6ZM 5HPFA 3PR6A 1XGIA 5DTTA 3GDIA 4HH3A 3DWKA 1JTDA 4LRZE 3BLMA 3MQOA 4OPZA 2EXBA 1K4EA 2WKHA 4S2MA 3O86A 4Q0IA 3ZHHA 3W8KA 4EETB 4GB7A 3MS6A 4RQ9A 4UAAA 3CUEC 1N9NA 3T1QB 5KZHA 4KZBA 3NECA 5FQMA 4YOFA 5GHZA 3C4PA 1YLPA 5EFWA 1UGUA 1QMFA 5CX7A 1FILA 1Z6FA 5KSHA 1M6KA 1KGFA 1NYYA 2ZC6B 1XP4A 4DXCA 1J3WA 1Y28A 5CGSA 4UQIM 2IWDA 1AXBA 5CTNA 4X53A 2XD1A 3BFCA 3Q1FA 5F6AA 3BQ8A 3TJZC 2Y2HA 2HGVA 1TS0A 2JCHA 1VEUB 1FCOA 2ZQCA 3IF5A 3NJAA 4WN5A 4WZ5A 3EWKA 2VA0A 2DMWA 4GD8A 5CHUA 1G6OA 3MXSA 1Y4OA 5HWWA 3PBRA 4BBTA 1GCEA 1VHMA 4GNUA 2W0NA 2ZMFA 1P0ZA 3D3OA 3QP1A 4PM8A 2HJEA 2QPNA 4R3BA 2A24A 4DE0A 1MY8A 4HBUA 3EGXC 1O07A 2BASA 3PAEA 4DDYA 4X56A 3UDFA 3KSIA 2Y55A 3PAGA 2M1CA 3FPWA 4OP5A 5LBRA 3BY9A 4DKIA 1K6SA 5J7EA 4DJ3A 1V9YA 2HP9A 4MBHA 5FI2A 3KSFA 5JYOA 1IEMA 2B02A 3MMHA 3LIFA 1MKIA 5HPIA 3QHYA 3CZDA 1E4DA 1FSYA 3WS1A 4XT2B 4O8GA 3L9KA 2OOLA 4Y5FA 2W3FA 3ZCZA 4E6WA 1S1YA 4OONA 4D60A 4RA7A 3LICA 4JF5A 2C6WB 2MJ6A 3BJNA 4EQIA 4UQIS 2O9CA 3OBFA 2WZZA 4HJ3A 5EV0A 2A24B 3NC8A 2RL3A 2XF3A 4HJ6A 1ZKJA 4F3LB 2DCFA 1FIKA 4NXGA 4NXEA 1ES2A 3V3RA 3BFEA 3LI8A 3OCLA 4QY6A 3V39A 1H5XA 4S2NA 3W4OA 5IS1A 5F83A 1OTDA 3ZNTA 2ZD8A 1PRQA 4P0MA 3BQAA 1MXOA 4C75A 4BQMA 2PR5A 5FDHA 4EW7A 3UMEA 4U0XA 3ITAA 3ZQ5A 1LL9A 4E3NA 4JKTA 2ZL1A 1SKOA 4N1HA 5HD3A 4LFUA 3HLFA 4R6LA 2OV5A 4P87A 4QWOA 4ZAMA 3CMZA 3VP0A 1J9MA 4WBGA 3SZTA 5A8BA 1TEMA 2Y91A 2UWXA 1OTBA 2B5RA 1NRFA 5KIZA 2JE5A 1W5DA 2ZM0A 3PBSA 5FI7A 3IX8A 4LV3A 1SZVA 2NUTC 5L10A 4U3TA 1YLTA 1SKFA 3BECA 4BBVA 1MZUA 5EM0A 2EA9A 2OWJA 1WYBA 3E2KA 4FH2A 3VV4A 4EXOA 3UNWA 3BWLA 3IBRA 1IYOA 2C5WB 1EWZA 3MZDA 4OQ0A 4S2PA 4XUXA 4CLCC 5M18A 5DFYA 2XRNA 1C3BA 2GDNA 2J80A 4HEFA 1T1AA 2HP5A 4E3JA 2AVXA 4PKYG 1PI5A 2P9VA 3IBJA 4RX3A 3V3SA 4Z1WA 1QMEA 1N9BA 2XA7S 3BFGA 3WWXA 2Y79A 2OAP1 4LRYC 4EEUA 2Z2MB 3UE0A 4G3VA 4KZ9A 1SHVA 4EBLA 3AGDA 1KE4A 5CGWA 4M4XA 1BTLA 2ZQAA 1BUEA 3GSGA 2PD8A 4KZ7A 5FQ9A 5TJJA 4JGRA 2VV6A 1KE0A 3CPTB 4ZJ2A 1FQGA 3KO6A 3C7UA 2ZQ9A 3MJQA 3N7WA 1RGZA 3UDIA 1GSWA 2WK0A 2ZM2A 3E4PA 2CMNA 1LT0A 4I3AA 3G32A 4CLCA 4OVDA 1H8ZA 3G2ZA 3N8RA 4P6ZS 2XDMA 5DVAA 2VKSA 4I38A 5HARA 3HJKA 3EGDC 3SS3A 4EBNA 2XEPA 3HL9A 4WM9A 5FAPA 2Y4AA 2I9VA 5JYPA 4X69A 2J8YA 1XPBA 3D4FA 1L3LA 4I3IA 4PM6A 1F2KA 3H82A 2JKRM 4LCMA 4ZJ1A 1V9ZA 3P7NA 1VEUA 1OJGA 3NI9A 3WS2A 4OOLA 1S6RA 3O88A 4Y15A 3ZVTA 1VETA 4HP9A 2B18A 3MKFA 4YWZA 1K56D 4KQQA 3SH9A 3SH8A 3W4QA 1IELA 5HL1A 3CI6A 5EVEA 1ONGA 2PYPA 1M40A 4M3KA 3T4OA 2EXAA 1ALQA 1L0EA 1SDNA 3CG5A 4GD6A 3T4SA 3CUEA 4BWIA 4IEDA 1ERQA 3L7HA 1GA0A 3C2WA 4D2OA 2W3HA 4QU3A 4N9KA 5FDSA 3BYDA 3ZG8B 1KVLA 5AQ9A 1FCMA 3CAXA 4KQOA 4B93A 2JN7A 2EFXA 2FZ0A 3RXWA 4MN6A 3NOUC 5CXWA 4GKUA 3BY8A 4OH0A 4OQGA 5EM1A 1S67L 3A3DA 4JF6A 1F98A 1YKDA 2PYRA 1Q2PA 5FAOA 1BLHA 1ZG6A 1HLUP 1CQAA 3NDEA 3T4LA 2ZLYA 4UHUA 4L9GA 4P85A 2V1AA 4IBRA 2H10A 4KZ5A 1HTZA 3R4KA 4WZ5C 3UE1A 1I2SA 2XR0A 3HJIA 2RCXA 1IKGA 3N8LA 3SH7A 1ES3A 3DW0A 3NOTC 1KDSA 4OKPA 2P7JA 4UA9A 2WKEA 2W3DA 2ZJ9A 3NIAA 4MN7A 2HDUA 3E98A 1TS6A 1A0KA 4B9OA 1S1ZA 3ZG5A 3NCKA 4Q0HA 1Y54A 4U0TA 2HDQA 1YLJA 3NOPC 4QD4A 1MBLA 3IF6B 3TSGA 3VSLA 5HWTA 3OPPA 5KMWA 5E2GA 4GW9A 2PHYA 5E2FA 3ZNYA 3BFDA 1JWPA 1OT6A 4Y0UA 2QJ5A 4MBKA 3LEZA 3G6OA 2E8JA 3NBLA 4RX2A 1ES4A 1DRMA 2ZC7A 1G28A 4ME4A 4HESA 1D06A 3G34A 3DTMA 4L9EA 3DBAA 4BD0A 3SS4A 2W1TB 3B47A 4ID4A 4ARZA 1Q2QA 2PD7A 3HLBA 4O0PA 3AGEA 2P74A 3VP2A 5HAQA 1K6RA 3TW8A 1TF1A 4LV2A 3F1NB 1L0GA 2QHKA 4FCFA 2OWHA 5D3OA 3DTKA 1MWSA 4EUVA 5CRFA 4X6TA 2PU2A 1K0KA 3SW1A 1NRJA 3LR4A 4WL9A 1DY6A 3DWZA 4QY5A 3JVUA 2P08A 1JWZA 1DJCA 3VP3A 2KLIA 5AJGA 3QP2A 4EESA 3GECA 5DF7A 5AVEA 2Y2IA 3A3IA 2J9OA 4F94A 3RFBA 4FOFA 3Q7ZA 1ZG4A 4MEZA 3IX4A 5TBMB 1MWRA 2V0WA 3P01A 5EVID 4DE2A 2ZC5B 2WGWA 5L2FA 1MWUA 4B4XA 1STZA 1YLWA 2YKFA 2VGLM 1WYCA 5G4ZA 2V20A 4QB8A 3MXRA 4JGQA 2PT7A 2Y2MA 1CEFA 1PZOA 3C8CA 3MZEA 3VMAA 2J7VA 2Y2QA 1CJFA 4BLMA 4LGWA 3GMWA 4HP4A 5EOEA 4Y17A 3C30A 2V9AA 3E0YA 5GL9A 2OSUA 4C6YA 1XFQA 2EX8A 1XFNA 1LI0A 3T12B 4E3OA 4Q8IA 3K2NA 4KZAA 2ACGA 4FUWA 4Y0TA 3A3FA 1SCWA 4WELA 3WS4A 2V1ZA 1S4SA 1GSXA 4R3AA 4LLOB 3IH9A 1LHYA 2JKTI 3B33A 2DRWA 3N8SA 4NG2A 3VP4A 2HJ9C 5EVIB 1TVFA 4OPQA 3OLOA 3E4QA 4QHCA 3T4QA 3QNBA 2Y2GA 3H7WB 2EWVA 1KE3A 4KZ3A 4Y3IA 4WUJA 4N9LA 3K3CA 1PZPA 4HHDA 3IX3A 4PM7A 4HIAA 2KDKA 5A91A 3MZFA 5BOHA 1ZTUA 1IYPA 4II7A 3IS2A 5F5YA 3M6HA 4HJ4A 3H9WA 3UE3A 1YAXA 2GZAA 3UY6A 3C38A 3UO9A 1XJ6A 4IUKA 4KG2A 2L0WA 3G4PA 4F3LA 2ZQ7A 4I39A 3KSGA 5F69A 2GNXA 3KYQA 3MFDA 4EBPA 5FI6A 4OOYA 3FKVA 4WLAA 2Y2PA 3T50A 3DTIA 4PMAA 3VE4A 5CHJA 3HREA 4CLCE 5I5LA 4GHIB 5E2HA 5EE8A 2BG1A 1YMXA 1BLSA 4GLQA 3EEHA 4OLGA 4KZ6A 1RGYA 3OC2A 3FPVA 1UWPX 5E43A 4ZRRA 1W79A 4DE3A 3HCYA 1SKOB 1O7EA 5TFQA 1K38A 3IS2B 1P9WA 4OLDA 3NY4A 3QP4A 1VQQA 4N1XA 3ZDJA 3ULFA 3OOVA 3F1OB 4IBXA 4EERA 1XKZA 3SOIA 4G3WA 2V8CA 3N6IA 2VGLS 2JBFA 2K2NA 1BLCA 4KG5A 2O99A 4LV1A 4NKPA 2K7SA 1JTGA 4O01A 1FSWA 3GVBA 4BBUA 1K57A 2R9WA 2PBYA 2YKHA 2EX6A 3GV9A 5FA7A 3TRCA 4DDSA 1N9LA 2M7VA 1T19A 2R9XA 2HPBA 5IHVA 3G31A 3VOLA 5HZHA 4R3JA 2L1MA 5AQAA 4ZDXA 3HUOA 3S7NA 2H28A 2VK3A 5IU1A 5J3WA 3U2AA 3EEAA 1YPRA 4E3KA 5HW3A 1BYWA 5DF9A 3G30A 4EU0A 5HSQA 3C7VA 2JKRI 4HOIA 3S1YA 5EVLA 4EUZA 1T1CA 3HLEA 5DFXA 1T1BA 2XK1A 4MCWA 1K57C 1MC0A 4LRXC 3U4LP 4X1LA 1MPLA 4ESPA 1BULA 1YSPA 5CEDA 3UMDA 5C5KA 1PW8A 4S2LA 3T1RA 3E2LA 2H0TA 1GHPA 4IJGA 1BSGA 4QPRA 4JXWA 1PW1A 5FSRA 3H82B 3PTEA 3T1SA 1H8MA 1LSXA 3IWQA 5GLAA 1ODVA 4DMZA 5M1AA 1XA1A 1XJ4A 2Q0OA 5FAQA 3QP6A 5HAIA 4WMCA 3KYZA 4MN5A 5EECA 1ZC2A 5FL3A 4GOGA 3F1OA 4JPMA 2D01A 1XJ2A 1I2WA 2XFTA 4EQ1A 1W8YA 3M2KA 1E3UA 3PBTA 2JKTM 1E25A 4E6XA 2L4RA 4A5RA 3CPTA 1AWIA 3K3DA 4WMCD 2BTFP 1DP6A 2QKPA 1ZHHB 1W63M 1H0MA 3OPHA 2I72A 4HY8A 1ONHA 3H7WA 3FV7A 3LIAA 2PRFA 3RTYA 3LIBA 1OMEA 1YMSA 2Y2KA 2ZMVA 3BRMA 4RYEA 3BW6A 3HUMA 5EVIC 3OPRA 3UB8A 3QP8A 2Q9MA 5L09A 1MWTA 3EQUA 3RH8B 1CI9A 3BLSA 1IYSA 4BMWA 1D1JA 4FSFA 5GLBA 3Q81A 3VOYA 4MNRA 1H8YA 3KYEA 2VV8A 4WYYA 4PKYA 1KGEA 4CQHA 3A3EA 2EX9A 2QJ7A 2XQZA 1XGJA 3ZG0A 1PWCA 3QP5A 1FR1A 5IT5A 4R23A 5F1GA 4E3IA 5FATA 2JHEA 1YM1A 3MFXA 4XUZA 5F1FA 2LB5A 4S2OA 3B3XA 3HVFA 4G3KA 3IH8A 4LCLA 4IVIA 1TD5A 3MSHA 1NY0A 4E04A 2M7UA 2XROA 2Y8HA 4EV4A 1L0DA 4YINA 4MMNA 1VETB 1PNEA 3G35A 4X25A 2W3GA 3HBRA 1OJ5A 1YT4A 3AGFA 3FG8A 3M2JA 1NWZA 4WEKA 4ZTKA 2R78A 4KUOA 1VM1A 3C4OA 5AQBA 2WAEA 4K91A 2WKPA 1NJ4A 2VV7A 4DF6A 4KZ8A 3KSHA 3B42A 2FH5A 5F68A 1KDWA 1NLZA 1YQSA 2J3TC 3PBQA 5L8MA 4OQHA 1DP9A 3GRJA 1I5QA 3UPNA 3EQVA 1W63Q 1RCJA 1YLYA 4O7DA 2O9BA 1K4FA 1OT9A 3NHQA 1LL5A 3JYIA 3P09A 2D02A 5I94A 3DAVA 4OQIA 3JVVA 1IOUA 4CJNA 1VB6A 3MR0A 4R38A 3PHYA 4WF0A 1TDLA 2G2WA 2OAQ1 1IKIA 4KQRA 4K0WA 1Z09A 2XD5A 1XXMA 3OPLA 2ZC4B 5FQKA 1OTEA 1TDGA 4N92A 2W27A 3O3VA 5HFOA 1G68A 3TOIA 4BD1A 3A0VA 3IT9A 1P9RA 2ZM8A 2V8FA 3IF6A 4NK3A 5MC7A 1K56A 5DJUA 2X01A 5A92A 5DTSA 1MKMA 4ETZA 3D72A 3Q82A 3S22A 4EWFA 3FZCA 4HNBA 3LR0A 1JNUA 2XSSA 4LV0A 4XT2A 5CEBA 1DJBA 2INWA 2OLUA 1S4RA 2V1BA 5FEFA 3DTEA 5GHYA 4EEPA 3VSKA 1DP8A 5AQ7A 5L07A 3CJMA 3WRZA 2K31A 5FQIA 3I7JA 4YFMA 2ZL1B 2A49A 1NXYA 4OOMA 2ZQ8A 3V50A 2WKRA 1K55A 1PYYA 3A3JA 5HDDA 2E8IA 4JGPA 2Y2LA 1RP5A 1H3QA
chains in the Genus database with same CATH topology
1D7EA 3LIEA 3HCYA 3FC7A 3CI6A 5DKKA 2IA2A 3IS2B 1P9WA 2PYPA 3T4TA 2GJ3A 3T4OA 4PAUA 1WA9A 4HI4A 3ULFA 3OOVA 3F1OB 1OPXA 2QWSA 3PBNA 3T4SA 3CUEA 4EERA 4BWIA 1NLYA 2A2LA 3UE6A 4BJPA 3UB9A 3KX0X 3C2WA 4G3WA 1X0OA 3EOIA 4GS9A 2VGLS 2W3HA 5AVFA 3LR3A 5HD5A 2K2NA 4UEYA 1F5MA 2O99A 4NKPA 2K7SA 3CAXA 4I5SA 3S7PA 3ZYTA 4KQOA 4O01A 2HF6A 4B93A 2JN7A 2NUPC 3MQ0A 4BBUA 3W2ZA 2FZ0A 2YKHA 5HPFA 4P6ZM 3PR6A 4MN6A 3NOUC 3GDIA 4HH3A 3TRCA 4LRZE 1N9LA 1S66L 2M7VA 1T19A 3MQOA 3BY8A 1S67L 3A0SA 1F98A 3VOLA 5HZHA 2L1MA 1YKDA 2PYRA 4Q0IA 3S7NA 4L0LA 4EETB 4R70A 4RQ9A 2P04A 2H28A 3CUEC 5IU1A 1N9NA 5J3WA 3U2AA 3T4LA 4IHQA 3EEAA 4YOFA 4L9GA 1BYWA 2V1AA 5EFWA 1UGUA 4LPZA 5DF9A 3ICYA 5CX7A 4HH2A 1TS7A 2XA7M 4EU0A 5HSQA 2PR6A 2JKRI 4HOIA 3LYXA 3R4KA 1T1CA 3A0RA 4WEJA 5DFXA 1T1BA 4H6JB 3LIDA 3MXQA 4MCWA 5KSHA 3HJIA 4ETXA 1MC0A 4LRXC 4DJ2A 1Y28A 5K5BA 3NOTC 4GCZA 2P7JA 1YSPA 1EW0A 2W3DA 4UQIM 3F1PA 4MN7A 4KUKA 3E4OA 3UMDA 5C5KA 3E98A 4PHTA 1TS6A 4K08A 4B9OA 1S1ZA 2WKQA 1OTAA 4Q0HA 4IJGA 5F6AA 1LL8A 3PYPA 4QPRA 3NOPC 3BQ8A 2J3TD 4ARZB 3TJZC 3H82B 2HGVA 1H8MA 1TS0A 5HWTA 3S7OA 1LSXA 1ODVA 4DMZA 4GHIA 4GW9A 2PHYA 4CLCD 3LI9A 1XJ4A 1F9IA 2VJWA 3NJAA 4WN5A 3UB7A 2ZOHA 3EWKA 2VA0A 2DMWA 1G6OA 3KYZA 4MN5A 1OT6A 5FL3A 5HWWA 2QJ5A 3PBRA 4BBTA 1VHMA 3F1OA 4Q0JA 3G6OA 4YNRA 1P97A 2Z6CA 2W0NA 2D01A 2ZMFA 4I3JA 3LFVA 1OTIA 1XJ2A 4IUHA 1P0ZA 3D3OA 3LR5A 4EQ1A 1LSVA 2HJEA 1DRMA 2A24A 3PBTA 1G28A 2JKTM 4ME4A 3EGXC 3F1PB 3PXPA 1D06A 2BASA 2L4RA 3K3DA 4HQAA 1DP6A 3KSIA 2M1CA 1ZHHB 2QKPA 1W63M 3FPWA 4L9EA 5LBRA 3BY9A 3DBAA 5J7EA 4DJ3A 1V9YA 2W1TB 4GS9B 3B47A 2VX8A 3KSFA 4HY8A 4ARZA 2PD7A 3H7WA 2B02A 3MMHA 3LIFA 4O0PA 3LIAA 2V0UA 3RTYA 5HPIA 3LIBA 4L9FA 5HWVA 5TBMA 2ZMVA 3BW6A 4XT2B 4O8GA 3TW8A 1TF1A 2OOLA 3F1NB 4Y5FA 2QHKA 5DKLA 2W3FA 3UB8A 2W3EA 1S1YA 2OWHA 4NEED 4EUVA 3EQUA 3LICA 3RH8B 2MJ6A 3BJNA 4UQIS 3MQQA 5DJTA 4BMWA 2O9CA 3OBFA 4CLCB 3SW1A 4FSFA 1NRJA 4HJ3A 3LR4A 2A24B 4WL9A 4HJ6A 2EWWA 3JVUA 2P08A 2VV8A 3R7WB 4F3LB 4PKYA 2KLIA 4CQHA 5AJGA 4NXGA 4NXEA 1XJ3A 4NXFA 2QJ7A 4EESA 3GECA 3LI8A 4KQDA 5AVEA 3OCLA 1N9OA 5IT5A 4MDZA 2HV1A 3RFBA 4FOFA 2JHEA 5IS1A 3MFXA 1OTDA 5TBMB 2LB5A 2V0WA 1YSQA 3BQAA 4G3KA 3P01A 2ZOIA 2PR5A 1TD5A 4E04A 3CWFA 1KOUA 4DN0A 1STZA 4EW7A 3UMEA 2M7UA 2YKFA 2VGLM 5HL6A 2XROA 5G4ZA 3ZQ5A 2Y8HA 1IFQA 3MF0A 4JGQA 4MMNA 2PT7A 5HD3A 2PDRA 3C8CA 2W3GA 4R6LA 1OJ5A 4HP4A 3FG8A 1NWZA 2QYBA 4WEKA 2J3WA 3C30A 5A8BA 1TS8A 3R7WA 2R78A 4KUOA 2V9AA 3E0YA 1OTBA 5KIZA 3PBSA 2LB9A 1XFQA 2W1RA 2WKPA 2VV7A 2NUTC 1XFNA 3KSHA 2ZBBA 3B42A 4BBVA 2FH5A 1MZUA 5F68A 2EA9A 2OWJA 1NLZA 3K2NA 2J3TC 3PBQA 5L8MA 3VV4A 4EXOA 1DP9A 3BWLA 3IBRA 4WELA 3EQVA 1W63Q 1S4SA 4GJ4A 3PBOA 2O9BA 1GSXA 4JGOA 4CLCC 4R3AA 2VLGA 4LLOB 5DFYA 1OT9A 2XRNA 2JKTI 2J80A 3NHQA 1T1AA 2O9AA 3B33A 2G7UA 4PKYG 2D02A 3IBJA 5G4YA 1GSVA 4Z1WA 3JVVA 1IOUA 2XA7S 1VB6A 3MR0A 3CLOA 4R38A 2Y79A 3PHYA 4WF0A 1T18A 2HJ9C 2OAP1 4LRYC 4EEUA 3F1NA 2OAQ1 3OLOA 2VEAA 3E4QA 4G3VA 3T4QA 3H7WB 3T4KA 2KOIA 2EWVA 4NXBA 2KX6A 4M4XA 1OTEA 4Y3IA 4WUJA 2VZWA 2W27A 3LUQA 4Y2FA 2PD8A 3T4JA 3K3CA 5TJJA 3A0VA 4JGRA 2VV6A 4HHDA 3V67A 1P9RA 4HIAA 2KDKA 3KO6A 4H6JA 5HDSA 3MJQA 1UWNX 1ZTUA 3TE8A 3UB6A 5MC7A 1GSWA 3OCNA 4II7A 2GX5A 3CITA 3E4PA 3IS2A 2CMNA 5DJUA 2W1TA 5F5YA 5J4EA 1LT0A 2Z6DA 4I3AA 1MKMA 4CLCA 4HJ4A 3H9WA 3UE3A 4P6ZS 1YAXA 2GZAA 4ETZA 2VKSA 3O5YA 3C38A 3D72A 4I38A 1XJ6A 3HJKA 4IUKA 2L0WA 3EGDC 3VE3A 4F3LA 4HNBA 3LR0A 1JNUA 2XSSA 4XT2A 4I39A 3KSGA 3S7QA 2INWA 5F69A 2GNXA 3KYQA 5HDCA 2I9VA 1S4RA 2V1BA 4WLAA 4I3IA 3T50A 3H82A 2JKRM 4EEPA 3VE4A 1DP8A 2K31A 1V9ZA 4CLCE 3P7NA 4GHIB 5I5LA 1OJGA 4OOMA 4AFIA 4OOLA 4GLQA 2WKRA 3EEHA 5HDDA 4HP9A 1LSWA 2B18A 3OC2A 3FPVA 4JGPA 1UWPX 4ZRRA 4YWZA 2O0YA 1H3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IBR A;  1D7E A;  3NOT C;  4GCZ A;  3LIC A;  3LIE A;  1S4S A;  2P7J A;  3RH8 B;  1EW0 A;  3FC7 A;  1GSX A;  3F1P A;  4JGO A;  3MQQ A;  5DKK A;  5DJT A;  4R3A A;  2VLG A;  4LLO B;  4KUK A;  1OT9 A;  3E4O A;  3UMD A;  3NHQ A;  3IS2 B;  2J80 A;  1T1A A;  3B33 A;  1TS6 A;  2PYP A;  4K08 A;  4B9O A;  3SW1 A;  1S1Z A;  2GJ3 A;  4HJ3 A;  4PKY G;  2WKQ A;  2D02 A;  2A24 B;  4WL9 A;  1OTA A;  1WA9 A;  4HJ6 A;  4HI4 A;  5G4Y A;  1GSV A;  3ULF A;  3F1O B;  2QWS A;  2VV8 A;  5F6A A;  4EER A;  1VB6 A;  4F3L B;  4PKY A;  3MR0 A;  3CLO A;  4R38 A;  1LL8 A;  3PYP A;  3PHY A;  4WF0 A;  3UE6 A;  1T18 A;  3NOP C;  4NXG A;  4LRY C;  4NXE A;  3F1N A;  4EEU A;  1XJ3 A;  3OLO A;  4NXF A;  3UB9 A;  2QJ7 A;  3H82 B;  3KX0 X;  2VEA A;  3GEC A;  3LI8 A;  4EES A;  3C2W A;  3E4Q A;  4KQD A;  1X0O A;  3H7W B;  5AVE A;  1TS0 A;  4GS9 A;  4NXB A;  5HWT A;  5AVF A;  1LSX A;  1N9O A;  1ODV A;  5HD5 A;  2KX6 A;  4GHI A;  4M4X A;  5J4E A;  1OTE A;  2PHY A;  4GW9 A;  4EW7 A;  4WUJ A;  3LI9 A;  2HV1 A;  2W27 A;  3LUQ A;  1XJ4 A;  2PD8 A;  1F9I A;  3NJA A;  4WN5 A;  2JHE A;  3UB7 A;  2ZOH A;  3K3C A;  3EWK A;  2K7S A;  3CAX A;  4I5S A;  5IS1 A;  5J7E A;  3MFX A;  4MN5 A;  3A0V A;  4JGR A;  1OTD A;  2VV6 A;  4HHD A;  2JN7 A;  5TBM B;  4BBU A;  2V0W A;  4HIA A;  2KDK A;  1OT6 A;  2YKH A;  4H6J A;  4E04 A;  5HDS A;  3MJQ A;  5HWW A;  2QJ5 A;  1UWN X;  2ZOI A;  4BBT A;  4MN6 A;  3F1O A;  3GDI A;  2PR5 A;  3G6O A;  3NOU C;  4HH3 A;  3UB6 A;  1GSW A;  3CWF A;  4LRZ E;  1N9L A;  1P97 A;  1KOU A;  1S66 L;  2D01 A;  2W0N A;  2Z6C A;  1T19 A;  1XJ2 A;  1OTI A;  3E4P A;  3BY8 A;  3IS2 A;  2CMN A;  3MQO A;  2YKF A;  1P0Z A;  5DJU A;  5F5Y A;  3UME A;  1LT0 A;  4EQ1 A;  2Z6D A;  5G4Z A;  3ZQ5 A;  1S67 L;  1LSV A;  3A0S A;  4I3A A;  1DRM A;  2A24 A;  4HJ4 A;  1F98 A;  3H9W A;  1G28 A;  4JGQ A;  3VOL A;  5HZH A;  2L1M A;  3F1P B;  5HD3 A;  2PDR A;  1D06 A;  2BAS A;  2L4R A;  3C8C A;  2PYR A;  3D72 A;  4I38 A;  1XJ6 A;  3HJK A;  3K3D A;  4I3J A;  4R6L A;  4HQA A;  1OJ5 A;  2L0W A;  4HP4 A;  4R70 A;  3VE3 A;  4EET B;  4F3L A;  4RQ9 A;  4HNB A;  2H28 A;  3FG8 A;  1DP6 A;  5IU1 A;  1JNU A;  2M1C A;  2QKP A;  4I39 A;  1NWZ A;  4XT2 A;  1N9N A;  2INW A;  5F69 A;  5J3W A;  4L9E A;  3BY9 A;  5HDC A;  2I9V A;  1TS8 A;  4DJ3 A;  2R78 A;  4KUO A;  1S4R A;  1V9Y A;  2V1B A;  2V9A A;  1BYW A;  4GS9 B;  4L9G A;  2V1A A;  5EFW A;  1OTB A;  1UGU A;  4WLA A;  5KIZ A;  4LPZ A;  2OWH A;  3ICY A;  4I3I A;  3H82 A;  4HH2 A;  3T50 A;  1TS7 A;  4HY8 A;  4EEP A;  1XFQ A;  2PD7 A;  3VE4 A;  1DP8 A;  2WKP A;  2B02 A;  2VV7 A;  3H7W A;  3LIF A;  5HSQ A;  1XFN A;  3LIA A;  2PR6 A;  2V0U A;  1V9Z A;  3RTY A;  3P7N A;  3LIB A;  4GHI B;  4HOI A;  4L9F A;  3LYX A;  2ZBB A;  5I5L A;  5TBM A;  1OJG A;  4BBV A;  5HWV A;  1MZU A;  1T1C A;  3A0R A;  5F68 A;  2EA9 A;  2OWJ A;  1T1B A;  2WKR A;  3EEH A;  4H6J B;  4XT2 B;  5HDD A;  3LID A;  3MXQ A;  2OOL A;  5A8B A;  3F1N B;  5DKL A;  2QHK A;  3HJI A;  1LSW A;  4HP9 A;  4EXO A;  1DP9 A;  3UB8 A;  3BWL A;  4JGP A;  1UWP X;  4LRX C;  4YWZ A;  4DJ2 A;  1S1Y A;  1Y28 A; 
#chains in the Genus database with same CATH topology
 4LEN A;  2EFU A;  5CHM A;  3IHB A;  3NDG A;  1ERM A;  5J8X A;  2CC1 A;  2IA2 A;  3FWL A;  3T4T A;  1WA9 A;  3T1X A;  2V2F F;  1NYM A;  2Y2J A;  2QWS A;  3PBN A;  1XX2 A;  2Z2L B;  5GLC A;  2Y2O A;  3UE6 A;  2XGN A;  4UA6 A;  4BJP A;  2HZ5 A;  3UB9 A;  3KX0 X;  2FFF B;  1X0O A;  3EOI A;  5HD5 A;  4UEY A;  2JC7 A;  3LY3 A;  1G6A A;  4I5S A;  1SDE A;  4MBF A;  2HF6 A;  3IWI A;  3MQ0 A;  3CHW P;  5CEC A;  2PAV P;  1S66 L;  5EUA A;  3P98 A;  3N4I A;  1U60 A;  3A0S A;  3TG9 A;  5CER A;  2HDR A;  2G2U A;  4C3Q A;  4L0L A;  4R70 A;  1BT5 A;  2P04 A;  2ZC3 B;  2WGW B;  4B88 A;  5U47 A;  3HUN A;  4IHQ A;  3UN7 A;  5FEG A;  4R4R A;  3LGO A;  4GZB A;  4LPZ A;  3LO7 A;  3ICY A;  4HH2 A;  1TS7 A;  1G5U A;  2XA7 M;  3HLC A;  3HLD A;  2PR6 A;  4H8R A;  4BEN A;  3LYX A;  4Y0O A;  5FAS A;  1PI4 A;  3A0R A;  4WEJ A;  2A3U A;  3UDX A;  4H6J B;  1EI5 A;  2P9V B;  3LID A;  3MXQ A;  4OPR A;  3MKE A;  3V5M A;  3GQZ A;  4ETX A;  5TR7 A;  5A93 A;  1KGG A;  4DJ2 A;  2WGV A;  4R0Q A;  5DF8 A;  5K5B A;  1HVB A;  4GCZ A;  1GA9 A;  1EW0 A;  3F1P A;  3IXH A;  4KUK A;  3E4O A;  1ESU A;  4PHT A;  5CTM A;  4K08 A;  4JXG A;  1DJA A;  2WKQ A;  4X1M A;  1OTA A;  4ZBE A;  2XLN A;  1PIO A;  1LL8 A;  3PYP A;  3OZH A;  4BL3 A;  4S2K A;  2J3T D;  4ARZ B;  4GN2 A;  2WGI A;  3GR2 A;  3VFH A;  3IXB A;  3S7O A;  4GHI A;  4CLC D;  3LI9 A;  2FFY A;  3BM6 A;  4KG6 A;  3C5A A;  1F9I A;  3IQA A;  2VJW A;  3UB7 A;  2ZOH A;  2JKF A;  4XXR A;  5TGF A;  1JWV A;  4S2I A;  4E3L A;  3S4X A;  2H5S A;  2EX2 A;  5EVI A;  1W7F A;  1K25 A;  3FKW A;  4CPK A;  3IHA A;  4Q0J A;  4YNR A;  1P97 A;  2Z6C A;  2IWB A;  4I3J A;  3LFV A;  1OTI A;  4IUH A;  3Q7V B;  3LR5 A;  1LSV A;  2HP6 A;  4RVA A;  3LEQ A;  4OP8 A;  3F1P B;  3PXP A;  4Y7P A;  3WRT A;  4HQA A;  3O87 A;  1BZA A;  1HD8 A;  1ACF A;  1PFL A;  4GS9 B;  4UA7 A;  2VX8 A;  1K54 C;  1LLB A;  4JF4 A;  4GDB A;  5EPH A;  2V0U A;  4OPY A;  4L9F A;  5HWV A;  5TBM A;  4DRT A;  4FD8 A;  3NUL A;  3HLW A;  5DKL A;  2XH9 A;  3BEB A;  2QMI A;  1ESI A;  2W3E A;  5KSC A;  2WZX A;  4NEE D;  3FYZ A;  3MQQ A;  2WYX A;  5DJT A;  4CLC B;  4BL2 A;  1LI9 A;  4JLF A;  3QNC A;  2EWW A;  4KEN B;  3R7W B;  4B4Z A;  1PWD A;  3IXD A;  3IWO A;  2WUQ A;  3LCE A;  3ZGA B;  1XJ3 A;  4NXF A;  4KQD A;  1KVM A;  2XFS A;  1K54 A;  1PWG A;  2JKG A;  3WS5 A;  1N9O A;  4S2J A;  4FTX A;  3GTC A;  1JVJ A;  5FQJ A;  4MDZ A;  2HV1 A;  4DXB A;  5DTK A;  1YSQ A;  1GHI A;  3WS0 A;  4R1G A;  2ZOI A;  3CWF A;  2VGK A;  2Y2N A;  1KOU A;  2BLS A;  4DN0 A;  5HAP A;  3IXG A;  5HL6 A;  3UPO A;  1HZO A;  1IFQ A;  3UPP A;  3MF0 A;  1GHM A;  3RXX A;  2B95 A;  4IVK A;  3W4P A;  2PDR A;  2J9P A;  4Z9Q A;  2WAF A;  1W8Q A;  2VGJ A;  4X55 A;  2X71 A;  2QYB A;  2J3W A;  1TS8 A;  3R7W A;  2Q9N A;  3Q07 A;  2LB9 A;  2ZQD A;  2W1R A;  4PM5 A;  2ZBB A;  4S2N C;  3HLG A;  1CI8 A;  4JXV A;  3VFF A;  2WKI A;  4ZJ3 A;  1FOF A;  3IF6 C;  3SS5 A;  3ZFZ A;  3G2Y A;  3M6B A;  4GJ4 A;  3JPU A;  3PBO A;  3VOZ A;  4JGO A;  4GDN A;  2VLG A;  2WAD A;  1CK3 A;  2O9A A;  2G7U A;  2H0Y A;  3D9Y A;  4X68 A;  2HDS A;  4JBF A;  5G4Y A;  1GSV A;  1BLP A;  5G18 A;  2X02 A;  3CLO A;  2ZMA A;  1T18 A;  5E2E A;  3F1N A;  2QZ6 A;  4PPR A;  3VP1 A;  2VEA A;  3T4K A;  3RJU A;  2KOI A;  4NXB A;  4P6B A;  2KX6 A;  3Q7V A;  5HX9 A;  2VZW A;  3UB5 P;  3LUQ A;  4Y2F A;  3T4J A;  1CF0 A;  1K55 C;  1FCN A;  3V67 A;  4PM9 A;  4H6J A;  5HDS A;  1UWN X;  3TE8 A;  4WZ4 A;  3UB6 A;  4QJG A;  3OCN A;  2GX5 A;  3CIT A;  2W1T A;  5J4E A;  2Z6D A;  3ITB A;  4Y13 A;  3O5Y A;  2UV0 E;  3VE3 A;  2DNS A;  3S7Q A;  1NZO A;  4JXS A;  5HDC A;  1NZU A;  3ZVW A;  1XA7 A;  2PBD P;  1IYQ A;  1YLZ A;  2OLV A;  1S0W A;  4NET A;  4AFI A;  5GLD A;  2Y59 A;  4K0X A;  3BFF A;  4E3M A;  1LSW A;  1WE4 A;  4R4S A;  2O0Y A;  4MLL A;  1D7E A;  3MBZ A;  3LIE A;  1L2S A;  3FC7 A;  1CEG A;  5DKK A;  3ZG9 B;  2GJ3 A;  2IWC A;  4PAU A;  4DE1 A;  1L0F A;  4HI4 A;  1OPX A;  1FR6 A;  1NLY A;  2A2L A;  5GHX A;  5M19 A;  1E3U D;  5EOO A;  4HBT A;  5A90 A;  1ES5 A;  4GS9 A;  5AVF A;  3LR3 A;  5F82 A;  1ERO A;  3ZG7 B;  1F5M A;  5CGX A;  3ISG A;  5FQQ A;  3S7P A;  3ZYT A;  1N4O A;  4FH4 A;  3LY4 A;  2NUP C;  3W2Z A;  2PU4 A;  4KZ4 A;  4P6Z M;  5HPF A;  3PR6 A;  1XGI A;  5DTT A;  3GDI A;  4HH3 A;  3DWK A;  1JTD A;  4LRZ E;  3BLM A;  3MQO A;  4OPZ A;  2EXB A;  1K4E A;  2WKH A;  4S2M A;  3O86 A;  4Q0I A;  3ZHH A;  3W8K A;  4EET B;  4GB7 A;  3MS6 A;  4RQ9 A;  4UAA A;  3CUE C;  1N9N A;  3T1Q B;  5KZH A;  4KZB A;  3NEC A;  5FQM A;  4YOF A;  5GHZ A;  3C4P A;  1YLP A;  5EFW A;  1UGU A;  1QMF A;  5CX7 A;  1FIL A;  1Z6F A;  5KSH A;  1M6K A;  1KGF A;  1NYY A;  2ZC6 B;  1XP4 A;  4DXC A;  1J3W A;  1Y28 A;  5CGS A;  4UQI M;  2IWD A;  1AXB A;  5CTN A;  4X53 A;  2XD1 A;  3BFC A;  3Q1F A;  5F6A A;  3BQ8 A;  3TJZ C;  2Y2H A;  2HGV A;  1TS0 A;  2JCH A;  1VEU B;  1FCO A;  2ZQC A;  3IF5 A;  3NJA A;  4WN5 A;  4WZ5 A;  3EWK A;  2VA0 A;  2DMW A;  4GD8 A;  5CHU A;  1G6O A;  3MXS A;  1Y4O A;  5HWW A;  3PBR A;  4BBT A;  1GCE A;  1VHM A;  4GNU A;  2W0N A;  2ZMF A;  1P0Z A;  3D3O A;  3QP1 A;  4PM8 A;  2HJE A;  2QPN A;  4R3B A;  2A24 A;  4DE0 A;  1MY8 A;  4HBU A;  3EGX C;  1O07 A;  2BAS A;  3PAE A;  4DDY A;  4X56 A;  3UDF A;  3KSI A;  2Y55 A;  3PAG A;  2M1C A;  3FPW A;  4OP5 A;  5LBR A;  3BY9 A;  4DKI A;  1K6S A;  5J7E A;  4DJ3 A;  1V9Y A;  2HP9 A;  4MBH A;  5FI2 A;  3KSF A;  5JYO A;  1IEM A;  2B02 A;  3MMH A;  3LIF A;  1MKI A;  5HPI A;  3QHY A;  3CZD A;  1E4D A;  1FSY A;  3WS1 A;  4XT2 B;  4O8G A;  3L9K A;  2OOL A;  4Y5F A;  2W3F A;  3ZCZ A;  4E6W A;  1S1Y A;  4OON A;  4D60 A;  4RA7 A;  3LIC A;  4JF5 A;  2C6W B;  2MJ6 A;  3BJN A;  4EQI A;  4UQI S;  2O9C A;  3OBF A;  2WZZ A;  4HJ3 A;  5EV0 A;  2A24 B;  3NC8 A;  2RL3 A;  2XF3 A;  4HJ6 A;  1ZKJ A;  4F3L B;  2DCF A;  1FIK A;  4NXG A;  4NXE A;  1ES2 A;  3V3R A;  3BFE A;  3LI8 A;  3OCL A;  4QY6 A;  3V39 A;  1H5X A;  4S2N A;  3W4O A;  5IS1 A;  5F83 A;  1OTD A;  3ZNT A;  2ZD8 A;  1PRQ A;  4P0M A;  3BQA A;  1MXO A;  4C75 A;  4BQM A;  2PR5 A;  5FDH A;  4EW7 A;  3UME A;  4U0X A;  3ITA A;  3ZQ5 A;  1LL9 A;  4E3N A;  4JKT A;  2ZL1 A;  1SKO A;  4N1H A;  5HD3 A;  4LFU A;  3HLF A;  4R6L A;  2OV5 A;  4P87 A;  4QWO A;  4ZAM A;  3CMZ A;  3VP0 A;  1J9M A;  4WBG A;  3SZT A;  5A8B A;  1TEM A;  2Y91 A;  2UWX A;  1OTB A;  2B5R A;  1NRF A;  5KIZ A;  2JE5 A;  1W5D A;  2ZM0 A;  3PBS A;  5FI7 A;  3IX8 A;  4LV3 A;  1SZV A;  2NUT C;  5L10 A;  4U3T A;  1YLT A;  1SKF A;  3BEC A;  4BBV A;  1MZU A;  5EM0 A;  2EA9 A;  2OWJ A;  1WYB A;  3E2K A;  4FH2 A;  3VV4 A;  4EXO A;  3UNW A;  3BWL A;  3IBR A;  1IYO A;  2C5W B;  1EWZ A;  3MZD A;  4OQ0 A;  4S2P A;  4XUX A;  4CLC C;  5M18 A;  5DFY A;  2XRN A;  1C3B A;  2GDN A;  2J80 A;  4HEF A;  1T1A A;  2HP5 A;  4E3J A;  2AVX A;  4PKY G;  1PI5 A;  2P9V A;  3IBJ A;  4RX3 A;  3V3S A;  4Z1W A;  1QME A;  1N9B A;  2XA7 S;  3BFG A;  3WWX A;  2Y79 A;  2OAP 1;  4LRY C;  4EEU A;  2Z2M B;  3UE0 A;  4G3V A;  4KZ9 A;  1SHV A;  4EBL A;  3AGD A;  1KE4 A;  5CGW A;  4M4X A;  1BTL A;  2ZQA A;  1BUE A;  3GSG A;  2PD8 A;  4KZ7 A;  5FQ9 A;  5TJJ A;  4JGR A;  2VV6 A;  1KE0 A;  3CPT B;  4ZJ2 A;  1FQG A;  3KO6 A;  3C7U A;  2ZQ9 A;  3MJQ A;  3N7W A;  1RGZ A;  3UDI A;  1GSW A;  2WK0 A;  2ZM2 A;  3E4P A;  2CMN A;  1LT0 A;  4I3A A;  3G32 A;  4CLC A;  4OVD A;  1H8Z A;  3G2Z A;  3N8R A;  4P6Z S;  2XDM A;  5DVA A;  2VKS A;  4I38 A;  5HAR A;  3HJK A;  3EGD C;  3SS3 A;  4EBN A;  2XEP A;  3HL9 A;  4WM9 A;  5FAP A;  2Y4A A;  2I9V A;  5JYP A;  4X69 A;  2J8Y A;  1XPB A;  3D4F A;  1L3L A;  4I3I A;  4PM6 A;  1F2K A;  3H82 A;  2JKR M;  4LCM A;  4ZJ1 A;  1V9Z A;  3P7N A;  1VEU A;  1OJG A;  3NI9 A;  3WS2 A;  4OOL A;  1S6R A;  3O88 A;  4Y15 A;  3ZVT A;  1VET A;  4HP9 A;  2B18 A;  3MKF A;  4YWZ A;  1K56 D;  4KQQ A;  3SH9 A;  3SH8 A;  3W4Q A;  1IEL A;  5HL1 A;  3CI6 A;  5EVE A;  1ONG A;  2PYP A;  1M40 A;  4M3K A;  3T4O A;  2EXA A;  1ALQ A;  1L0E A;  1SDN A;  3CG5 A;  4GD6 A;  3T4S A;  3CUE A;  4BWI A;  4IED A;  1ERQ A;  3L7H A;  1GA0 A;  3C2W A;  4D2O A;  2W3H A;  4QU3 A;  4N9K A;  5FDS A;  3BYD A;  3ZG8 B;  1KVL A;  5AQ9 A;  1FCM A;  3CAX A;  4KQO A;  4B93 A;  2JN7 A;  2EFX A;  2FZ0 A;  3RXW A;  4MN6 A;  3NOU C;  5CXW A;  4GKU A;  3BY8 A;  4OH0 A;  4OQG A;  5EM1 A;  1S67 L;  3A3D A;  4JF6 A;  1F98 A;  1YKD A;  2PYR A;  1Q2P A;  5FAO A;  1BLH A;  1ZG6 A;  1HLU P;  1CQA A;  3NDE A;  3T4L A;  2ZLY A;  4UHU A;  4L9G A;  4P85 A;  2V1A A;  4IBR A;  2H10 A;  4KZ5 A;  1HTZ A;  3R4K A;  4WZ5 C;  3UE1 A;  1I2S A;  2XR0 A;  3HJI A;  2RCX A;  1IKG A;  3N8L A;  3SH7 A;  1ES3 A;  3DW0 A;  3NOT C;  1KDS A;  4OKP A;  2P7J A;  4UA9 A;  2WKE A;  2W3D A;  2ZJ9 A;  3NIA A;  4MN7 A;  2HDU A;  3E98 A;  1TS6 A;  1A0K A;  4B9O A;  1S1Z A;  3ZG5 A;  3NCK A;  4Q0H A;  1Y54 A;  4U0T A;  2HDQ A;  1YLJ A;  3NOP C;  4QD4 A;  1MBL A;  3IF6 B;  3TSG A;  3VSL A;  5HWT A;  3OPP A;  5KMW A;  5E2G A;  4GW9 A;  2PHY A;  5E2F A;  3ZNY A;  3BFD A;  1JWP A;  1OT6 A;  4Y0U A;  2QJ5 A;  4MBK A;  3LEZ A;  3G6O A;  2E8J A;  3NBL A;  4RX2 A;  1ES4 A;  1DRM A;  2ZC7 A;  1G28 A;  4ME4 A;  4HES A;  1D06 A;  3G34 A;  3DTM A;  4L9E A;  3DBA A;  4BD0 A;  3SS4 A;  2W1T B;  3B47 A;  4ID4 A;  4ARZ A;  1Q2Q A;  2PD7 A;  3HLB A;  4O0P A;  3AGE A;  2P74 A;  3VP2 A;  5HAQ A;  1K6R A;  3TW8 A;  1TF1 A;  4LV2 A;  3F1N B;  1L0G A;  2QHK A;  4FCF A;  2OWH A;  5D3O A;  3DTK A;  1MWS A;  4EUV A;  5CRF A;  4X6T A;  2PU2 A;  1K0K A;  3SW1 A;  1NRJ A;  3LR4 A;  4WL9 A;  1DY6 A;  3DWZ A;  4QY5 A;  3JVU A;  2P08 A;  1JWZ A;  1DJC A;  3VP3 A;  2KLI A;  5AJG A;  3QP2 A;  4EES A;  3GEC A;  5DF7 A;  5AVE A;  2Y2I A;  3A3I A;  2J9O A;  4F94 A;  3RFB A;  4FOF A;  3Q7Z A;  1ZG4 A;  4MEZ A;  3IX4 A;  5TBM B;  1MWR A;  2V0W A;  3P01 A;  5EVI D;  4DE2 A;  2ZC5 B;  2WGW A;  5L2F A;  1MWU A;  4B4X A;  1STZ A;  1YLW A;  2YKF A;  2VGL M;  1WYC A;  5G4Z A;  2V20 A;  4QB8 A;  3MXR A;  4JGQ A;  2PT7 A;  2Y2M A;  1CEF A;  1PZO A;  3C8C A;  3MZE A;  3VMA A;  2J7V A;  2Y2Q A;  1CJF A;  4BLM A;  4LGW A;  3GMW A;  4HP4 A;  5EOE A;  4Y17 A;  3C30 A;  2V9A A;  3E0Y A;  5GL9 A;  2OSU A;  4C6Y A;  1XFQ A;  2EX8 A;  1XFN A;  1LI0 A;  3T12 B;  4E3O A;  4Q8I A;  3K2N A;  4KZA A;  2ACG A;  4FUW A;  4Y0T A;  3A3F A;  1SCW A;  4WEL A;  3WS4 A;  2V1Z A;  1S4S A;  1GSX A;  4R3A A;  4LLO B;  3IH9 A;  1LHY A;  2JKT I;  3B33 A;  2DRW A;  3N8S A;  4NG2 A;  3VP4 A;  2HJ9 C;  5EVI B;  1TVF A;  4OPQ A;  3OLO A;  3E4Q A;  4QHC A;  3T4Q A;  3QNB A;  2Y2G A;  3H7W B;  2EWV A;  1KE3 A;  4KZ3 A;  4Y3I A;  4WUJ A;  4N9L A;  3K3C A;  1PZP A;  4HHD A;  3IX3 A;  4PM7 A;  4HIA A;  2KDK A;  5A91 A;  3MZF A;  5BOH A;  1ZTU A;  1IYP A;  4II7 A;  3IS2 A;  5F5Y A;  3M6H A;  4HJ4 A;  3H9W A;  3UE3 A;  1YAX A;  2GZA A;  3UY6 A;  3C38 A;  3UO9 A;  1XJ6 A;  4IUK A;  4KG2 A;  2L0W A;  3G4P A;  4F3L A;  2ZQ7 A;  4I39 A;  3KSG A;  5F69 A;  2GNX A;  3KYQ A;  3MFD A;  4EBP A;  5FI6 A;  4OOY A;  3FKV A;  4WLA A;  2Y2P A;  3T50 A;  3DTI A;  4PMA A;  3VE4 A;  5CHJ A;  3HRE A;  4CLC E;  5I5L A;  4GHI B;  5E2H A;  5EE8 A;  2BG1 A;  1YMX A;  1BLS A;  4GLQ A;  3EEH A;  4OLG A;  4KZ6 A;  1RGY A;  3OC2 A;  3FPV A;  1UWP X;  5E43 A;  4ZRR A;  1W79 A;  4DE3 A;  3HCY A;  1SKO B;  1O7E A;  5TFQ A;  1K38 A;  3IS2 B;  1P9W A;  4OLD A;  3NY4 A;  3QP4 A;  1VQQ A;  4N1X A;  3ZDJ A;  3ULF A;  3OOV A;  3F1O B;  4IBX A;  4EER A;  1XKZ A;  3SOI A;  4G3W A;  2V8C A;  3N6I A;  2VGL S;  2JBF A;  2K2N A;  1BLC A;  4KG5 A;  2O99 A;  4LV1 A;  4NKP A;  2K7S A;  1JTG A;  4O01 A;  1FSW A;  3GVB A;  4BBU A;  1K57 A;  2R9W A;  2PBY A;  2YKH A;  2EX6 A;  3GV9 A;  5FA7 A;  3TRC A;  4DDS A;  1N9L A;  2M7V A;  1T19 A;  2R9X A;  2HPB A;  5IHV A;  3G31 A;  3VOL A;  5HZH A;  4R3J A;  2L1M A;  5AQA A;  4ZDX A;  3HUO A;  3S7N A;  2H28 A;  2VK3 A;  5IU1 A;  5J3W A;  3U2A A;  3EEA A;  1YPR A;  4E3K A;  5HW3 A;  1BYW A;  5DF9 A;  3G30 A;  4EU0 A;  5HSQ A;  3C7V A;  2JKR I;  4HOI A;  3S1Y A;  5EVL A;  4EUZ A;  1T1C A;  3HLE A;  5DFX A;  1T1B A;  2XK1 A;  4MCW A;  1K57 C;  1MC0 A;  4LRX C;  3U4L P;  4X1L A;  1MPL A;  4ESP A;  1BUL A;  1YSP A;  5CED A;  3UMD A;  5C5K A;  1PW8 A;  4S2L A;  3T1R A;  3E2L A;  2H0T A;  1GHP A;  4IJG A;  1BSG A;  4QPR A;  4JXW A;  1PW1 A;  5FSR A;  3H82 B;  3PTE A;  3T1S A;  1H8M A;  1LSX A;  3IWQ A;  5GLA A;  1ODV A;  4DMZ A;  5M1A A;  1XA1 A;  1XJ4 A;  2Q0O A;  5FAQ A;  3QP6 A;  5HAI A;  4WMC A;  3KYZ A;  4MN5 A;  5EEC A;  1ZC2 A;  5FL3 A;  4GOG A;  3F1O A;  4JPM A;  2D01 A;  1XJ2 A;  1I2W A;  2XFT A;  4EQ1 A;  1W8Y A;  3M2K A;  1E3U A;  3PBT A;  2JKT M;  1E25 A;  4E6X A;  2L4R A;  4A5R A;  3CPT A;  1AWI A;  3K3D A;  4WMC D;  2BTF P;  1DP6 A;  2QKP A;  1ZHH B;  1W63 M;  1H0M A;  3OPH A;  2I72 A;  4HY8 A;  1ONH A;  3H7W A;  3FV7 A;  3LIA A;  2PRF A;  3RTY A;  3LIB A;  1OME A;  1YMS A;  2Y2K A;  2ZMV A;  3BRM A;  4RYE A;  3BW6 A;  3HUM A;  5EVI C;  3OPR A;  3UB8 A;  3QP8 A;  2Q9M A;  5L09 A;  1MWT A;  3EQU A;  3RH8 B;  1CI9 A;  3BLS A;  1IYS A;  4BMW A;  1D1J A;  4FSF A;  5GLB A;  3Q81 A;  3VOY A;  4MNR A;  1H8Y A;  3KYE A;  2VV8 A;  4WYY A;  4PKY A;  1KGE A;  4CQH A;  3A3E A;  2EX9 A;  2QJ7 A;  2XQZ A;  1XGJ A;  3ZG0 A;  1PWC A;  3QP5 A;  1FR1 A;  5IT5 A;  4R23 A;  5F1G A;  4E3I A;  5FAT A;  2JHE A;  1YM1 A;  3MFX A;  4XUZ A;  5F1F A;  2LB5 A;  4S2O A;  3B3X A;  3HVF A;  4G3K A;  3IH8 A;  4LCL A;  4IVI A;  1TD5 A;  3MSH A;  1NY0 A;  4E04 A;  2M7U A;  2XRO A;  2Y8H A;  4EV4 A;  1L0D A;  4YIN A;  4MMN A;  1VET B;  1PNE A;  3G35 A;  4X25 A;  2W3G A;  3HBR A;  1OJ5 A;  1YT4 A;  3AGF A;  3FG8 A;  3M2J A;  1NWZ A;  4WEK A;  4ZTK A;  2R78 A;  4KUO A;  1VM1 A;  3C4O A;  5AQB A;  2WAE A;  4K91 A;  2WKP A;  1NJ4 A;  2VV7 A;  4DF6 A;  4KZ8 A;  3KSH A;  3B42 A;  2FH5 A;  5F68 A;  1KDW A;  1NLZ A;  1YQS A;  2J3T C;  3PBQ A;  5L8M A;  4OQH A;  1DP9 A;  3GRJ A;  1I5Q A;  3UPN A;  3EQV A;  1W63 Q;  1RCJ A;  1YLY A;  4O7D A;  2O9B A;  1K4F A;  1OT9 A;  3NHQ A;  1LL5 A;  3JYI A;  3P09 A;  2D02 A;  5I94 A;  3DAV A;  4OQI A;  3JVV A;  1IOU A;  4CJN A;  1VB6 A;  3MR0 A;  4R38 A;  3PHY A;  4WF0 A;  1TDL A;  2G2W A;  2OAQ 1;  1IKI A;  4KQR A;  4K0W A;  1Z09 A;  2XD5 A;  1XXM A;  3OPL A;  2ZC4 B;  5FQK A;  1OTE A;  1TDG A;  4N92 A;  2W27 A;  3O3V A;  5HFO A;  1G68 A;  3TOI A;  4BD1 A;  3A0V A;  3IT9 A;  1P9R A;  2ZM8 A;  2V8F A;  3IF6 A;  4NK3 A;  5MC7 A;  1K56 A;  5DJU A;  2X01 A;  5A92 A;  5DTS A;  1MKM A;  4ETZ A;  3D72 A;  3Q82 A;  3S22 A;  4EWF A;  3FZC A;  4HNB A;  3LR0 A;  1JNU A;  2XSS A;  4LV0 A;  4XT2 A;  5CEB A;  1DJB A;  2INW A;  2OLU A;  1S4R A;  2V1B A;  5FEF A;  3DTE A;  5GHY A;  4EEP A;  3VSK A;  1DP8 A;  5AQ7 A;  5L07 A;  3CJM A;  3WRZ A;  2K31 A;  5FQI A;  3I7J A;  4YFM A;  2ZL1 B;  2A49 A;  1NXY A;  4OOM A;  2ZQ8 A;  3V50 A;  2WKR A;  1K55 A;  1PYY A;  3A3J A;  5HDD A;  2E8I A;  4JGP A;  2Y2L A;  1RP5 A;  1H3Q A; 
#chains in the Genus database with same CATH homology
 1D7E A;  3LIE A;  3HCY A;  3FC7 A;  3CI6 A;  5DKK A;  2IA2 A;  3IS2 B;  1P9W A;  2PYP A;  3T4T A;  2GJ3 A;  3T4O A;  4PAU A;  1WA9 A;  4HI4 A;  3ULF A;  3OOV A;  3F1O B;  1OPX A;  2QWS A;  3PBN A;  3T4S A;  3CUE A;  4EER A;  4BWI A;  1NLY A;  2A2L A;  3UE6 A;  4BJP A;  3UB9 A;  3KX0 X;  3C2W A;  4G3W A;  1X0O A;  3EOI A;  4GS9 A;  2VGL S;  2W3H A;  5AVF A;  3LR3 A;  5HD5 A;  2K2N A;  4UEY A;  1F5M A;  2O99 A;  4NKP A;  2K7S A;  3CAX A;  4I5S A;  3S7P A;  3ZYT A;  4KQO A;  4O01 A;  2HF6 A;  4B93 A;  2JN7 A;  2NUP C;  3MQ0 A;  4BBU A;  3W2Z A;  2FZ0 A;  2YKH A;  5HPF A;  4P6Z M;  3PR6 A;  4MN6 A;  3NOU C;  3GDI A;  4HH3 A;  3TRC A;  4LRZ E;  1N9L A;  1S66 L;  2M7V A;  1T19 A;  3MQO A;  3BY8 A;  1S67 L;  3A0S A;  1F98 A;  3VOL A;  5HZH A;  2L1M A;  1YKD A;  2PYR A;  4Q0I A;  3S7N A;  4L0L A;  4EET B;  4R70 A;  4RQ9 A;  2P04 A;  2H28 A;  3CUE C;  5IU1 A;  1N9N A;  5J3W A;  3U2A A;  3T4L A;  4IHQ A;  3EEA A;  4YOF A;  4L9G A;  1BYW A;  2V1A A;  5EFW A;  1UGU A;  4LPZ A;  5DF9 A;  3ICY A;  5CX7 A;  4HH2 A;  1TS7 A;  2XA7 M;  4EU0 A;  5HSQ A;  2PR6 A;  2JKR I;  4HOI A;  3LYX A;  3R4K A;  1T1C A;  3A0R A;  4WEJ A;  5DFX A;  1T1B A;  4H6J B;  3LID A;  3MXQ A;  4MCW A;  5KSH A;  3HJI A;  4ETX A;  1MC0 A;  4LRX C;  4DJ2 A;  1Y28 A;  5K5B A;  3NOT C;  4GCZ A;  2P7J A;  1YSP A;  1EW0 A;  2W3D A;  4UQI M;  3F1P A;  4MN7 A;  4KUK A;  3E4O A;  3UMD A;  5C5K A;  3E98 A;  4PHT A;  1TS6 A;  4K08 A;  4B9O A;  1S1Z A;  2WKQ A;  1OTA A;  4Q0H A;  4IJG A;  5F6A A;  1LL8 A;  3PYP A;  4QPR A;  3NOP C;  3BQ8 A;  2J3T D;  4ARZ B;  3TJZ C;  3H82 B;  2HGV A;  1H8M A;  1TS0 A;  5HWT A;  3S7O A;  1LSX A;  1ODV A;  4DMZ A;  4GHI A;  4GW9 A;  2PHY A;  4CLC D;  3LI9 A;  1XJ4 A;  1F9I A;  2VJW A;  3NJA A;  4WN5 A;  3UB7 A;  2ZOH A;  3EWK A;  2VA0 A;  2DMW A;  1G6O A;  3KYZ A;  4MN5 A;  1OT6 A;  5FL3 A;  5HWW A;  2QJ5 A;  3PBR A;  4BBT A;  1VHM A;  3F1O A;  4Q0J A;  3G6O A;  4YNR A;  1P97 A;  2Z6C A;  2W0N A;  2D01 A;  2ZMF A;  4I3J A;  3LFV A;  1OTI A;  1XJ2 A;  4IUH A;  1P0Z A;  3D3O A;  3LR5 A;  4EQ1 A;  1LSV A;  2HJE A;  1DRM A;  2A24 A;  3PBT A;  1G28 A;  2JKT M;  4ME4 A;  3EGX C;  3F1P B;  3PXP A;  1D06 A;  2BAS A;  2L4R A;  3K3D A;  4HQA A;  1DP6 A;  3KSI A;  2M1C A;  1ZHH B;  2QKP A;  1W63 M;  3FPW A;  4L9E A;  5LBR A;  3BY9 A;  3DBA A;  5J7E A;  4DJ3 A;  1V9Y A;  2W1T B;  4GS9 B;  3B47 A;  2VX8 A;  3KSF A;  4HY8 A;  4ARZ A;  2PD7 A;  3H7W A;  2B02 A;  3MMH A;  3LIF A;  4O0P A;  3LIA A;  2V0U A;  3RTY A;  5HPI A;  3LIB A;  4L9F A;  5HWV A;  5TBM A;  2ZMV A;  3BW6 A;  4XT2 B;  4O8G A;  3TW8 A;  1TF1 A;  2OOL A;  3F1N B;  4Y5F A;  2QHK A;  5DKL A;  2W3F A;  3UB8 A;  2W3E A;  1S1Y A;  2OWH A;  4NEE D;  4EUV A;  3EQU A;  3LIC A;  3RH8 B;  2MJ6 A;  3BJN A;  4UQI S;  3MQQ A;  5DJT A;  4BMW A;  2O9C A;  3OBF A;  4CLC B;  3SW1 A;  4FSF A;  1NRJ A;  4HJ3 A;  3LR4 A;  2A24 B;  4WL9 A;  4HJ6 A;  2EWW A;  3JVU A;  2P08 A;  2VV8 A;  3R7W B;  4F3L B;  4PKY A;  2KLI A;  4CQH A;  5AJG A;  4NXG A;  4NXE A;  1XJ3 A;  4NXF A;  2QJ7 A;  4EES A;  3GEC A;  3LI8 A;  4KQD A;  5AVE A;  3OCL A;  1N9O A;  5IT5 A;  4MDZ A;  2HV1 A;  3RFB A;  4FOF A;  2JHE A;  5IS1 A;  3MFX A;  1OTD A;  5TBM B;  2LB5 A;  2V0W A;  1YSQ A;  3BQA A;  4G3K A;  3P01 A;  2ZOI A;  2PR5 A;  1TD5 A;  4E04 A;  3CWF A;  1KOU A;  4DN0 A;  1STZ A;  4EW7 A;  3UME A;  2M7U A;  2YKF A;  2VGL M;  5HL6 A;  2XRO A;  5G4Z A;  3ZQ5 A;  2Y8H A;  1IFQ A;  3MF0 A;  4JGQ A;  4MMN A;  2PT7 A;  5HD3 A;  2PDR A;  3C8C A;  2W3G A;  4R6L A;  1OJ5 A;  4HP4 A;  3FG8 A;  1NWZ A;  2QYB A;  4WEK A;  2J3W A;  3C30 A;  5A8B A;  1TS8 A;  3R7W A;  2R78 A;  4KUO A;  2V9A A;  3E0Y A;  1OTB A;  5KIZ A;  3PBS A;  2LB9 A;  1XFQ A;  2W1R A;  2WKP A;  2VV7 A;  2NUT C;  1XFN A;  3KSH A;  2ZBB A;  3B42 A;  4BBV A;  2FH5 A;  1MZU A;  5F68 A;  2EA9 A;  2OWJ A;  1NLZ A;  3K2N A;  2J3T C;  3PBQ A;  5L8M A;  3VV4 A;  4EXO A;  1DP9 A;  3BWL A;  3IBR A;  4WEL A;  3EQV A;  1W63 Q;  1S4S A;  4GJ4 A;  3PBO A;  2O9B A;  1GSX A;  4JGO A;  4CLC C;  4R3A A;  2VLG A;  4LLO B;  5DFY A;  1OT9 A;  2XRN A;  2JKT I;  2J80 A;  3NHQ A;  1T1A A;  2O9A A;  3B33 A;  2G7U A;  4PKY G;  2D02 A;  3IBJ A;  5G4Y A;  1GSV A;  4Z1W A;  3JVV A;  1IOU A;  2XA7 S;  1VB6 A;  3MR0 A;  3CLO A;  4R38 A;  2Y79 A;  3PHY A;  4WF0 A;  1T18 A;  2HJ9 C;  2OAP 1;  4LRY C;  4EEU A;  3F1N A;  2OAQ 1;  3OLO A;  2VEA A;  3E4Q A;  4G3V A;  3T4Q A;  3H7W B;  3T4K A;  2KOI A;  2EWV A;  4NXB A;  2KX6 A;  4M4X A;  1OTE A;  4Y3I A;  4WUJ A;  2VZW A;  2W27 A;  3LUQ A;  4Y2F A;  2PD8 A;  3T4J A;  3K3C A;  5TJJ A;  3A0V A;  4JGR A;  2VV6 A;  4HHD A;  3V67 A;  1P9R A;  4HIA A;  2KDK A;  3KO6 A;  4H6J A;  5HDS A;  3MJQ A;  1UWN X;  1ZTU A;  3TE8 A;  3UB6 A;  5MC7 A;  1GSW A;  3OCN A;  4II7 A;  2GX5 A;  3CIT A;  3E4P A;  3IS2 A;  2CMN A;  5DJU A;  2W1T A;  5F5Y A;  5J4E A;  1LT0 A;  2Z6D A;  4I3A A;  1MKM A;  4CLC A;  4HJ4 A;  3H9W A;  3UE3 A;  4P6Z S;  1YAX A;  2GZA A;  4ETZ A;  2VKS A;  3O5Y A;  3C38 A;  3D72 A;  4I38 A;  1XJ6 A;  3HJK A;  4IUK A;  2L0W A;  3EGD C;  3VE3 A;  4F3L A;  4HNB A;  3LR0 A;  1JNU A;  2XSS A;  4XT2 A;  4I39 A;  3KSG A;  3S7Q A;  2INW A;  5F69 A;  2GNX A;  3KYQ A;  5HDC A;  2I9V A;  1S4R A;  2V1B A;  4WLA A;  4I3I A;  3T50 A;  3H82 A;  2JKR M;  4EEP A;  3VE4 A;  1DP8 A;  2K31 A;  1V9Z A;  4CLC E;  3P7N A;  4GHI B;  5I5L A;  1OJG A;  4OOM A;  4AFI A;  4OOL A;  4GLQ A;  2WKR A;  3EEH A;  5HDD A;  4HP9 A;  1LSW A;  2B18 A;  3OC2 A;  3FPV A;  4JGP A;  1UWP X;  4ZRR A;  4YWZ A;  2O0Y A;  1H3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...