1V9YA

Crystal structure of the heme pas sensor domain of ec dos (ferric form)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
113
structure length
103
Chain Sequence
GIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNRERELQLEKKDGSKIWTRFALSKVSAEGKVYYLALVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A redox-controlled molecular switch revealed by the crystal structure of a bacterial heme PAS sensor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
molecule keywords Heme pas sensor protein
total genus 31
structure length 103
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2004-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1v9yA00
4R6LA 2PDRA 1VB6A 4NXBA 1P97A 1OT9A 2OWJA 2H28A 3IBRA 4WL9A 2OOLA 3LIFA 4I38A 5TBMB 1TS8A 3BWLA 2QKPA 4GW9A 3BY9A 3MFXA 4EXOA 1EW0A 4DJ2A 3VOLA 2QJ5A 5HWTA 4I5SA 4HIAA 1XFNA 3OLOA 2Z6CA 5J7EA 3E4QA 3NOPC 1G28A 3PHYA 4JGPA 1LSVA 1S67L 3NHQA 4GHIA 4NXGA 3RTYA 5HWVA 5F68A 4EETB 1N9LA 2PYRA 4I3JA 1N9NA 2PR6A 5G4YA 1X0OA 2PD8A 2YKFA 2A24A 2V0UA 4WN5A 5DJUA 2PD7A 1D06A 3MJQA 4LLOB 4K08A 1LL8A 4WF0A 2WKPA 3CAXA 1TS0A 3RH8B 1NWZA 4BBUA 2J80A 3MQOA 4KUKA 4BBVA 2R78A 1OTIA 4E04A 2VV8A 4YWZA 4GHIB 1OJ5A 5F5YA 4M4XA 2VEAA 4WUJA 4I39A 3H9WA 3K3CA 3LIEA 3H7WB 3LI9A 1DP9A 1V9YA 2M1CA 3H82B 2VLGA 5F69A 3KX0X 3MXQA 5J3WA 4HH2A 1BYWA 3LICA 4H6JA 1P0ZA 5TBMA 4LRYC 2JN7A 4HHDA 1F98A 1XFQA 3A0VA 4PKYG 1S1YA 3UMEA 3NOUC 1LSXA 1T1AA 2KDKA 3F1PB 3MR0A 5HDSA 3T50A 1GSVA 3F1NA 4HOIA 4HH3A 4EERA 4HY8A 3LI8A 5HDDA 2K7SA 3C2WA 1T1BA 5HD5A 4DJ3A 4F3LB 5HWWA 4HJ4A 3UB7A 5HZHA 4MN5A 2V1AA 4HP9A 1S66L 3VE3A 3LUQA 3LIBA 4HJ6A 3LYXA 1WA9A 2ZOHA 1OTAA 3E4PA 5HSQA 2KX6A 3B33A 5DKKA 3BY8A 4L9EA 1UWPX 4EESA 4EEPA 2ZOIA 2Z6DA 3E4OA 1OT6A 3LIDA 2ZBBA 1DRMA 2PHYA 1GSXA 2I9VA 3SW1A 4GS9A 4LRXC 5I5LA 2QWSA 2W0NA 3H82A 5J4EA 2QHKA 2D01A 1LSWA 2CMNA 3C8CA 1S1ZA 4I3AA 4JGQA 1UWNX 4JGOA 3HJIA 2GJ3A 3NOTC 4L9FA 3A0RA 1D7EA 4MN6A 4NXFA 5AVFA 5KIZA 5IS1A 2YKHA 5HD3A 1N9OA 4I3IA 2L0WA 4PKYA 1DP6A 1T19A 3MQQA 3UB8A 4B9OA 2HV1A 4HI4A 4XT2A 2BASA 1LT0A 3PYPA 2W27A 3P7NA 2L4RA 3UMDA 1S4SA 2INWA 1S4RA 3ICYA 1GSWA 3G6OA 4R38A 1T1CA 1MZUA 4WLAA 2L1MA 3D72A 3NJAA 4LRZE 3IS2B 1XJ6A 4GCZA 5HDCA 1ODVA 2D02A 3A0SA 3H7WA 1JNUA 1KOUA 2V9AA 3F1OA 3LIAA 4GS9B 4H6JB 1XJ2A 1OTEA 2V0WA 3FC7A 1F9IA 1OTBA 5A8BA 1XJ4A 3K3DA 5EFWA 4EQ1A 4HQAA 3UB6A 2JHEA 2V1BA 3GECA 4HP4A 3UE6A 3F1PA 2VV6A 4RQ9A 4HNBA 5IU1A 3UB9A 3F1NB 4NXEA 4EEUA 2PYPA 4F3LA 1UGUA 2QJ7A 2WKRA 1OJGA 1TS6A 2WKQA 1TS7A 3HJKA 2VV7A 3IS2A 2A24B 3EEHA 1OTDA 4XT2B 1V9ZA 5DKLA 3F1OB 3VE4A 2EA9A 2P7JA 3GDIA 5AVEA 1T18A 5F6AA 1Y28A 2OWHA 3ULFA 1XJ3A 3CLOA 2PR5A 4HJ3A 3EWKA 4KQDA 4KUOA 4L9GA 4LPZA 4BBTA 5DJTA 2B02A 3CWFA 3ZQ5A 5G4ZA 4R70A 4EW7A 4R3AA 3FG8A 4JGRA 1DP8A
chains in the Genus database with same CATH superfamily
4CQHA 1ERMA 1Y54A 4GKUA 3MFDA 4MCWA 4E6XA 1IYOA 4EXOA 1ONHA 1SHVA 4OH0A 1K55C 4I5SA 3NOPC 3GQZA 1N9LA 1PYYA 4I3JA 5J3WA 4EBNA 4H8RA 1K55A 2PD7A 3C7VA 3OCLA 1E3UA 2H10A 3VSLA 4BBVA 4U0TA 1JWPA 2VGJA 1XP4A 3VOYA 3LI9A 3H7WB 2QYBA 2IWBA 1ALQA 4P87A 4GD8A 3MBZA 5FAOA 4HOIA 2ZQDA 3IF6B 4HJ6A 1WA9A 4L9EA 1H8MA 2ZBBA 4E3MA 3ZNYA 2W0NA 4YOFA 1VETB 1S1ZA 3SZTA 1Q2QA 1YMXA 3B3XA 4E3NA 4HI4A 1KE0A 1N9BA 4CLCA 2HP5A 3GR2A 5EVIC 5FATA 1G68A 3NBLA 1MWUA 2VK3A 1MWTA 2EFXA 4ME4A 1DJBA 1J9MA 1OTEA 3FC7A 5EFWA 4EQ1A 3F1PA 2XA7M 3UB9A 2K2NA 5DTSA 2P74A 3M6BA 4YNRA 1UGUA 1H0MA 4O8GA 2P08A 2P7JA 2WZXA 1PI5A 2ZM0A 1AWIA 3FPWA 2H0TA 3G30A 1S6RA 4IVIA 1YLJA 4LV2A 5DF8A 1E3UD 4DJ2A 1HLUP 2Y2IA 3ISGA 2O9BA 5FQ9A 3B47A 4EETB 3E2LA 3DTKA 3FKWA 2PD8A 5DJUA 4P6ZS 4XXRA 2J80A 5GHYA 4C3QA 2Y2NA 4DXBA 4I39A 1I2SA 2M1CA 2J3WA 1J3WA 2JKTI 5KZHA 4ZJ3A 2Q9NA 4JF4A 3UE0A 5HD5A 2K7SA 4BENA 4JKTA 3N8LA 3HLGA 4MN5A 3JPUA 4UQIS 3CHWP 3LYXA 4BL3A 1OTAA 3P01A 1FCOA 3Q1FA 2XH9A 1DJAA 1ES3A 4E3OA 3EOIA 4NXFA 4DDSA 3A0RA 3HLWA 5KIZA 1GHMA 4B9OA 3LR0A 1FSWA 4UA6A 1EROA 5FAPA 4ARZB 3VV4A 5HDCA 5E43A 1L0DA 2LB9A 4UEYA 1E25A 1RGYA 3GECA 4S2OA 5EVIA 2DNSA 2WKRA 3MZFA 1YKDA 4GZBA 2A24B 1V9ZA 3GSGA 5M19A 4IUHA 4N9LA 3TW8A 1YSPA 2FH5A 1PRQA 4S2LA 2FZ0A 3NCKA 1PZOA 3BY9A 2ZQCA 3VOLA 4ESPA 2VGLS 4IBRA 1MXOA 4HEFA 3LFVA 5G4YA 2PR6A 3WS2A 4F3LA 4QHCA 2Y8HA 4A5RA 3FV7A 2IWCA 1XX2A 2HJ9C 1L0FA 5F5YA 4WUJA 3DAVA 3AGFA 4FD8A 4QD4A 5F69A 4OQIA 4RX3A 1KGFA 3NULA 1KE4A 3S7PA 2Y2HA 4BLMA 3IWIA 2JKGA 2JBFA 4HJ4A 2WAEA 3LIBA 1G6AA 1TF1A 1Q2PA 5K5BA 5DKKA 1L0EA 2ZOIA 3E4OA 1L2SA 2Y55A 2QZ6A 3LR5A 1SKOB 3IX4A 3BJNA 3KSGA 4LRXC 3A3JA 3C8CA 3IWOA 2B95A 4I3AA 4B88A 2GJ3A 1CEGA 2O99A 3IBJA 1K54A 1PWGA 5E2GA 3UE3A 4DE3A 5KSCA 4HESA 1Y4OA 3MKFA 4X55A 4Q0JA 5CXWA 1GSWA 5M1AA 3I7JA 3O86A 2WKEA 4EWFA 4OPRA 4S2NC 1YLTA 2Y2LA 2OLVA 3ZVWA 2JKRM 3A3FA 3TE8A 3G31A 3N8SA 3ZG5A 4WELA 4KG2A 2PR5A 4X1LA 3CWFA 3TRCA 2G2UA 2OV5A 3MFXA 3UB5P 3V3SA 4JBFA 2W1TB 3NHQA 1AXBA 1NJ4A 3LEZA 3AGEA 2EXBA 4E04A 3BQ8A 4OPQA 2ZQ8A 2M7VA 4HH2A 3BLMA 3SOIA 2ZQ7A 1PW8A 2W3EA 3M6HA 2WKIA 5FL3A 2ZC5B 3F1NA 4CJNA 4HH3A 1STZA 1H8YA 1SKOA 4F3LB 4KQOA 3V50A 4EV4A 4X56A 4E6WA 5TJJA 5GHZA 1P9RA 4L9FA 3CPTB 1YMSA 4FTXA 4LV1A 3ZG8B 4XT2A 3W8KA 1O07A 2Y2KA 4LENA 4ZTKA 3HLFA 4CLCC 1S4RA 3IF6C 3IXGA 1FR1A 1T1CA 4RVAA 2J9PA 1HVBA 1BTLA 2WAFA 2V9AA 3HBRA 1CK3A 2V0WA 4OOLA 4HQAA 2BLSA 4NG2A 4KZ4A 5F82A 3VP2A 4DKIA 1W8YA 3HJKA 2WKQA 1K6RA 2C6WB 1GA9A 3GDIA 3G35A 2OWHA 3UDIA 5DJTA 4JGRA 2XD1A 3KO6A 1P97A 1IFQA 4NK3A 4I38A 4L0LA 3BFEA 5HAPA 2PRFA 4OPZA 1YLYA 1ESUA 3PHYA 1LSVA 1S67L 4GHIA 5DF7A 5F68A 3LR3A 3MJQA 4K08A 4WF0A 2WKHA 2WKPA 3CAXA 3TG9A 1RGZA 4Q8IA 1FSYA 1GCEA 1E4DA 2R78A 2Z2LB 3BYDA 4GHIB 2B5RA 4X1MA 5A90A 2H0YA 3UE1A 3PR6A 2O9AA 5FI2A 4OLDA 2EX9A 2KDKA 5C5KA 3KYQA 4R1GA 1K56A 1CF0A 1S66L 4OP5A 3T4QA 2B18A 1XXMA 2XQZA 5EM1A 4KZ3A 5EVEA 2P04A 3SW1A 1G5UA 3QP2A 1JTDA 5TFQA 3TOIA 1QMEA 3MZDA 3IF5A 1DP6A 3MQQA 1G6OA 4Y2FA 5DTTA 4YFMA 4Q0IA 4C75A 3S7OA 3HUOA 1KVLA 1YAXA 2PT7A 5FQMA 4I3IA 2XR0A 4WBGA 3VE4A 3CMZA 5CGSA 1Y28A 4UQIM 1XJ3A 3EWKA 3ZG7B 1N4OA 2HPBA 3T4TA 4CPKA 1ZKJA 1D1JA 2H28A 5DF9A 2OOLA 3LIFA 1TS8A 3BWLA 5HWVA 2HJEA 2NUTC 3G34A 4JPMA 3VMAA 2A24A 2EX8A 4KG5A 2PBDP 4KG6A 1ZC2A 3CZDA 3K3CA 4Z1WA 3KX0X 3KYEA 5DVAA 2ZMAA 1L3LA 1GHIA 3MXSA 4PM7A 1K4FA 4WYYA 2HP9A 5D3OA 3GRJA 3LY4A 2WGWB 3BM6A 4OOYA 3WWXA 2XRNA 4EESA 5JYOA 3LY3A 2PHYA 5EECA 3QP6A 2ZD8A 3NOTC 2YKHA 5HD3A 5L8MA 1T19A 1NLYA 3G2YA 3P98A 2L4RA 2Y2PA 3A3EA 3DW0A 1FR6A 4ZJ1A 1M6KA 1MZUA 1MBLA 1XJ6A 2P9VB 3AGDA 2PU2A 1BSGA 3BW6A 1ONGA 3WRTA 4GS9B 3FZCA 1F9IA 4ZBEA 5EVID 5A8BA 2HDSA 3UN7A 4HBTA 2JHEA 4RQ9A 2ZM8A 4GN2A 3E98A 3E2KA 3ZGAB 3DBAA 1OPXA 5F6AA 4OONA 3QNBA 4L9GA 4U0XA 2ZMFA 4NXBA 2OWJA 5CGWA 5GL9A 3LR4A 4DE1A 3DWKA 3HUMA 3FYZA 1XKZA 2IWDA 1N9NA 3C5AA 1P9WA 2I72A 4WEJA 1LL8A 3RH8B 3MKEA 1FCMA 3VP4A 2W1TA 1ESIA 4ARZA 4M4XA 4BMWA 1JWVA 4DRTA 3LIEA 1DP9A 3LICA 4HHDA 1S1YA 3BEBA 4KQRA 4IBXA 1GSVA 5AQ7A 3W4OA 3Q81A 1I2WA 2HF6A 5CERA 3CUEC 3B42A 5CTMA 4X69A 4NKPA 4GS9A 1HD8A 5L09A 4JGOA 4Y17A 5HARA 2Y4AA 1CJFA 1DY6A 1VHMA 2L0WA 3IH8A 3UB8A 5FSRA 5FEGA 2W3DA 3P7NA 2KLIA 3Q7VA 4KZBA 3VOZA 3WS5A 3EQVA 3EGXC 4OPYA 1KDSA 4GCZA 5EPHA 4IVKA 3LIAA 3H7WA 1W7FA 3OPHA 2Y59A 4KQQA 4QWOA 3K3DA 1S0WA 3V3RA 3DWZA 2V8CA 4GD6A 4DDYA 1OJGA 3EEHA 4GNUA 1OTDA 1W79A 4BL2A 2FFFB 5GLCA 3R7WA 4R3BA 4BBTA 2X01A 4S2KA 4EW7A 3PBQA 3A3IA 4YINA 4R3JA 4EUZA 4FH4A 3N7WA 4PM9A 4GW9A 2VGKA 4PMAA 1VETA 2R9WA 3Q07A 3ZG9B 1XFNA 3TSGA 4E3IA 2J3TD 5E2HA 4X25A 1IELA 1TS0A 2KOIA 3V39A 3MQOA 4GLQA 4KENB 1XA7A 3UPPA 3H9WA 1Z6FA 4DE0A 1LL9A 4WEKA 3E0YA 4LRYC 2W1RA 4FCFA 4BD0A 1XFQA 5HL1A 2EX6A 3O3VA 3MR0A 2VKSA 3Q7ZA 3WS1A 1MWSA 1IYPA 2Y79A 3R7WB 1BZAA 2LB5A 1OT6A 4KZ5A 3JVVA 1WYBA 2JKFA 4OQHA 2IA2A 3CITA 3NDGA 4JXSA 4MBFA 1D7EA 3D4FA 3ZNTA 1FCNA 4K0XA 2X02A 3L7HA 2WZZA 2O0YA 3LCEA 3UMDA 1RP5A 2HGVA 4R38A 4WLAA 4RA7A 5FDSA 1XJ2A 3UPOA 4XUZA 3C7UA 1NZOA 2PYPA 4D2OA 4DN0A 4OQ0A 5GHXA 2O9CA 3ULFA 4E3LA 3MMHA 1PWDA 1YT4A 2DRWA 5HPFA 4R6LA 5FA7A 4MLLA 3MF0A 3IBRA 2ZL1A 4DE2A 1RCJA 4JF5A 1G28A 2ZQ9A 1VM1A 5FQJA 1ERQA 4Y0TA 1X0OA 3GMWA 4WMCA 2ZC6B 1BLPA 4X6TA 5AQ9A 4ETZA 5TR7A 5EUAA 3QP8A 3CUEA 5BOHA 2VEAA 5F1FA 1LI0A 2VLGA 2RL3A 3SS4A 4N9KA 3C38A 4BQMA 1ACFA 1NRFA 4LGWA 5EE8A 4GDBA 1BT5A 1H3QA 3G2ZA 3IXBA 4P0MA 3S1YA 4PM5A 1TVFA 3IHAA 4KZ9A 3IF6A 4ZJ2A 3D9YA 2JKRI 4JGQA 3HJIA 5HAIA 3P09A 2A2LA 3HLDA 1EWZA 1IYQA 1K54C 1HTZA 3PBOA 1YM1A 2INWA 5FQKA 5GLDA 4WZ5C 3G6OA 3IXHA 3D72A 3S7NA 5FAQA 3RXXA 1ODVA 2XEPA 3ITBA 2Q0OA 4OLGA 3UB6A 2GX5A 1YQSA 2VV6A 1BLCA 5FQQA 2FFYA 2ZC3B 4Y15A 3FPVA 2Y91A 5EVIB 5GLBA 2M7UA 3S22A 1VB6A 3VP1A 1WYCA 4EBLA 4JLFA 1H5XA 4KZAA 2K31A 3ZG0A 1FQGA 1ZG6A 4WMCD 2XDMA 3RTYA 4ZDXA 1MKMA 4X68A 4WN5A 4N92A 3V67A 3WRZA 1TDLA 2HP6A 3QP1A 1I5QA 4DXCA 1W8QA 4Y0UA 3HL9A 4II7A 5HAQA 1K6SA 3T50A 1K57A 3HUNA 3LI8A 4KZ7A 4CLCB 5A93A 1BLHA 1MPLA 4R4SA 2DCFA 4NEED 3TJZC 1ES2A 4OOMA 4G3KA 3VP0A 4QY6A 2GZAA 4D60A 1UWNX 5FASA 1CI8A 3T4OA 3MQ0A 4N1HA 1LT0A 3HLEA 5CEDA 3PTEA 4B93A 2D02A 5I94A 3LEQA 2JCHA 3HREA 4IEDA 1FIKA 1PZPA 1MKIA 5IHVA 2V1BA 3RJUA 3T4LA 2HDUA 3HVFA 4S2PA 1TS6A 5AQAA 3RFBA 4R23A 2GNXA 2HDQA 4KQDA 4LPZA 3VFHA 1VEUB 5U47A 1BUEA 4OKPA 4UHUA 3U2AA 2VZWA 2OSUA 1EW0A 4PPRA 1SDEA 5HWTA 2Z6CA 4NXGA 3L9KA 1LL5A 2OAQ1 1KDWA 3W4PA 1TD5A 2CC1A 3PXPA 3M2JA 3NI9A 5CHUA 5FQIA 1M40A 4OQGA 3T4SA 5HX9A 1OJ5A 2XLNA 4PM8A 3BLSA 3IX3A 1BYWA 4K91A 4Y13A 1PNEA 1F98A 3UMEA 2XFTA 4JXGA 1XA1A 3OPLA 1ES4A 5A92A 2X71A 4FH2A 3C2WA 1T1BA 2J9OA 4QJGA 5HZHA 5HW3A 3LUQA 4HBUA 4G3WA 5IT5A 1VEUA 2Z6DA 3PBRA 3LIDA 3NC8A 5LBRA 1YLWA 1GSXA 4MN7A 2I9VA 4QPRA 1K57C 2XSSA 2XD5A 2E8JA 1LSWA 2CMNA 4LFUA 3KSFA 3M2KA 5GLAA 2EWWA 3EQUA 3PYPA 4P85A 1PI4A 1S4SA 3GV9A 3C4OA 2XK1A 1JNUA 2ZMVA 2WK0A 2Y2GA 2GDNA 1MWRA 3UE6A 3O5YA 1K25A 4N1XA 4HNBA 3PBNA 3F1NB 5E2FA 3K2NA 2HDRA 2EA9A 3WS0A 1TDGA 4GDNA 4WL9A 2JKTM 2NUPC 5EOEA 2JC7A 4QY5A 3T4JA 1NXYA 2XROA 3KYZA 3OLOA 4KZ6A 4CLCE 4BWIA 4LLOB 1O7EA 3ZHHA 1NWZA 4BBUA 4AFIA 4ZRRA 2V2FF 2ZQAA 3VSKA 4QU3A 1V9YA 5KSHA 5L10A 4GJ4A 4O01A 5TBMA 3MXQA 4H6JA 2Y2OA 1LSXA 3OZHA 2VGLM 1ZG4A 4WZ4A 4S2IA 5HWWA 2V1AA 4MBKA 1CEFA 3E4PA 3G32A 3BY8A 4EEPA 1UWPX 1HZOA 3ZFZA 3T4KA 4PAUA 1LHYA 3FWLA 5FI7A 5CX7A 2QWSA 4PM6A 4JXVA 5IS1A 5AVFA 5CECA 1MC0A 2Y2QA 1L0GA 5AQBA 4R4RA 5CHJA 4M3KA 4LV0A 2WGIA 3ICYA 1KGGA 3DTEA 3BRMA 3IS2B 2OLUA 3A0SA 1KOUA 3FKVA 3QHYA 3W2ZA 2MJ6A 4GOGA 1NZUA 3IS2A 5DFXA 3UDFA 2XFSA 3OC2A 4B4XA 4BJPA 1T18A 5G4ZA 4R3AA 4EBPA 1IKGA 3DTMA 3OOVA 2ZM2A 2QKPA 3O88A 1BULA 1WE4A 2EXAA 4IHQA 3CPTA 4OP8A 2PYRA 4UAAA 1TEMA 2WGWA 1SZVA 1LI9A 4F94A 1IKIA 4Y7PA 1OTIA 2VV8A 2V20A 3T1XA 2ZC4B 1NYYA 5AJGA 4R0QA 4ZAMA 5F83A 5TGFA 3MZEA 3EEAA 5CRFA 3CG5A 3HCYA 5HDSA 4JXWA 5EVLA 4HY8A 4XUXA 3S4XA 4DJ3A 3D3OA 2Y2JA 3NY4A 1PWCA 3VE3A 3B33A 4S2MA 4EU0A 3PBTA 3UDXA 1CI9A 4C6YA 4ETXA 4Y3IA 1LLBA 2HV1A 2VA0A 2QPNA 5JYPA 3QP4A 4LV3A 1JWZA 4Y0OA 3NJAA 5DTKA 3ZVTA 4X53A 3O87A 1ES5A 3IQAA 2BTFP 4O7DA 3S7QA 3EGDC 2QJ7A 1NYMA 4G3VA 1TS7A 3W4QA 5DKLA 3WS4A 5AVEA 1U60A 1YPRA 3CLOA 3VFFA 1YLZA 1K0KA 2J8YA 3F1PB 5HFOA 2UWXA 4E3KA 5HL6A 2E8IA 1W5DA 2G7UA 3U4LP 1ZTUA 2PU4A 2QJ5A 2H5SA 4ID4A 4JGPA 3SS5A 4E3JA 3HLCA 1A0KA 1IEMA 2ZL1B 5EV0A 5FEFA 4JF6A 3IT9A 1PFLA 4UA7A 3A3DA 4QB8A 3V5MA 3ZYTA 1P0ZA 2JN7A 1H8ZA 3BFGA 2XA7S 3NOUC 1K56D 1C3BA 5HDDA 1JVJA 3SH9A 1BLSA 2ACGA 4Y5FA 1W63M 2VJWA 1K4EA 5DFYA 3SH8A 3BECA 3ZDJA 2D01A 2WUQA 4O0PA 3N8RA 4PKYA 1QMFA 4KZ8A 5CEBA 3IXDA 1YLPA 2W27A 4Q0HA 3UO9A 2HZ5A 2L1MA 5A91A 3SS3A 1DJCA 2XGNA 3R4KA 1XPBA 3LO7A 3RXWA 3JYIA 1SDNA 1OTBA 3KSHA 2XF3A 4K0WA 2AVXA 4EQIA 4HP4A 5FDHA 4RYEA 5FI6A 2VX8A 1KVMA 4S2JA 2W3GA 3SH7A 3IH9A 3ITAA 4KUOA 4MMNA 1MY8A 4R70A 4WM9A 3FG8A 1DP8A 2PDRA 1OT9A 3JVUA 5M18A 5TBMB 4MDZA 1XGJA 1NRJA 2ZJ9A 3OPRA 3Q82A 1CQAA 4FUWA 4HIAA 3GTCA 5J7EA 2OAP1 4BD1A 2V0UA 3HLBA 2W3FA 1GA0A 2Z2MB 4KUKA 3QP5A 1VQQA 1KGEA 1JTGA 3H82B 3C30A 5G18A 1ZHHB 1T1AA 3LGOA 2V1ZA 1KE3A 3PAEA 4B4ZA 5EOOA 1FILA 3UB7A 2EX2A 1GHPA 5KMWA 3MS6A 1Z09A 3MXRA 5HPIA 1NY0A 3OCNA 5EM0A 1DRMA 2ZLYA 3PAGA 3CI6A 4MEZA 5F1GA 5I5LA 5J4EA 4EUVA 2EWVA 4S2NA 2WYXA 1N9OA 4IUKA 1FOFA 5L07A 2BASA 4IJGA 2BG1A 3OBFA 4FOFA 4OVDA 3BFFA 3UY6A 3CJMA 5J8XA 4LRZE 1SCWA 4WZ5A 3G4PA 2RCXA 4H6JB 2A3UA 5MC7A 1XJ4A 3BQAA 5IU1A 4EEUA 4NXEA 3BFCA 2VV7A 4XT2B 2Y2MA 2ZC7A 3NECA 4P6BA 1NLZA 2B02A 3ZCZA 3IWQA 4DF6A 2EFUA 1XGIA 1SKFA 4Z9QA 3OPPA 3UNWA 5CGXA 5E2EA 3NIAA 5CTNA 3E4QA 3N6IA 1W63Q 2A49A 2YKFA 3GVBA 3BFDA 1D06A 2C5WB 2W3HA 4LCLA 4NETA 3T1RA 4UA9A 1F2KA 4U3TA 2WGVA 4FSFA 1OMEA 2V8FA 4YWZA 1PIOA 2P9VA 2PAVP 2PBYA 1IOUA 4PHTA 4PKYG 3A0VA 3UPNA 2QMIA 4MNRA 3QNCA 4EERA 3T1QB 4DMZA 4RX2A 5CHMA 4HP9A 3PBSA 2ZOHA 3Q7VB 5HSQA 1PW1A 1EI5A 2DMWA 3VP3A 1F5MA 4P6ZM 2WADA 3C4PA 4MBHA 3NDEA 3H82A 2QHKA 1IYSA 3KSIA 4MN6A 3T1SA 2J3TC 2UV0E 4GB7A 3DTIA 1K38A 3N4IA 4LCMA 2R9XA 2G2WA 3F1OA 5L2FA 3MSHA 3IX8A 3T12B 4CLCD 2JE5A 2Q9MA 3F1OB 2J7VA 4HJ3A 1YSQA 3ZQ5A 3IHBA 2KX6A
chains in the Genus database with same CATH topology
4R6LA 3KO6A 4CQHA 3MF0A 1P97A 1IFQA 3IBRA 3OOVA 4MCWA 4I38A 4L0LA 2QKPA 4EXOA 4IHQA 4I5SA 3NOPC 1G28A 3PHYA 1LSVA 1S67L 4GHIA 5F68A 1N9LA 2PYRA 4I3JA 5J3WA 1X0OA 3LR3A 2PD7A 3MJQA 4K08A 3OCLA 4WF0A 2WKPA 4ETZA 3CAXA 4BBVA 2R78A 1OTIA 2VV8A 3CUEA 4GHIB 2VEAA 3LI9A 3H7WB 2QYBA 5AJGA 2VLGA 3EEAA 3C38A 3PR6A 2O9AA 3HCYA 2KDKA 5HDSA 5C5KA 3KYQA 4HOIA 4HY8A 4DJ3A 3D3OA 1H3QA 3VE3A 1S66L 3T4QA 4HJ6A 1WA9A 2B18A 3B33A 4L9EA 4EU0A 3PBTA 2P04A 1H8MA 2ZBBA 3SW1A 4ETXA 2W0NA 4Y3IA 4YOFA 1S1ZA 2JKRI 4JGQA 3HJIA 1DP6A 2A2LA 1G6OA 3MQQA 4Y2FA 2HV1A 4HI4A 2VA0A 4CLCA 3PBOA 2INWA 3G6OA 3D72A 3NJAA 3S7NA 4Q0IA 1ODVA 3S7OA 4ME4A 3FC7A 1OTEA 5EFWA 4EQ1A 3UB6A 1YAXA 3S7QA 2PT7A 3F1PA 2GX5A 2VV6A 2XA7M 3UB9A 2K2NA 4YNRA 1UGUA 3EGDC 2QJ7A 4I3IA 4G3VA 1TS7A 4O8GA 2P08A 5DKLA 3VE4A 2P7JA 5AVEA 1Y28A 4UQIM 1XJ3A 3CLOA 3EWKA 3FPVA 3F1PB 2M7UA 3T4TA 1VB6A 3FPWA 2H28A 5DF9A 5HL6A 2OOLA 3LIFA 1TS8A 2G7UA 3BWLA 1ZTUA 4DJ2A 2QJ5A 2K31A 2O9BA 5HWVA 4JGPA 3RTYA 2HJEA 2NUTC 3B47A 1MKMA 4EETB 2PD8A 2A24A 4WN5A 5DJUA 3V67A 4P6ZS 2J80A 4I39A 3K3CA 4Z1WA 2M1CA 2J3WA 3KX0X 3ZYTA 1P0ZA 2JKTI 2JN7A 2XA7S 4II7A 3NOUC 3T50A 3LI8A 5HDDA 2K7SA 5HD5A 4CLCB 4MN5A 4UQIS 3LYXA 1OTAA 3P01A 2XRNA 4EESA 4Y5FA 4NEED 3TJZC 1W63M 2VJWA 2PHYA 5DFYA 4OOMA 4G3KA 2D01A 2GZAA 3EOIA 1UWNX 3NOTC 4NXFA 3A0RA 5KIZA 2YKHA 5HD3A 3T4OA 4O0PA 5L8MA 4PKYA 3MQ0A 1T19A 1NLYA 4B9OA 3LR0A 1LT0A 2W27A 4Q0HA 2L4RA 4B93A 1MZUA 2L1MA 4ARZB 1XJ6A 3VV4A 3BW6A 3R4KA 5HDCA 2D02A 4GS9B 1F9IA 1OTBA 3KSHA 5A8BA 2LB9A 4UEYA 2JHEA 2V1BA 3GECA 4HP4A 3T4LA 4RQ9A 2WKRA 1TS6A 3E98A 2VX8A 1YKDA 2A24B 3RFBA 3DBAA 1V9ZA 1OPXA 4IUHA 2W3GA 5F6AA 3TW8A 2GNXA 1YSPA 4KUOA 4KQDA 4L9GA 4LPZA 2FH5A 4MMNA 4R70A 3FG8A 1DP8A 2ZMFA 2PDRA 4NXBA 1OT9A 2OWJA 3JVUA 2FZ0A 5TBMB 4MDZA 3U2AA 1NRJA 2VZWA 3BY9A 1EW0A 3VOLA 2VGLS 5HWTA 4HIAA 3LR4A 2Z6CA 2OAP1 5J7EA 4NXGA 2OAQ1 1TD5A 3LFVA 5G4YA 1N9NA 2PR6A 4F3LA 2V0UA 2Y8HA 1P9WA 4WEJA 1LL8A 3PXPA 3RH8B 2W3FA 2W1TA 4KUKA 2HJ9C 3T4SA 5F5YA 1OJ5A 4ARZA 4M4XA 4WUJA 4BMWA 3LIEA 1DP9A 5F69A 3H82B 1BYWA 3LICA 4HHDA 1F98A 3C30A 1S1YA 3UMEA 3S7PA 1ZHHB 1T1AA 1GSVA 3C2WA 1T1BA 2HF6A 4HJ4A 3UB7A 5HZHA 3LUQA 3LIBA 4G3WA 1TF1A 5IT5A 5K5BA 5DKKA 5HPIA 2ZOIA 2Z6DA 3PBRA 3E4OA 3LIDA 3OCNA 3CUEC 5LBRA 3B42A 1DRMA 3LR5A 1GSXA 4MN7A 2I9VA 3CI6A 3BJNA 4NKPA 3KSGA 4QPRA 4GS9A 4LRXC 5I5LA 2XSSA 5J4EA 1LSWA 2CMNA 3C8CA 4EUVA 4I3AA 2EWVA 4JGOA 2GJ3A 3KSFA 2O99A 3IBJA 1N9OA 1VHMA 2EWWA 4IUKA 2L0WA 3EQUA 3UB8A 3UE3A 2BASA 3PYPA 2W3DA 4IJGA 3P7NA 3OBFA 2KLIA 1S4SA 4FOFA 4Q0JA 1GSWA 3EQVA 3EGXC 4LRZE 4GCZA 3LIAA 3H7WA 1JNUA 2ZMVA 4H6JB 5MC7A 1XJ4A 3K3DA 3UE6A 3O5YA 3BQAA 4HNBA 5IU1A 3PBNA 3F1NB 4NXEA 4EEUA 3K2NA 2JKRM 1OJGA 2VV7A 3EEHA 1OTDA 4XT2B 3TE8A 2EA9A 4WELA 1NLZA 2PR5A 3R7WA 4BBTA 2B02A 3CWFA 4EW7A 3TRCA 3PBQA 4WL9A 2JKTM 2NUPC 4GW9A 3MFXA 3T4JA 2XROA 3KYZA 1XFNA 3OLOA 2W1TB 3E4QA 3NHQA 1W63Q 2J3TD 2YKFA 4CLCE 1D06A 4LLOB 4BWIA 2W3HA 1TS0A 2KOIA 1NWZA 4BBUA 3MQOA 4GLQA 4AFIA 4FSFA 4ZRRA 4E04A 4YWZA 3BQ8A 3H9WA 2M7VA 1V9YA 5KSHA 4GJ4A 4O01A 5TBMA 3MXQA 4HH2A 4H6JA 4WEKA 3E0YA 4LRYC 2W1RA 1IOUA 4PHTA 1XFQA 2W3EA 3A0VA 4PKYG 1LSXA 3MR0A 5FL3A 3F1NA 2VKSA 2VGLM 4HH3A 1STZA 4EERA 4DMZA 4F3LB 5HWWA 2V1AA 4HP9A 3PBSA 2ZOHA 3E4PA 5HSQA 2Y79A 4KQOA 3R7WB 3BY8A 4EEPA 1UWPX 2DMWA 2LB5A 3T4KA 4PAUA 1OT6A 1F5MA 4P6ZM 3JVVA 5CX7A 2QWSA 3H82A 2IA2A 2QHKA 5TJJA 3CITA 1P9RA 3KSIA 4L9FA 5IS1A 1D7EA 4MN6A 5AVFA 2J3TC 1MC0A 4XT2A 2O0YA 3UMDA 4CLCC 1S4RA 3ICYA 2HGVA 4R38A 1T1CA 4WLAA 3IS2B 3A0SA 3F1OA 1KOUA 2V9AA 1XJ2A 2V0WA 2MJ6A 4OOLA 3W2ZA 4CLCD 4HQAA 2PYPA 3HJKA 3IS2A 2WKQA 5DFXA 4DN0A 3F1OB 3OC2A 2O9CA 3ULFA 3GDIA 4BJPA 1T18A 2OWHA 3MMHA 4HJ3A 1YSQA 5DJTA 3ZQ5A 5G4ZA 5HPFA 4R3AA 4JGRA 2KX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R6L A;  2PDR A;  1VB6 A;  4NXB A;  1P97 A;  1OT9 A;  2OWJ A;  2H28 A;  3IBR A;  4WL9 A;  2OOL A;  3LIF A;  4I38 A;  5TBM B;  1TS8 A;  3BWL A;  2QKP A;  4GW9 A;  3BY9 A;  3MFX A;  4EXO A;  1EW0 A;  4DJ2 A;  3VOL A;  2QJ5 A;  5HWT A;  4I5S A;  4HIA A;  1XFN A;  3OLO A;  2Z6C A;  5J7E A;  3E4Q A;  3NOP C;  1G28 A;  3PHY A;  4JGP A;  1LSV A;  1S67 L;  3NHQ A;  4GHI A;  4NXG A;  3RTY A;  5HWV A;  5F68 A;  4EET B;  1N9L A;  2PYR A;  4I3J A;  1N9N A;  2PR6 A;  5G4Y A;  1X0O A;  2PD8 A;  2YKF A;  2A24 A;  2V0U A;  4WN5 A;  5DJU A;  2PD7 A;  1D06 A;  3MJQ A;  4LLO B;  4K08 A;  1LL8 A;  4WF0 A;  2WKP A;  3CAX A;  1TS0 A;  3RH8 B;  1NWZ A;  4BBU A;  2J80 A;  3MQO A;  4KUK A;  4BBV A;  2R78 A;  1OTI A;  4E04 A;  2VV8 A;  4YWZ A;  4GHI B;  1OJ5 A;  5F5Y A;  4M4X A;  2VEA A;  4WUJ A;  4I39 A;  3H9W A;  3K3C A;  3LIE A;  3H7W B;  3LI9 A;  1DP9 A;  1V9Y A;  2M1C A;  3H82 B;  2VLG A;  5F69 A;  3KX0 X;  3MXQ A;  5J3W A;  4HH2 A;  1BYW A;  3LIC A;  4H6J A;  1P0Z A;  5TBM A;  4LRY C;  2JN7 A;  4HHD A;  1F98 A;  1XFQ A;  3A0V A;  4PKY G;  1S1Y A;  3UME A;  3NOU C;  1LSX A;  1T1A A;  2KDK A;  3F1P B;  3MR0 A;  5HDS A;  3T50 A;  1GSV A;  3F1N A;  4HOI A;  4HH3 A;  4EER A;  4HY8 A;  3LI8 A;  5HDD A;  2K7S A;  3C2W A;  1T1B A;  5HD5 A;  4DJ3 A;  4F3L B;  5HWW A;  4HJ4 A;  3UB7 A;  5HZH A;  4MN5 A;  2V1A A;  4HP9 A;  1S66 L;  3VE3 A;  3LUQ A;  3LIB A;  4HJ6 A;  3LYX A;  1WA9 A;  2ZOH A;  1OTA A;  3E4P A;  5HSQ A;  2KX6 A;  3B33 A;  5DKK A;  3BY8 A;  4L9E A;  1UWP X;  4EES A;  4EEP A;  2ZOI A;  2Z6D A;  3E4O A;  1OT6 A;  3LID A;  2ZBB A;  1DRM A;  2PHY A;  1GSX A;  2I9V A;  3SW1 A;  4GS9 A;  4LRX C;  5I5L A;  2QWS A;  2W0N A;  3H82 A;  5J4E A;  2QHK A;  2D01 A;  1LSW A;  2CMN A;  3C8C A;  1S1Z A;  4I3A A;  4JGQ A;  1UWN X;  4JGO A;  3HJI A;  2GJ3 A;  3NOT C;  4L9F A;  3A0R A;  1D7E A;  4MN6 A;  4NXF A;  5AVF A;  5KIZ A;  5IS1 A;  2YKH A;  5HD3 A;  1N9O A;  4I3I A;  2L0W A;  4PKY A;  1DP6 A;  1T19 A;  3MQQ A;  3UB8 A;  4B9O A;  2HV1 A;  4HI4 A;  4XT2 A;  2BAS A;  1LT0 A;  3PYP A;  2W27 A;  3P7N A;  2L4R A;  3UMD A;  1S4S A;  2INW A;  1S4R A;  3ICY A;  1GSW A;  3G6O A;  4R38 A;  1T1C A;  1MZU A;  4WLA A;  2L1M A;  3D72 A;  3NJA A;  4LRZ E;  3IS2 B;  1XJ6 A;  4GCZ A;  5HDC A;  1ODV A;  2D02 A;  3A0S A;  3H7W A;  1JNU A;  1KOU A;  2V9A A;  3F1O A;  3LIA A;  4GS9 B;  4H6J B;  1XJ2 A;  1OTE A;  2V0W A;  3FC7 A;  1F9I A;  1OTB A;  5A8B A;  1XJ4 A;  3K3D A;  5EFW A;  4EQ1 A;  4HQA A;  3UB6 A;  2JHE A;  2V1B A;  3GEC A;  4HP4 A;  3UE6 A;  3F1P A;  2VV6 A;  4RQ9 A;  4HNB A;  5IU1 A;  3UB9 A;  3F1N B;  4NXE A;  4EEU A;  2PYP A;  4F3L A;  1UGU A;  2QJ7 A;  2WKR A;  1OJG A;  1TS6 A;  2WKQ A;  1TS7 A;  3HJK A;  2VV7 A;  3IS2 A;  2A24 B;  3EEH A;  1OTD A;  4XT2 B;  1V9Z A;  5DKL A;  3F1O B;  3VE4 A;  2EA9 A;  2P7J A;  3GDI A;  5AVE A;  1T18 A;  5F6A A;  1Y28 A;  2OWH A;  3ULF A;  1XJ3 A;  3CLO A;  2PR5 A;  4HJ3 A;  3EWK A;  4KQD A;  4KUO A;  4L9G A;  4LPZ A;  4BBT A;  5DJT A;  2B02 A;  3CWF A;  3ZQ5 A;  5G4Z A;  4R70 A;  4EW7 A;  4R3A A;  3FG8 A;  4JGR A;  1DP8 A; 
#chains in the Genus database with same CATH topology
 4CQH A;  1ERM A;  1Y54 A;  4GKU A;  3MFD A;  4MCW A;  4E6X A;  1IYO A;  4EXO A;  1ONH A;  1SHV A;  4OH0 A;  1K55 C;  4I5S A;  3NOP C;  3GQZ A;  1N9L A;  1PYY A;  4I3J A;  5J3W A;  4EBN A;  4H8R A;  1K55 A;  2PD7 A;  3C7V A;  3OCL A;  1E3U A;  2H10 A;  3VSL A;  4BBV A;  4U0T A;  1JWP A;  2VGJ A;  1XP4 A;  3VOY A;  3LI9 A;  3H7W B;  2QYB A;  2IWB A;  1ALQ A;  4P87 A;  4GD8 A;  3MBZ A;  5FAO A;  4HOI A;  2ZQD A;  3IF6 B;  4HJ6 A;  1WA9 A;  4L9E A;  1H8M A;  2ZBB A;  4E3M A;  3ZNY A;  2W0N A;  4YOF A;  1VET B;  1S1Z A;  3SZT A;  1Q2Q A;  1YMX A;  3B3X A;  4E3N A;  4HI4 A;  1KE0 A;  1N9B A;  4CLC A;  2HP5 A;  3GR2 A;  5EVI C;  5FAT A;  1G68 A;  3NBL A;  1MWU A;  2VK3 A;  1MWT A;  2EFX A;  4ME4 A;  1DJB A;  1J9M A;  1OTE A;  3FC7 A;  5EFW A;  4EQ1 A;  3F1P A;  2XA7 M;  3UB9 A;  2K2N A;  5DTS A;  2P74 A;  3M6B A;  4YNR A;  1UGU A;  1H0M A;  4O8G A;  2P08 A;  2P7J A;  2WZX A;  1PI5 A;  2ZM0 A;  1AWI A;  3FPW A;  2H0T A;  3G30 A;  1S6R A;  4IVI A;  1YLJ A;  4LV2 A;  5DF8 A;  1E3U D;  4DJ2 A;  1HLU P;  2Y2I A;  3ISG A;  2O9B A;  5FQ9 A;  3B47 A;  4EET B;  3E2L A;  3DTK A;  3FKW A;  2PD8 A;  5DJU A;  4P6Z S;  4XXR A;  2J80 A;  5GHY A;  4C3Q A;  2Y2N A;  4DXB A;  4I39 A;  1I2S A;  2M1C A;  2J3W A;  1J3W A;  2JKT I;  5KZH A;  4ZJ3 A;  2Q9N A;  4JF4 A;  3UE0 A;  5HD5 A;  2K7S A;  4BEN A;  4JKT A;  3N8L A;  3HLG A;  4MN5 A;  3JPU A;  4UQI S;  3CHW P;  3LYX A;  4BL3 A;  1OTA A;  3P01 A;  1FCO A;  3Q1F A;  2XH9 A;  1DJA A;  1ES3 A;  4E3O A;  3EOI A;  4NXF A;  4DDS A;  3A0R A;  3HLW A;  5KIZ A;  1GHM A;  4B9O A;  3LR0 A;  1FSW A;  4UA6 A;  1ERO A;  5FAP A;  4ARZ B;  3VV4 A;  5HDC A;  5E43 A;  1L0D A;  2LB9 A;  4UEY A;  1E25 A;  1RGY A;  3GEC A;  4S2O A;  5EVI A;  2DNS A;  2WKR A;  3MZF A;  1YKD A;  4GZB A;  2A24 B;  1V9Z A;  3GSG A;  5M19 A;  4IUH A;  4N9L A;  3TW8 A;  1YSP A;  2FH5 A;  1PRQ A;  4S2L A;  2FZ0 A;  3NCK A;  1PZO A;  3BY9 A;  2ZQC A;  3VOL A;  4ESP A;  2VGL S;  4IBR A;  1MXO A;  4HEF A;  3LFV A;  5G4Y A;  2PR6 A;  3WS2 A;  4F3L A;  4QHC A;  2Y8H A;  4A5R A;  3FV7 A;  2IWC A;  1XX2 A;  2HJ9 C;  1L0F A;  5F5Y A;  4WUJ A;  3DAV A;  3AGF A;  4FD8 A;  4QD4 A;  5F69 A;  4OQI A;  4RX3 A;  1KGF A;  3NUL A;  1KE4 A;  3S7P A;  2Y2H A;  4BLM A;  3IWI A;  2JKG A;  2JBF A;  4HJ4 A;  2WAE A;  3LIB A;  1G6A A;  1TF1 A;  1Q2P A;  5K5B A;  5DKK A;  1L0E A;  2ZOI A;  3E4O A;  1L2S A;  2Y55 A;  2QZ6 A;  3LR5 A;  1SKO B;  3IX4 A;  3BJN A;  3KSG A;  4LRX C;  3A3J A;  3C8C A;  3IWO A;  2B95 A;  4I3A A;  4B88 A;  2GJ3 A;  1CEG A;  2O99 A;  3IBJ A;  1K54 A;  1PWG A;  5E2G A;  3UE3 A;  4DE3 A;  5KSC A;  4HES A;  1Y4O A;  3MKF A;  4X55 A;  4Q0J A;  5CXW A;  1GSW A;  5M1A A;  3I7J A;  3O86 A;  2WKE A;  4EWF A;  4OPR A;  4S2N C;  1YLT A;  2Y2L A;  2OLV A;  3ZVW A;  2JKR M;  3A3F A;  3TE8 A;  3G31 A;  3N8S A;  3ZG5 A;  4WEL A;  4KG2 A;  2PR5 A;  4X1L A;  3CWF A;  3TRC A;  2G2U A;  2OV5 A;  3MFX A;  3UB5 P;  3V3S A;  4JBF A;  2W1T B;  3NHQ A;  1AXB A;  1NJ4 A;  3LEZ A;  3AGE A;  2EXB A;  4E04 A;  3BQ8 A;  4OPQ A;  2ZQ8 A;  2M7V A;  4HH2 A;  3BLM A;  3SOI A;  2ZQ7 A;  1PW8 A;  2W3E A;  3M6H A;  2WKI A;  5FL3 A;  2ZC5 B;  3F1N A;  4CJN A;  4HH3 A;  1STZ A;  1H8Y A;  1SKO A;  4F3L B;  4KQO A;  3V50 A;  4EV4 A;  4X56 A;  4E6W A;  5TJJ A;  5GHZ A;  1P9R A;  4L9F A;  3CPT B;  1YMS A;  4FTX A;  4LV1 A;  3ZG8 B;  4XT2 A;  3W8K A;  1O07 A;  2Y2K A;  4LEN A;  4ZTK A;  3HLF A;  4CLC C;  1S4R A;  3IF6 C;  3IXG A;  1FR1 A;  1T1C A;  4RVA A;  2J9P A;  1HVB A;  1BTL A;  2WAF A;  2V9A A;  3HBR A;  1CK3 A;  2V0W A;  4OOL A;  4HQA A;  2BLS A;  4NG2 A;  4KZ4 A;  5F82 A;  3VP2 A;  4DKI A;  1W8Y A;  3HJK A;  2WKQ A;  1K6R A;  2C6W B;  1GA9 A;  3GDI A;  3G35 A;  2OWH A;  3UDI A;  5DJT A;  4JGR A;  2XD1 A;  3KO6 A;  1P97 A;  1IFQ A;  4NK3 A;  4I38 A;  4L0L A;  3BFE A;  5HAP A;  2PRF A;  4OPZ A;  1YLY A;  1ESU A;  3PHY A;  1LSV A;  1S67 L;  4GHI A;  5DF7 A;  5F68 A;  3LR3 A;  3MJQ A;  4K08 A;  4WF0 A;  2WKH A;  2WKP A;  3CAX A;  3TG9 A;  1RGZ A;  4Q8I A;  1FSY A;  1GCE A;  1E4D A;  2R78 A;  2Z2L B;  3BYD A;  4GHI B;  2B5R A;  4X1M A;  5A90 A;  2H0Y A;  3UE1 A;  3PR6 A;  2O9A A;  5FI2 A;  4OLD A;  2EX9 A;  2KDK A;  5C5K A;  3KYQ A;  4R1G A;  1K56 A;  1CF0 A;  1S66 L;  4OP5 A;  3T4Q A;  2B18 A;  1XXM A;  2XQZ A;  5EM1 A;  4KZ3 A;  5EVE A;  2P04 A;  3SW1 A;  1G5U A;  3QP2 A;  1JTD A;  5TFQ A;  3TOI A;  1QME A;  3MZD A;  3IF5 A;  1DP6 A;  3MQQ A;  1G6O A;  4Y2F A;  5DTT A;  4YFM A;  4Q0I A;  4C75 A;  3S7O A;  3HUO A;  1KVL A;  1YAX A;  2PT7 A;  5FQM A;  4I3I A;  2XR0 A;  4WBG A;  3VE4 A;  3CMZ A;  5CGS A;  1Y28 A;  4UQI M;  1XJ3 A;  3EWK A;  3ZG7 B;  1N4O A;  2HPB A;  3T4T A;  4CPK A;  1ZKJ A;  1D1J A;  2H28 A;  5DF9 A;  2OOL A;  3LIF A;  1TS8 A;  3BWL A;  5HWV A;  2HJE A;  2NUT C;  3G34 A;  4JPM A;  3VMA A;  2A24 A;  2EX8 A;  4KG5 A;  2PBD P;  4KG6 A;  1ZC2 A;  3CZD A;  3K3C A;  4Z1W A;  3KX0 X;  3KYE A;  5DVA A;  2ZMA A;  1L3L A;  1GHI A;  3MXS A;  4PM7 A;  1K4F A;  4WYY A;  2HP9 A;  5D3O A;  3GRJ A;  3LY4 A;  2WGW B;  3BM6 A;  4OOY A;  3WWX A;  2XRN A;  4EES A;  5JYO A;  3LY3 A;  2PHY A;  5EEC A;  3QP6 A;  2ZD8 A;  3NOT C;  2YKH A;  5HD3 A;  5L8M A;  1T19 A;  1NLY A;  3G2Y A;  3P98 A;  2L4R A;  2Y2P A;  3A3E A;  3DW0 A;  1FR6 A;  4ZJ1 A;  1M6K A;  1MZU A;  1MBL A;  1XJ6 A;  2P9V B;  3AGD A;  2PU2 A;  1BSG A;  3BW6 A;  1ONG A;  3WRT A;  4GS9 B;  3FZC A;  1F9I A;  4ZBE A;  5EVI D;  5A8B A;  2HDS A;  3UN7 A;  4HBT A;  2JHE A;  4RQ9 A;  2ZM8 A;  4GN2 A;  3E98 A;  3E2K A;  3ZGA B;  3DBA A;  1OPX A;  5F6A A;  4OON A;  3QNB A;  4L9G A;  4U0X A;  2ZMF A;  4NXB A;  2OWJ A;  5CGW A;  5GL9 A;  3LR4 A;  4DE1 A;  3DWK A;  3HUM A;  3FYZ A;  1XKZ A;  2IWD A;  1N9N A;  3C5A A;  1P9W A;  2I72 A;  4WEJ A;  1LL8 A;  3RH8 B;  3MKE A;  1FCM A;  3VP4 A;  2W1T A;  1ESI A;  4ARZ A;  4M4X A;  4BMW A;  1JWV A;  4DRT A;  3LIE A;  1DP9 A;  3LIC A;  4HHD A;  1S1Y A;  3BEB A;  4KQR A;  4IBX A;  1GSV A;  5AQ7 A;  3W4O A;  3Q81 A;  1I2W A;  2HF6 A;  5CER A;  3CUE C;  3B42 A;  5CTM A;  4X69 A;  4NKP A;  4GS9 A;  1HD8 A;  5L09 A;  4JGO A;  4Y17 A;  5HAR A;  2Y4A A;  1CJF A;  1DY6 A;  1VHM A;  2L0W A;  3IH8 A;  3UB8 A;  5FSR A;  5FEG A;  2W3D A;  3P7N A;  2KLI A;  3Q7V A;  4KZB A;  3VOZ A;  3WS5 A;  3EQV A;  3EGX C;  4OPY A;  1KDS A;  4GCZ A;  5EPH A;  4IVK A;  3LIA A;  3H7W A;  1W7F A;  3OPH A;  2Y59 A;  4KQQ A;  4QWO A;  3K3D A;  1S0W A;  3V3R A;  3DWZ A;  2V8C A;  4GD6 A;  4DDY A;  1OJG A;  3EEH A;  4GNU A;  1OTD A;  1W79 A;  4BL2 A;  2FFF B;  5GLC A;  3R7W A;  4R3B A;  4BBT A;  2X01 A;  4S2K A;  4EW7 A;  3PBQ A;  3A3I A;  4YIN A;  4R3J A;  4EUZ A;  4FH4 A;  3N7W A;  4PM9 A;  4GW9 A;  2VGK A;  4PMA A;  1VET A;  2R9W A;  3Q07 A;  3ZG9 B;  1XFN A;  3TSG A;  4E3I A;  2J3T D;  5E2H A;  4X25 A;  1IEL A;  1TS0 A;  2KOI A;  3V39 A;  3MQO A;  4GLQ A;  4KEN B;  1XA7 A;  3UPP A;  3H9W A;  1Z6F A;  4DE0 A;  1LL9 A;  4WEK A;  3E0Y A;  4LRY C;  2W1R A;  4FCF A;  4BD0 A;  1XFQ A;  5HL1 A;  2EX6 A;  3O3V A;  3MR0 A;  2VKS A;  3Q7Z A;  3WS1 A;  1MWS A;  1IYP A;  2Y79 A;  3R7W B;  1BZA A;  2LB5 A;  1OT6 A;  4KZ5 A;  3JVV A;  1WYB A;  2JKF A;  4OQH A;  2IA2 A;  3CIT A;  3NDG A;  4JXS A;  4MBF A;  1D7E A;  3D4F A;  3ZNT A;  1FCN A;  4K0X A;  2X02 A;  3L7H A;  2WZZ A;  2O0Y A;  3LCE A;  3UMD A;  1RP5 A;  2HGV A;  4R38 A;  4WLA A;  4RA7 A;  5FDS A;  1XJ2 A;  3UPO A;  4XUZ A;  3C7U A;  1NZO A;  2PYP A;  4D2O A;  4DN0 A;  4OQ0 A;  5GHX A;  2O9C A;  3ULF A;  4E3L A;  3MMH A;  1PWD A;  1YT4 A;  2DRW A;  5HPF A;  4R6L A;  5FA7 A;  4MLL A;  3MF0 A;  3IBR A;  2ZL1 A;  4DE2 A;  1RCJ A;  4JF5 A;  1G28 A;  2ZQ9 A;  1VM1 A;  5FQJ A;  1ERQ A;  4Y0T A;  1X0O A;  3GMW A;  4WMC A;  2ZC6 B;  1BLP A;  4X6T A;  5AQ9 A;  4ETZ A;  5TR7 A;  5EUA A;  3QP8 A;  3CUE A;  5BOH A;  2VEA A;  5F1F A;  1LI0 A;  2VLG A;  2RL3 A;  3SS4 A;  4N9K A;  3C38 A;  4BQM A;  1ACF A;  1NRF A;  4LGW A;  5EE8 A;  4GDB A;  1BT5 A;  1H3Q A;  3G2Z A;  3IXB A;  4P0M A;  3S1Y A;  4PM5 A;  1TVF A;  3IHA A;  4KZ9 A;  3IF6 A;  4ZJ2 A;  3D9Y A;  2JKR I;  4JGQ A;  3HJI A;  5HAI A;  3P09 A;  2A2L A;  3HLD A;  1EWZ A;  1IYQ A;  1K54 C;  1HTZ A;  3PBO A;  1YM1 A;  2INW A;  5FQK A;  5GLD A;  4WZ5 C;  3G6O A;  3IXH A;  3D72 A;  3S7N A;  5FAQ A;  3RXX A;  1ODV A;  2XEP A;  3ITB A;  2Q0O A;  4OLG A;  3UB6 A;  2GX5 A;  1YQS A;  2VV6 A;  1BLC A;  5FQQ A;  2FFY A;  2ZC3 B;  4Y15 A;  3FPV A;  2Y91 A;  5EVI B;  5GLB A;  2M7U A;  3S22 A;  1VB6 A;  3VP1 A;  1WYC A;  4EBL A;  4JLF A;  1H5X A;  4KZA A;  2K31 A;  3ZG0 A;  1FQG A;  1ZG6 A;  4WMC D;  2XDM A;  3RTY A;  4ZDX A;  1MKM A;  4X68 A;  4WN5 A;  4N92 A;  3V67 A;  3WRZ A;  1TDL A;  2HP6 A;  3QP1 A;  1I5Q A;  4DXC A;  1W8Q A;  4Y0U A;  3HL9 A;  4II7 A;  5HAQ A;  1K6S A;  3T50 A;  1K57 A;  3HUN A;  3LI8 A;  4KZ7 A;  4CLC B;  5A93 A;  1BLH A;  1MPL A;  4R4S A;  2DCF A;  4NEE D;  3TJZ C;  1ES2 A;  4OOM A;  4G3K A;  3VP0 A;  4QY6 A;  2GZA A;  4D60 A;  1UWN X;  5FAS A;  1CI8 A;  3T4O A;  3MQ0 A;  4N1H A;  1LT0 A;  3HLE A;  5CED A;  3PTE A;  4B93 A;  2D02 A;  5I94 A;  3LEQ A;  2JCH A;  3HRE A;  4IED A;  1FIK A;  1PZP A;  1MKI A;  5IHV A;  2V1B A;  3RJU A;  3T4L A;  2HDU A;  3HVF A;  4S2P A;  1TS6 A;  5AQA A;  3RFB A;  4R23 A;  2GNX A;  2HDQ A;  4KQD A;  4LPZ A;  3VFH A;  1VEU B;  5U47 A;  1BUE A;  4OKP A;  4UHU A;  3U2A A;  2VZW A;  2OSU A;  1EW0 A;  4PPR A;  1SDE A;  5HWT A;  2Z6C A;  4NXG A;  3L9K A;  1LL5 A;  2OAQ 1;  1KDW A;  3W4P A;  1TD5 A;  2CC1 A;  3PXP A;  3M2J A;  3NI9 A;  5CHU A;  5FQI A;  1M40 A;  4OQG A;  3T4S A;  5HX9 A;  1OJ5 A;  2XLN A;  4PM8 A;  3BLS A;  3IX3 A;  1BYW A;  4K91 A;  4Y13 A;  1PNE A;  1F98 A;  3UME A;  2XFT A;  4JXG A;  1XA1 A;  3OPL A;  1ES4 A;  5A92 A;  2X71 A;  4FH2 A;  3C2W A;  1T1B A;  2J9O A;  4QJG A;  5HZH A;  5HW3 A;  3LUQ A;  4HBU A;  4G3W A;  5IT5 A;  1VEU A;  2Z6D A;  3PBR A;  3LID A;  3NC8 A;  5LBR A;  1YLW A;  1GSX A;  4MN7 A;  2I9V A;  4QPR A;  1K57 C;  2XSS A;  2XD5 A;  2E8J A;  1LSW A;  2CMN A;  4LFU A;  3KSF A;  3M2K A;  5GLA A;  2EWW A;  3EQU A;  3PYP A;  4P85 A;  1PI4 A;  1S4S A;  3GV9 A;  3C4O A;  2XK1 A;  1JNU A;  2ZMV A;  2WK0 A;  2Y2G A;  2GDN A;  1MWR A;  3UE6 A;  3O5Y A;  1K25 A;  4N1X A;  4HNB A;  3PBN A;  3F1N B;  5E2F A;  3K2N A;  2HDR A;  2EA9 A;  3WS0 A;  1TDG A;  4GDN A;  4WL9 A;  2JKT M;  2NUP C;  5EOE A;  2JC7 A;  4QY5 A;  3T4J A;  1NXY A;  2XRO A;  3KYZ A;  3OLO A;  4KZ6 A;  4CLC E;  4BWI A;  4LLO B;  1O7E A;  3ZHH A;  1NWZ A;  4BBU A;  4AFI A;  4ZRR A;  2V2F F;  2ZQA A;  3VSK A;  4QU3 A;  1V9Y A;  5KSH A;  5L10 A;  4GJ4 A;  4O01 A;  5TBM A;  3MXQ A;  4H6J A;  2Y2O A;  1LSX A;  3OZH A;  2VGL M;  1ZG4 A;  4WZ4 A;  4S2I A;  5HWW A;  2V1A A;  4MBK A;  1CEF A;  3E4P A;  3G32 A;  3BY8 A;  4EEP A;  1UWP X;  1HZO A;  3ZFZ A;  3T4K A;  4PAU A;  1LHY A;  3FWL A;  5FI7 A;  5CX7 A;  2QWS A;  4PM6 A;  4JXV A;  5IS1 A;  5AVF A;  5CEC A;  1MC0 A;  2Y2Q A;  1L0G A;  5AQB A;  4R4R A;  5CHJ A;  4M3K A;  4LV0 A;  2WGI A;  3ICY A;  1KGG A;  3DTE A;  3BRM A;  3IS2 B;  2OLU A;  3A0S A;  1KOU A;  3FKV A;  3QHY A;  3W2Z A;  2MJ6 A;  4GOG A;  1NZU A;  3IS2 A;  5DFX A;  3UDF A;  2XFS A;  3OC2 A;  4B4X A;  4BJP A;  1T18 A;  5G4Z A;  4R3A A;  4EBP A;  1IKG A;  3DTM A;  3OOV A;  2ZM2 A;  2QKP A;  3O88 A;  1BUL A;  1WE4 A;  2EXA A;  4IHQ A;  3CPT A;  4OP8 A;  2PYR A;  4UAA A;  1TEM A;  2WGW A;  1SZV A;  1LI9 A;  4F94 A;  1IKI A;  4Y7P A;  1OTI A;  2VV8 A;  2V20 A;  3T1X A;  2ZC4 B;  1NYY A;  5AJG A;  4R0Q A;  4ZAM A;  5F83 A;  5TGF A;  3MZE A;  3EEA A;  5CRF A;  3CG5 A;  3HCY A;  5HDS A;  4JXW A;  5EVL A;  4HY8 A;  4XUX A;  3S4X A;  4DJ3 A;  3D3O A;  2Y2J A;  3NY4 A;  1PWC A;  3VE3 A;  3B33 A;  4S2M A;  4EU0 A;  3PBT A;  3UDX A;  1CI9 A;  4C6Y A;  4ETX A;  4Y3I A;  1LLB A;  2HV1 A;  2VA0 A;  2QPN A;  5JYP A;  3QP4 A;  4LV3 A;  1JWZ A;  4Y0O A;  3NJA A;  5DTK A;  3ZVT A;  4X53 A;  3O87 A;  1ES5 A;  3IQA A;  2BTF P;  4O7D A;  3S7Q A;  3EGD C;  2QJ7 A;  1NYM A;  4G3V A;  1TS7 A;  3W4Q A;  5DKL A;  3WS4 A;  5AVE A;  1U60 A;  1YPR A;  3CLO A;  3VFF A;  1YLZ A;  1K0K A;  2J8Y A;  3F1P B;  5HFO A;  2UWX A;  4E3K A;  5HL6 A;  2E8I A;  1W5D A;  2G7U A;  3U4L P;  1ZTU A;  2PU4 A;  2QJ5 A;  2H5S A;  4ID4 A;  4JGP A;  3SS5 A;  4E3J A;  3HLC A;  1A0K A;  1IEM A;  2ZL1 B;  5EV0 A;  5FEF A;  4JF6 A;  3IT9 A;  1PFL A;  4UA7 A;  3A3D A;  4QB8 A;  3V5M A;  3ZYT A;  1P0Z A;  2JN7 A;  1H8Z A;  3BFG A;  2XA7 S;  3NOU C;  1K56 D;  1C3B A;  5HDD A;  1JVJ A;  3SH9 A;  1BLS A;  2ACG A;  4Y5F A;  1W63 M;  2VJW A;  1K4E A;  5DFY A;  3SH8 A;  3BEC A;  3ZDJ A;  2D01 A;  2WUQ A;  4O0P A;  3N8R A;  4PKY A;  1QMF A;  4KZ8 A;  5CEB A;  3IXD A;  1YLP A;  2W27 A;  4Q0H A;  3UO9 A;  2HZ5 A;  2L1M A;  5A91 A;  3SS3 A;  1DJC A;  2XGN A;  3R4K A;  1XPB A;  3LO7 A;  3RXW A;  3JYI A;  1SDN A;  1OTB A;  3KSH A;  2XF3 A;  4K0W A;  2AVX A;  4EQI A;  4HP4 A;  5FDH A;  4RYE A;  5FI6 A;  2VX8 A;  1KVM A;  4S2J A;  2W3G A;  3SH7 A;  3IH9 A;  3ITA A;  4KUO A;  4MMN A;  1MY8 A;  4R70 A;  4WM9 A;  3FG8 A;  1DP8 A;  2PDR A;  1OT9 A;  3JVU A;  5M18 A;  5TBM B;  4MDZ A;  1XGJ A;  1NRJ A;  2ZJ9 A;  3OPR A;  3Q82 A;  1CQA A;  4FUW A;  4HIA A;  3GTC A;  5J7E A;  2OAP 1;  4BD1 A;  2V0U A;  3HLB A;  2W3F A;  1GA0 A;  2Z2M B;  4KUK A;  3QP5 A;  1VQQ A;  1KGE A;  1JTG A;  3H82 B;  3C30 A;  5G18 A;  1ZHH B;  1T1A A;  3LGO A;  2V1Z A;  1KE3 A;  3PAE A;  4B4Z A;  5EOO A;  1FIL A;  3UB7 A;  2EX2 A;  1GHP A;  5KMW A;  3MS6 A;  1Z09 A;  3MXR A;  5HPI A;  1NY0 A;  3OCN A;  5EM0 A;  1DRM A;  2ZLY A;  3PAG A;  3CI6 A;  4MEZ A;  5F1G A;  5I5L A;  5J4E A;  4EUV A;  2EWV A;  4S2N A;  2WYX A;  1N9O A;  4IUK A;  1FOF A;  5L07 A;  2BAS A;  4IJG A;  2BG1 A;  3OBF A;  4FOF A;  4OVD A;  3BFF A;  3UY6 A;  3CJM A;  5J8X A;  4LRZ E;  1SCW A;  4WZ5 A;  3G4P A;  2RCX A;  4H6J B;  2A3U A;  5MC7 A;  1XJ4 A;  3BQA A;  5IU1 A;  4EEU A;  4NXE A;  3BFC A;  2VV7 A;  4XT2 B;  2Y2M A;  2ZC7 A;  3NEC A;  4P6B A;  1NLZ A;  2B02 A;  3ZCZ A;  3IWQ A;  4DF6 A;  2EFU A;  1XGI A;  1SKF A;  4Z9Q A;  3OPP A;  3UNW A;  5CGX A;  5E2E A;  3NIA A;  5CTN A;  3E4Q A;  3N6I A;  1W63 Q;  2A49 A;  2YKF A;  3GVB A;  3BFD A;  1D06 A;  2C5W B;  2W3H A;  4LCL A;  4NET A;  3T1R A;  4UA9 A;  1F2K A;  4U3T A;  2WGV A;  4FSF A;  1OME A;  2V8F A;  4YWZ A;  1PIO A;  2P9V A;  2PAV P;  2PBY A;  1IOU A;  4PHT A;  4PKY G;  3A0V A;  3UPN A;  2QMI A;  4MNR A;  3QNC A;  4EER A;  3T1Q B;  4DMZ A;  4RX2 A;  5CHM A;  4HP9 A;  3PBS A;  2ZOH A;  3Q7V B;  5HSQ A;  1PW1 A;  1EI5 A;  2DMW A;  3VP3 A;  1F5M A;  4P6Z M;  2WAD A;  3C4P A;  4MBH A;  3NDE A;  3H82 A;  2QHK A;  1IYS A;  3KSI A;  4MN6 A;  3T1S A;  2J3T C;  2UV0 E;  4GB7 A;  3DTI A;  1K38 A;  3N4I A;  4LCM A;  2R9X A;  2G2W A;  3F1O A;  5L2F A;  3MSH A;  3IX8 A;  3T12 B;  4CLC D;  2JE5 A;  2Q9M A;  3F1O B;  2J7V A;  4HJ3 A;  1YSQ A;  3ZQ5 A;  3IHB A;  2KX6 A; 
#chains in the Genus database with same CATH homology
 4R6L A;  3KO6 A;  4CQH A;  3MF0 A;  1P97 A;  1IFQ A;  3IBR A;  3OOV A;  4MCW A;  4I38 A;  4L0L A;  2QKP A;  4EXO A;  4IHQ A;  4I5S A;  3NOP C;  1G28 A;  3PHY A;  1LSV A;  1S67 L;  4GHI A;  5F68 A;  1N9L A;  2PYR A;  4I3J A;  5J3W A;  1X0O A;  3LR3 A;  2PD7 A;  3MJQ A;  4K08 A;  3OCL A;  4WF0 A;  2WKP A;  4ETZ A;  3CAX A;  4BBV A;  2R78 A;  1OTI A;  2VV8 A;  3CUE A;  4GHI B;  2VEA A;  3LI9 A;  3H7W B;  2QYB A;  5AJG A;  2VLG A;  3EEA A;  3C38 A;  3PR6 A;  2O9A A;  3HCY A;  2KDK A;  5HDS A;  5C5K A;  3KYQ A;  4HOI A;  4HY8 A;  4DJ3 A;  3D3O A;  1H3Q A;  3VE3 A;  1S66 L;  3T4Q A;  4HJ6 A;  1WA9 A;  2B18 A;  3B33 A;  4L9E A;  4EU0 A;  3PBT A;  2P04 A;  1H8M A;  2ZBB A;  3SW1 A;  4ETX A;  2W0N A;  4Y3I A;  4YOF A;  1S1Z A;  2JKR I;  4JGQ A;  3HJI A;  1DP6 A;  2A2L A;  1G6O A;  3MQQ A;  4Y2F A;  2HV1 A;  4HI4 A;  2VA0 A;  4CLC A;  3PBO A;  2INW A;  3G6O A;  3D72 A;  3NJA A;  3S7N A;  4Q0I A;  1ODV A;  3S7O A;  4ME4 A;  3FC7 A;  1OTE A;  5EFW A;  4EQ1 A;  3UB6 A;  1YAX A;  3S7Q A;  2PT7 A;  3F1P A;  2GX5 A;  2VV6 A;  2XA7 M;  3UB9 A;  2K2N A;  4YNR A;  1UGU A;  3EGD C;  2QJ7 A;  4I3I A;  4G3V A;  1TS7 A;  4O8G A;  2P08 A;  5DKL A;  3VE4 A;  2P7J A;  5AVE A;  1Y28 A;  4UQI M;  1XJ3 A;  3CLO A;  3EWK A;  3FPV A;  3F1P B;  2M7U A;  3T4T A;  1VB6 A;  3FPW A;  2H28 A;  5DF9 A;  5HL6 A;  2OOL A;  3LIF A;  1TS8 A;  2G7U A;  3BWL A;  1ZTU A;  4DJ2 A;  2QJ5 A;  2K31 A;  2O9B A;  5HWV A;  4JGP A;  3RTY A;  2HJE A;  2NUT C;  3B47 A;  1MKM A;  4EET B;  2PD8 A;  2A24 A;  4WN5 A;  5DJU A;  3V67 A;  4P6Z S;  2J80 A;  4I39 A;  3K3C A;  4Z1W A;  2M1C A;  2J3W A;  3KX0 X;  3ZYT A;  1P0Z A;  2JKT I;  2JN7 A;  2XA7 S;  4II7 A;  3NOU C;  3T50 A;  3LI8 A;  5HDD A;  2K7S A;  5HD5 A;  4CLC B;  4MN5 A;  4UQI S;  3LYX A;  1OTA A;  3P01 A;  2XRN A;  4EES A;  4Y5F A;  4NEE D;  3TJZ C;  1W63 M;  2VJW A;  2PHY A;  5DFY A;  4OOM A;  4G3K A;  2D01 A;  2GZA A;  3EOI A;  1UWN X;  3NOT C;  4NXF A;  3A0R A;  5KIZ A;  2YKH A;  5HD3 A;  3T4O A;  4O0P A;  5L8M A;  4PKY A;  3MQ0 A;  1T19 A;  1NLY A;  4B9O A;  3LR0 A;  1LT0 A;  2W27 A;  4Q0H A;  2L4R A;  4B93 A;  1MZU A;  2L1M A;  4ARZ B;  1XJ6 A;  3VV4 A;  3BW6 A;  3R4K A;  5HDC A;  2D02 A;  4GS9 B;  1F9I A;  1OTB A;  3KSH A;  5A8B A;  2LB9 A;  4UEY A;  2JHE A;  2V1B A;  3GEC A;  4HP4 A;  3T4L A;  4RQ9 A;  2WKR A;  1TS6 A;  3E98 A;  2VX8 A;  1YKD A;  2A24 B;  3RFB A;  3DBA A;  1V9Z A;  1OPX A;  4IUH A;  2W3G A;  5F6A A;  3TW8 A;  2GNX A;  1YSP A;  4KUO A;  4KQD A;  4L9G A;  4LPZ A;  2FH5 A;  4MMN A;  4R70 A;  3FG8 A;  1DP8 A;  2ZMF A;  2PDR A;  4NXB A;  1OT9 A;  2OWJ A;  3JVU A;  2FZ0 A;  5TBM B;  4MDZ A;  3U2A A;  1NRJ A;  2VZW A;  3BY9 A;  1EW0 A;  3VOL A;  2VGL S;  5HWT A;  4HIA A;  3LR4 A;  2Z6C A;  2OAP 1;  5J7E A;  4NXG A;  2OAQ 1;  1TD5 A;  3LFV A;  5G4Y A;  1N9N A;  2PR6 A;  4F3L A;  2V0U A;  2Y8H A;  1P9W A;  4WEJ A;  1LL8 A;  3PXP A;  3RH8 B;  2W3F A;  2W1T A;  4KUK A;  2HJ9 C;  3T4S A;  5F5Y A;  1OJ5 A;  4ARZ A;  4M4X A;  4WUJ A;  4BMW A;  3LIE A;  1DP9 A;  5F69 A;  3H82 B;  1BYW A;  3LIC A;  4HHD A;  1F98 A;  3C30 A;  1S1Y A;  3UME A;  3S7P A;  1ZHH B;  1T1A A;  1GSV A;  3C2W A;  1T1B A;  2HF6 A;  4HJ4 A;  3UB7 A;  5HZH A;  3LUQ A;  3LIB A;  4G3W A;  1TF1 A;  5IT5 A;  5K5B A;  5DKK A;  5HPI A;  2ZOI A;  2Z6D A;  3PBR A;  3E4O A;  3LID A;  3OCN A;  3CUE C;  5LBR A;  3B42 A;  1DRM A;  3LR5 A;  1GSX A;  4MN7 A;  2I9V A;  3CI6 A;  3BJN A;  4NKP A;  3KSG A;  4QPR A;  4GS9 A;  4LRX C;  5I5L A;  2XSS A;  5J4E A;  1LSW A;  2CMN A;  3C8C A;  4EUV A;  4I3A A;  2EWV A;  4JGO A;  2GJ3 A;  3KSF A;  2O99 A;  3IBJ A;  1N9O A;  1VHM A;  2EWW A;  4IUK A;  2L0W A;  3EQU A;  3UB8 A;  3UE3 A;  2BAS A;  3PYP A;  2W3D A;  4IJG A;  3P7N A;  3OBF A;  2KLI A;  1S4S A;  4FOF A;  4Q0J A;  1GSW A;  3EQV A;  3EGX C;  4LRZ E;  4GCZ A;  3LIA A;  3H7W A;  1JNU A;  2ZMV A;  4H6J B;  5MC7 A;  1XJ4 A;  3K3D A;  3UE6 A;  3O5Y A;  3BQA A;  4HNB A;  5IU1 A;  3PBN A;  3F1N B;  4NXE A;  4EEU A;  3K2N A;  2JKR M;  1OJG A;  2VV7 A;  3EEH A;  1OTD A;  4XT2 B;  3TE8 A;  2EA9 A;  4WEL A;  1NLZ A;  2PR5 A;  3R7W A;  4BBT A;  2B02 A;  3CWF A;  4EW7 A;  3TRC A;  3PBQ A;  4WL9 A;  2JKT M;  2NUP C;  4GW9 A;  3MFX A;  3T4J A;  2XRO A;  3KYZ A;  1XFN A;  3OLO A;  2W1T B;  3E4Q A;  3NHQ A;  1W63 Q;  2J3T D;  2YKF A;  4CLC E;  1D06 A;  4LLO B;  4BWI A;  2W3H A;  1TS0 A;  2KOI A;  1NWZ A;  4BBU A;  3MQO A;  4GLQ A;  4AFI A;  4FSF A;  4ZRR A;  4E04 A;  4YWZ A;  3BQ8 A;  3H9W A;  2M7V A;  1V9Y A;  5KSH A;  4GJ4 A;  4O01 A;  5TBM A;  3MXQ A;  4HH2 A;  4H6J A;  4WEK A;  3E0Y A;  4LRY C;  2W1R A;  1IOU A;  4PHT A;  1XFQ A;  2W3E A;  3A0V A;  4PKY G;  1LSX A;  3MR0 A;  5FL3 A;  3F1N A;  2VKS A;  2VGL M;  4HH3 A;  1STZ A;  4EER A;  4DMZ A;  4F3L B;  5HWW A;  2V1A A;  4HP9 A;  3PBS A;  2ZOH A;  3E4P A;  5HSQ A;  2Y79 A;  4KQO A;  3R7W B;  3BY8 A;  4EEP A;  1UWP X;  2DMW A;  2LB5 A;  3T4K A;  4PAU A;  1OT6 A;  1F5M A;  4P6Z M;  3JVV A;  5CX7 A;  2QWS A;  3H82 A;  2IA2 A;  2QHK A;  5TJJ A;  3CIT A;  1P9R A;  3KSI A;  4L9F A;  5IS1 A;  1D7E A;  4MN6 A;  5AVF A;  2J3T C;  1MC0 A;  4XT2 A;  2O0Y A;  3UMD A;  4CLC C;  1S4R A;  3ICY A;  2HGV A;  4R38 A;  1T1C A;  4WLA A;  3IS2 B;  3A0S A;  3F1O A;  1KOU A;  2V9A A;  1XJ2 A;  2V0W A;  2MJ6 A;  4OOL A;  3W2Z A;  4CLC D;  4HQA A;  2PYP A;  3HJK A;  3IS2 A;  2WKQ A;  5DFX A;  4DN0 A;  3F1O B;  3OC2 A;  2O9C A;  3ULF A;  3GDI A;  4BJP A;  1T18 A;  2OWH A;  3MMH A;  4HJ3 A;  1YSQ A;  5DJT A;  3ZQ5 A;  5G4Z A;  5HPF A;  4R3A A;  4JGR A;  2KX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...