1V9YA

Crystal structure of the heme pas sensor domain of ec dos (ferric form)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
113
structure length
103
Chain Sequence
GIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNRERELQLEKKDGSKIWTRFALSKVSAEGKVYYLALVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Heme pas sensor protein
publication title A redox-controlled molecular switch revealed by the crystal structure of a bacterial heme PAS sensor.
pubmed doi rcsb
source organism Escherichia coli
total genus 31
structure length 103
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2004-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1v9yA00
1GSVA 4I3IA 2D02A 4DJ3A 3SW1A 1DP8A 1JNUA 5HWTA 3HJIA 4K08A 4L9EA 5HDDA 4GS9A 1P97A 4BBVA 2P7JA 2HV1A 2V0UA 3BY8A 2WKPA 2VV6A 3BWLA 4JGOA 3UB9A 4E04A 1LSVA 1T1AA 2WKQA 1X0OA 4HJ6A 3ULFA 3EEHA 2YKHA 4WUJA 4F3LB 4EETB 4HHDA 3F1PB 3MQOA 4HH2A 4GCZA 4HJ4A 4PKYA 5J7EA 3B33A 3MJQA 4YWZA 3MQQA 1T18A 2QWSA 3ICYA 1XJ2A 4H6JB 2H28A 2KX6A 1OJ5A 1T1CA 1UWPX 4NXEA 1XJ3A 4DJ2A 4L9FA 4HNBA 1KOUA 3LI8A 3MFXA 5F69A 3VE4A 3KX0X 2L1MA 3F1OB 4EW7A 4HP4A 3E4OA 3LIDA 5EFWA 2WKRA 3RTYA 4I5SA 2V1AA 1ODVA 3UB7A 3F1NA 5DJTA 4PKYG 4MN5A 1XJ6A 2JHEA 1UWNX 5F68A 3E4QA 5F5YA 3LYXA 4GHIA 4HY8A 3NOPC 1DP6A 3A0RA 3C8CA 4HQAA 3CLOA 3UB8A 1EW0A 1OT6A 5HD5A 3UB6A 2QKPA 2R78A 3BY9A 4NXGA 1V9ZA 4EQ1A 2CMNA 1OTEA 1F98A 3H7WB 3IBRA 4HI4A 3MXQA 4XT2B 5DKLA 5DKKA 3H82B 1S4SA 1T19A 2ZOIA 3LI9A 5TBMA 3C2WA 3UE6A 5HWWA 2PD8A 3LIEA 5HZHA 1TS7A 1OT9A 4WN5A 3A0SA 1D7EA 2V1BA 4NXBA 3UMEA 4R70A 1LT0A 1F9IA 1S4RA 4KUOA 3E4PA 3EWKA 2OWHA 5G4ZA 3NOUC 4LRZE 1N9LA 3GDIA 4R3AA 2D01A 4I3AA 1UGUA 4EEUA 3A0VA 4B9OA 1MZUA 4RQ9A 5HDSA 1LL8A 2Z6CA 2OOLA 2QJ7A 4BBUA 4F3LA 3F1PA 2PYRA 4EEPA 2PR5A 4H6JA 1OTAA 2A24B 5AVFA 4EERA 1TS6A 3NOTC 3IS2B 4WL9A 3UMDA 3VE3A 5KIZA 2VV8A 1OTBA 2PHYA 1V9YA 3F1OA 1TS0A 1S1YA 2VLGA 2M1CA 1OTDA 4HOIA 4LRYC 4HH3A 5HWVA 4EXOA 3H9WA 1XFQA 3G6OA 3ZQ5A 1DP9A 2QHKA 5I5LA 4GS9B 4KQDA 3MR0A 4NXFA 2INWA 2PDRA 3FC7A 5HSQA 5J3WA 2BASA 2JN7A 2I9VA 1P0ZA 3GECA 2L4RA 3OLOA 1OTIA 3PHYA 4JGRA 3T50A 2V0WA 2VEAA 2YKFA 4BBTA 1OJGA 2L0WA 1TS8A 1NWZA 4R6LA 1LSXA 5AVEA 1G28A 4JGQA 3LUQA 4LRXC 5HDCA 4WLAA 3H7WA 2VV7A 3LIAA 4WF0A 3CAXA 3RH8B 1S1ZA 4JGPA 4XT2A 5IS1A 3H82A 4KUKA 5IU1A 1GSWA 1VB6A 2Z6DA 3LIFA 2V9AA 2ZOHA 2W0NA 1N9OA 1D06A 2W27A 5DJUA 2ZBBA 4GW9A 4I38A 3NHQA 4EESA 4MN6A 3CWFA 1LSWA 5HD3A 3PYPA 2K7SA 1WA9A 4M4XA 3K3CA 1N9NA 4HIAA 5G4YA 1XJ4A 3D72A 4HJ3A 1S66L 2PR6A 4I39A 3F1NB 1S67L 4LLOB 2EA9A 2B02A 3LIBA 1GSXA 3HJKA 2PYPA 1T1BA 4GHIB 5F6AA 3K3DA 3LICA 5J4EA 4LPZA 2GJ3A 1BYWA 5A8BA 1XFNA 2A24A 2QJ5A 1Y28A 3VOLA 3P7NA 3IS2A 2KDKA 2OWJA 4HP9A 4I3JA 2PD7A 3NJAA 3FG8A 2J80A 1DRMA 4R38A 5TBMB 4L9GA
chains in the Genus database with same CATH superfamily
4B4ZA 4I3IA 4C6YA 2ZC6B 5E2HA 5HWTA 1Z09A 2EFUA 3FZCA 1IEMA 5FDHA 3BY8A 3TJZC 2EXBA 3KSFA 4G3KA 1XA7A 3BWLA 4Q0HA 3BW6A 3FKVA 5TJJA 3U2AA 3UB9A 3RXWA 2ZLYA 2H5SA 4E04A 1IYOA 1LSVA 1T1AA 2WKQA 4WZ4A 4A5RA 3GQZA 4DE3A 3O3VA 3MZDA 2VGLS 5TGFA 4E3NA 3KYEA 2YKHA 4WUJA 2EX6A 4UEYA 4CJNA 1LI0A 3DTEA 2XSSA 5F1GA 4Y5FA 4EETB 3S1YA 4CQHA 1PWCA 2WGWB 4HH2A 1W63M 4HJ4A 3IF6B 5J7EA 3B33A 3MJQA 4QY6A 4JF4A 4S2MA 2ZQCA 3ICYA 1XJ2A 2R9XA 2XEPA 2H28A 3GR2A 3PAGA 1UWPX 3BFCA 4DJ2A 1KOUA 4FH2A 3KX0X 2EX9A 4KZ9A 3SZTA 2L1MA 1TD5A 5C5KA 4II7A 2E8JA 4EW7A 1YM1A 4KQRA 2Y2OA 3E4OA 2XH9A 3HBRA 5CGWA 2JKRM 3WWXA 1I5QA 1OMEA 2V1AA 5JYOA 4EBLA 2WADA 4UHUA 3MKFA 5DJTA 3Q7ZA 4P87A 3IWQA 4E3KA 2HP9A 3UE1A 3W2ZA 4Q0IA 5F68A 3E4QA 3B42A 4CLCB 3LEZA 3LR5A 2WKHA 4E3MA 2HGVA 2M7VA 4Q8IA 3CLOA 3PBRA 5HD5A 2ZMVA 3BQAA 3UDXA 2AVXA 2XFSA 3BY9A 2O9BA 5EVIC 3BYDA 4OVDA 5FAQA 4EQ1A 2CMNA 4QWOA 5TFQA 3IBRA 3T4OA 3PBNA 3P09A 3HLWA 4OOYA 1XGIA 1HD8A 4KZ3A 3MXQA 4DXBA 5DKLA 3LI9A 5TBMA 4ZJ2A 3C4OA 1E4DA 3UE6A 3PBQA 2V1ZA 3T1QB 3TE8A 3OCNA 4JBFA 2V1BA 3UMEA 1LT0A 4IUKA 3G2ZA 1C3BA 2HPBA 1Y54A 1F9IA 5FAPA 4KUOA 3EWKA 2Y2HA 2ZM0A 1M40A 1P9WA 3GV9A 3FWLA 5EV0A 4G3VA 4R3AA 1CK3A 3MXRA 2XK1A 4U0TA 2ZC3B 3IQAA 1UGUA 1ESIA 4EEUA 3A0VA 2C6WB 1E25A 4KZ5A 1LL8A 3N4IA 3M6HA 3T1SA 3W8KA 4YOFA 3AGEA 4LCLA 2WGWA 1LL9A 2Y4AA 3IF6A 4B4XA 4S2OA 4ARZB 2ZC4B 1FOFA 4M3KA 4ZJ3A 2WZXA 1OTAA 1NLZA 5L2FA 3HUNA 3NOTC 2G2UA 3IS2B 4C75A 3NCKA 4R4RA 1OTBA 2PHYA 4OLGA 1YAXA 3Q7VB 1NYYA 1S1YA 4ZJ1A 1ES2A 4GB7A 4ETXA 2XA7M 2W3HA 5M1AA 3V39A 2Y59A 3HLFA 3T4LA 2X71A 4HH3A 4EXOA 2A2LA 1DP9A 3IWIA 4GS9B 5EECA 4GJ4A 1Q2QA 3OPLA 4NXFA 5FQKA 5HSQA 4WEJA 1SKOB 4JPMA 5DVAA 3ZG9B 2JN7A 3EQVA 4CLCA 5HW3A 4PHTA 1N9BA 3PHYA 1RGYA 3T50A 5CGSA 5LBRA 2VEAA 3R4KA 2Q0OA 4NETA 5L8MA 1NWZA 4FCFA 2XQZA 4QJGA 4YINA 3S7OA 2JCHA 1KGGA 3LUQA 4LRXC 3AGDA 4X69A 3GVBA 1KE0A 4ID4A 4BWIA 3C30A 5EUAA 4QD4A 2ZJ9A 4UAAA 4JGPA 5IS1A 4KUKA 4BD1A 2XFTA 5IU1A 2Z6DA 4RA7A 2I72A 3EQUA 3DTKA 5EOOA 3VFHA 5F82A 1TDGA 5HAIA 2J9OA 3D9YA 2JKTI 5DJUA 5FI2A 2P08A 4EESA 1K38A 5IT5A 3CWFA 1LSWA 3PYPA 1E3UD 1WA9A 2A3UA 4PM7A 1TDLA 5G4YA 1XJ4A 4Y15A 3HUOA 2HP6A 3V67A 3WS1A 1S67L 3DW0A 2EA9A 4X56A 2VKSA 3MZEA 4IUHA 4EUZA 4OKPA 5E2GA 2XROA 2V20A 2ZQAA 1IKGA 4S2JA 2MJ6A 3BLSA 1MWRA 2PYPA 4GHIB 4KZ6A 2WGIA 5AQ7A 1K57C 4EV4A 3CZDA 4K91A 3M6BA 1IOUA 3DWZA 4FTXA 2R9WA 2Y2NA 3SS4A 3IH8A 4ARZA 1ZKJA 2W3DA 3NDEA 1XFNA 2QJ5A 4BLMA 3CG5A 5J8XA 1JVJA 3IS2A 5EE8A 4HP9A 1CEFA 1K56A 2PD7A 5AQ9A 3NJAA 1P9RA 1FR6A 3Q7VA 1PI4A 1S0WA 2H0TA 2J80A 5A92A 1IFQA 1GA9A 4WELA 3HVFA 1JTDA 2D02A 1EROA 1VQQA 2NUTC 2JKTM 1JNUA 3ZG5A 1IELA 3IBJA 4GS9A 4BBVA 1G6AA 2P7JA 3KSGA 5CTNA 5EOEA 1XPBA 5D3OA 4KZBA 4JXSA 1SKOA 1YLYA 1IYPA 3BJNA 3G34A 4RVAA 5FQQA 3ZHHA 4XUZA 1H5XA 1LI9A 1PIOA 5FQIA 1PW1A 2HP5A 1TEMA 4BJPA 2OLVA 4GZBA 1X0OA 3ULFA 3Q07A 4O8GA 1BLHA 5F1FA 4P6ZS 3WRZA 3HL9A 4JF6A 1ZHHB 4JF5A 2WZZA 4MN7A 4GCZA 4OQ0A 3GTCA 2XRNA 1ACFA 5EVIB 1T1CA 4NXEA 1XJ3A 4KG2A 3T4QA 2ZQ8A 2JC7A 5FASA 5HAPA 4JXVA 4ZBEA 3VSKA 4R3BA 3ZG7B 3TSGA 4QHCA 4E3OA 2P74A 2BLSA 4GOGA 1W8QA 4I5SA 1ODVA 1NLYA 3UB7A 1VHMA 3WS4A 3KSHA 4MN5A 1XJ6A 3OPPA 1FSWA 4Z9QA 2O9CA 3NIAA 1DJAA 3VV4A 3VP3A 5F5YA 5HARA 1BTLA 1HTZA 3C38A 1I2SA 3HCYA 5GLBA 3D4FA 4S2PA 3IH9A 3IXBA 4GHIA 4N92A 3EOIA 4N9LA 3WS0A 4EU0A 5HPFA 3C8CA 4N1XA 4C3QA 1H8MA 2XD5A 1OT6A 5E2EA 2JKRI 2WUQA 2QKPA 5L10A 5GHXA 4OOMA 2J9PA 2R78A 4UA6A 5FI7A 1YLTA 3O87A 4GN2A 3G35A 3VOYA 2V2FF 1YSQA 3H7WB 4D60A 3MFDA 1RP5A 1FQGA 4HI4A 3HUMA 4OPYA 5CX7A 1SHVA 2PU2A 1T19A 3QHYA 4NEED 3B3XA 4OPRA 3C2WA 2M7UA 3MXSA 2J3TD 2PD8A 3LEQA 4IJGA 3CPTB 3PBTA 5HZHA 3MF0A 3BECA 3T12B 3FYZA 4WN5A 2B18A 4OP5A 2EWWA 4PM9A 3E4PA 2WKEA 3FPWA 5G4ZA 4KQOA 3NOUC 1MKIA 4KENB 4YFMA 2D01A 4I3AA 3HLCA 3E2KA 4YNRA 5CEBA 3E0YA 3A3IA 4S2NC 4UA7A 1CF0A 2UV0E 2JKFA 4H8RA 2PYRA 1O7EA 2PAVP 2A24B 3DTMA 1TS6A 1KGEA 3UE3A 3IXGA 5EVIA 2XD1A 4WMCD 5FEGA 5EM1A 5KIZA 1CQAA 3G31A 1PRQA 3C7UA 3EGDC 2UWXA 5DF7A 4O01A 1NY0A 4IVKA 1FSYA 4JLFA 1TS0A 1XXMA 1SKFA 4GD8A 3G32A 1EI5A 2VLGA 1OTDA 1WE4A 5FAOA 1XFQA 4KG5A 3UPNA 1BLPA 1ZTUA 5TR7A 1LHYA 2C5WB 3G6OA 4P6BA 2QHKA 5I5LA 4B93A 2PDRA 3FC7A 1GHIA 2ZQDA 2GNXA 4OP8A 3Q82A 1PI5A 1P0ZA 1GHPA 4EWFA 3GECA 5CHJA 1N4OA 2V0WA 3S7QA 4KZAA 3HLDA 4FUWA 2Y55A 4R6LA 4WZ5A 3BQ8A 4RX3A 4JGQA 5EVEA 2VJWA 1YLJA 4EUVA 1K55C 1I2WA 5HDCA 3VP1A 3H7WA 1IYSA 1H8ZA 2P04A 3LIAA 3GSGA 3CAXA 4WF0A 1S1ZA 1YPRA 3RH8B 1QMFA 1IYQA 3UN7A 1GSWA 1VB6A 3E2LA 4R3JA 3LIFA 4QU3A 3VMAA 4S2IA 2G7UA 1N9OA 5MC7A 3TRCA 5CTMA 3CPTA 2ZBBA 4WZ5C 4I38A 3NHQA 5M19A 3LR4A 4MCWA 3SS5A 5HD3A 4FD8A 3QNBA 4ZDXA 4M4XA 1AWIA 3QP6A 2IA2A 1N9NA 3O86A 4HIAA 4X6TA 5CXWA 3BRMA 5U47A 1S66L 2PR6A 3CHWP 2HF6A 3DBAA 3V50A 4LLOB 4B88A 1MY8A 3ZVTA 1E3UA 3L7HA 2B02A 1SDNA 3LIBA 4L0LA 3MMHA 1GSXA 2W3FA 4U3TA 1ALQA 1KGFA 5F6AA 3JVUA 5M18A 2K31A 2J8YA 1W7FA 4LPZA 2GJ3A 4Y0TA 1BYWA 2IWCA 3LY3A 3A3EA 1H0MA 2BTFP 5A91A 2A24A 1TVFA 2XF3A 3U4LP 4IHQA 1Y28A 3VOLA 3P7NA 5HL1A 3L9KA 2KDKA 1G68A 3FG8A 3ZDJA 4PPRA 4XXRA 1K0KA 4R38A 1FCNA 4L9GA 3FPVA 3NDGA 1GSVA 1DY6A 4K0XA 4X55A 3D3OA 1DP8A 5JYPA 4K0WA 5FI6A 4MNRA 3ZNYA 4JXWA 1LLBA 4L9EA 3VOZA 5GHZA 4OOLA 1P97A 3FV7A 3MSHA 1MKMA 4ETZA 2J7VA 2VV6A 3JVVA 3VP2A 2Y79A 2WKIA 1YLZA 4UQIM 3N6IA 1K6RA 3IWOA 4HJ6A 2ZM8A 1STZA 3EEHA 1YT4A 1ONGA 2EX8A 1CJFA 3M2KA 4RYEA 5L07A 1W8YA 5EPHA 3T4SA 4UA9A 3WS5A 4E6WA 2FH5A 2LB5A 1BZAA 1K57A 4GKUA 4HHDA 5HFOA 3F1PB 4P0MA 4GDNA 4PKYA 2J3WA 2P9VA 3MQQA 2HJEA 2QWSA 3SH9A 1BULA 2KX6A 3G30A 4Y2FA 4OONA 2H10A 3ISGA 4L9FA 4HNBA 1LL5A 3MFXA 4BMWA 1L2SA 4XUXA 1MWSA 4O7DA 4HP4A 1K25A 3LIDA 4WM9A 1Q2PA 3AGFA 5EFWA 3W4QA 3HLEA 3RTYA 3IHBA 1CI8A 5CHMA 1YKDA 1NRFA 4S2KA 5DTTA 4DE2A 3UO9A 2JHEA 5AQBA 5DF8A 4S2LA 2VZWA 2W3GA 3M2JA 3OPHA 3HLBA 2W1TB 2ZL1B 3LYXA 2B5RA 1KE4A 3MQ0A 4X1MA 2XA7S 4DRTA 2FFFB 4HY8A 1DP6A 3UDFA 1CI9A 3NY4A 5K5BA 2HDSA 3ZYTA 3T1RA 1H8YA 3A0RA 4AFIA 4CLCD 3UB8A 3UB6A 1XX2A 3VFFA 3EEAA 4X25A 3GMWA 4BQMA 3KYZA 3QNCA 5EVLA 1O07A 2E8IA 4NXGA 2G2WA 1V9ZA 5FSRA 5IHVA 4ME4A 1NYMA 1RGZA 4E6XA 3IX4A 4XT2B 4OQHA 2WAFA 1PWGA 3H82B 1S4SA 2OAP1 2ZOIA 2XLNA 4BD0A 1NZUA 2HZ5A 1BLCA 5GLAA 2HDRA 4OQIA 3LY4A 2Z2LB 1HZOA 3BFFA 3MBZA 3UY6A 4ZRRA 2X01A 3OC2A 1K4EA 5A90A 4ESPA 1TS7A 1U60A 2Q9MA 2BG1A 3T4TA 1OT9A 4IEDA 3G4PA 3A0SA 4OPZA 3LGOA 2OSUA 4X53A 3JYIA 2VGLM 1CEGA 3LR0A 4LV3A 4R70A 3VSLA 5HPIA 3V5MA 4IBXA 4CPKA 3OZHA 2OWHA 3CUEC 2DNSA 4LRZE 3O5YA 4QPRA 2OV5A 5FDSA 3NULA 2VX8A 4OH0A 2ZMAA 2QYBA 1ERMA 2Y2LA 1HVBA 4O0PA 4B9OA 5CEDA 1KE3A 4Q0JA 3QP8A 5HDSA 1PFLA 3BFDA 2ZMFA 4N9KA 2QJ7A 4BBUA 5KSHA 2J3TC 3S22A 1MC0A 2QPNA 3F1PA 3RJUA 3JPUA 4EEPA 3TW8A 1G6OA 4DKIA 5AVFA 4EERA 3LR3A 3SH7A 3VP4A 1F5MA 1YMXA 3UMDA 2HJ9C 1XKZA 4BL2A 2FZ0A 4LCMA 2ZC7A 2DCFA 4NK3A 1DJBA 4MBFA 1K56D 3PBSA 1L3LA 1XA1A 5AQAA 4X68A 1FCOA 2M1CA 1ES3A 4WMCA 1YQSA 3IHAA 1W79A 4LRYC 3H9WA 2Y2PA 5DF9A 1W5DA 1YLWA 2Y2IA 3PXPA 4CLCE 3MR0A 5J3WA 3UPPA 4HESA 2W1TA 2ZL1A 2BASA 2I9VA 3PBOA 4PM5A 1BUEA 2L4RA 3ZG0A 3OLOA 5DTKA 1NZOA 4BBTA 3N8LA 3A3JA 3S7PA 1DJCA 4E3LA 1G28A 3K2NA 3KYQA 3N8RA 5CERA 2PRFA 3MKEA 4S2NA 2GDNA 2VV7A 2ACGA 2ZQ9A 4XT2A 1L0GA 3H82A 1Y4OA 3T1XA 3C4PA 4HBTA 4OPQA 2A49A 4QB8A 3EGXC 1D06A 2CC1A 5CGXA 3Q1FA 1GA0A 4DDYA 2W3EA 4MBHA 4MN6A 2O0YA 3CJMA 2K7SA 3DAVA 4KZ8A 4LV0A 2Z2MB 3K3CA 3D72A 4HJ3A 5HAQA 4IVIA 3OPRA 4Y7PA 2VGJA 4RX2A 3BEBA 4N1HA 5A93A 3F1NB 3FKWA 3ZVWA 3I7JA 4FOFA 5KSCA 2PBYA 1PNEA 3HJKA 5KZHA 1A0KA 3S7NA 1T1BA 5DFXA 3IT9A 3NI9A 2PBDP 3R7WB 5J4EA 2HDQA 5GLCA 4ZTKA 4Y3IA 5HL6A 1VEUB 3UDIA 3SOIA 2O99A 1K55A 2ZM2A 4PMAA 1PW8A 3V3SA 2Y2MA 4MEZA 2NUPC 1BT5A 4KZ4A 5EM0A 4EBPA 1DRMA 5BOHA 3WS2A 1PZOA 1FILA 3KO6A 3QP2A 5I94A 4Z1WA 4DJ3A 3SW1A 5HX9A 5CHUA 3W4OA 3HJIA 4K08A 3IXHA 5HDDA 4KG6A 1BLSA 2HV1A 2V0UA 4LFUA 1L0EA 4DE0A 1Z6FA 5FQJA 1FCMA 3KSIA 5G18A 5FA7A 3LCEA 2WKPA 4LENA 4JGOA 3A3DA 3O88A 2LB9A 4OQGA 2Y2QA 2P9VB 4MMNA 3T4KA 1PWDA 4BENA 4EBNA 1NXYA 5FL3A 2WGVA 1ZG4A 1BSGA 2WK0A 1MBLA 5AJGA 2VK3A 3MS6A 3UE0A 3N7WA 4ZAMA 3IXDA 3HREA 4FSFA 4PAUA 4F3LB 1S6RA 3BLMA 3ITAA 1SCWA 3MQOA 3VP0A 1NRJA 2Y2KA 5E2FA 3PR6A 1SZVA 4YWZA 3BFEA 1T18A 2QZ6A 3C7VA 4H6JB 5FQ9A 1OPXA 3NECA 3CMZA 1ONHA 2XDMA 4DXCA 1AXBA 1OJ5A 2EX2A 1ES4A 4GNUA 3PAEA 5EVID 3LI8A 5F69A 3VE4A 3IF5A 4U0XA 3N8SA 3F1OB 4QY5A 4LV2A 1K4FA 1ERQA 2Y2JA 4D2OA 3RXXA 2RL3A 4DE1A 2WKRA 1QMEA 1KDSA 4HBUA 2V8FA 4HEFA 3F1NA 3T4JA 4PKYG 3W4PA 4NG2A 1MXOA 2GZAA 3S4XA 1FIKA 1W63Q 2EXAA 1UWNX 2VGKA 4DF6A 4GLQA 4GD6A 1JWPA 3LO7A 2OAQ1 1M6KA 2IWDA 3ZGAB 3NOPC 2H0YA 2IWBA 3ZCZA 1PYYA 4HQAA 3ZFZA 3IF6C 3NBLA 1EW0A 3R7WA 1JWVA 4PM6A 1VEUA 1J3WA 4BL3A 1YMSA 5FEFA 3C5AA 3A3FA 1J9MA 1OTEA 1F98A 1KVLA 4WYYA 3PTEA 4Y13A 3UNWA 5CRFA 4E3JA 2EFXA 4X1LA 5DKKA 4R23A 4P85A 4KQQA 2EWVA 2VA0A 1L0FA 3CI6A 3BFGA 5HWWA 3LIEA 5L09A 3ZG8B 2Q9NA 1KVMA 2DRWA 3V3RA 3UB5P 5E43A 1D7EA 3TG9A 4NXBA 4Y0OA 1ESUA 1ZG6A 4P6ZM 2QMIA 1S4RA 4CLCC 3MZFA 3B47A 1N9LA 3GDIA 1XP4A 1K54A 2HDUA 5FQMA 2WAEA 3WRTA 1KDWA 1F2KA 2XGNA 3E98A 4F94A 5GL9A 1MZUA 4RQ9A 4WEKA 1MWUA 4LV1A 1IKIA 2Z6CA 2OOLA 1VETB 2W1RA 4F3LA 2GX5A 3OCLA 1WYBA 3IX3A 2Y8HA 4NKPA 2JBFA 4DDSA 3OOVA 4FH4A 2PR5A 2O9AA 4H6JA 1K54C 4E3IA 1NJ4A 4WL9A 3VE3A 2VV8A 4PM8A 4R4SA 1V9YA 3F1OA 1ES5A 1L0DA 4MDZA 3LFVA 1RCJA 3SS3A 4GDBA 4JKTA 2WYXA 1EWZA 4HOIA 5HWVA 3DWKA 3ZQ5A 2JKGA 3RFBA 1K6SA 4LGWA 4KQDA 2INWA 4OLDA 5GLDA 3ZNTA 3BM6A 5CECA 2ZQ7A 2FFYA 1D1JA 1OTIA 4MLLA 3CUEA 4JGRA 2YKFA 3Q81A 1G5UA 1OJGA 2L0WA 1TS8A 1LSXA 2ZD8A 5AVEA 2KLIA 3IX8A 4JXGA 3HLGA 2X02A 3ITBA 1VM1A 4WLAA 1ZC2A 3QP5A 2JE5A 1MPLA 1YSPA 2PU4A 1GHMA 4G3WA 2V9AA 2DMWA 4UQIS 2ZOHA 3SH8A 5KMWA 2W0NA 2W27A 4Y0UA 3GRJA 4GW9A 1YLPA 4WBGA 4MBKA 3QP1A 3NC8A 4R0QA 2RCXA 2Y2GA 2KOIA 3QP4A 2Y91A 1SDEA 2XR0A 4EQIA 4IBRA 1FR1A 4KZ7A 5FATA 4I39A 1JTGA 3DTIA 3G2YA 1GCEA 3P01A 1TF1A 4R1GA 1WYCA 2ZC5B 4DN0A 3P98A 2OLUA 2K2NA 5DFYA 1VETA 2V8CA 5F83A 3K3DA 3OBFA 5DTSA 3TOIA 1MWTA 3CITA 3LICA 2B95A 3UPOA 5A8BA 4Y17A 1XGJA 2OWJA 1HLUP 4I3JA 5GHYA 1PZPA 1H3QA 4DMZA 2PT7A 1JWZA 5TBMB
chains in the Genus database with same CATH topology
1GSVA 4WELA 4I3IA 3KO6A 2D02A 4Z1WA 3D3OA 4DJ3A 3SW1A 2NUTC 2JKTM 1DP8A 1JNUA 5HWTA 3HJIA 3IBJA 4K08A 4L9EA 5HDDA 4GS9A 4OOLA 1P97A 4BBVA 2P7JA 3KSGA 2HV1A 2V0UA 3BY8A 3TJZC 1MKMA 3KSFA 4G3KA 4ETZA 3KSIA 3BJNA 2WKPA 2VV6A 3BWLA 4Q0HA 3BW6A 3JVVA 4JGOA 5TJJA 3U2AA 3UB9A 2LB9A 2Y79A 4MMNA 4E04A 3T4KA 1LSVA 4BJPA 1T1AA 4UQIM 2WKQA 5FL3A 1X0OA 4HJ6A 3ULFA 1STZA 2VGLS 3EEHA 5AJGA 4O8GA 4P6ZS 2YKHA 3T4SA 4WUJA 4UEYA 2XSSA 2FH5A 2LB5A 4FSFA 4PAUA 1ZHHB 4Y5FA 4EETB 4F3LB 4HHDA 4CQHA 3F1PB 4MN7A 3MQOA 4HH2A 4GCZA 1NRJA 1W63M 4HJ4A 4PKYA 5J7EA 3PR6A 3B33A 3MJQA 2J3WA 4YWZA 3MQQA 1T18A 2HJEA 2QWSA 3ICYA 1XJ2A 4H6JB 2H28A 1OPXA 2XRNA 2KX6A 4Y2FA 1OJ5A 1T1CA 1UWPX 4NXEA 1XJ3A 3T4QA 4DJ2A 4L9FA 4HNBA 1KOUA 3LI8A 3MFXA 5F69A 3VE4A 3KX0X 4BMWA 2L1MA 3F1OB 1TD5A 5C5KA 4II7A 4EW7A 4HP4A 3E4OA 3LIDA 2JKRM 5EFWA 2WKRA 3RTYA 4I5SA 2V1AA 1ODVA 1NLYA 3UB7A 3F1NA 1VHMA 5DJTA 3T4JA 4PKYG 1YKDA 2GZAA 3KSHA 4MN5A 1XJ6A 1W63Q 2JHEA 2VZWA 2O9CA 2W3GA 1UWNX 3W2ZA 3VV4A 4Q0IA 5F68A 4GLQA 3E4QA 5F5YA 3C38A 2W1TB 3HCYA 2OAQ1 3LYXA 3B42A 4CLCB 3LR5A 3MQ0A 2XA7S 4GHIA 4HY8A 3NOPC 1DP6A 2HGVA 2M7VA 5K5BA 3ZYTA 3EOIA 3A0RA 4AFIA 4EU0A 4CLCD 3C8CA 4HQAA 5HPFA 3CLOA 1H8MA 3UB8A 3R7WA 1EW0A 1OT6A 3PBRA 5HD5A 2JKRI 3UB6A 2QKPA 2ZMVA 3EEAA 3BQAA 4OOMA 3KYZA 2R78A 3BY9A 4NXGA 2O9BA 1V9ZA 4ME4A 4EQ1A 2CMNA 1OTEA 1YSQA 1F98A 3H7WB 3IBRA 3T4OA 3PBNA 4HI4A 5CX7A 3MXQA 4XT2B 5DKLA 5DKKA 3H82B 1S4SA 2OAP1 1T19A 2ZOIA 4NEED 3LI9A 5TBMA 2EWVA 2VA0A 3C2WA 2M7UA 3UE6A 3CI6A 2J3TD 5HWWA 2PD8A 3LIEA 4IJGA 3PBQA 4ZRRA 3OC2A 3TE8A 3PBTA 5HZHA 3MF0A 1TS7A 3T4TA 1OT9A 3OCNA 4WN5A 3A0SA 2B18A 1D7EA 2V1BA 4NXBA 2VGLM 3UMEA 3LR0A 2EWWA 4R70A 1LT0A 5HPIA 4IUKA 4P6ZM 1F9IA 1S4RA 4KUOA 3E4PA 3EWKA 4CLCC 2OWHA 3FPWA 5G4ZA 1P9WA 3CUEC 4KQOA 3NOUC 3B47A 4LRZE 3O5YA 1N9LA 3GDIA 4G3VA 4QPRA 4R3AA 2D01A 4I3AA 2VX8A 2QYBA 1UGUA 4YNRA 4EEUA 3E98A 4O0PA 3A0VA 4B9OA 3E0YA 4Q0JA 1MZUA 4RQ9A 4WEKA 5HDSA 1LL8A 2Z6CA 2OOLA 2ZMFA 2W1RA 4YOFA 2QJ7A 4BBUA 4F3LA 5KSHA 2GX5A 2J3TC 1MC0A 3OCLA 3F1PA 2PYRA 2Y8HA 4NKPA 4EEPA 4ARZB 3OOVA 2PR5A 2O9AA 3TW8A 4H6JA 1OTAA 1G6OA 1NLZA 2A24B 5AVFA 4EERA 1TS6A 3UE3A 3LR3A 3NOTC 1F5MA 3IS2B 4WL9A 3UMDA 3VE3A 5KIZA 2HJ9C 2VV8A 3EGDC 1OTBA 2FZ0A 2PHYA 1V9YA 4O01A 1YAXA 3F1OA 1TS0A 4MDZA 1S1YA 3PBSA 2VLGA 3LFVA 4ETXA 2M1CA 1OTDA 2XA7M 2W3HA 3T4LA 4HOIA 4LRYC 4HH3A 5HWVA 4EXOA 3H9WA 2A2LA 1XFQA 5DF9A 1ZTUA 3G6OA 3ZQ5A 1DP9A 2QHKA 5I5LA 3RFBA 4B93A 4GS9B 4GJ4A 3PXPA 4KQDA 4CLCE 3MR0A 4NXFA 2INWA 2PDRA 3FC7A 5HSQA 5J3WA 4WEJA 2GNXA 2W1TA 2BASA 2JN7A 2I9VA 3EQVA 1P0ZA 3PBOA 4CLCA 4PHTA 3GECA 2L4RA 3OLOA 1OTIA 3CUEA 3PHYA 4JGRA 3T50A 2V0WA 5LBRA 3S7QA 2VEAA 3R4KA 2YKFA 4BBTA 1OJGA 2L0WA 1TS8A 5L8MA 1NWZA 4R6LA 1LSXA 3BQ8A 5AVEA 3S7PA 1G28A 2KLIA 4JGQA 3K2NA 3S7OA 2VJWA 4EUVA 3LUQA 4LRXC 3KYQA 5HDCA 4WLAA 4BWIA 3C30A 3H7WA 2P04A 2VV7A 1YSPA 3LIAA 4WF0A 3CAXA 3RH8B 1S1ZA 4JGPA 4XT2A 5IS1A 3H82A 4KUKA 5IU1A 1GSWA 1VB6A 2Z6DA 3LIFA 4G3WA 2V9AA 3EQUA 2DMWA 4UQIS 2ZOHA 2G7UA 2W0NA 1N9OA 3EGXC 3TRCA 5MC7A 1D06A 2W27A 2JKTI 5DJUA 2ZBBA 2P08A 4GW9A 4I38A 3NHQA 4EESA 2W3EA 5IT5A 3LR4A 4MN6A 2O0YA 3CWFA 1LSWA 4MCWA 5HD3A 3PYPA 2K7SA 1WA9A 4M4XA 2KOIA 3K3CA 2IA2A 1N9NA 4HIAA 5G4YA 1XJ4A 3D72A 4HJ3A 1S66L 2PR6A 3V67A 4I39A 2HF6A 3F1NB 3DBAA 1S67L 4LLOB 2EA9A 3P01A 1TF1A 4FOFA 2B02A 2VKSA 3LIBA 4IUHA 4L0LA 3MMHA 1GSXA 3HJKA 2XROA 4DN0A 2W3FA 3S7NA 2MJ6A 2K2NA 5DFYA 2PYPA 1T1BA 4GHIB 5F6AA 5DFXA 3JVUA 3K3DA 3OBFA 1IOUA 2K31A 3CITA 3R7WB 3LICA 5J4EA 4LPZA 2GJ3A 4ARZA 1BYWA 4Y3IA 2W3DA 5HL6A 5A8BA 1XFNA 2A24A 2QJ5A 2O99A 4IHQA 1Y28A 3VOLA 3P7NA 3IS2A 2KDKA 2OWJA 4HP9A 4I3JA 2PD7A 3NJAA 3FG8A 1P9RA 2NUPC 1H3QA 4DMZA 2PT7A 2J80A 1DRMA 1IFQA 4R38A 5TBMB 4L9GA 3FPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSV A;  4I3I A;  2D02 A;  4DJ3 A;  3SW1 A;  1DP8 A;  1JNU A;  5HWT A;  3HJI A;  4K08 A;  4L9E A;  5HDD A;  4GS9 A;  1P97 A;  4BBV A;  2P7J A;  2HV1 A;  2V0U A;  3BY8 A;  2WKP A;  2VV6 A;  3BWL A;  4JGO A;  3UB9 A;  4E04 A;  1LSV A;  1T1A A;  2WKQ A;  1X0O A;  4HJ6 A;  3ULF A;  3EEH A;  2YKH A;  4WUJ A;  4F3L B;  4EET B;  4HHD A;  3F1P B;  3MQO A;  4HH2 A;  4GCZ A;  4HJ4 A;  4PKY A;  5J7E A;  3B33 A;  3MJQ A;  4YWZ A;  3MQQ A;  1T18 A;  2QWS A;  3ICY A;  1XJ2 A;  4H6J B;  2H28 A;  2KX6 A;  1OJ5 A;  1T1C A;  1UWP X;  4NXE A;  1XJ3 A;  4DJ2 A;  4L9F A;  4HNB A;  1KOU A;  3LI8 A;  3MFX A;  5F69 A;  3VE4 A;  3KX0 X;  2L1M A;  3F1O B;  4EW7 A;  4HP4 A;  3E4O A;  3LID A;  5EFW A;  2WKR A;  3RTY A;  4I5S A;  2V1A A;  1ODV A;  3UB7 A;  3F1N A;  5DJT A;  4PKY G;  4MN5 A;  1XJ6 A;  2JHE A;  1UWN X;  5F68 A;  3E4Q A;  5F5Y A;  3LYX A;  4GHI A;  4HY8 A;  3NOP C;  1DP6 A;  3A0R A;  3C8C A;  4HQA A;  3CLO A;  3UB8 A;  1EW0 A;  1OT6 A;  5HD5 A;  3UB6 A;  2QKP A;  2R78 A;  3BY9 A;  4NXG A;  1V9Z A;  4EQ1 A;  2CMN A;  1OTE A;  1F98 A;  3H7W B;  3IBR A;  4HI4 A;  3MXQ A;  4XT2 B;  5DKL A;  5DKK A;  3H82 B;  1S4S A;  1T19 A;  2ZOI A;  3LI9 A;  5TBM A;  3C2W A;  3UE6 A;  5HWW A;  2PD8 A;  3LIE A;  5HZH A;  1TS7 A;  1OT9 A;  4WN5 A;  3A0S A;  1D7E A;  2V1B A;  4NXB A;  3UME A;  4R70 A;  1LT0 A;  1F9I A;  1S4R A;  4KUO A;  3E4P A;  3EWK A;  2OWH A;  5G4Z A;  3NOU C;  4LRZ E;  1N9L A;  3GDI A;  4R3A A;  2D01 A;  4I3A A;  1UGU A;  4EEU A;  3A0V A;  4B9O A;  1MZU A;  4RQ9 A;  5HDS A;  1LL8 A;  2Z6C A;  2OOL A;  2QJ7 A;  4BBU A;  4F3L A;  3F1P A;  2PYR A;  4EEP A;  2PR5 A;  4H6J A;  1OTA A;  2A24 B;  5AVF A;  4EER A;  1TS6 A;  3NOT C;  3IS2 B;  4WL9 A;  3UMD A;  3VE3 A;  5KIZ A;  2VV8 A;  1OTB A;  2PHY A;  1V9Y A;  3F1O A;  1TS0 A;  1S1Y A;  2VLG A;  2M1C A;  1OTD A;  4HOI A;  4LRY C;  4HH3 A;  5HWV A;  4EXO A;  3H9W A;  1XFQ A;  3G6O A;  3ZQ5 A;  1DP9 A;  2QHK A;  5I5L A;  4GS9 B;  4KQD A;  3MR0 A;  4NXF A;  2INW A;  2PDR A;  3FC7 A;  5HSQ A;  5J3W A;  2BAS A;  2JN7 A;  2I9V A;  1P0Z A;  3GEC A;  2L4R A;  3OLO A;  1OTI A;  3PHY A;  4JGR A;  3T50 A;  2V0W A;  2VEA A;  2YKF A;  4BBT A;  1OJG A;  2L0W A;  1TS8 A;  1NWZ A;  4R6L A;  1LSX A;  5AVE A;  1G28 A;  4JGQ A;  3LUQ A;  4LRX C;  5HDC A;  4WLA A;  3H7W A;  2VV7 A;  3LIA A;  4WF0 A;  3CAX A;  3RH8 B;  1S1Z A;  4JGP A;  4XT2 A;  5IS1 A;  3H82 A;  4KUK A;  5IU1 A;  1GSW A;  1VB6 A;  2Z6D A;  3LIF A;  2V9A A;  2ZOH A;  2W0N A;  1N9O A;  1D06 A;  2W27 A;  5DJU A;  2ZBB A;  4GW9 A;  4I38 A;  3NHQ A;  4EES A;  4MN6 A;  3CWF A;  1LSW A;  5HD3 A;  3PYP A;  2K7S A;  1WA9 A;  4M4X A;  3K3C A;  1N9N A;  4HIA A;  5G4Y A;  1XJ4 A;  3D72 A;  4HJ3 A;  1S66 L;  2PR6 A;  4I39 A;  3F1N B;  1S67 L;  4LLO B;  2EA9 A;  2B02 A;  3LIB A;  1GSX A;  3HJK A;  2PYP A;  1T1B A;  4GHI B;  5F6A A;  3K3D A;  3LIC A;  5J4E A;  4LPZ A;  2GJ3 A;  1BYW A;  5A8B A;  1XFN A;  2A24 A;  2QJ5 A;  1Y28 A;  3VOL A;  3P7N A;  3IS2 A;  2KDK A;  2OWJ A;  4HP9 A;  4I3J A;  2PD7 A;  3NJA A;  3FG8 A;  2J80 A;  1DRM A;  4R38 A;  5TBM B;  4L9G A; 
#chains in the Genus database with same CATH topology
 4B4Z A;  4I3I A;  4C6Y A;  2ZC6 B;  5E2H A;  5HWT A;  1Z09 A;  2EFU A;  3FZC A;  1IEM A;  5FDH A;  3BY8 A;  3TJZ C;  2EXB A;  3KSF A;  4G3K A;  1XA7 A;  3BWL A;  4Q0H A;  3BW6 A;  3FKV A;  5TJJ A;  3U2A A;  3UB9 A;  3RXW A;  2ZLY A;  2H5S A;  4E04 A;  1IYO A;  1LSV A;  1T1A A;  2WKQ A;  4WZ4 A;  4A5R A;  3GQZ A;  4DE3 A;  3O3V A;  3MZD A;  2VGL S;  5TGF A;  4E3N A;  3KYE A;  2YKH A;  4WUJ A;  2EX6 A;  4UEY A;  4CJN A;  1LI0 A;  3DTE A;  2XSS A;  5F1G A;  4Y5F A;  4EET B;  3S1Y A;  4CQH A;  1PWC A;  2WGW B;  4HH2 A;  1W63 M;  4HJ4 A;  3IF6 B;  5J7E A;  3B33 A;  3MJQ A;  4QY6 A;  4JF4 A;  4S2M A;  2ZQC A;  3ICY A;  1XJ2 A;  2R9X A;  2XEP A;  2H28 A;  3GR2 A;  3PAG A;  1UWP X;  3BFC A;  4DJ2 A;  1KOU A;  4FH2 A;  3KX0 X;  2EX9 A;  4KZ9 A;  3SZT A;  2L1M A;  1TD5 A;  5C5K A;  4II7 A;  2E8J A;  4EW7 A;  1YM1 A;  4KQR A;  2Y2O A;  3E4O A;  2XH9 A;  3HBR A;  5CGW A;  2JKR M;  3WWX A;  1I5Q A;  1OME A;  2V1A A;  5JYO A;  4EBL A;  2WAD A;  4UHU A;  3MKF A;  5DJT A;  3Q7Z A;  4P87 A;  3IWQ A;  4E3K A;  2HP9 A;  3UE1 A;  3W2Z A;  4Q0I A;  5F68 A;  3E4Q A;  3B42 A;  4CLC B;  3LEZ A;  3LR5 A;  2WKH A;  4E3M A;  2HGV A;  2M7V A;  4Q8I A;  3CLO A;  3PBR A;  5HD5 A;  2ZMV A;  3BQA A;  3UDX A;  2AVX A;  2XFS A;  3BY9 A;  2O9B A;  5EVI C;  3BYD A;  4OVD A;  5FAQ A;  4EQ1 A;  2CMN A;  4QWO A;  5TFQ A;  3IBR A;  3T4O A;  3PBN A;  3P09 A;  3HLW A;  4OOY A;  1XGI A;  1HD8 A;  4KZ3 A;  3MXQ A;  4DXB A;  5DKL A;  3LI9 A;  5TBM A;  4ZJ2 A;  3C4O A;  1E4D A;  3UE6 A;  3PBQ A;  2V1Z A;  3T1Q B;  3TE8 A;  3OCN A;  4JBF A;  2V1B A;  3UME A;  1LT0 A;  4IUK A;  3G2Z A;  1C3B A;  2HPB A;  1Y54 A;  1F9I A;  5FAP A;  4KUO A;  3EWK A;  2Y2H A;  2ZM0 A;  1M40 A;  1P9W A;  3GV9 A;  3FWL A;  5EV0 A;  4G3V A;  4R3A A;  1CK3 A;  3MXR A;  2XK1 A;  4U0T A;  2ZC3 B;  3IQA A;  1UGU A;  1ESI A;  4EEU A;  3A0V A;  2C6W B;  1E25 A;  4KZ5 A;  1LL8 A;  3N4I A;  3M6H A;  3T1S A;  3W8K A;  4YOF A;  3AGE A;  4LCL A;  2WGW A;  1LL9 A;  2Y4A A;  3IF6 A;  4B4X A;  4S2O A;  4ARZ B;  2ZC4 B;  1FOF A;  4M3K A;  4ZJ3 A;  2WZX A;  1OTA A;  1NLZ A;  5L2F A;  3HUN A;  3NOT C;  2G2U A;  3IS2 B;  4C75 A;  3NCK A;  4R4R A;  1OTB A;  2PHY A;  4OLG A;  1YAX A;  3Q7V B;  1NYY A;  1S1Y A;  4ZJ1 A;  1ES2 A;  4GB7 A;  4ETX A;  2XA7 M;  2W3H A;  5M1A A;  3V39 A;  2Y59 A;  3HLF A;  3T4L A;  2X71 A;  4HH3 A;  4EXO A;  2A2L A;  1DP9 A;  3IWI A;  4GS9 B;  5EEC A;  4GJ4 A;  1Q2Q A;  3OPL A;  4NXF A;  5FQK A;  5HSQ A;  4WEJ A;  1SKO B;  4JPM A;  5DVA A;  3ZG9 B;  2JN7 A;  3EQV A;  4CLC A;  5HW3 A;  4PHT A;  1N9B A;  3PHY A;  1RGY A;  3T50 A;  5CGS A;  5LBR A;  2VEA A;  3R4K A;  2Q0O A;  4NET A;  5L8M A;  1NWZ A;  4FCF A;  2XQZ A;  4QJG A;  4YIN A;  3S7O A;  2JCH A;  1KGG A;  3LUQ A;  4LRX C;  3AGD A;  4X69 A;  3GVB A;  1KE0 A;  4ID4 A;  4BWI A;  3C30 A;  5EUA A;  4QD4 A;  2ZJ9 A;  4UAA A;  4JGP A;  5IS1 A;  4KUK A;  4BD1 A;  2XFT A;  5IU1 A;  2Z6D A;  4RA7 A;  2I72 A;  3EQU A;  3DTK A;  5EOO A;  3VFH A;  5F82 A;  1TDG A;  5HAI A;  2J9O A;  3D9Y A;  2JKT I;  5DJU A;  5FI2 A;  2P08 A;  4EES A;  1K38 A;  5IT5 A;  3CWF A;  1LSW A;  3PYP A;  1E3U D;  1WA9 A;  2A3U A;  4PM7 A;  1TDL A;  5G4Y A;  1XJ4 A;  4Y15 A;  3HUO A;  2HP6 A;  3V67 A;  3WS1 A;  1S67 L;  3DW0 A;  2EA9 A;  4X56 A;  2VKS A;  3MZE A;  4IUH A;  4EUZ A;  4OKP A;  5E2G A;  2XRO A;  2V20 A;  2ZQA A;  1IKG A;  4S2J A;  2MJ6 A;  3BLS A;  1MWR A;  2PYP A;  4GHI B;  4KZ6 A;  2WGI A;  5AQ7 A;  1K57 C;  4EV4 A;  3CZD A;  4K91 A;  3M6B A;  1IOU A;  3DWZ A;  4FTX A;  2R9W A;  2Y2N A;  3SS4 A;  3IH8 A;  4ARZ A;  1ZKJ A;  2W3D A;  3NDE A;  1XFN A;  2QJ5 A;  4BLM A;  3CG5 A;  5J8X A;  1JVJ A;  3IS2 A;  5EE8 A;  4HP9 A;  1CEF A;  1K56 A;  2PD7 A;  5AQ9 A;  3NJA A;  1P9R A;  1FR6 A;  3Q7V A;  1PI4 A;  1S0W A;  2H0T A;  2J80 A;  5A92 A;  1IFQ A;  1GA9 A;  4WEL A;  3HVF A;  1JTD A;  2D02 A;  1ERO A;  1VQQ A;  2NUT C;  2JKT M;  1JNU A;  3ZG5 A;  1IEL A;  3IBJ A;  4GS9 A;  4BBV A;  1G6A A;  2P7J A;  3KSG A;  5CTN A;  5EOE A;  1XPB A;  5D3O A;  4KZB A;  4JXS A;  1SKO A;  1YLY A;  1IYP A;  3BJN A;  3G34 A;  4RVA A;  5FQQ A;  3ZHH A;  4XUZ A;  1H5X A;  1LI9 A;  1PIO A;  5FQI A;  1PW1 A;  2HP5 A;  1TEM A;  4BJP A;  2OLV A;  4GZB A;  1X0O A;  3ULF A;  3Q07 A;  4O8G A;  1BLH A;  5F1F A;  4P6Z S;  3WRZ A;  3HL9 A;  4JF6 A;  1ZHH B;  4JF5 A;  2WZZ A;  4MN7 A;  4GCZ A;  4OQ0 A;  3GTC A;  2XRN A;  1ACF A;  5EVI B;  1T1C A;  4NXE A;  1XJ3 A;  4KG2 A;  3T4Q A;  2ZQ8 A;  2JC7 A;  5FAS A;  5HAP A;  4JXV A;  4ZBE A;  3VSK A;  4R3B A;  3ZG7 B;  3TSG A;  4QHC A;  4E3O A;  2P74 A;  2BLS A;  4GOG A;  1W8Q A;  4I5S A;  1ODV A;  1NLY A;  3UB7 A;  1VHM A;  3WS4 A;  3KSH A;  4MN5 A;  1XJ6 A;  3OPP A;  1FSW A;  4Z9Q A;  2O9C A;  3NIA A;  1DJA A;  3VV4 A;  3VP3 A;  5F5Y A;  5HAR A;  1BTL A;  1HTZ A;  3C38 A;  1I2S A;  3HCY A;  5GLB A;  3D4F A;  4S2P A;  3IH9 A;  3IXB A;  4GHI A;  4N92 A;  3EOI A;  4N9L A;  3WS0 A;  4EU0 A;  5HPF A;  3C8C A;  4N1X A;  4C3Q A;  1H8M A;  2XD5 A;  1OT6 A;  5E2E A;  2JKR I;  2WUQ A;  2QKP A;  5L10 A;  5GHX A;  4OOM A;  2J9P A;  2R78 A;  4UA6 A;  5FI7 A;  1YLT A;  3O87 A;  4GN2 A;  3G35 A;  3VOY A;  2V2F F;  1YSQ A;  3H7W B;  4D60 A;  3MFD A;  1RP5 A;  1FQG A;  4HI4 A;  3HUM A;  4OPY A;  5CX7 A;  1SHV A;  2PU2 A;  1T19 A;  3QHY A;  4NEE D;  3B3X A;  4OPR A;  3C2W A;  2M7U A;  3MXS A;  2J3T D;  2PD8 A;  3LEQ A;  4IJG A;  3CPT B;  3PBT A;  5HZH A;  3MF0 A;  3BEC A;  3T12 B;  3FYZ A;  4WN5 A;  2B18 A;  4OP5 A;  2EWW A;  4PM9 A;  3E4P A;  2WKE A;  3FPW A;  5G4Z A;  4KQO A;  3NOU C;  1MKI A;  4KEN B;  4YFM A;  2D01 A;  4I3A A;  3HLC A;  3E2K A;  4YNR A;  5CEB A;  3E0Y A;  3A3I A;  4S2N C;  4UA7 A;  1CF0 A;  2UV0 E;  2JKF A;  4H8R A;  2PYR A;  1O7E A;  2PAV P;  2A24 B;  3DTM A;  1TS6 A;  1KGE A;  3UE3 A;  3IXG A;  5EVI A;  2XD1 A;  4WMC D;  5FEG A;  5EM1 A;  5KIZ A;  1CQA A;  3G31 A;  1PRQ A;  3C7U A;  3EGD C;  2UWX A;  5DF7 A;  4O01 A;  1NY0 A;  4IVK A;  1FSY A;  4JLF A;  1TS0 A;  1XXM A;  1SKF A;  4GD8 A;  3G32 A;  1EI5 A;  2VLG A;  1OTD A;  1WE4 A;  5FAO A;  1XFQ A;  4KG5 A;  3UPN A;  1BLP A;  1ZTU A;  5TR7 A;  1LHY A;  2C5W B;  3G6O A;  4P6B A;  2QHK A;  5I5L A;  4B93 A;  2PDR A;  3FC7 A;  1GHI A;  2ZQD A;  2GNX A;  4OP8 A;  3Q82 A;  1PI5 A;  1P0Z A;  1GHP A;  4EWF A;  3GEC A;  5CHJ A;  1N4O A;  2V0W A;  3S7Q A;  4KZA A;  3HLD A;  4FUW A;  2Y55 A;  4R6L A;  4WZ5 A;  3BQ8 A;  4RX3 A;  4JGQ A;  5EVE A;  2VJW A;  1YLJ A;  4EUV A;  1K55 C;  1I2W A;  5HDC A;  3VP1 A;  3H7W A;  1IYS A;  1H8Z A;  2P04 A;  3LIA A;  3GSG A;  3CAX A;  4WF0 A;  1S1Z A;  1YPR A;  3RH8 B;  1QMF A;  1IYQ A;  3UN7 A;  1GSW A;  1VB6 A;  3E2L A;  4R3J A;  3LIF A;  4QU3 A;  3VMA A;  4S2I A;  2G7U A;  1N9O A;  5MC7 A;  3TRC A;  5CTM A;  3CPT A;  2ZBB A;  4WZ5 C;  4I38 A;  3NHQ A;  5M19 A;  3LR4 A;  4MCW A;  3SS5 A;  5HD3 A;  4FD8 A;  3QNB A;  4ZDX A;  4M4X A;  1AWI A;  3QP6 A;  2IA2 A;  1N9N A;  3O86 A;  4HIA A;  4X6T A;  5CXW A;  3BRM A;  5U47 A;  1S66 L;  2PR6 A;  3CHW P;  2HF6 A;  3DBA A;  3V50 A;  4LLO B;  4B88 A;  1MY8 A;  3ZVT A;  1E3U A;  3L7H A;  2B02 A;  1SDN A;  3LIB A;  4L0L A;  3MMH A;  1GSX A;  2W3F A;  4U3T A;  1ALQ A;  1KGF A;  5F6A A;  3JVU A;  5M18 A;  2K31 A;  2J8Y A;  1W7F A;  4LPZ A;  2GJ3 A;  4Y0T A;  1BYW A;  2IWC A;  3LY3 A;  3A3E A;  1H0M A;  2BTF P;  5A91 A;  2A24 A;  1TVF A;  2XF3 A;  3U4L P;  4IHQ A;  1Y28 A;  3VOL A;  3P7N A;  5HL1 A;  3L9K A;  2KDK A;  1G68 A;  3FG8 A;  3ZDJ A;  4PPR A;  4XXR A;  1K0K A;  4R38 A;  1FCN A;  4L9G A;  3FPV A;  3NDG A;  1GSV A;  1DY6 A;  4K0X A;  4X55 A;  3D3O A;  1DP8 A;  5JYP A;  4K0W A;  5FI6 A;  4MNR A;  3ZNY A;  4JXW A;  1LLB A;  4L9E A;  3VOZ A;  5GHZ A;  4OOL A;  1P97 A;  3FV7 A;  3MSH A;  1MKM A;  4ETZ A;  2J7V A;  2VV6 A;  3JVV A;  3VP2 A;  2Y79 A;  2WKI A;  1YLZ A;  4UQI M;  3N6I A;  1K6R A;  3IWO A;  4HJ6 A;  2ZM8 A;  1STZ A;  3EEH A;  1YT4 A;  1ONG A;  2EX8 A;  1CJF A;  3M2K A;  4RYE A;  5L07 A;  1W8Y A;  5EPH A;  3T4S A;  4UA9 A;  3WS5 A;  4E6W A;  2FH5 A;  2LB5 A;  1BZA A;  1K57 A;  4GKU A;  4HHD A;  5HFO A;  3F1P B;  4P0M A;  4GDN A;  4PKY A;  2J3W A;  2P9V A;  3MQQ A;  2HJE A;  2QWS A;  3SH9 A;  1BUL A;  2KX6 A;  3G30 A;  4Y2F A;  4OON A;  2H10 A;  3ISG A;  4L9F A;  4HNB A;  1LL5 A;  3MFX A;  4BMW A;  1L2S A;  4XUX A;  1MWS A;  4O7D A;  4HP4 A;  1K25 A;  3LID A;  4WM9 A;  1Q2P A;  3AGF A;  5EFW A;  3W4Q A;  3HLE A;  3RTY A;  3IHB A;  1CI8 A;  5CHM A;  1YKD A;  1NRF A;  4S2K A;  5DTT A;  4DE2 A;  3UO9 A;  2JHE A;  5AQB A;  5DF8 A;  4S2L A;  2VZW A;  2W3G A;  3M2J A;  3OPH A;  3HLB A;  2W1T B;  2ZL1 B;  3LYX A;  2B5R A;  1KE4 A;  3MQ0 A;  4X1M A;  2XA7 S;  4DRT A;  2FFF B;  4HY8 A;  1DP6 A;  3UDF A;  1CI9 A;  3NY4 A;  5K5B A;  2HDS A;  3ZYT A;  3T1R A;  1H8Y A;  3A0R A;  4AFI A;  4CLC D;  3UB8 A;  3UB6 A;  1XX2 A;  3VFF A;  3EEA A;  4X25 A;  3GMW A;  4BQM A;  3KYZ A;  3QNC A;  5EVL A;  1O07 A;  2E8I A;  4NXG A;  2G2W A;  1V9Z A;  5FSR A;  5IHV A;  4ME4 A;  1NYM A;  1RGZ A;  4E6X A;  3IX4 A;  4XT2 B;  4OQH A;  2WAF A;  1PWG A;  3H82 B;  1S4S A;  2OAP 1;  2ZOI A;  2XLN A;  4BD0 A;  1NZU A;  2HZ5 A;  1BLC A;  5GLA A;  2HDR A;  4OQI A;  3LY4 A;  2Z2L B;  1HZO A;  3BFF A;  3MBZ A;  3UY6 A;  4ZRR A;  2X01 A;  3OC2 A;  1K4E A;  5A90 A;  4ESP A;  1TS7 A;  1U60 A;  2Q9M A;  2BG1 A;  3T4T A;  1OT9 A;  4IED A;  3G4P A;  3A0S A;  4OPZ A;  3LGO A;  2OSU A;  4X53 A;  3JYI A;  2VGL M;  1CEG A;  3LR0 A;  4LV3 A;  4R70 A;  3VSL A;  5HPI A;  3V5M A;  4IBX A;  4CPK A;  3OZH A;  2OWH A;  3CUE C;  2DNS A;  4LRZ E;  3O5Y A;  4QPR A;  2OV5 A;  5FDS A;  3NUL A;  2VX8 A;  4OH0 A;  2ZMA A;  2QYB A;  1ERM A;  2Y2L A;  1HVB A;  4O0P A;  4B9O A;  5CED A;  1KE3 A;  4Q0J A;  3QP8 A;  5HDS A;  1PFL A;  3BFD A;  2ZMF A;  4N9K A;  2QJ7 A;  4BBU A;  5KSH A;  2J3T C;  3S22 A;  1MC0 A;  2QPN A;  3F1P A;  3RJU A;  3JPU A;  4EEP A;  3TW8 A;  1G6O A;  4DKI A;  5AVF A;  4EER A;  3LR3 A;  3SH7 A;  3VP4 A;  1F5M A;  1YMX A;  3UMD A;  2HJ9 C;  1XKZ A;  4BL2 A;  2FZ0 A;  4LCM A;  2ZC7 A;  2DCF A;  4NK3 A;  1DJB A;  4MBF A;  1K56 D;  3PBS A;  1L3L A;  1XA1 A;  5AQA A;  4X68 A;  1FCO A;  2M1C A;  1ES3 A;  4WMC A;  1YQS A;  3IHA A;  1W79 A;  4LRY C;  3H9W A;  2Y2P A;  5DF9 A;  1W5D A;  1YLW A;  2Y2I A;  3PXP A;  4CLC E;  3MR0 A;  5J3W A;  3UPP A;  4HES A;  2W1T A;  2ZL1 A;  2BAS A;  2I9V A;  3PBO A;  4PM5 A;  1BUE A;  2L4R A;  3ZG0 A;  3OLO A;  5DTK A;  1NZO A;  4BBT A;  3N8L A;  3A3J A;  3S7P A;  1DJC A;  4E3L A;  1G28 A;  3K2N A;  3KYQ A;  3N8R A;  5CER A;  2PRF A;  3MKE A;  4S2N A;  2GDN A;  2VV7 A;  2ACG A;  2ZQ9 A;  4XT2 A;  1L0G A;  3H82 A;  1Y4O A;  3T1X A;  3C4P A;  4HBT A;  4OPQ A;  2A49 A;  4QB8 A;  3EGX C;  1D06 A;  2CC1 A;  5CGX A;  3Q1F A;  1GA0 A;  4DDY A;  2W3E A;  4MBH A;  4MN6 A;  2O0Y A;  3CJM A;  2K7S A;  3DAV A;  4KZ8 A;  4LV0 A;  2Z2M B;  3K3C A;  3D72 A;  4HJ3 A;  5HAQ A;  4IVI A;  3OPR A;  4Y7P A;  2VGJ A;  4RX2 A;  3BEB A;  4N1H A;  5A93 A;  3F1N B;  3FKW A;  3ZVW A;  3I7J A;  4FOF A;  5KSC A;  2PBY A;  1PNE A;  3HJK A;  5KZH A;  1A0K A;  3S7N A;  1T1B A;  5DFX A;  3IT9 A;  3NI9 A;  2PBD P;  3R7W B;  5J4E A;  2HDQ A;  5GLC A;  4ZTK A;  4Y3I A;  5HL6 A;  1VEU B;  3UDI A;  3SOI A;  2O99 A;  1K55 A;  2ZM2 A;  4PMA A;  1PW8 A;  3V3S A;  2Y2M A;  4MEZ A;  2NUP C;  1BT5 A;  4KZ4 A;  5EM0 A;  4EBP A;  1DRM A;  5BOH A;  3WS2 A;  1PZO A;  1FIL A;  3KO6 A;  3QP2 A;  5I94 A;  4Z1W A;  4DJ3 A;  3SW1 A;  5HX9 A;  5CHU A;  3W4O A;  3HJI A;  4K08 A;  3IXH A;  5HDD A;  4KG6 A;  1BLS A;  2HV1 A;  2V0U A;  4LFU A;  1L0E A;  4DE0 A;  1Z6F A;  5FQJ A;  1FCM A;  3KSI A;  5G18 A;  5FA7 A;  3LCE A;  2WKP A;  4LEN A;  4JGO A;  3A3D A;  3O88 A;  2LB9 A;  4OQG A;  2Y2Q A;  2P9V B;  4MMN A;  3T4K A;  1PWD A;  4BEN A;  4EBN A;  1NXY A;  5FL3 A;  2WGV A;  1ZG4 A;  1BSG A;  2WK0 A;  1MBL A;  5AJG A;  2VK3 A;  3MS6 A;  3UE0 A;  3N7W A;  4ZAM A;  3IXD A;  3HRE A;  4FSF A;  4PAU A;  4F3L B;  1S6R A;  3BLM A;  3ITA A;  1SCW A;  3MQO A;  3VP0 A;  1NRJ A;  2Y2K A;  5E2F A;  3PR6 A;  1SZV A;  4YWZ A;  3BFE A;  1T18 A;  2QZ6 A;  3C7V A;  4H6J B;  5FQ9 A;  1OPX A;  3NEC A;  3CMZ A;  1ONH A;  2XDM A;  4DXC A;  1AXB A;  1OJ5 A;  2EX2 A;  1ES4 A;  4GNU A;  3PAE A;  5EVI D;  3LI8 A;  5F69 A;  3VE4 A;  3IF5 A;  4U0X A;  3N8S A;  3F1O B;  4QY5 A;  4LV2 A;  1K4F A;  1ERQ A;  2Y2J A;  4D2O A;  3RXX A;  2RL3 A;  4DE1 A;  2WKR A;  1QME A;  1KDS A;  4HBU A;  2V8F A;  4HEF A;  3F1N A;  3T4J A;  4PKY G;  3W4P A;  4NG2 A;  1MXO A;  2GZA A;  3S4X A;  1FIK A;  1W63 Q;  2EXA A;  1UWN X;  2VGK A;  4DF6 A;  4GLQ A;  4GD6 A;  1JWP A;  3LO7 A;  2OAQ 1;  1M6K A;  2IWD A;  3ZGA B;  3NOP C;  2H0Y A;  2IWB A;  3ZCZ A;  1PYY A;  4HQA A;  3ZFZ A;  3IF6 C;  3NBL A;  1EW0 A;  3R7W A;  1JWV A;  4PM6 A;  1VEU A;  1J3W A;  4BL3 A;  1YMS A;  5FEF A;  3C5A A;  3A3F A;  1J9M A;  1OTE A;  1F98 A;  1KVL A;  4WYY A;  3PTE A;  4Y13 A;  3UNW A;  5CRF A;  4E3J A;  2EFX A;  4X1L A;  5DKK A;  4R23 A;  4P85 A;  4KQQ A;  2EWV A;  2VA0 A;  1L0F A;  3CI6 A;  3BFG A;  5HWW A;  3LIE A;  5L09 A;  3ZG8 B;  2Q9N A;  1KVM A;  2DRW A;  3V3R A;  3UB5 P;  5E43 A;  1D7E A;  3TG9 A;  4NXB A;  4Y0O A;  1ESU A;  1ZG6 A;  4P6Z M;  2QMI A;  1S4R A;  4CLC C;  3MZF A;  3B47 A;  1N9L A;  3GDI A;  1XP4 A;  1K54 A;  2HDU A;  5FQM A;  2WAE A;  3WRT A;  1KDW A;  1F2K A;  2XGN A;  3E98 A;  4F94 A;  5GL9 A;  1MZU A;  4RQ9 A;  4WEK A;  1MWU A;  4LV1 A;  1IKI A;  2Z6C A;  2OOL A;  1VET B;  2W1R A;  4F3L A;  2GX5 A;  3OCL A;  1WYB A;  3IX3 A;  2Y8H A;  4NKP A;  2JBF A;  4DDS A;  3OOV A;  4FH4 A;  2PR5 A;  2O9A A;  4H6J A;  1K54 C;  4E3I A;  1NJ4 A;  4WL9 A;  3VE3 A;  2VV8 A;  4PM8 A;  4R4S A;  1V9Y A;  3F1O A;  1ES5 A;  1L0D A;  4MDZ A;  3LFV A;  1RCJ A;  3SS3 A;  4GDB A;  4JKT A;  2WYX A;  1EWZ A;  4HOI A;  5HWV A;  3DWK A;  3ZQ5 A;  2JKG A;  3RFB A;  1K6S A;  4LGW A;  4KQD A;  2INW A;  4OLD A;  5GLD A;  3ZNT A;  3BM6 A;  5CEC A;  2ZQ7 A;  2FFY A;  1D1J A;  1OTI A;  4MLL A;  3CUE A;  4JGR A;  2YKF A;  3Q81 A;  1G5U A;  1OJG A;  2L0W A;  1TS8 A;  1LSX A;  2ZD8 A;  5AVE A;  2KLI A;  3IX8 A;  4JXG A;  3HLG A;  2X02 A;  3ITB A;  1VM1 A;  4WLA A;  1ZC2 A;  3QP5 A;  2JE5 A;  1MPL A;  1YSP A;  2PU4 A;  1GHM A;  4G3W A;  2V9A A;  2DMW A;  4UQI S;  2ZOH A;  3SH8 A;  5KMW A;  2W0N A;  2W27 A;  4Y0U A;  3GRJ A;  4GW9 A;  1YLP A;  4WBG A;  4MBK A;  3QP1 A;  3NC8 A;  4R0Q A;  2RCX A;  2Y2G A;  2KOI A;  3QP4 A;  2Y91 A;  1SDE A;  2XR0 A;  4EQI A;  4IBR A;  1FR1 A;  4KZ7 A;  5FAT A;  4I39 A;  1JTG A;  3DTI A;  3G2Y A;  1GCE A;  3P01 A;  1TF1 A;  4R1G A;  1WYC A;  2ZC5 B;  4DN0 A;  3P98 A;  2OLU A;  2K2N A;  5DFY A;  1VET A;  2V8C A;  5F83 A;  3K3D A;  3OBF A;  5DTS A;  3TOI A;  1MWT A;  3CIT A;  3LIC A;  2B95 A;  3UPO A;  5A8B A;  4Y17 A;  1XGJ A;  2OWJ A;  1HLU P;  4I3J A;  5GHY A;  1PZP A;  1H3Q A;  4DMZ A;  2PT7 A;  1JWZ A;  5TBM B; 
#chains in the Genus database with same CATH homology
 1GSV A;  4WEL A;  4I3I A;  3KO6 A;  2D02 A;  4Z1W A;  3D3O A;  4DJ3 A;  3SW1 A;  2NUT C;  2JKT M;  1DP8 A;  1JNU A;  5HWT A;  3HJI A;  3IBJ A;  4K08 A;  4L9E A;  5HDD A;  4GS9 A;  4OOL A;  1P97 A;  4BBV A;  2P7J A;  3KSG A;  2HV1 A;  2V0U A;  3BY8 A;  3TJZ C;  1MKM A;  3KSF A;  4G3K A;  4ETZ A;  3KSI A;  3BJN A;  2WKP A;  2VV6 A;  3BWL A;  4Q0H A;  3BW6 A;  3JVV A;  4JGO A;  5TJJ A;  3U2A A;  3UB9 A;  2LB9 A;  2Y79 A;  4MMN A;  4E04 A;  3T4K A;  1LSV A;  4BJP A;  1T1A A;  4UQI M;  2WKQ A;  5FL3 A;  1X0O A;  4HJ6 A;  3ULF A;  1STZ A;  2VGL S;  3EEH A;  5AJG A;  4O8G A;  4P6Z S;  2YKH A;  3T4S A;  4WUJ A;  4UEY A;  2XSS A;  2FH5 A;  2LB5 A;  4FSF A;  4PAU A;  1ZHH B;  4Y5F A;  4EET B;  4F3L B;  4HHD A;  4CQH A;  3F1P B;  4MN7 A;  3MQO A;  4HH2 A;  4GCZ A;  1NRJ A;  1W63 M;  4HJ4 A;  4PKY A;  5J7E A;  3PR6 A;  3B33 A;  3MJQ A;  2J3W A;  4YWZ A;  3MQQ A;  1T18 A;  2HJE A;  2QWS A;  3ICY A;  1XJ2 A;  4H6J B;  2H28 A;  1OPX A;  2XRN A;  2KX6 A;  4Y2F A;  1OJ5 A;  1T1C A;  1UWP X;  4NXE A;  1XJ3 A;  3T4Q A;  4DJ2 A;  4L9F A;  4HNB A;  1KOU A;  3LI8 A;  3MFX A;  5F69 A;  3VE4 A;  3KX0 X;  4BMW A;  2L1M A;  3F1O B;  1TD5 A;  5C5K A;  4II7 A;  4EW7 A;  4HP4 A;  3E4O A;  3LID A;  2JKR M;  5EFW A;  2WKR A;  3RTY A;  4I5S A;  2V1A A;  1ODV A;  1NLY A;  3UB7 A;  3F1N A;  1VHM A;  5DJT A;  3T4J A;  4PKY G;  1YKD A;  2GZA A;  3KSH A;  4MN5 A;  1XJ6 A;  1W63 Q;  2JHE A;  2VZW A;  2O9C A;  2W3G A;  1UWN X;  3W2Z A;  3VV4 A;  4Q0I A;  5F68 A;  4GLQ A;  3E4Q A;  5F5Y A;  3C38 A;  2W1T B;  3HCY A;  2OAQ 1;  3LYX A;  3B42 A;  4CLC B;  3LR5 A;  3MQ0 A;  2XA7 S;  4GHI A;  4HY8 A;  3NOP C;  1DP6 A;  2HGV A;  2M7V A;  5K5B A;  3ZYT A;  3EOI A;  3A0R A;  4AFI A;  4EU0 A;  4CLC D;  3C8C A;  4HQA A;  5HPF A;  3CLO A;  1H8M A;  3UB8 A;  3R7W A;  1EW0 A;  1OT6 A;  3PBR A;  5HD5 A;  2JKR I;  3UB6 A;  2QKP A;  2ZMV A;  3EEA A;  3BQA A;  4OOM A;  3KYZ A;  2R78 A;  3BY9 A;  4NXG A;  2O9B A;  1V9Z A;  4ME4 A;  4EQ1 A;  2CMN A;  1OTE A;  1YSQ A;  1F98 A;  3H7W B;  3IBR A;  3T4O A;  3PBN A;  4HI4 A;  5CX7 A;  3MXQ A;  4XT2 B;  5DKL A;  5DKK A;  3H82 B;  1S4S A;  2OAP 1;  1T19 A;  2ZOI A;  4NEE D;  3LI9 A;  5TBM A;  2EWV A;  2VA0 A;  3C2W A;  2M7U A;  3UE6 A;  3CI6 A;  2J3T D;  5HWW A;  2PD8 A;  3LIE A;  4IJG A;  3PBQ A;  4ZRR A;  3OC2 A;  3TE8 A;  3PBT A;  5HZH A;  3MF0 A;  1TS7 A;  3T4T A;  1OT9 A;  3OCN A;  4WN5 A;  3A0S A;  2B18 A;  1D7E A;  2V1B A;  4NXB A;  2VGL M;  3UME A;  3LR0 A;  2EWW A;  4R70 A;  1LT0 A;  5HPI A;  4IUK A;  4P6Z M;  1F9I A;  1S4R A;  4KUO A;  3E4P A;  3EWK A;  4CLC C;  2OWH A;  3FPW A;  5G4Z A;  1P9W A;  3CUE C;  4KQO A;  3NOU C;  3B47 A;  4LRZ E;  3O5Y A;  1N9L A;  3GDI A;  4G3V A;  4QPR A;  4R3A A;  2D01 A;  4I3A A;  2VX8 A;  2QYB A;  1UGU A;  4YNR A;  4EEU A;  3E98 A;  4O0P A;  3A0V A;  4B9O A;  3E0Y A;  4Q0J A;  1MZU A;  4RQ9 A;  4WEK A;  5HDS A;  1LL8 A;  2Z6C A;  2OOL A;  2ZMF A;  2W1R A;  4YOF A;  2QJ7 A;  4BBU A;  4F3L A;  5KSH A;  2GX5 A;  2J3T C;  1MC0 A;  3OCL A;  3F1P A;  2PYR A;  2Y8H A;  4NKP A;  4EEP A;  4ARZ B;  3OOV A;  2PR5 A;  2O9A A;  3TW8 A;  4H6J A;  1OTA A;  1G6O A;  1NLZ A;  2A24 B;  5AVF A;  4EER A;  1TS6 A;  3UE3 A;  3LR3 A;  3NOT C;  1F5M A;  3IS2 B;  4WL9 A;  3UMD A;  3VE3 A;  5KIZ A;  2HJ9 C;  2VV8 A;  3EGD C;  1OTB A;  2FZ0 A;  2PHY A;  1V9Y A;  4O01 A;  1YAX A;  3F1O A;  1TS0 A;  4MDZ A;  1S1Y A;  3PBS A;  2VLG A;  3LFV A;  4ETX A;  2M1C A;  1OTD A;  2XA7 M;  2W3H A;  3T4L A;  4HOI A;  4LRY C;  4HH3 A;  5HWV A;  4EXO A;  3H9W A;  2A2L A;  1XFQ A;  5DF9 A;  1ZTU A;  3G6O A;  3ZQ5 A;  1DP9 A;  2QHK A;  5I5L A;  3RFB A;  4B93 A;  4GS9 B;  4GJ4 A;  3PXP A;  4KQD A;  4CLC E;  3MR0 A;  4NXF A;  2INW A;  2PDR A;  3FC7 A;  5HSQ A;  5J3W A;  4WEJ A;  2GNX A;  2W1T A;  2BAS A;  2JN7 A;  2I9V A;  3EQV A;  1P0Z A;  3PBO A;  4CLC A;  4PHT A;  3GEC A;  2L4R A;  3OLO A;  1OTI A;  3CUE A;  3PHY A;  4JGR A;  3T50 A;  2V0W A;  5LBR A;  3S7Q A;  2VEA A;  3R4K A;  2YKF A;  4BBT A;  1OJG A;  2L0W A;  1TS8 A;  5L8M A;  1NWZ A;  4R6L A;  1LSX A;  3BQ8 A;  5AVE A;  3S7P A;  1G28 A;  2KLI A;  4JGQ A;  3K2N A;  3S7O A;  2VJW A;  4EUV A;  3LUQ A;  4LRX C;  3KYQ A;  5HDC A;  4WLA A;  4BWI A;  3C30 A;  3H7W A;  2P04 A;  2VV7 A;  1YSP A;  3LIA A;  4WF0 A;  3CAX A;  3RH8 B;  1S1Z A;  4JGP A;  4XT2 A;  5IS1 A;  3H82 A;  4KUK A;  5IU1 A;  1GSW A;  1VB6 A;  2Z6D A;  3LIF A;  4G3W A;  2V9A A;  3EQU A;  2DMW A;  4UQI S;  2ZOH A;  2G7U A;  2W0N A;  1N9O A;  3EGX C;  3TRC A;  5MC7 A;  1D06 A;  2W27 A;  2JKT I;  5DJU A;  2ZBB A;  2P08 A;  4GW9 A;  4I38 A;  3NHQ A;  4EES A;  2W3E A;  5IT5 A;  3LR4 A;  4MN6 A;  2O0Y A;  3CWF A;  1LSW A;  4MCW A;  5HD3 A;  3PYP A;  2K7S A;  1WA9 A;  4M4X A;  2KOI A;  3K3C A;  2IA2 A;  1N9N A;  4HIA A;  5G4Y A;  1XJ4 A;  3D72 A;  4HJ3 A;  1S66 L;  2PR6 A;  3V67 A;  4I39 A;  2HF6 A;  3F1N B;  3DBA A;  1S67 L;  4LLO B;  2EA9 A;  3P01 A;  1TF1 A;  4FOF A;  2B02 A;  2VKS A;  3LIB A;  4IUH A;  4L0L A;  3MMH A;  1GSX A;  3HJK A;  2XRO A;  4DN0 A;  2W3F A;  3S7N A;  2MJ6 A;  2K2N A;  5DFY A;  2PYP A;  1T1B A;  4GHI B;  5F6A A;  5DFX A;  3JVU A;  3K3D A;  3OBF A;  1IOU A;  2K31 A;  3CIT A;  3R7W B;  3LIC A;  5J4E A;  4LPZ A;  2GJ3 A;  4ARZ A;  1BYW A;  4Y3I A;  2W3D A;  5HL6 A;  5A8B A;  1XFN A;  2A24 A;  2QJ5 A;  2O99 A;  4IHQ A;  1Y28 A;  3VOL A;  3P7N A;  3IS2 A;  2KDK A;  2OWJ A;  4HP9 A;  4I3J A;  2PD7 A;  3NJA A;  3FG8 A;  1P9R A;  2NUP C;  1H3Q A;  4DMZ A;  2PT7 A;  2J80 A;  1DRM A;  1IFQ A;  4R38 A;  5TBM B;  4L9G A;  3FPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...