2VGLS

Ap2 clathrin adaptor core
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
142
structure length
142
Chain Sequence
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADAPTOR PROTEIN COMPLEX AP-2, ALPHA 2 SUBUNIT
publication title Molecular Architecture and Functional Model of the Endocytic Ap2 Complex
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
total genus 50
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2007-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2vglS00
2VGLM 2XA7M 1W63M 2HF6A 2FH5A 2JKRI 4UQIS 4P6ZS 2JKTM 4UQIM 4P6ZM 1NRJA 3TJZC 1W63Q 2JKRM 4NEED 2VGLS 2XA7S 2JKTI 5MC7A
chains in the Genus database with same CATH superfamily
3ITBA 2J7VA 4CLCA 2V2FF 3LR3A 2Y2GA 2ZOHA 4IVKA 3IXGA 2JKTM 1XX2A 2J8YA 4ZTKA 4S2KA 2XA7S 2VGLM 5IS1A 3LUQA 2Y55A 5G18A 3G2ZA 2I72A 4KZ5A 1QMEA 3DTMA 1PWDA 5GLBA 4M3KA 3CHWP 3VP2A 2KOIA 3H7WB 3R7WA 3D3OA 2WGVA 2X01A 4ARZB 4MBHA 1K6RA 1KVMA 4MN7A 3VSLA 1BTLA 5C5KA 3S4XA 3LY3A 4NETA 5FQQA 5EVIA 4GLQA 2X71A 3IXDA 1L0DA 2Z2MB 3NY4A 5FI6A 3CMZA 4R3BA 1IYOA 2XR0A 4MN6A 1SZVA 1ES2A 3S7NA 4OP5A 2A49A 4ZRRA 4MMNA 2XF3A 3WS1A 3FPVA 2H5SA 3WS0A 1KGFA 4F3LA 2P7JA 2W3DA 2BG1A 2VV7A 4L9FA 1DP8A 4QY5A 1L0EA 2EA9A 3UY6A 2JKGA 2VGLS 1PNEA 5L07A 1MKMA 3C2WA 2XGNA 1SCWA 4OQGA 3JVUA 4R4RA 2JKRI 1DP9A 2Y59A 4GB7A 3ZGAB 1TD5A 4E3KA 2XD5A 3O5YA 2K31A 4KG2A 3W4PA 3D72A 3KSGA 3S7QA 3FPWA 1NRJA 3EEHA 2X02A 2W3GA 2ZL1B 3AGEA 1E3UD 2HDSA 4LFUA 4UA9A 5J7EA 4LLOB 3GQZA 1Q2QA 4GZBA 4HNBA 1ONHA 2QKPA 1ZG4A 4WELA 4GS9B 3PHYA 5HPIA 3NBLA 4P6ZS 5FQIA 3V67A 5DJTA 2XK1A 1HZOA 3IXBA 3SZTA 4BWIA 2JKTI 2WGWB 3IWOA 4S2IA 5DKLA 2WAEA 3BY9A 3LYXA 3RFBA 5HDCA 2EX9A 3AGDA 2V8CA 1T18A 3TOIA 1TVFA 3N8RA 1K54C 3TJZC 3TW8A 1LSVA 1IELA 4DE0A 5CX7A 4GHIB 1T19A 2Y4AA 2M7UA 3G6OA 1VETA 5E2FA 2JC7A 1YLPA 1MPLA 4XUXA 3OC2A 2L4RA 1XJ2A 3BQ8A 2Y2NA 1MC0A 3IWQA 5F82A 3UB8A 4WM9A 4AFIA 3L9KA 3CUEC 5DVAA 3CITA 2V1ZA 2V20A 3G2YA 4X1LA 2AVXA 4I3AA 3IF6B 2FZ0A 1A0KA 3MQOA 5FAOA 4LCLA 4FCFA 4OVDA 2WZXA 3HJKA 4GD8A 3GDIA 2W1TB 1E25A 3VV4A 2J3WA 2WUQA 2DCFA 4YWZA 1FQGA 3QP6A 4LRYC 2R9WA 4KQOA 3N6IA 4I3IA 5AQ7A 4S2OA 4DDYA 1BYWA 1UWNX 2WKIA 1G28A 3HL9A 4DE3A 5EVID 3P7NA 3HUOA 2Y2PA 2E8JA 3C30A 3T4TA 1S66L 1YLWA 1GHPA 3B47A 5HDSA 1IKGA 4N9KA 1I2WA 3PBNA 2WK0A 2HDRA 3UNWA 1BLPA 2WKPA 4JBFA 3FKVA 2ACGA 2OAP1 4K08A 4GDBA 2OWHA 5FSRA 2HF6A 3LR4A 4WEKA 3HLGA 2BLSA 1XGJA 2WKEA 2ZBBA 1Y54A 5GLAA 3R4KA 4R70A 2P08A 1CI8A 4NEED 3P01A 3LI8A 1V9ZA 4LV0A 1YAXA 3A0VA 2DRWA 5EECA 4Y3IA 3CJMA 4KZ9A 2G7UA 1FCNA 5BOHA 1KGGA 5CGSA 5FQ9A 2EFUA 1YLYA 2PR6A 3UN7A 3LY4A 3BEBA 3CAXA 5CRFA 3A0RA 5HAQA 1MWUA 2I9VA 4KG5A 4E6XA 4ARZA 3ZQ5A 3GMWA 3UB5P 4U3TA 5GHYA 1L3LA 4EUVA 2BTFP 1EI5A 3BQAA 4KZAA 5HZHA 4O7DA 2OLVA 4Y17A 1YPRA 4ETXA 4XT2B 3PBTA 1PZPA 3PAGA 4EUZA 5CEBA 4HJ6A 4DKIA 4GKUA 3QP1A 5TGFA 3UDFA 4ZJ2A 2CMNA 4OOMA 5FAPA 3MS6A 1NXYA 1BT5A 3O86A 2PHYA 1TEMA 3IF6C 4EQ1A 4N1XA 3EWKA 2PDRA 3SS3A 4HY8A 3S7OA 2Q0OA 5EVEA 3LIEA 4JF6A 3MKFA 4EWFA 4EERA 4Y13A 3RH8B 1D7EA 1MXOA 4OOYA 2WKQA 3UPOA 2HP6A 3DBAA 3GV9A 3HUMA 3OZHA 3C5AA 2R78A 4MDZA 1W63Q 4E3OA 5M1AA 4Z9QA 4KZ6A 5GLCA 4I38A 1HTZA 4FD8A 4R6LA 1BSGA 3LO7A 1STZA 4BLMA 3JYIA 2ZM0A 1KE4A 5G4ZA 1XFNA 1T1CA 2GDNA 3HLFA 5L8MA 4YINA 1Q2PA 3FC7A 5E2GA 4JXSA 2WGWA 4YNRA 1VEUB 2VGKA 1K57A 3HCYA 2VKSA 4HI4A 4B88A 5LBRA 2HZ5A 4IEDA 4GCZA 3T4JA 2J3TD 3LIDA 3V50A 2H10A 4C75A 3BFDA 1F5MA 1ESUA 3ZCZA 4K0XA 2IA2A 2H0YA 3HLDA 1J9MA 4P6BA 3F1NA 1TS0A 3TRCA 3VP0A 3E2LA 4Y2FA 3IQAA 4MBFA 4ME4A 3S1YA 4ZAMA 2V0WA 3EGDC 4DRTA 4PM9A 4HJ4A 3IS2B 5HL1A 1NLZA 1CF0A 3F1PB 4HIAA 4EBLA 3Q07A 4GNUA 3M2KA 1OPXA 1SKFA 5AQAA 1OTBA 4NKPA 3C4OA 3ZG0A 5HAPA 1E4DA 3BWLA 3A3DA 1KDSA 2Y2IA 2P9VB 2ZQAA 3DTEA 2PU4A 1GCEA 4EV4A 3QNBA 3MR0A 3EGXC 1LHYA 2OV5A 4HP4A 1ES5A 3H9WA 3BLSA 4Y5FA 1X0OA 5HPFA 2NUPC 3LEZA 4S2PA 4HJ3A 2QMIA 3BW6A 5EOEA 4O8GA 2H28A 3IX8A 1K55A 1AWIA 1GHMA 2M7VA 4EEPA 3O88A 3HLCA 3S22A 3T1QB 4G3VA 4RYEA 1XJ6A 5DKKA 1IYSA 1NY0A 2QZ6A 4R38A 3PYPA 4KQRA 1EROA 2DMWA 4KQQA 4PM6A 4CJNA 3BJNA 1DJAA 3H82A 3N8LA 2PBDP 4L0LA 2V9AA 3C7VA 4HHDA 4B4ZA 3T4KA 2EXAA 2O9CA 2A3UA 2QWSA 5DF7A 4OLDA 4U0TA 4OP8A 1MBLA 2VA0A 4LRZE 3VFFA 2J80A 3NJAA 2ZQ7A 3MBZA 4KUKA 1NWZA 5KSHA 2FH5A 1DRMA 4HH3A 3IBRA 1O7EA 4F94A 4NXFA 1NZOA 2PU2A 4PM7A 4KQDA 5HWVA 4KZ7A 5JYPA 2ZC7A 1ESIA 1GA9A 1LL9A 3LR5A 3UE0A 4P0MA 4HESA 3CPTA 3LIAA 1Y4OA 3NCKA 4QPRA 4Q0IA 4UEYA 2J9OA 2R9XA 5GHXA 1W7FA 4GOGA 4WF0A 3AGFA 2Y91A 4I5SA 1FOFA 2A24B 1Z6FA 1O07A 3EEAA 4X69A 5GL9A 1WE4A 4XT2A 5FEFA 4JF4A 4EESA 1I2SA 3ZHHA 3EOIA 1K4FA 2ZM8A 5CGWA 5E43A 5D3OA 3N8SA 3OCNA 3T50A 3ZG7B 3V5MA 3NDEA 4WBGA 4MCWA 1XP4A 3Q81A 2D02A 5FATA 1U60A 2ZQ8A 3G30A 4S2NC 5DF8A 1FILA 3NHQA 4FSFA 4EEUA 3K2NA 4R0QA 2PR5A 1XKZA 1VHMA 5TBMA 2V1BA 4Q8IA 1P97A 1S1YA 4EQIA 2WKHA 1ONGA 3T12B 3TSGA 2DNSA 2EXBA 4HBUA 3UDIA 1S4SA 2EFXA 2JKFA 1CJFA 3KSFA 1SKOB 1RP5A 3EQVA 1S1ZA 1YSQA 5AQ9A 1WA9A 1MWSA 1SDNA 3B33A 4S2JA 4OPRA 4GDNA 1G6AA 4OPZA 4OPYA 1L0GA 4WMCA 3ISGA 5HD5A 2XH9A 5CXWA 3SOIA 3V3RA 5HAIA 4UAAA 2Z2LB 2XFSA 5CECA 2HP9A 3CLOA 4JLFA 2PAVP 1DJBA 3OOVA 5IT5A 2VZWA 4CLCD 5DFXA 1TS7A 4E6WA 4E3NA 3I7JA 3KO6A 1S67L 4QD4A 4MEZA 4BL3A 2K7SA 2Y2HA 3GVBA 3PXPA 4B9OA 1CQAA 2Y8HA 4BD0A 3ZFZA 2P04A 5FQMA 1DP6A 3PTEA 3CG5A 1KOUA 1PZOA 1TF1A 1IFQA 3WRZA 2B18A 1YT4A 1YMSA 4IJGA 4E3JA 2GNXA 4C6YA 3L7HA 1K0KA 1KE0A 5FQKA 3HVFA 5KSCA 1IEMA 5FAQA 5DTSA 2GZAA 2GJ3A 3LFVA 3CWFA 1M6KA 4UHUA 1OT9A 2O99A 3IS2A 3BLMA 3ZYTA 1MKIA 3A3EA 3A3IA 4MLLA 2V8FA 3T4QA 3WS2A 2Q9MA 1OTDA 1YKDA 1GSVA 1G68A 5DTTA 4N92A 1JTGA 4GN2A 2INWA 5EUAA 2P9VA 3EQUA 1BZAA 1KVLA 4A5RA 5F6AA 3IX3A 3G31A 3OBFA 2HP5A 2Y2KA 3MFXA 5F69A 5K5BA 4WZ5C 3UPPA 3K3DA 2EWVA 2ZQDA 4DE2A 3HLBA 3G34A 3PBSA 2RL3A 3QP5A 5EM0A 4GJ4A 3QP2A 1F98A 1FSYA 5A91A 3VE3A 4ZDXA 5L2FA 1K54A 5HX9A 1I5QA 5DJUA 1W8YA 3ZDJA 4DJ3A 2D01A 4X25A 2JE5A 1H3QA 4QHCA 5J4EA 5CTMA 3IWIA 4OQHA 3O87A 5TR7A 1JWPA 5E2EA 3VP1A 4U0XA 3D4FA 4BMWA 1LSWA 5MC7A 4H6JB 3SS5A 3PR6A 3R7WB 4DXCA 3CUEA 4N1HA 2ZQCA 3PBOA 4XXRA 4JGPA 5L09A 4Y0UA 2WKRA 3P09A 4X55A 3FYZA 4NXEA 3BFCA 5EVIB 1QMFA 1PWCA 3H7WA 5EVLA 3V39A 5M19A 2LB5A 2JBFA 1LL5A 3BM6A 1VM1A 2QYBA 2W3HA 4DF6A 4OH0A 4NXBA 2ZMVA 4IUHA 2V0UA 2EWWA 1K56A 3VE4A 3Q7ZA 1Y28A 4FH2A 1PFLA 3C4PA 2W1RA 1WYBA 1XXMA 2Y79A 1N9OA 4YOFA 4BBVA 2PRFA 5IU1A 5F1GA 4O0PA 4N9LA 1VB6A 4PKYG 4BBUA 3NI9A 4OQ0A 3RXWA 3QNCA 3DW0A 2WZZA 4Y0OA 1DY6A 4BQMA 2ZJ9A 3T1XA 4OPQA 4X1MA 5A8BA 1HD8A 2YKFA 1PIOA 2V1AA 4FTXA 3UMEA 4D60A 1Z09A 5F1FA 3GECA 1K6SA 4GW9A 4HEFA 3W2ZA 3IBJA 4M4XA 5FDHA 4YFMA 2FFFB 2ZL1A 1OJ5A 1H8ZA 4JPMA 1NRFA 3QP8A 2HJ9C 1VQQA 1LI0A 4IUKA 1WYCA 4UQIM 2ZC5B 3IT9A 2OWJA 3HUNA 2OAQ1 4GS9A 3A0SA 1XPBA 4UA7A 4X6TA 1NYMA 4FOFA 4EW7A 4X68A 3V3SA 2JN7A 4D2OA 2P74A 1S4RA 1JWVA 5KIZA 5CERA 5TFQA 4PKYA 1PI4A 3FWLA 5U47A 4G3KA 1ZKJA 3VOYA 4KENB 1PYYA 2KLIA 3BRMA 3MKEA 5DFYA 2E8IA 3MFDA 3VP3A 1RCJA 5AJGA 4GHIA 3CI6A 1FR1A 4FUWA 2G2WA 1N9LA 3SH9A 1PRQA 2L1MA 2HPBA 1OTAA 3U4LP 3JVVA 4Y7PA 2EX2A 3MMHA 1XFQA 1MY8A 3GSGA 1CI9A 4K0WA 3WRTA 3IF6A 5FI2A 4G3WA 4UQIS 4NK3A 5EVIC 1JWZA 1YMXA 3Q1FA 3WWXA 1IOUA 1ERQA 3UE6A 1FIKA 3DTKA 2W1TA 4R3AA 3W4OA 5J3WA 2M1CA 2PD8A 2XFTA 4WL9A 4II7A 3KYZA 3G32A 5F83A 3G4PA 4LV2A 2ZD8A 3RTYA 3ICYA 4PPRA 1K56D 5M18A 2JKRM 4PAUA 4HQAA 5AQBA 3F1OB 2J9PA 4PMAA 5F68A 4EXOA 1J3WA 1W63M 2HV1A 3IHBA 3ZG9B 5CHJA 2ZMAA 3C8CA 4WYYA 3NECA 4Q0JA 1EWZA 1ZHHB 4I3JA 2BASA 4OQIA 3UB6A 1T1AA 2QHKA 1RGZA 2Y2MA 3VOLA 3MSHA 4Q0HA 1TDGA 1OTIA 4WLAA 5HFOA 4DE1A 2Q9NA 3NOPC 2W27A 1UWPX 3B3XA 1ODVA 1C3BA 3UB7A 3UPNA 4NG2A 1H8YA 1SHVA 2W3EA 3K3CA 4B4XA 4JGRA 3GRJA 4O01A 4CLCE 2IWBA 1P9RA 3VMAA 4H6JA 3JPUA 4JXVA 4HOIA 4OKPA 4OOLA 5EPHA 5EFWA 3MXSA 3ZNYA 3QP4A 2KDKA 2HGVA 3OLOA 1NYYA 3PAEA 3UO9A 3E2KA 4MNRA 3DWZA 3MZEA 3DWKA 3MJQA 2XSSA 4MBKA 4DMZA 2VV6A 2ZC3B 3WS5A 1ES3A 3UE1A 1AXBA 1H5XA 3IHAA 2ZM2A 1PWGA 1LSXA 3IXHA 4S2LA 1N9NA 4P6ZM 5FQJA 2Y2LA 3OPRA 5CTNA 1K25A 1FSWA 2ZOIA 3OPLA 2W0NA 1F2KA 2ZQ9A 3VSKA 1V9YA 1ZC2A 3G35A 2C6WB 4QU3A 3E0YA 2Y2QA 4C3QA 1W5DA 4ZJ1A 4KZ4A 2VGJA 3BECA 4CPKA 3A3JA 1GA0A 1YSPA 3KSHA 5EM1A 3T1SA 3MZFA 1YLZA 3SW1A 4L9EA 1ERMA 3LI9A 5HDDA 3FZCA 2ZMFA 3HREA 3BFFA 4GD6A 5AVFA 5IHVA 1IKIA 3C7UA 5A93A 1GSXA 1GSWA 3IX4A 4X56A 4Y0TA 4MN5A 3NULA 5JYOA 1PW1A 2HJEA 5FA7A 5HARA 3TG9A 1BUEA 4EETB 1GHIA 3D9YA 3ZVWA 3QHYA 5HWWA 1D1JA 2RCXA 5CGXA 1FCMA 2VX8A 1KDWA 3U2AA 3Q7VB 3LICA 3GTCA 1ACFA 3VP4A 5CEDA 1N9BA 2O0YA 2J3TC 5HWTA 4S2MA 2PD7A 3MXQA 4DN0A 4LCMA 4E3MA 1FCOA 2QJ5A 2XRNA 5KZHA 1VEUA 4KUOA 1YLTA 4CQHA 2XROA 3F1NB 4XUZA 2XEPA 5I94A 1JTDA 4OLGA 4DDSA 1KE3A 4RX3A 5GHZA 1PI5A 1BLSA 1HLUP 3BFGA 3FG8A 1H8MA 2MJ6A 5HD3A 2OOLA 3CZDA 3BYDA 5E2HA 1TS6A 2VEAA 1MWTA 3W4QA 2QPNA 3OPPA 3W8KA 3NDGA 4LV1A 4PM5A 1M40A 3F1PA 3HLWA 1OTEA 1S6RA 3T4LA 1T1BA 4S2NA 1LLBA 2Y2JA 4JGOA 2B95A 1NJ4A 1ES4A 4LPZA 1YQSA 1UGUA 2H0TA 4DXBA 4RVAA 1IYPA 2QJ7A 1W8QA 3T4SA 4EBPA 2O9AA 4LGWA 4LENA 4KG6A 4QJGA 2VK3A 2VV8A 2GX5A 3ZG8B 5FL3A 5AVEA 4QY6A 4CLCB 3UMDA 4LV3A 3MQ0A 4ESPA 2WGIA 1LI9A 3WS4A 2Y2OA 3F1OA 2XLNA 2ZC4B 4E3IA 1N4OA 1CEGA 1D06A 1ZG6A 4H8RA 3LIFA 1CEFA 1S0WA 1TDLA 3KX0X 1JNUA 3KYEA 4HH2A 3GR2A 1BULA 2G2UA 4BENA 1F9IA 3ZNTA 2Z6CA 3H82B 4IVIA 5HL6A 4KZBA 4E3LA 3MXRA 1P0ZA 2O9BA 5TJJA 3LIBA 4JXGA 4JF5A 2PBYA 4PM8A 3VFHA 4E04A 4RA7A 4R23A 1BLCA 5A90A 4K91A 2B5RA 3E98A 4RX2A 4P85A 4ID4A 1XJ4A 4WN5A 1TS8A 4KZ8A 2YKHA 1K4EA 2UV0E 3LCEA 3ZG5A 5CHMA 3HBRA 3CPTB 1K57C 4L9GA 3A3FA 3LR0A 5DF9A 1OJGA 2NUTC 5EV0A 1KGEA 3LGOA 4WMCD 4X53A 4OONA 3IH8A 2WAFA 3MZDA 4F3LB 4ETZA 2HDUA 5EOOA 1MZUA 5CHUA 1W79A 3DTIA 2EX8A 1L0FA 1G6OA 1IYQA 2L0WA 3C38A 5FDSA 1PW8A 1XA7A 3E4PA 4HP9A 3BFEA 4IHQA 2A24A 4WZ5A 3VOZA 3O3VA 1H0MA 3SS4A 2UWXA 4IBXA 3UE3A 5FASA 3IH9A 2PYRA 5G4YA 3ITAA 2C5WB 2XD1A 1NLYA 2WADA 5FEGA 4DJ2A 2VLGA 3SH7A 3IF5A 1LL8A 1MWRA 2IWCA 5TBMB 2PYPA 3NOUC 4WEJA 4QB8A 3T4OA 3ULFA 4WUJA 5EE8A 3DAVA 5HW3A 1YM1A 1L2SA 4LRXC 4KZ3A 3OCLA 4EBNA 1XGIA 2XDMA 3UB9A 2FFYA 2CC1A 4UA6A 4BBTA 2VJWA 4RQ9A 4R3JA 3FKWA 4CLCC 1VETB 1SKOA 1DJCA 1K55C 1YLJA 2JCHA 2KX6A 4NXGA 3FV7A 5DTKA 2W3FA 3Q7VA 1G5UA 3OPHA 5J8XA 2A2LA 2OLUA 2ZC6B 4BL2A 3E4QA 1JVJA 2HDQA 2Z6DA 3PBRA 4QWOA 1XA1A 3KYQA 2EX6A 3BY8A 4ZBEA 3MF0A 4P87A 4JGQA 3UDXA 3NIAA 4BD1A 3NOTC 5L10A 3MQQA 4R4SA 1ZTUA 5I5LA 1CK3A 4HBTA 3RXXA 1BLHA 2WYXA 3E4OA 1E3UA 4JXWA 4ZJ3A 1NZUA 5F5YA 4Y15A 1EW0A 1RGYA 3NC8A 3P98A 2LB9A 5GLDA 4PHTA 1HVBA 3SH8A 3LEQA 2XA7M 1K38A 2PT7A 1OT6A 2JHEA 3N4IA 1OMEA 4EU0A 3M6BA 4B93A 2B02A 5KMWA 3HLEA 1SDEA 3N7WA 3M6HA 2IWDA 4Z1WA 3TE8A 2ZLYA 1FR6A 3S7PA 4IBRA 5A92A 3Q82A 3PBQA 4WZ4A 3B42A 3HJIA 3KSIA 4FH4A 4I39A 2K2NA 4BJPA 3RJUA 5FI7A 2XQZA 1P9WA 3T1RA 3M2JA 3ZVTA 1ALQA 4JKTA 1XJ3A 4R1GA 2OSUA 1LT0A 5HSQA
chains in the Genus database with same CATH topology
1F98A 3VE3A 4R6LA 4CLCA 1STZA 5HWWA 5DJUA 3LR3A 2ZOHA 5G4ZA 4DJ3A 2D01A 1XFNA 1T1CA 2VX8A 2JKTM 1H3QA 5J4EA 3U2AA 3LICA 5L8MA 4BMWA 2O0YA 2XA7S 2J3TC 1LSWA 5MC7A 5HWTA 2VGLM 4H6JB 5IS1A 3FC7A 2PD7A 3LUQA 3MXQA 4DN0A 3PR6A 2QJ5A 2XRNA 4YNRA 3R7WB 3CUEA 3PBOA 3HCYA 4JGPA 2VKSA 2WKRA 2KOIA 4HI4A 3H7WB 3R7WA 4NXEA 5LBRA 3D3OA 4KUOA 4ARZB 4CQHA 4GCZA 3T4JA 2J3TD 3LIDA 4MN7A 3H7WA 2XROA 3F1NB 1F5MA 2LB5A 5C5KA 2IA2A 4GLQA 2QYBA 2W3HA 4NXBA 2ZMVA 3F1NA 4IUHA 1TS0A 2V0UA 2EWWA 3TRCA 3VE4A 4Y2FA 3FG8A 4ME4A 4MN6A 1H8MA 2MJ6A 5HD3A 1Y28A 2OOLA 2W1RA 3S7NA 2V0WA 3EGDC 4ZRRA 4HJ4A 4MMNA 2Y79A 3IS2B 1N9OA 1NLZA 4YOFA 1TS6A 4BBVA 2VEAA 5IU1A 3FPVA 3F1PB 4HIAA 4O0PA 1VB6A 1OPXA 4PKYG 4BBUA 1OTBA 4NKPA 4F3LA 2P7JA 3F1PA 2W3DA 1OTEA 3T4LA 1T1BA 3BWLA 2VV7A 4L9FA 1DP8A 4JGOA 2EA9A 2VGLS 4LPZA 1MKMA 3C2WA 1UGUA 3MR0A 5A8BA 3EGXC 2YKFA 2V1AA 3JVUA 4HP4A 2QJ7A 3UMEA 2JKRI 1DP9A 3H9WA 1TD5A 3T4SA 3O5YA 2K31A 3GECA 2O9AA 3D72A 4Y5FA 3KSGA 3S7QA 3FPWA 1NRJA 1X0OA 4GW9A 3EEHA 2VV8A 2GX5A 2W3GA 3W2ZA 3IBJA 5HPFA 2NUPC 5FL3A 4M4XA 5AVEA 4CLCB 3UMDA 5J7EA 3MQ0A 4LLOB 4HJ3A 4HNBA 1OJ5A 3BW6A 2QKPA 3F1OA 4O8GA 2H28A 2HJ9C 4WELA 4GS9B 4IUKA 2M7VA 3PHYA 4EEPA 1D06A 5HPIA 4P6ZS 4UQIM 3V67A 2OWJA 5DJTA 2OAQ1 3LIFA 4G3VA 4GS9A 3A0SA 1XJ6A 5DKKA 3KX0X 1JNUA 4HH2A 4BWIA 4R38A 2JKTI 4FOFA 4EW7A 3PYPA 1F9IA 5DKLA 2JN7A 3BY9A 2Z6CA 3H82B 3LYXA 1S4RA 3RFBA 5KIZA 5HDCA 5HL6A 4PKYA 2DMWA 1P0ZA 2O9BA 5TJJA 4G3KA 1T18A 3BJNA 3H82A 3LIBA 4L0LA 2V9AA 4HHDA 3TJZC 2KLIA 3TW8A 1LSVA 4E04A 5CX7A 3T4KA 4GHIB 2O9CA 1T19A 2QWSA 2M7UA 3G6OA 5DFYA 3E98A 2VA0A 4LRZE 5AJGA 4GHIA 2J80A 3NJAA 3OC2A 3CI6A 1XJ4A 4KUKA 1NWZA 1TS8A 4WN5A 5KSHA 2L4RA 2FH5A 1DRMA 1XJ2A 3BQ8A 3IBRA 4HH3A 2YKHA 1N9LA 1MC0A 4NXFA 3UB8A 4AFIA 4KQDA 5HWVA 2L1MA 3CUEC 3CITA 1OTAA 4L9GA 3LR0A 5DF9A 1OJGA 2NUTC 3JVVA 3LR5A 4I3AA 2FZ0A 3MMHA 1XFQA 3LIAA 3MQOA 4F3LB 4QPRA 3HJKA 4Q0IA 4UEYA 4ETZA 4G3WA 3GDIA 4UQIS 2W1TB 1MZUA 3VV4A 4WF0A 1IOUA 2J3WA 1G6OA 3UE6A 4I5SA 2A24B 2L0WA 4YWZA 2W1TA 3C38A 4LRYC 4R3AA 3EEAA 4KQOA 5J3WA 2M1CA 3E4PA 2PD8A 4I3IA 4WL9A 4HP9A 4II7A 4IHQA 2A24A 4XT2A 1BYWA 1UWNX 1G28A 3KYZA 4EESA 3EOIA 3P7NA 3OCNA 3RTYA 3T50A 3UE3A 3ICYA 2PYRA 5G4YA 3C30A 4MCWA 2JKRM 4PAUA 4HQAA 3T4TA 2D02A 1NLYA 3F1OB 1S66L 5F68A 4EXOA 4DJ2A 3B47A 2VLGA 5HDSA 1W63M 2HV1A 1LL8A 3NHQA 4FSFA 4EEUA 5TBMB 3PBNA 2PYPA 3NOUC 4WEJA 3T4OA 3ULFA 3C8CA 3K2NA 2PR5A 4Q0JA 4WUJA 1VHMA 1ZHHB 4I3JA 5TBMA 2WKPA 2BASA 2V1BA 1P97A 4LRXC 3UB6A 1S1YA 1T1AA 2QHKA 3VOLA 4Q0HA 2OAP1 3OCLA 4K08A 1OTIA 2OWHA 4WLAA 3UB9A 2HF6A 3LR4A 1S4SA 3NOPC 4BBTA 2VJWA 4RQ9A 3KSFA 4WEKA 2W27A 3EQVA 1S1ZA 1YSQA 1WA9A 1UWPX 2ZBBA 1ODVA 3B33A 3UB7A 4CLCC 3R4KA 5HD5A 4R70A 2P08A 2KX6A 2W3EA 3K3CA 4JGRA 4NXGA 4NEED 2W3FA 3P01A 3LI8A 4O01A 4CLCE 1V9ZA 1YAXA 3A0VA 4Y3IA 3CLOA 1P9RA 2G7UA 2A2LA 4H6JA 3E4QA 4HOIA 3OOVA 5IT5A 2Z6DA 2PR6A 4OOLA 5EFWA 2VZWA 4CLCD 5DFXA 1TS7A 3PBRA 2KDKA 2HGVA 3KO6A 3CAXA 3OLOA 3A0RA 1S67L 3KYQA 2K7SA 3BY8A 3PXPA 3MF0A 3MJQA 2I9VA 4B9OA 2XSSA 4JGQA 4ARZA 4DMZA 2VV6A 2Y8HA 3ZQ5A 2P04A 3NOTC 3MQQA 1DP6A 1ZTUA 1KOUA 5I5LA 1TF1A 1IFQA 4EUVA 1LSXA 2B18A 3BQAA 3E4OA 1N9NA 4P6ZM 5HZHA 4IJGA 2GNXA 4ETXA 2ZOIA 5F5YA 2W0NA 1EW0A 4XT2B 2LB9A 3PBTA 4PHTA 1V9YA 2XA7M 2GZAA 2PT7A 2GJ3A 3LFVA 4HJ6A 3CWFA 1OT6A 3E0YA 1OT9A 2JHEA 2O99A 3IS2A 3ZYTA 4EU0A 2CMNA 4OOMA 2B02A 4B93A 3T4QA 1YSPA 1OTDA 2PHYA 1YKDA 1GSVA 3KSHA 4EQ1A 4Z1WA 3EWKA 2PDRA 3TE8A 4HY8A 3SW1A 4L9EA 3S7PA 3S7OA 3LI9A 2INWA 5HDDA 3PBQA 3LIEA 2ZMFA 3B42A 3HJIA 3EQUA 3KSIA 4EERA 4I39A 5AVFA 2K2NA 5F6AA 3RH8B 4BJPA 1D7EA 3OBFA 2WKQA 1GSXA 3MFXA 1GSWA 3DBAA 5F69A 5K5BA 4MN5A 3K3DA 2EWVA 2R78A 1P9WA 4MDZA 1W63Q 2HJEA 3PBSA 1XJ3A 1LT0A 4GJ4A 5HSQA 4I38A 4EETB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VGL M;  2XA7 M;  1W63 M;  2HF6 A;  2FH5 A;  2JKR I;  4UQI S;  4P6Z S;  2JKT M;  4UQI M;  4P6Z M;  1NRJ A;  3TJZ C;  1W63 Q;  2JKR M;  4NEE D;  2VGL S;  2XA7 S;  2JKT I;  5MC7 A; 
#chains in the Genus database with same CATH topology
 3ITB A;  2J7V A;  4CLC A;  2V2F F;  3LR3 A;  2Y2G A;  2ZOH A;  4IVK A;  3IXG A;  2JKT M;  1XX2 A;  2J8Y A;  4ZTK A;  4S2K A;  2XA7 S;  2VGL M;  5IS1 A;  3LUQ A;  2Y55 A;  5G18 A;  3G2Z A;  2I72 A;  4KZ5 A;  1QME A;  3DTM A;  1PWD A;  5GLB A;  4M3K A;  3CHW P;  3VP2 A;  2KOI A;  3H7W B;  3R7W A;  3D3O A;  2WGV A;  2X01 A;  4ARZ B;  4MBH A;  1K6R A;  1KVM A;  4MN7 A;  3VSL A;  1BTL A;  5C5K A;  3S4X A;  3LY3 A;  4NET A;  5FQQ A;  5EVI A;  4GLQ A;  2X71 A;  3IXD A;  1L0D A;  2Z2M B;  3NY4 A;  5FI6 A;  3CMZ A;  4R3B A;  1IYO A;  2XR0 A;  4MN6 A;  1SZV A;  1ES2 A;  3S7N A;  4OP5 A;  2A49 A;  4ZRR A;  4MMN A;  2XF3 A;  3WS1 A;  3FPV A;  2H5S A;  3WS0 A;  1KGF A;  4F3L A;  2P7J A;  2W3D A;  2BG1 A;  2VV7 A;  4L9F A;  1DP8 A;  4QY5 A;  1L0E A;  2EA9 A;  3UY6 A;  2JKG A;  2VGL S;  1PNE A;  5L07 A;  1MKM A;  3C2W A;  2XGN A;  1SCW A;  4OQG A;  3JVU A;  4R4R A;  2JKR I;  1DP9 A;  2Y59 A;  4GB7 A;  3ZGA B;  1TD5 A;  4E3K A;  2XD5 A;  3O5Y A;  2K31 A;  4KG2 A;  3W4P A;  3D72 A;  3KSG A;  3S7Q A;  3FPW A;  1NRJ A;  3EEH A;  2X02 A;  2W3G A;  2ZL1 B;  3AGE A;  1E3U D;  2HDS A;  4LFU A;  4UA9 A;  5J7E A;  4LLO B;  3GQZ A;  1Q2Q A;  4GZB A;  4HNB A;  1ONH A;  2QKP A;  1ZG4 A;  4WEL A;  4GS9 B;  3PHY A;  5HPI A;  3NBL A;  4P6Z S;  5FQI A;  3V67 A;  5DJT A;  2XK1 A;  1HZO A;  3IXB A;  3SZT A;  4BWI A;  2JKT I;  2WGW B;  3IWO A;  4S2I A;  5DKL A;  2WAE A;  3BY9 A;  3LYX A;  3RFB A;  5HDC A;  2EX9 A;  3AGD A;  2V8C A;  1T18 A;  3TOI A;  1TVF A;  3N8R A;  1K54 C;  3TJZ C;  3TW8 A;  1LSV A;  1IEL A;  4DE0 A;  5CX7 A;  4GHI B;  1T19 A;  2Y4A A;  2M7U A;  3G6O A;  1VET A;  5E2F A;  2JC7 A;  1YLP A;  1MPL A;  4XUX A;  3OC2 A;  2L4R A;  1XJ2 A;  3BQ8 A;  2Y2N A;  1MC0 A;  3IWQ A;  5F82 A;  3UB8 A;  4WM9 A;  4AFI A;  3L9K A;  3CUE C;  5DVA A;  3CIT A;  2V1Z A;  2V20 A;  3G2Y A;  4X1L A;  2AVX A;  4I3A A;  3IF6 B;  2FZ0 A;  1A0K A;  3MQO A;  5FAO A;  4LCL A;  4FCF A;  4OVD A;  2WZX A;  3HJK A;  4GD8 A;  3GDI A;  2W1T B;  1E25 A;  3VV4 A;  2J3W A;  2WUQ A;  2DCF A;  4YWZ A;  1FQG A;  3QP6 A;  4LRY C;  2R9W A;  4KQO A;  3N6I A;  4I3I A;  5AQ7 A;  4S2O A;  4DDY A;  1BYW A;  1UWN X;  2WKI A;  1G28 A;  3HL9 A;  4DE3 A;  5EVI D;  3P7N A;  3HUO A;  2Y2P A;  2E8J A;  3C30 A;  3T4T A;  1S66 L;  1YLW A;  1GHP A;  3B47 A;  5HDS A;  1IKG A;  4N9K A;  1I2W A;  3PBN A;  2WK0 A;  2HDR A;  3UNW A;  1BLP A;  2WKP A;  4JBF A;  3FKV A;  2ACG A;  2OAP 1;  4K08 A;  4GDB A;  2OWH A;  5FSR A;  2HF6 A;  3LR4 A;  4WEK A;  3HLG A;  2BLS A;  1XGJ A;  2WKE A;  2ZBB A;  1Y54 A;  5GLA A;  3R4K A;  4R70 A;  2P08 A;  1CI8 A;  4NEE D;  3P01 A;  3LI8 A;  1V9Z A;  4LV0 A;  1YAX A;  3A0V A;  2DRW A;  5EEC A;  4Y3I A;  3CJM A;  4KZ9 A;  2G7U A;  1FCN A;  5BOH A;  1KGG A;  5CGS A;  5FQ9 A;  2EFU A;  1YLY A;  2PR6 A;  3UN7 A;  3LY4 A;  3BEB A;  3CAX A;  5CRF A;  3A0R A;  5HAQ A;  1MWU A;  2I9V A;  4KG5 A;  4E6X A;  4ARZ A;  3ZQ5 A;  3GMW A;  3UB5 P;  4U3T A;  5GHY A;  1L3L A;  4EUV A;  2BTF P;  1EI5 A;  3BQA A;  4KZA A;  5HZH A;  4O7D A;  2OLV A;  4Y17 A;  1YPR A;  4ETX A;  4XT2 B;  3PBT A;  1PZP A;  3PAG A;  4EUZ A;  5CEB A;  4HJ6 A;  4DKI A;  4GKU A;  3QP1 A;  5TGF A;  3UDF A;  4ZJ2 A;  2CMN A;  4OOM A;  5FAP A;  3MS6 A;  1NXY A;  1BT5 A;  3O86 A;  2PHY A;  1TEM A;  3IF6 C;  4EQ1 A;  4N1X A;  3EWK A;  2PDR A;  3SS3 A;  4HY8 A;  3S7O A;  2Q0O A;  5EVE A;  3LIE A;  4JF6 A;  3MKF A;  4EWF A;  4EER A;  4Y13 A;  3RH8 B;  1D7E A;  1MXO A;  4OOY A;  2WKQ A;  3UPO A;  2HP6 A;  3DBA A;  3GV9 A;  3HUM A;  3OZH A;  3C5A A;  2R78 A;  4MDZ A;  1W63 Q;  4E3O A;  5M1A A;  4Z9Q A;  4KZ6 A;  5GLC A;  4I38 A;  1HTZ A;  4FD8 A;  4R6L A;  1BSG A;  3LO7 A;  1STZ A;  4BLM A;  3JYI A;  2ZM0 A;  1KE4 A;  5G4Z A;  1XFN A;  1T1C A;  2GDN A;  3HLF A;  5L8M A;  4YIN A;  1Q2P A;  3FC7 A;  5E2G A;  4JXS A;  2WGW A;  4YNR A;  1VEU B;  2VGK A;  1K57 A;  3HCY A;  2VKS A;  4HI4 A;  4B88 A;  5LBR A;  2HZ5 A;  4IED A;  4GCZ A;  3T4J A;  2J3T D;  3LID A;  3V50 A;  2H10 A;  4C75 A;  3BFD A;  1F5M A;  1ESU A;  3ZCZ A;  4K0X A;  2IA2 A;  2H0Y A;  3HLD A;  1J9M A;  4P6B A;  3F1N A;  1TS0 A;  3TRC A;  3VP0 A;  3E2L A;  4Y2F A;  3IQA A;  4MBF A;  4ME4 A;  3S1Y A;  4ZAM A;  2V0W A;  3EGD C;  4DRT A;  4PM9 A;  4HJ4 A;  3IS2 B;  5HL1 A;  1NLZ A;  1CF0 A;  3F1P B;  4HIA A;  4EBL A;  3Q07 A;  4GNU A;  3M2K A;  1OPX A;  1SKF A;  5AQA A;  1OTB A;  4NKP A;  3C4O A;  3ZG0 A;  5HAP A;  1E4D A;  3BWL A;  3A3D A;  1KDS A;  2Y2I A;  2P9V B;  2ZQA A;  3DTE A;  2PU4 A;  1GCE A;  4EV4 A;  3QNB A;  3MR0 A;  3EGX C;  1LHY A;  2OV5 A;  4HP4 A;  1ES5 A;  3H9W A;  3BLS A;  4Y5F A;  1X0O A;  5HPF A;  2NUP C;  3LEZ A;  4S2P A;  4HJ3 A;  2QMI A;  3BW6 A;  5EOE A;  4O8G A;  2H28 A;  3IX8 A;  1K55 A;  1AWI A;  1GHM A;  2M7V A;  4EEP A;  3O88 A;  3HLC A;  3S22 A;  3T1Q B;  4G3V A;  4RYE A;  1XJ6 A;  5DKK A;  1IYS A;  1NY0 A;  2QZ6 A;  4R38 A;  3PYP A;  4KQR A;  1ERO A;  2DMW A;  4KQQ A;  4PM6 A;  4CJN A;  3BJN A;  1DJA A;  3H82 A;  3N8L A;  2PBD P;  4L0L A;  2V9A A;  3C7V A;  4HHD A;  4B4Z A;  3T4K A;  2EXA A;  2O9C A;  2A3U A;  2QWS A;  5DF7 A;  4OLD A;  4U0T A;  4OP8 A;  1MBL A;  2VA0 A;  4LRZ E;  3VFF A;  2J80 A;  3NJA A;  2ZQ7 A;  3MBZ A;  4KUK A;  1NWZ A;  5KSH A;  2FH5 A;  1DRM A;  4HH3 A;  3IBR A;  1O7E A;  4F94 A;  4NXF A;  1NZO A;  2PU2 A;  4PM7 A;  4KQD A;  5HWV A;  4KZ7 A;  5JYP A;  2ZC7 A;  1ESI A;  1GA9 A;  1LL9 A;  3LR5 A;  3UE0 A;  4P0M A;  4HES A;  3CPT A;  3LIA A;  1Y4O A;  3NCK A;  4QPR A;  4Q0I A;  4UEY A;  2J9O A;  2R9X A;  5GHX A;  1W7F A;  4GOG A;  4WF0 A;  3AGF A;  2Y91 A;  4I5S A;  1FOF A;  2A24 B;  1Z6F A;  1O07 A;  3EEA A;  4X69 A;  5GL9 A;  1WE4 A;  4XT2 A;  5FEF A;  4JF4 A;  4EES A;  1I2S A;  3ZHH A;  3EOI A;  1K4F A;  2ZM8 A;  5CGW A;  5E43 A;  5D3O A;  3N8S A;  3OCN A;  3T50 A;  3ZG7 B;  3V5M A;  3NDE A;  4WBG A;  4MCW A;  1XP4 A;  3Q81 A;  2D02 A;  5FAT A;  1U60 A;  2ZQ8 A;  3G30 A;  4S2N C;  5DF8 A;  1FIL A;  3NHQ A;  4FSF A;  4EEU A;  3K2N A;  4R0Q A;  2PR5 A;  1XKZ A;  1VHM A;  5TBM A;  2V1B A;  4Q8I A;  1P97 A;  1S1Y A;  4EQI A;  2WKH A;  1ONG A;  3T12 B;  3TSG A;  2DNS A;  2EXB A;  4HBU A;  3UDI A;  1S4S A;  2EFX A;  2JKF A;  1CJF A;  3KSF A;  1SKO B;  1RP5 A;  3EQV A;  1S1Z A;  1YSQ A;  5AQ9 A;  1WA9 A;  1MWS A;  1SDN A;  3B33 A;  4S2J A;  4OPR A;  4GDN A;  1G6A A;  4OPZ A;  4OPY A;  1L0G A;  4WMC A;  3ISG A;  5HD5 A;  2XH9 A;  5CXW A;  3SOI A;  3V3R A;  5HAI A;  4UAA A;  2Z2L B;  2XFS A;  5CEC A;  2HP9 A;  3CLO A;  4JLF A;  2PAV P;  1DJB A;  3OOV A;  5IT5 A;  2VZW A;  4CLC D;  5DFX A;  1TS7 A;  4E6W A;  4E3N A;  3I7J A;  3KO6 A;  1S67 L;  4QD4 A;  4MEZ A;  4BL3 A;  2K7S A;  2Y2H A;  3GVB A;  3PXP A;  4B9O A;  1CQA A;  2Y8H A;  4BD0 A;  3ZFZ A;  2P04 A;  5FQM A;  1DP6 A;  3PTE A;  3CG5 A;  1KOU A;  1PZO A;  1TF1 A;  1IFQ A;  3WRZ A;  2B18 A;  1YT4 A;  1YMS A;  4IJG A;  4E3J A;  2GNX A;  4C6Y A;  3L7H A;  1K0K A;  1KE0 A;  5FQK A;  3HVF A;  5KSC A;  1IEM A;  5FAQ A;  5DTS A;  2GZA A;  2GJ3 A;  3LFV A;  3CWF A;  1M6K A;  4UHU A;  1OT9 A;  2O99 A;  3IS2 A;  3BLM A;  3ZYT A;  1MKI A;  3A3E A;  3A3I A;  4MLL A;  2V8F A;  3T4Q A;  3WS2 A;  2Q9M A;  1OTD A;  1YKD A;  1GSV A;  1G68 A;  5DTT A;  4N92 A;  1JTG A;  4GN2 A;  2INW A;  5EUA A;  2P9V A;  3EQU A;  1BZA A;  1KVL A;  4A5R A;  5F6A A;  3IX3 A;  3G31 A;  3OBF A;  2HP5 A;  2Y2K A;  3MFX A;  5F69 A;  5K5B A;  4WZ5 C;  3UPP A;  3K3D A;  2EWV A;  2ZQD A;  4DE2 A;  3HLB A;  3G34 A;  3PBS A;  2RL3 A;  3QP5 A;  5EM0 A;  4GJ4 A;  3QP2 A;  1F98 A;  1FSY A;  5A91 A;  3VE3 A;  4ZDX A;  5L2F A;  1K54 A;  5HX9 A;  1I5Q A;  5DJU A;  1W8Y A;  3ZDJ A;  4DJ3 A;  2D01 A;  4X25 A;  2JE5 A;  1H3Q A;  4QHC A;  5J4E A;  5CTM A;  3IWI A;  4OQH A;  3O87 A;  5TR7 A;  1JWP A;  5E2E A;  3VP1 A;  4U0X A;  3D4F A;  4BMW A;  1LSW A;  5MC7 A;  4H6J B;  3SS5 A;  3PR6 A;  3R7W B;  4DXC A;  3CUE A;  4N1H A;  2ZQC A;  3PBO A;  4XXR A;  4JGP A;  5L09 A;  4Y0U A;  2WKR A;  3P09 A;  4X55 A;  3FYZ A;  4NXE A;  3BFC A;  5EVI B;  1QMF A;  1PWC A;  3H7W A;  5EVL A;  3V39 A;  5M19 A;  2LB5 A;  2JBF A;  1LL5 A;  3BM6 A;  1VM1 A;  2QYB A;  2W3H A;  4DF6 A;  4OH0 A;  4NXB A;  2ZMV A;  4IUH A;  2V0U A;  2EWW A;  1K56 A;  3VE4 A;  3Q7Z A;  1Y28 A;  4FH2 A;  1PFL A;  3C4P A;  2W1R A;  1WYB A;  1XXM A;  2Y79 A;  1N9O A;  4YOF A;  4BBV A;  2PRF A;  5IU1 A;  5F1G A;  4O0P A;  4N9L A;  1VB6 A;  4PKY G;  4BBU A;  3NI9 A;  4OQ0 A;  3RXW A;  3QNC A;  3DW0 A;  2WZZ A;  4Y0O A;  1DY6 A;  4BQM A;  2ZJ9 A;  3T1X A;  4OPQ A;  4X1M A;  5A8B A;  1HD8 A;  2YKF A;  1PIO A;  2V1A A;  4FTX A;  3UME A;  4D60 A;  1Z09 A;  5F1F A;  3GEC A;  1K6S A;  4GW9 A;  4HEF A;  3W2Z A;  3IBJ A;  4M4X A;  5FDH A;  4YFM A;  2FFF B;  2ZL1 A;  1OJ5 A;  1H8Z A;  4JPM A;  1NRF A;  3QP8 A;  2HJ9 C;  1VQQ A;  1LI0 A;  4IUK A;  1WYC A;  4UQI M;  2ZC5 B;  3IT9 A;  2OWJ A;  3HUN A;  2OAQ 1;  4GS9 A;  3A0S A;  1XPB A;  4UA7 A;  4X6T A;  1NYM A;  4FOF A;  4EW7 A;  4X68 A;  3V3S A;  2JN7 A;  4D2O A;  2P74 A;  1S4R A;  1JWV A;  5KIZ A;  5CER A;  5TFQ A;  4PKY A;  1PI4 A;  3FWL A;  5U47 A;  4G3K A;  1ZKJ A;  3VOY A;  4KEN B;  1PYY A;  2KLI A;  3BRM A;  3MKE A;  5DFY A;  2E8I A;  3MFD A;  3VP3 A;  1RCJ A;  5AJG A;  4GHI A;  3CI6 A;  1FR1 A;  4FUW A;  2G2W A;  1N9L A;  3SH9 A;  1PRQ A;  2L1M A;  2HPB A;  1OTA A;  3U4L P;  3JVV A;  4Y7P A;  2EX2 A;  3MMH A;  1XFQ A;  1MY8 A;  3GSG A;  1CI9 A;  4K0W A;  3WRT A;  3IF6 A;  5FI2 A;  4G3W A;  4UQI S;  4NK3 A;  5EVI C;  1JWZ A;  1YMX A;  3Q1F A;  3WWX A;  1IOU A;  1ERQ A;  3UE6 A;  1FIK A;  3DTK A;  2W1T A;  4R3A A;  3W4O A;  5J3W A;  2M1C A;  2PD8 A;  2XFT A;  4WL9 A;  4II7 A;  3KYZ A;  3G32 A;  5F83 A;  3G4P A;  4LV2 A;  2ZD8 A;  3RTY A;  3ICY A;  4PPR A;  1K56 D;  5M18 A;  2JKR M;  4PAU A;  4HQA A;  5AQB A;  3F1O B;  2J9P A;  4PMA A;  5F68 A;  4EXO A;  1J3W A;  1W63 M;  2HV1 A;  3IHB A;  3ZG9 B;  5CHJ A;  2ZMA A;  3C8C A;  4WYY A;  3NEC A;  4Q0J A;  1EWZ A;  1ZHH B;  4I3J A;  2BAS A;  4OQI A;  3UB6 A;  1T1A A;  2QHK A;  1RGZ A;  2Y2M A;  3VOL A;  3MSH A;  4Q0H A;  1TDG A;  1OTI A;  4WLA A;  5HFO A;  4DE1 A;  2Q9N A;  3NOP C;  2W27 A;  1UWP X;  3B3X A;  1ODV A;  1C3B A;  3UB7 A;  3UPN A;  4NG2 A;  1H8Y A;  1SHV A;  2W3E A;  3K3C A;  4B4X A;  4JGR A;  3GRJ A;  4O01 A;  4CLC E;  2IWB A;  1P9R A;  3VMA A;  4H6J A;  3JPU A;  4JXV A;  4HOI A;  4OKP A;  4OOL A;  5EPH A;  5EFW A;  3MXS A;  3ZNY A;  3QP4 A;  2KDK A;  2HGV A;  3OLO A;  1NYY A;  3PAE A;  3UO9 A;  3E2K A;  4MNR A;  3DWZ A;  3MZE A;  3DWK A;  3MJQ A;  2XSS A;  4MBK A;  4DMZ A;  2VV6 A;  2ZC3 B;  3WS5 A;  1ES3 A;  3UE1 A;  1AXB A;  1H5X A;  3IHA A;  2ZM2 A;  1PWG A;  1LSX A;  3IXH A;  4S2L A;  1N9N A;  4P6Z M;  5FQJ A;  2Y2L A;  3OPR A;  5CTN A;  1K25 A;  1FSW A;  2ZOI A;  3OPL A;  2W0N A;  1F2K A;  2ZQ9 A;  3VSK A;  1V9Y A;  1ZC2 A;  3G35 A;  2C6W B;  4QU3 A;  3E0Y A;  2Y2Q A;  4C3Q A;  1W5D A;  4ZJ1 A;  4KZ4 A;  2VGJ A;  3BEC A;  4CPK A;  3A3J A;  1GA0 A;  1YSP A;  3KSH A;  5EM1 A;  3T1S A;  3MZF A;  1YLZ A;  3SW1 A;  4L9E A;  1ERM A;  3LI9 A;  5HDD A;  3FZC A;  2ZMF A;  3HRE A;  3BFF A;  4GD6 A;  5AVF A;  5IHV A;  1IKI A;  3C7U A;  5A93 A;  1GSX A;  1GSW A;  3IX4 A;  4X56 A;  4Y0T A;  4MN5 A;  3NUL A;  5JYO A;  1PW1 A;  2HJE A;  5FA7 A;  5HAR A;  3TG9 A;  1BUE A;  4EET B;  1GHI A;  3D9Y A;  3ZVW A;  3QHY A;  5HWW A;  1D1J A;  2RCX A;  5CGX A;  1FCM A;  2VX8 A;  1KDW A;  3U2A A;  3Q7V B;  3LIC A;  3GTC A;  1ACF A;  3VP4 A;  5CED A;  1N9B A;  2O0Y A;  2J3T C;  5HWT A;  4S2M A;  2PD7 A;  3MXQ A;  4DN0 A;  4LCM A;  4E3M A;  1FCO A;  2QJ5 A;  2XRN A;  5KZH A;  1VEU A;  4KUO A;  1YLT A;  4CQH A;  2XRO A;  3F1N B;  4XUZ A;  2XEP A;  5I94 A;  1JTD A;  4OLG A;  4DDS A;  1KE3 A;  4RX3 A;  5GHZ A;  1PI5 A;  1BLS A;  1HLU P;  3BFG A;  3FG8 A;  1H8M A;  2MJ6 A;  5HD3 A;  2OOL A;  3CZD A;  3BYD A;  5E2H A;  1TS6 A;  2VEA A;  1MWT A;  3W4Q A;  2QPN A;  3OPP A;  3W8K A;  3NDG A;  4LV1 A;  4PM5 A;  1M40 A;  3F1P A;  3HLW A;  1OTE A;  1S6R A;  3T4L A;  1T1B A;  4S2N A;  1LLB A;  2Y2J A;  4JGO A;  2B95 A;  1NJ4 A;  1ES4 A;  4LPZ A;  1YQS A;  1UGU A;  2H0T A;  4DXB A;  4RVA A;  1IYP A;  2QJ7 A;  1W8Q A;  3T4S A;  4EBP A;  2O9A A;  4LGW A;  4LEN A;  4KG6 A;  4QJG A;  2VK3 A;  2VV8 A;  2GX5 A;  3ZG8 B;  5FL3 A;  5AVE A;  4QY6 A;  4CLC B;  3UMD A;  4LV3 A;  3MQ0 A;  4ESP A;  2WGI A;  1LI9 A;  3WS4 A;  2Y2O A;  3F1O A;  2XLN A;  2ZC4 B;  4E3I A;  1N4O A;  1CEG A;  1D06 A;  1ZG6 A;  4H8R A;  3LIF A;  1CEF A;  1S0W A;  1TDL A;  3KX0 X;  1JNU A;  3KYE A;  4HH2 A;  3GR2 A;  1BUL A;  2G2U A;  4BEN A;  1F9I A;  3ZNT A;  2Z6C A;  3H82 B;  4IVI A;  5HL6 A;  4KZB A;  4E3L A;  3MXR A;  1P0Z A;  2O9B A;  5TJJ A;  3LIB A;  4JXG A;  4JF5 A;  2PBY A;  4PM8 A;  3VFH A;  4E04 A;  4RA7 A;  4R23 A;  1BLC A;  5A90 A;  4K91 A;  2B5R A;  3E98 A;  4RX2 A;  4P85 A;  4ID4 A;  1XJ4 A;  4WN5 A;  1TS8 A;  4KZ8 A;  2YKH A;  1K4E A;  2UV0 E;  3LCE A;  3ZG5 A;  5CHM A;  3HBR A;  3CPT B;  1K57 C;  4L9G A;  3A3F A;  3LR0 A;  5DF9 A;  1OJG A;  2NUT C;  5EV0 A;  1KGE A;  3LGO A;  4WMC D;  4X53 A;  4OON A;  3IH8 A;  2WAF A;  3MZD A;  4F3L B;  4ETZ A;  2HDU A;  5EOO A;  1MZU A;  5CHU A;  1W79 A;  3DTI A;  2EX8 A;  1L0F A;  1G6O A;  1IYQ A;  2L0W A;  3C38 A;  5FDS A;  1PW8 A;  1XA7 A;  3E4P A;  4HP9 A;  3BFE A;  4IHQ A;  2A24 A;  4WZ5 A;  3VOZ A;  3O3V A;  1H0M A;  3SS4 A;  2UWX A;  4IBX A;  3UE3 A;  5FAS A;  3IH9 A;  2PYR A;  5G4Y A;  3ITA A;  2C5W B;  2XD1 A;  1NLY A;  2WAD A;  5FEG A;  4DJ2 A;  2VLG A;  3SH7 A;  3IF5 A;  1LL8 A;  1MWR A;  2IWC A;  5TBM B;  2PYP A;  3NOU C;  4WEJ A;  4QB8 A;  3T4O A;  3ULF A;  4WUJ A;  5EE8 A;  3DAV A;  5HW3 A;  1YM1 A;  1L2S A;  4LRX C;  4KZ3 A;  3OCL A;  4EBN A;  1XGI A;  2XDM A;  3UB9 A;  2FFY A;  2CC1 A;  4UA6 A;  4BBT A;  2VJW A;  4RQ9 A;  4R3J A;  3FKW A;  4CLC C;  1VET B;  1SKO A;  1DJC A;  1K55 C;  1YLJ A;  2JCH A;  2KX6 A;  4NXG A;  3FV7 A;  5DTK A;  2W3F A;  3Q7V A;  1G5U A;  3OPH A;  5J8X A;  2A2L A;  2OLU A;  2ZC6 B;  4BL2 A;  3E4Q A;  1JVJ A;  2HDQ A;  2Z6D A;  3PBR A;  4QWO A;  1XA1 A;  3KYQ A;  2EX6 A;  3BY8 A;  4ZBE A;  3MF0 A;  4P87 A;  4JGQ A;  3UDX A;  3NIA A;  4BD1 A;  3NOT C;  5L10 A;  3MQQ A;  4R4S A;  1ZTU A;  5I5L A;  1CK3 A;  4HBT A;  3RXX A;  1BLH A;  2WYX A;  3E4O A;  1E3U A;  4JXW A;  4ZJ3 A;  1NZU A;  5F5Y A;  4Y15 A;  1EW0 A;  1RGY A;  3NC8 A;  3P98 A;  2LB9 A;  5GLD A;  4PHT A;  1HVB A;  3SH8 A;  3LEQ A;  2XA7 M;  1K38 A;  2PT7 A;  1OT6 A;  2JHE A;  3N4I A;  1OME A;  4EU0 A;  3M6B A;  4B93 A;  2B02 A;  5KMW A;  3HLE A;  1SDE A;  3N7W A;  3M6H A;  2IWD A;  4Z1W A;  3TE8 A;  2ZLY A;  1FR6 A;  3S7P A;  4IBR A;  5A92 A;  3Q82 A;  3PBQ A;  4WZ4 A;  3B42 A;  3HJI A;  3KSI A;  4FH4 A;  4I39 A;  2K2N A;  4BJP A;  3RJU A;  5FI7 A;  2XQZ A;  1P9W A;  3T1R A;  3M2J A;  3ZVT A;  1ALQ A;  4JKT A;  1XJ3 A;  4R1G A;  2OSU A;  1LT0 A;  5HSQ A; 
#chains in the Genus database with same CATH homology
 1F98 A;  3VE3 A;  4R6L A;  4CLC A;  1STZ A;  5HWW A;  5DJU A;  3LR3 A;  2ZOH A;  5G4Z A;  4DJ3 A;  2D01 A;  1XFN A;  1T1C A;  2VX8 A;  2JKT M;  1H3Q A;  5J4E A;  3U2A A;  3LIC A;  5L8M A;  4BMW A;  2O0Y A;  2XA7 S;  2J3T C;  1LSW A;  5MC7 A;  5HWT A;  2VGL M;  4H6J B;  5IS1 A;  3FC7 A;  2PD7 A;  3LUQ A;  3MXQ A;  4DN0 A;  3PR6 A;  2QJ5 A;  2XRN A;  4YNR A;  3R7W B;  3CUE A;  3PBO A;  3HCY A;  4JGP A;  2VKS A;  2WKR A;  2KOI A;  4HI4 A;  3H7W B;  3R7W A;  4NXE A;  5LBR A;  3D3O A;  4KUO A;  4ARZ B;  4CQH A;  4GCZ A;  3T4J A;  2J3T D;  3LID A;  4MN7 A;  3H7W A;  2XRO A;  3F1N B;  1F5M A;  2LB5 A;  5C5K A;  2IA2 A;  4GLQ A;  2QYB A;  2W3H A;  4NXB A;  2ZMV A;  3F1N A;  4IUH A;  1TS0 A;  2V0U A;  2EWW A;  3TRC A;  3VE4 A;  4Y2F A;  3FG8 A;  4ME4 A;  4MN6 A;  1H8M A;  2MJ6 A;  5HD3 A;  1Y28 A;  2OOL A;  2W1R A;  3S7N A;  2V0W A;  3EGD C;  4ZRR A;  4HJ4 A;  4MMN A;  2Y79 A;  3IS2 B;  1N9O A;  1NLZ A;  4YOF A;  1TS6 A;  4BBV A;  2VEA A;  5IU1 A;  3FPV A;  3F1P B;  4HIA A;  4O0P A;  1VB6 A;  1OPX A;  4PKY G;  4BBU A;  1OTB A;  4NKP A;  4F3L A;  2P7J A;  3F1P A;  2W3D A;  1OTE A;  3T4L A;  1T1B A;  3BWL A;  2VV7 A;  4L9F A;  1DP8 A;  4JGO A;  2EA9 A;  2VGL S;  4LPZ A;  1MKM A;  3C2W A;  1UGU A;  3MR0 A;  5A8B A;  3EGX C;  2YKF A;  2V1A A;  3JVU A;  4HP4 A;  2QJ7 A;  3UME A;  2JKR I;  1DP9 A;  3H9W A;  1TD5 A;  3T4S A;  3O5Y A;  2K31 A;  3GEC A;  2O9A A;  3D72 A;  4Y5F A;  3KSG A;  3S7Q A;  3FPW A;  1NRJ A;  1X0O A;  4GW9 A;  3EEH A;  2VV8 A;  2GX5 A;  2W3G A;  3W2Z A;  3IBJ A;  5HPF A;  2NUP C;  5FL3 A;  4M4X A;  5AVE A;  4CLC B;  3UMD A;  5J7E A;  3MQ0 A;  4LLO B;  4HJ3 A;  4HNB A;  1OJ5 A;  3BW6 A;  2QKP A;  3F1O A;  4O8G A;  2H28 A;  2HJ9 C;  4WEL A;  4GS9 B;  4IUK A;  2M7V A;  3PHY A;  4EEP A;  1D06 A;  5HPI A;  4P6Z S;  4UQI M;  3V67 A;  2OWJ A;  5DJT A;  2OAQ 1;  3LIF A;  4G3V A;  4GS9 A;  3A0S A;  1XJ6 A;  5DKK A;  3KX0 X;  1JNU A;  4HH2 A;  4BWI A;  4R38 A;  2JKT I;  4FOF A;  4EW7 A;  3PYP A;  1F9I A;  5DKL A;  2JN7 A;  3BY9 A;  2Z6C A;  3H82 B;  3LYX A;  1S4R A;  3RFB A;  5KIZ A;  5HDC A;  5HL6 A;  4PKY A;  2DMW A;  1P0Z A;  2O9B A;  5TJJ A;  4G3K A;  1T18 A;  3BJN A;  3H82 A;  3LIB A;  4L0L A;  2V9A A;  4HHD A;  3TJZ C;  2KLI A;  3TW8 A;  1LSV A;  4E04 A;  5CX7 A;  3T4K A;  4GHI B;  2O9C A;  1T19 A;  2QWS A;  2M7U A;  3G6O A;  5DFY A;  3E98 A;  2VA0 A;  4LRZ E;  5AJG A;  4GHI A;  2J80 A;  3NJA A;  3OC2 A;  3CI6 A;  1XJ4 A;  4KUK A;  1NWZ A;  1TS8 A;  4WN5 A;  5KSH A;  2L4R A;  2FH5 A;  1DRM A;  1XJ2 A;  3BQ8 A;  3IBR A;  4HH3 A;  2YKH A;  1N9L A;  1MC0 A;  4NXF A;  3UB8 A;  4AFI A;  4KQD A;  5HWV A;  2L1M A;  3CUE C;  3CIT A;  1OTA A;  4L9G A;  3LR0 A;  5DF9 A;  1OJG A;  2NUT C;  3JVV A;  3LR5 A;  4I3A A;  2FZ0 A;  3MMH A;  1XFQ A;  3LIA A;  3MQO A;  4F3L B;  4QPR A;  3HJK A;  4Q0I A;  4UEY A;  4ETZ A;  4G3W A;  3GDI A;  4UQI S;  2W1T B;  1MZU A;  3VV4 A;  4WF0 A;  1IOU A;  2J3W A;  1G6O A;  3UE6 A;  4I5S A;  2A24 B;  2L0W A;  4YWZ A;  2W1T A;  3C38 A;  4LRY C;  4R3A A;  3EEA A;  4KQO A;  5J3W A;  2M1C A;  3E4P A;  2PD8 A;  4I3I A;  4WL9 A;  4HP9 A;  4II7 A;  4IHQ A;  2A24 A;  4XT2 A;  1BYW A;  1UWN X;  1G28 A;  3KYZ A;  4EES A;  3EOI A;  3P7N A;  3OCN A;  3RTY A;  3T50 A;  3UE3 A;  3ICY A;  2PYR A;  5G4Y A;  3C30 A;  4MCW A;  2JKR M;  4PAU A;  4HQA A;  3T4T A;  2D02 A;  1NLY A;  3F1O B;  1S66 L;  5F68 A;  4EXO A;  4DJ2 A;  3B47 A;  2VLG A;  5HDS A;  1W63 M;  2HV1 A;  1LL8 A;  3NHQ A;  4FSF A;  4EEU A;  5TBM B;  3PBN A;  2PYP A;  3NOU C;  4WEJ A;  3T4O A;  3ULF A;  3C8C A;  3K2N A;  2PR5 A;  4Q0J A;  4WUJ A;  1VHM A;  1ZHH B;  4I3J A;  5TBM A;  2WKP A;  2BAS A;  2V1B A;  1P97 A;  4LRX C;  3UB6 A;  1S1Y A;  1T1A A;  2QHK A;  3VOL A;  4Q0H A;  2OAP 1;  3OCL A;  4K08 A;  1OTI A;  2OWH A;  4WLA A;  3UB9 A;  2HF6 A;  3LR4 A;  1S4S A;  3NOP C;  4BBT A;  2VJW A;  4RQ9 A;  3KSF A;  4WEK A;  2W27 A;  3EQV A;  1S1Z A;  1YSQ A;  1WA9 A;  1UWP X;  2ZBB A;  1ODV A;  3B33 A;  3UB7 A;  4CLC C;  3R4K A;  5HD5 A;  4R70 A;  2P08 A;  2KX6 A;  2W3E A;  3K3C A;  4JGR A;  4NXG A;  4NEE D;  2W3F A;  3P01 A;  3LI8 A;  4O01 A;  4CLC E;  1V9Z A;  1YAX A;  3A0V A;  4Y3I A;  3CLO A;  1P9R A;  2G7U A;  2A2L A;  4H6J A;  3E4Q A;  4HOI A;  3OOV A;  5IT5 A;  2Z6D A;  2PR6 A;  4OOL A;  5EFW A;  2VZW A;  4CLC D;  5DFX A;  1TS7 A;  3PBR A;  2KDK A;  2HGV A;  3KO6 A;  3CAX A;  3OLO A;  3A0R A;  1S67 L;  3KYQ A;  2K7S A;  3BY8 A;  3PXP A;  3MF0 A;  3MJQ A;  2I9V A;  4B9O A;  2XSS A;  4JGQ A;  4ARZ A;  4DMZ A;  2VV6 A;  2Y8H A;  3ZQ5 A;  2P04 A;  3NOT C;  3MQQ A;  1DP6 A;  1ZTU A;  1KOU A;  5I5L A;  1TF1 A;  1IFQ A;  4EUV A;  1LSX A;  2B18 A;  3BQA A;  3E4O A;  1N9N A;  4P6Z M;  5HZH A;  4IJG A;  2GNX A;  4ETX A;  2ZOI A;  5F5Y A;  2W0N A;  1EW0 A;  4XT2 B;  2LB9 A;  3PBT A;  4PHT A;  1V9Y A;  2XA7 M;  2GZA A;  2PT7 A;  2GJ3 A;  3LFV A;  4HJ6 A;  3CWF A;  1OT6 A;  3E0Y A;  1OT9 A;  2JHE A;  2O99 A;  3IS2 A;  3ZYT A;  4EU0 A;  2CMN A;  4OOM A;  2B02 A;  4B93 A;  3T4Q A;  1YSP A;  1OTD A;  2PHY A;  1YKD A;  1GSV A;  3KSH A;  4EQ1 A;  4Z1W A;  3EWK A;  2PDR A;  3TE8 A;  4HY8 A;  3SW1 A;  4L9E A;  3S7P A;  3S7O A;  3LI9 A;  2INW A;  5HDD A;  3PBQ A;  3LIE A;  2ZMF A;  3B42 A;  3HJI A;  3EQU A;  3KSI A;  4EER A;  4I39 A;  5AVF A;  2K2N A;  5F6A A;  3RH8 B;  4BJP A;  1D7E A;  3OBF A;  2WKQ A;  1GSX A;  3MFX A;  1GSW A;  3DBA A;  5F69 A;  5K5B A;  4MN5 A;  3K3D A;  2EWV A;  2R78 A;  1P9W A;  4MDZ A;  1W63 Q;  2HJE A;  3PBS A;  1XJ3 A;  1LT0 A;  4GJ4 A;  5HSQ A;  4I38 A;  4EET B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...