2VGLS

Ap2 clathrin adaptor core
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
142
structure length
142
Chain Sequence
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Architecture and Functional Model of the Endocytic Ap2 Complex
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
molecule keywords ADAPTOR PROTEIN COMPLEX AP-2, ALPHA 2 SUBUNIT
total genus 50
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2007-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2vglS00
4P6ZM 2JKTI 2JKRM 4UQIM 2VGLM 2XA7S 1W63Q 2HF6A 1W63M 5MC7A 4NEED 1NRJA 2VGLS 2XA7M 4UQIS 3TJZC 2JKTM 2JKRI 4P6ZS 2FH5A
chains in the Genus database with same CATH superfamily
4N9KA 3TRCA 3ULFA 2VLGA 5FQKA 4BMWA 1EI5A 4Y13A 4PM8A 3F1OB 2L4RA 1FIKA 2BLSA 5HAQA 5HARA 1IYPA 4R38A 2KLIA 3LR4A 3S7NA 2Y2GA 4XUZA 4HJ6A 2VGLS 4DE2A 4ME4A 4K08A 3B33A 3MS6A 1P9WA 1I2SA 3HUNA 5CRFA 4NXBA 5AQ7A 2Y2LA 4M3KA 3VP2A 4KQQA 1BLSA 3BFEA 1OJGA 1TD5A 3IBJA 3BY9A 2JBFA 3G31A 3KSHA 3EWKA 1PFLA 3Q7VA 5F1GA 5GHYA 3CUEC 4P0MA 1SDNA 1XA7A 4E04A 3E0YA 1P9RA 2R9XA 4EEUA 3T4JA 4HEFA 4B93A 3DTKA 3CAXA 3HLGA 4PM5A 3CUEA 4GOGA 5EOEA 1FOFA 2J3TC 2ZC7A 3PAGA 4YFMA 5HWWA 2NUTC 3VE3A 1S1ZA 4WN5A 2DMWA 5HWTA 3T4KA 1MY8A 2QKPA 2Y2IA 2XK1A 3C38A 1QMEA 1P97A 3UMEA 3BFDA 4HP9A 4Y15A 1N9NA 2HDQA 4DJ3A 2A24B 3W2ZA 1T1AA 2KDKA 3A3EA 5FQQA 3VSKA 3EGXC 1SKOA 1KE4A 3BFCA 1K6SA 3GSGA 3MQQA 2ZOHA 1PZPA 4WMCA 3TG9A 4MBKA 5DJTA 4BQMA 4X55A 5CERA 2H0YA 1FR1A 1HD8A 5A93A 1Y4OA 4MMNA 2JKGA 2V2FF 4FUWA 2QZ6A 3O87A 2WK0A 2W3DA 5FEGA 3QP5A 1VEUB 2A3UA 1OTAA 3W4PA 4ZAMA 4E3NA 3SS3A 4OP5A 1VETA 4DXCA 4R6LA 4PKYG 3PBNA 3MR0A 1HZOA 4GCZA 2ZQAA 4BENA 4PM6A 2Y55A 5IS1A 2ZQ9A 1T18A 3MSHA 1IKGA 3RTYA 2B95A 2PR5A 2Z6DA 4GHIB 4ZJ2A 3OCNA 3BJNA 4DE0A 3EOIA 5FI6A 2M7UA 5FL3A 3M2JA 3A3DA 4OLDA 3IH8A 4L9FA 2XA7M 5J4EA 1K54A 1XGIA 5TBMB 4D60A 4EBNA 2WADA 3T50A 3DTMA 2HP9A 1V9YA 3WS0A 1YSPA 3UY6A 4EEPA 4X1MA 5CGSA 4K0XA 2OOLA 2ZQDA 2X02A 4G3WA 1GHPA 3F1PA 3N4IA 1BT5A 3NECA 5HZHA 4O0PA 3L9KA 1D1JA 4MBFA 3ZG5A 1LL5A 1H0MA 1K55C 4X53A 5CXWA 4WMCD 3S4XA 1UWPX 3V50A 4EUZA 2AVXA 3LIDA 4BL2A 1F2KA 3E4PA 3SOIA 2ZBBA 1NZUA 3ZVTA 4DXBA 2RL3A 4LRXC 3UB6A 3FZCA 5CGWA 2HJ9C 3NBLA 1KDWA 4MN6A 4YINA 2W1TB 2XF3A 2KOIA 2CMNA 4DE3A 2W3GA 3P01A 5J3WA 3E98A 2IWDA 4B4ZA 3MZFA 4KZAA 4II7A 1VEUA 1XA1A 3SW1A 3AGFA 3MZDA 2ZL1B 4LRZE 1BLHA 5IU1A 3HL9A 3Q81A 5HDSA 5A91A 4FSFA 2PD8A 5A90A 4OP8A 2G7UA 4MDZA 2Y2NA 2I9VA 1SCWA 4WBGA 3N8LA 2EWWA 4KG5A 1KE0A 1HVBA 3TE8A 4E6XA 1ES2A 2ZD8A 1TS8A 2GX5A 2V8CA 3ITBA 1MWUA 1PW8A 4KQRA 5EVEA 4N9LA 3MZEA 3FV7A 1T1BA 2PR6A 2VZWA 4IUHA 4RYEA 4BBVA 4X6TA 5DFYA 2BASA 3RJUA 2XDMA 1WE4A 2BG1A 5FSRA 1YLJA 2QHKA 4KG6A 4DE1A 4H8RA 3C8CA 1EWZA 1J9MA 3CLOA 1KVMA 1W8QA 1OTDA 4G3VA 3P98A 4JXSA 3PBSA 3SS5A 3UNWA 4MNRA 1SDEA 1GSXA 1LSWA 2WKHA 3S22A 3IWOA 2JE5A 4ARZA 4S2OA 2G2WA 4LCMA 5GHZA 2WAFA 3BWLA 3G32A 2W27A 1SZVA 5DFXA 2FZ0A 1XPBA 4JXWA 2XA7S 3H9WA 4K91A 2O9CA 5F68A 1M6KA 1U60A 1YMSA 4N1HA 3KSIA 5JYPA 1I2WA 3BECA 4NK3A 4CJNA 4JKTA 1LLBA 5I94A 1MZUA 2JKTI 2V8FA 5D3OA 3JVUA 3CMZA 2EA9A 1ES5A 4ZJ3A 4Q8IA 2Z2MB 1DP6A 1KE3A 1OTBA 2M7VA 3NCKA 1W63Q 4UA9A 1YAXA 3KO6A 2HZ5A 4BBTA 4GB7A 2JKTM 2QWSA 3ZYTA 1FCNA 3K2NA 5LBRA 3B47A 5HDDA 4EBLA 3D4FA 1MBLA 3MXRA 3UN7A 5DKLA 1F98A 3D3OA 1YLZA 1ESIA 5MC7A 3IF6A 3IF5A 1Q2PA 2I72A 2HPBA 4I3JA 1GSVA 4HH3A 5E2FA 3UB5P 3W4QA 2Y2HA 2IWCA 2Y2KA 3T1QB 4L9EA 1RGZA 3NOPC 1G28A 1GA9A 5F69A 1JWZA 1FCMA 4B4XA 3KYZA 3OZHA 4X56A 2XQZA 5DF9A 3PTEA 1XJ4A 1PIOA 2K2NA 4MCWA 1QMFA 3VP0A 4WL9A 4CLCC 3LIAA 1XFNA 4IVKA 2GZAA 3A0RA 4NG2A 4UQIM 3LI9A 3CG5A 4B9OA 2XH9A 3H82B 5L8MA 1NLZA 3EEAA 3GQZA 3U2AA 4GD6A 2XFTA 1KGFA 3NOUC 1S0WA 1X0OA 5DF7A 1PW1A 4LFUA 3S7QA 4I3AA 4H6JA 2OWJA 2O9BA 3ZQ5A 3ZGAB 1O7EA 3UPPA 5M1AA 2YKFA 3CWFA 4ARZB 2EXBA 3EQUA 4OOLA 4JF5A 1K54C 3VP4A 2R9WA 3PBQA 4I3IA 5HD3A 3IHBA 3LI8A 1VHMA 3LGOA 4KZ8A 2PRFA 3KYQA 3IXHA 4DDYA 4YNRA 2W3HA 5I5LA 3ZDJA 3CI6A 3U4LP 3T4OA 2VV8A 4Y2FA 3DWKA 3TJZC 3QNBA 4LCLA 1DP8A 2ZQ7A 3VE4A 5FI2A 3GVBA 3GV9A 4GJ4A 5CX7A 3NJAA 1H3QA 4MN7A 3DW0A 4XT2A 1ERQA 1DP9A 2ZQ8A 3M6HA 1XJ2A 2JCHA 3PYPA 3G30A 1LT0A 5HSQA 4BD0A 3ICYA 3MFDA 3C4PA 4JF4A 4OONA 1H8ZA 1ERMA 4LV0A 5E2EA 2ZC4B 5AJGA 2J9PA 5EPHA 2ZLYA 5C5KA 4QD4A 1DY6A 2VJWA 4HESA 3HJKA 3BLSA 2Y91A 3DWZA 5EVIA 1BUEA 4EUVA 2INWA 3Q7ZA 1YLWA 2KX6A 4OPRA 3TW8A 3IBRA 1FSYA 3VFHA 3IX4A 3B42A 3CJMA 5EUAA 1W7FA 3OPHA 4R4SA 3Q07A 3GDIA 3QP1A 1XFQA 5GLCA 5FAPA 2H0TA 3UB9A 4MEZA 5CTNA 5AQAA 4OQ0A 3ZNTA 3IWQA 3CITA 4BWIA 4QWOA 4OQIA 4E3MA 3IF6B 1GSWA 2XFSA 3SS4A 2W0NA 5TJJA 2WKEA 3O88A 1Z6FA 1OTIA 4OH0A 5GLAA 3P09A 3MQ0A 1TS6A 1WA9A 1K6RA 5EVIC 2ZMVA 1S4RA 3N6IA 1D7EA 1ES4A 4E3LA 1TS7A 4R3AA 1CQAA 1K4EA 4QJGA 2QYBA 4GHIA 1KGEA 3IT9A 5FAQA 5HDCA 4FTXA 4HI4A 3V5MA 5CEBA 4CPKA 1NRJA 4PHTA 4UHUA 1YMXA 2WGWA 4D2OA 4UA7A 2ZM8A 3A3FA 1ZC2A 3UE1A 4DRTA 4L0LA 1N9LA 2ZM0A 4NXGA 4JXVA 3KSGA 4EBPA 3E4QA 3GRJA 4FH4A 2HV1A 2V9AA 4O01A 2W3FA 2J7VA 4QY5A 5M19A 1W63M 4K0WA 2Q9MA 4GW9A 3C7VA 3HREA 3QP4A 1YLYA 1ZTUA 1KVLA 4PM7A 4FOFA 3HLWA 4KZBA 3VP1A 3Q82A 1OTEA 1XP4A 5BOHA 5HW3A 5GLDA 1ACFA 1AWIA 1ONGA 4WZ4A 5EOOA 2Q9NA 1E4DA 4IBXA 3SH8A 2ZL1A 3IXGA 4RX2A 2Y59A 1MKMA 4E6WA 4JGQA 1NJ4A 1XX2A 5AVFA 2IWBA 3EQVA 2JKRM 2OAP1 2Y2JA 3HLCA 4GDBA 5FDHA 3WS5A 4E3IA 1T1CA 4Y3IA 1BYWA 1PI5A 5E43A 1XXMA 3UO9A 4UQIS 2EX8A 5G4YA 4HY8A 1ZHHB 1GHIA 2P08A 2B5RA 3FYZA 2Y2OA 3LY3A 3E2KA 4WZ5A 4E3JA 4G3KA 3T4LA 3RXXA 3MBZA 2JHEA 2PBDP 3T1RA 4DJ2A 2P7JA 2Q0OA 4BBUA 2OLUA 2WGVA 3NHQA 1EW0A 4X68A 1N9BA 1T19A 3E2LA 4UA6A 5HPIA 3MXSA 2V0UA 1E3UA 4S2PA 4B88A 5CHUA 1K4FA 1ZKJA 2EX9A 4ZJ1A 2DCFA 5EVIB 4NKPA 2EFXA 4I39A 4NXEA 4HP4A 2EFUA 5FA7A 3MJQA 1LHYA 2ZOIA 4KZ7A 4S2MA 1CK3A 4KZ4A 1CF0A 3ZG0A 5FEFA 1AXBA 2A49A 2XSSA 2WAEA 3FG8A 3IX8A 3FKWA 3CPTA 3VFFA 3RH8B 4JPMA 4HOIA 1IFQA 5HD5A 3M6BA 2B18A 3HBRA 4WEKA 3QHYA 4PMAA 1FQGA 1P0ZA 3OPLA 1TDGA 4O7DA 2HDSA 3O86A 3NI9A 1NY0A 4E3OA 3PBTA 4HJ4A 3I7JA 3BM6A 2K31A 1YPRA 2YKHA 1L0EA 1XJ6A 4KQDA 2A2LA 3V39A 4OOMA 3E4OA 1RGYA 4MBHA 2X71A 4UEYA 3GTCA 3BFGA 3N8RA 4ZBEA 4Y7PA 4LV1A 2D01A 3FPVA 3BYDA 3FC7A 4P85A 2V1AA 5M18A 1JWPA 1BULA 5FQMA 5DTSA 4QB8A 3ZCZA 1RP5A 2Z2LB 3PBRA 2X01A 1OJ5A 3EGDC 4P6ZS 4U0XA 3G6OA 1YLTA 4P87A 3LIFA 4BJPA 4HQAA 4P6ZM 1G6OA 5GHXA 3T12B 3OOVA 2J9OA 3UMDA 4R3BA 2WKIA 3WRZA 3HUMA 1JTGA 2WKRA 3Q1FA 1ESUA 1E25A 1EROA 3BY8A 2GDNA 1DJAA 1FCOA 4KQOA 4IUKA 4Z1WA 5GL9A 3BQ8A 3F1NB 1XKZA 3PAEA 3A3IA 1TS0A 3N8SA 3DTIA 4Q0HA 5FQJA 2Y4AA 1H8YA 3EEHA 5U47A 3A3JA 4O8GA 4QY6A 4EU0A 3PXPA 3FPWA 4RVAA 3BFFA 4HBTA 2H5SA 2RCXA 1A0KA 3LEZA 1KOUA 3DBAA 2PT7A 3C5AA 2W3EA 3PBOA 1K38A 2EX6A 4S2LA 2HDRA 4DKIA 2ZMAA 3O5YA 4ZRRA 2FH5A 4L9GA 4IBRA 5DJUA 1Y54A 1BZAA 3G34A 3IH9A 4KUOA 2ZC6B 2GJ3A 5DF8A 3QP6A 3GMWA 1MWRA 2V1ZA 2MJ6A 5CECA 5DVAA 2UWXA 4ZDXA 1D06A 3A0SA 5A8BA 5KIZA 2OAQ1 1G5UA 1S66L 5CHJA 5EVID 3T1SA 4OLGA 3IXDA 2O99A 2ZM2A 5F5YA 1NYMA 1CI8A 3VOYA 3SH7A 2V0WA 4RA7A 4GN2A 1IYQA 4H6JB 2WKPA 4R23A 1VM1A 2PD7A 1MWSA 4IHQA 4DF6A 2W1RA 3SH9A 2L0WA 3C30A 3N7WA 3JPUA 5IT5A 3OBFA 4WYYA 1N4OA 3ZFZA 1M40A 1JNUA 2J8YA 3S7PA 2Z6CA 3R7WB 1ES3A 1N9OA 4Y0UA 2O9AA 2QJ5A 4LLOB 1ODVA 4JGRA 1VETB 5DKKA 3R7WA 3H7WB 4HIAA 1YLPA 1S6RA 3OC2A 5L07A 3BQAA 1PWDA 3TOIA 2G2UA 3LFVA 5FATA 4N1XA 3IF6C 4ESPA 1XJ3A 5HFOA 5AVEA 2J3TD 1LSVA 5CEDA 3IHAA 4WM9A 5K5BA 4CLCA 4GDNA 3RFBA 3IQAA 2J80A 4JBFA 3LEQA 4LGWA 3WWXA 5L2FA 1RCJA 1IYOA 4GZBA 3NULA 2PU4A 4MLLA 3KX0X 2ZMFA 4FH2A 1MKIA 2IA2A 2V1BA 2PYRA 5G4ZA 5AQBA 2L1MA 1W79A 4EETB 1Z09A 3KYEA 1MPLA 2VK3A 2EXAA 3LY4A 4NEED 1IELA 3NIAA 3QP2A 4Y0OA 2CC1A 1OT9A 4KZ5A 1CI9A 4GD8A 4EXOA 2H28A 4P6BA 2QJ7A 1MXOA 1K25A 1LSXA 4CQHA 3IWIA 1G68A 3NC8A 4JGPA 2O0YA 4CLCD 3D72A 3LIEA 4OQHA 4S2JA 2M1CA 4EQ1A 5FQ9A 4JGOA 2EX2A 4S2KA 3P7NA 2HP6A 5EE8A 5G18A 4KENB 4S2NA 5E2HA 2JC7A 3ISGA 2XROA 2VGKA 2XD5A 4X25A 2WZZA 4DN0A 4XT2B 2LB5A 1OT6A 4LV3A 4S2NC 5HAPA 1BLCA 4KUKA 1DJBA 5KMWA 1TDLA 2XR0A 3OCLA 1L0DA 1DJCA 3NOTC 3JVVA 5KZHA 3UPNA 3LCEA 4OOYA 1W8YA 1TF1A 5EECA 4LENA 1F5MA 4R70A 2BTFP 4U3TA 1GHMA 4HNBA 3G35A 3ZG9B 2QPNA 1IYSA 4A5RA 3CPTB 4JF6A 4OPQA 2WKQA 3MF0A 3B3XA 1S4SA 3QP8A 4IJGA 4FD8A 5HWVA 3F1NA 3NDGA 4PM9A 2P04A 3S7OA 3K3CA 2ACGA 4WLAA 4BD1A 4KZ3A 2HP5A 3W4OA 3MQOA 1ONHA 3FKVA 1NWZA 2HF6A 4YWZA 4RQ9A 3OLOA 4HH2A 4M4XA 1LI0A 1PYYA 2ZC5B 1I5QA 3ZVWA 4GKUA 3RXWA 2C6WB 3BW6A 1K55A 2PAVP 4EQIA 2ZC3B 2A24A 5TBMA 3C2WA 1BLPA 1DRMA 3HLEA 4Z9QA 1O07A 1UGUA 1ZG4A 1KDSA 4R1GA 5F83A 1E3UD 3WS4A 4XXRA 3MFXA 5CTMA 4JLFA 2EWVA 4GNUA 1S67L 2VGJA 5A92A 5EFWA 3TSGA 4YOFA 3O3VA 3LUQA 5FAOA 1SKFA 2UV0E 3PHYA 1WYCA 3G2YA 1ZG6A 1KGGA 1Q2QA 5CGXA 2JN7A 2J3WA 2JKFA 1JWVA 1LL8A 2VGLM 4CLCE 4PPRA 4R0QA 2DNSA 3BLMA 2VV7A 4C3QA 3M2KA 3FWLA 1K56D 1IKIA 2E8IA 5J7EA 3MKEA 3HUOA 4ID4A 2WUQA 2GNXA 3T4TA 1YKDA 1FILA 5HL6A 4QU3A 3IS2A 3CZDA 2Y2QA 3UE0A 5HX9A 2PU2A 1HLUP 2OSUA 4Q0IA 4F3LB 5DTKA 4PKYA 3F1OA 1VQQA 1FSWA 1OMEA 2Y2PA 3HVFA 2P9VA 3UE3A 4DMZA 2VEAA 3AGEA 2PBYA 2W1TA 4U0TA 4MN5A 3LICA 4XUXA 5L10A 4EERA 3T4QA 2OLVA 4NETA 4KZ6A 3WRTA 2XLNA 4HHDA 4ETZA 4WF0A 4R3JA 4LPZA 5TFQA 5AQ9A 3CHWP 4ZTKA 4F94A 4WELA 2B02A 5FDSA 1PI4A 3D9YA 2HDUA 4R4RA 3UPOA 3GR2A 3H7WA 4CLCB 2WYXA 3MXQA 1F9IA 2Y2MA 3ZG7B 1C3BA 2Y79A 2XRNA 2C5WB 3W8KA 1NZOA 1L2SA 5F82A 3KSFA 3MMHA 3HLFA 1PRQA 3GECA 4N92A 5EVLA 5HPFA 4Y5FA 3LO7A 4PAUA 1NLYA 3ZG8B 1STZA 2XD1A 1PZOA 4WEJA 3HCYA 4X1LA 4I38A 1L0FA 2VA0A 1H5XA 2LB9A 1GA0A 4EV4A 5FI7A 3G2ZA 2ZQCA 3ZNYA 1FR6A 1OPXA 5JYOA 1MC0A 2PHYA 1K56A 1PNEA 1WYBA 3BRMA 3NY4A 5GLBA 1NXYA 3VMAA 4OKPA 3IX3A 2Y8HA 4Q0JA 3OPRA 2OV5A 5EM1A 3C7UA 4UAAA 1J3WA 3LR5A 3T1XA 3V3RA 3LR0A 2NUPC 3VV4A 4OPYA 5KSCA 2P9VB 3ITAA 3UDFA 4OQGA 2VX8A 3IXBA 3V67A 1NYYA 3LIBA 1YT4A 2PYPA 1L0GA 1TVFA 1HTZA 1JTDA 1YQSA 2WGIA 5IHVA 3UB7A 5J8XA 3LYXA 3DAVA 3IS2B 4EW7A 4WUJA 1CEFA 5FQIA 3C4OA 3Q7VB 5L09A 3HLBA 5E2GA 2FFYA 4C6YA 2XEPA 2WZXA 1V9ZA 2JKRI 4RX3A 3HJIA 1ALQA 1CEGA 4F3LA 1BTLA 1TEMA 2R78A 1IEMA 2HJEA 3H82A 2VV6A 4OPZA 4BLMA 1BSGA 3QNCA 3ZHHA 1SHVA 3VOZA 4Y0TA 2QMIA 1K0KA 3WS2A 4AFIA 2XGNA 3F1PB 3NDEA 3UB8A 3UE6A 5HL1A 3UDXA 3DTEA 4BL3A 1SKOB 1CJFA 1K57A 1Y28A 4IEDA 1H8MA 3T4SA 1NRFA 1VB6A 1LI9A 2VKSA 3K3DA 3UDIA 4EWFA 3MKFA 5KSHA 4OVDA 2K7SA 3HLDA 1LL9A 1G6AA 4EESA 1YM1A 3A0VA 1S1YA 4JXGA 1W5DA 4LRYC 4FCFA 4X69A 4S2IA 5F1FA 2PDRA 4GS9B 1GCEA 3PR6A 4QPRA 5TR7A 1JVJA 4KG2A 4Y17A 1PWGA 5TGFA 5EM0A 4IVIA 3L7HA 4E3KA 3VP3A 4KZ9A 3G4PA 3SZTA 2OWHA 1MWTA 4DDSA 1XGJA 2ZJ9A 1YSQA 5DTTA 2E8JA 4I5SA 3VSLA 2HGVA 4GS9A 1IOUA 3OPPA 1K57C 3JYIA 5HAIA 3V3SA 3WS1A 5EV0A 5CHMA 2FFFB 3AGDA 4C75A 2D02A 4LV2A 5F6AA 3LR3A 4ETXA 2V20A 2H10A 4WZ5C 2WGWB 3VOLA 4GLQA 1L3LA 3R4KA 1PWCA 4NXFA 3S1YA 2P74A 4QHCA 5FASA 3BEBA 1UWNX 4HJ3A 2DRWA 4HBUA
chains in the Genus database with same CATH topology
1YAXA 4M4XA 3TRCA 3KO6A 3ULFA 2VLGA 4BBTA 2JKTM 2QWSA 4NKPA 4BMWA 3ZYTA 4I39A 4NXEA 3K2NA 4HP4A 5LBRA 3B47A 3MJQA 5HDDA 2ZOIA 3BW6A 5DKLA 1F98A 3D3OA 2XSSA 3F1OB 3FG8A 2L4RA 5MC7A 2A24A 5TBMA 3C2WA 3RH8B 4HOIA 1IFQA 1GSVA 4I3JA 5HD5A 4HH3A 1DRMA 2B18A 4R38A 4WEKA 2KLIA 3LR4A 3S7NA 4HJ6A 4L9EA 2VGLS 1P0ZA 3NOPC 1G28A 1UGUA 5F69A 4ME4A 4K08A 3B33A 1P9WA 3KYZA 5DF9A 3PBTA 4HJ4A 4NXBA 1XJ4A 3MFXA 2K31A 2EWVA 2YKHA 2K2NA 4MCWA 1S67L 4WL9A 1XJ6A 1OJGA 5EFWA 1TD5A 3IBJA 4KQDA 4YOFA 4CLCC 2A2LA 3BY9A 3LIAA 3LUQA 4OOMA 3E4OA 1XFNA 3PHYA 2GZAA 3A0RA 4UEYA 3KSHA 3EWKA 2D01A 4UQIM 3FPVA 3CUEC 3FC7A 2JN7A 2J3WA 3E0YA 3LI9A 4B9OA 1P9RA 4E04A 3H82B 5L8MA 1NLZA 4EEUA 3T4JA 1LL8A 2VGLM 3EEAA 4B93A 2V1AA 3U2AA 4CLCE 3CAXA 3CUEA 3NOUC 1X0OA 2J3TC 3S7QA 2VV7A 4I3AA 4H6JA 2OWJA 2O9BA 5HWWA 3ZQ5A 2NUTC 3VE3A 1S1ZA 4WN5A 5J7EA 2DMWA 3PBRA 5HWTA 3T4KA 2YKFA 3CWFA 1OJ5A 2QKPA 2GNXA 3T4TA 1YKDA 3EGDC 4ARZB 3C38A 4P6ZS 5HL6A 3IS2A 1P97A 3UMEA 3EQUA 4HP9A 4OOLA 3G6OA 1N9NA 3LIFA 4BJPA 4DJ3A 2A24B 4HQAA 4P6ZM 1T1AA 3W2ZA 2KDKA 4Q0IA 4F3LB 3PBQA 4I3IA 1G6OA 5HD3A 3LI8A 3EGXC 3OOVA 3F1OA 4PKYA 3UMDA 1VHMA 2WKRA 3KYQA 3BY8A 4YNRA 2W3HA 5I5LA 3MQQA 3CI6A 2ZOHA 4DMZA 3UE3A 2VEAA 4KQOA 4IUKA 4Z1WA 5DJTA 3BQ8A 2W1TA 3F1NB 3T4OA 4MN5A 3LICA 1TS0A 2VV8A 4EERA 4Y2FA 3T4QA 4Q0HA 4MMNA 4HHDA 3TJZC 4ETZA 4WF0A 3EEHA 4LPZA 1DP8A 4O8GA 3VE4A 2W3DA 4GJ4A 5CX7A 4EU0A 3PXPA 3NJAA 1H3QA 3FPWA 4MN7A 1OTAA 4WELA 2B02A 4XT2A 1KOUA 3DBAA 1DP9A 2PT7A 3H7WA 4R6LA 2W3EA 1XJ2A 3PBNA 4PKYG 3PBOA 3MR0A 3PYPA 4CLCB 3MXQA 1F9IA 4GCZA 1LT0A 5HSQA 3O5YA 4ZRRA 2Y79A 2FH5A 3ICYA 5IS1A 2XRNA 4L9GA 1T18A 5DJUA 4KUOA 3KSFA 3MMHA 2GJ3A 3RTYA 3GECA 2PR5A 2Z6DA 5HPFA 5AJGA 4Y5FA 4PAUA 1NLYA 2MJ6A 1STZA 4GHIB 5C5KA 4WEJA 1D06A 3OCNA 3BJNA 3A0SA 3HCYA 2VJWA 5A8BA 3EOIA 5KIZA 4I38A 2OAQ1 2VA0A 3HJKA 2LB9A 1S66L 2M7UA 5FL3A 4EUVA 2O99A 2INWA 5F5YA 1OPXA 2KX6A 4L9FA 3TW8A 2XA7M 5J4EA 2V0WA 3IBRA 1MC0A 2PHYA 5TBMB 4H6JB 2WKPA 3T50A 3B42A 2PD7A 4IHQA 3GDIA 2W1RA 2L0WA 3C30A 1V9YA 5IT5A 4Q0JA 2Y8HA 3OBFA 1XFQA 1YSPA 4EEPA 3UB9A 2OOLA 3LR5A 1JNUA 4G3WA 3S7PA 2Z6CA 3F1PA 3LR0A 2NUPC 3R7WB 3VV4A 1N9OA 3CITA 5HZHA 4O0PA 2O9AA 2QJ5A 4LLOB 1ODVA 4JGRA 2VX8A 5DKKA 3R7WA 3H7WB 4HIAA 3OC2A 4BWIA 3BQAA 3V67A 3LFVA 3LIBA 2PYPA 1UWPX 1GSWA 3LIDA 2W0NA 1XJ3A 5TJJA 3E4PA 2ZBBA 1OTIA 3UB7A 3MQ0A 1TS6A 1WA9A 4LRXC 3UB6A 5AVEA 3LYXA 2J3TD 2HJ9C 2ZMVA 1S4RA 3IS2B 4EW7A 1LSVA 4WUJA 4MN6A 2W1TB 5K5BA 4CLCA 1D7EA 3RFBA 2J80A 1TS7A 2KOIA 4R3AA 2CMNA 2W3GA 3P01A 5J3WA 2QYBA 3E98A 4GHIA 1V9ZA 2JKRI 4II7A 3KX0X 5HDCA 2ZMFA 3HJIA 4F3LA 2R78A 3SW1A 2IA2A 2V1BA 2PYRA 2HJEA 4LRZE 5G4ZA 4HI4A 3H82A 2L1MA 5IU1A 4EETB 1NRJA 2VV6A 4PHTA 5HDSA 4FSFA 2PD8A 2G7UA 4L0LA 1N9LA 4MDZA 4NEED 4NXGA 2I9VA 3KSGA 1OT9A 4AFIA 2EWWA 3F1PB 3UB8A 4EXOA 2H28A 3UE6A 3E4QA 2QJ7A 2HV1A 3TE8A 2V9AA 1LSXA 4CQHA 1TS8A 2GX5A 1Y28A 4O01A 2W3FA 1H8MA 3T4SA 1VB6A 1W63M 3K3DA 2VKSA 4JGPA 2O0YA 4CLCD 4GW9A 3D72A 3LIEA 1ZTUA 5KSHA 2K7SA 2M1CA 4EQ1A 1T1BA 4FOFA 2PR6A 4JGOA 2VZWA 4IUHA 4BBVA 5DFYA 2BASA 3P7NA 4EESA 3A0VA 2XROA 2QHKA 1OTEA 3C8CA 1S1YA 4DN0A 4LRYC 4XT2B 2LB5A 1OT6A 3CLOA 4KUKA 1OTDA 2PDRA 4G3VA 4GS9B 1MKMA 3OCLA 3PBSA 3PR6A 4QPRA 3NOTC 3JVVA 4JGQA 5AVFA 1GSXA 3EQVA 1LSWA 2JKRM 2OAP1 1TF1A 4ARZA 1F5MA 4R70A 3BWLA 4HNBA 1T1CA 2OWHA 4Y3IA 1BYWA 1YSQA 4UQIS 2W27A 5DFXA 5G4YA 2FZ0A 4HY8A 4I5SA 2WKQA 2HGVA 3MF0A 4GS9A 1IOUA 2XA7S 1S4SA 1ZHHB 3H9WA 2P08A 2O9CA 5F68A 4IJGA 3KSIA 2D02A 5HWVA 5F6AA 4G3KA 3T4LA 3F1NA 3LR3A 2JHEA 4ETXA 2P04A 3S7OA 3K3CA 4DJ2A 4WLAA 2P7JA 1MZUA 2JKTI 4BBUA 3VOLA 4GLQA 3NHQA 3R4KA 1EW0A 3JVUA 1T19A 4NXFA 2EA9A 3MQOA 1DP6A 5HPIA 1OTBA 2V0UA 2M7VA 1NWZA 1W63Q 2HF6A 4YWZA 1UWNX 4HJ3A 4RQ9A 3OLOA 4HH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P6Z M;  2JKT I;  2JKR M;  4UQI M;  2VGL M;  2XA7 S;  1W63 Q;  2HF6 A;  1W63 M;  5MC7 A;  4NEE D;  1NRJ A;  2VGL S;  2XA7 M;  4UQI S;  3TJZ C;  2JKT M;  2JKR I;  4P6Z S;  2FH5 A; 
#chains in the Genus database with same CATH topology
 4N9K A;  3TRC A;  3ULF A;  2VLG A;  5FQK A;  4BMW A;  1EI5 A;  4Y13 A;  4PM8 A;  3F1O B;  2L4R A;  1FIK A;  2BLS A;  5HAQ A;  5HAR A;  1IYP A;  4R38 A;  2KLI A;  3LR4 A;  3S7N A;  2Y2G A;  4XUZ A;  4HJ6 A;  2VGL S;  4DE2 A;  4ME4 A;  4K08 A;  3B33 A;  3MS6 A;  1P9W A;  1I2S A;  3HUN A;  5CRF A;  4NXB A;  5AQ7 A;  2Y2L A;  4M3K A;  3VP2 A;  4KQQ A;  1BLS A;  3BFE A;  1OJG A;  1TD5 A;  3IBJ A;  3BY9 A;  2JBF A;  3G31 A;  3KSH A;  3EWK A;  1PFL A;  3Q7V A;  5F1G A;  5GHY A;  3CUE C;  4P0M A;  1SDN A;  1XA7 A;  4E04 A;  3E0Y A;  1P9R A;  2R9X A;  4EEU A;  3T4J A;  4HEF A;  4B93 A;  3DTK A;  3CAX A;  3HLG A;  4PM5 A;  3CUE A;  4GOG A;  5EOE A;  1FOF A;  2J3T C;  2ZC7 A;  3PAG A;  4YFM A;  5HWW A;  2NUT C;  3VE3 A;  1S1Z A;  4WN5 A;  2DMW A;  5HWT A;  3T4K A;  1MY8 A;  2QKP A;  2Y2I A;  2XK1 A;  3C38 A;  1QME A;  1P97 A;  3UME A;  3BFD A;  4HP9 A;  4Y15 A;  1N9N A;  2HDQ A;  4DJ3 A;  2A24 B;  3W2Z A;  1T1A A;  2KDK A;  3A3E A;  5FQQ A;  3VSK A;  3EGX C;  1SKO A;  1KE4 A;  3BFC A;  1K6S A;  3GSG A;  3MQQ A;  2ZOH A;  1PZP A;  4WMC A;  3TG9 A;  4MBK A;  5DJT A;  4BQM A;  4X55 A;  5CER A;  2H0Y A;  1FR1 A;  1HD8 A;  5A93 A;  1Y4O A;  4MMN A;  2JKG A;  2V2F F;  4FUW A;  2QZ6 A;  3O87 A;  2WK0 A;  2W3D A;  5FEG A;  3QP5 A;  1VEU B;  2A3U A;  1OTA A;  3W4P A;  4ZAM A;  4E3N A;  3SS3 A;  4OP5 A;  1VET A;  4DXC A;  4R6L A;  4PKY G;  3PBN A;  3MR0 A;  1HZO A;  4GCZ A;  2ZQA A;  4BEN A;  4PM6 A;  2Y55 A;  5IS1 A;  2ZQ9 A;  1T18 A;  3MSH A;  1IKG A;  3RTY A;  2B95 A;  2PR5 A;  2Z6D A;  4GHI B;  4ZJ2 A;  3OCN A;  3BJN A;  4DE0 A;  3EOI A;  5FI6 A;  2M7U A;  5FL3 A;  3M2J A;  3A3D A;  4OLD A;  3IH8 A;  4L9F A;  2XA7 M;  5J4E A;  1K54 A;  1XGI A;  5TBM B;  4D60 A;  4EBN A;  2WAD A;  3T50 A;  3DTM A;  2HP9 A;  1V9Y A;  3WS0 A;  1YSP A;  3UY6 A;  4EEP A;  4X1M A;  5CGS A;  4K0X A;  2OOL A;  2ZQD A;  2X02 A;  4G3W A;  1GHP A;  3F1P A;  3N4I A;  1BT5 A;  3NEC A;  5HZH A;  4O0P A;  3L9K A;  1D1J A;  4MBF A;  3ZG5 A;  1LL5 A;  1H0M A;  1K55 C;  4X53 A;  5CXW A;  4WMC D;  3S4X A;  1UWP X;  3V50 A;  4EUZ A;  2AVX A;  3LID A;  4BL2 A;  1F2K A;  3E4P A;  3SOI A;  2ZBB A;  1NZU A;  3ZVT A;  4DXB A;  2RL3 A;  4LRX C;  3UB6 A;  3FZC A;  5CGW A;  2HJ9 C;  3NBL A;  1KDW A;  4MN6 A;  4YIN A;  2W1T B;  2XF3 A;  2KOI A;  2CMN A;  4DE3 A;  2W3G A;  3P01 A;  5J3W A;  3E98 A;  2IWD A;  4B4Z A;  3MZF A;  4KZA A;  4II7 A;  1VEU A;  1XA1 A;  3SW1 A;  3AGF A;  3MZD A;  2ZL1 B;  4LRZ E;  1BLH A;  5IU1 A;  3HL9 A;  3Q81 A;  5HDS A;  5A91 A;  4FSF A;  2PD8 A;  5A90 A;  4OP8 A;  2G7U A;  4MDZ A;  2Y2N A;  2I9V A;  1SCW A;  4WBG A;  3N8L A;  2EWW A;  4KG5 A;  1KE0 A;  1HVB A;  3TE8 A;  4E6X A;  1ES2 A;  2ZD8 A;  1TS8 A;  2GX5 A;  2V8C A;  3ITB A;  1MWU A;  1PW8 A;  4KQR A;  5EVE A;  4N9L A;  3MZE A;  3FV7 A;  1T1B A;  2PR6 A;  2VZW A;  4IUH A;  4RYE A;  4BBV A;  4X6T A;  5DFY A;  2BAS A;  3RJU A;  2XDM A;  1WE4 A;  2BG1 A;  5FSR A;  1YLJ A;  2QHK A;  4KG6 A;  4DE1 A;  4H8R A;  3C8C A;  1EWZ A;  1J9M A;  3CLO A;  1KVM A;  1W8Q A;  1OTD A;  4G3V A;  3P98 A;  4JXS A;  3PBS A;  3SS5 A;  3UNW A;  4MNR A;  1SDE A;  1GSX A;  1LSW A;  2WKH A;  3S22 A;  3IWO A;  2JE5 A;  4ARZ A;  4S2O A;  2G2W A;  4LCM A;  5GHZ A;  2WAF A;  3BWL A;  3G32 A;  2W27 A;  1SZV A;  5DFX A;  2FZ0 A;  1XPB A;  4JXW A;  2XA7 S;  3H9W A;  4K91 A;  2O9C A;  5F68 A;  1M6K A;  1U60 A;  1YMS A;  4N1H A;  3KSI A;  5JYP A;  1I2W A;  3BEC A;  4NK3 A;  4CJN A;  4JKT A;  1LLB A;  5I94 A;  1MZU A;  2JKT I;  2V8F A;  5D3O A;  3JVU A;  3CMZ A;  2EA9 A;  1ES5 A;  4ZJ3 A;  4Q8I A;  2Z2M B;  1DP6 A;  1KE3 A;  1OTB A;  2M7V A;  3NCK A;  1W63 Q;  4UA9 A;  1YAX A;  3KO6 A;  2HZ5 A;  4BBT A;  4GB7 A;  2JKT M;  2QWS A;  3ZYT A;  1FCN A;  3K2N A;  5LBR A;  3B47 A;  5HDD A;  4EBL A;  3D4F A;  1MBL A;  3MXR A;  3UN7 A;  5DKL A;  1F98 A;  3D3O A;  1YLZ A;  1ESI A;  5MC7 A;  3IF6 A;  3IF5 A;  1Q2P A;  2I72 A;  2HPB A;  4I3J A;  1GSV A;  4HH3 A;  5E2F A;  3UB5 P;  3W4Q A;  2Y2H A;  2IWC A;  2Y2K A;  3T1Q B;  4L9E A;  1RGZ A;  3NOP C;  1G28 A;  1GA9 A;  5F69 A;  1JWZ A;  1FCM A;  4B4X A;  3KYZ A;  3OZH A;  4X56 A;  2XQZ A;  5DF9 A;  3PTE A;  1XJ4 A;  1PIO A;  2K2N A;  4MCW A;  1QMF A;  3VP0 A;  4WL9 A;  4CLC C;  3LIA A;  1XFN A;  4IVK A;  2GZA A;  3A0R A;  4NG2 A;  4UQI M;  3LI9 A;  3CG5 A;  4B9O A;  2XH9 A;  3H82 B;  5L8M A;  1NLZ A;  3EEA A;  3GQZ A;  3U2A A;  4GD6 A;  2XFT A;  1KGF A;  3NOU C;  1S0W A;  1X0O A;  5DF7 A;  1PW1 A;  4LFU A;  3S7Q A;  4I3A A;  4H6J A;  2OWJ A;  2O9B A;  3ZQ5 A;  3ZGA B;  1O7E A;  3UPP A;  5M1A A;  2YKF A;  3CWF A;  4ARZ B;  2EXB A;  3EQU A;  4OOL A;  4JF5 A;  1K54 C;  3VP4 A;  2R9W A;  3PBQ A;  4I3I A;  5HD3 A;  3IHB A;  3LI8 A;  1VHM A;  3LGO A;  4KZ8 A;  2PRF A;  3KYQ A;  3IXH A;  4DDY A;  4YNR A;  2W3H A;  5I5L A;  3ZDJ A;  3CI6 A;  3U4L P;  3T4O A;  2VV8 A;  4Y2F A;  3DWK A;  3TJZ C;  3QNB A;  4LCL A;  1DP8 A;  2ZQ7 A;  3VE4 A;  5FI2 A;  3GVB A;  3GV9 A;  4GJ4 A;  5CX7 A;  3NJA A;  1H3Q A;  4MN7 A;  3DW0 A;  4XT2 A;  1ERQ A;  1DP9 A;  2ZQ8 A;  3M6H A;  1XJ2 A;  2JCH A;  3PYP A;  3G30 A;  1LT0 A;  5HSQ A;  4BD0 A;  3ICY A;  3MFD A;  3C4P A;  4JF4 A;  4OON A;  1H8Z A;  1ERM A;  4LV0 A;  5E2E A;  2ZC4 B;  5AJG A;  2J9P A;  5EPH A;  2ZLY A;  5C5K A;  4QD4 A;  1DY6 A;  2VJW A;  4HES A;  3HJK A;  3BLS A;  2Y91 A;  3DWZ A;  5EVI A;  1BUE A;  4EUV A;  2INW A;  3Q7Z A;  1YLW A;  2KX6 A;  4OPR A;  3TW8 A;  3IBR A;  1FSY A;  3VFH A;  3IX4 A;  3B42 A;  3CJM A;  5EUA A;  1W7F A;  3OPH A;  4R4S A;  3Q07 A;  3GDI A;  3QP1 A;  1XFQ A;  5GLC A;  5FAP A;  2H0T A;  3UB9 A;  4MEZ A;  5CTN A;  5AQA A;  4OQ0 A;  3ZNT A;  3IWQ A;  3CIT A;  4BWI A;  4QWO A;  4OQI A;  4E3M A;  3IF6 B;  1GSW A;  2XFS A;  3SS4 A;  2W0N A;  5TJJ A;  2WKE A;  3O88 A;  1Z6F A;  1OTI A;  4OH0 A;  5GLA A;  3P09 A;  3MQ0 A;  1TS6 A;  1WA9 A;  1K6R A;  5EVI C;  2ZMV A;  1S4R A;  3N6I A;  1D7E A;  1ES4 A;  4E3L A;  1TS7 A;  4R3A A;  1CQA A;  1K4E A;  4QJG A;  2QYB A;  4GHI A;  1KGE A;  3IT9 A;  5FAQ A;  5HDC A;  4FTX A;  4HI4 A;  3V5M A;  5CEB A;  4CPK A;  1NRJ A;  4PHT A;  4UHU A;  1YMX A;  2WGW A;  4D2O A;  4UA7 A;  2ZM8 A;  3A3F A;  1ZC2 A;  3UE1 A;  4DRT A;  4L0L A;  1N9L A;  2ZM0 A;  4NXG A;  4JXV A;  3KSG A;  4EBP A;  3E4Q A;  3GRJ A;  4FH4 A;  2HV1 A;  2V9A A;  4O01 A;  2W3F A;  2J7V A;  4QY5 A;  5M19 A;  1W63 M;  4K0W A;  2Q9M A;  4GW9 A;  3C7V A;  3HRE A;  3QP4 A;  1YLY A;  1ZTU A;  1KVL A;  4PM7 A;  4FOF A;  3HLW A;  4KZB A;  3VP1 A;  3Q82 A;  1OTE A;  1XP4 A;  5BOH A;  5HW3 A;  5GLD A;  1ACF A;  1AWI A;  1ONG A;  4WZ4 A;  5EOO A;  2Q9N A;  1E4D A;  4IBX A;  3SH8 A;  2ZL1 A;  3IXG A;  4RX2 A;  2Y59 A;  1MKM A;  4E6W A;  4JGQ A;  1NJ4 A;  1XX2 A;  5AVF A;  2IWB A;  3EQV A;  2JKR M;  2OAP 1;  2Y2J A;  3HLC A;  4GDB A;  5FDH A;  3WS5 A;  4E3I A;  1T1C A;  4Y3I A;  1BYW A;  1PI5 A;  5E43 A;  1XXM A;  3UO9 A;  4UQI S;  2EX8 A;  5G4Y A;  4HY8 A;  1ZHH B;  1GHI A;  2P08 A;  2B5R A;  3FYZ A;  2Y2O A;  3LY3 A;  3E2K A;  4WZ5 A;  4E3J A;  4G3K A;  3T4L A;  3RXX A;  3MBZ A;  2JHE A;  2PBD P;  3T1R A;  4DJ2 A;  2P7J A;  2Q0O A;  4BBU A;  2OLU A;  2WGV A;  3NHQ A;  1EW0 A;  4X68 A;  1N9B A;  1T19 A;  3E2L A;  4UA6 A;  5HPI A;  3MXS A;  2V0U A;  1E3U A;  4S2P A;  4B88 A;  5CHU A;  1K4F A;  1ZKJ A;  2EX9 A;  4ZJ1 A;  2DCF A;  5EVI B;  4NKP A;  2EFX A;  4I39 A;  4NXE A;  4HP4 A;  2EFU A;  5FA7 A;  3MJQ A;  1LHY A;  2ZOI A;  4KZ7 A;  4S2M A;  1CK3 A;  4KZ4 A;  1CF0 A;  3ZG0 A;  5FEF A;  1AXB A;  2A49 A;  2XSS A;  2WAE A;  3FG8 A;  3IX8 A;  3FKW A;  3CPT A;  3VFF A;  3RH8 B;  4JPM A;  4HOI A;  1IFQ A;  5HD5 A;  3M6B A;  2B18 A;  3HBR A;  4WEK A;  3QHY A;  4PMA A;  1FQG A;  1P0Z A;  3OPL A;  1TDG A;  4O7D A;  2HDS A;  3O86 A;  3NI9 A;  1NY0 A;  4E3O A;  3PBT A;  4HJ4 A;  3I7J A;  3BM6 A;  2K31 A;  1YPR A;  2YKH A;  1L0E A;  1XJ6 A;  4KQD A;  2A2L A;  3V39 A;  4OOM A;  3E4O A;  1RGY A;  4MBH A;  2X71 A;  4UEY A;  3GTC A;  3BFG A;  3N8R A;  4ZBE A;  4Y7P A;  4LV1 A;  2D01 A;  3FPV A;  3BYD A;  3FC7 A;  4P85 A;  2V1A A;  5M18 A;  1JWP A;  1BUL A;  5FQM A;  5DTS A;  4QB8 A;  3ZCZ A;  1RP5 A;  2Z2L B;  3PBR A;  2X01 A;  1OJ5 A;  3EGD C;  4P6Z S;  4U0X A;  3G6O A;  1YLT A;  4P87 A;  3LIF A;  4BJP A;  4HQA A;  4P6Z M;  1G6O A;  5GHX A;  3T12 B;  3OOV A;  2J9O A;  3UMD A;  4R3B A;  2WKI A;  3WRZ A;  3HUM A;  1JTG A;  2WKR A;  3Q1F A;  1ESU A;  1E25 A;  1ERO A;  3BY8 A;  2GDN A;  1DJA A;  1FCO A;  4KQO A;  4IUK A;  4Z1W A;  5GL9 A;  3BQ8 A;  3F1N B;  1XKZ A;  3PAE A;  3A3I A;  1TS0 A;  3N8S A;  3DTI A;  4Q0H A;  5FQJ A;  2Y4A A;  1H8Y A;  3EEH A;  5U47 A;  3A3J A;  4O8G A;  4QY6 A;  4EU0 A;  3PXP A;  3FPW A;  4RVA A;  3BFF A;  4HBT A;  2H5S A;  2RCX A;  1A0K A;  3LEZ A;  1KOU A;  3DBA A;  2PT7 A;  3C5A A;  2W3E A;  3PBO A;  1K38 A;  2EX6 A;  4S2L A;  2HDR A;  4DKI A;  2ZMA A;  3O5Y A;  4ZRR A;  2FH5 A;  4L9G A;  4IBR A;  5DJU A;  1Y54 A;  1BZA A;  3G34 A;  3IH9 A;  4KUO A;  2ZC6 B;  2GJ3 A;  5DF8 A;  3QP6 A;  3GMW A;  1MWR A;  2V1Z A;  2MJ6 A;  5CEC A;  5DVA A;  2UWX A;  4ZDX A;  1D06 A;  3A0S A;  5A8B A;  5KIZ A;  2OAQ 1;  1G5U A;  1S66 L;  5CHJ A;  5EVI D;  3T1S A;  4OLG A;  3IXD A;  2O99 A;  2ZM2 A;  5F5Y A;  1NYM A;  1CI8 A;  3VOY A;  3SH7 A;  2V0W A;  4RA7 A;  4GN2 A;  1IYQ A;  4H6J B;  2WKP A;  4R23 A;  1VM1 A;  2PD7 A;  1MWS A;  4IHQ A;  4DF6 A;  2W1R A;  3SH9 A;  2L0W A;  3C30 A;  3N7W A;  3JPU A;  5IT5 A;  3OBF A;  4WYY A;  1N4O A;  3ZFZ A;  1M40 A;  1JNU A;  2J8Y A;  3S7P A;  2Z6C A;  3R7W B;  1ES3 A;  1N9O A;  4Y0U A;  2O9A A;  2QJ5 A;  4LLO B;  1ODV A;  4JGR A;  1VET B;  5DKK A;  3R7W A;  3H7W B;  4HIA A;  1YLP A;  1S6R A;  3OC2 A;  5L07 A;  3BQA A;  1PWD A;  3TOI A;  2G2U A;  3LFV A;  5FAT A;  4N1X A;  3IF6 C;  4ESP A;  1XJ3 A;  5HFO A;  5AVE A;  2J3T D;  1LSV A;  5CED A;  3IHA A;  4WM9 A;  5K5B A;  4CLC A;  4GDN A;  3RFB A;  3IQA A;  2J80 A;  4JBF A;  3LEQ A;  4LGW A;  3WWX A;  5L2F A;  1RCJ A;  1IYO A;  4GZB A;  3NUL A;  2PU4 A;  4MLL A;  3KX0 X;  2ZMF A;  4FH2 A;  1MKI A;  2IA2 A;  2V1B A;  2PYR A;  5G4Z A;  5AQB A;  2L1M A;  1W79 A;  4EET B;  1Z09 A;  3KYE A;  1MPL A;  2VK3 A;  2EXA A;  3LY4 A;  4NEE D;  1IEL A;  3NIA A;  3QP2 A;  4Y0O A;  2CC1 A;  1OT9 A;  4KZ5 A;  1CI9 A;  4GD8 A;  4EXO A;  2H28 A;  4P6B A;  2QJ7 A;  1MXO A;  1K25 A;  1LSX A;  4CQH A;  3IWI A;  1G68 A;  3NC8 A;  4JGP A;  2O0Y A;  4CLC D;  3D72 A;  3LIE A;  4OQH A;  4S2J A;  2M1C A;  4EQ1 A;  5FQ9 A;  4JGO A;  2EX2 A;  4S2K A;  3P7N A;  2HP6 A;  5EE8 A;  5G18 A;  4KEN B;  4S2N A;  5E2H A;  2JC7 A;  3ISG A;  2XRO A;  2VGK A;  2XD5 A;  4X25 A;  2WZZ A;  4DN0 A;  4XT2 B;  2LB5 A;  1OT6 A;  4LV3 A;  4S2N C;  5HAP A;  1BLC A;  4KUK A;  1DJB A;  5KMW A;  1TDL A;  2XR0 A;  3OCL A;  1L0D A;  1DJC A;  3NOT C;  3JVV A;  5KZH A;  3UPN A;  3LCE A;  4OOY A;  1W8Y A;  1TF1 A;  5EEC A;  4LEN A;  1F5M A;  4R70 A;  2BTF P;  4U3T A;  1GHM A;  4HNB A;  3G35 A;  3ZG9 B;  2QPN A;  1IYS A;  4A5R A;  3CPT B;  4JF6 A;  4OPQ A;  2WKQ A;  3MF0 A;  3B3X A;  1S4S A;  3QP8 A;  4IJG A;  4FD8 A;  5HWV A;  3F1N A;  3NDG A;  4PM9 A;  2P04 A;  3S7O A;  3K3C A;  2ACG A;  4WLA A;  4BD1 A;  4KZ3 A;  2HP5 A;  3W4O A;  3MQO A;  1ONH A;  3FKV A;  1NWZ A;  2HF6 A;  4YWZ A;  4RQ9 A;  3OLO A;  4HH2 A;  4M4X A;  1LI0 A;  1PYY A;  2ZC5 B;  1I5Q A;  3ZVW A;  4GKU A;  3RXW A;  2C6W B;  3BW6 A;  1K55 A;  2PAV P;  4EQI A;  2ZC3 B;  2A24 A;  5TBM A;  3C2W A;  1BLP A;  1DRM A;  3HLE A;  4Z9Q A;  1O07 A;  1UGU A;  1ZG4 A;  1KDS A;  4R1G A;  5F83 A;  1E3U D;  3WS4 A;  4XXR A;  3MFX A;  5CTM A;  4JLF A;  2EWV A;  4GNU A;  1S67 L;  2VGJ A;  5A92 A;  5EFW A;  3TSG A;  4YOF A;  3O3V A;  3LUQ A;  5FAO A;  1SKF A;  2UV0 E;  3PHY A;  1WYC A;  3G2Y A;  1ZG6 A;  1KGG A;  1Q2Q A;  5CGX A;  2JN7 A;  2J3W A;  2JKF A;  1JWV A;  1LL8 A;  2VGL M;  4CLC E;  4PPR A;  4R0Q A;  2DNS A;  3BLM A;  2VV7 A;  4C3Q A;  3M2K A;  3FWL A;  1K56 D;  1IKI A;  2E8I A;  5J7E A;  3MKE A;  3HUO A;  4ID4 A;  2WUQ A;  2GNX A;  3T4T A;  1YKD A;  1FIL A;  5HL6 A;  4QU3 A;  3IS2 A;  3CZD A;  2Y2Q A;  3UE0 A;  5HX9 A;  2PU2 A;  1HLU P;  2OSU A;  4Q0I A;  4F3L B;  5DTK A;  4PKY A;  3F1O A;  1VQQ A;  1FSW A;  1OME A;  2Y2P A;  3HVF A;  2P9V A;  3UE3 A;  4DMZ A;  2VEA A;  3AGE A;  2PBY A;  2W1T A;  4U0T A;  4MN5 A;  3LIC A;  4XUX A;  5L10 A;  4EER A;  3T4Q A;  2OLV A;  4NET A;  4KZ6 A;  3WRT A;  2XLN A;  4HHD A;  4ETZ A;  4WF0 A;  4R3J A;  4LPZ A;  5TFQ A;  5AQ9 A;  3CHW P;  4ZTK A;  4F94 A;  4WEL A;  2B02 A;  5FDS A;  1PI4 A;  3D9Y A;  2HDU A;  4R4R A;  3UPO A;  3GR2 A;  3H7W A;  4CLC B;  2WYX A;  3MXQ A;  1F9I A;  2Y2M A;  3ZG7 B;  1C3B A;  2Y79 A;  2XRN A;  2C5W B;  3W8K A;  1NZO A;  1L2S A;  5F82 A;  3KSF A;  3MMH A;  3HLF A;  1PRQ A;  3GEC A;  4N92 A;  5EVL A;  5HPF A;  4Y5F A;  3LO7 A;  4PAU A;  1NLY A;  3ZG8 B;  1STZ A;  2XD1 A;  1PZO A;  4WEJ A;  3HCY A;  4X1L A;  4I38 A;  1L0F A;  2VA0 A;  1H5X A;  2LB9 A;  1GA0 A;  4EV4 A;  5FI7 A;  3G2Z A;  2ZQC A;  3ZNY A;  1FR6 A;  1OPX A;  5JYO A;  1MC0 A;  2PHY A;  1K56 A;  1PNE A;  1WYB A;  3BRM A;  3NY4 A;  5GLB A;  1NXY A;  3VMA A;  4OKP A;  3IX3 A;  2Y8H A;  4Q0J A;  3OPR A;  2OV5 A;  5EM1 A;  3C7U A;  4UAA A;  1J3W A;  3LR5 A;  3T1X A;  3V3R A;  3LR0 A;  2NUP C;  3VV4 A;  4OPY A;  5KSC A;  2P9V B;  3ITA A;  3UDF A;  4OQG A;  2VX8 A;  3IXB A;  3V67 A;  1NYY A;  3LIB A;  1YT4 A;  2PYP A;  1L0G A;  1TVF A;  1HTZ A;  1JTD A;  1YQS A;  2WGI A;  5IHV A;  3UB7 A;  5J8X A;  3LYX A;  3DAV A;  3IS2 B;  4EW7 A;  4WUJ A;  1CEF A;  5FQI A;  3C4O A;  3Q7V B;  5L09 A;  3HLB A;  5E2G A;  2FFY A;  4C6Y A;  2XEP A;  2WZX A;  1V9Z A;  2JKR I;  4RX3 A;  3HJI A;  1ALQ A;  1CEG A;  4F3L A;  1BTL A;  1TEM A;  2R78 A;  1IEM A;  2HJE A;  3H82 A;  2VV6 A;  4OPZ A;  4BLM A;  1BSG A;  3QNC A;  3ZHH A;  1SHV A;  3VOZ A;  4Y0T A;  2QMI A;  1K0K A;  3WS2 A;  4AFI A;  2XGN A;  3F1P B;  3NDE A;  3UB8 A;  3UE6 A;  5HL1 A;  3UDX A;  3DTE A;  4BL3 A;  1SKO B;  1CJF A;  1K57 A;  1Y28 A;  4IED A;  1H8M A;  3T4S A;  1NRF A;  1VB6 A;  1LI9 A;  2VKS A;  3K3D A;  3UDI A;  4EWF A;  3MKF A;  5KSH A;  4OVD A;  2K7S A;  3HLD A;  1LL9 A;  1G6A A;  4EES A;  1YM1 A;  3A0V A;  1S1Y A;  4JXG A;  1W5D A;  4LRY C;  4FCF A;  4X69 A;  4S2I A;  5F1F A;  2PDR A;  4GS9 B;  1GCE A;  3PR6 A;  4QPR A;  5TR7 A;  1JVJ A;  4KG2 A;  4Y17 A;  1PWG A;  5TGF A;  5EM0 A;  4IVI A;  3L7H A;  4E3K A;  3VP3 A;  4KZ9 A;  3G4P A;  3SZT A;  2OWH A;  1MWT A;  4DDS A;  1XGJ A;  2ZJ9 A;  1YSQ A;  5DTT A;  2E8J A;  4I5S A;  3VSL A;  2HGV A;  4GS9 A;  1IOU A;  3OPP A;  1K57 C;  3JYI A;  5HAI A;  3V3S A;  3WS1 A;  5EV0 A;  5CHM A;  2FFF B;  3AGD A;  4C75 A;  2D02 A;  4LV2 A;  5F6A A;  3LR3 A;  4ETX A;  2V20 A;  2H10 A;  4WZ5 C;  2WGW B;  3VOL A;  4GLQ A;  1L3L A;  3R4K A;  1PWC A;  4NXF A;  3S1Y A;  2P74 A;  4QHC A;  5FAS A;  3BEB A;  1UWN X;  4HJ3 A;  2DRW A;  4HBU A; 
#chains in the Genus database with same CATH homology
 1YAX A;  4M4X A;  3TRC A;  3KO6 A;  3ULF A;  2VLG A;  4BBT A;  2JKT M;  2QWS A;  4NKP A;  4BMW A;  3ZYT A;  4I39 A;  4NXE A;  3K2N A;  4HP4 A;  5LBR A;  3B47 A;  3MJQ A;  5HDD A;  2ZOI A;  3BW6 A;  5DKL A;  1F98 A;  3D3O A;  2XSS A;  3F1O B;  3FG8 A;  2L4R A;  5MC7 A;  2A24 A;  5TBM A;  3C2W A;  3RH8 B;  4HOI A;  1IFQ A;  1GSV A;  4I3J A;  5HD5 A;  4HH3 A;  1DRM A;  2B18 A;  4R38 A;  4WEK A;  2KLI A;  3LR4 A;  3S7N A;  4HJ6 A;  4L9E A;  2VGL S;  1P0Z A;  3NOP C;  1G28 A;  1UGU A;  5F69 A;  4ME4 A;  4K08 A;  3B33 A;  1P9W A;  3KYZ A;  5DF9 A;  3PBT A;  4HJ4 A;  4NXB A;  1XJ4 A;  3MFX A;  2K31 A;  2EWV A;  2YKH A;  2K2N A;  4MCW A;  1S67 L;  4WL9 A;  1XJ6 A;  1OJG A;  5EFW A;  1TD5 A;  3IBJ A;  4KQD A;  4YOF A;  4CLC C;  2A2L A;  3BY9 A;  3LIA A;  3LUQ A;  4OOM A;  3E4O A;  1XFN A;  3PHY A;  2GZA A;  3A0R A;  4UEY A;  3KSH A;  3EWK A;  2D01 A;  4UQI M;  3FPV A;  3CUE C;  3FC7 A;  2JN7 A;  2J3W A;  3E0Y A;  3LI9 A;  4B9O A;  1P9R A;  4E04 A;  3H82 B;  5L8M A;  1NLZ A;  4EEU A;  3T4J A;  1LL8 A;  2VGL M;  3EEA A;  4B93 A;  2V1A A;  3U2A A;  4CLC E;  3CAX A;  3CUE A;  3NOU C;  1X0O A;  2J3T C;  3S7Q A;  2VV7 A;  4I3A A;  4H6J A;  2OWJ A;  2O9B A;  5HWW A;  3ZQ5 A;  2NUT C;  3VE3 A;  1S1Z A;  4WN5 A;  5J7E A;  2DMW A;  3PBR A;  5HWT A;  3T4K A;  2YKF A;  3CWF A;  1OJ5 A;  2QKP A;  2GNX A;  3T4T A;  1YKD A;  3EGD C;  4ARZ B;  3C38 A;  4P6Z S;  5HL6 A;  3IS2 A;  1P97 A;  3UME A;  3EQU A;  4HP9 A;  4OOL A;  3G6O A;  1N9N A;  3LIF A;  4BJP A;  4DJ3 A;  2A24 B;  4HQA A;  4P6Z M;  1T1A A;  3W2Z A;  2KDK A;  4Q0I A;  4F3L B;  3PBQ A;  4I3I A;  1G6O A;  5HD3 A;  3LI8 A;  3EGX C;  3OOV A;  3F1O A;  4PKY A;  3UMD A;  1VHM A;  2WKR A;  3KYQ A;  3BY8 A;  4YNR A;  2W3H A;  5I5L A;  3MQQ A;  3CI6 A;  2ZOH A;  4DMZ A;  3UE3 A;  2VEA A;  4KQO A;  4IUK A;  4Z1W A;  5DJT A;  3BQ8 A;  2W1T A;  3F1N B;  3T4O A;  4MN5 A;  3LIC A;  1TS0 A;  2VV8 A;  4EER A;  4Y2F A;  3T4Q A;  4Q0H A;  4MMN A;  4HHD A;  3TJZ C;  4ETZ A;  4WF0 A;  3EEH A;  4LPZ A;  1DP8 A;  4O8G A;  3VE4 A;  2W3D A;  4GJ4 A;  5CX7 A;  4EU0 A;  3PXP A;  3NJA A;  1H3Q A;  3FPW A;  4MN7 A;  1OTA A;  4WEL A;  2B02 A;  4XT2 A;  1KOU A;  3DBA A;  1DP9 A;  2PT7 A;  3H7W A;  4R6L A;  2W3E A;  1XJ2 A;  3PBN A;  4PKY G;  3PBO A;  3MR0 A;  3PYP A;  4CLC B;  3MXQ A;  1F9I A;  4GCZ A;  1LT0 A;  5HSQ A;  3O5Y A;  4ZRR A;  2Y79 A;  2FH5 A;  3ICY A;  5IS1 A;  2XRN A;  4L9G A;  1T18 A;  5DJU A;  4KUO A;  3KSF A;  3MMH A;  2GJ3 A;  3RTY A;  3GEC A;  2PR5 A;  2Z6D A;  5HPF A;  5AJG A;  4Y5F A;  4PAU A;  1NLY A;  2MJ6 A;  1STZ A;  4GHI B;  5C5K A;  4WEJ A;  1D06 A;  3OCN A;  3BJN A;  3A0S A;  3HCY A;  2VJW A;  5A8B A;  3EOI A;  5KIZ A;  4I38 A;  2OAQ 1;  2VA0 A;  3HJK A;  2LB9 A;  1S66 L;  2M7U A;  5FL3 A;  4EUV A;  2O99 A;  2INW A;  5F5Y A;  1OPX A;  2KX6 A;  4L9F A;  3TW8 A;  2XA7 M;  5J4E A;  2V0W A;  3IBR A;  1MC0 A;  2PHY A;  5TBM B;  4H6J B;  2WKP A;  3T50 A;  3B42 A;  2PD7 A;  4IHQ A;  3GDI A;  2W1R A;  2L0W A;  3C30 A;  1V9Y A;  5IT5 A;  4Q0J A;  2Y8H A;  3OBF A;  1XFQ A;  1YSP A;  4EEP A;  3UB9 A;  2OOL A;  3LR5 A;  1JNU A;  4G3W A;  3S7P A;  2Z6C A;  3F1P A;  3LR0 A;  2NUP C;  3R7W B;  3VV4 A;  1N9O A;  3CIT A;  5HZH A;  4O0P A;  2O9A A;  2QJ5 A;  4LLO B;  1ODV A;  4JGR A;  2VX8 A;  5DKK A;  3R7W A;  3H7W B;  4HIA A;  3OC2 A;  4BWI A;  3BQA A;  3V67 A;  3LFV A;  3LIB A;  2PYP A;  1UWP X;  1GSW A;  3LID A;  2W0N A;  1XJ3 A;  5TJJ A;  3E4P A;  2ZBB A;  1OTI A;  3UB7 A;  3MQ0 A;  1TS6 A;  1WA9 A;  4LRX C;  3UB6 A;  5AVE A;  3LYX A;  2J3T D;  2HJ9 C;  2ZMV A;  1S4R A;  3IS2 B;  4EW7 A;  1LSV A;  4WUJ A;  4MN6 A;  2W1T B;  5K5B A;  4CLC A;  1D7E A;  3RFB A;  2J80 A;  1TS7 A;  2KOI A;  4R3A A;  2CMN A;  2W3G A;  3P01 A;  5J3W A;  2QYB A;  3E98 A;  4GHI A;  1V9Z A;  2JKR I;  4II7 A;  3KX0 X;  5HDC A;  2ZMF A;  3HJI A;  4F3L A;  2R78 A;  3SW1 A;  2IA2 A;  2V1B A;  2PYR A;  2HJE A;  4LRZ E;  5G4Z A;  4HI4 A;  3H82 A;  2L1M A;  5IU1 A;  4EET B;  1NRJ A;  2VV6 A;  4PHT A;  5HDS A;  4FSF A;  2PD8 A;  2G7U A;  4L0L A;  1N9L A;  4MDZ A;  4NEE D;  4NXG A;  2I9V A;  3KSG A;  1OT9 A;  4AFI A;  2EWW A;  3F1P B;  3UB8 A;  4EXO A;  2H28 A;  3UE6 A;  3E4Q A;  2QJ7 A;  2HV1 A;  3TE8 A;  2V9A A;  1LSX A;  4CQH A;  1TS8 A;  2GX5 A;  1Y28 A;  4O01 A;  2W3F A;  1H8M A;  3T4S A;  1VB6 A;  1W63 M;  3K3D A;  2VKS A;  4JGP A;  2O0Y A;  4CLC D;  4GW9 A;  3D72 A;  3LIE A;  1ZTU A;  5KSH A;  2K7S A;  2M1C A;  4EQ1 A;  1T1B A;  4FOF A;  2PR6 A;  4JGO A;  2VZW A;  4IUH A;  4BBV A;  5DFY A;  2BAS A;  3P7N A;  4EES A;  3A0V A;  2XRO A;  2QHK A;  1OTE A;  3C8C A;  1S1Y A;  4DN0 A;  4LRY C;  4XT2 B;  2LB5 A;  1OT6 A;  3CLO A;  4KUK A;  1OTD A;  2PDR A;  4G3V A;  4GS9 B;  1MKM A;  3OCL A;  3PBS A;  3PR6 A;  4QPR A;  3NOT C;  3JVV A;  4JGQ A;  5AVF A;  1GSX A;  3EQV A;  1LSW A;  2JKR M;  2OAP 1;  1TF1 A;  4ARZ A;  1F5M A;  4R70 A;  3BWL A;  4HNB A;  1T1C A;  2OWH A;  4Y3I A;  1BYW A;  1YSQ A;  4UQI S;  2W27 A;  5DFX A;  5G4Y A;  2FZ0 A;  4HY8 A;  4I5S A;  2WKQ A;  2HGV A;  3MF0 A;  4GS9 A;  1IOU A;  2XA7 S;  1S4S A;  1ZHH B;  3H9W A;  2P08 A;  2O9C A;  5F68 A;  4IJG A;  3KSI A;  2D02 A;  5HWV A;  5F6A A;  4G3K A;  3T4L A;  3F1N A;  3LR3 A;  2JHE A;  4ETX A;  2P04 A;  3S7O A;  3K3C A;  4DJ2 A;  4WLA A;  2P7J A;  1MZU A;  2JKT I;  4BBU A;  3VOL A;  4GLQ A;  3NHQ A;  3R4K A;  1EW0 A;  3JVU A;  1T19 A;  4NXF A;  2EA9 A;  3MQO A;  1DP6 A;  5HPI A;  1OTB A;  2V0U A;  2M7V A;  1NWZ A;  1W63 Q;  2HF6 A;  4YWZ A;  1UWN X;  4HJ3 A;  4RQ9 A;  3OLO A;  4HH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...