2VGLS

Ap2 clathrin adaptor core
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
142
structure length
142
Chain Sequence
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Architecture and Functional Model of the Endocytic Ap2 Complex
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
molecule keywords ADAPTOR PROTEIN COMPLEX AP-2, ALPHA 2 SUBUNIT
total genus 50
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2007-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2vglS00
2HF6A 2VGLS 2XA7S 4P6ZS 2VGLM 2XA7M 5MC7A 1NRJA 1W63Q 2JKTI 2JKRI 2JKTM 4P6ZM 2FH5A 2JKRM 3TJZC 4UQIM 1W63M 4UQIS 4NEED
chains in the Genus database with same CATH superfamily
2HF6A 1I5QA 3BFDA 4R6LA 4EBLA 3IXGA 4QB8A 1NLYA 3ZVWA 1YSPA 3UMDA 1YLYA 3T1XA 2VGLS 3F1PA 3BW6A 4CLCC 3UB5P 3A0VA 3M6HA 1NRJA 4I3JA 2OAP1 4FH4A 2P9VA 3IH8A 5DJUA 1J3WA 2OWHA 5E2GA 4OQIA 3VOZA 3ZVTA 2G7UA 4KZAA 2WKRA 2EWWA 2OLVA 4LV1A 2JHEA 4GDBA 1RGYA 1UWNX 2V0WA 4X1LA 5HDSA 2XDMA 1I2SA 3UO9A 1OJGA 3H7WA 4JF4A 3ITAA 4HOIA 3W4PA 4UA6A 3LIDA 4GKUA 1PRQA 2PR5A 4KZ5A 2HGVA 3OCLA 1SDNA 5FQQA 4GB7A 1K6RA 2CMNA 3O87A 1P9RA 4WMCA 5DF9A 4ME4A 3LICA 1YMSA 3N8LA 4Y0OA 3FZCA 4ETXA 2B5RA 4LCMA 5DF7A 4EQIA 4L9GA 4LRZE 4E3LA 3BFCA 4BJPA 3DW0A 5G18A 1ALQA 1HTZA 4CLCE 2Z2LB 3Q7VA 1U60A 1CI8A 4K0XA 4R23A 4Y0UA 1TF1A 5EUAA 4IUHA 2XQZA 4IEDA 2B02A 5GLCA 3R7WB 4KG6A 1G5UA 1S66L 3H9WA 2RL3A 3JVVA 3MS6A 1MWRA 4HEFA 3GDIA 3KYEA 5TR7A 3V67A 3AGFA 2Y2IA 1VEUB 1SZVA 4BBUA 4EXOA 1PI4A 1L0EA 5L09A 1TS0A 4P87A 4MBKA 1DJCA 2V20A 4C6YA 2WGWA 1K4FA 2WZZA 2QZ6A 3TRCA 1XJ2A 1W79A 5FQ9A 3RXXA 5F1GA 4HHDA 2VV7A 1ODVA 3ZYTA 3VP3A 3DTIA 3RTYA 4PAUA 3ZFZA 3GMWA 4HQAA 2WKIA 3M2JA 4MDZA 2Y4AA 2EXAA 1FIKA 2NUPC 2EX9A 1S4SA 4JGPA 4DE0A 4ZJ1A 5GLBA 1KVLA 3E4QA 4F3LA 1JNUA 4LRYC 3N6IA 2M1CA 4Q0IA 4YFMA 5FA7A 4QWOA 2JBFA 3UPOA 2YKFA 5HWVA 3ISGA 4ZJ3A 3UB9A 3VP2A 5CEBA 3OPLA 3VSKA 4S2JA 3LEQA 4NXFA 1FSWA 2ZJ9A 5E2FA 1L0GA 4RA7A 5BOHA 1FOFA 5GHZA 1PYYA 2JKTI 4IJGA 5KMWA 4MLLA 4HIAA 4PM9A 3BYDA 5FQMA 4N1HA 4X6TA 3U4LP 1XPBA 1RP5A 5FI7A 4B4XA 4ETZA 3DBAA 2X02A 4HESA 2G2WA 3C4PA 4UA7A 3JVUA 1OTEA 2L4RA 4X55A 3UPPA 3U2AA 3PR6A 1TD5A 3NBLA 2UV0E 1FCNA 2VK3A 1KGEA 4KZ7A 1W63M 4GS9A 4JGQA 2A24B 2P7JA 4FOFA 3BFFA 3MQOA 4OPYA 3G35A 4F94A 3NOUC 1YLPA 2A24A 2BASA 3AGEA 4DRTA 1IYQA 5K5BA 1N9BA 3CUEA 4HI4A 3GQZA 2Z6CA 1DY6A 1NWZA 5DTTA 2XRNA 4KZ6A 2IWCA 1HLUP 2IWBA 1L2SA 4E3MA 5DKLA 2EWVA 4P6ZM 4OLGA 3FKWA 3QP4A 1I2WA 4WN5A 3A3EA 3LGOA 4NG2A 4JPMA 2H0TA 2OWJA 3ITBA 2GDNA 3OC2A 2HDRA 2W1RA 3DTKA 4N92A 4EERA 3OLOA 4OPRA 3OCNA 1ONGA 2Q9MA 2J9PA 4O7DA 4CLCA 5HDCA 1GA0A 5AJGA 1MWSA 5A93A 5CHUA 2PU2A 3H82B 1TVFA 2W1TB 3RFBA 3SW1A 3FPVA 1GHIA 5DVAA 2ZC5B 3IF5A 1L3LA 1S0WA 2WK0A 4OQGA 5CTNA 1YLWA 3EEHA 1LL9A 1PFLA 2VEAA 4R1GA 3O5YA 2VGJA 3MKEA 2M7VA 4Q8IA 2LB5A 3MFXA 2W3DA 1KE3A 3VP0A 3VV4A 1SKOB 4WMCD 2W3EA 1H8MA 5F1FA 3T4KA 4JBFA 1M6KA 2J7VA 1JWVA 3PBRA 2UWXA 1SKOA 4JF5A 3EWKA 3VE4A 2ZD8A 2WKQA 4JF6A 3IX8A 3SS3A 2XGNA 2P74A 1OTBA 5CX7A 4DE3A 2G2UA 3PBSA 3S1YA 4PM8A 3SH7A 4R0QA 2JE5A 4BWIA 2C6WB 4KZ8A 4BQMA 4S2IA 4XT2B 5HWTA 3DWKA 3LO7A 2WGWB 4Y3IA 1KGGA 2DMWA 3HUNA 1YKDA 1CJFA 5M18A 2XLNA 4KQRA 3B33A 4WUJA 3FV7A 3LCEA 3LR5A 2WAEA 3F1NA 1Z09A 4QHCA 4B93A 4BL3A 4CLCB 4PHTA 1FCOA 5CXWA 4MCWA 1LLBA 4S2OA 4BD1A 1TS7A 4FTXA 4S2MA 1V9ZA 3IF6B 3N8RA 2ACGA 4E3KA 1MBLA 2CC1A 3BLSA 1JTDA 2H10A 2Y2OA 2JC7A 5HAQA 4OH0A 2VX8A 2FH5A 4R4SA 4KUOA 1IYOA 4X69A 3VOLA 3WWXA 1YMXA 2H5SA 1SHVA 4BLMA 2Y59A 1VB6A 1LI9A 4JGOA 3S7PA 2ZLYA 1RCJA 1T18A 3MZEA 3HREA 1X0OA 3MSHA 1OTDA 1VETA 4GCZA 3C5AA 4PM7A 1GSXA 4GZBA 3FG8A 2ZC4B 3SOIA 3NOTC 2O9CA 5J7EA 3MR0A 1JTGA 5F69A 4CJNA 2D01A 2EFUA 2VGKA 4G3KA 4IBXA 2WGVA 4Y5FA 1YLTA 4UHUA 4PM6A 5JYPA 5C5KA 3IS2A 4U3TA 1BYWA 5HL1A 4UQIM 2I72A 5FQIA 4QPRA 3HVFA 1DP8A 1HZOA 1XJ3A 2ZQ7A 2O9BA 2OAQ1 4ZBEA 4EEUA 4Y7PA 3UE6A 3VMAA 2Y2JA 3ZDJA 1W5DA 4KUKA 1N9OA 3O88A 1D06A 5TGFA 3G6OA 4KZ4A 4NXEA 1IFQA 4KQDA 3UDXA 3ZNYA 3B42A 4BENA 3G4PA 4RVAA 5HWWA 3HLWA 3IWIA 5A90A 1TDLA 2WAFA 1HD8A 4HJ3A 3IXBA 1P9WA 1AWIA 3RXWA 4PKYA 5L2FA 1BSGA 4LLOB 4ZDXA 1H0MA 2P08A 2ZQDA 1T19A 4OP5A 3E4OA 4OQHA 3TJZC 3T4SA 3M2KA 4Y13A 1YM1A 3M6BA 1K0KA 4HP9A 4ZTKA 1NJ4A 1PI5A 1P0ZA 2ZM8A 2ZQAA 1ZC2A 4XUZA 4XUXA 1K54A 3TW8A 1FR1A 4WZ5A 5J4EA 4JLFA 3G30A 1SCWA 4NK3A 1OMEA 4QJGA 5DJTA 4BBTA 4K91A 5EECA 2PDRA 5HD3A 3LEZA 5HZHA 1SDEA 3HJKA 5HPFA 1T1BA 2ZBBA 3UMEA 3D4FA 1LSXA 2VV8A 1MC0A 1K25A 4LFUA 1S1ZA 4OOMA 5GHYA 3GSGA 4BL2A 3UB8A 5HX9A 5CRFA 3C7VA 4E3NA 2PYRA 4RQ9A 2VV6A 4ESPA 4OKPA 1YSQA 2V8CA 3LY3A 3KSHA 4WEJA 2PBDP 5CGWA 4FSFA 5A91A 3QNBA 4JXWA 1C3BA 4OOLA 2ZMVA 1K4EA 3MZFA 5IT5A 1MZUA 2Y2MA 3NC8A 1OJ5A 3HLBA 3P98A 2HP5A 2JKGA 2O99A 4EUVA 2GJ3A 4O01A 3GV9A 4QU3A 4R3BA 5EVIC 4H8RA 2Y2GA 2ZL1B 1WE4A 3VP4A 4II7A 3QP6A 3MQ0A 3ZQ5A 2JCHA 2ZL1A 3FPWA 5FDSA 4EBPA 3D3OA 3S4XA 2HDUA 1VM1A 5KSCA 5MC7A 3S7OA 2WADA 2DNSA 2PHYA 3B47A 4OLDA 2OV5A 5DFYA 3Q7VB 1AXBA 1GSVA 3MXRA 1W8QA 1YAXA 2EFXA 3VP1A 3UNWA 5AVEA 4GNUA 5IHVA 4GLQA 1Y54A 3UB6A 1IYSA 4KZ9A 3PBQA 3DAVA 3IBJA 4P6BA 1D1JA 3W8KA 3P7NA 4IBRA 4EV4A 1KOUA 4Z1WA 1CEGA 3HLEA 4ARZB 4N9KA 1F9IA 3SZTA 2WZXA 3NULA 3V3SA 3A0SA 2R9WA 2ZMFA 2Y2LA 2XSSA 4DDSA 3HLCA 4DJ3A 1CI9A 1MKIA 1K57A 3PBTA 2VZWA 2KLIA 1K56A 2O0YA 2Y2KA 4HBTA 2HZ5A 3HCYA 5EVID 5HL6A 1BUEA 1IEMA 2QMIA 3K3DA 5FAQA 2ZQCA 3ICYA 1LI0A 4WYYA 4LGWA 4WZ5C 5CERA 3BQ8A 2ZC6B 3T4JA 3IX3A 4EQ1A 1BLCA 3LIEA 4I38A 3V3RA 5HD5A 5E2EA 3HUOA 1G68A 1N9LA 2VJWA 4UQIS 4G3VA 4RX3A 1XX2A 5AQ7A 4LENA 5FAOA 3MKFA 2KDKA 3WS0A 3C4OA 2XROA 3UE3A 2ZC7A 2OOLA 4E3JA 1STZA 3CLOA 2B18A 3CPTB 2WYXA 1ESIA 2ZC3B 2J3TC 3PAGA 5F82A 3CAXA 2DRWA 2HDQA 2EX8A 2ZOHA 2ZOIA 4JGRA 3UB7A 1ACFA 1HVBA 3IBRA 3GRJA 1V9YA 3K3CA 3LI8A 5TBMA 3WS4A 1KE0A 4R4RA 1NZOA 2R78A 5CGSA 4QY5A 4DXCA 4PKYG 3T4LA 1NYYA 1CK3A 3T4OA 3MZDA 3E2LA 1ES2A 3ZNTA 1EW0A 4LV3A 5G4YA 2QJ5A 1T1AA 1E3UD 2WKPA 2ZM2A 1XXMA 3KYQA 1VHMA 1P97A 4LV0A 3F1NB 2H28A 3PBOA 1TS8A 4HH2A 2XA7S 2BLSA 3SS5A 4ARZA 5FL3A 1FQGA 3T12B 5EV0A 1FILA 3TG9A 1LL5A 1K6SA 2V9AA 4P85A 3CZDA 4DE2A 4MN5A 4UA9A 3S7QA 4GD6A 2WUQA 2PAVP 1XP4A 3MXSA 4KZBA 3OZHA 4KG2A 5DTKA 3D9YA 5FDHA 4DMZA 2JKTM 1K55C 1ESUA 4B4ZA 4WF0A 3SH9A 5KIZA 4MN7A 5JYOA 1OT6A 3FKVA 1ONHA 4XXRA 3PAEA 1PWGA 1E3UA 3KSIA 2A49A 2A3UA 2Y2NA 1BZAA 1XGIA 1BLHA 2J3WA 4FD8A 1LT0A 2FFFB 2DCFA 3UY6A 3MF0A 2WKHA 3ZHHA 2Q9NA 4E04A 3C7UA 3LIBA 3JPUA 3EOIA 4OONA 3NECA 4YINA 5GLAA 3W4OA 5AQBA 3I7JA 4G3WA 5U47A 2Y8HA 4P0MA 3QP5A 1JWPA 4HNBA 4GN2A 1XGJA 1IOUA 3PBNA 4CQHA 3WS5A 1YLJA 2KOIA 4OPQA 4HJ4A 3EGXC 3VE3A 4IUKA 2J9OA 5EFWA 3UPNA 4X25A 3VFHA 3EQUA 3IX4A 4NXGA 2P04A 1S6RA 3QNCA 1VQQA 1EROA 4WM9A 4HY8A 3KSFA 5GL9A 1F98A 3ZCZA 1YLZA 3L9KA 2V0UA 3BJNA 4WELA 5A8BA 2C5WB 1XA1A 1IYPA 4EESA 1S4RA 2VLGA 1IKGA 3VOYA 1Y28A 4I3AA 4PM5A 3OPRA 2EX6A 3AGDA 4PPRA 5HAPA 2XK1A 3OPHA 2X71A 4C75A 4GDNA 3CWFA 5HSQA 1LSVA 1Z6FA 2FFYA 4OVDA 1BLSA 2QHKA 1IELA 3SH8A 1RGZA 3MXQA 3N7WA 3O3VA 1FR6A 1W8YA 1ERQA 4O0PA 2K2NA 3R4KA 1KDWA 4D2OA 4UEYA 3HBRA 1WA9A 4MN6A 3LR3A 2VKSA 5L07A 3T1RA 2HP9A 5EM1A 2PD8A 3BECA 2HV1A 5M1AA 4LRXC 4JXGA 5EVLA 4U0TA 1SKFA 5I5LA 4N1XA 3QP2A 5HFOA 5FQJA 1GA9A 5FQKA 4M4XA 2HJEA 4KZ3A 4EU0A 1MKMA 2XD1A 3Q07A 4DN0A 3DTEA 3P09A 4CPKA 3G2ZA 4R3AA 1XJ4A 2Y91A 3T4TA 4IVIA 4O8GA 1PNEA 5EVEA 3HLFA 2X01A 5J8XA 3LYXA 4F3LB 3BRMA 2NUTC 3IF6A 3Q82A 1YT4A 5EPHA 1NXYA 5M19A 1GCEA 5HAIA 4Q0HA 3LIFA 2IA2A 3C38A 4X68A 3NDEA 5FEGA 1OTIA 3UE1A 5EOOA 4S2NA 1EWZA 1CEFA 4KG5A 3A3IA 1J9MA 4U0XA 4GD8A 2QJ7A 5CECA 2Y55A 5F83A 2PRFA 2KX6A 1ERMA 4DXBA 1DP9A 2Y2PA 2B95A 3GR2A 4WZ4A 3FWLA 1BULA 3GTCA 2H0YA 3S7NA 2XR0A 1ES4A 3NCKA 5CHJA 1VEUA 1CF0A 4R70A 1N4OA 3R7WA 5DKKA 1ES3A 4KQOA 1PIOA 3ZG5A 3BM6A 1JWZA 5TJJA 2BG1A 3K2NA 1W7FA 4JXSA 2YKHA 3ZG8B 3Q81A 3SS4A 2O9AA 1G6OA 3T1QB 1LL8A 3CJMA 3PHYA 4BMWA 3JYIA 2HP6A 4OOYA 1BLPA 5F68A 3NDGA 3G34A 3LUQA 4Y2FA 4L0LA 3S22A 3C2WA 2HPBA 4B88A 4FCFA 5F6AA 3G2YA 1LSWA 3IT9A 2Y79A 3IWOA 2Y2HA 1XFQA 3BY8A 3MFDA 4P6ZS 3IHBA 5EE8A 4E3IA 4LPZA 1ES5A 1S1YA 3WRZA 2W0NA 3L7HA 4DF6A 3GECA 1O07A 5DF8A 4RYEA 3G31A 4R3JA 3V39A 4UAAA 4RX2A 2J80A 1UWPX 1K55A 5EVIB 3T1SA 2XFSA 3ULFA 1Y4OA 5A92A 2QYBA 1XFNA 3LIAA 5E2HA 3IQAA 2XF3A 3DWZA 3EQVA 4BBVA 3QP1A 2W1TA 1H3QA 1DJAA 5DTSA 1G28A 4GS9B 5F5YA 4DDYA 1OT9A 1NLZA 1GSWA 3T4QA 3TSGA 3G32A 2QPNA 3LI9A 4I39A 3QP8A 5AQAA 5FASA 5FSRA 4Q0JA 1WYCA 3A3FA 4EBNA 5CTMA 4Y15A 2FZ0A 4GHIA 1KE4A 5IU1A 3F1PB 1FCMA 1PWDA 2RCXA 2JKRI 3HUMA 4ID4A 3T50A 5TFQA 5IS1A 5HW3A 3C30A 1L0FA 3HLDA 1K38A 3NHQA 1S67L 1KGFA 5EM0A 2XD5A 1CQAA 1PW1A 3Q1FA 3OPPA 4I5SA 4MBFA 5J3WA 2L0WA 5GLDA 1Q2PA 5HARA 4JXVA 2WGIA 3V50A 4YWZA 3E2KA 1YQSA 4K0WA 3QHYA 2M7UA 1TDGA 2K31A 3LY4A 4QY6A 3UN7A 3A3DA 4E6XA 2XH9A 4N9LA 3MMHA 3MJQA 3NY4A 1XA7A 3H82A 2BTFP 2R9XA 2E8IA 4HJ6A 2EX2A 4EW7A 1KVMA 3CI6A 4EWFA 4X53A 1IKIA 1UGUA 1ZKJA 4KQQA 3F1OB 1K57C 1ZG4A 2IWDA 4HP4A 3TE8A 1K56D 4KENB 4L9FA 3MBZA 1M40A 4Y0TA 3LR0A 5DFXA 5TBMB 3ZG0A 1A0KA 4Z9QA 3LFVA 4AFIA 2INWA 2P9VB 3HLGA 3CHWP 2OSUA 3IXHA 3OOVA 4GHIB 2V1AA 3OBFA 1OTAA 1KDSA 3KO6A 4NEED 2GZAA 3UDIA 4DE1A 3ZG7B 3NIAA 3BFGA 3EGDC 1D7EA 2XEPA 4DKIA 4ZAMA 1NYMA 5EOEA 4K08A 4B9OA 3W4QA 4HH3A 3O86A 2PBYA 4OP8A 1JVJA 4EETB 2ZMAA 3BWLA 2XA7M 4GOGA 3HJIA 4EEPA 2Q0OA 4H6JA 4PMAA 2PU4A 1MWTA 3IHAA 2V8FA 4IVKA 2K7SA 1H8YA 3F1OA 2W3GA 1WYBA 3IWQA 5EVIA 3H7WB 1YPRA 5L8MA 3CMZA 1TEMA 3EEAA 3CG5A 2V1BA 3VFFA 3RH8B 4XT2A 3IF6C 4NETA 3D72A 4NKPA 4CLCD 2J3TD 4X56A 4LV2A 3E98A 3E4PA 2W3HA 4LCLA 5FEFA 1FSYA 1EI5A 2E8JA 5FI6A 4S2LA 2W3FA 3UE0A 2PR6A 1NY0A 1QMFA 2D02A 4M3KA 4MEZA 3C8CA 5HDDA 3VSLA 3ZG9B 4WEKA 3ZGAB 3KX0X 5G4ZA 1L0DA 1E4DA 1MWUA 4EUZA 1MXOA 1TS6A 2LB9A 5HPIA 1BT5A 1GHMA 4ZRRA 3IH9A 1XJ6A 1DRMA 2L1MA 1MY8A 4I3IA 1LHYA 1OPXA 2ZM0A 4ZJ2A 3WS1A 2JN7A 2QKPA 3BEBA 3HL9A 5E43A 3V5MA 5KSHA 2JKFA 2Z6DA 2XFTA 4Y17A 3PTEA 2GNXA 5LBRA 5KZHA 3B3XA 1BTLA 3GVBA 4X1MA 4H6JB 2PYPA 3WRTA 1ZTUA 5FATA 1PW8A 2EA9A 2V1ZA 1K54C 4D60A 3UDFA 3BFEA 1W63Q 1XKZA 2A2LA 5GHXA 2J8YA 2ZQ8A 2HDSA 1DP6A 1H8ZA 2VA0A 4NXBA 4YOFA 1QMEA 4GW9A 3W2ZA 3MQQA 3A3JA 1PZOA 3IS2B 2I9VA 3NJAA 3PXPA 2QWSA 3E0YA 4OQ0A 2W27A 2HJ9C 1NZUA 3CPTA 4GJ4A 1NRFA 4S2KA 1GHPA 2Z2MB 4QD4A 3CITA 4FUWA 2PD7A 1N9NA 4YNRA 5CEDA 4L9EA 2JKRM 1VETB 1Q2QA 4MNRA 4S2NC 3DTMA 5L10A 5I94A 3KSGA 3N8SA 3NI9A 4WBGA 2PT7A 1H5XA 1ZG6A 3BQAA 5CHMA 5FAPA 1DJBA 1G6AA 4FH2A 3IXDA 2GX5A 4HBUA 5CGXA 4JKTA 3BLMA 4MMNA 2EXBA 2MJ6A 4OPZA 3N4IA 2Y2QA 1F2KA 1O7EA 5AQ9A 4C3QA 4MBHA 2OLUA 3LR4A 3Q7ZA 4WLAA 1ZHHB 4E6WA 3BY9A 3WS2A 3CUEC 4R38A 4WL9A 1T1CA 2VGLM 2ZQ9A 1PWCA 3PYPA 3A0RA 3FC7A 3FYZA 2AVXA 4S2PA 4IHQA 1MPLA 5D3OA 5FI2A 3NOPC 4DJ2A 1E25A 1PZPA 4BD0A 5AVFA 4A5RA 2V2FF 3KYZA 1F5MA 2WKEA 3TOIA 3P01A 4E3OA 3RJUA
chains in the Genus database with same CATH topology
2HF6A 4R6LA 3EQVA 4BBVA 2W1TA 3B33A 4WUJA 2R78A 1H3QA 1NLYA 1G28A 4GS9B 5F5YA 3LR5A 4PKYG 1OT9A 1NLZA 1GSWA 3F1NA 1YSPA 3T4QA 3T4LA 4B93A 3LI9A 4I39A 3UMDA 3T4OA 4CLCB 4PHTA 4Q0JA 2VGLS 3F1PA 3BW6A 4MCWA 4CLCC 1EW0A 5G4YA 2FZ0A 4GHIA 2QJ5A 1TS7A 3A0VA 1NRJA 4I3JA 1T1AA 2OAP1 1V9ZA 5IU1A 3F1PB 2WKPA 3KYQA 1VHMA 1P97A 2JKRI 5DJUA 2OWHA 3F1NB 3T50A 5IS1A 2H28A 3C30A 3PBOA 2G7UA 1TS8A 4HH2A 2XA7S 2WKRA 4ARZA 2EWWA 3NHQA 5FL3A 1S67L 2JHEA 1UWNX 2V0WA 5HDSA 2VX8A 2FH5A 2V9AA 1OJGA 4KUOA 3H7WA 4I5SA 5J3WA 3VOLA 4HOIA 4MN5A 1VB6A 2L0WA 3S7QA 4JGOA 3S7PA 1T18A 3LIDA 4DMZA 1X0OA 2JKTM 4YWZA 1OTDA 2M7UA 2K31A 4WF0A 2PR5A 2HGVA 4GCZA 3OCLA 4MN7A 5KIZA 1OT6A 3MMHA 2CMNA 3MJQA 1GSXA 1P9RA 3KSIA 3FG8A 5DF9A 3H82A 3LICA 3NOTC 4ME4A 4HJ6A 2O9CA 4EW7A 5J7EA 3MR0A 3CI6A 5F69A 4ETXA 1UGUA 2J3WA 4L9GA 3F1OB 1LT0A 2D01A 4LRZE 4G3KA 4BJPA 4HP4A 3TE8A 4Y5FA 3MF0A 4L9FA 3LR0A 4E04A 5DFXA 4CLCE 5TBMB 3LIBA 1TF1A 3EOIA 4IUHA 5C5KA 3IS2A 1BYWA 4UQIM 2B02A 3R7WB 4QPRA 1DP8A 3LFVA 4AFIA 1S66L 3H9WA 4G3WA 2INWA 1XJ3A 2Y8HA 3JVVA 2O9BA 4HNBA 3OOVA 3GDIA 1IOUA 4GHIB 2V1AA 2OAQ1 3V67A 4EEUA 3OBFA 1OTAA 3UE6A 3KO6A 3PBNA 4CQHA 4KUKA 1N9OA 1D06A 4NEED 2KOIA 2GZAA 4BBUA 3G6OA 4EXOA 4HJ4A 3EGXC 4NXEA 3VE3A 4IUKA 1TS0A 5EFWA 1IFQA 4KQDA 3EGDC 1D7EA 3EQUA 3B42A 4NXGA 2P04A 4K08A 5HWWA 4B9OA 4HH3A 3TRCA 1XJ2A 4HY8A 4EETB 3KSFA 3BWLA 2XA7M 4HJ3A 4HHDA 2VV7A 3HJIA 4EEPA 1ODVA 4H6JA 3ZYTA 1P9WA 1F98A 3RTYA 4PAUA 4PKYA 2K7SA 4HQAA 3F1OA 4LLOB 2W3GA 2P08A 1T19A 3H7WB 2V0UA 3E4OA 5L8MA 4MDZA 3BJNA 3TJZC 4WELA 3T4SA 5A8BA 2NUPC 4EESA 1S4SA 4JGPA 3EEAA 1S4RA 4HP9A 2VLGA 1P0ZA 3E4QA 4F3LA 1Y28A 4I3AA 1JNUA 4LRYC 2M1CA 2V1BA 4Q0IA 3RH8B 4XT2A 2YKFA 3D72A 4NKPA 3TW8A 5HWVA 3CWFA 3UB9A 4CLCD 2J3TD 5HSQA 1LSVA 5J4EA 3E98A 2QHKA 3E4PA 5DJTA 4NXFA 3MXQA 4BBTA 2PDRA 5HD3A 2W3HA 5HZHA 4O0PA 2K2NA 3R4KA 4IJGA 2JKTI 3HJKA 4UEYA 5HPFA 1T1BA 2ZBBA 3UMEA 4HIAA 1WA9A 1LSXA 2VV8A 1MC0A 4MN6A 1S1ZA 4OOMA 3LR3A 2W3FA 2PR6A 2VKSA 3UB8A 2D02A 3C8CA 2PYRA 4ETZA 4RQ9A 3DBAA 5HDDA 2VV6A 4WEKA 2PD8A 3KX0X 1YSQA 3JVUA 5G4ZA 2HV1A 3KSHA 4LRXC 1OTEA 4WEJA 2L4RA 1TS6A 2LB9A 3U2AA 4FSFA 3PR6A 1TD5A 5I5LA 5HPIA 4OOLA 4ZRRA 4M4XA 2HJEA 2ZMVA 1XJ6A 4EU0A 1DRMA 2L1MA 1W63M 1MKMA 4GS9A 4JGQA 2A24B 2P7JA 4FOFA 5IT5A 4DN0A 1MZUA 3MQOA 4I3IA 1OJ5A 1OPXA 3NOUC 4R3AA 1XJ4A 2JN7A 2QKPA 2O99A 4O8GA 3T4TA 2A24A 2BASA 5KSHA 4EUVA 2GJ3A 3LYXA 4O01A 5K5BA 4F3LB 2NUTC 2Z6DA 2GNXA 3CUEA 4HI4A 2Z6CA 1NWZA 4Q0HA 5LBRA 3LIFA 4II7A 2XRNA 3MQ0A 2IA2A 3ZQ5A 4H6JB 3C38A 5DKLA 1OTIA 2PYPA 3FPWA 1ZTUA 3D3OA 2EA9A 5MC7A 1W63Q 2A2LA 2EWVA 4P6ZM 3S7OA 2PHYA 3B47A 1DP6A 4NXBA 2VA0A 4YOFA 5DFYA 4GW9A 2QJ7A 4WN5A 1GSVA 3W2ZA 3MQQA 1YAXA 2KX6A 3IS2B 2I9VA 2OWJA 3NJAA 3PXPA 5AVEA 1DP9A 3OC2A 2QWSA 2W1RA 3E0YA 4EERA 2W27A 4GLQA 2HJ9C 3OLOA 4GJ4A 3UB6A 3PBQA 3OCNA 3CITA 3IBJA 3S7NA 2PD7A 4CLCA 5HDCA 3P7NA 5AJGA 1N9NA 4R70A 4YNRA 4L9EA 2JKRM 3R7WA 5DKKA 3H82B 1KOUA 4Z1WA 4KQOA 2W1TB 3RFBA 4ARZB 3SW1A 3FPVA 1F9IA 5TJJA 3KSGA 3K2NA 3A0SA 2PT7A 2ZMFA 2YKHA 2XSSA 3BQAA 4DJ3A 2O9AA 3EEHA 1G6OA 1LL8A 2VEAA 3PBTA 3PHYA 3O5YA 2VZWA 4BMWA 2KLIA 2GX5A 2O0YA 2M7VA 5F68A 3HCYA 2LB5A 3MFXA 4MMNA 3LUQA 2MJ6A 4Y2FA 4L0LA 3C2WA 5HL6A 2W3DA 3K3DA 3ICYA 3VV4A 2W3EA 1H8MA 3BQ8A 3LR4A 3T4JA 3T4KA 5F6AA 4EQ1A 4WLAA 1ZHHB 3LIEA 4I38A 1LSWA 5HD5A 3PBRA 2Y79A 3BY9A 3CUEC 1N9LA 2VJWA 4UQIS 4G3VA 3EWKA 1XFQA 3BY8A 4P6ZS 3VE4A 4R38A 4LPZA 2WKQA 4WL9A 1S1YA 2W0NA 2KDKA 1T1CA 2VGLM 1OTBA 3PYPA 3A0RA 3UE3A 2OOLA 2XROA 3FC7A 5CX7A 3GECA 3PBSA 4IHQA 1STZA 3CLOA 2B18A 4BWIA 2J80A 1UWPX 3NOPC 2J3TC 4DJ2A 3CAXA 2ZOHA 4XT2B 2ZOIA 4JGRA 5HWTA 5AVFA 3UB7A 3ULFA 2QYBA 3KYZA 1F5MA 3IBRA 1XFNA 3LIAA 4Y3IA 1V9YA 3K3CA 3LI8A 3P01A 2DMWA 5TBMA 1YKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HF6 A;  2VGL S;  2XA7 S;  4P6Z S;  2VGL M;  2XA7 M;  5MC7 A;  1NRJ A;  1W63 Q;  2JKT I;  2JKR I;  2JKT M;  4P6Z M;  2FH5 A;  2JKR M;  3TJZ C;  4UQI M;  1W63 M;  4UQI S;  4NEE D; 
#chains in the Genus database with same CATH topology
 2HF6 A;  1I5Q A;  3BFD A;  4R6L A;  4EBL A;  3IXG A;  4QB8 A;  1NLY A;  3ZVW A;  1YSP A;  3UMD A;  1YLY A;  3T1X A;  2VGL S;  3F1P A;  3BW6 A;  4CLC C;  3UB5 P;  3A0V A;  3M6H A;  1NRJ A;  4I3J A;  2OAP 1;  4FH4 A;  2P9V A;  3IH8 A;  5DJU A;  1J3W A;  2OWH A;  5E2G A;  4OQI A;  3VOZ A;  3ZVT A;  2G7U A;  4KZA A;  2WKR A;  2EWW A;  2OLV A;  4LV1 A;  2JHE A;  4GDB A;  1RGY A;  1UWN X;  2V0W A;  4X1L A;  5HDS A;  2XDM A;  1I2S A;  3UO9 A;  1OJG A;  3H7W A;  4JF4 A;  3ITA A;  4HOI A;  3W4P A;  4UA6 A;  3LID A;  4GKU A;  1PRQ A;  2PR5 A;  4KZ5 A;  2HGV A;  3OCL A;  1SDN A;  5FQQ A;  4GB7 A;  1K6R A;  2CMN A;  3O87 A;  1P9R A;  4WMC A;  5DF9 A;  4ME4 A;  3LIC A;  1YMS A;  3N8L A;  4Y0O A;  3FZC A;  4ETX A;  2B5R A;  4LCM A;  5DF7 A;  4EQI A;  4L9G A;  4LRZ E;  4E3L A;  3BFC A;  4BJP A;  3DW0 A;  5G18 A;  1ALQ A;  1HTZ A;  4CLC E;  2Z2L B;  3Q7V A;  1U60 A;  1CI8 A;  4K0X A;  4R23 A;  4Y0U A;  1TF1 A;  5EUA A;  4IUH A;  2XQZ A;  4IED A;  2B02 A;  5GLC A;  3R7W B;  4KG6 A;  1G5U A;  1S66 L;  3H9W A;  2RL3 A;  3JVV A;  3MS6 A;  1MWR A;  4HEF A;  3GDI A;  3KYE A;  5TR7 A;  3V67 A;  3AGF A;  2Y2I A;  1VEU B;  1SZV A;  4BBU A;  4EXO A;  1PI4 A;  1L0E A;  5L09 A;  1TS0 A;  4P87 A;  4MBK A;  1DJC A;  2V20 A;  4C6Y A;  2WGW A;  1K4F A;  2WZZ A;  2QZ6 A;  3TRC A;  1XJ2 A;  1W79 A;  5FQ9 A;  3RXX A;  5F1G A;  4HHD A;  2VV7 A;  1ODV A;  3ZYT A;  3VP3 A;  3DTI A;  3RTY A;  4PAU A;  3ZFZ A;  3GMW A;  4HQA A;  2WKI A;  3M2J A;  4MDZ A;  2Y4A A;  2EXA A;  1FIK A;  2NUP C;  2EX9 A;  1S4S A;  4JGP A;  4DE0 A;  4ZJ1 A;  5GLB A;  1KVL A;  3E4Q A;  4F3L A;  1JNU A;  4LRY C;  3N6I A;  2M1C A;  4Q0I A;  4YFM A;  5FA7 A;  4QWO A;  2JBF A;  3UPO A;  2YKF A;  5HWV A;  3ISG A;  4ZJ3 A;  3UB9 A;  3VP2 A;  5CEB A;  3OPL A;  3VSK A;  4S2J A;  3LEQ A;  4NXF A;  1FSW A;  2ZJ9 A;  5E2F A;  1L0G A;  4RA7 A;  5BOH A;  1FOF A;  5GHZ A;  1PYY A;  2JKT I;  4IJG A;  5KMW A;  4MLL A;  4HIA A;  4PM9 A;  3BYD A;  5FQM A;  4N1H A;  4X6T A;  3U4L P;  1XPB A;  1RP5 A;  5FI7 A;  4B4X A;  4ETZ A;  3DBA A;  2X02 A;  4HES A;  2G2W A;  3C4P A;  4UA7 A;  3JVU A;  1OTE A;  2L4R A;  4X55 A;  3UPP A;  3U2A A;  3PR6 A;  1TD5 A;  3NBL A;  2UV0 E;  1FCN A;  2VK3 A;  1KGE A;  4KZ7 A;  1W63 M;  4GS9 A;  4JGQ A;  2A24 B;  2P7J A;  4FOF A;  3BFF A;  3MQO A;  4OPY A;  3G35 A;  4F94 A;  3NOU C;  1YLP A;  2A24 A;  2BAS A;  3AGE A;  4DRT A;  1IYQ A;  5K5B A;  1N9B A;  3CUE A;  4HI4 A;  3GQZ A;  2Z6C A;  1DY6 A;  1NWZ A;  5DTT A;  2XRN A;  4KZ6 A;  2IWC A;  1HLU P;  2IWB A;  1L2S A;  4E3M A;  5DKL A;  2EWV A;  4P6Z M;  4OLG A;  3FKW A;  3QP4 A;  1I2W A;  4WN5 A;  3A3E A;  3LGO A;  4NG2 A;  4JPM A;  2H0T A;  2OWJ A;  3ITB A;  2GDN A;  3OC2 A;  2HDR A;  2W1R A;  3DTK A;  4N92 A;  4EER A;  3OLO A;  4OPR A;  3OCN A;  1ONG A;  2Q9M A;  2J9P A;  4O7D A;  4CLC A;  5HDC A;  1GA0 A;  5AJG A;  1MWS A;  5A93 A;  5CHU A;  2PU2 A;  3H82 B;  1TVF A;  2W1T B;  3RFB A;  3SW1 A;  3FPV A;  1GHI A;  5DVA A;  2ZC5 B;  3IF5 A;  1L3L A;  1S0W A;  2WK0 A;  4OQG A;  5CTN A;  1YLW A;  3EEH A;  1LL9 A;  1PFL A;  2VEA A;  4R1G A;  3O5Y A;  2VGJ A;  3MKE A;  2M7V A;  4Q8I A;  2LB5 A;  3MFX A;  2W3D A;  1KE3 A;  3VP0 A;  3VV4 A;  1SKO B;  4WMC D;  2W3E A;  1H8M A;  5F1F A;  3T4K A;  4JBF A;  1M6K A;  2J7V A;  1JWV A;  3PBR A;  2UWX A;  1SKO A;  4JF5 A;  3EWK A;  3VE4 A;  2ZD8 A;  2WKQ A;  4JF6 A;  3IX8 A;  3SS3 A;  2XGN A;  2P74 A;  1OTB A;  5CX7 A;  4DE3 A;  2G2U A;  3PBS A;  3S1Y A;  4PM8 A;  3SH7 A;  4R0Q A;  2JE5 A;  4BWI A;  2C6W B;  4KZ8 A;  4BQM A;  4S2I A;  4XT2 B;  5HWT A;  3DWK A;  3LO7 A;  2WGW B;  4Y3I A;  1KGG A;  2DMW A;  3HUN A;  1YKD A;  1CJF A;  5M18 A;  2XLN A;  4KQR A;  3B33 A;  4WUJ A;  3FV7 A;  3LCE A;  3LR5 A;  2WAE A;  3F1N A;  1Z09 A;  4QHC A;  4B93 A;  4BL3 A;  4CLC B;  4PHT A;  1FCO A;  5CXW A;  4MCW A;  1LLB A;  4S2O A;  4BD1 A;  1TS7 A;  4FTX A;  4S2M A;  1V9Z A;  3IF6 B;  3N8R A;  2ACG A;  4E3K A;  1MBL A;  2CC1 A;  3BLS A;  1JTD A;  2H10 A;  2Y2O A;  2JC7 A;  5HAQ A;  4OH0 A;  2VX8 A;  2FH5 A;  4R4S A;  4KUO A;  1IYO A;  4X69 A;  3VOL A;  3WWX A;  1YMX A;  2H5S A;  1SHV A;  4BLM A;  2Y59 A;  1VB6 A;  1LI9 A;  4JGO A;  3S7P A;  2ZLY A;  1RCJ A;  1T18 A;  3MZE A;  3HRE A;  1X0O A;  3MSH A;  1OTD A;  1VET A;  4GCZ A;  3C5A A;  4PM7 A;  1GSX A;  4GZB A;  3FG8 A;  2ZC4 B;  3SOI A;  3NOT C;  2O9C A;  5J7E A;  3MR0 A;  1JTG A;  5F69 A;  4CJN A;  2D01 A;  2EFU A;  2VGK A;  4G3K A;  4IBX A;  2WGV A;  4Y5F A;  1YLT A;  4UHU A;  4PM6 A;  5JYP A;  5C5K A;  3IS2 A;  4U3T A;  1BYW A;  5HL1 A;  4UQI M;  2I72 A;  5FQI A;  4QPR A;  3HVF A;  1DP8 A;  1HZO A;  1XJ3 A;  2ZQ7 A;  2O9B A;  2OAQ 1;  4ZBE A;  4EEU A;  4Y7P A;  3UE6 A;  3VMA A;  2Y2J A;  3ZDJ A;  1W5D A;  4KUK A;  1N9O A;  3O88 A;  1D06 A;  5TGF A;  3G6O A;  4KZ4 A;  4NXE A;  1IFQ A;  4KQD A;  3UDX A;  3ZNY A;  3B42 A;  4BEN A;  3G4P A;  4RVA A;  5HWW A;  3HLW A;  3IWI A;  5A90 A;  1TDL A;  2WAF A;  1HD8 A;  4HJ3 A;  3IXB A;  1P9W A;  1AWI A;  3RXW A;  4PKY A;  5L2F A;  1BSG A;  4LLO B;  4ZDX A;  1H0M A;  2P08 A;  2ZQD A;  1T19 A;  4OP5 A;  3E4O A;  4OQH A;  3TJZ C;  3T4S A;  3M2K A;  4Y13 A;  1YM1 A;  3M6B A;  1K0K A;  4HP9 A;  4ZTK A;  1NJ4 A;  1PI5 A;  1P0Z A;  2ZM8 A;  2ZQA A;  1ZC2 A;  4XUZ A;  4XUX A;  1K54 A;  3TW8 A;  1FR1 A;  4WZ5 A;  5J4E A;  4JLF A;  3G30 A;  1SCW A;  4NK3 A;  1OME A;  4QJG A;  5DJT A;  4BBT A;  4K91 A;  5EEC A;  2PDR A;  5HD3 A;  3LEZ A;  5HZH A;  1SDE A;  3HJK A;  5HPF A;  1T1B A;  2ZBB A;  3UME A;  3D4F A;  1LSX A;  2VV8 A;  1MC0 A;  1K25 A;  4LFU A;  1S1Z A;  4OOM A;  5GHY A;  3GSG A;  4BL2 A;  3UB8 A;  5HX9 A;  5CRF A;  3C7V A;  4E3N A;  2PYR A;  4RQ9 A;  2VV6 A;  4ESP A;  4OKP A;  1YSQ A;  2V8C A;  3LY3 A;  3KSH A;  4WEJ A;  2PBD P;  5CGW A;  4FSF A;  5A91 A;  3QNB A;  4JXW A;  1C3B A;  4OOL A;  2ZMV A;  1K4E A;  3MZF A;  5IT5 A;  1MZU A;  2Y2M A;  3NC8 A;  1OJ5 A;  3HLB A;  3P98 A;  2HP5 A;  2JKG A;  2O99 A;  4EUV A;  2GJ3 A;  4O01 A;  3GV9 A;  4QU3 A;  4R3B A;  5EVI C;  4H8R A;  2Y2G A;  2ZL1 B;  1WE4 A;  3VP4 A;  4II7 A;  3QP6 A;  3MQ0 A;  3ZQ5 A;  2JCH A;  2ZL1 A;  3FPW A;  5FDS A;  4EBP A;  3D3O A;  3S4X A;  2HDU A;  1VM1 A;  5KSC A;  5MC7 A;  3S7O A;  2WAD A;  2DNS A;  2PHY A;  3B47 A;  4OLD A;  2OV5 A;  5DFY A;  3Q7V B;  1AXB A;  1GSV A;  3MXR A;  1W8Q A;  1YAX A;  2EFX A;  3VP1 A;  3UNW A;  5AVE A;  4GNU A;  5IHV A;  4GLQ A;  1Y54 A;  3UB6 A;  1IYS A;  4KZ9 A;  3PBQ A;  3DAV A;  3IBJ A;  4P6B A;  1D1J A;  3W8K A;  3P7N A;  4IBR A;  4EV4 A;  1KOU A;  4Z1W A;  1CEG A;  3HLE A;  4ARZ B;  4N9K A;  1F9I A;  3SZT A;  2WZX A;  3NUL A;  3V3S A;  3A0S A;  2R9W A;  2ZMF A;  2Y2L A;  2XSS A;  4DDS A;  3HLC A;  4DJ3 A;  1CI9 A;  1MKI A;  1K57 A;  3PBT A;  2VZW A;  2KLI A;  1K56 A;  2O0Y A;  2Y2K A;  4HBT A;  2HZ5 A;  3HCY A;  5EVI D;  5HL6 A;  1BUE A;  1IEM A;  2QMI A;  3K3D A;  5FAQ A;  2ZQC A;  3ICY A;  1LI0 A;  4WYY A;  4LGW A;  4WZ5 C;  5CER A;  3BQ8 A;  2ZC6 B;  3T4J A;  3IX3 A;  4EQ1 A;  1BLC A;  3LIE A;  4I38 A;  3V3R A;  5HD5 A;  5E2E A;  3HUO A;  1G68 A;  1N9L A;  2VJW A;  4UQI S;  4G3V A;  4RX3 A;  1XX2 A;  5AQ7 A;  4LEN A;  5FAO A;  3MKF A;  2KDK A;  3WS0 A;  3C4O A;  2XRO A;  3UE3 A;  2ZC7 A;  2OOL A;  4E3J A;  1STZ A;  3CLO A;  2B18 A;  3CPT B;  2WYX A;  1ESI A;  2ZC3 B;  2J3T C;  3PAG A;  5F82 A;  3CAX A;  2DRW A;  2HDQ A;  2EX8 A;  2ZOH A;  2ZOI A;  4JGR A;  3UB7 A;  1ACF A;  1HVB A;  3IBR A;  3GRJ A;  1V9Y A;  3K3C A;  3LI8 A;  5TBM A;  3WS4 A;  1KE0 A;  4R4R A;  1NZO A;  2R78 A;  5CGS A;  4QY5 A;  4DXC A;  4PKY G;  3T4L A;  1NYY A;  1CK3 A;  3T4O A;  3MZD A;  3E2L A;  1ES2 A;  3ZNT A;  1EW0 A;  4LV3 A;  5G4Y A;  2QJ5 A;  1T1A A;  1E3U D;  2WKP A;  2ZM2 A;  1XXM A;  3KYQ A;  1VHM A;  1P97 A;  4LV0 A;  3F1N B;  2H28 A;  3PBO A;  1TS8 A;  4HH2 A;  2XA7 S;  2BLS A;  3SS5 A;  4ARZ A;  5FL3 A;  1FQG A;  3T12 B;  5EV0 A;  1FIL A;  3TG9 A;  1LL5 A;  1K6S A;  2V9A A;  4P85 A;  3CZD A;  4DE2 A;  4MN5 A;  4UA9 A;  3S7Q A;  4GD6 A;  2WUQ A;  2PAV P;  1XP4 A;  3MXS A;  4KZB A;  3OZH A;  4KG2 A;  5DTK A;  3D9Y A;  5FDH A;  4DMZ A;  2JKT M;  1K55 C;  1ESU A;  4B4Z A;  4WF0 A;  3SH9 A;  5KIZ A;  4MN7 A;  5JYO A;  1OT6 A;  3FKV A;  1ONH A;  4XXR A;  3PAE A;  1PWG A;  1E3U A;  3KSI A;  2A49 A;  2A3U A;  2Y2N A;  1BZA A;  1XGI A;  1BLH A;  2J3W A;  4FD8 A;  1LT0 A;  2FFF B;  2DCF A;  3UY6 A;  3MF0 A;  2WKH A;  3ZHH A;  2Q9N A;  4E04 A;  3C7U A;  3LIB A;  3JPU A;  3EOI A;  4OON A;  3NEC A;  4YIN A;  5GLA A;  3W4O A;  5AQB A;  3I7J A;  4G3W A;  5U47 A;  2Y8H A;  4P0M A;  3QP5 A;  1JWP A;  4HNB A;  4GN2 A;  1XGJ A;  1IOU A;  3PBN A;  4CQH A;  3WS5 A;  1YLJ A;  2KOI A;  4OPQ A;  4HJ4 A;  3EGX C;  3VE3 A;  4IUK A;  2J9O A;  5EFW A;  3UPN A;  4X25 A;  3VFH A;  3EQU A;  3IX4 A;  4NXG A;  2P04 A;  1S6R A;  3QNC A;  1VQQ A;  1ERO A;  4WM9 A;  4HY8 A;  3KSF A;  5GL9 A;  1F98 A;  3ZCZ A;  1YLZ A;  3L9K A;  2V0U A;  3BJN A;  4WEL A;  5A8B A;  2C5W B;  1XA1 A;  1IYP A;  4EES A;  1S4R A;  2VLG A;  1IKG A;  3VOY A;  1Y28 A;  4I3A A;  4PM5 A;  3OPR A;  2EX6 A;  3AGD A;  4PPR A;  5HAP A;  2XK1 A;  3OPH A;  2X71 A;  4C75 A;  4GDN A;  3CWF A;  5HSQ A;  1LSV A;  1Z6F A;  2FFY A;  4OVD A;  1BLS A;  2QHK A;  1IEL A;  3SH8 A;  1RGZ A;  3MXQ A;  3N7W A;  3O3V A;  1FR6 A;  1W8Y A;  1ERQ A;  4O0P A;  2K2N A;  3R4K A;  1KDW A;  4D2O A;  4UEY A;  3HBR A;  1WA9 A;  4MN6 A;  3LR3 A;  2VKS A;  5L07 A;  3T1R A;  2HP9 A;  5EM1 A;  2PD8 A;  3BEC A;  2HV1 A;  5M1A A;  4LRX C;  4JXG A;  5EVL A;  4U0T A;  1SKF A;  5I5L A;  4N1X A;  3QP2 A;  5HFO A;  5FQJ A;  1GA9 A;  5FQK A;  4M4X A;  2HJE A;  4KZ3 A;  4EU0 A;  1MKM A;  2XD1 A;  3Q07 A;  4DN0 A;  3DTE A;  3P09 A;  4CPK A;  3G2Z A;  4R3A A;  1XJ4 A;  2Y91 A;  3T4T A;  4IVI A;  4O8G A;  1PNE A;  5EVE A;  3HLF A;  2X01 A;  5J8X A;  3LYX A;  4F3L B;  3BRM A;  2NUT C;  3IF6 A;  3Q82 A;  1YT4 A;  5EPH A;  1NXY A;  5M19 A;  1GCE A;  5HAI A;  4Q0H A;  3LIF A;  2IA2 A;  3C38 A;  4X68 A;  3NDE A;  5FEG A;  1OTI A;  3UE1 A;  5EOO A;  4S2N A;  1EWZ A;  1CEF A;  4KG5 A;  3A3I A;  1J9M A;  4U0X A;  4GD8 A;  2QJ7 A;  5CEC A;  2Y55 A;  5F83 A;  2PRF A;  2KX6 A;  1ERM A;  4DXB A;  1DP9 A;  2Y2P A;  2B95 A;  3GR2 A;  4WZ4 A;  3FWL A;  1BUL A;  3GTC A;  2H0Y A;  3S7N A;  2XR0 A;  1ES4 A;  3NCK A;  5CHJ A;  1VEU A;  1CF0 A;  4R70 A;  1N4O A;  3R7W A;  5DKK A;  1ES3 A;  4KQO A;  1PIO A;  3ZG5 A;  3BM6 A;  1JWZ A;  5TJJ A;  2BG1 A;  3K2N A;  1W7F A;  4JXS A;  2YKH A;  3ZG8 B;  3Q81 A;  3SS4 A;  2O9A A;  1G6O A;  3T1Q B;  1LL8 A;  3CJM A;  3PHY A;  4BMW A;  3JYI A;  2HP6 A;  4OOY A;  1BLP A;  5F68 A;  3NDG A;  3G34 A;  3LUQ A;  4Y2F A;  4L0L A;  3S22 A;  3C2W A;  2HPB A;  4B88 A;  4FCF A;  5F6A A;  3G2Y A;  1LSW A;  3IT9 A;  2Y79 A;  3IWO A;  2Y2H A;  1XFQ A;  3BY8 A;  3MFD A;  4P6Z S;  3IHB A;  5EE8 A;  4E3I A;  4LPZ A;  1ES5 A;  1S1Y A;  3WRZ A;  2W0N A;  3L7H A;  4DF6 A;  3GEC A;  1O07 A;  5DF8 A;  4RYE A;  3G31 A;  4R3J A;  3V39 A;  4UAA A;  4RX2 A;  2J80 A;  1UWP X;  1K55 A;  5EVI B;  3T1S A;  2XFS A;  3ULF A;  1Y4O A;  5A92 A;  2QYB A;  1XFN A;  3LIA A;  5E2H A;  3IQA A;  2XF3 A;  3DWZ A;  3EQV A;  4BBV A;  3QP1 A;  2W1T A;  1H3Q A;  1DJA A;  5DTS A;  1G28 A;  4GS9 B;  5F5Y A;  4DDY A;  1OT9 A;  1NLZ A;  1GSW A;  3T4Q A;  3TSG A;  3G32 A;  2QPN A;  3LI9 A;  4I39 A;  3QP8 A;  5AQA A;  5FAS A;  5FSR A;  4Q0J A;  1WYC A;  3A3F A;  4EBN A;  5CTM A;  4Y15 A;  2FZ0 A;  4GHI A;  1KE4 A;  5IU1 A;  3F1P B;  1FCM A;  1PWD A;  2RCX A;  2JKR I;  3HUM A;  4ID4 A;  3T50 A;  5TFQ A;  5IS1 A;  5HW3 A;  3C30 A;  1L0F A;  3HLD A;  1K38 A;  3NHQ A;  1S67 L;  1KGF A;  5EM0 A;  2XD5 A;  1CQA A;  1PW1 A;  3Q1F A;  3OPP A;  4I5S A;  4MBF A;  5J3W A;  2L0W A;  5GLD A;  1Q2P A;  5HAR A;  4JXV A;  2WGI A;  3V50 A;  4YWZ A;  3E2K A;  1YQS A;  4K0W A;  3QHY A;  2M7U A;  1TDG A;  2K31 A;  3LY4 A;  4QY6 A;  3UN7 A;  3A3D A;  4E6X A;  2XH9 A;  4N9L A;  3MMH A;  3MJQ A;  3NY4 A;  1XA7 A;  3H82 A;  2BTF P;  2R9X A;  2E8I A;  4HJ6 A;  2EX2 A;  4EW7 A;  1KVM A;  3CI6 A;  4EWF A;  4X53 A;  1IKI A;  1UGU A;  1ZKJ A;  4KQQ A;  3F1O B;  1K57 C;  1ZG4 A;  2IWD A;  4HP4 A;  3TE8 A;  1K56 D;  4KEN B;  4L9F A;  3MBZ A;  1M40 A;  4Y0T A;  3LR0 A;  5DFX A;  5TBM B;  3ZG0 A;  1A0K A;  4Z9Q A;  3LFV A;  4AFI A;  2INW A;  2P9V B;  3HLG A;  3CHW P;  2OSU A;  3IXH A;  3OOV A;  4GHI B;  2V1A A;  3OBF A;  1OTA A;  1KDS A;  3KO6 A;  4NEE D;  2GZA A;  3UDI A;  4DE1 A;  3ZG7 B;  3NIA A;  3BFG A;  3EGD C;  1D7E A;  2XEP A;  4DKI A;  4ZAM A;  1NYM A;  5EOE A;  4K08 A;  4B9O A;  3W4Q A;  4HH3 A;  3O86 A;  2PBY A;  4OP8 A;  1JVJ A;  4EET B;  2ZMA A;  3BWL A;  2XA7 M;  4GOG A;  3HJI A;  4EEP A;  2Q0O A;  4H6J A;  4PMA A;  2PU4 A;  1MWT A;  3IHA A;  2V8F A;  4IVK A;  2K7S A;  1H8Y A;  3F1O A;  2W3G A;  1WYB A;  3IWQ A;  5EVI A;  3H7W B;  1YPR A;  5L8M A;  3CMZ A;  1TEM A;  3EEA A;  3CG5 A;  2V1B A;  3VFF A;  3RH8 B;  4XT2 A;  3IF6 C;  4NET A;  3D72 A;  4NKP A;  4CLC D;  2J3T D;  4X56 A;  4LV2 A;  3E98 A;  3E4P A;  2W3H A;  4LCL A;  5FEF A;  1FSY A;  1EI5 A;  2E8J A;  5FI6 A;  4S2L A;  2W3F A;  3UE0 A;  2PR6 A;  1NY0 A;  1QMF A;  2D02 A;  4M3K A;  4MEZ A;  3C8C A;  5HDD A;  3VSL A;  3ZG9 B;  4WEK A;  3ZGA B;  3KX0 X;  5G4Z A;  1L0D A;  1E4D A;  1MWU A;  4EUZ A;  1MXO A;  1TS6 A;  2LB9 A;  5HPI A;  1BT5 A;  1GHM A;  4ZRR A;  3IH9 A;  1XJ6 A;  1DRM A;  2L1M A;  1MY8 A;  4I3I A;  1LHY A;  1OPX A;  2ZM0 A;  4ZJ2 A;  3WS1 A;  2JN7 A;  2QKP A;  3BEB A;  3HL9 A;  5E43 A;  3V5M A;  5KSH A;  2JKF A;  2Z6D A;  2XFT A;  4Y17 A;  3PTE A;  2GNX A;  5LBR A;  5KZH A;  3B3X A;  1BTL A;  3GVB A;  4X1M A;  4H6J B;  2PYP A;  3WRT A;  1ZTU A;  5FAT A;  1PW8 A;  2EA9 A;  2V1Z A;  1K54 C;  4D60 A;  3UDF A;  3BFE A;  1W63 Q;  1XKZ A;  2A2L A;  5GHX A;  2J8Y A;  2ZQ8 A;  2HDS A;  1DP6 A;  1H8Z A;  2VA0 A;  4NXB A;  4YOF A;  1QME A;  4GW9 A;  3W2Z A;  3MQQ A;  3A3J A;  1PZO A;  3IS2 B;  2I9V A;  3NJA A;  3PXP A;  2QWS A;  3E0Y A;  4OQ0 A;  2W27 A;  2HJ9 C;  1NZU A;  3CPT A;  4GJ4 A;  1NRF A;  4S2K A;  1GHP A;  2Z2M B;  4QD4 A;  3CIT A;  4FUW A;  2PD7 A;  1N9N A;  4YNR A;  5CED A;  4L9E A;  2JKR M;  1VET B;  1Q2Q A;  4MNR A;  4S2N C;  3DTM A;  5L10 A;  5I94 A;  3KSG A;  3N8S A;  3NI9 A;  4WBG A;  2PT7 A;  1H5X A;  1ZG6 A;  3BQA A;  5CHM A;  5FAP A;  1DJB A;  1G6A A;  4FH2 A;  3IXD A;  2GX5 A;  4HBU A;  5CGX A;  4JKT A;  3BLM A;  4MMN A;  2EXB A;  2MJ6 A;  4OPZ A;  3N4I A;  2Y2Q A;  1F2K A;  1O7E A;  5AQ9 A;  4C3Q A;  4MBH A;  2OLU A;  3LR4 A;  3Q7Z A;  4WLA A;  1ZHH B;  4E6W A;  3BY9 A;  3WS2 A;  3CUE C;  4R38 A;  4WL9 A;  1T1C A;  2VGL M;  2ZQ9 A;  1PWC A;  3PYP A;  3A0R A;  3FC7 A;  3FYZ A;  2AVX A;  4S2P A;  4IHQ A;  1MPL A;  5D3O A;  5FI2 A;  3NOP C;  4DJ2 A;  1E25 A;  1PZP A;  4BD0 A;  5AVF A;  4A5R A;  2V2F F;  3KYZ A;  1F5M A;  2WKE A;  3TOI A;  3P01 A;  4E3O A;  3RJU A; 
#chains in the Genus database with same CATH homology
 2HF6 A;  4R6L A;  3EQV A;  4BBV A;  2W1T A;  3B33 A;  4WUJ A;  2R78 A;  1H3Q A;  1NLY A;  1G28 A;  4GS9 B;  5F5Y A;  3LR5 A;  4PKY G;  1OT9 A;  1NLZ A;  1GSW A;  3F1N A;  1YSP A;  3T4Q A;  3T4L A;  4B93 A;  3LI9 A;  4I39 A;  3UMD A;  3T4O A;  4CLC B;  4PHT A;  4Q0J A;  2VGL S;  3F1P A;  3BW6 A;  4MCW A;  4CLC C;  1EW0 A;  5G4Y A;  2FZ0 A;  4GHI A;  2QJ5 A;  1TS7 A;  3A0V A;  1NRJ A;  4I3J A;  1T1A A;  2OAP 1;  1V9Z A;  5IU1 A;  3F1P B;  2WKP A;  3KYQ A;  1VHM A;  1P97 A;  2JKR I;  5DJU A;  2OWH A;  3F1N B;  3T50 A;  5IS1 A;  2H28 A;  3C30 A;  3PBO A;  2G7U A;  1TS8 A;  4HH2 A;  2XA7 S;  2WKR A;  4ARZ A;  2EWW A;  3NHQ A;  5FL3 A;  1S67 L;  2JHE A;  1UWN X;  2V0W A;  5HDS A;  2VX8 A;  2FH5 A;  2V9A A;  1OJG A;  4KUO A;  3H7W A;  4I5S A;  5J3W A;  3VOL A;  4HOI A;  4MN5 A;  1VB6 A;  2L0W A;  3S7Q A;  4JGO A;  3S7P A;  1T18 A;  3LID A;  4DMZ A;  1X0O A;  2JKT M;  4YWZ A;  1OTD A;  2M7U A;  2K31 A;  4WF0 A;  2PR5 A;  2HGV A;  4GCZ A;  3OCL A;  4MN7 A;  5KIZ A;  1OT6 A;  3MMH A;  2CMN A;  3MJQ A;  1GSX A;  1P9R A;  3KSI A;  3FG8 A;  5DF9 A;  3H82 A;  3LIC A;  3NOT C;  4ME4 A;  4HJ6 A;  2O9C A;  4EW7 A;  5J7E A;  3MR0 A;  3CI6 A;  5F69 A;  4ETX A;  1UGU A;  2J3W A;  4L9G A;  3F1O B;  1LT0 A;  2D01 A;  4LRZ E;  4G3K A;  4BJP A;  4HP4 A;  3TE8 A;  4Y5F A;  3MF0 A;  4L9F A;  3LR0 A;  4E04 A;  5DFX A;  4CLC E;  5TBM B;  3LIB A;  1TF1 A;  3EOI A;  4IUH A;  5C5K A;  3IS2 A;  1BYW A;  4UQI M;  2B02 A;  3R7W B;  4QPR A;  1DP8 A;  3LFV A;  4AFI A;  1S66 L;  3H9W A;  4G3W A;  2INW A;  1XJ3 A;  2Y8H A;  3JVV A;  2O9B A;  4HNB A;  3OOV A;  3GDI A;  1IOU A;  4GHI B;  2V1A A;  2OAQ 1;  3V67 A;  4EEU A;  3OBF A;  1OTA A;  3UE6 A;  3KO6 A;  3PBN A;  4CQH A;  4KUK A;  1N9O A;  1D06 A;  4NEE D;  2KOI A;  2GZA A;  4BBU A;  3G6O A;  4EXO A;  4HJ4 A;  3EGX C;  4NXE A;  3VE3 A;  4IUK A;  1TS0 A;  5EFW A;  1IFQ A;  4KQD A;  3EGD C;  1D7E A;  3EQU A;  3B42 A;  4NXG A;  2P04 A;  4K08 A;  5HWW A;  4B9O A;  4HH3 A;  3TRC A;  1XJ2 A;  4HY8 A;  4EET B;  3KSF A;  3BWL A;  2XA7 M;  4HJ3 A;  4HHD A;  2VV7 A;  3HJI A;  4EEP A;  1ODV A;  4H6J A;  3ZYT A;  1P9W A;  1F98 A;  3RTY A;  4PAU A;  4PKY A;  2K7S A;  4HQA A;  3F1O A;  4LLO B;  2W3G A;  2P08 A;  1T19 A;  3H7W B;  2V0U A;  3E4O A;  5L8M A;  4MDZ A;  3BJN A;  3TJZ C;  4WEL A;  3T4S A;  5A8B A;  2NUP C;  4EES A;  1S4S A;  4JGP A;  3EEA A;  1S4R A;  4HP9 A;  2VLG A;  1P0Z A;  3E4Q A;  4F3L A;  1Y28 A;  4I3A A;  1JNU A;  4LRY C;  2M1C A;  2V1B A;  4Q0I A;  3RH8 B;  4XT2 A;  2YKF A;  3D72 A;  4NKP A;  3TW8 A;  5HWV A;  3CWF A;  3UB9 A;  4CLC D;  2J3T D;  5HSQ A;  1LSV A;  5J4E A;  3E98 A;  2QHK A;  3E4P A;  5DJT A;  4NXF A;  3MXQ A;  4BBT A;  2PDR A;  5HD3 A;  2W3H A;  5HZH A;  4O0P A;  2K2N A;  3R4K A;  4IJG A;  2JKT I;  3HJK A;  4UEY A;  5HPF A;  1T1B A;  2ZBB A;  3UME A;  4HIA A;  1WA9 A;  1LSX A;  2VV8 A;  1MC0 A;  4MN6 A;  1S1Z A;  4OOM A;  3LR3 A;  2W3F A;  2PR6 A;  2VKS A;  3UB8 A;  2D02 A;  3C8C A;  2PYR A;  4ETZ A;  4RQ9 A;  3DBA A;  5HDD A;  2VV6 A;  4WEK A;  2PD8 A;  3KX0 X;  1YSQ A;  3JVU A;  5G4Z A;  2HV1 A;  3KSH A;  4LRX C;  1OTE A;  4WEJ A;  2L4R A;  1TS6 A;  2LB9 A;  3U2A A;  4FSF A;  3PR6 A;  1TD5 A;  5I5L A;  5HPI A;  4OOL A;  4ZRR A;  4M4X A;  2HJE A;  2ZMV A;  1XJ6 A;  4EU0 A;  1DRM A;  2L1M A;  1W63 M;  1MKM A;  4GS9 A;  4JGQ A;  2A24 B;  2P7J A;  4FOF A;  5IT5 A;  4DN0 A;  1MZU A;  3MQO A;  4I3I A;  1OJ5 A;  1OPX A;  3NOU C;  4R3A A;  1XJ4 A;  2JN7 A;  2QKP A;  2O99 A;  4O8G A;  3T4T A;  2A24 A;  2BAS A;  5KSH A;  4EUV A;  2GJ3 A;  3LYX A;  4O01 A;  5K5B A;  4F3L B;  2NUT C;  2Z6D A;  2GNX A;  3CUE A;  4HI4 A;  2Z6C A;  1NWZ A;  4Q0H A;  5LBR A;  3LIF A;  4II7 A;  2XRN A;  3MQ0 A;  2IA2 A;  3ZQ5 A;  4H6J B;  3C38 A;  5DKL A;  1OTI A;  2PYP A;  3FPW A;  1ZTU A;  3D3O A;  2EA9 A;  5MC7 A;  1W63 Q;  2A2L A;  2EWV A;  4P6Z M;  3S7O A;  2PHY A;  3B47 A;  1DP6 A;  4NXB A;  2VA0 A;  4YOF A;  5DFY A;  4GW9 A;  2QJ7 A;  4WN5 A;  1GSV A;  3W2Z A;  3MQQ A;  1YAX A;  2KX6 A;  3IS2 B;  2I9V A;  2OWJ A;  3NJA A;  3PXP A;  5AVE A;  1DP9 A;  3OC2 A;  2QWS A;  2W1R A;  3E0Y A;  4EER A;  2W27 A;  4GLQ A;  2HJ9 C;  3OLO A;  4GJ4 A;  3UB6 A;  3PBQ A;  3OCN A;  3CIT A;  3IBJ A;  3S7N A;  2PD7 A;  4CLC A;  5HDC A;  3P7N A;  5AJG A;  1N9N A;  4R70 A;  4YNR A;  4L9E A;  2JKR M;  3R7W A;  5DKK A;  3H82 B;  1KOU A;  4Z1W A;  4KQO A;  2W1T B;  3RFB A;  4ARZ B;  3SW1 A;  3FPV A;  1F9I A;  5TJJ A;  3KSG A;  3K2N A;  3A0S A;  2PT7 A;  2ZMF A;  2YKH A;  2XSS A;  3BQA A;  4DJ3 A;  2O9A A;  3EEH A;  1G6O A;  1LL8 A;  2VEA A;  3PBT A;  3PHY A;  3O5Y A;  2VZW A;  4BMW A;  2KLI A;  2GX5 A;  2O0Y A;  2M7V A;  5F68 A;  3HCY A;  2LB5 A;  3MFX A;  4MMN A;  3LUQ A;  2MJ6 A;  4Y2F A;  4L0L A;  3C2W A;  5HL6 A;  2W3D A;  3K3D A;  3ICY A;  3VV4 A;  2W3E A;  1H8M A;  3BQ8 A;  3LR4 A;  3T4J A;  3T4K A;  5F6A A;  4EQ1 A;  4WLA A;  1ZHH B;  3LIE A;  4I38 A;  1LSW A;  5HD5 A;  3PBR A;  2Y79 A;  3BY9 A;  3CUE C;  1N9L A;  2VJW A;  4UQI S;  4G3V A;  3EWK A;  1XFQ A;  3BY8 A;  4P6Z S;  3VE4 A;  4R38 A;  4LPZ A;  2WKQ A;  4WL9 A;  1S1Y A;  2W0N A;  2KDK A;  1T1C A;  2VGL M;  1OTB A;  3PYP A;  3A0R A;  3UE3 A;  2OOL A;  2XRO A;  3FC7 A;  5CX7 A;  3GEC A;  3PBS A;  4IHQ A;  1STZ A;  3CLO A;  2B18 A;  4BWI A;  2J80 A;  1UWP X;  3NOP C;  2J3T C;  4DJ2 A;  3CAX A;  2ZOH A;  4XT2 B;  2ZOI A;  4JGR A;  5HWT A;  5AVF A;  3UB7 A;  3ULF A;  2QYB A;  3KYZ A;  1F5M A;  3IBR A;  1XFN A;  3LIA A;  4Y3I A;  1V9Y A;  3K3C A;  3LI8 A;  3P01 A;  2DMW A;  5TBM A;  1YKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...