2VGLS

Ap2 clathrin adaptor core
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
142
structure length
142
Chain Sequence
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords ADAPTOR PROTEIN COMPLEX AP-2, ALPHA 2 SUBUNIT
publication title Molecular Architecture and Functional Model of the Endocytic Ap2 Complex
pubmed doi rcsb
source organism Rattus norvegicus
total genus 50
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2007-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2vglS00
4NEED 2JKTM 2JKTI 2HF6A 1W63Q 2VGLM 2VGLS 2FH5A 5MC7A 4UQIM 4UQIS 1W63M 1NRJA 2XA7M 2XA7S 2JKRI 3TJZC 2JKRM 4P6ZM 4P6ZS
chains in the Genus database with same CATH superfamily
3K3DA 4B9OA 2JKTM 4X6TA 2IWBA 2Y55A 3ZNTA 1K6SA 2PR6A 4NETA 5EVEA 5CTMA 3W4QA 3CZDA 1JNUA 3A3EA 2E8JA 2QMIA 2JBFA 5J7EA 4I39A 3T4OA 2ZM0A 2HGVA 2YKFA 4EBNA 1JTDA 3CMZA 4ZJ1A 1HZOA 4QY5A 2OAP1 1IFQA 4HBUA 3VSKA 4PKYA 1STZA 4OKPA 4DE0A 1OTAA 4EV4A 3VP2A 2I9VA 3T1RA 1BYWA 4S2LA 4BLMA 1XGJA 1TF1A 2KOIA 4BD0A 4JGOA 5A91A 4MEZA 3IHBA 4Y7PA 3W2ZA 3IHAA 1QMFA 4N1XA 2HDRA 1ZHHB 4EQ1A 2WKIA 5L8MA 1XX2A 2VX8A 1H8ZA 2E8IA 2A24B 3UDFA 3BEBA 1XJ3A 4ZTKA 2RCXA 2PD8A 3A3DA 3BFGA 3GVBA 4KG2A 4Q0HA 5AVEA 1OPXA 5FASA 1YMSA 1NY0A 1YLJA 2M7UA 1TS6A 1I2WA 4HIAA 3VP4A 5AQ9A 4X55A 2PD7A 5EV0A 4WL9A 1FR6A 2WZZA 1OT6A 3QP6A 2FFYA 1E4DA 2OV5A 4IHQA 3T50A 2WUQA 4CLCB 2JKRI 1N4OA 4F3LA 1YSQA 5HZHA 4I5SA 1ERMA 3MFDA 3T4JA 2WADA 2L1MA 4NK3A 2VEAA 1JWPA 2WGIA 4L9GA 1YPRA 2MJ6A 4EEUA 1KGFA 5GHZA 1XA1A 1JWVA 5FDSA 2XH9A 4GS9A 4F94A 1BLCA 3LIDA 4DJ2A 1ERQA 4FOFA 5FQMA 1VQQA 3UMEA 4WBGA 2HDQA 4KZ5A 4U0TA 1BSGA 5HAQA 1TD5A 2BLSA 4X56A 2LB5A 4LPZA 4QJGA 1KGEA 2ZQDA 3LR0A 4K91A 1SCWA 3PYPA 3ZNYA 2WKQA 4HJ3A 1T18A 3QP2A 3ZDJA 1ZG6A 1IYSA 2W1RA 3HUOA 3IQAA 2B5RA 1F5MA 1T1AA 3NI9A 4E04A 4EEPA 3F1NA 2O99A 3Q1FA 5AVFA 1EROA 2HV1A 4L9FA 5DF8A 2QPNA 5HD5A 2W3EA 3HVFA 2XA7S 4OQIA 1W79A 4FSFA 2EXBA 3DBAA 3GR2A 3QP1A 2VK3A 4DE3A 3GMWA 4EERA 5I5LA 5HAIA 2JKFA 1W7FA 3T4QA 4ZJ3A 1CF0A 4CPKA 4NG2A 1PRQA 4PM9A 5DKKA 2G2WA 4RX2A 4WZ4A 2GZAA 2VJWA 1LSVA 3GTCA 1MC0A 4IEDA 4S2OA 2PR5A 1DJAA 4Z1WA 2ZMAA 3W4PA 2Y4AA 2FZ0A 4KZ8A 3MQ0A 1W8YA 2ZM2A 3S7OA 4IUKA 1NLZA 3V3SA 4NKPA 3BFCA 3S4XA 3MF0A 4YNRA 1OTBA 1SHVA 4S2IA 5FAQA 1W63Q 4MMNA 2ZQCA 1K4EA 4FTXA 2V8CA 4WELA 2BASA 1ES5A 1H5XA 3JVVA 2WKRA 3K2NA 1GHPA 3OCLA 2UV0E 2V1AA 3A3FA 3MR0A 1FCMA 3OPRA 2P9VB 3LIAA 4B93A 1W5DA 3QNCA 1K25A 2W27A 4MBKA 1DP9A 2WKHA 4BBUA 5IT5A 5F5YA 4Y2FA 4WEJA 3N8LA 2HDSA 2VGJA 2Y91A 2FH5A 3BRMA 1VETB 2XRNA 1XFNA 2H0TA 4KZAA 1MXOA 4LCMA 2NUPC 3RXWA 4K08A 5TFQA 1SKOB 3LI8A 3EEAA 2HF6A 4Y0OA 4E3OA 5FQKA 3PBRA 3FKVA 4YFMA 4LRYC 3CG5A 5D3OA 3TW8A 2JKGA 4QHCA 5CERA 4PAUA 4UA9A 1WYBA 4R23A 1EW0A 1BLSA 4M4XA 1NJ4A 1ODVA 2WGVA 3PR6A 3HUMA 3G30A 3HBRA 2X71A 4G3VA 5F1GA 4DN0A 4N92A 3QP5A 4P0MA 4A5RA 4UQIM 5E43A 5EVIB 4Y3IA 1Z6FA 3TG9A 3UMDA 4WLAA 3N8RA 2B18A 3VFFA 2ZM8A 4KENB 2XD1A 3T4LA 3UB5P 2W1TA 5FEGA 3V5MA 4KZBA 3LIEA 2R9WA 3UDIA 1Q2PA 2WZXA 3H82B 4GLQA 4WZ5A 5FATA 5FI6A 4CJNA 5FQ9A 1KE0A 2VGKA 5FAPA 3N6IA 4WZ5C 3MXSA 2IWDA 1TEMA 3MFXA 1HVBA 5AQAA 1XJ2A 1G5UA 5CHJA 4HH3A 1P9RA 4OP8A 5L2FA 3G32A 3DTKA 3DWKA 4GOGA 2J9PA 3DTMA 2EXAA 4R4SA 1L3LA 1ALQA 3P98A 4U3TA 3BLSA 3VOZA 3IWQA 1FCNA 2WAEA 1K4FA 1G6AA 4HHDA 2XFSA 3MXQA 5HD3A 3RXXA 4HI4A 5HDSA 4X1MA 1O7EA 5CXWA 5GLCA 4HY8A 3MBZA 1XPBA 5FI2A 1TS8A 5FI7A 4X69A 1GSWA 3SOIA 5J3WA 2CMNA 1DP6A 3LYXA 5F83A 2ZC5B 2PBDP 1LI0A 3NDGA 4E3JA 1FR1A 1GSVA 3IX8A 2OLUA 5DFYA 4ZRRA 4OVDA 3W4OA 4L9EA 5BOHA 3S1YA 2WKEA 4EQIA 1PWCA 5CGXA 2M7VA 2P74A 1G28A 3LEQA 3BJNA 5CGWA 3ZVTA 5K5BA 5EVLA 3PHYA 4GD6A 2V20A 1XJ6A 2RL3A 3RTYA 5MC7A 4YWZA 4JF6A 3WS5A 1UWNX 5L09A 4RQ9A 3E4PA 3P7NA 4QU3A 5HPFA 5TBMB 1W8QA 4BL3A 4M3KA 4BMWA 2J3TD 4E3MA 2WK0A 4LLOB 2PBYA 4C75A 3AGEA 4GNUA 5CHMA 1T1BA 2XDMA 4JGQA 1C3BA 1TS0A 4HNBA 3CPTA 2Y2LA 3NJAA 4GHIB 4DF6A 1L0GA 5A90A 4BL2A 5DTTA 4RX3A 2HPBA 3Q81A 2HP5A 3HCYA 2PDRA 1BULA 3VOYA 1N9BA 4KQQA 1KVLA 1DRMA 1N9LA 4K0WA 5FSRA 4DE1A 3NC8A 4OQHA 3IX3A 4OPRA 3WS0A 4CLCE 1ZKJA 1YMXA 1E3UA 1XP4A 3ZVWA 5CEBA 2V0UA 3EWKA 2ZL1A 4C3QA 4HQAA 3IS2B 3T1QB 3CUEA 4R38A 4EU0A 3HJIA 5F6AA 4OP5A 2ZQ8A 4DMZA 3AGFA 1MKMA 2B95A 2V1BA 1PIOA 1WYCA 5U47A 3CUEC 3MZDA 3N7WA 3TSGA 3Q7ZA 2O9AA 5G4YA 3AGDA 3P01A 2W3HA 4PM6A 1CQAA 4HEFA 4P6ZM 4ARZB 4JLFA 3Q07A 5KIZA 3LY4A 1S6RA 2Y2MA 4KQRA 4YOFA 3UE3A 2P7JA 1DY6A 4GZBA 1XGIA 3MQQA 4BJPA 5L07A 4AFIA 5A8BA 2XROA 2Y2PA 5DTSA 2EX2A 4Y0UA 3RFBA 3B33A 3OPPA 1RCJA 3T1XA 1VB6A 1XFQA 1YLZA 4ETXA 3F1OA 5L10A 4EETB 5EOEA 3E4QA 4FUWA 4EESA 4FH4A 3BQAA 3IBJA 2XK1A 3TJZC 4UA7A 3PBOA 1I2SA 3LR3A 5M19A 5GLBA 2OOLA 1PNEA 4KUOA 3E2KA 4JF5A 3C7UA 2Y2JA 1NYYA 4MBFA 3OLOA 3HLEA 3N8SA 1YLYA 2WYXA 3KO6A 1J3WA 4QPRA 2P08A 5IHVA 4KZ9A 2XSSA 4JGRA 3SS5A 1EWZA 5HX9A 1H0MA 4O01A 3BFFA 5E2FA 3O87A 4O8GA 2W3FA 2JKRM 3T1SA 1KE3A 3O86A 3IT9A 2FFFB 2JN7A 4BENA 4LV2A 3VE4A 4HP4A 1FSYA 3GRJA 3GSGA 1XJ4A 2EX9A 1UGUA 5TJJA 3UE0A 3MZEA 3EOIA 2ZD8A 1NRJA 3NHQA 2G2UA 3R7WA 1FILA 3G2YA 2EA9A 2ZQ7A 1YKDA 2D01A 3KYZA 2XFTA 2VV7A 4DXBA 4L0LA 1K6RA 1RP5A 3IF5A 5F1FA 3ZHHA 2JHEA 5EVIC 3FPVA 4EW7A 3HJKA 3F1PB 4H6JA 1UWPX 4JXGA 1ES3A 1MY8A 3HLFA 2JC7A 4DXCA 3FPWA 3NCKA 3LEZA 2ZOHA 3ITBA 4MLLA 1L2SA 5F82A 1TDLA 2PYRA 4KZ4A 4JGPA 4WM9A 4LGWA 4Q0IA 1FCOA 1EI5A 4GD8A 4K0XA 3HLDA 1KVMA 3MZFA 3SH8A 3D72A 2XLNA 4OPYA 4FD8A 2ZBBA 3SH9A 4E3IA 3U4LP 3M2KA 3G4PA 2Y59A 4XUXA 3EQUA 5KMWA 2CC1A 4WMCA 3UPPA 4LV0A 5E2HA 1FQGA 3S22A 1ES2A 2VKSA 2J9OA 1N9NA 1D06A 1IYQA 4G3KA 3C5AA 5DVAA 5CRFA 2KDKA 3ZG0A 3MSHA 3S7PA 4HESA 3V67A 5CECA 5KZHA 5A92A 1YM1A 3IF6A 3I7JA 4E3KA 1IYOA 4O7DA 2VGLM 3EGXC 1P9WA 5M18A 3BY9A 3QNBA 3Q7VA 5TGFA 3IF6C 2VZWA 3DTEA 1X0OA 3FV7A 3NECA 2EFUA 4Q0JA 3UDXA 3TRCA 1G68A 4JXWA 1S1YA 2V2FF 2VA0A 3FZCA 4KZ7A 1BLHA 5LBRA 4IUHA 3PTEA 2V8FA 5HFOA 1GA0A 1LLBA 2ZMVA 1IELA 4G3WA 4UQIS 5FQIA 3IXHA 3IXDA 1MZUA 1LSXA 2OSUA 4GB7A 1LHYA 3KYQA 1K54A 4QWOA 1VEUA 4GS9B 2R78A 2ZJ9A 5FQJA 4ZDXA 3UB6A 2V9AA 1M6KA 2QJ7A 4HJ4A 2IWCA 4CQHA 2XR0A 3O88A 1K54C 2VV8A 4I3AA 1PI4A 2UWXA 5M1AA 4GHIA 2R9XA 4BBVA 4XT2A 4FH2A 2P04A 2QHKA 3MKEA 3UE1A 2GJ3A 1NXYA 4PM7A 3BLMA 4D2OA 5AJGA 3FC7A 5DJUA 2ZC4B 3ZQ5A 1K55A 4S2NA 2PT7A 4KQDA 3F1NB 4FCFA 4OQGA 2D02A 1FIKA 3KSFA 4LV1A 1K55C 4S2NC 5HW3A 2J80A 3OCNA 5C5KA 3HLWA 1LT0A 3IWIA 3QHYA 2V1ZA 4E3NA 1PYYA 2HP9A 3WRTA 4KUKA 1MWRA 2DRWA 4E3LA 3FG8A 4ME4A 4OONA 4BD1A 3UB9A 2K31A 5HPIA 2NUTC 4IJGA 2Y79A 3HLGA 4X53A 4P6BA 1PWDA 3QP8A 4KG6A 4UHUA 2J3WA 2WGWB 1SDNA 1RGZA 3C4OA 5EUAA 1AXBA 3A0RA 1OTIA 3MKFA 3OBFA 5CEDA 1NWZA 2ACGA 3Q82A 4P87A 5EM1A 4DKIA 3EQVA 3EEHA 5HL6A 2XQZA 1BTLA 3CITA 3A3JA 4WUJA 1YLWA 2A24A 4PMAA 2C6WB 3WS1A 5FEFA 3VMAA 1OTEA 2Y2QA 5HARA 4PPRA 3V39A 4I3IA 5J8XA 2O0YA 1O07A 1TS7A 1P97A 4P85A 5IU1A 3MJQA 4CLCA 5KSHA 3B3XA 3LI9A 3IH8A 4R6LA 4PM5A 4R0QA 5HDDA 1PWGA 4R70A 1H8MA 1Y54A 4B4ZA 1S66L 4CLCC 3E2LA 2GX5A 3LIFA 1KE4A 3BW6A 3ZG7B 2A2LA 2Y2IA 3SZTA 3TOIA 2QZ6A 4BBTA 3MMHA 5HL1A 2WKPA 1K56A 1I5QA 2PRFA 3CLOA 3C2WA 3H9WA 4EUVA 2K7SA 3OPLA 1CI8A 5IS1A 3ICYA 2Y8HA 2L0WA 3H7WB 1DP8A 4JXVA 3ZGAB 1PW8A 5G4ZA 4LRZE 5FDHA 2EX8A 1WE4A 3JVUA 4MN7A 4HJ6A 1ONGA 4XXRA 4ESPA 1CEFA 4LCLA 1QMEA 3A3IA 1MWTA 3LICA 1MPLA 5EPHA 3T4SA 5JYPA 2KX6A 3C38A 2EWWA 5GHXA 4DJ3A 1E3UD 1NZUA 2ZQ9A 4OOMA 2Q9MA 4HBTA 3VP0A 4QD4A 3BWLA 3E98A 1CJFA 1L0FA 3IX4A 1F9IA 3B47A 5F68A 3JPUA 1HD8A 5HWTA 3V50A 1ACFA 4KQOA 2IA2A 5E2GA 1K38A 2ZMFA 2VV6A 2XGNA 2PU2A 4H8RA 4DDYA 4KZ3A 3B42A 2PYPA 3VP1A 4IVIA 3OPHA 1DJBA 2W3DA 3WWXA 1S1ZA 1XXMA 4Y0TA 2QYBA 2Z2LB 1NZOA 1ESUA 3VE3A 4IVKA 5EOOA 2ZOIA 4E6WA 1NRFA 3KSGA 2Z6CA 3C8CA 3UNWA 1GHMA 1P0ZA 3L7HA 4Y13A 3NOPC 2OLVA 4UAAA 1NYMA 4OLDA 5A93A 1GSXA 5TR7A 3UB8A 1IOUA 3A0VA 4HH2A 3KYEA 1L0DA 2OWJA 4ETZA 2JE5A 4ZJ2A 4OPZA 4U0XA 4EUZA 3BECA 4X1LA 5EECA 4R3BA 3D9YA 3RJUA 1YLTA 4WEKA 4S2PA 1K57A 5HDCA 2P9VA 1LI9A 1JTGA 5DF7A 3LCEA 1KDWA 4UEYA 2H28A 1TVFA 5CHUA 4R4RA 4MN6A 2W3GA 2Y2GA 3PAEA 2X01A 3ZYTA 2Y2NA 3OC2A 2JCHA 1K57C 4NXBA 4JF4A 4GW9A 4NXGA 4GDNA 3G2ZA 4OQ0A 1AWIA 1F2KA 3UPOA 4LRXC 2PHYA 2ZC3B 1LL5A 3ZG9B 3LR4A 5EE8A 1OJGA 3WRZA 1VETA 1VM1A 3LO7A 4LV3A 1OT9A 1LL9A 2BTFP 1TDGA 4S2JA 2O9CA 1MBLA 2EX6A 3CWFA 1H3QA 1SKOA 4JKTA 4WF0A 2O9BA 5GL9A 1U60A 4Y15A 3BYDA 3BM6A 4MBHA 2QKPA 1HTZA 2A3UA 2AVXA 1D1JA 3MS6A 4JBFA 1WA9A 1T19A 3G31A 3WS4A 3L9KA 1S4SA 3M6HA 4OOLA 1MKIA 4GDBA 2Q9NA 3QP4A 3HUNA 3CJMA 4ZBEA 4Z9QA 5EVID 3BY8A 3WS2A 1CI9A 3P09A 3CPTB 2DNSA 1OJ5A 3UE6A 5EVIA 4N9LA 4YINA 3IWOA 4R1GA 5E2EA 4GN2A 2EFXA 3V3RA 3MXRA 1Y4OA 3SH7A 2XEPA 3PBTA 2Z2MB 4GCZA 1S0WA 5DJTA 3H82A 2I72A 3DAVA 4MN5A 3TE8A 2OWHA 1V9YA 5EM0A 3IXGA 3A0SA 3GECA 4KG5A 3CHWP 5EFWA 3O5YA 1ES4A 3CI6A 3JYIA 3PBNA 3SW1A 3OZHA 2VGLS 2ZL1B 2QWSA 4S2KA 4WMCD 1PW1A 2GNXA 1ONHA 2WGWA 3S7NA 3K3CA 3HLBA 3G34A 2GDNA 2G7UA 4KZ6A 4DRTA 3ISGA 4B88A 1M40A 2W0NA 3PXPA 3RH8B 3VV4A 1E25A 4R3JA 2XA7M 1ZG4A 4WYYA 3GV9A 5HAPA 1DJCA 2Y2KA 1IYPA 1A0KA 3KSIA 2WAFA 4DDSA 3UO9A 5HWVA 2C5WB 2XD5A 2H5SA 3M6BA 3M2JA 4PHTA 1MWSA 1KOUA 3SS3A 2HP6A 5GLAA 1YAXA 4R3AA 3R4KA 3F1OB 3NIAA 3HL9A 1IKGA 2PAVP 4C6YA 2QJ5A 1VHMA 1V9ZA 1GCEA 1ZTUA 4F3LB 4LFUA 3LUQA 2DCFA 3NDEA 1MWUA 5FAOA 4BQMA 3PAGA 3E4OA 2DMWA 5TBMA 2H10A 4MNRA 4PM8A 3IBRA 5FL3A 4X25A 1Q2QA 1XKZA 3GDIA 3D3OA 4I38A 4QY6A 4S2MA 2INWA 3BQ8A 2KLIA 1W63M 4JPMA 4OH0A 3SS4A 1JVJA 2EWVA 3NULA 1XA7A 3H7WA 2VLGA 4Q8IA 3FWLA 2J7VA 4RA7A 1SDEA 3D4FA 4EXOA 3HLCA 2HJEA 2YKHA 3E0YA 4MCWA 3C4PA 3OOVA 3NBLA 3ULFA 1S67L 4Y17A 1NLYA 5I94A 3LR5A 3VSLA 3KX0X 1HLUP 4EBPA 4HP9A 3IXBA 3R7WB 4E6XA 5GHYA 3T4TA 5F69A 3DW0A 3IS2A 3N4IA 5KSCA 4PKYG 1PZPA 4H6JB 3DWZA 1JWZA 4B4XA 1L0EA 1F98A 3EGDC 4RVAA 4GJ4A 4NXEA 1YSPA 2Q0OA 4GKUA 4JXSA 1ZC2A 3ZG8B 1PZOA 3S7QA 4BWIA 3LIBA 1BT5A 3VFHA 3LFVA 4ARZA 5CGSA 3ZG5A 2ZC6B 1SKFA 2ZLYA 2HJ9C 3BFEA 4XUZA 2OAQ1 5CTNA 1K0KA 1PFLA 5J4EA 2A49A 4EBLA 3W8KA 3C30A 1GA9A 1SZVA 2ZC7A 4X68A 3T4KA 1FSWA 5DTKA 4NEED 5HWWA 3DTIA 3KSHA 4NXFA 3C7VA 3PBSA 2J8YA 5GLDA 5AQBA 1CEGA 4CLCD 1YQSA 2HDUA 3FKWA 1Z09A 3IF6B 2HZ5A 1N9OA 1LSWA 1KGGA 1BZAA 3T12B 2L4RA 4EWFA 3VP3A 5DFXA 4HOIA 3Q7VB 1OMEA 2Z6DA 2K2NA 5FA7A 1S4RA 3LY3A 1FOFA 3UN7A 1IKIA 1H8YA 4N9KA 3VOLA 3UPNA 1Y28A 2B02A 2PU4A 3G35A 3CAXA 1PI5A 1BUEA 1K56D 4D60A 1OTDA 2Y2OA 5DF9A 3BFDA 4OLGA 4OOYA 4O0PA 4QB8A 5CX7A 3ITAA 5AQ7A 3UB7A 4UA6A 4DE2A 2ZQAA 3GQZA 1G6OA 1BLPA 1GHIA 1KDSA 2Y2HA 3ZFZA 4MDZA 1J9MA 4II7A 4LENA 2LB9A 1T1CA 2M1CA 4N1HA 4IBRA 5HSQA 4ID4A 4OPQA 1VEUB 1CK3A 3FYZA 4I3JA 3LGOA 2JKTI 3O3VA 4WN5A 4ZAMA 5G18A 3NY4A 3UY6A 1YT4A 3PBQA 3NOUC 4RYEA 5FQQA 4IBXA 5DKLA 1RGYA 4XT2B 3HREA 2J3TC 2V0WA 4P6ZS 3U2AA 2BG1A 2X02A 3G6OA 2XF3A 5JYOA 1LL8A 1D7EA 4Y5FA 3ZCZA 3NOTC 1IEMA 3F1PA 2W1TB 2H0YA 3IH9A 3MQOA 1ESIA 1YLPA
chains in the Genus database with same CATH topology
3K3DA 4B9OA 2JKTM 3MXQA 5HD3A 4HI4A 2ZMVA 5HDSA 3BY8A 2PR6A 4G3WA 1JNUA 4UQIS 4HY8A 5J7EA 4I39A 3T4OA 1OJ5A 3UE6A 1TS8A 2HGVA 2YKFA 1GSWA 2OAP1 1IFQA 5J3WA 2CMNA 1DP6A 1MZUA 1LSXA 3LYXA 4PKYA 1STZA 3KYQA 4GS9B 2R78A 1OTAA 1GSVA 2I9VA 3PBTA 5DFYA 4ZRRA 1BYWA 4GCZA 5DJTA 3UB6A 2V9AA 3H82A 2QJ7A 4L9EA 4MN5A 4HJ4A 1TF1A 2KOIA 4CQHA 3TE8A 4JGOA 2OWHA 1V9YA 2VV8A 4I3AA 3A0SA 3GECA 5EFWA 2M7VA 4GHIA 3O5YA 3W2ZA 4BBVA 1G28A 3CI6A 4XT2A 3BJNA 5K5BA 2P04A 3PBNA 3SW1A 1ZHHB 2QHKA 4EQ1A 2VGLS 2GJ3A 5L8MA 3PHYA 1XJ6A 5AJGA 3RTYA 5MC7A 2QWSA 4YWZA 2VX8A 3FC7A 1UWNX 5DJUA 3ZQ5A 2A24B 3E4PA 4RQ9A 1XJ3A 2PT7A 2GNXA 3P7NA 4KQDA 5HPFA 2PD8A 5TBMB 3F1NB 4Q0HA 5AVEA 2D02A 4BMWA 1OPXA 2J3TD 3S7NA 3K3CA 4LLOB 2M7UA 1TS6A 3KSFA 2G7UA 4HIAA 2W0NA 2PD7A 3PXPA 3RH8B 3VV4A 2J80A 1T1BA 4WL9A 3OCNA 5C5KA 4JGQA 1OT6A 1TS0A 2XA7M 1LT0A 4HNBA 4IHQA 3T50A 3NJAA 4CLCB 2JKRI 4GHIB 4F3LA 1YSQA 5HZHA 4I5SA 4KUKA 3T4JA 3KSIA 2L1MA 3FG8A 4ME4A 3UB9A 2VEAA 2K31A 5HPIA 5HWVA 4L9GA 2NUTC 2MJ6A 4EEUA 4IJGA 2Y79A 3HCYA 2PDRA 4GS9A 3LIDA 4DJ2A 2J3WA 1DRMA 1N9LA 4FOFA 4PHTA 1KOUA 3UMEA 3A0RA 1OTIA 1YAXA 4R3AA 3R4KA 3F1OB 1TD5A 2QJ5A 1VHMA 2LB5A 3OBFA 4CLCE 4LPZA 1V9ZA 3LR0A 1NWZA 2V0UA 3EWKA 3PYPA 3EQVA 3EEHA 5HL6A 3CITA 4HQAA 2WKQA 3IS2B 3CUEA 1ZTUA 4HJ3A 4R38A 4EU0A 1T18A 3HJIA 5F6AA 4F3LB 4WUJA 3LUQA 4DMZA 2A24A 2W1RA 1MKMA 1F5MA 1T1AA 4E04A 3E4OA 2V1BA 4EEPA 2DMWA 5TBMA 3F1NA 2O99A 3IBRA 1OTEA 3CUEC 5FL3A 3GDIA 3D3OA 5AVFA 4I38A 4I3IA 2HV1A 2INWA 2O9AA 4L9FA 5G4YA 3BQ8A 2KLIA 1W63M 5HD5A 2W3EA 2O0YA 2XA7S 1TS7A 2EWVA 4FSFA 1P97A 3DBAA 3P01A 5IU1A 2W3HA 3MJQA 3H7WA 2VLGA 4P6ZM 4ARZB 4CLCA 5KSHA 3LI9A 4EERA 5I5LA 4R6LA 5KIZA 5HDDA 4EXOA 3T4QA 4R70A 2HJEA 1H8MA 2YKHA 3E0YA 4MCWA 4YOFA 1S66L 4CLCC 2GX5A 3UE3A 3LIFA 2P7JA 5DKKA 3BW6A 2VJWA 2GZAA 3OOVA 1LSVA 3MQQA 4BJPA 3ULFA 1MC0A 4AFIA 1S67L 2A2LA 2PR5A 1NLYA 5A8BA 2XROA 3LR5A 3RFBA 4Z1WA 3B33A 4BBTA 3MMHA 1VB6A 1XFQA 3KX0X 4ETXA 3F1OA 4EETB 3E4QA 4HP9A 2WKPA 4EESA 2FZ0A 4EUVA 3H9WA 3CLOA 3C2WA 3R7WB 2K7SA 3MQ0A 5IS1A 3T4TA 5F69A 3S7OA 3BQAA 3ICYA 2Y8HA 4IUKA 2L0WA 3IBJA 1NLZA 3H7WB 1DP8A 4NKPA 3IS2A 3TJZC 3PBOA 3MF0A 5G4ZA 4YNRA 3LR3A 4LRZE 1OTBA 2OOLA 4KUOA 3JVUA 4PKYG 4MN7A 4HJ6A 1W63Q 4H6JB 4MMNA 1F98A 3EGDC 4WELA 2BASA 3LICA 4GJ4A 3JVVA 4NXEA 3T4SA 1YSPA 2WKRA 2KX6A 3C38A 2EWWA 3OLOA 4DJ3A 3S7QA 3K2NA 3KO6A 4OOMA 4QPRA 3OCLA 2P08A 3LIBA 4BWIA 2V1AA 3LFVA 4ARZA 3MR0A 2XSSA 4JGRA 3BWLA 3E98A 4O01A 2HJ9C 3LIAA 1F9IA 3B47A 5F68A 4B93A 2OAQ1 4O8GA 2W3FA 5HWTA 2JKRM 5J4EA 2W27A 4KQOA 2IA2A 1DP9A 4BBUA 5IT5A 5F5YA 4Y2FA 3C30A 2JN7A 2ZMFA 3T4KA 4WEJA 2VV6A 3VE4A 4NEED 4HP4A 5HWWA 3KSHA 4NXFA 1XJ4A 3PBSA 3B42A 2PYPA 2FH5A 1UGUA 5TJJA 2W3DA 3EOIA 4CLCD 1NRJA 3NHQA 1S1ZA 2XRNA 3R7WA 1XFNA 2QYBA 2EA9A 1N9OA 1LSWA 1YKDA 2D01A 3KYZA 2NUPC 3VE3A 2VV7A 4K08A 2L4RA 4L0LA 3LI8A 3EEAA 5DFXA 2ZOIA 2HF6A 4HOIA 3KSGA 2Z6CA 3C8CA 2JHEA 3PBRA 1P0ZA 2Z6DA 2K2NA 3FPVA 4EW7A 1S4RA 3NOPC 3HJKA 4LRYC 3F1PB 4H6JA 3TW8A 1UWPX 1GSXA 1IOUA 3UB8A 4PAUA 3A0VA 3FPWA 3VOLA 1EW0A 2ZOHA 1Y28A 2B02A 4HH2A 2OWJA 3CAXA 4M4XA 1ODVA 4ETZA 2PYRA 4JGPA 3PR6A 4Q0IA 1OTDA 5DF9A 4G3VA 4DN0A 4O0PA 5CX7A 3UB7A 4WEKA 3D72A 4UQIM 5HDCA 1G6OA 2ZBBA 4Y3IA 4MDZA 4II7A 4UEYA 2H28A 2LB9A 1T1CA 3UMDA 4WLAA 2M1CA 2B18A 4MN6A 3T4LA 5HSQA 2W3GA 2W1TA 3EQUA 3ZYTA 3OC2A 3LIEA 4I3JA 2VKSA 4NXBA 2JKTI 4WN5A 1N9NA 3H82B 1D06A 4GLQA 4G3KA 3PBQA 4GW9A 4NXGA 3NOUC 4LRXC 2PHYA 2KDKA 3LR4A 1OJGA 3S7PA 5DKLA 3V67A 4XT2B 1OT9A 2J3TC 3MFXA 2V0WA 4P6ZS 3U2AA 3G6OA 1XJ2A 2O9CA 2VGLM 3CWFA 4HH3A 3EGXC 1P9WA 1H3QA 1P9RA 4WF0A 2O9BA 1LL8A 3BY9A 1D7EA 4Y5FA 3NOTC 2VZWA 2QKPA 1X0OA 3F1PA 4Q0JA 3TRCA 3MQOA 1S1YA 2W1TB 2VA0A 1T19A 1WA9A 5LBRA 1S4SA 4HHDA 4OOLA 4IUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NEE D;  2JKT M;  2JKT I;  2HF6 A;  1W63 Q;  2VGL M;  2VGL S;  2FH5 A;  5MC7 A;  4UQI M;  4UQI S;  1W63 M;  1NRJ A;  2XA7 M;  2XA7 S;  2JKR I;  3TJZ C;  2JKR M;  4P6Z M;  4P6Z S; 
#chains in the Genus database with same CATH topology
 3K3D A;  4B9O A;  2JKT M;  4X6T A;  2IWB A;  2Y55 A;  3ZNT A;  1K6S A;  2PR6 A;  4NET A;  5EVE A;  5CTM A;  3W4Q A;  3CZD A;  1JNU A;  3A3E A;  2E8J A;  2QMI A;  2JBF A;  5J7E A;  4I39 A;  3T4O A;  2ZM0 A;  2HGV A;  2YKF A;  4EBN A;  1JTD A;  3CMZ A;  4ZJ1 A;  1HZO A;  4QY5 A;  2OAP 1;  1IFQ A;  4HBU A;  3VSK A;  4PKY A;  1STZ A;  4OKP A;  4DE0 A;  1OTA A;  4EV4 A;  3VP2 A;  2I9V A;  3T1R A;  1BYW A;  4S2L A;  4BLM A;  1XGJ A;  1TF1 A;  2KOI A;  4BD0 A;  4JGO A;  5A91 A;  4MEZ A;  3IHB A;  4Y7P A;  3W2Z A;  3IHA A;  1QMF A;  4N1X A;  2HDR A;  1ZHH B;  4EQ1 A;  2WKI A;  5L8M A;  1XX2 A;  2VX8 A;  1H8Z A;  2E8I A;  2A24 B;  3UDF A;  3BEB A;  1XJ3 A;  4ZTK A;  2RCX A;  2PD8 A;  3A3D A;  3BFG A;  3GVB A;  4KG2 A;  4Q0H A;  5AVE A;  1OPX A;  5FAS A;  1YMS A;  1NY0 A;  1YLJ A;  2M7U A;  1TS6 A;  1I2W A;  4HIA A;  3VP4 A;  5AQ9 A;  4X55 A;  2PD7 A;  5EV0 A;  4WL9 A;  1FR6 A;  2WZZ A;  1OT6 A;  3QP6 A;  2FFY A;  1E4D A;  2OV5 A;  4IHQ A;  3T50 A;  2WUQ A;  4CLC B;  2JKR I;  1N4O A;  4F3L A;  1YSQ A;  5HZH A;  4I5S A;  1ERM A;  3MFD A;  3T4J A;  2WAD A;  2L1M A;  4NK3 A;  2VEA A;  1JWP A;  2WGI A;  4L9G A;  1YPR A;  2MJ6 A;  4EEU A;  1KGF A;  5GHZ A;  1XA1 A;  1JWV A;  5FDS A;  2XH9 A;  4GS9 A;  4F94 A;  1BLC A;  3LID A;  4DJ2 A;  1ERQ A;  4FOF A;  5FQM A;  1VQQ A;  3UME A;  4WBG A;  2HDQ A;  4KZ5 A;  4U0T A;  1BSG A;  5HAQ A;  1TD5 A;  2BLS A;  4X56 A;  2LB5 A;  4LPZ A;  4QJG A;  1KGE A;  2ZQD A;  3LR0 A;  4K91 A;  1SCW A;  3PYP A;  3ZNY A;  2WKQ A;  4HJ3 A;  1T18 A;  3QP2 A;  3ZDJ A;  1ZG6 A;  1IYS A;  2W1R A;  3HUO A;  3IQA A;  2B5R A;  1F5M A;  1T1A A;  3NI9 A;  4E04 A;  4EEP A;  3F1N A;  2O99 A;  3Q1F A;  5AVF A;  1ERO A;  2HV1 A;  4L9F A;  5DF8 A;  2QPN A;  5HD5 A;  2W3E A;  3HVF A;  2XA7 S;  4OQI A;  1W79 A;  4FSF A;  2EXB A;  3DBA A;  3GR2 A;  3QP1 A;  2VK3 A;  4DE3 A;  3GMW A;  4EER A;  5I5L A;  5HAI A;  2JKF A;  1W7F A;  3T4Q A;  4ZJ3 A;  1CF0 A;  4CPK A;  4NG2 A;  1PRQ A;  4PM9 A;  5DKK A;  2G2W A;  4RX2 A;  4WZ4 A;  2GZA A;  2VJW A;  1LSV A;  3GTC A;  1MC0 A;  4IED A;  4S2O A;  2PR5 A;  1DJA A;  4Z1W A;  2ZMA A;  3W4P A;  2Y4A A;  2FZ0 A;  4KZ8 A;  3MQ0 A;  1W8Y A;  2ZM2 A;  3S7O A;  4IUK A;  1NLZ A;  3V3S A;  4NKP A;  3BFC A;  3S4X A;  3MF0 A;  4YNR A;  1OTB A;  1SHV A;  4S2I A;  5FAQ A;  1W63 Q;  4MMN A;  2ZQC A;  1K4E A;  4FTX A;  2V8C A;  4WEL A;  2BAS A;  1ES5 A;  1H5X A;  3JVV A;  2WKR A;  3K2N A;  1GHP A;  3OCL A;  2UV0 E;  2V1A A;  3A3F A;  3MR0 A;  1FCM A;  3OPR A;  2P9V B;  3LIA A;  4B93 A;  1W5D A;  3QNC A;  1K25 A;  2W27 A;  4MBK A;  1DP9 A;  2WKH A;  4BBU A;  5IT5 A;  5F5Y A;  4Y2F A;  4WEJ A;  3N8L A;  2HDS A;  2VGJ A;  2Y91 A;  2FH5 A;  3BRM A;  1VET B;  2XRN A;  1XFN A;  2H0T A;  4KZA A;  1MXO A;  4LCM A;  2NUP C;  3RXW A;  4K08 A;  5TFQ A;  1SKO B;  3LI8 A;  3EEA A;  2HF6 A;  4Y0O A;  4E3O A;  5FQK A;  3PBR A;  3FKV A;  4YFM A;  4LRY C;  3CG5 A;  5D3O A;  3TW8 A;  2JKG A;  4QHC A;  5CER A;  4PAU A;  4UA9 A;  1WYB A;  4R23 A;  1EW0 A;  1BLS A;  4M4X A;  1NJ4 A;  1ODV A;  2WGV A;  3PR6 A;  3HUM A;  3G30 A;  3HBR A;  2X71 A;  4G3V A;  5F1G A;  4DN0 A;  4N92 A;  3QP5 A;  4P0M A;  4A5R A;  4UQI M;  5E43 A;  5EVI B;  4Y3I A;  1Z6F A;  3TG9 A;  3UMD A;  4WLA A;  3N8R A;  2B18 A;  3VFF A;  2ZM8 A;  4KEN B;  2XD1 A;  3T4L A;  3UB5 P;  2W1T A;  5FEG A;  3V5M A;  4KZB A;  3LIE A;  2R9W A;  3UDI A;  1Q2P A;  2WZX A;  3H82 B;  4GLQ A;  4WZ5 A;  5FAT A;  5FI6 A;  4CJN A;  5FQ9 A;  1KE0 A;  2VGK A;  5FAP A;  3N6I A;  4WZ5 C;  3MXS A;  2IWD A;  1TEM A;  3MFX A;  1HVB A;  5AQA A;  1XJ2 A;  1G5U A;  5CHJ A;  4HH3 A;  1P9R A;  4OP8 A;  5L2F A;  3G32 A;  3DTK A;  3DWK A;  4GOG A;  2J9P A;  3DTM A;  2EXA A;  4R4S A;  1L3L A;  1ALQ A;  3P98 A;  4U3T A;  3BLS A;  3VOZ A;  3IWQ A;  1FCN A;  2WAE A;  1K4F A;  1G6A A;  4HHD A;  2XFS A;  3MXQ A;  5HD3 A;  3RXX A;  4HI4 A;  5HDS A;  4X1M A;  1O7E A;  5CXW A;  5GLC A;  4HY8 A;  3MBZ A;  1XPB A;  5FI2 A;  1TS8 A;  5FI7 A;  4X69 A;  1GSW A;  3SOI A;  5J3W A;  2CMN A;  1DP6 A;  3LYX A;  5F83 A;  2ZC5 B;  2PBD P;  1LI0 A;  3NDG A;  4E3J A;  1FR1 A;  1GSV A;  3IX8 A;  2OLU A;  5DFY A;  4ZRR A;  4OVD A;  3W4O A;  4L9E A;  5BOH A;  3S1Y A;  2WKE A;  4EQI A;  1PWC A;  5CGX A;  2M7V A;  2P74 A;  1G28 A;  3LEQ A;  3BJN A;  5CGW A;  3ZVT A;  5K5B A;  5EVL A;  3PHY A;  4GD6 A;  2V20 A;  1XJ6 A;  2RL3 A;  3RTY A;  5MC7 A;  4YWZ A;  4JF6 A;  3WS5 A;  1UWN X;  5L09 A;  4RQ9 A;  3E4P A;  3P7N A;  4QU3 A;  5HPF A;  5TBM B;  1W8Q A;  4BL3 A;  4M3K A;  4BMW A;  2J3T D;  4E3M A;  2WK0 A;  4LLO B;  2PBY A;  4C75 A;  3AGE A;  4GNU A;  5CHM A;  1T1B A;  2XDM A;  4JGQ A;  1C3B A;  1TS0 A;  4HNB A;  3CPT A;  2Y2L A;  3NJA A;  4GHI B;  4DF6 A;  1L0G A;  5A90 A;  4BL2 A;  5DTT A;  4RX3 A;  2HPB A;  3Q81 A;  2HP5 A;  3HCY A;  2PDR A;  1BUL A;  3VOY A;  1N9B A;  4KQQ A;  1KVL A;  1DRM A;  1N9L A;  4K0W A;  5FSR A;  4DE1 A;  3NC8 A;  4OQH A;  3IX3 A;  4OPR A;  3WS0 A;  4CLC E;  1ZKJ A;  1YMX A;  1E3U A;  1XP4 A;  3ZVW A;  5CEB A;  2V0U A;  3EWK A;  2ZL1 A;  4C3Q A;  4HQA A;  3IS2 B;  3T1Q B;  3CUE A;  4R38 A;  4EU0 A;  3HJI A;  5F6A A;  4OP5 A;  2ZQ8 A;  4DMZ A;  3AGF A;  1MKM A;  2B95 A;  2V1B A;  1PIO A;  1WYC A;  5U47 A;  3CUE C;  3MZD A;  3N7W A;  3TSG A;  3Q7Z A;  2O9A A;  5G4Y A;  3AGD A;  3P01 A;  2W3H A;  4PM6 A;  1CQA A;  4HEF A;  4P6Z M;  4ARZ B;  4JLF A;  3Q07 A;  5KIZ A;  3LY4 A;  1S6R A;  2Y2M A;  4KQR A;  4YOF A;  3UE3 A;  2P7J A;  1DY6 A;  4GZB A;  1XGI A;  3MQQ A;  4BJP A;  5L07 A;  4AFI A;  5A8B A;  2XRO A;  2Y2P A;  5DTS A;  2EX2 A;  4Y0U A;  3RFB A;  3B33 A;  3OPP A;  1RCJ A;  3T1X A;  1VB6 A;  1XFQ A;  1YLZ A;  4ETX A;  3F1O A;  5L10 A;  4EET B;  5EOE A;  3E4Q A;  4FUW A;  4EES A;  4FH4 A;  3BQA A;  3IBJ A;  2XK1 A;  3TJZ C;  4UA7 A;  3PBO A;  1I2S A;  3LR3 A;  5M19 A;  5GLB A;  2OOL A;  1PNE A;  4KUO A;  3E2K A;  4JF5 A;  3C7U A;  2Y2J A;  1NYY A;  4MBF A;  3OLO A;  3HLE A;  3N8S A;  1YLY A;  2WYX A;  3KO6 A;  1J3W A;  4QPR A;  2P08 A;  5IHV A;  4KZ9 A;  2XSS A;  4JGR A;  3SS5 A;  1EWZ A;  5HX9 A;  1H0M A;  4O01 A;  3BFF A;  5E2F A;  3O87 A;  4O8G A;  2W3F A;  2JKR M;  3T1S A;  1KE3 A;  3O86 A;  3IT9 A;  2FFF B;  2JN7 A;  4BEN A;  4LV2 A;  3VE4 A;  4HP4 A;  1FSY A;  3GRJ A;  3GSG A;  1XJ4 A;  2EX9 A;  1UGU A;  5TJJ A;  3UE0 A;  3MZE A;  3EOI A;  2ZD8 A;  1NRJ A;  3NHQ A;  2G2U A;  3R7W A;  1FIL A;  3G2Y A;  2EA9 A;  2ZQ7 A;  1YKD A;  2D01 A;  3KYZ A;  2XFT A;  2VV7 A;  4DXB A;  4L0L A;  1K6R A;  1RP5 A;  3IF5 A;  5F1F A;  3ZHH A;  2JHE A;  5EVI C;  3FPV A;  4EW7 A;  3HJK A;  3F1P B;  4H6J A;  1UWP X;  4JXG A;  1ES3 A;  1MY8 A;  3HLF A;  2JC7 A;  4DXC A;  3FPW A;  3NCK A;  3LEZ A;  2ZOH A;  3ITB A;  4MLL A;  1L2S A;  5F82 A;  1TDL A;  2PYR A;  4KZ4 A;  4JGP A;  4WM9 A;  4LGW A;  4Q0I A;  1FCO A;  1EI5 A;  4GD8 A;  4K0X A;  3HLD A;  1KVM A;  3MZF A;  3SH8 A;  3D72 A;  2XLN A;  4OPY A;  4FD8 A;  2ZBB A;  3SH9 A;  4E3I A;  3U4L P;  3M2K A;  3G4P A;  2Y59 A;  4XUX A;  3EQU A;  5KMW A;  2CC1 A;  4WMC A;  3UPP A;  4LV0 A;  5E2H A;  1FQG A;  3S22 A;  1ES2 A;  2VKS A;  2J9O A;  1N9N A;  1D06 A;  1IYQ A;  4G3K A;  3C5A A;  5DVA A;  5CRF A;  2KDK A;  3ZG0 A;  3MSH A;  3S7P A;  4HES A;  3V67 A;  5CEC A;  5KZH A;  5A92 A;  1YM1 A;  3IF6 A;  3I7J A;  4E3K A;  1IYO A;  4O7D A;  2VGL M;  3EGX C;  1P9W A;  5M18 A;  3BY9 A;  3QNB A;  3Q7V A;  5TGF A;  3IF6 C;  2VZW A;  3DTE A;  1X0O A;  3FV7 A;  3NEC A;  2EFU A;  4Q0J A;  3UDX A;  3TRC A;  1G68 A;  4JXW A;  1S1Y A;  2V2F F;  2VA0 A;  3FZC A;  4KZ7 A;  1BLH A;  5LBR A;  4IUH A;  3PTE A;  2V8F A;  5HFO A;  1GA0 A;  1LLB A;  2ZMV A;  1IEL A;  4G3W A;  4UQI S;  5FQI A;  3IXH A;  3IXD A;  1MZU A;  1LSX A;  2OSU A;  4GB7 A;  1LHY A;  3KYQ A;  1K54 A;  4QWO A;  1VEU A;  4GS9 B;  2R78 A;  2ZJ9 A;  5FQJ A;  4ZDX A;  3UB6 A;  2V9A A;  1M6K A;  2QJ7 A;  4HJ4 A;  2IWC A;  4CQH A;  2XR0 A;  3O88 A;  1K54 C;  2VV8 A;  4I3A A;  1PI4 A;  2UWX A;  5M1A A;  4GHI A;  2R9X A;  4BBV A;  4XT2 A;  4FH2 A;  2P04 A;  2QHK A;  3MKE A;  3UE1 A;  2GJ3 A;  1NXY A;  4PM7 A;  3BLM A;  4D2O A;  5AJG A;  3FC7 A;  5DJU A;  2ZC4 B;  3ZQ5 A;  1K55 A;  4S2N A;  2PT7 A;  4KQD A;  3F1N B;  4FCF A;  4OQG A;  2D02 A;  1FIK A;  3KSF A;  4LV1 A;  1K55 C;  4S2N C;  5HW3 A;  2J80 A;  3OCN A;  5C5K A;  3HLW A;  1LT0 A;  3IWI A;  3QHY A;  2V1Z A;  4E3N A;  1PYY A;  2HP9 A;  3WRT A;  4KUK A;  1MWR A;  2DRW A;  4E3L A;  3FG8 A;  4ME4 A;  4OON A;  4BD1 A;  3UB9 A;  2K31 A;  5HPI A;  2NUT C;  4IJG A;  2Y79 A;  3HLG A;  4X53 A;  4P6B A;  1PWD A;  3QP8 A;  4KG6 A;  4UHU A;  2J3W A;  2WGW B;  1SDN A;  1RGZ A;  3C4O A;  5EUA A;  1AXB A;  3A0R A;  1OTI A;  3MKF A;  3OBF A;  5CED A;  1NWZ A;  2ACG A;  3Q82 A;  4P87 A;  5EM1 A;  4DKI A;  3EQV A;  3EEH A;  5HL6 A;  2XQZ A;  1BTL A;  3CIT A;  3A3J A;  4WUJ A;  1YLW A;  2A24 A;  4PMA A;  2C6W B;  3WS1 A;  5FEF A;  3VMA A;  1OTE A;  2Y2Q A;  5HAR A;  4PPR A;  3V39 A;  4I3I A;  5J8X A;  2O0Y A;  1O07 A;  1TS7 A;  1P97 A;  4P85 A;  5IU1 A;  3MJQ A;  4CLC A;  5KSH A;  3B3X A;  3LI9 A;  3IH8 A;  4R6L A;  4PM5 A;  4R0Q A;  5HDD A;  1PWG A;  4R70 A;  1H8M A;  1Y54 A;  4B4Z A;  1S66 L;  4CLC C;  3E2L A;  2GX5 A;  3LIF A;  1KE4 A;  3BW6 A;  3ZG7 B;  2A2L A;  2Y2I A;  3SZT A;  3TOI A;  2QZ6 A;  4BBT A;  3MMH A;  5HL1 A;  2WKP A;  1K56 A;  1I5Q A;  2PRF A;  3CLO A;  3C2W A;  3H9W A;  4EUV A;  2K7S A;  3OPL A;  1CI8 A;  5IS1 A;  3ICY A;  2Y8H A;  2L0W A;  3H7W B;  1DP8 A;  4JXV A;  3ZGA B;  1PW8 A;  5G4Z A;  4LRZ E;  5FDH A;  2EX8 A;  1WE4 A;  3JVU A;  4MN7 A;  4HJ6 A;  1ONG A;  4XXR A;  4ESP A;  1CEF A;  4LCL A;  1QME A;  3A3I A;  1MWT A;  3LIC A;  1MPL A;  5EPH A;  3T4S A;  5JYP A;  2KX6 A;  3C38 A;  2EWW A;  5GHX A;  4DJ3 A;  1E3U D;  1NZU A;  2ZQ9 A;  4OOM A;  2Q9M A;  4HBT A;  3VP0 A;  4QD4 A;  3BWL A;  3E98 A;  1CJF A;  1L0F A;  3IX4 A;  1F9I A;  3B47 A;  5F68 A;  3JPU A;  1HD8 A;  5HWT A;  3V50 A;  1ACF A;  4KQO A;  2IA2 A;  5E2G A;  1K38 A;  2ZMF A;  2VV6 A;  2XGN A;  2PU2 A;  4H8R A;  4DDY A;  4KZ3 A;  3B42 A;  2PYP A;  3VP1 A;  4IVI A;  3OPH A;  1DJB A;  2W3D A;  3WWX A;  1S1Z A;  1XXM A;  4Y0T A;  2QYB A;  2Z2L B;  1NZO A;  1ESU A;  3VE3 A;  4IVK A;  5EOO A;  2ZOI A;  4E6W A;  1NRF A;  3KSG A;  2Z6C A;  3C8C A;  3UNW A;  1GHM A;  1P0Z A;  3L7H A;  4Y13 A;  3NOP C;  2OLV A;  4UAA A;  1NYM A;  4OLD A;  5A93 A;  1GSX A;  5TR7 A;  3UB8 A;  1IOU A;  3A0V A;  4HH2 A;  3KYE A;  1L0D A;  2OWJ A;  4ETZ A;  2JE5 A;  4ZJ2 A;  4OPZ A;  4U0X A;  4EUZ A;  3BEC A;  4X1L A;  5EEC A;  4R3B A;  3D9Y A;  3RJU A;  1YLT A;  4WEK A;  4S2P A;  1K57 A;  5HDC A;  2P9V A;  1LI9 A;  1JTG A;  5DF7 A;  3LCE A;  1KDW A;  4UEY A;  2H28 A;  1TVF A;  5CHU A;  4R4R A;  4MN6 A;  2W3G A;  2Y2G A;  3PAE A;  2X01 A;  3ZYT A;  2Y2N A;  3OC2 A;  2JCH A;  1K57 C;  4NXB A;  4JF4 A;  4GW9 A;  4NXG A;  4GDN A;  3G2Z A;  4OQ0 A;  1AWI A;  1F2K A;  3UPO A;  4LRX C;  2PHY A;  2ZC3 B;  1LL5 A;  3ZG9 B;  3LR4 A;  5EE8 A;  1OJG A;  3WRZ A;  1VET A;  1VM1 A;  3LO7 A;  4LV3 A;  1OT9 A;  1LL9 A;  2BTF P;  1TDG A;  4S2J A;  2O9C A;  1MBL A;  2EX6 A;  3CWF A;  1H3Q A;  1SKO A;  4JKT A;  4WF0 A;  2O9B A;  5GL9 A;  1U60 A;  4Y15 A;  3BYD A;  3BM6 A;  4MBH A;  2QKP A;  1HTZ A;  2A3U A;  2AVX A;  1D1J A;  3MS6 A;  4JBF A;  1WA9 A;  1T19 A;  3G31 A;  3WS4 A;  3L9K A;  1S4S A;  3M6H A;  4OOL A;  1MKI A;  4GDB A;  2Q9N A;  3QP4 A;  3HUN A;  3CJM A;  4ZBE A;  4Z9Q A;  5EVI D;  3BY8 A;  3WS2 A;  1CI9 A;  3P09 A;  3CPT B;  2DNS A;  1OJ5 A;  3UE6 A;  5EVI A;  4N9L A;  4YIN A;  3IWO A;  4R1G A;  5E2E A;  4GN2 A;  2EFX A;  3V3R A;  3MXR A;  1Y4O A;  3SH7 A;  2XEP A;  3PBT A;  2Z2M B;  4GCZ A;  1S0W A;  5DJT A;  3H82 A;  2I72 A;  3DAV A;  4MN5 A;  3TE8 A;  2OWH A;  1V9Y A;  5EM0 A;  3IXG A;  3A0S A;  3GEC A;  4KG5 A;  3CHW P;  5EFW A;  3O5Y A;  1ES4 A;  3CI6 A;  3JYI A;  3PBN A;  3SW1 A;  3OZH A;  2VGL S;  2ZL1 B;  2QWS A;  4S2K A;  4WMC D;  1PW1 A;  2GNX A;  1ONH A;  2WGW A;  3S7N A;  3K3C A;  3HLB A;  3G34 A;  2GDN A;  2G7U A;  4KZ6 A;  4DRT A;  3ISG A;  4B88 A;  1M40 A;  2W0N A;  3PXP A;  3RH8 B;  3VV4 A;  1E25 A;  4R3J A;  2XA7 M;  1ZG4 A;  4WYY A;  3GV9 A;  5HAP A;  1DJC A;  2Y2K A;  1IYP A;  1A0K A;  3KSI A;  2WAF A;  4DDS A;  3UO9 A;  5HWV A;  2C5W B;  2XD5 A;  2H5S A;  3M6B A;  3M2J A;  4PHT A;  1MWS A;  1KOU A;  3SS3 A;  2HP6 A;  5GLA A;  1YAX A;  4R3A A;  3R4K A;  3F1O B;  3NIA A;  3HL9 A;  1IKG A;  2PAV P;  4C6Y A;  2QJ5 A;  1VHM A;  1V9Z A;  1GCE A;  1ZTU A;  4F3L B;  4LFU A;  3LUQ A;  2DCF A;  3NDE A;  1MWU A;  5FAO A;  4BQM A;  3PAG A;  3E4O A;  2DMW A;  5TBM A;  2H10 A;  4MNR A;  4PM8 A;  3IBR A;  5FL3 A;  4X25 A;  1Q2Q A;  1XKZ A;  3GDI A;  3D3O A;  4I38 A;  4QY6 A;  4S2M A;  2INW A;  3BQ8 A;  2KLI A;  1W63 M;  4JPM A;  4OH0 A;  3SS4 A;  1JVJ A;  2EWV A;  3NUL A;  1XA7 A;  3H7W A;  2VLG A;  4Q8I A;  3FWL A;  2J7V A;  4RA7 A;  1SDE A;  3D4F A;  4EXO A;  3HLC A;  2HJE A;  2YKH A;  3E0Y A;  4MCW A;  3C4P A;  3OOV A;  3NBL A;  3ULF A;  1S67 L;  4Y17 A;  1NLY A;  5I94 A;  3LR5 A;  3VSL A;  3KX0 X;  1HLU P;  4EBP A;  4HP9 A;  3IXB A;  3R7W B;  4E6X A;  5GHY A;  3T4T A;  5F69 A;  3DW0 A;  3IS2 A;  3N4I A;  5KSC A;  4PKY G;  1PZP A;  4H6J B;  3DWZ A;  1JWZ A;  4B4X A;  1L0E A;  1F98 A;  3EGD C;  4RVA A;  4GJ4 A;  4NXE A;  1YSP A;  2Q0O A;  4GKU A;  4JXS A;  1ZC2 A;  3ZG8 B;  1PZO A;  3S7Q A;  4BWI A;  3LIB A;  1BT5 A;  3VFH A;  3LFV A;  4ARZ A;  5CGS A;  3ZG5 A;  2ZC6 B;  1SKF A;  2ZLY A;  2HJ9 C;  3BFE A;  4XUZ A;  2OAQ 1;  5CTN A;  1K0K A;  1PFL A;  5J4E A;  2A49 A;  4EBL A;  3W8K A;  3C30 A;  1GA9 A;  1SZV A;  2ZC7 A;  4X68 A;  3T4K A;  1FSW A;  5DTK A;  4NEE D;  5HWW A;  3DTI A;  3KSH A;  4NXF A;  3C7V A;  3PBS A;  2J8Y A;  5GLD A;  5AQB A;  1CEG A;  4CLC D;  1YQS A;  2HDU A;  3FKW A;  1Z09 A;  3IF6 B;  2HZ5 A;  1N9O A;  1LSW A;  1KGG A;  1BZA A;  3T12 B;  2L4R A;  4EWF A;  3VP3 A;  5DFX A;  4HOI A;  3Q7V B;  1OME A;  2Z6D A;  2K2N A;  5FA7 A;  1S4R A;  3LY3 A;  1FOF A;  3UN7 A;  1IKI A;  1H8Y A;  4N9K A;  3VOL A;  3UPN A;  1Y28 A;  2B02 A;  2PU4 A;  3G35 A;  3CAX A;  1PI5 A;  1BUE A;  1K56 D;  4D60 A;  1OTD A;  2Y2O A;  5DF9 A;  3BFD A;  4OLG A;  4OOY A;  4O0P A;  4QB8 A;  5CX7 A;  3ITA A;  5AQ7 A;  3UB7 A;  4UA6 A;  4DE2 A;  2ZQA A;  3GQZ A;  1G6O A;  1BLP A;  1GHI A;  1KDS A;  2Y2H A;  3ZFZ A;  4MDZ A;  1J9M A;  4II7 A;  4LEN A;  2LB9 A;  1T1C A;  2M1C A;  4N1H A;  4IBR A;  5HSQ A;  4ID4 A;  4OPQ A;  1VEU B;  1CK3 A;  3FYZ A;  4I3J A;  3LGO A;  2JKT I;  3O3V A;  4WN5 A;  4ZAM A;  5G18 A;  3NY4 A;  3UY6 A;  1YT4 A;  3PBQ A;  3NOU C;  4RYE A;  5FQQ A;  4IBX A;  5DKL A;  1RGY A;  4XT2 B;  3HRE A;  2J3T C;  2V0W A;  4P6Z S;  3U2A A;  2BG1 A;  2X02 A;  3G6O A;  2XF3 A;  5JYO A;  1LL8 A;  1D7E A;  4Y5F A;  3ZCZ A;  3NOT C;  1IEM A;  3F1P A;  2W1T B;  2H0Y A;  3IH9 A;  3MQO A;  1ESI A;  1YLP A; 
#chains in the Genus database with same CATH homology
 3K3D A;  4B9O A;  2JKT M;  3MXQ A;  5HD3 A;  4HI4 A;  2ZMV A;  5HDS A;  3BY8 A;  2PR6 A;  4G3W A;  1JNU A;  4UQI S;  4HY8 A;  5J7E A;  4I39 A;  3T4O A;  1OJ5 A;  3UE6 A;  1TS8 A;  2HGV A;  2YKF A;  1GSW A;  2OAP 1;  1IFQ A;  5J3W A;  2CMN A;  1DP6 A;  1MZU A;  1LSX A;  3LYX A;  4PKY A;  1STZ A;  3KYQ A;  4GS9 B;  2R78 A;  1OTA A;  1GSV A;  2I9V A;  3PBT A;  5DFY A;  4ZRR A;  1BYW A;  4GCZ A;  5DJT A;  3UB6 A;  2V9A A;  3H82 A;  2QJ7 A;  4L9E A;  4MN5 A;  4HJ4 A;  1TF1 A;  2KOI A;  4CQH A;  3TE8 A;  4JGO A;  2OWH A;  1V9Y A;  2VV8 A;  4I3A A;  3A0S A;  3GEC A;  5EFW A;  2M7V A;  4GHI A;  3O5Y A;  3W2Z A;  4BBV A;  1G28 A;  3CI6 A;  4XT2 A;  3BJN A;  5K5B A;  2P04 A;  3PBN A;  3SW1 A;  1ZHH B;  2QHK A;  4EQ1 A;  2VGL S;  2GJ3 A;  5L8M A;  3PHY A;  1XJ6 A;  5AJG A;  3RTY A;  5MC7 A;  2QWS A;  4YWZ A;  2VX8 A;  3FC7 A;  1UWN X;  5DJU A;  3ZQ5 A;  2A24 B;  3E4P A;  4RQ9 A;  1XJ3 A;  2PT7 A;  2GNX A;  3P7N A;  4KQD A;  5HPF A;  2PD8 A;  5TBM B;  3F1N B;  4Q0H A;  5AVE A;  2D02 A;  4BMW A;  1OPX A;  2J3T D;  3S7N A;  3K3C A;  4LLO B;  2M7U A;  1TS6 A;  3KSF A;  2G7U A;  4HIA A;  2W0N A;  2PD7 A;  3PXP A;  3RH8 B;  3VV4 A;  2J80 A;  1T1B A;  4WL9 A;  3OCN A;  5C5K A;  4JGQ A;  1OT6 A;  1TS0 A;  2XA7 M;  1LT0 A;  4HNB A;  4IHQ A;  3T50 A;  3NJA A;  4CLC B;  2JKR I;  4GHI B;  4F3L A;  1YSQ A;  5HZH A;  4I5S A;  4KUK A;  3T4J A;  3KSI A;  2L1M A;  3FG8 A;  4ME4 A;  3UB9 A;  2VEA A;  2K31 A;  5HPI A;  5HWV A;  4L9G A;  2NUT C;  2MJ6 A;  4EEU A;  4IJG A;  2Y79 A;  3HCY A;  2PDR A;  4GS9 A;  3LID A;  4DJ2 A;  2J3W A;  1DRM A;  1N9L A;  4FOF A;  4PHT A;  1KOU A;  3UME A;  3A0R A;  1OTI A;  1YAX A;  4R3A A;  3R4K A;  3F1O B;  1TD5 A;  2QJ5 A;  1VHM A;  2LB5 A;  3OBF A;  4CLC E;  4LPZ A;  1V9Z A;  3LR0 A;  1NWZ A;  2V0U A;  3EWK A;  3PYP A;  3EQV A;  3EEH A;  5HL6 A;  3CIT A;  4HQA A;  2WKQ A;  3IS2 B;  3CUE A;  1ZTU A;  4HJ3 A;  4R38 A;  4EU0 A;  1T18 A;  3HJI A;  5F6A A;  4F3L B;  4WUJ A;  3LUQ A;  4DMZ A;  2A24 A;  2W1R A;  1MKM A;  1F5M A;  1T1A A;  4E04 A;  3E4O A;  2V1B A;  4EEP A;  2DMW A;  5TBM A;  3F1N A;  2O99 A;  3IBR A;  1OTE A;  3CUE C;  5FL3 A;  3GDI A;  3D3O A;  5AVF A;  4I38 A;  4I3I A;  2HV1 A;  2INW A;  2O9A A;  4L9F A;  5G4Y A;  3BQ8 A;  2KLI A;  1W63 M;  5HD5 A;  2W3E A;  2O0Y A;  2XA7 S;  1TS7 A;  2EWV A;  4FSF A;  1P97 A;  3DBA A;  3P01 A;  5IU1 A;  2W3H A;  3MJQ A;  3H7W A;  2VLG A;  4P6Z M;  4ARZ B;  4CLC A;  5KSH A;  3LI9 A;  4EER A;  5I5L A;  4R6L A;  5KIZ A;  5HDD A;  4EXO A;  3T4Q A;  4R70 A;  2HJE A;  1H8M A;  2YKH A;  3E0Y A;  4MCW A;  4YOF A;  1S66 L;  4CLC C;  2GX5 A;  3UE3 A;  3LIF A;  2P7J A;  5DKK A;  3BW6 A;  2VJW A;  2GZA A;  3OOV A;  1LSV A;  3MQQ A;  4BJP A;  3ULF A;  1MC0 A;  4AFI A;  1S67 L;  2A2L A;  2PR5 A;  1NLY A;  5A8B A;  2XRO A;  3LR5 A;  3RFB A;  4Z1W A;  3B33 A;  4BBT A;  3MMH A;  1VB6 A;  1XFQ A;  3KX0 X;  4ETX A;  3F1O A;  4EET B;  3E4Q A;  4HP9 A;  2WKP A;  4EES A;  2FZ0 A;  4EUV A;  3H9W A;  3CLO A;  3C2W A;  3R7W B;  2K7S A;  3MQ0 A;  5IS1 A;  3T4T A;  5F69 A;  3S7O A;  3BQA A;  3ICY A;  2Y8H A;  4IUK A;  2L0W A;  3IBJ A;  1NLZ A;  3H7W B;  1DP8 A;  4NKP A;  3IS2 A;  3TJZ C;  3PBO A;  3MF0 A;  5G4Z A;  4YNR A;  3LR3 A;  4LRZ E;  1OTB A;  2OOL A;  4KUO A;  3JVU A;  4PKY G;  4MN7 A;  4HJ6 A;  1W63 Q;  4H6J B;  4MMN A;  1F98 A;  3EGD C;  4WEL A;  2BAS A;  3LIC A;  4GJ4 A;  3JVV A;  4NXE A;  3T4S A;  1YSP A;  2WKR A;  2KX6 A;  3C38 A;  2EWW A;  3OLO A;  4DJ3 A;  3S7Q A;  3K2N A;  3KO6 A;  4OOM A;  4QPR A;  3OCL A;  2P08 A;  3LIB A;  4BWI A;  2V1A A;  3LFV A;  4ARZ A;  3MR0 A;  2XSS A;  4JGR A;  3BWL A;  3E98 A;  4O01 A;  2HJ9 C;  3LIA A;  1F9I A;  3B47 A;  5F68 A;  4B93 A;  2OAQ 1;  4O8G A;  2W3F A;  5HWT A;  2JKR M;  5J4E A;  2W27 A;  4KQO A;  2IA2 A;  1DP9 A;  4BBU A;  5IT5 A;  5F5Y A;  4Y2F A;  3C30 A;  2JN7 A;  2ZMF A;  3T4K A;  4WEJ A;  2VV6 A;  3VE4 A;  4NEE D;  4HP4 A;  5HWW A;  3KSH A;  4NXF A;  1XJ4 A;  3PBS A;  3B42 A;  2PYP A;  2FH5 A;  1UGU A;  5TJJ A;  2W3D A;  3EOI A;  4CLC D;  1NRJ A;  3NHQ A;  1S1Z A;  2XRN A;  3R7W A;  1XFN A;  2QYB A;  2EA9 A;  1N9O A;  1LSW A;  1YKD A;  2D01 A;  3KYZ A;  2NUP C;  3VE3 A;  2VV7 A;  4K08 A;  2L4R A;  4L0L A;  3LI8 A;  3EEA A;  5DFX A;  2ZOI A;  2HF6 A;  4HOI A;  3KSG A;  2Z6C A;  3C8C A;  2JHE A;  3PBR A;  1P0Z A;  2Z6D A;  2K2N A;  3FPV A;  4EW7 A;  1S4R A;  3NOP C;  3HJK A;  4LRY C;  3F1P B;  4H6J A;  3TW8 A;  1UWP X;  1GSX A;  1IOU A;  3UB8 A;  4PAU A;  3A0V A;  3FPW A;  3VOL A;  1EW0 A;  2ZOH A;  1Y28 A;  2B02 A;  4HH2 A;  2OWJ A;  3CAX A;  4M4X A;  1ODV A;  4ETZ A;  2PYR A;  4JGP A;  3PR6 A;  4Q0I A;  1OTD A;  5DF9 A;  4G3V A;  4DN0 A;  4O0P A;  5CX7 A;  3UB7 A;  4WEK A;  3D72 A;  4UQI M;  5HDC A;  1G6O A;  2ZBB A;  4Y3I A;  4MDZ A;  4II7 A;  4UEY A;  2H28 A;  2LB9 A;  1T1C A;  3UMD A;  4WLA A;  2M1C A;  2B18 A;  4MN6 A;  3T4L A;  5HSQ A;  2W3G A;  2W1T A;  3EQU A;  3ZYT A;  3OC2 A;  3LIE A;  4I3J A;  2VKS A;  4NXB A;  2JKT I;  4WN5 A;  1N9N A;  3H82 B;  1D06 A;  4GLQ A;  4G3K A;  3PBQ A;  4GW9 A;  4NXG A;  3NOU C;  4LRX C;  2PHY A;  2KDK A;  3LR4 A;  1OJG A;  3S7P A;  5DKL A;  3V67 A;  4XT2 B;  1OT9 A;  2J3T C;  3MFX A;  2V0W A;  4P6Z S;  3U2A A;  3G6O A;  1XJ2 A;  2O9C A;  2VGL M;  3CWF A;  4HH3 A;  3EGX C;  1P9W A;  1H3Q A;  1P9R A;  4WF0 A;  2O9B A;  1LL8 A;  3BY9 A;  1D7E A;  4Y5F A;  3NOT C;  2VZW A;  2QKP A;  1X0O A;  3F1P A;  4Q0J A;  3TRC A;  3MQO A;  1S1Y A;  2W1T B;  2VA0 A;  1T19 A;  1WA9 A;  5LBR A;  1S4S A;  4HHD A;  4OOL A;  4IUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...