2VGLS

Ap2 clathrin adaptor core
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
142
structure length
142
Chain Sequence
b'MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADAPTOR PROTEIN COMPLEX AP-2, ALPHA 2 SUBUNIT
publication title Molecular Architecture and Functional Model of the Endocytic Ap2 Complex
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
total genus 50
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2007-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2vglS00
3TJZC 4P6ZS 2VGLM 2XA7M 5MC7A 1NRJA 2JKRI 4UQIM 2JKRM 4NEED 4P6ZM 2JKTI 2VGLS 2XA7S 1W63Q 2FH5A 1W63M 4UQIS 2HF6A 2JKTM
chains in the Genus database with same CATH superfamily
5GLCA 4UA6A 2HDRA 2HGVA 3UE0A 1OTAA 4MCWA 4R4SA 3MMHA 3WS4A 1F2KA 3T4QA 2XK1A 5FQJA 1D1JA 4GJ4A 4P85A 3N4IA 3ISGA 2V20A 3HVFA 1XXMA 3S7PA 3CZDA 4JGPA 2W1TA 1MWRA 2IA2A 2OWJA 2J8YA 4ZJ2A 2VJWA 3SH8A 2ZOIA 4GD6A 3QP4A 1JVJA 4Y5FA 4P6ZM 3WRZA 3HUMA 4EUVA 2H0YA 3OLOA 4MBKA 5CERA 4R0QA 2PYPA 5DTSA 1K4EA 2Y2OA 3T4SA 3CG5A 3KYEA 4DJ2A 2W27A 5HDDA 3U4LP 2W3FA 1MY8A 1V9ZA 3LIEA 1LI9A 4GLQA 3VV4A 4Z9QA 1N9LA 3DAVA 3OPRA 5A8BA 3T12B 3PAEA 3C7VA 3AGEA 2R9XA 2Y91A 2M7VA 3NULA 4X6TA 5HARA 2Y2MA 5MC7A 3HJKA 3H82B 4FCFA 2I9VA 1E3UA 4B4ZA 3ZFZA 4B4XA 1K55A 3WS1A 3WS2A 3ZG9B 2C5WB 4WZ5C 3PHYA 1FSYA 2ZC4B 3MXQA 2VKSA 3ZVTA 2O9AA 4GHIA 2EWVA 2VA0A 4JXSA 1K6SA 2XA7M 3ITAA 5HWWA 4X68A 4K91A 3GMWA 1OJ5A 1TS7A 3VOZA 1J3WA 2Y2KA 3V67A 3OPLA 4R3BA 4S2KA 4EBLA 2WADA 4JGOA 3LR3A 1GA0A 3FG8A 2HDSA 3UPPA 3HUNA 1G6OA 1TS6A 5J3WA 3UDIA 1P9RA 1NWZA 3BRMA 1NY0A 4WMCA 2JCHA 1HVBA 3R7WA 3LGOA 2J9PA 4HESA 3IH9A 5KMWA 1FR6A 3MZDA 2WAEA 1DY6A 5HX9A 2QHKA 1H8ZA 3PYPA 2J3TC 4KZ4A 2ZMAA 1KGGA 3HLEA 4LENA 2ZQ8A 4H6JA 4N1XA 4R70A 3Q7ZA 2E8IA 4E04A 5DFXA 3N8RA 1H8MA 2O9BA 3DWKA 5CEDA 3QP1A 4G3KA 5DFYA 3KYZA 1L0FA 3MKFA 1NZOA 3M6BA 1PZPA 1HLUP 3BFFA 4IUKA 2OLUA 2WGIA 2JKFA 4LRXC 2W3HA 4KQQA 2XRNA 2BTFP 1H0MA 1ERQA 4WEKA 3BFEA 2OAQ1 5CGXA 5AQAA 4MLLA 3IWQA 1TDGA 5KSCA 3GVBA 1BT5A 4WN5A 3ZGAB 3NHQA 3GTCA 1MBLA 1ES5A 3K3CA 4NXBA 5E43A 1E25A 2WKHA 3OPPA 4BL2A 1Z09A 1LSXA 1EW0A 4F94A 1TF1A 2XFTA 4EV4A 4CPKA 4GZBA 2GDNA 1Y54A 2XROA 3JVVA 3KYQA 1OMEA 4OVDA 3IH8A 2OV5A 4QU3A 4EBPA 4E3OA 1MC0A 5AVFA 2W1TB 5FQ9A 2XEPA 4KZAA 4DF6A 3LY3A 4NKPA 3HLBA 4CLCB 1KE4A 4E6WA 3MQ0A 2EWWA 2K7SA 3T1XA 1IYPA 4ME4A 5EVIC 4ZRRA 4Y0UA 1O7EA 3NY4A 2VV8A 2Y55A 1PIOA 5HPFA 3GSGA 1X0OA 2XDMA 4EXOA 5F69A 1YSPA 2Q9MA 1DP9A 1PI4A 3GR2A 4WLAA 4GD8A 1QMEA 1L0DA 3CJMA 4Y0TA 4OPYA 3DWZA 2WKPA 1XKZA 4DE0A 3VOLA 5M18A 1VM1A 3H9WA 3CHWP 2A3UA 3PTEA 2X02A 1KDSA 3CPTA 3UB6A 4N9KA 3E4QA 2HDUA 3BFDA 1YLJA 3BY8A 1V9YA 2KLIA 4OQHA 2ZM2A 3BFCA 4CLCE 2Y8HA 2ZQAA 4PM5A 3E0YA 5IS1A 1EI5A 3NBLA 4HEFA 1KE3A 1S0WA 2PYRA 4R6LA 4LFUA 2Y2LA 4PPRA 2ACGA 3IX8A 4NK3A 3IHBA 4KZBA 5DF9A 2ZQDA 3KSHA 1XFNA 3T4LA 1F5MA 3N7WA 4CJNA 2PR6A 4OP5A 3IXHA 3Q7VB 2PRFA 4PM9A 2Z2MB 1FOFA 4KUOA 5EE8A 2ZC5B 4S2OA 3KSFA 4X56A 4KG2A 2J7VA 3AGFA 5GHYA 4H6JB 2KX6A 3CWFA 3MZFA 4X1LA 3MS6A 4CLCD 2V8CA 1MKIA 3HL9A 2ZL1A 1OTIA 3UB5P 4H8RA 1XX2A 3IS2A 5LBRA 4O0PA 3ZDJA 3N6IA 4NXFA 5GLAA 1W8YA 4HJ3A 4E3KA 2P74A 5EM1A 3F1OA 3WS0A 3LR0A 2X01A 4IUHA 2FZ0A 2A2LA 4ZTKA 1BZAA 5GL9A 2H28A 1ZG4A 3BLMA 2EX8A 4DDSA 1K4FA 2Y2IA 2Q9NA 4E3NA 1ACFA 4PHTA 2XSSA 1XFQA 1CK3A 3DTKA 5CEBA 5DTKA 5A92A 5HAPA 3RH8B 2IWDA 2P9VA 3VFHA 1STZA 1K54C 1CI8A 3TE8A 4RVAA 3E4PA 2L1MA 2PBDP 2JKRI 3BWLA 4EWFA 4WF0A 5GHXA 4WZ5A 3EQVA 4BBUA 1LL5A 3BEBA 1W8QA 1T1BA 4E6XA 1JWVA 2WGWA 3NOPC 3Q82A 4AFIA 4KZ6A 2YKHA 1NZUA 4GS9B 3TSGA 4BD0A 1YKDA 3W4PA 3FV7A 3ZNYA 3RTYA 3NOUC 3PBNA 4ETXA 3ZG8B 3W4OA 1NXYA 1XJ2A 3UE6A 4OQGA 4IHQA 2B02A 3T1RA 4O7DA 4P87A 4X55A 2DNSA 1H3QA 2CC1A 5EFWA 1XJ6A 2QPNA 4B93A 3F1PB 3HJIA 3RFBA 4KQOA 4WMCD 2Y59A 4UAAA 3U2AA 2OWHA 4PKYA 4ARZA 2QMIA 4R4RA 1XP4A 4S2NC 2EX9A 4QY6A 2R9WA 2QJ5A 3EGXC 1T18A 4GNUA 5CHMA 4X69A 3T4TA 2PD7A 2V1ZA 4QB8A 1PWDA 4DXCA 4OQ0A 3W4QA 2D02A 1T19A 4LCMA 1S4RA 5CHJA 1MPLA 2H0TA 1CF0A 4O8GA 2V8FA 1UWNX 2WKQA 1XA1A 5EM0A 3SH7A 3LR5A 1T1AA 2JKGA 1SKFA 3GECA 4PKYG 5GLBA 1W63M 4WYYA 4UQIS 4C6YA 1KOUA 3G32A 2ZD8A 3CUEC 3KO6A 4ETZA 5DTTA 3M2KA 3RJUA 5HD3A 2VEAA 3MR0A 1FCOA 4X53A 3UB7A 3VFFA 2W1RA 1GHIA 2XD5A 3WRTA 1JTGA 3KSGA 1FIKA 3V50A 4GCZA 1SKOA 1OTDA 3PR6A 3VP4A 3NDGA 3T1QB 3CMZA 5M19A 1EWZA 3S22A 5CX7A 5G4YA 1MXOA 3IXDA 3LEQA 4P0MA 2ZOHA 1MZUA 1CI9A 3ZG0A 1SCWA 4L9GA 2I72A 3PBSA 2FFYA 2W3GA 2ZL1B 5EVIA 4I3IA 3BY9A 1YM1A 4KG5A 3F1OB 4OOMA 4ESPA 4XXRA 5G18A 5L09A 2J3WA 3EGDC 4EU0A 4G3WA 4OQIA 3D3OA 4U0XA 4WEJA 1QMFA 1FQGA 2X71A 1YPRA 5L2FA 5HWVA 4BL3A 3M6HA 2HJEA 3ZG5A 2OAP1 1ES4A 3CI6A 3DBAA 2P9VB 4DJ3A 3IBRA 3EEHA 3NI9A 1K57C 1LI0A 2K2NA 3PBQA 1YQSA 1ZHHB 1JNUA 2XR0A 5DKKA 1LHYA 3IF6C 3HLCA 4PM8A 4OPZA 4EQIA 4IBXA 1S1YA 2IWBA 1K56A 2VK3A 4L0LA 2QZ6A 5E2EA 3LO7A 5KIZA 1L3LA 4P6BA 2P04A 1BSGA 3NOTC 4R3AA 2JKTM 1W79A 1NLZA 4E3IA 3LFVA 3DTIA 5GLDA 1SDEA 4HBUA 3O87A 2INWA 2HP5A 4UA7A 5HAQA 1I2WA 2ZQ7A 4U3TA 3QP8A 2DMWA 3O88A 4GW9A 3E2LA 3HUOA 3AGDA 4HI4A 3KX0X 4DMZA 4KUKA 3K2NA 5TBMB 4Y0OA 3VP1A 4B9OA 2D01A 1ERMA 1OJGA 1ESIA 3G34A 3PXPA 2PU2A 3LI9A 5F1FA 2OSUA 3KSIA 3T4OA 5DJUA 3B47A 3T4KA 3VMAA 1JWPA 5AVEA 3M2JA 3G2YA 5HPIA 4BQMA 1MKMA 1N9BA 2GZAA 3ITBA 3NC8A 3W2ZA 4DE2A 3SH9A 3IT9A 4BWIA 1AWIA 2KOIA 5TGFA 5FQMA 1ZKJA 4FH2A 5FEFA 4WM9A 4EEUA 4HOIA 3LY4A 4LV2A 1YLTA 1PZOA 5HDCA 1SZVA 2VX8A 3LEZA 1OTBA 1XJ3A 1BLCA 2Y2NA 4QJGA 3C7UA 2UV0E 5HDSA 5FI6A 1WE4A 5EV0A 3ZNTA 3LYXA 4BLMA 3A3EA 3IQAA 1E4DA 4YWZA 4NXEA 4PMAA 2WGVA 4DE1A 1K54A 3MSHA 5HL1A 4CLCC 3MKEA 2M1CA 2Y2JA 1L0GA 5J4EA 4S2LA 3MJQA 3UB8A 3F1NA 3HLWA 4JF4A 4YOFA 4XUZA 1SKOB 5F68A 3O5YA 1OT9A 1IKIA 2EX2A 4IBRA 3WS5A 4OP8A 2FH5A 1PYYA 4Z1WA 4ZBEA 4UHUA 4OH0A 1XA7A 2Y79A 4O01A 2WAFA 2LB9A 1LT0A 3VE3A 4RYEA 3HLDA 5KSHA 2WUQA 2OLVA 2PD8A 3TW8A 5U47A 1TD5A 3ZCZA 3JVUA 1GSVA 4DDYA 5TJJA 5F1GA 4LV0A 3IBJA 1HZOA 1ZTUA 5FDSA 1BLHA 3K3DA 2PHYA 3MFDA 5HFOA 1L2SA 3ICYA 2EFXA 4HP4A 3IXBA 4K08A 4PAUA 4GHIB 4UA9A 4N9LA 4S2NA 2VV7A 3BQ8A 2V1AA 4S2MA 3NIAA 5FI2A 4X1MA 4HHDA 3B3XA 4HJ4A 4FD8A 4OOLA 1GA9A 4D2OA 1A0KA 4NETA 2M7UA 1LSWA 5FDHA 2MJ6A 1YSQA 1VEUA 5A91A 1S66L 4KZ7A 3QHYA 3OOVA 3C4OA 1D06A 2WKEA 3L9KA 1IELA 5F83A 2Y2GA 1BYWA 1PW1A 3HREA 3A3DA 3R7WB 5EOEA 3SS4A 4XUXA 2PU4A 4IEDA 1Y28A 2EX6A 3VP2A 3CUEA 5J7EA 3LR4A 1IYSA 5F82A 2Z6DA 1I2SA 4CQHA 5BOHA 5AQ7A 3FZCA 5L10A 5FAPA 3A0VA 3P01A 5HZHA 1SDNA 4E3JA 5JYOA 1S4SA 5G4ZA 3BFGA 1IOUA 2ZM0A 1PNEA 4KENB 4MN7A 3SW1A 4WL9A 5CECA 4KZ9A 3G4PA 2QKPA 1BLSA 4Y17A 5FSRA 3OPHA 5D3OA 4Q8IA 1VB6A 5L8MA 1NYMA 2ZC6B 5FEGA 3FC7A 4YFMA 1K0KA 1CQAA 5E2FA 5JYPA 1FILA 2PT7A 1W63Q 4JF6A 5DJTA 1YMSA 1GSXA 5AQBA 1WA9A 4M3KA 5DVAA 1LLBA 5DKLA 1E3UD 4YINA 5IHVA 3OZHA 4I5SA 3PBOA 2XLNA 2GJ3A 4MN5A 3G30A 3O3VA 1BUEA 4S2IA 1CEFA 2ZM8A 2XH9A 3OC2A 2H10A 1OT6A 1GHMA 5EUAA 1NRJA 3B42A 1K57A 1TEMA 3BQAA 5CGWA 2G2UA 3T50A 4MDZA 3C8CA 4JXWA 3IF6A 4JPMA 1FR1A 4JF5A 3V3RA 4QWOA 1OTEA 4P6ZS 4DXBA 5KZHA 4NXGA 4OLGA 3A0SA 1CEGA 2Z6CA 3NJAA 1ONGA 3QP6A 2JN7A 3ZHHA 4Q0IA 4KQDA 2V2FF 4WUJA 1W7FA 2BG1A 1MWTA 1H5XA 3VE4A 1BTLA 3TJZC 5CRFA 2WZXA 4UEYA 3S4XA 4GN2A 1UWPX 1S67L 5FA7A 4NG2A 5HSQA 2XD1A 2Q0OA 3TOIA 1TS0A 3LUQA 4BENA 2VZWA 2VGLS 3V3SA 4C75A 1LL8A 4L9EA 1W5DA 1HTZA 4BJPA 1WYBA 3VP0A 5FQQA 4DN0A 3CPTB 4HBTA 1KVMA 4C3QA 3G35A 2W3EA 5L07A 3UMDA 1F9IA 5HW3A 3GV9A 4A5RA 5HL6A 4ZJ3A 1JWZA 1SHVA 4HH2A 4R1GA 1KGEA 1OPXA 5GHZA 1IYOA 2E8JA 4BD1A 3OCLA 5C5KA 3C30A 1VEUB 3QP2A 2EXAA 5F6AA 3V39A 1G6AA 4LRYC 2XFSA 4EEPA 4R23A 4JGRA 5AQ9A 2J80A 4DRTA 1P9WA 4K0XA 4L9FA 1KGFA 2VLGA 3BM6A 1D7EA 2B95A 4Y15A 3LIDA 4ZDXA 2ZJ9A 3UPOA 4BBVA 1IKGA 2UWXA 1XGIA 3NCKA 1G5UA 3E2KA 4K0WA 4CLCA 3QNCA 4EERA 5EVEA 2J9OA 3FPWA 1DJBA 4KG6A 1T1CA 2LB5A 3A0RA 3C38A 2HF6A 1FCNA 2B5RA 1K25A 3UMEA 1Q2PA 1K6RA 1AXBA 1RP5A 3TG9A 3IS2B 1G28A 4RX2A 2EFUA 2HV1A 2KDKA 4BMWA 1N9NA 2L4RA 5CTNA 1H8YA 4R38A 4KZ8A 3P09A 1ES2A 3TRCA 2G7UA 4OKPA 4ID4A 4XT2A 3JYIA 3I7JA 4LV1A 3FPVA 2PAVP 2A24A 1HD8A 4MMNA 2VGLM 4RA7A 4JXVA 3EOIA 4I3JA 1YLPA 4FUWA 2ZMFA 1PI5A 3DW0A 2XF3A 2JKTI 4JGQA 3C2WA 4Q0HA 2JC7A 3E4OA 1NYYA 2NUTC 1XGJA 3MXSA 4HQAA 3ULFA 3G31A 3N8SA 4RX3A 2WGWB 1ZG6A 5E2GA 4UQIM 3ZG7B 3UY6A 3IWIA 4KQRA 2GX5A 4F3LA 2BASA 4S2JA 4LLOB 2Z2LB 1DP8A 3IX3A 3DTEA 3GDIA 5HAIA 5CGSA 3LIFA 2FFFB 1YMXA 1IYQA 2O99A 1EROA 4QHCA 3IF6B 2JHEA 4Q0JA 3JPUA 2EXBA 3OCNA 1RGYA 2QYBA 3H7WA 2L0WA 3Q7VA 2B18A 4Y13A 1FSWA 3CAXA 2RL3A 3QNBA 3SS5A 2YKFA 2AVXA 1NLYA 1Q2QA 5CXWA 4EETB 1F98A 1P97A 3HCYA 1DJCA 4ARZB 3UO9A 4R3JA 4WZ4A 4JKTA 3D9YA 1YLWA 2BLSA 4QPRA 1YLYA 2HDQA 5IU1A 1GCEA 4LV3A 2V0UA 2ZBBA 4EESA 5DF8A 3ZQ5A 3BLSA 5EPHA 1BLPA 3MQOA 3W8KA 3Q1FA 5EOOA 5FI7A 3MXRA 3MQQA 1M6KA 1VQQA 5IT5A 3MBZA 4GOGA 2XGNA 3RXWA 3LI8A 1RGZA 2O0YA 2ZQCA 3S7QA 1P0ZA 3A3IA 2Y2QA 4OPQA 4N92A 3FYZA 2QJ7A 4PM6A 4GDBA 1M40A 3EEAA 3EQUA 4I38A 4KZ5A 4OPRA 3HBRA 3L7HA 1GSWA 1KE0A 4EW7A 4Y3IA 3DTMA 3G6OA 3HLFA 3LIAA 4GS9A 1YT4A 4WBGA 3Q07A 3S1YA 2V0WA 1MWUA 1JTDA 5FL3A 2ZC7A 4PM7A 2WYXA 4EBNA 4LPZA 3D4FA 4DKIA 3RXXA 3BW6A 3CLOA 5K5BA 4ZJ1A 1J9MA 1S6RA 1XJ4A 4FH4A 2HP9A 3BECA 4ZAMA 4MNRA 3BJNA 3C4PA 4EQ1A 3UDFA 4NEED 1TDLA 2R78A 3F1PA 5EVIB 1YLZA 5F5YA 1TS8A 3T4JA 1U60A 3C5AA 1K55C 1VETA 3SOIA 2P7JA 5A90A 3N8LA 4DE3A 4XT2B 1DJAA 5CHUA 3SS3A 2J3TD 1K38A 3IF5A 2A24B 3FKWA 5FQKA 4HNBA 4FOFA 1N9OA 5HD5A 3ZYTA 1IFQA 1PFLA 2W3DA 3UNWA 3WWXA 4EUZA 1DRMA 3IXGA 2NUPC 4U0TA 3UN7A 4N1HA 2CMNA 1WYCA 1IEMA 1YAXA 4X25A 3UE1A 5AJGA 2VV6A 3VSLA 2WZZA 2JBFA 3R4KA 4MEZA 4HJ6A 1NJ4A 1I5QA 4HP9A 5FAOA 3S7NA 2IWCA 3IHAA 1PW8A 4GB7A 4HIAA 4F3LB 4S2PA 4JBFA 1C3BA 4QY5A 1ONHA 2GNXA 4LGWA 2V9AA 3A3FA 1MWSA 3S7OA 3GQZA 3PBTA 3OBFA 3G2ZA 5CTMA 1ODVA 4WELA 1CJFA 5TR7A 3H7WB 4IVIA 2HZ5A 1S1ZA 3EWKA 4FTXA 1GHPA 5DF7A 1Z6FA 5FAQA 4GKUA 5TFQA 2ZQ9A 5HWTA 4B88A 1O07A 2A49A 1G68A 2HPBA 1ESUA 4HH3A 2O9CA 3P98A 3Q81A 1XPBA 5E2HA 2HJ9C 3CITA 1LL9A 1ZC2A 4D60A 3E98A 3H82A 2Y2HA 5EVID 2DCFA 4Y2FA 3VP3A 2QWSA 1PWGA 4II7A 3SZTA 2VGKA 5M1AA 3B33A 2C6WB 3T1SA 1LSVA 1VHMA 4HY8A 2P08A 1PWCA 2Y4AA 2JE5A 3MZEA 4FSFA 3O86A 4E3MA 2PBYA 4IJGA 4IVKA 1UGUA 4MN6A 2XQZA 2ZC3B 1TVFA 3D72A 2DRWA 3LCEA 4GDNA 3FKVA 5FASA 2ZLYA 5FATA 2EA9A 4G3VA 4I39A 4RQ9A 3HLGA 5EECA 3PBRA 5I5LA 1Y4OA 3IX4A 1N4OA 3P7NA 2K31A 4JLFA 3F1NB 4OONA 2WK0A 2RCXA 2H5SA 4OOYA 1K56D 3UDXA 3MF0A 4Y7PA 4BBTA 3UE3A 2G2WA 3ZVWA 1ES3A 2Y2PA 4YNRA 3LICA 1KVLA 1NRFA 3NDEA 2JKRM 5I94A 3QP5A 4MBHA 1DP6A 4E3LA 3GRJA 2WKIA 2ZMVA 3A3JA 3IWOA 2OOLA 1BULA 2PDRA 1VETB 5A93A 5J8XA 3BYDA 3LIBA 2PR5A 4I3AA 4JXGA 5TBMA 1PRQA 4KZ3A 1KDWA 4QD4A 2W0NA 3VOYA 3PAGA 4LRZE 3MFXA 2V1BA 2VGJA 2WKRA 2HP6A 4OLDA 1RCJA 3NECA 3FWLA 4M4XA 3VSKA 4MBFA 1ALQA 2XA7S 5FQIA 3UPNA 3V5MA 1L0EA 5EVLA 4LCLA 3UB9A 1FCMA
chains in the Genus database with same CATH topology
3LIFA 2FZ0A 2A2LA 2Y79A 4O01A 2O99A 2LB9A 1LT0A 2HGVA 3VE3A 2H28A 1OTAA 4MCWA 3MMHA 2JHEA 4Q0JA 5KSHA 3OCNA 3T4QA 4PHTA 2XSSA 2QYBA 1XFQA 2PD8A 3H7WA 3TW8A 2L0WA 1TD5A 2B18A 4GJ4A 3CAXA 3JVUA 1GSVA 5TJJA 3RH8B 3S7PA 2YKFA 1STZA 3IBJA 3TE8A 1NLYA 1ZTUA 2W1TA 3E4PA 4JGPA 4EETB 2L1MA 2IA2A 1F98A 2JKRI 3K3DA 2OWJA 2PHYA 3BWLA 1P97A 4WF0A 2VJWA 2ZOIA 3HCYA 3EQVA 4BBUA 3ICYA 4ARZB 4HP4A 4Y5FA 4P6ZM 1T1BA 4K08A 4PAUA 3NOPC 4QPRA 4GHIB 4AFIA 4EUVA 2YKHA 5IU1A 3OLOA 2VV7A 4GS9B 2PYPA 3BQ8A 2V1AA 1YKDA 2V0UA 2ZBBA 4EESA 3RTYA 3ZQ5A 3T4SA 3NOUC 3PBNA 4HHDA 4HJ4A 4OOLA 4ETXA 3MQOA 1XJ2A 4DJ2A 2W27A 3UE6A 5HDDA 2W3FA 2M7UA 3MQQA 1LSWA 4IHQA 2B02A 2MJ6A 1V9ZA 1YSQA 3LIEA 4GLQA 3VV4A 5IT5A 1N9LA 1S66L 3LI8A 5A8BA 3OOVA 1D06A 2O0YA 1H3QA 2M7VA 3S7QA 5EFWA 1XJ6A 4B93A 5MC7A 3HJKA 1BYWA 3H82B 3F1PB 3HJIA 1P0ZA 3RFBA 2I9VA 4KQOA 3R7WB 2QJ7A 1Y28A 3CUEA 5J7EA 3U2AA 3LR4A 3PHYA 3EEAA 3EQUA 2OWHA 4I38A 4PKYA 4ARZA 3MXQA 2VKSA 1GSWA 2Z6DA 2O9AA 4Y3IA 4EW7A 4CQHA 4GHIA 2EWVA 2VA0A 3A0VA 3G6OA 3P01A 5HZHA 2XA7M 5HWWA 3LIAA 4GS9A 2V0WA 2QJ5A 3EGXC 1T18A 1S4SA 5FL3A 5G4ZA 1OJ5A 1TS7A 3T4TA 2PD7A 1IOUA 3V67A 4MN7A 4LPZA 3SW1A 4WL9A 2QKPA 4JGOA 3BW6A 3CLOA 5K5BA 2D02A 1T19A 3LR3A 1S4RA 1VB6A 3FG8A 5L8MA 1XJ4A 3FC7A 1G6OA 1TS6A 3BJNA 4O8GA 4EQ1A 5J3WA 1UWNX 2WKQA 4NEED 2R78A 1P9RA 1NWZA 3F1PA 3LR5A 3R7WA 5F5YA 1T1AA 1TS8A 2PT7A 3GECA 3T4JA 1W63Q 4PKYG 1W63M 5DJTA 4UQIS 1KOUA 2P7JA 1GSXA 1WA9A 2QHKA 3CUEC 3KO6A 4ETZA 3PYPA 2J3TC 5DKLA 4XT2B 4I5SA 3PBOA 5HD3A 2J3TD 2GJ3A 2VEAA 3MR0A 3UB7A 4H6JA 2W1RA 2A24B 4R70A 4E04A 4MN5A 3KSGA 4HNBA 4FOFA 5DFXA 1N9OA 5HD5A 1H8MA 2O9BA 3ZYTA 4GCZA 1IFQA 4G3KA 1OTDA 3OC2A 3PR6A 3KYZA 5DFYA 2W3DA 1OT6A 1DRMA 2NUPC 1NRJA 5CX7A 5G4YA 3B42A 2CMNA 3BQAA 3T50A 4MDZA 1YAXA 5AJGA 2VV6A 2ZOHA 3C8CA 1MZUA 3R4KA 4IUKA 4HJ6A 4LRXC 2W3HA 2XRNA 4HP9A 4L9GA 4WEKA 3PBSA 3S7NA 2OAQ1 2W3GA 1OTEA 4P6ZS 4HIAA 4I3IA 4F3LB 4NXGA 3A0SA 3BY9A 4WN5A 2Z6CA 3NHQA 3NJAA 3F1OB 3K3CA 4NXBA 4OOMA 2JN7A 2GNXA 4Q0IA 4KQDA 2J3WA 2V9AA 3EGDC 4EU0A 4G3WA 4WUJA 3D3OA 1LSXA 4WEJA 1EW0A 3S7OA 3PBTA 3OBFA 1TF1A 3VE4A 1ODVA 3TJZC 4WELA 5HWVA 3H7WB 2XROA 3JVVA 2HJEA 4UEYA 3KYQA 1UWPX 2OAP1 1S67L 1S1ZA 3EWKA 5HSQA 3CI6A 3DBAA 4DJ3A 1TS0A 3LUQA 3IBRA 3EEHA 1MC0A 2VZWA 5AVFA 2W1TB 2VGLS 5HWTA 2K2NA 3PBQA 1ZHHB 1JNUA 1LL8A 4L9EA 5DKKA 4BJPA 4HH3A 4NKPA 2O9CA 4CLCB 4DN0A 3MQ0A 2EWWA 2K7SA 1S1YA 4ME4A 2HJ9C 4ZRRA 4L0LA 2W3EA 3CITA 2VV8A 3UMDA 3E98A 3H82A 1F9IA 5KIZA 5HL6A 5HPFA 4Y2FA 2P04A 3NOTC 2QWSA 4R3AA 2JKTM 4HH2A 1OPXA 4II7A 1NLZA 1X0OA 3LFVA 4EXOA 5F69A 3B33A 1YSPA 3OCLA 5C5KA 1LSVA 1VHMA 1DP9A 3C30A 2P08A 4HY8A 2INWA 5F6AA 4WLAA 4FSFA 4LRYC 2DMWA 4GW9A 4IJGA 4EEPA 4JGRA 1UGUA 4MN6A 2J80A 2WKPA 1P9WA 4L9FA 4HI4A 3KX0X 4DMZA 2VLGA 3D72A 4KUKA 1D7EA 3K2NA 3VOLA 3LIDA 4BBVA 3H9WA 5TBMB 2EA9A 4G3VA 4I39A 4RQ9A 4B9OA 2D01A 1OJGA 3PBRA 3PXPA 5I5LA 3LI9A 4CLCA 3KSIA 4EERA 3T4OA 3FPWA 5DJUA 3UB6A 3E4QA 3B47A 3P7NA 1T1CA 2K31A 3T4KA 2LB5A 3F1NB 3BY8A 3A0RA 3C38A 1V9YA 2HF6A 5AVEA 2KLIA 5HPIA 3UMEA 4CLCE 2Y8HA 1MKMA 2GZAA 3MF0A 3W2ZA 3IS2B 4BBTA 4BWIA 3UE3A 1G28A 2KOIA 3E0YA 5IS1A 2HV1A 2KDKA 3LICA 4YNRA 4BMWA 1N9NA 2L4RA 2PYRA 2JKRM 4EEUA 4R38A 4R6LA 3TRCA 4HOIA 1DP6A 2G7UA 4XT2A 5DF9A 5HDCA 3FPVA 2VX8A 1OTBA 1XJ3A 2ZMVA 3KSHA 1XFNA 2A24A 3T4LA 1F5MA 5HDSA 4MMNA 2VGLM 2PR6A 2OOLA 2PDRA 3EOIA 3LYXA 4I3JA 3LIBA 2PR5A 4I3AA 4YWZA 2ZMFA 4KUOA 5TBMA 4NXEA 4JGQA 2JKTI 3KSFA 3C2WA 2W0NA 4CLCC 4Q0HA 2M1CA 3E4OA 2NUTC 5J4EA 4H6JB 2KX6A 4LRZE 3MFXA 4HQAA 3MJQA 3ULFA 3CWFA 2V1BA 3UB8A 3F1NA 4CLCD 4UQIM 2WKRA 4YOFA 5F68A 1OTIA 4M4XA 2GX5A 3IS2A 5LBRA 3O5YA 4O0PA 1OT9A 4NXFA 4F3LA 4HJ3A 2BASA 4LLOB 2XA7S 1DP8A 2FH5A 3GDIA 3UB9A 3F1OA 4Z1WA 3LR0A 4IUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TJZ C;  4P6Z S;  2VGL M;  2XA7 M;  5MC7 A;  1NRJ A;  2JKR I;  4UQI M;  2JKR M;  4NEE D;  4P6Z M;  2JKT I;  2VGL S;  2XA7 S;  1W63 Q;  2FH5 A;  1W63 M;  4UQI S;  2HF6 A;  2JKT M; 
#chains in the Genus database with same CATH topology
 5GLC A;  4UA6 A;  2HDR A;  2HGV A;  3UE0 A;  1OTA A;  4MCW A;  4R4S A;  3MMH A;  3WS4 A;  1F2K A;  3T4Q A;  2XK1 A;  5FQJ A;  1D1J A;  4GJ4 A;  4P85 A;  3N4I A;  3ISG A;  2V20 A;  3HVF A;  1XXM A;  3S7P A;  3CZD A;  4JGP A;  2W1T A;  1MWR A;  2IA2 A;  2OWJ A;  2J8Y A;  4ZJ2 A;  2VJW A;  3SH8 A;  2ZOI A;  4GD6 A;  3QP4 A;  1JVJ A;  4Y5F A;  4P6Z M;  3WRZ A;  3HUM A;  4EUV A;  2H0Y A;  3OLO A;  4MBK A;  5CER A;  4R0Q A;  2PYP A;  5DTS A;  1K4E A;  2Y2O A;  3T4S A;  3CG5 A;  3KYE A;  4DJ2 A;  2W27 A;  5HDD A;  3U4L P;  2W3F A;  1MY8 A;  1V9Z A;  3LIE A;  1LI9 A;  4GLQ A;  3VV4 A;  4Z9Q A;  1N9L A;  3DAV A;  3OPR A;  5A8B A;  3T12 B;  3PAE A;  3C7V A;  3AGE A;  2R9X A;  2Y91 A;  2M7V A;  3NUL A;  4X6T A;  5HAR A;  2Y2M A;  5MC7 A;  3HJK A;  3H82 B;  4FCF A;  2I9V A;  1E3U A;  4B4Z A;  3ZFZ A;  4B4X A;  1K55 A;  3WS1 A;  3WS2 A;  3ZG9 B;  2C5W B;  4WZ5 C;  3PHY A;  1FSY A;  2ZC4 B;  3MXQ A;  2VKS A;  3ZVT A;  2O9A A;  4GHI A;  2EWV A;  2VA0 A;  4JXS A;  1K6S A;  2XA7 M;  3ITA A;  5HWW A;  4X68 A;  4K91 A;  3GMW A;  1OJ5 A;  1TS7 A;  3VOZ A;  1J3W A;  2Y2K A;  3V67 A;  3OPL A;  4R3B A;  4S2K A;  4EBL A;  2WAD A;  4JGO A;  3LR3 A;  1GA0 A;  3FG8 A;  2HDS A;  3UPP A;  3HUN A;  1G6O A;  1TS6 A;  5J3W A;  3UDI A;  1P9R A;  1NWZ A;  3BRM A;  1NY0 A;  4WMC A;  2JCH A;  1HVB A;  3R7W A;  3LGO A;  2J9P A;  4HES A;  3IH9 A;  5KMW A;  1FR6 A;  3MZD A;  2WAE A;  1DY6 A;  5HX9 A;  2QHK A;  1H8Z A;  3PYP A;  2J3T C;  4KZ4 A;  2ZMA A;  1KGG A;  3HLE A;  4LEN A;  2ZQ8 A;  4H6J A;  4N1X A;  4R70 A;  3Q7Z A;  2E8I A;  4E04 A;  5DFX A;  3N8R A;  1H8M A;  2O9B A;  3DWK A;  5CED A;  3QP1 A;  4G3K A;  5DFY A;  3KYZ A;  1L0F A;  3MKF A;  1NZO A;  3M6B A;  1PZP A;  1HLU P;  3BFF A;  4IUK A;  2OLU A;  2WGI A;  2JKF A;  4LRX C;  2W3H A;  4KQQ A;  2XRN A;  2BTF P;  1H0M A;  1ERQ A;  4WEK A;  3BFE A;  2OAQ 1;  5CGX A;  5AQA A;  4MLL A;  3IWQ A;  1TDG A;  5KSC A;  3GVB A;  1BT5 A;  4WN5 A;  3ZGA B;  3NHQ A;  3GTC A;  1MBL A;  1ES5 A;  3K3C A;  4NXB A;  5E43 A;  1E25 A;  2WKH A;  3OPP A;  4BL2 A;  1Z09 A;  1LSX A;  1EW0 A;  4F94 A;  1TF1 A;  2XFT A;  4EV4 A;  4CPK A;  4GZB A;  2GDN A;  1Y54 A;  2XRO A;  3JVV A;  3KYQ A;  1OME A;  4OVD A;  3IH8 A;  2OV5 A;  4QU3 A;  4EBP A;  4E3O A;  1MC0 A;  5AVF A;  2W1T B;  5FQ9 A;  2XEP A;  4KZA A;  4DF6 A;  3LY3 A;  4NKP A;  3HLB A;  4CLC B;  1KE4 A;  4E6W A;  3MQ0 A;  2EWW A;  2K7S A;  3T1X A;  1IYP A;  4ME4 A;  5EVI C;  4ZRR A;  4Y0U A;  1O7E A;  3NY4 A;  2VV8 A;  2Y55 A;  1PIO A;  5HPF A;  3GSG A;  1X0O A;  2XDM A;  4EXO A;  5F69 A;  1YSP A;  2Q9M A;  1DP9 A;  1PI4 A;  3GR2 A;  4WLA A;  4GD8 A;  1QME A;  1L0D A;  3CJM A;  4Y0T A;  4OPY A;  3DWZ A;  2WKP A;  1XKZ A;  4DE0 A;  3VOL A;  5M18 A;  1VM1 A;  3H9W A;  3CHW P;  2A3U A;  3PTE A;  2X02 A;  1KDS A;  3CPT A;  3UB6 A;  4N9K A;  3E4Q A;  2HDU A;  3BFD A;  1YLJ A;  3BY8 A;  1V9Y A;  2KLI A;  4OQH A;  2ZM2 A;  3BFC A;  4CLC E;  2Y8H A;  2ZQA A;  4PM5 A;  3E0Y A;  5IS1 A;  1EI5 A;  3NBL A;  4HEF A;  1KE3 A;  1S0W A;  2PYR A;  4R6L A;  4LFU A;  2Y2L A;  4PPR A;  2ACG A;  3IX8 A;  4NK3 A;  3IHB A;  4KZB A;  5DF9 A;  2ZQD A;  3KSH A;  1XFN A;  3T4L A;  1F5M A;  3N7W A;  4CJN A;  2PR6 A;  4OP5 A;  3IXH A;  3Q7V B;  2PRF A;  4PM9 A;  2Z2M B;  1FOF A;  4KUO A;  5EE8 A;  2ZC5 B;  4S2O A;  3KSF A;  4X56 A;  4KG2 A;  2J7V A;  3AGF A;  5GHY A;  4H6J B;  2KX6 A;  3CWF A;  3MZF A;  4X1L A;  3MS6 A;  4CLC D;  2V8C A;  1MKI A;  3HL9 A;  2ZL1 A;  1OTI A;  3UB5 P;  4H8R A;  1XX2 A;  3IS2 A;  5LBR A;  4O0P A;  3ZDJ A;  3N6I A;  4NXF A;  5GLA A;  1W8Y A;  4HJ3 A;  4E3K A;  2P74 A;  5EM1 A;  3F1O A;  3WS0 A;  3LR0 A;  2X01 A;  4IUH A;  2FZ0 A;  2A2L A;  4ZTK A;  1BZA A;  5GL9 A;  2H28 A;  1ZG4 A;  3BLM A;  2EX8 A;  4DDS A;  1K4F A;  2Y2I A;  2Q9N A;  4E3N A;  1ACF A;  4PHT A;  2XSS A;  1XFQ A;  1CK3 A;  3DTK A;  5CEB A;  5DTK A;  5A92 A;  5HAP A;  3RH8 B;  2IWD A;  2P9V A;  3VFH A;  1STZ A;  1K54 C;  1CI8 A;  3TE8 A;  4RVA A;  3E4P A;  2L1M A;  2PBD P;  2JKR I;  3BWL A;  4EWF A;  4WF0 A;  5GHX A;  4WZ5 A;  3EQV A;  4BBU A;  1LL5 A;  3BEB A;  1W8Q A;  1T1B A;  4E6X A;  1JWV A;  2WGW A;  3NOP C;  3Q82 A;  4AFI A;  4KZ6 A;  2YKH A;  1NZU A;  4GS9 B;  3TSG A;  4BD0 A;  1YKD A;  3W4P A;  3FV7 A;  3ZNY A;  3RTY A;  3NOU C;  3PBN A;  4ETX A;  3ZG8 B;  3W4O A;  1NXY A;  1XJ2 A;  3UE6 A;  4OQG A;  4IHQ A;  2B02 A;  3T1R A;  4O7D A;  4P87 A;  4X55 A;  2DNS A;  1H3Q A;  2CC1 A;  5EFW A;  1XJ6 A;  2QPN A;  4B93 A;  3F1P B;  3HJI A;  3RFB A;  4KQO A;  4WMC D;  2Y59 A;  4UAA A;  3U2A A;  2OWH A;  4PKY A;  4ARZ A;  2QMI A;  4R4R A;  1XP4 A;  4S2N C;  2EX9 A;  4QY6 A;  2R9W A;  2QJ5 A;  3EGX C;  1T18 A;  4GNU A;  5CHM A;  4X69 A;  3T4T A;  2PD7 A;  2V1Z A;  4QB8 A;  1PWD A;  4DXC A;  4OQ0 A;  3W4Q A;  2D02 A;  1T19 A;  4LCM A;  1S4R A;  5CHJ A;  1MPL A;  2H0T A;  1CF0 A;  4O8G A;  2V8F A;  1UWN X;  2WKQ A;  1XA1 A;  5EM0 A;  3SH7 A;  3LR5 A;  1T1A A;  2JKG A;  1SKF A;  3GEC A;  4PKY G;  5GLB A;  1W63 M;  4WYY A;  4UQI S;  4C6Y A;  1KOU A;  3G32 A;  2ZD8 A;  3CUE C;  3KO6 A;  4ETZ A;  5DTT A;  3M2K A;  3RJU A;  5HD3 A;  2VEA A;  3MR0 A;  1FCO A;  4X53 A;  3UB7 A;  3VFF A;  2W1R A;  1GHI A;  2XD5 A;  3WRT A;  1JTG A;  3KSG A;  1FIK A;  3V50 A;  4GCZ A;  1SKO A;  1OTD A;  3PR6 A;  3VP4 A;  3NDG A;  3T1Q B;  3CMZ A;  5M19 A;  1EWZ A;  3S22 A;  5CX7 A;  5G4Y A;  1MXO A;  3IXD A;  3LEQ A;  4P0M A;  2ZOH A;  1MZU A;  1CI9 A;  3ZG0 A;  1SCW A;  4L9G A;  2I72 A;  3PBS A;  2FFY A;  2W3G A;  2ZL1 B;  5EVI A;  4I3I A;  3BY9 A;  1YM1 A;  4KG5 A;  3F1O B;  4OOM A;  4ESP A;  4XXR A;  5G18 A;  5L09 A;  2J3W A;  3EGD C;  4EU0 A;  4G3W A;  4OQI A;  3D3O A;  4U0X A;  4WEJ A;  1QMF A;  1FQG A;  2X71 A;  1YPR A;  5L2F A;  5HWV A;  4BL3 A;  3M6H A;  2HJE A;  3ZG5 A;  2OAP 1;  1ES4 A;  3CI6 A;  3DBA A;  2P9V B;  4DJ3 A;  3IBR A;  3EEH A;  3NI9 A;  1K57 C;  1LI0 A;  2K2N A;  3PBQ A;  1YQS A;  1ZHH B;  1JNU A;  2XR0 A;  5DKK A;  1LHY A;  3IF6 C;  3HLC A;  4PM8 A;  4OPZ A;  4EQI A;  4IBX A;  1S1Y A;  2IWB A;  1K56 A;  2VK3 A;  4L0L A;  2QZ6 A;  5E2E A;  3LO7 A;  5KIZ A;  1L3L A;  4P6B A;  2P04 A;  1BSG A;  3NOT C;  4R3A A;  2JKT M;  1W79 A;  1NLZ A;  4E3I A;  3LFV A;  3DTI A;  5GLD A;  1SDE A;  4HBU A;  3O87 A;  2INW A;  2HP5 A;  4UA7 A;  5HAQ A;  1I2W A;  2ZQ7 A;  4U3T A;  3QP8 A;  2DMW A;  3O88 A;  4GW9 A;  3E2L A;  3HUO A;  3AGD A;  4HI4 A;  3KX0 X;  4DMZ A;  4KUK A;  3K2N A;  5TBM B;  4Y0O A;  3VP1 A;  4B9O A;  2D01 A;  1ERM A;  1OJG A;  1ESI A;  3G34 A;  3PXP A;  2PU2 A;  3LI9 A;  5F1F A;  2OSU A;  3KSI A;  3T4O A;  5DJU A;  3B47 A;  3T4K A;  3VMA A;  1JWP A;  5AVE A;  3M2J A;  3G2Y A;  5HPI A;  4BQM A;  1MKM A;  1N9B A;  2GZA A;  3ITB A;  3NC8 A;  3W2Z A;  4DE2 A;  3SH9 A;  3IT9 A;  4BWI A;  1AWI A;  2KOI A;  5TGF A;  5FQM A;  1ZKJ A;  4FH2 A;  5FEF A;  4WM9 A;  4EEU A;  4HOI A;  3LY4 A;  4LV2 A;  1YLT A;  1PZO A;  5HDC A;  1SZV A;  2VX8 A;  3LEZ A;  1OTB A;  1XJ3 A;  1BLC A;  2Y2N A;  4QJG A;  3C7U A;  2UV0 E;  5HDS A;  5FI6 A;  1WE4 A;  5EV0 A;  3ZNT A;  3LYX A;  4BLM A;  3A3E A;  3IQA A;  1E4D A;  4YWZ A;  4NXE A;  4PMA A;  2WGV A;  4DE1 A;  1K54 A;  3MSH A;  5HL1 A;  4CLC C;  3MKE A;  2M1C A;  2Y2J A;  1L0G A;  5J4E A;  4S2L A;  3MJQ A;  3UB8 A;  3F1N A;  3HLW A;  4JF4 A;  4YOF A;  4XUZ A;  1SKO B;  5F68 A;  3O5Y A;  1OT9 A;  1IKI A;  2EX2 A;  4IBR A;  3WS5 A;  4OP8 A;  2FH5 A;  1PYY A;  4Z1W A;  4ZBE A;  4UHU A;  4OH0 A;  1XA7 A;  2Y79 A;  4O01 A;  2WAF A;  2LB9 A;  1LT0 A;  3VE3 A;  4RYE A;  3HLD A;  5KSH A;  2WUQ A;  2OLV A;  2PD8 A;  3TW8 A;  5U47 A;  1TD5 A;  3ZCZ A;  3JVU A;  1GSV A;  4DDY A;  5TJJ A;  5F1G A;  4LV0 A;  3IBJ A;  1HZO A;  1ZTU A;  5FDS A;  1BLH A;  3K3D A;  2PHY A;  3MFD A;  5HFO A;  1L2S A;  3ICY A;  2EFX A;  4HP4 A;  3IXB A;  4K08 A;  4PAU A;  4GHI B;  4UA9 A;  4N9L A;  4S2N A;  2VV7 A;  3BQ8 A;  2V1A A;  4S2M A;  3NIA A;  5FI2 A;  4X1M A;  4HHD A;  3B3X A;  4HJ4 A;  4FD8 A;  4OOL A;  1GA9 A;  4D2O A;  1A0K A;  4NET A;  2M7U A;  1LSW A;  5FDH A;  2MJ6 A;  1YSQ A;  1VEU A;  5A91 A;  1S66 L;  4KZ7 A;  3QHY A;  3OOV A;  3C4O A;  1D06 A;  2WKE A;  3L9K A;  1IEL A;  5F83 A;  2Y2G A;  1BYW A;  1PW1 A;  3HRE A;  3A3D A;  3R7W B;  5EOE A;  3SS4 A;  4XUX A;  2PU4 A;  4IED A;  1Y28 A;  2EX6 A;  3VP2 A;  3CUE A;  5J7E A;  3LR4 A;  1IYS A;  5F82 A;  2Z6D A;  1I2S A;  4CQH A;  5BOH A;  5AQ7 A;  3FZC A;  5L10 A;  5FAP A;  3A0V A;  3P01 A;  5HZH A;  1SDN A;  4E3J A;  5JYO A;  1S4S A;  5G4Z A;  3BFG A;  1IOU A;  2ZM0 A;  1PNE A;  4KEN B;  4MN7 A;  3SW1 A;  4WL9 A;  5CEC A;  4KZ9 A;  3G4P A;  2QKP A;  1BLS A;  4Y17 A;  5FSR A;  3OPH A;  5D3O A;  4Q8I A;  1VB6 A;  5L8M A;  1NYM A;  2ZC6 B;  5FEG A;  3FC7 A;  4YFM A;  1K0K A;  1CQA A;  5E2F A;  5JYP A;  1FIL A;  2PT7 A;  1W63 Q;  4JF6 A;  5DJT A;  1YMS A;  1GSX A;  5AQB A;  1WA9 A;  4M3K A;  5DVA A;  1LLB A;  5DKL A;  1E3U D;  4YIN A;  5IHV A;  3OZH A;  4I5S A;  3PBO A;  2XLN A;  2GJ3 A;  4MN5 A;  3G30 A;  3O3V A;  1BUE A;  4S2I A;  1CEF A;  2ZM8 A;  2XH9 A;  3OC2 A;  2H10 A;  1OT6 A;  1GHM A;  5EUA A;  1NRJ A;  3B42 A;  1K57 A;  1TEM A;  3BQA A;  5CGW A;  2G2U A;  3T50 A;  4MDZ A;  3C8C A;  4JXW A;  3IF6 A;  4JPM A;  1FR1 A;  4JF5 A;  3V3R A;  4QWO A;  1OTE A;  4P6Z S;  4DXB A;  5KZH A;  4NXG A;  4OLG A;  3A0S A;  1CEG A;  2Z6C A;  3NJA A;  1ONG A;  3QP6 A;  2JN7 A;  3ZHH A;  4Q0I A;  4KQD A;  2V2F F;  4WUJ A;  1W7F A;  2BG1 A;  1MWT A;  1H5X A;  3VE4 A;  1BTL A;  3TJZ C;  5CRF A;  2WZX A;  4UEY A;  3S4X A;  4GN2 A;  1UWP X;  1S67 L;  5FA7 A;  4NG2 A;  5HSQ A;  2XD1 A;  2Q0O A;  3TOI A;  1TS0 A;  3LUQ A;  4BEN A;  2VZW A;  2VGL S;  3V3S A;  4C75 A;  1LL8 A;  4L9E A;  1W5D A;  1HTZ A;  4BJP A;  1WYB A;  3VP0 A;  5FQQ A;  4DN0 A;  3CPT B;  4HBT A;  1KVM A;  4C3Q A;  3G35 A;  2W3E A;  5L07 A;  3UMD A;  1F9I A;  5HW3 A;  3GV9 A;  4A5R A;  5HL6 A;  4ZJ3 A;  1JWZ A;  1SHV A;  4HH2 A;  4R1G A;  1KGE A;  1OPX A;  5GHZ A;  1IYO A;  2E8J A;  4BD1 A;  3OCL A;  5C5K A;  3C30 A;  1VEU B;  3QP2 A;  2EXA A;  5F6A A;  3V39 A;  1G6A A;  4LRY C;  2XFS A;  4EEP A;  4R23 A;  4JGR A;  5AQ9 A;  2J80 A;  4DRT A;  1P9W A;  4K0X A;  4L9F A;  1KGF A;  2VLG A;  3BM6 A;  1D7E A;  2B95 A;  4Y15 A;  3LID A;  4ZDX A;  2ZJ9 A;  3UPO A;  4BBV A;  1IKG A;  2UWX A;  1XGI A;  3NCK A;  1G5U A;  3E2K A;  4K0W A;  4CLC A;  3QNC A;  4EER A;  5EVE A;  2J9O A;  3FPW A;  1DJB A;  4KG6 A;  1T1C A;  2LB5 A;  3A0R A;  3C38 A;  2HF6 A;  1FCN A;  2B5R A;  1K25 A;  3UME A;  1Q2P A;  1K6R A;  1AXB A;  1RP5 A;  3TG9 A;  3IS2 B;  1G28 A;  4RX2 A;  2EFU A;  2HV1 A;  2KDK A;  4BMW A;  1N9N A;  2L4R A;  5CTN A;  1H8Y A;  4R38 A;  4KZ8 A;  3P09 A;  1ES2 A;  3TRC A;  2G7U A;  4OKP A;  4ID4 A;  4XT2 A;  3JYI A;  3I7J A;  4LV1 A;  3FPV A;  2PAV P;  2A24 A;  1HD8 A;  4MMN A;  2VGL M;  4RA7 A;  4JXV A;  3EOI A;  4I3J A;  1YLP A;  4FUW A;  2ZMF A;  1PI5 A;  3DW0 A;  2XF3 A;  2JKT I;  4JGQ A;  3C2W A;  4Q0H A;  2JC7 A;  3E4O A;  1NYY A;  2NUT C;  1XGJ A;  3MXS A;  4HQA A;  3ULF A;  3G31 A;  3N8S A;  4RX3 A;  2WGW B;  1ZG6 A;  5E2G A;  4UQI M;  3ZG7 B;  3UY6 A;  3IWI A;  4KQR A;  2GX5 A;  4F3L A;  2BAS A;  4S2J A;  4LLO B;  2Z2L B;  1DP8 A;  3IX3 A;  3DTE A;  3GDI A;  5HAI A;  5CGS A;  3LIF A;  2FFF B;  1YMX A;  1IYQ A;  2O99 A;  1ERO A;  4QHC A;  3IF6 B;  2JHE A;  4Q0J A;  3JPU A;  2EXB A;  3OCN A;  1RGY A;  2QYB A;  3H7W A;  2L0W A;  3Q7V A;  2B18 A;  4Y13 A;  1FSW A;  3CAX A;  2RL3 A;  3QNB A;  3SS5 A;  2YKF A;  2AVX A;  1NLY A;  1Q2Q A;  5CXW A;  4EET B;  1F98 A;  1P97 A;  3HCY A;  1DJC A;  4ARZ B;  3UO9 A;  4R3J A;  4WZ4 A;  4JKT A;  3D9Y A;  1YLW A;  2BLS A;  4QPR A;  1YLY A;  2HDQ A;  5IU1 A;  1GCE A;  4LV3 A;  2V0U A;  2ZBB A;  4EES A;  5DF8 A;  3ZQ5 A;  3BLS A;  5EPH A;  1BLP A;  3MQO A;  3W8K A;  3Q1F A;  5EOO A;  5FI7 A;  3MXR A;  3MQQ A;  1M6K A;  1VQQ A;  5IT5 A;  3MBZ A;  4GOG A;  2XGN A;  3RXW A;  3LI8 A;  1RGZ A;  2O0Y A;  2ZQC A;  3S7Q A;  1P0Z A;  3A3I A;  2Y2Q A;  4OPQ A;  4N92 A;  3FYZ A;  2QJ7 A;  4PM6 A;  4GDB A;  1M40 A;  3EEA A;  3EQU A;  4I38 A;  4KZ5 A;  4OPR A;  3HBR A;  3L7H A;  1GSW A;  1KE0 A;  4EW7 A;  4Y3I A;  3DTM A;  3G6O A;  3HLF A;  3LIA A;  4GS9 A;  1YT4 A;  4WBG A;  3Q07 A;  3S1Y A;  2V0W A;  1MWU A;  1JTD A;  5FL3 A;  2ZC7 A;  4PM7 A;  2WYX A;  4EBN A;  4LPZ A;  3D4F A;  4DKI A;  3RXX A;  3BW6 A;  3CLO A;  5K5B A;  4ZJ1 A;  1J9M A;  1S6R A;  1XJ4 A;  4FH4 A;  2HP9 A;  3BEC A;  4ZAM A;  4MNR A;  3BJN A;  3C4P A;  4EQ1 A;  3UDF A;  4NEE D;  1TDL A;  2R78 A;  3F1P A;  5EVI B;  1YLZ A;  5F5Y A;  1TS8 A;  3T4J A;  1U60 A;  3C5A A;  1K55 C;  1VET A;  3SOI A;  2P7J A;  5A90 A;  3N8L A;  4DE3 A;  4XT2 B;  1DJA A;  5CHU A;  3SS3 A;  2J3T D;  1K38 A;  3IF5 A;  2A24 B;  3FKW A;  5FQK A;  4HNB A;  4FOF A;  1N9O A;  5HD5 A;  3ZYT A;  1IFQ A;  1PFL A;  2W3D A;  3UNW A;  3WWX A;  4EUZ A;  1DRM A;  3IXG A;  2NUP C;  4U0T A;  3UN7 A;  4N1H A;  2CMN A;  1WYC A;  1IEM A;  1YAX A;  4X25 A;  3UE1 A;  5AJG A;  2VV6 A;  3VSL A;  2WZZ A;  2JBF A;  3R4K A;  4MEZ A;  4HJ6 A;  1NJ4 A;  1I5Q A;  4HP9 A;  5FAO A;  3S7N A;  2IWC A;  3IHA A;  1PW8 A;  4GB7 A;  4HIA A;  4F3L B;  4S2P A;  4JBF A;  1C3B A;  4QY5 A;  1ONH A;  2GNX A;  4LGW A;  2V9A A;  3A3F A;  1MWS A;  3S7O A;  3GQZ A;  3PBT A;  3OBF A;  3G2Z A;  5CTM A;  1ODV A;  4WEL A;  1CJF A;  5TR7 A;  3H7W B;  4IVI A;  2HZ5 A;  1S1Z A;  3EWK A;  4FTX A;  1GHP A;  5DF7 A;  1Z6F A;  5FAQ A;  4GKU A;  5TFQ A;  2ZQ9 A;  5HWT A;  4B88 A;  1O07 A;  2A49 A;  1G68 A;  2HPB A;  1ESU A;  4HH3 A;  2O9C A;  3P98 A;  3Q81 A;  1XPB A;  5E2H A;  2HJ9 C;  3CIT A;  1LL9 A;  1ZC2 A;  4D60 A;  3E98 A;  3H82 A;  2Y2H A;  5EVI D;  2DCF A;  4Y2F A;  3VP3 A;  2QWS A;  1PWG A;  4II7 A;  3SZT A;  2VGK A;  5M1A A;  3B33 A;  2C6W B;  3T1S A;  1LSV A;  1VHM A;  4HY8 A;  2P08 A;  1PWC A;  2Y4A A;  2JE5 A;  3MZE A;  4FSF A;  3O86 A;  4E3M A;  2PBY A;  4IJG A;  4IVK A;  1UGU A;  4MN6 A;  2XQZ A;  2ZC3 B;  1TVF A;  3D72 A;  2DRW A;  3LCE A;  4GDN A;  3FKV A;  5FAS A;  2ZLY A;  5FAT A;  2EA9 A;  4G3V A;  4I39 A;  4RQ9 A;  3HLG A;  5EEC A;  3PBR A;  5I5L A;  1Y4O A;  3IX4 A;  1N4O A;  3P7N A;  2K31 A;  4JLF A;  3F1N B;  4OON A;  2WK0 A;  2RCX A;  2H5S A;  4OOY A;  1K56 D;  3UDX A;  3MF0 A;  4Y7P A;  4BBT A;  3UE3 A;  2G2W A;  3ZVW A;  1ES3 A;  2Y2P A;  4YNR A;  3LIC A;  1KVL A;  1NRF A;  3NDE A;  2JKR M;  5I94 A;  3QP5 A;  4MBH A;  1DP6 A;  4E3L A;  3GRJ A;  2WKI A;  2ZMV A;  3A3J A;  3IWO A;  2OOL A;  1BUL A;  2PDR A;  1VET B;  5A93 A;  5J8X A;  3BYD A;  3LIB A;  2PR5 A;  4I3A A;  4JXG A;  5TBM A;  1PRQ A;  4KZ3 A;  1KDW A;  4QD4 A;  2W0N A;  3VOY A;  3PAG A;  4LRZ E;  3MFX A;  2V1B A;  2VGJ A;  2WKR A;  2HP6 A;  4OLD A;  1RCJ A;  3NEC A;  3FWL A;  4M4X A;  3VSK A;  4MBF A;  1ALQ A;  2XA7 S;  5FQI A;  3UPN A;  3V5M A;  1L0E A;  5EVL A;  4LCL A;  3UB9 A;  1FCM A; 
#chains in the Genus database with same CATH homology
 3LIF A;  2FZ0 A;  2A2L A;  2Y79 A;  4O01 A;  2O99 A;  2LB9 A;  1LT0 A;  2HGV A;  3VE3 A;  2H28 A;  1OTA A;  4MCW A;  3MMH A;  2JHE A;  4Q0J A;  5KSH A;  3OCN A;  3T4Q A;  4PHT A;  2XSS A;  2QYB A;  1XFQ A;  2PD8 A;  3H7W A;  3TW8 A;  2L0W A;  1TD5 A;  2B18 A;  4GJ4 A;  3CAX A;  3JVU A;  1GSV A;  5TJJ A;  3RH8 B;  3S7P A;  2YKF A;  1STZ A;  3IBJ A;  3TE8 A;  1NLY A;  1ZTU A;  2W1T A;  3E4P A;  4JGP A;  4EET B;  2L1M A;  2IA2 A;  1F98 A;  2JKR I;  3K3D A;  2OWJ A;  2PHY A;  3BWL A;  1P97 A;  4WF0 A;  2VJW A;  2ZOI A;  3HCY A;  3EQV A;  4BBU A;  3ICY A;  4ARZ B;  4HP4 A;  4Y5F A;  4P6Z M;  1T1B A;  4K08 A;  4PAU A;  3NOP C;  4QPR A;  4GHI B;  4AFI A;  4EUV A;  2YKH A;  5IU1 A;  3OLO A;  2VV7 A;  4GS9 B;  2PYP A;  3BQ8 A;  2V1A A;  1YKD A;  2V0U A;  2ZBB A;  4EES A;  3RTY A;  3ZQ5 A;  3T4S A;  3NOU C;  3PBN A;  4HHD A;  4HJ4 A;  4OOL A;  4ETX A;  3MQO A;  1XJ2 A;  4DJ2 A;  2W27 A;  3UE6 A;  5HDD A;  2W3F A;  2M7U A;  3MQQ A;  1LSW A;  4IHQ A;  2B02 A;  2MJ6 A;  1V9Z A;  1YSQ A;  3LIE A;  4GLQ A;  3VV4 A;  5IT5 A;  1N9L A;  1S66 L;  3LI8 A;  5A8B A;  3OOV A;  1D06 A;  2O0Y A;  1H3Q A;  2M7V A;  3S7Q A;  5EFW A;  1XJ6 A;  4B93 A;  5MC7 A;  3HJK A;  1BYW A;  3H82 B;  3F1P B;  3HJI A;  1P0Z A;  3RFB A;  2I9V A;  4KQO A;  3R7W B;  2QJ7 A;  1Y28 A;  3CUE A;  5J7E A;  3U2A A;  3LR4 A;  3PHY A;  3EEA A;  3EQU A;  2OWH A;  4I38 A;  4PKY A;  4ARZ A;  3MXQ A;  2VKS A;  1GSW A;  2Z6D A;  2O9A A;  4Y3I A;  4EW7 A;  4CQH A;  4GHI A;  2EWV A;  2VA0 A;  3A0V A;  3G6O A;  3P01 A;  5HZH A;  2XA7 M;  5HWW A;  3LIA A;  4GS9 A;  2V0W A;  2QJ5 A;  3EGX C;  1T18 A;  1S4S A;  5FL3 A;  5G4Z A;  1OJ5 A;  1TS7 A;  3T4T A;  2PD7 A;  1IOU A;  3V67 A;  4MN7 A;  4LPZ A;  3SW1 A;  4WL9 A;  2QKP A;  4JGO A;  3BW6 A;  3CLO A;  5K5B A;  2D02 A;  1T19 A;  3LR3 A;  1S4R A;  1VB6 A;  3FG8 A;  5L8M A;  1XJ4 A;  3FC7 A;  1G6O A;  1TS6 A;  3BJN A;  4O8G A;  4EQ1 A;  5J3W A;  1UWN X;  2WKQ A;  4NEE D;  2R78 A;  1P9R A;  1NWZ A;  3F1P A;  3LR5 A;  3R7W A;  5F5Y A;  1T1A A;  1TS8 A;  2PT7 A;  3GEC A;  3T4J A;  1W63 Q;  4PKY G;  1W63 M;  5DJT A;  4UQI S;  1KOU A;  2P7J A;  1GSX A;  1WA9 A;  2QHK A;  3CUE C;  3KO6 A;  4ETZ A;  3PYP A;  2J3T C;  5DKL A;  4XT2 B;  4I5S A;  3PBO A;  5HD3 A;  2J3T D;  2GJ3 A;  2VEA A;  3MR0 A;  3UB7 A;  4H6J A;  2W1R A;  2A24 B;  4R70 A;  4E04 A;  4MN5 A;  3KSG A;  4HNB A;  4FOF A;  5DFX A;  1N9O A;  5HD5 A;  1H8M A;  2O9B A;  3ZYT A;  4GCZ A;  1IFQ A;  4G3K A;  1OTD A;  3OC2 A;  3PR6 A;  3KYZ A;  5DFY A;  2W3D A;  1OT6 A;  1DRM A;  2NUP C;  1NRJ A;  5CX7 A;  5G4Y A;  3B42 A;  2CMN A;  3BQA A;  3T50 A;  4MDZ A;  1YAX A;  5AJG A;  2VV6 A;  2ZOH A;  3C8C A;  1MZU A;  3R4K A;  4IUK A;  4HJ6 A;  4LRX C;  2W3H A;  2XRN A;  4HP9 A;  4L9G A;  4WEK A;  3PBS A;  3S7N A;  2OAQ 1;  2W3G A;  1OTE A;  4P6Z S;  4HIA A;  4I3I A;  4F3L B;  4NXG A;  3A0S A;  3BY9 A;  4WN5 A;  2Z6C A;  3NHQ A;  3NJA A;  3F1O B;  3K3C A;  4NXB A;  4OOM A;  2JN7 A;  2GNX A;  4Q0I A;  4KQD A;  2J3W A;  2V9A A;  3EGD C;  4EU0 A;  4G3W A;  4WUJ A;  3D3O A;  1LSX A;  4WEJ A;  1EW0 A;  3S7O A;  3PBT A;  3OBF A;  1TF1 A;  3VE4 A;  1ODV A;  3TJZ C;  4WEL A;  5HWV A;  3H7W B;  2XRO A;  3JVV A;  2HJE A;  4UEY A;  3KYQ A;  1UWP X;  2OAP 1;  1S67 L;  1S1Z A;  3EWK A;  5HSQ A;  3CI6 A;  3DBA A;  4DJ3 A;  1TS0 A;  3LUQ A;  3IBR A;  3EEH A;  1MC0 A;  2VZW A;  5AVF A;  2W1T B;  2VGL S;  5HWT A;  2K2N A;  3PBQ A;  1ZHH B;  1JNU A;  1LL8 A;  4L9E A;  5DKK A;  4BJP A;  4HH3 A;  4NKP A;  2O9C A;  4CLC B;  4DN0 A;  3MQ0 A;  2EWW A;  2K7S A;  1S1Y A;  4ME4 A;  2HJ9 C;  4ZRR A;  4L0L A;  2W3E A;  3CIT A;  2VV8 A;  3UMD A;  3E98 A;  3H82 A;  1F9I A;  5KIZ A;  5HL6 A;  5HPF A;  4Y2F A;  2P04 A;  3NOT C;  2QWS A;  4R3A A;  2JKT M;  4HH2 A;  1OPX A;  4II7 A;  1NLZ A;  1X0O A;  3LFV A;  4EXO A;  5F69 A;  3B33 A;  1YSP A;  3OCL A;  5C5K A;  1LSV A;  1VHM A;  1DP9 A;  3C30 A;  2P08 A;  4HY8 A;  2INW A;  5F6A A;  4WLA A;  4FSF A;  4LRY C;  2DMW A;  4GW9 A;  4IJG A;  4EEP A;  4JGR A;  1UGU A;  4MN6 A;  2J80 A;  2WKP A;  1P9W A;  4L9F A;  4HI4 A;  3KX0 X;  4DMZ A;  2VLG A;  3D72 A;  4KUK A;  1D7E A;  3K2N A;  3VOL A;  3LID A;  4BBV A;  3H9W A;  5TBM B;  2EA9 A;  4G3V A;  4I39 A;  4RQ9 A;  4B9O A;  2D01 A;  1OJG A;  3PBR A;  3PXP A;  5I5L A;  3LI9 A;  4CLC A;  3KSI A;  4EER A;  3T4O A;  3FPW A;  5DJU A;  3UB6 A;  3E4Q A;  3B47 A;  3P7N A;  1T1C A;  2K31 A;  3T4K A;  2LB5 A;  3F1N B;  3BY8 A;  3A0R A;  3C38 A;  1V9Y A;  2HF6 A;  5AVE A;  2KLI A;  5HPI A;  3UME A;  4CLC E;  2Y8H A;  1MKM A;  2GZA A;  3MF0 A;  3W2Z A;  3IS2 B;  4BBT A;  4BWI A;  3UE3 A;  1G28 A;  2KOI A;  3E0Y A;  5IS1 A;  2HV1 A;  2KDK A;  3LIC A;  4YNR A;  4BMW A;  1N9N A;  2L4R A;  2PYR A;  2JKR M;  4EEU A;  4R38 A;  4R6L A;  3TRC A;  4HOI A;  1DP6 A;  2G7U A;  4XT2 A;  5DF9 A;  5HDC A;  3FPV A;  2VX8 A;  1OTB A;  1XJ3 A;  2ZMV A;  3KSH A;  1XFN A;  2A24 A;  3T4L A;  1F5M A;  5HDS A;  4MMN A;  2VGL M;  2PR6 A;  2OOL A;  2PDR A;  3EOI A;  3LYX A;  4I3J A;  3LIB A;  2PR5 A;  4I3A A;  4YWZ A;  2ZMF A;  4KUO A;  5TBM A;  4NXE A;  4JGQ A;  2JKT I;  3KSF A;  3C2W A;  2W0N A;  4CLC C;  4Q0H A;  2M1C A;  3E4O A;  2NUT C;  5J4E A;  4H6J B;  2KX6 A;  4LRZ E;  3MFX A;  4HQA A;  3MJQ A;  3ULF A;  3CWF A;  2V1B A;  3UB8 A;  3F1N A;  4CLC D;  4UQI M;  2WKR A;  4YOF A;  5F68 A;  1OTI A;  4M4X A;  2GX5 A;  3IS2 A;  5LBR A;  3O5Y A;  4O0P A;  1OT9 A;  4NXF A;  4F3L A;  4HJ3 A;  2BAS A;  4LLO B;  2XA7 S;  1DP8 A;  2FH5 A;  3GDI A;  3UB9 A;  3F1O A;  4Z1W A;  3LR0 A;  4IUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...