3H7WA

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains with the artificial ligand ths017
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
114
structure length
108
Chain Sequence
FKGLDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYPQCIMCVNYVLSEIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Endothelial PAS domain-containing protein 1
publication title Principles of ligand binding within a completely buried cavity in HIF2alpha PAS-B
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 108
sequence length 114
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3h7wA00
3BY9A 2H28A 4JGRA 2INWA 1VB6A 4R6LA 5DJUA 2M1CA 4RQ9A 3A0SA 1OTEA 3MQQA 2WKQA 2K7SA 1T18A 2V0WA 3F1OB 3UB7A 1UGUA 4MN6A 1S66L 4EEUA 4E04A 5HZHA 4HH2A 1XFQA 3LI9A 5HD3A 4EXOA 4I3IA 5DKLA 2YKFA 3BWLA 3MJQA 3UB8A 4KUOA 2A24A 3VE3A 1OTIA 4JGQA 1X0OA 1S1ZA 1XJ6A 3H7WA 1NWZA 4PKYG 4KUKA 3E4QA 4HQAA 3H82A 1OJGA 4HJ4A 2VV7A 3LI8A 1V9YA 2L1MA 5J3WA 5IU1A 5J7EA 3MR0A 3E4PA 4WF0A 3GDIA 4I38A 3F1NA 3NOUC 3UE6A 2OWHA 3VOLA 5G4YA 2QJ7A 5DKKA 3C8CA 3RTYA 3PHYA 1OT9A 3NOPC 3NJAA 1TS8A 4HI4A 1DRMA 5A8BA 3C2WA 2QJ5A 3MQOA 3IBRA 2WKPA 1LT0A 2D01A 4PKYA 1LSVA 4HIAA 5EFWA 3OLOA 2V0UA 3B33A 2CMNA 3PYPA 1LL8A 1OTDA 2OOLA 5AVEA 1OTAA 2P7JA 3H9WA 3IS2B 4NXGA 2L4RA 5I5LA 2ZOIA 3F1OA 1GSVA 5HDSA 5TBMB 2PHYA 3NOTC 1D7EA 1N9NA 2PR5A 4NXFA 1N9OA 1JNUA 1S4RA 2KX6A 4HP9A 1MZUA 2BASA 4WUJA 1T1CA 4GW9A 4HY8A 4BBTA 4LRXC 3LYXA 4HNBA 2VV8A 4B9OA 1XJ2A 4WLAA 3RH8B 4EESA 1P0ZA 5F5YA 2W0NA 4EQ1A 1XFNA 2QHKA 4I39A 3CAXA 3T50A 3VE4A 4LRYC 1DP8A 2W27A 4I3JA 5G4ZA 2GJ3A 1XJ3A 1Y28A 1TS6A 3K3DA 1KOUA 4DJ3A 2Z6DA 3KX0X 3F1PB 1UWPX 3LICA 5IS1A 4WN5A 2I9VA 2QWSA 4HJ3A 3K3CA 4EETB 5HDCA 4K08A 4L9EA 1P97A 3H7WB 1F9IA 4EEPA 5KIZA 4H6JB 4HOIA 1LSXA 4R38A 2D02A 3H82B 4L9GA 2VEAA 4NXBA 2EA9A 1XJ4A 2PR6A 3FC7A 2PDRA 2B02A 1T19A 2OWJA 3LIBA 4GHIB 1ODVA 1GSXA 2ZOHA 4GCZA 4WL9A 5TBMA 4HHDA 4DJ2A 3F1NB 2V9AA 4XT2B 3GECA 1DP6A 4F3LB 3NHQA 3SW1A 5J4EA 1EW0A 3MXQA 4M4XA 3CWFA 4L9FA 4GS9B 4NXEA 2JHEA 5HWWA 4HP4A 3LIEA 2VLGA 3G6OA 4R3AA 4MN5A 3LUQA 3HJKA 3ICYA 3HJIA 2HV1A 4HJ6A 3EWKA 3LIDA 5F69A 2JN7A 2PD8A 3LIAA 3UMDA 2R78A 4LLOB 4JGOA 4KQDA 1GSWA 3F1PA 4R70A 2QKPA 3FG8A 5F6AA 3EEHA 4YWZA 1UWNX 1TS7A 4BBUA 2J80A 5HWTA 4LRZE 1V9ZA 1LSWA 3D72A 5HDDA 4I3AA 1OT6A 4I5SA 2WKRA 1OJ5A 3ULFA 1G28A 4EERA 1TS0A 2YKHA 2PD7A 4LPZA 3BY8A 4H6JA 3MFXA 2A24B 1S67L 4BBVA 2Z6CA 2V1BA 3P7NA 3CLOA 1WA9A 2VV6A 1T1AA 4GHIA 5AVFA 2PYRA 1N9LA 3LIFA 5HWVA 3E4OA 4EW7A 2V1AA 1BYWA 4XT2A 4JGPA 1DP9A 3IS2A 3UB6A 1D06A 4F3LA 2L0WA 2PYPA 2ZBBA 5HSQA 3A0RA 4GS9A 3A0VA 5HD5A 1OTBA 4HH3A 1S4SA 1S1YA 1T1BA 3UMEA 1F98A 3UB9A 5DJTA 2KDKA 5F68A 3ZQ5A
chains in the Genus database with same CATH superfamily
5A92A 1KE4A 2HP9A 4JGRA 5E2FA 3ITBA 2QPNA 5DJUA 4RQ9A 3GR2A 3A0SA 5CRFA 1HTZA 3E2LA 1OTEA 4P87A 2V1ZA 3BFFA 2HDUA 3VP3A 2K2NA 4KG2A 1BTLA 2Q0OA 1SZVA 5HAIA 4KZ5A 3BQAA 4WYYA 4CLCA 1UGUA 4MN6A 1S66L 2XD5A 4DXCA 4EEUA 3MF0A 3QP8A 2W3FA 4HH2A 4ETXA 4WZ4A 4I3IA 3C30A 5DKLA 3C7UA 5AQAA 4IUKA 4X1MA 1IFQA 1W7FA 3E0YA 3CZDA 3QP6A 3PTEA 1S1ZA 1D1JA 2VX8A 3QP2A 3RJUA 3MMHA 1NLYA 5GLCA 2WUQA 4JXGA 2PBDP 2ZQ7A 3E4QA 3A3JA 1KGEA 3UB5P 1H8MA 2X71A 2Y91A 3DTKA 3T1QB 3CHWP 1I2SA 5J7EA 1AXBA 3OC2A 4DE2A 2WAFA 4XUZA 4OOMA 4X68A 4LV0A 1I2WA 1BLCA 3VOLA 3EGXC 2QJ7A 3C8CA 2JKFA 5CHUA 3TE8A 3NJAA 3IXBA 2HJ9C 2A49A 2VGJA 2ZJ9A 4MBKA 1ESIA 2QJ5A 3MQOA 1LT0A 1YLTA 1LSVA 3RXXA 2QZ6A 3C4OA 2EFUA 1YKDA 3OOVA 3GMWA 3DWZA 1Z09A 4Y0UA 4DMZA 3B33A 4BENA 3GTCA 1OTDA 1XP4A 3FV7A 5AVEA 1GHPA 3HL9A 3IS2B 3AGEA 3MXSA 2V8CA 4PM8A 2OV5A 4CJNA 1SKFA 5FQQA 4HBUA 5DFYA 1D7EA 4ZRRA 3O5YA 1PW8A 4RX3A 2IWCA 3S7PA 4Q8IA 3T4TA 1W63M 2KX6A 2J9PA 2WAEA 2BASA 5F1GA 1T1CA 1ERMA 4NEED 5EPHA 4ZTKA 4LRXC 1CJFA 3WS1A 4WLAA 5FDSA 3RH8B 4XUXA 2NUTC 1YLZA 4MBHA 4DDSA 4ETZA 4EESA 4Z9QA 3DTMA 4I39A 4YNRA 1XX2A 2GNXA 1IOUA 4QD4A 1DP8A 3PBSA 3HLCA 3UPNA 4X53A 2GJ3A 1Y28A 4YFMA 3MZDA 2P9VB 3IWOA 3KO6A 2O9BA 4GDBA 1A0KA 1EWZA 1BULA 1IEMA 4NK3A 3R7WB 3BFCA 3FWLA 2ZD8A 4C3QA 4JXWA 1NY0A 4N1HA 3LICA 3BQ8A 5IS1A 4UQIS 5L8MA 2XR0A 4OOLA 1CK3A 2H10A 3PR6A 2LB9A 2EXBA 4UHUA 3CITA 1ES4A 3E98A 5KIZA 4H6JB 3MQ0A 2W3HA 1HZOA 1IKIA 4BD1A 2P08A 3NCKA 1XJ4A 2PDRA 2Y79A 3IWQA 2PBYA 3LEQA 2XFSA 1GSXA 1K4FA 1E3UD 5EM1A 2ZOHA 4WL9A 3NDEA 3AGFA 3F1NB 4XT2B 2Q9MA 1C3BA 2JC7A 3JPUA 2Y2KA 4IUHA 4KG6A 4C6YA 1NRJA 3KYEA 1EW0A 3VOZA 1CQAA 4NXEA 3G31A 3GRJA 3IH8A 5FAOA 4D2OA 2PU4A 5HW3A 5FI2A 2WZZA 4PM6A 3DBAA 3QHYA 4WMCD 4MN5A 1G6OA 1PZOA 3LUQA 3HJKA 3LR4A 3PXPA 4EBNA 1S6RA 3TW8A 2JCHA 2V20A 3G4PA 5DTKA 4HJ6A 4Q0JA 2OSUA 5M19A 3ZG5A 4KZ3A 1Q2QA 2FZ0A 5F83A 3LIAA 4ZJ1A 2P9VA 2R78A 4JGOA 2O9CA 3CMZA 4FOFA 2LB5A 3FG8A 4G3VA 3QP1A 3R7WA 5HWTA 4LRZE 5M1AA 1V9ZA 3EQUA 2EWWA 5HDDA 4I3AA 1GA9A 1VEUB 1OJ5A 3ULFA 4DE1A 2Y2LA 3VP2A 4EERA 2KOIA 1L0GA 1TS0A 2YKHA 2ZMFA 2ZL1B 1JWZA 2PT7A 2WZXA 5L07A 4IVIA 4H6JA 2J7VA 5FSRA 3MFXA 4GB7A 1MKIA 3DAVA 5AQ7A 2QYBA 1VETA 2Y2OA 3P7NA 2Y2NA 3CLOA 4MNRA 4P85A 1T1AA 4OQ0A 1ESUA 1CI8A 2PYRA 3LIFA 3HUOA 3S7NA 5FQJA 1SCWA 4O7DA 4XT2A 2ZMVA 1KGGA 5DVAA 3BW6A 1ONGA 2IA2A 3GV9A 3D3OA 3LCEA 2PYPA 5FI7A 5EE8A 4ARZA 4JLFA 2JKTI 2DCFA 4O8GA 5E2GA 1S4SA 5FA7A 2VA0A 1NXYA 3NIAA 4RX2A 2KDKA 5F68A 2XROA 3BY9A 4HESA 1TEMA 2C5WB 4ID4A 2INWA 2E8JA 4R6LA 1ZHHB 4ZBEA 4BLMA 2RCXA 3FKWA 3FPVA 2ZC4B 3MBZA 3LGOA 3BECA 1I5QA 2J3TC 1DY6A 3A3EA 3A3DA 3UPPA 3N4IA 1T18A 2V0WA 3V5MA 3F1OB 4X55A 4Y15A 4EWFA 3UB7A 4E04A 3LR5A 4Q0HA 3TRCA 1J3WA 4II7A 5KMWA 1VEUA 4EXOA 4N92A 2VJWA 3W4QA 3LEZA 2ACGA 4B88A 5A90A 4KZ8A 5CHMA 3T1XA 3HREA 2WGIA 2NUPC 5DF8A 2X01A 1OTIA 1MXOA 4DDYA 5AQBA 1YSQA 1X0OA 1XJ6A 1IELA 3GSGA 5GLDA 3UY6A 4Y0TA 4UAAA 3T1RA 3H82A 1OJGA 3T4LA 3LI8A 2IWDA 3BFGA 2L1MA 3NBLA 5J3WA 3SS5A 4M3KA 5IU1A 3LY4A 3MR0A 4WZ5A 2ZC6B 1CI9A 4R4SA 3GDIA 3D9YA 3SS3A 3NOUC 4WM9A 3UE6A 2OWHA 3LFVA 3NULA 1SDNA 1KDWA 1OT9A 4G3KA 1TS8A 3ISGA 1DRMA 3IT9A 2Y2PA 1TVFA 4EU0A 2ZC5B 1ALQA 3IBRA 2HDSA 2WKPA 3LO7A 1YLJA 2D01A 5GLAA 3PBRA 3OPPA 4HIAA 3HCYA 2V0UA 2MJ6A 2IWBA 2JBFA 4WELA 3M6BA 5A91A 3BJNA 5M18A 2XGNA 3T4SA 5CERA 2P7JA 1IYSA 4E3OA 3IF5A 1W79A 5I5LA 3F1OA 1BLPA 4HEFA 5HDSA 3GQZA 3NOTC 4LV3A 1N9NA 1W8QA 4NXFA 1N9OA 3MKFA 1K4EA 1K6RA 1HD8A 4QY6A 4GW9A 4BBTA 1K25A 3LYXA 4HNBA 2VV8A 3FYZA 1H8YA 4JF6A 4KENB 1P0ZA 5F5YA 2W0NA 4EQ1A 1BT5A 3CG5A 1PWGA 3IQAA 3CAXA 3TJZC 2VGKA 5TGFA 4E3IA 5HL1A 2O0YA 1NYMA 2W27A 1XJ3A 1TS6A 2C6WB 5EVID 3ZG9B 3F1PB 3ZVTA 3MS6A 2Y2JA 4UA6A 3BFEA 1UWPX 4WN5A 3DWKA 1FR6A 3UO9A 4RYEA 2HP5A 4K08A 5HDCA 3HLBA 3UE0A 3H7WB 2VK3A 1YSPA 3V3SA 4CLCD 4B4ZA 2W1TB 3EEAA 5JYPA 4LFUA 4P0MA 2VEAA 4NXBA 3FC7A 1ZTUA 2B02A 1T19A 3ZNYA 1OPXA 2J9OA 3T4JA 2OWJA 3LIBA 3WS4A 3CI6A 1ODVA 2ZQDA 4S2NC 4OP5A 3IWIA 3OZHA 1H5XA 5CEDA 2XDMA 2WGWB 1KVMA 4BL2A 2W1RA 4PPRA 4MMNA 3NHQA 3N8SA 4M4XA 2BTFP 4BQMA 2XH9A 5U47A 3TG9A 3OPRA 4RVAA 4GNUA 4R0QA 4NETA 4CLCC 4HP4A 1K55A 1F2KA 4ZJ3A 3LIEA 1NZUA 2VLGA 3G6OA 2Z2LB 1KVLA 1FSWA 3T4OA 4R3AA 4DKIA 2Y2IA 4WEKA 3PAGA 1Y54A 2V8FA 3OPLA 3Q82A 3S4XA 2X02A 3S7QA 3W2ZA 3VSKA 3F1PA 3MZFA 5C5KA 2W3DA 2QKPA 5F6AA 1UWNX 1ES2A 5TJJA 1TS7A 2J80A 2RL3A 1ERQA 1WYBA 3ITAA 1OT6A 3WS0A 2WKRA 5DFXA 3O86A 1PNEA 1EI5A 1Z6FA 4X56A 1YLYA 4JXSA 4LCLA 2EWVA 1S67L 4MCWA 4BBVA 1CEGA 1M40A 1MWTA 2EX6A 5EV0A 1FQGA 2Y55A 1WA9A 4Y17A 2VV6A 1KE3A 4OLDA 5HWVA 3E4OA 4EW7A 1GA0A 1BYWA 3KSGA 4EBPA 4OVDA 3HBRA 1DP9A 3IS2A 2P74A 3PBQA 3Q7VB 1IKGA 1GHIA 2ZMAA 2HZ5A 2ZQ8A 2ZBBA 2K31A 3A0RA 4K0XA 5FEFA 3I7JA 5EM0A 1OTBA 2Z2MB 1CF0A 1MPLA 2XF3A 3ZQ5A 5EOOA 3V67A 4Y7PA 3A3FA 4QU3A 3CUEC 3HUNA 4KQQA 4OPYA 2G2UA 4OP8A 5GHYA 3UPOA 2M1CA 1XKZA 3MQQA 4K0WA 1MWRA 2ZQAA 4LENA 2EXAA 4BWIA 2H0YA 4S2LA 5EUAA 3W4PA 2FFFB 5A93A 1K57C 2XQZA 3BEBA 5HZHA 4Y2FA 1MWSA 4PM9A 3HLEA 5HARA 3BM6A 3M6HA 1HLUP 1P9WA 1YT4A 2YKFA 3VFHA 2VKSA 3PBTA 2JKRM 4KQOA 3SS4A 3BWLA 1FR1A 2O9AA 3MJQA 3W4OA 4KUOA 1ACFA 3WS2A 3HLGA 3VE3A 5CXWA 4JGQA 3SZTA 3OCNA 1MBLA 1FILA 1MWUA 2EX2A 4PKYG 5FEGA 4DF6A 4EV4A 3E2KA 4HQAA 3Q07A 2Y2GA 4E3JA 3MSHA 2WYXA 4Y0OA 4IJGA 1ZC2A 5CGWA 3Q7VA 5EOEA 5EVLA 5F1FA 3E4PA 4WF0A 4JXVA 4I38A 3F1NA 3BYDA 1XXMA 1LLBA 3P98A 4DE0A 5CHJA 5G4YA 1S0WA 3RTYA 1FCMA 2WKEA 3NOPC 3WRZA 1H8ZA 4HI4A 5L09A 1W8YA 4BJPA 5A8BA 3C2WA 1IYQA 1Q2PA 1Y4OA 3UDIA 2JE5A 3V3RA 3U2AA 2HP6A 1O07A 4AFIA 4X69A 2Y2HA 3BFDA 2EX9A 3OLOA 5FQKA 4WEJA 3VSLA 2GX5A 4RA7A 2CMNA 1LL8A 5FATA 4EQIA 3W8KA 1KDSA 2BLSA 1OTAA 1P9RA 1YQSA 1DJBA 4GOGA 4NXGA 2L4RA 4PM5A 4R4RA 5BOHA 1GSVA 5TBMB 2PHYA 3PBNA 1PWDA 4QWOA 1ES5A 2UV0E 1FOFA 2EFXA 1E4DA 1MZUA 2XLNA 1YMXA 1KGFA 4HY8A 1ONHA 3IHAA 3WRTA 3ZNTA 1XJ2A 1JWVA 4OPZA 3FZCA 4FD8A 4IBXA 1BLHA 2ZL1A 4QB8A 3WWXA 5J8XA 2B5RA 3JVVA 3T12B 1K38A 3NECA 3S22A 1XFNA 4G3WA 2QHKA 5F82A 4OQIA 4GN2A 4B4XA 1K0KA 2EX8A 4KZ4A 2P04A 1AWIA 3VE4A 4LRYC 5HX9A 5L2FA 4R1GA 4Y13A 2B18A 2PAVP 1LL9A 3K3DA 1KOUA 2FFYA 1WE4A 5CGSA 4PHTA 1STZA 3IX4A 1G68A 1BUEA 3RXWA 5KZHA 3BRMA 4P6ZS 2KLIA 2I9VA 2QWSA 4EETB 1NRFA 1RCJA 4L9EA 4FH4A 1IYPA 3O3VA 4S2KA 1QMEA 2QMIA 4HOIA 4N1XA 4R38A 4JF4A 5FAQA 3Q7ZA 4GD6A 5G18A 4BL3A 5CGXA 3D4FA 2D02A 3UE1A 4JPMA 4L9GA 5GHXA 2EA9A 2ZM2A 2PR6A 2VGLS 3DW0A 4LCMA 3HUMA 2ZLYA 2HJEA 4OPQA 1RGYA 5TBMA 3KSFA 2J8YA 4DJ2A 3IXHA 2O99A 3GECA 4FTXA 1DP6A 1E25A 1ZG6A 4UQIM 2A3UA 1F5MA 2W3EA 1LI9A 4MN7A 3CWFA 4JKTA 3IF6C 1DJCA 1YPRA 2FH5A 3BLMA 4L9FA 1J9MA 4KZ7A 1WYCA 3PAEA 3P01A 1QMFA 4S2NA 3EOIA 5GLBA 5GHZA 1G5UA 5HL6A 2AVXA 1PWCA 4E3KA 2VZWA 3RFBA 3SH7A 1BLSA 4DRTA 3N8LA 3S1YA 3EWKA 2JN7A 3C4PA 5KSCA 5FASA 5HFOA 3N6IA 1XPBA 4ZDXA 3PBOA 1TDGA 3UMDA 5AJGA 4KQDA 1H0MA 3O87A 5IHVA 4R70A 1JTDA 1L3LA 1K54C 3EEHA 4IBRA 4YWZA 2ZC7A 3G32A 4BBUA 1G6AA 4I5SA 2XA7S 4YOFA 1G28A 3C38A 4QJGA 2B95A 1L0EA 2OAQ1 4WZ5C 5TFQA 4R3JA 5CTNA 3BY8A 1M6KA 4OPRA 1OMEA 2A24B 4JF5A 3EQVA 4S2OA 3L7HA 4H8RA 2Z6CA 2V1BA 3NI9A 4DN0A 4FUWA 1L2SA 1TD5A 1W63Q 2CC1A 3VMAA 2V1AA 4IEDA 5FDHA 3IXDA 4CQHA 4CPKA 2WK0A 5EVIC 4L0LA 3VOYA 2BG1A 1JVJA 1N4OA 1XA7A 2Y59A 4FSFA 5HSQA 4OKPA 3IHBA 3VP1A 4UA9A 3NY4A 3UNWA 1S1YA 2Q9NA 5GL9A 4WBGA 1T1BA 3UMEA 1F98A 5DJTA 4QHCA 5FQ9A 1PZPA 3B3XA 5CTMA 1CEFA 2H28A 3QP5A 3C7VA 2M7UA 2HGVA 1VB6A 1SDEA 5E2HA 4N9LA 1U60A 2DMWA 2JKGA 3N7WA 4S2PA 2WGVA 4P6BA 2J3WA 4GDNA 3T1SA 3VP4A 3L9KA 3ZFZA 4F94A 4PAUA 2WKQA 1IYOA 5FQMA 1YAXA 2K7SA 4EUVA 3ZG7B 2H5SA 2ZC3B 5KSHA 2XSSA 5JYOA 3ZG0A 4LV2A 4YINA 1K56A 3AGDA 1PW1A 1EROA 1LL5A 3CUEA 1XFQA 4X25A 1SKOB 3LI9A 5HD3A 3ZCZA 3QP4A 1MKMA 1KE0A 2OLUA 3T4KA 1RGZA 1E3UA 2G7UA 4OQGA 2ZQ9A 3UB8A 4KZ9A 4O0PA 2A24A 3KSIA 4NKPA 2XD1A 4U0XA 3MFDA 4QY5A 1K57A 4PMAA 3H7WA 1NWZA 4Q0IA 1ES3A 4OONA 2W1TA 4KUKA 4R23A 3DTEA 3V50A 4Y5FA 4MBFA 2A2LA 2WKHA 4HJ4A 4FCFA 4BD0A 4E3MA 2VV7A 1L0FA 2DNSA 1V9YA 3G34A 4D60A 5DTTA 4S2JA 3NC8A 4WMCA 4FH2A 5DF9A 1SHVA 2WGWA 4LGWA 2JKTM 4Y3IA 4MLLA 5DKKA 2UWXA 3PHYA 3R4KA 2ZM0A 3IX8A 1K56D 1PI5A 4GJ4A 1VETB 4KZ6A 3CJMA 4PKYA 5MC7A 4B93A 1K55C 5EFWA 3LR0A 5I94A 3Q1FA 3MKEA 3PYPA 1YLWA 2OOLA 3CPTB 4KQRA 3H9WA 5IT5A 4P6ZM 1YLPA 3HLDA 4GD8A 2ZOIA 2W3GA 3MXRA 4KZBA 1DJAA 2HF6A 3KSHA 3SH9A 3LY3A 4ARZB 2PR5A 4KZAA 1SKOA 1JNUA 4IHQA 1H3QA 1S4RA 4HP9A 4WUJA 4E3LA 4A5RA 2VGLM 4B9OA 3ZGAB 1FCNA 2R9WA 3HLWA 4KG5A 3TSGA 4EBLA 3NDGA 2PU2A 3SH8A 3G35A 1BSGA 2ZM8A 3M2KA 5HAQA 4E3NA 5TR7A 4OOYA 3T50A 1XGIA 3FPWA 5EVEA 3IF6B 1PFLA 5HPFA 2XRNA 4I3JA 5G4ZA 3M2JA 4R3BA 4OH0A 4DJ3A 2Z6DA 1MC0A 1PRQA 3KX0X 4E6WA 2R9XA 3G30A 1PI4A 1RP5A 1VM1A 4DE3A 1MY8A 4CLCE 2DRWA 4HJ3A 3K3CA 3VFFA 4K91A 2OAP1 2WADA 1P97A 5E43A 2WKIA 4JBFA 1K6SA 4S2MA 1F9IA 5D3OA 4EEPA 4N9KA 1NYYA 1LSXA 4GKUA 1TF1A 4O01A 4U3TA 3H82B 3ZG8B 3CPTA 4ESPA 3ZHHA 5FQIA 2HDRA 4GHIB 2XA7M 5CX7A 3UDFA 1VHMA 2PRFA 4BMWA 4GCZA 2J3TD 4HHDA 1NJ4A 2V9AA 4OLGA 3VP0A 4F3LB 3N8RA 3SW1A 1FIKA 5J4EA 1N9BA 5AQ9A 3MXQA 2Y4AA 3BLSA 3QNCA 3G2YA 3ZYTA 4GS9B 2JHEA 3IH9A 5FI6A 4EUZA 3HLFA 1JTGA 3IBJA 5LBRA 1YMSA 5HWWA 3OBFA 5DF7A 2H0TA 5CECA 5E2EA 3IXGA 3S7OA 5EVIB 2M7VA 4HBTA 1FSYA 3U4LP 3VV4A 3ICYA 2XFTA 3HJIA 4UA7A 2HV1A 3FKVA 3IF6A 5FAPA 5F69A 3LIDA 3TOIA 3JVUA 2PD8A 5DTSA 2ZQCA 4X1LA 4LLOB 3UDXA 1LHYA 3C5AA 2OLVA 4DXBA 1VQQA 4ZJ2A 3O88A 4PM7A 2Y2MA 1GSWA 3K2NA 4OQHA 4CLCB 1XGJA 1ZG4A 1LSWA 3D72A 1BZAA 4GLQA 3QNBA 2I72A 2G2WA 4LV1A 3SOIA 1LI0A 1GCEA 2HDQA 5EECA 2PD7A 2GZAA 2JKRI 4ME4A 5HPIA 4LPZA 3KYZA 2XEPA 2GDNA 3HVFA 2Y8HA 3V39A 1PIOA 3LR3A 1K54A 3ZVWA 4U0TA 5FL3A 3OCLA 3UN7A 3OPHA 4GHIA 3MZEA 4QPRA 1GHMA 3T4QA 5AVFA 5HAPA 4MEZA 1YM1A 1PYYA 1N9LA 1JWPA 4GZBA 5L10A 3GVBA 1W5DA 4UEYA 2HPBA 1XA1A 4JGPA 3ZDJA 3EGDC 4C75A 3UE3A 3UB6A 1HVBA 1D06A 4MDZA 1O7EA 1ZKJA 1NLZA 3P09A 4E6XA 4F3LA 3KYQA 2L0WA 1NZOA 3IX3A 2XK1A 4IVKA 2V2FF 4GS9A 1TDLA 5CEBA 3G2ZA 3DTIA 3Q81A 3A0VA 3JYIA 4ZAMA 5HD5A 3A3IA 3B47A 5K5BA 4X6TA 4XXRA 4HH3A 1L0DA 1FCOA 4S2IA 4NG2A 3UB9A 2Y2QA 4Z1WA 5EVIA 2E8IA 3WS5A 3B42A
chains in the Genus database with same CATH topology
3BY9A 2H28A 4JGRA 3CUEC 2INWA 2M7UA 2HGVA 1VB6A 4R6LA 5DJUA 1ZHHB 2DMWA 2M1CA 4RQ9A 3A0SA 3FPVA 1OTEA 2J3WA 3MQQA 4PAUA 2WKQA 2K2NA 2J3TC 1YAXA 2K7SA 4EUVA 1T18A 2V0WA 4BWIA 3F1OB 3BQAA 3UB7A 4CLCA 1UGUA 4MN6A 1S66L 2XSSA 4E04A 4EEUA 3LR5A 3MF0A 5KSHA 4Q0HA 3TRCA 4Y2FA 5HZHA 4II7A 2W3FA 3CUEA 4HH2A 1XFQA 3LI9A 5HD3A 4ETXA 4EXOA 2VJWA 1P9WA 1MKMA 4I3IA 3C30A 5DKLA 3T4KA 2YKFA 2VKSA 3PBTA 2JKRM 2G7UA 4KQOA 3BWLA 2O9AA 3MJQA 3UB8A 4IUKA 4KUOA 4O0PA 2A24A 3KSIA 2NUPC 1IFQA 4NKPA 3VE3A 1OTIA 3E0YA 4JGQA 1YSQA 1X0OA 3OCNA 1S1ZA 1XJ6A 3H7WA 1NWZA 2VX8A 4Q0IA 4PKYG 2W1TA 3MMHA 1NLYA 4KUKA 3E4QA 4HQAA 3H82A 4Y5FA 1OJGA 2A2LA 4HJ4A 3T4LA 2VV7A 3LI8A 1H8MA 1V9YA 4IJGA 2L1MA 5J3WA 5IU1A 5J7EA 3MR0A 3E4PA 3OC2A 4WF0A 3GDIA 4I38A 3F1NA 5DF9A 4OOMA 3NOUC 2JKTM 4Y3IA 3UE6A 2OWHA 3LFVA 3VOLA 3EGXC 5G4YA 2QJ7A 3C8CA 5DKKA 3RTYA 3PHYA 1OT9A 3R4KA 3NOPC 4G3KA 3TE8A 3NJAA 1TS8A 4HI4A 1DRMA 2HJ9C 4GJ4A 4BJPA 5A8BA 3C2WA 2QJ5A 4EU0A 3MQOA 3IBRA 2WKPA 1LT0A 2D01A 4PKYA 3U2AA 1LSVA 3PBRA 4HIAA 5MC7A 4AFIA 4B93A 3HCYA 1YKDA 5EFWA 3OLOA 3OOVA 2V0UA 2MJ6A 4WEJA 3LR0A 2GX5A 3B33A 4WELA 4DMZA 3BJNA 2CMNA 3PYPA 1LL8A 3T4SA 1OTDA 2OOLA 5AVEA 1OTAA 1P9RA 2P7JA 3H9WA 5IT5A 4P6ZM 3IS2B 4NXGA 2L4RA 5I5LA 2ZOIA 3F1OA 2W3GA 2HF6A 1GSVA 5HDSA 5TBMB 2PHYA 3KSHA 3NOTC 5DFYA 1D7EA 3PBNA 3O5YA 4ZRRA 4ARZB 1N9NA 2PR5A 4NXFA 1N9OA 1JNUA 3S7PA 4IHQA 1S4RA 1H3QA 3T4TA 1W63M 2KX6A 4HP9A 1MZUA 2BASA 4WUJA 1T1CA 4NEED 4GW9A 4HY8A 4BBTA 4LRXC 3LYXA 4HNBA 2VV8A 2VGLM 4B9OA 1XJ2A 4WLAA 3RH8B 2NUTC 4ETZA 4EESA 1P0ZA 3JVVA 5F5YA 2W0NA 4EQ1A 1XFNA 4G3WA 2QHKA 4I39A 4YNRA 3CAXA 3T50A 3FPWA 3TJZC 2GNXA 1IOUA 2P04A 3VE4A 4LRYC 5HPFA 1DP8A 3PBSA 2O0YA 2XRNA 2W27A 4I3JA 5G4ZA 2B18A 2GJ3A 1XJ3A 1Y28A 1TS6A 3K3DA 1KOUA 4DJ3A 3KO6A 2O9BA 2Z6DA 1MC0A 4PHTA 3KX0X 1STZA 3F1PB 3R7WB 4CLCE 1UWPX 4P6ZS 2KLIA 3LICA 3BQ8A 5IS1A 4WN5A 2I9VA 2QWSA 4UQIS 4HJ3A 5L8MA 3K3CA 4EETB 5HDCA 2OAP1 4K08A 4OOLA 4L9EA 1P97A 3PR6A 2LB9A 3H7WB 1F9IA 4EEPA 3CITA 3E98A 5KIZA 4H6JB 4HOIA 1LSXA 4R38A 1TF1A 1YSPA 3MQ0A 2W3HA 4CLCD 2W1TB 3EEAA 4O01A 2P08A 2D02A 3H82B 4L9GA 2VEAA 4NXBA 2EA9A 1XJ4A 2PR6A 1ZTUA 2PDRA 3FC7A 2B02A 1T19A 2Y79A 1OPXA 3T4JA 2OWJA 2VGLS 3LIBA 4GHIB 3CI6A 1ODVA 2XA7M 1GSXA 5CX7A 2HJEA 1VHMA 2ZOHA 4GCZA 4WL9A 4BMWA 2J3TD 5TBMA 4HHDA 3KSFA 4DJ2A 3F1NB 2V9AA 4XT2B 2O99A 3GECA 1DP6A 4IUHA 2W1RA 4UQIM 1NRJA 1F5MA 2W3EA 4MMNA 4F3LB 3NHQA 3SW1A 5J4EA 1EW0A 4MN7A 3MXQA 4M4XA 3CWFA 3ZYTA 2FH5A 4L9FA 4GS9B 4NXEA 2JHEA 3IBJA 4CLCC 5LBRA 5HWWA 3P01A 4HP4A 3EOIA 3OBFA 3LIEA 2VLGA 3G6OA 5HL6A 3S7OA 3T4OA 3DBAA 4R3AA 2M7VA 4MN5A 1G6OA 2VZWA 3LUQA 3RFBA 3HJKA 3LR4A 3ICYA 3PXPA 3VV4A 3HJIA 3TW8A 2HV1A 4HJ6A 4Q0JA 4WEKA 3EWKA 3LIDA 5F69A 2JN7A 3JVUA 2FZ0A 2PD8A 3PBOA 3LIAA 3UMDA 2R78A 4LLOB 5AJGA 4JGOA 4KQDA 3S7QA 2O9CA 3W2ZA 1GSWA 2LB5A 3F1PA 3K2NA 4FOFA 4R70A 5C5KA 2W3DA 2QKPA 3FG8A 5F6AA 3EEHA 4G3VA 4YWZA 1UWNX 5TJJA 3R7WA 4CLCB 1TS7A 4BBUA 2J80A 5HWTA 4LRZE 1V9ZA 1LSWA 3EQUA 3D72A 2EWWA 4GLQA 5HDDA 4I3AA 1OT6A 4I5SA 2WKRA 2XA7S 1OJ5A 4YOFA 5DFXA 3ULFA 1G28A 2KOIA 3C38A 4EERA 1TS0A 2OAQ1 2YKHA 2ZMFA 2PD7A 2GZAA 2JKRI 4ME4A 5HPIA 2PT7A 4LPZA 3BY8A 4H6JA 2EWVA 3KYZA 3MFXA 2A24B 3EQVA 2Y8HA 1S67L 3LR3A 4MCWA 4BBVA 2QYBA 2Z6CA 2V1BA 3P7NA 5FL3A 3CLOA 1WA9A 3OCLA 4DN0A 2VV6A 1T1AA 4GHIA 4QPRA 3T4QA 1TD5A 5AVFA 1W63Q 2PYRA 1N9LA 3LIFA 5HWVA 3S7NA 3E4OA 4EW7A 2V1AA 4UEYA 1BYWA 3KSGA 4XT2A 4CQHA 4JGPA 2ZMVA 1DP9A 3EGDC 3BW6A 3IS2A 3UE3A 4L0LA 2IA2A 3UB6A 3PBQA 1D06A 4MDZA 4F3LA 1NLZA 3KYQA 3D3OA 2L0WA 2PYPA 2K31A 2ZBBA 4FSFA 5HSQA 3A0RA 4GS9A 4ARZA 2JKTI 3A0VA 4O8GA 5HD5A 5K5BA 1OTBA 3B47A 4HH3A 1S4SA 2VA0A 1S1YA 1T1BA 3UMEA 1F98A 3UB9A 5DJTA 2KDKA 5F68A 4Z1WA 2XROA 3ZQ5A 3V67A 3B42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BY9 A;  2H28 A;  4JGR A;  2INW A;  1VB6 A;  4R6L A;  5DJU A;  2M1C A;  4RQ9 A;  3A0S A;  1OTE A;  3MQQ A;  2WKQ A;  2K7S A;  1T18 A;  2V0W A;  3F1O B;  3UB7 A;  1UGU A;  4MN6 A;  1S66 L;  4EEU A;  4E04 A;  5HZH A;  4HH2 A;  1XFQ A;  3LI9 A;  5HD3 A;  4EXO A;  4I3I A;  5DKL A;  2YKF A;  3BWL A;  3MJQ A;  3UB8 A;  4KUO A;  2A24 A;  3VE3 A;  1OTI A;  4JGQ A;  1X0O A;  1S1Z A;  1XJ6 A;  3H7W A;  1NWZ A;  4PKY G;  4KUK A;  3E4Q A;  4HQA A;  3H82 A;  1OJG A;  4HJ4 A;  2VV7 A;  3LI8 A;  1V9Y A;  2L1M A;  5J3W A;  5IU1 A;  5J7E A;  3MR0 A;  3E4P A;  4WF0 A;  3GDI A;  4I38 A;  3F1N A;  3NOU C;  3UE6 A;  2OWH A;  3VOL A;  5G4Y A;  2QJ7 A;  5DKK A;  3C8C A;  3RTY A;  3PHY A;  1OT9 A;  3NOP C;  3NJA A;  1TS8 A;  4HI4 A;  1DRM A;  5A8B A;  3C2W A;  2QJ5 A;  3MQO A;  3IBR A;  2WKP A;  1LT0 A;  2D01 A;  4PKY A;  1LSV A;  4HIA A;  5EFW A;  3OLO A;  2V0U A;  3B33 A;  2CMN A;  3PYP A;  1LL8 A;  1OTD A;  2OOL A;  5AVE A;  1OTA A;  2P7J A;  3H9W A;  3IS2 B;  4NXG A;  2L4R A;  5I5L A;  2ZOI A;  3F1O A;  1GSV A;  5HDS A;  5TBM B;  2PHY A;  3NOT C;  1D7E A;  1N9N A;  2PR5 A;  4NXF A;  1N9O A;  1JNU A;  1S4R A;  2KX6 A;  4HP9 A;  1MZU A;  2BAS A;  4WUJ A;  1T1C A;  4GW9 A;  4HY8 A;  4BBT A;  4LRX C;  3LYX A;  4HNB A;  2VV8 A;  4B9O A;  1XJ2 A;  4WLA A;  3RH8 B;  4EES A;  1P0Z A;  5F5Y A;  2W0N A;  4EQ1 A;  1XFN A;  2QHK A;  4I39 A;  3CAX A;  3T50 A;  3VE4 A;  4LRY C;  1DP8 A;  2W27 A;  4I3J A;  5G4Z A;  2GJ3 A;  1XJ3 A;  1Y28 A;  1TS6 A;  3K3D A;  1KOU A;  4DJ3 A;  2Z6D A;  3KX0 X;  3F1P B;  1UWP X;  3LIC A;  5IS1 A;  4WN5 A;  2I9V A;  2QWS A;  4HJ3 A;  3K3C A;  4EET B;  5HDC A;  4K08 A;  4L9E A;  1P97 A;  3H7W B;  1F9I A;  4EEP A;  5KIZ A;  4H6J B;  4HOI A;  1LSX A;  4R38 A;  2D02 A;  3H82 B;  4L9G A;  2VEA A;  4NXB A;  2EA9 A;  1XJ4 A;  2PR6 A;  3FC7 A;  2PDR A;  2B02 A;  1T19 A;  2OWJ A;  3LIB A;  4GHI B;  1ODV A;  1GSX A;  2ZOH A;  4GCZ A;  4WL9 A;  5TBM A;  4HHD A;  4DJ2 A;  3F1N B;  2V9A A;  4XT2 B;  3GEC A;  1DP6 A;  4F3L B;  3NHQ A;  3SW1 A;  5J4E A;  1EW0 A;  3MXQ A;  4M4X A;  3CWF A;  4L9F A;  4GS9 B;  4NXE A;  2JHE A;  5HWW A;  4HP4 A;  3LIE A;  2VLG A;  3G6O A;  4R3A A;  4MN5 A;  3LUQ A;  3HJK A;  3ICY A;  3HJI A;  2HV1 A;  4HJ6 A;  3EWK A;  3LID A;  5F69 A;  2JN7 A;  2PD8 A;  3LIA A;  3UMD A;  2R78 A;  4LLO B;  4JGO A;  4KQD A;  1GSW A;  3F1P A;  4R70 A;  2QKP A;  3FG8 A;  5F6A A;  3EEH A;  4YWZ A;  1UWN X;  1TS7 A;  4BBU A;  2J80 A;  5HWT A;  4LRZ E;  1V9Z A;  1LSW A;  3D72 A;  5HDD A;  4I3A A;  1OT6 A;  4I5S A;  2WKR A;  1OJ5 A;  3ULF A;  1G28 A;  4EER A;  1TS0 A;  2YKH A;  2PD7 A;  4LPZ A;  3BY8 A;  4H6J A;  3MFX A;  2A24 B;  1S67 L;  4BBV A;  2Z6C A;  2V1B A;  3P7N A;  3CLO A;  1WA9 A;  2VV6 A;  1T1A A;  4GHI A;  5AVF A;  2PYR A;  1N9L A;  3LIF A;  5HWV A;  3E4O A;  4EW7 A;  2V1A A;  1BYW A;  4XT2 A;  4JGP A;  1DP9 A;  3IS2 A;  3UB6 A;  1D06 A;  4F3L A;  2L0W A;  2PYP A;  2ZBB A;  5HSQ A;  3A0R A;  4GS9 A;  3A0V A;  5HD5 A;  1OTB A;  4HH3 A;  1S4S A;  1S1Y A;  1T1B A;  3UME A;  1F98 A;  3UB9 A;  5DJT A;  2KDK A;  5F68 A;  3ZQ5 A; 
#chains in the Genus database with same CATH topology
 5A92 A;  1KE4 A;  2HP9 A;  4JGR A;  5E2F A;  3ITB A;  2QPN A;  5DJU A;  4RQ9 A;  3GR2 A;  3A0S A;  5CRF A;  1HTZ A;  3E2L A;  1OTE A;  4P87 A;  2V1Z A;  3BFF A;  2HDU A;  3VP3 A;  2K2N A;  4KG2 A;  1BTL A;  2Q0O A;  1SZV A;  5HAI A;  4KZ5 A;  3BQA A;  4WYY A;  4CLC A;  1UGU A;  4MN6 A;  1S66 L;  2XD5 A;  4DXC A;  4EEU A;  3MF0 A;  3QP8 A;  2W3F A;  4HH2 A;  4ETX A;  4WZ4 A;  4I3I A;  3C30 A;  5DKL A;  3C7U A;  5AQA A;  4IUK A;  4X1M A;  1IFQ A;  1W7F A;  3E0Y A;  3CZD A;  3QP6 A;  3PTE A;  1S1Z A;  1D1J A;  2VX8 A;  3QP2 A;  3RJU A;  3MMH A;  1NLY A;  5GLC A;  2WUQ A;  4JXG A;  2PBD P;  2ZQ7 A;  3E4Q A;  3A3J A;  1KGE A;  3UB5 P;  1H8M A;  2X71 A;  2Y91 A;  3DTK A;  3T1Q B;  3CHW P;  1I2S A;  5J7E A;  1AXB A;  3OC2 A;  4DE2 A;  2WAF A;  4XUZ A;  4OOM A;  4X68 A;  4LV0 A;  1I2W A;  1BLC A;  3VOL A;  3EGX C;  2QJ7 A;  3C8C A;  2JKF A;  5CHU A;  3TE8 A;  3NJA A;  3IXB A;  2HJ9 C;  2A49 A;  2VGJ A;  2ZJ9 A;  4MBK A;  1ESI A;  2QJ5 A;  3MQO A;  1LT0 A;  1YLT A;  1LSV A;  3RXX A;  2QZ6 A;  3C4O A;  2EFU A;  1YKD A;  3OOV A;  3GMW A;  3DWZ A;  1Z09 A;  4Y0U A;  4DMZ A;  3B33 A;  4BEN A;  3GTC A;  1OTD A;  1XP4 A;  3FV7 A;  5AVE A;  1GHP A;  3HL9 A;  3IS2 B;  3AGE A;  3MXS A;  2V8C A;  4PM8 A;  2OV5 A;  4CJN A;  1SKF A;  5FQQ A;  4HBU A;  5DFY A;  1D7E A;  4ZRR A;  3O5Y A;  1PW8 A;  4RX3 A;  2IWC A;  3S7P A;  4Q8I A;  3T4T A;  1W63 M;  2KX6 A;  2J9P A;  2WAE A;  2BAS A;  5F1G A;  1T1C A;  1ERM A;  4NEE D;  5EPH A;  4ZTK A;  4LRX C;  1CJF A;  3WS1 A;  4WLA A;  5FDS A;  3RH8 B;  4XUX A;  2NUT C;  1YLZ A;  4MBH A;  4DDS A;  4ETZ A;  4EES A;  4Z9Q A;  3DTM A;  4I39 A;  4YNR A;  1XX2 A;  2GNX A;  1IOU A;  4QD4 A;  1DP8 A;  3PBS A;  3HLC A;  3UPN A;  4X53 A;  2GJ3 A;  1Y28 A;  4YFM A;  3MZD A;  2P9V B;  3IWO A;  3KO6 A;  2O9B A;  4GDB A;  1A0K A;  1EWZ A;  1BUL A;  1IEM A;  4NK3 A;  3R7W B;  3BFC A;  3FWL A;  2ZD8 A;  4C3Q A;  4JXW A;  1NY0 A;  4N1H A;  3LIC A;  3BQ8 A;  5IS1 A;  4UQI S;  5L8M A;  2XR0 A;  4OOL A;  1CK3 A;  2H10 A;  3PR6 A;  2LB9 A;  2EXB A;  4UHU A;  3CIT A;  1ES4 A;  3E98 A;  5KIZ A;  4H6J B;  3MQ0 A;  2W3H A;  1HZO A;  1IKI A;  4BD1 A;  2P08 A;  3NCK A;  1XJ4 A;  2PDR A;  2Y79 A;  3IWQ A;  2PBY A;  3LEQ A;  2XFS A;  1GSX A;  1K4F A;  1E3U D;  5EM1 A;  2ZOH A;  4WL9 A;  3NDE A;  3AGF A;  3F1N B;  4XT2 B;  2Q9M A;  1C3B A;  2JC7 A;  3JPU A;  2Y2K A;  4IUH A;  4KG6 A;  4C6Y A;  1NRJ A;  3KYE A;  1EW0 A;  3VOZ A;  1CQA A;  4NXE A;  3G31 A;  3GRJ A;  3IH8 A;  5FAO A;  4D2O A;  2PU4 A;  5HW3 A;  5FI2 A;  2WZZ A;  4PM6 A;  3DBA A;  3QHY A;  4WMC D;  4MN5 A;  1G6O A;  1PZO A;  3LUQ A;  3HJK A;  3LR4 A;  3PXP A;  4EBN A;  1S6R A;  3TW8 A;  2JCH A;  2V20 A;  3G4P A;  5DTK A;  4HJ6 A;  4Q0J A;  2OSU A;  5M19 A;  3ZG5 A;  4KZ3 A;  1Q2Q A;  2FZ0 A;  5F83 A;  3LIA A;  4ZJ1 A;  2P9V A;  2R78 A;  4JGO A;  2O9C A;  3CMZ A;  4FOF A;  2LB5 A;  3FG8 A;  4G3V A;  3QP1 A;  3R7W A;  5HWT A;  4LRZ E;  5M1A A;  1V9Z A;  3EQU A;  2EWW A;  5HDD A;  4I3A A;  1GA9 A;  1VEU B;  1OJ5 A;  3ULF A;  4DE1 A;  2Y2L A;  3VP2 A;  4EER A;  2KOI A;  1L0G A;  1TS0 A;  2YKH A;  2ZMF A;  2ZL1 B;  1JWZ A;  2PT7 A;  2WZX A;  5L07 A;  4IVI A;  4H6J A;  2J7V A;  5FSR A;  3MFX A;  4GB7 A;  1MKI A;  3DAV A;  5AQ7 A;  2QYB A;  1VET A;  2Y2O A;  3P7N A;  2Y2N A;  3CLO A;  4MNR A;  4P85 A;  1T1A A;  4OQ0 A;  1ESU A;  1CI8 A;  2PYR A;  3LIF A;  3HUO A;  3S7N A;  5FQJ A;  1SCW A;  4O7D A;  4XT2 A;  2ZMV A;  1KGG A;  5DVA A;  3BW6 A;  1ONG A;  2IA2 A;  3GV9 A;  3D3O A;  3LCE A;  2PYP A;  5FI7 A;  5EE8 A;  4ARZ A;  4JLF A;  2JKT I;  2DCF A;  4O8G A;  5E2G A;  1S4S A;  5FA7 A;  2VA0 A;  1NXY A;  3NIA A;  4RX2 A;  2KDK A;  5F68 A;  2XRO A;  3BY9 A;  4HES A;  1TEM A;  2C5W B;  4ID4 A;  2INW A;  2E8J A;  4R6L A;  1ZHH B;  4ZBE A;  4BLM A;  2RCX A;  3FKW A;  3FPV A;  2ZC4 B;  3MBZ A;  3LGO A;  3BEC A;  1I5Q A;  2J3T C;  1DY6 A;  3A3E A;  3A3D A;  3UPP A;  3N4I A;  1T18 A;  2V0W A;  3V5M A;  3F1O B;  4X55 A;  4Y15 A;  4EWF A;  3UB7 A;  4E04 A;  3LR5 A;  4Q0H A;  3TRC A;  1J3W A;  4II7 A;  5KMW A;  1VEU A;  4EXO A;  4N92 A;  2VJW A;  3W4Q A;  3LEZ A;  2ACG A;  4B88 A;  5A90 A;  4KZ8 A;  5CHM A;  3T1X A;  3HRE A;  2WGI A;  2NUP C;  5DF8 A;  2X01 A;  1OTI A;  1MXO A;  4DDY A;  5AQB A;  1YSQ A;  1X0O A;  1XJ6 A;  1IEL A;  3GSG A;  5GLD A;  3UY6 A;  4Y0T A;  4UAA A;  3T1R A;  3H82 A;  1OJG A;  3T4L A;  3LI8 A;  2IWD A;  3BFG A;  2L1M A;  3NBL A;  5J3W A;  3SS5 A;  4M3K A;  5IU1 A;  3LY4 A;  3MR0 A;  4WZ5 A;  2ZC6 B;  1CI9 A;  4R4S A;  3GDI A;  3D9Y A;  3SS3 A;  3NOU C;  4WM9 A;  3UE6 A;  2OWH A;  3LFV A;  3NUL A;  1SDN A;  1KDW A;  1OT9 A;  4G3K A;  1TS8 A;  3ISG A;  1DRM A;  3IT9 A;  2Y2P A;  1TVF A;  4EU0 A;  2ZC5 B;  1ALQ A;  3IBR A;  2HDS A;  2WKP A;  3LO7 A;  1YLJ A;  2D01 A;  5GLA A;  3PBR A;  3OPP A;  4HIA A;  3HCY A;  2V0U A;  2MJ6 A;  2IWB A;  2JBF A;  4WEL A;  3M6B A;  5A91 A;  3BJN A;  5M18 A;  2XGN A;  3T4S A;  5CER A;  2P7J A;  1IYS A;  4E3O A;  3IF5 A;  1W79 A;  5I5L A;  3F1O A;  1BLP A;  4HEF A;  5HDS A;  3GQZ A;  3NOT C;  4LV3 A;  1N9N A;  1W8Q A;  4NXF A;  1N9O A;  3MKF A;  1K4E A;  1K6R A;  1HD8 A;  4QY6 A;  4GW9 A;  4BBT A;  1K25 A;  3LYX A;  4HNB A;  2VV8 A;  3FYZ A;  1H8Y A;  4JF6 A;  4KEN B;  1P0Z A;  5F5Y A;  2W0N A;  4EQ1 A;  1BT5 A;  3CG5 A;  1PWG A;  3IQA A;  3CAX A;  3TJZ C;  2VGK A;  5TGF A;  4E3I A;  5HL1 A;  2O0Y A;  1NYM A;  2W27 A;  1XJ3 A;  1TS6 A;  2C6W B;  5EVI D;  3ZG9 B;  3F1P B;  3ZVT A;  3MS6 A;  2Y2J A;  4UA6 A;  3BFE A;  1UWP X;  4WN5 A;  3DWK A;  1FR6 A;  3UO9 A;  4RYE A;  2HP5 A;  4K08 A;  5HDC A;  3HLB A;  3UE0 A;  3H7W B;  2VK3 A;  1YSP A;  3V3S A;  4CLC D;  4B4Z A;  2W1T B;  3EEA A;  5JYP A;  4LFU A;  4P0M A;  2VEA A;  4NXB A;  3FC7 A;  1ZTU A;  2B02 A;  1T19 A;  3ZNY A;  1OPX A;  2J9O A;  3T4J A;  2OWJ A;  3LIB A;  3WS4 A;  3CI6 A;  1ODV A;  2ZQD A;  4S2N C;  4OP5 A;  3IWI A;  3OZH A;  1H5X A;  5CED A;  2XDM A;  2WGW B;  1KVM A;  4BL2 A;  2W1R A;  4PPR A;  4MMN A;  3NHQ A;  3N8S A;  4M4X A;  2BTF P;  4BQM A;  2XH9 A;  5U47 A;  3TG9 A;  3OPR A;  4RVA A;  4GNU A;  4R0Q A;  4NET A;  4CLC C;  4HP4 A;  1K55 A;  1F2K A;  4ZJ3 A;  3LIE A;  1NZU A;  2VLG A;  3G6O A;  2Z2L B;  1KVL A;  1FSW A;  3T4O A;  4R3A A;  4DKI A;  2Y2I A;  4WEK A;  3PAG A;  1Y54 A;  2V8F A;  3OPL A;  3Q82 A;  3S4X A;  2X02 A;  3S7Q A;  3W2Z A;  3VSK A;  3F1P A;  3MZF A;  5C5K A;  2W3D A;  2QKP A;  5F6A A;  1UWN X;  1ES2 A;  5TJJ A;  1TS7 A;  2J80 A;  2RL3 A;  1ERQ A;  1WYB A;  3ITA A;  1OT6 A;  3WS0 A;  2WKR A;  5DFX A;  3O86 A;  1PNE A;  1EI5 A;  1Z6F A;  4X56 A;  1YLY A;  4JXS A;  4LCL A;  2EWV A;  1S67 L;  4MCW A;  4BBV A;  1CEG A;  1M40 A;  1MWT A;  2EX6 A;  5EV0 A;  1FQG A;  2Y55 A;  1WA9 A;  4Y17 A;  2VV6 A;  1KE3 A;  4OLD A;  5HWV A;  3E4O A;  4EW7 A;  1GA0 A;  1BYW A;  3KSG A;  4EBP A;  4OVD A;  3HBR A;  1DP9 A;  3IS2 A;  2P74 A;  3PBQ A;  3Q7V B;  1IKG A;  1GHI A;  2ZMA A;  2HZ5 A;  2ZQ8 A;  2ZBB A;  2K31 A;  3A0R A;  4K0X A;  5FEF A;  3I7J A;  5EM0 A;  1OTB A;  2Z2M B;  1CF0 A;  1MPL A;  2XF3 A;  3ZQ5 A;  5EOO A;  3V67 A;  4Y7P A;  3A3F A;  4QU3 A;  3CUE C;  3HUN A;  4KQQ A;  4OPY A;  2G2U A;  4OP8 A;  5GHY A;  3UPO A;  2M1C A;  1XKZ A;  3MQQ A;  4K0W A;  1MWR A;  2ZQA A;  4LEN A;  2EXA A;  4BWI A;  2H0Y A;  4S2L A;  5EUA A;  3W4P A;  2FFF B;  5A93 A;  1K57 C;  2XQZ A;  3BEB A;  5HZH A;  4Y2F A;  1MWS A;  4PM9 A;  3HLE A;  5HAR A;  3BM6 A;  3M6H A;  1HLU P;  1P9W A;  1YT4 A;  2YKF A;  3VFH A;  2VKS A;  3PBT A;  2JKR M;  4KQO A;  3SS4 A;  3BWL A;  1FR1 A;  2O9A A;  3MJQ A;  3W4O A;  4KUO A;  1ACF A;  3WS2 A;  3HLG A;  3VE3 A;  5CXW A;  4JGQ A;  3SZT A;  3OCN A;  1MBL A;  1FIL A;  1MWU A;  2EX2 A;  4PKY G;  5FEG A;  4DF6 A;  4EV4 A;  3E2K A;  4HQA A;  3Q07 A;  2Y2G A;  4E3J A;  3MSH A;  2WYX A;  4Y0O A;  4IJG A;  1ZC2 A;  5CGW A;  3Q7V A;  5EOE A;  5EVL A;  5F1F A;  3E4P A;  4WF0 A;  4JXV A;  4I38 A;  3F1N A;  3BYD A;  1XXM A;  1LLB A;  3P98 A;  4DE0 A;  5CHJ A;  5G4Y A;  1S0W A;  3RTY A;  1FCM A;  2WKE A;  3NOP C;  3WRZ A;  1H8Z A;  4HI4 A;  5L09 A;  1W8Y A;  4BJP A;  5A8B A;  3C2W A;  1IYQ A;  1Q2P A;  1Y4O A;  3UDI A;  2JE5 A;  3V3R A;  3U2A A;  2HP6 A;  1O07 A;  4AFI A;  4X69 A;  2Y2H A;  3BFD A;  2EX9 A;  3OLO A;  5FQK A;  4WEJ A;  3VSL A;  2GX5 A;  4RA7 A;  2CMN A;  1LL8 A;  5FAT A;  4EQI A;  3W8K A;  1KDS A;  2BLS A;  1OTA A;  1P9R A;  1YQS A;  1DJB A;  4GOG A;  4NXG A;  2L4R A;  4PM5 A;  4R4R A;  5BOH A;  1GSV A;  5TBM B;  2PHY A;  3PBN A;  1PWD A;  4QWO A;  1ES5 A;  2UV0 E;  1FOF A;  2EFX A;  1E4D A;  1MZU A;  2XLN A;  1YMX A;  1KGF A;  4HY8 A;  1ONH A;  3IHA A;  3WRT A;  3ZNT A;  1XJ2 A;  1JWV A;  4OPZ A;  3FZC A;  4FD8 A;  4IBX A;  1BLH A;  2ZL1 A;  4QB8 A;  3WWX A;  5J8X A;  2B5R A;  3JVV A;  3T12 B;  1K38 A;  3NEC A;  3S22 A;  1XFN A;  4G3W A;  2QHK A;  5F82 A;  4OQI A;  4GN2 A;  4B4X A;  1K0K A;  2EX8 A;  4KZ4 A;  2P04 A;  1AWI A;  3VE4 A;  4LRY C;  5HX9 A;  5L2F A;  4R1G A;  4Y13 A;  2B18 A;  2PAV P;  1LL9 A;  3K3D A;  1KOU A;  2FFY A;  1WE4 A;  5CGS A;  4PHT A;  1STZ A;  3IX4 A;  1G68 A;  1BUE A;  3RXW A;  5KZH A;  3BRM A;  4P6Z S;  2KLI A;  2I9V A;  2QWS A;  4EET B;  1NRF A;  1RCJ A;  4L9E A;  4FH4 A;  1IYP A;  3O3V A;  4S2K A;  1QME A;  2QMI A;  4HOI A;  4N1X A;  4R38 A;  4JF4 A;  5FAQ A;  3Q7Z A;  4GD6 A;  5G18 A;  4BL3 A;  5CGX A;  3D4F A;  2D02 A;  3UE1 A;  4JPM A;  4L9G A;  5GHX A;  2EA9 A;  2ZM2 A;  2PR6 A;  2VGL S;  3DW0 A;  4LCM A;  3HUM A;  2ZLY A;  2HJE A;  4OPQ A;  1RGY A;  5TBM A;  3KSF A;  2J8Y A;  4DJ2 A;  3IXH A;  2O99 A;  3GEC A;  4FTX A;  1DP6 A;  1E25 A;  1ZG6 A;  4UQI M;  2A3U A;  1F5M A;  2W3E A;  1LI9 A;  4MN7 A;  3CWF A;  4JKT A;  3IF6 C;  1DJC A;  1YPR A;  2FH5 A;  3BLM A;  4L9F A;  1J9M A;  4KZ7 A;  1WYC A;  3PAE A;  3P01 A;  1QMF A;  4S2N A;  3EOI A;  5GLB A;  5GHZ A;  1G5U A;  5HL6 A;  2AVX A;  1PWC A;  4E3K A;  2VZW A;  3RFB A;  3SH7 A;  1BLS A;  4DRT A;  3N8L A;  3S1Y A;  3EWK A;  2JN7 A;  3C4P A;  5KSC A;  5FAS A;  5HFO A;  3N6I A;  1XPB A;  4ZDX A;  3PBO A;  1TDG A;  3UMD A;  5AJG A;  4KQD A;  1H0M A;  3O87 A;  5IHV A;  4R70 A;  1JTD A;  1L3L A;  1K54 C;  3EEH A;  4IBR A;  4YWZ A;  2ZC7 A;  3G32 A;  4BBU A;  1G6A A;  4I5S A;  2XA7 S;  4YOF A;  1G28 A;  3C38 A;  4QJG A;  2B95 A;  1L0E A;  2OAQ 1;  4WZ5 C;  5TFQ A;  4R3J A;  5CTN A;  3BY8 A;  1M6K A;  4OPR A;  1OME A;  2A24 B;  4JF5 A;  3EQV A;  4S2O A;  3L7H A;  4H8R A;  2Z6C A;  2V1B A;  3NI9 A;  4DN0 A;  4FUW A;  1L2S A;  1TD5 A;  1W63 Q;  2CC1 A;  3VMA A;  2V1A A;  4IED A;  5FDH A;  3IXD A;  4CQH A;  4CPK A;  2WK0 A;  5EVI C;  4L0L A;  3VOY A;  2BG1 A;  1JVJ A;  1N4O A;  1XA7 A;  2Y59 A;  4FSF A;  5HSQ A;  4OKP A;  3IHB A;  3VP1 A;  4UA9 A;  3NY4 A;  3UNW A;  1S1Y A;  2Q9N A;  5GL9 A;  4WBG A;  1T1B A;  3UME A;  1F98 A;  5DJT A;  4QHC A;  5FQ9 A;  1PZP A;  3B3X A;  5CTM A;  1CEF A;  2H28 A;  3QP5 A;  3C7V A;  2M7U A;  2HGV A;  1VB6 A;  1SDE A;  5E2H A;  4N9L A;  1U60 A;  2DMW A;  2JKG A;  3N7W A;  4S2P A;  2WGV A;  4P6B A;  2J3W A;  4GDN A;  3T1S A;  3VP4 A;  3L9K A;  3ZFZ A;  4F94 A;  4PAU A;  2WKQ A;  1IYO A;  5FQM A;  1YAX A;  2K7S A;  4EUV A;  3ZG7 B;  2H5S A;  2ZC3 B;  5KSH A;  2XSS A;  5JYO A;  3ZG0 A;  4LV2 A;  4YIN A;  1K56 A;  3AGD A;  1PW1 A;  1ERO A;  1LL5 A;  3CUE A;  1XFQ A;  4X25 A;  1SKO B;  3LI9 A;  5HD3 A;  3ZCZ A;  3QP4 A;  1MKM A;  1KE0 A;  2OLU A;  3T4K A;  1RGZ A;  1E3U A;  2G7U A;  4OQG A;  2ZQ9 A;  3UB8 A;  4KZ9 A;  4O0P A;  2A24 A;  3KSI A;  4NKP A;  2XD1 A;  4U0X A;  3MFD A;  4QY5 A;  1K57 A;  4PMA A;  3H7W A;  1NWZ A;  4Q0I A;  1ES3 A;  4OON A;  2W1T A;  4KUK A;  4R23 A;  3DTE A;  3V50 A;  4Y5F A;  4MBF A;  2A2L A;  2WKH A;  4HJ4 A;  4FCF A;  4BD0 A;  4E3M A;  2VV7 A;  1L0F A;  2DNS A;  1V9Y A;  3G34 A;  4D60 A;  5DTT A;  4S2J A;  3NC8 A;  4WMC A;  4FH2 A;  5DF9 A;  1SHV A;  2WGW A;  4LGW A;  2JKT M;  4Y3I A;  4MLL A;  5DKK A;  2UWX A;  3PHY A;  3R4K A;  2ZM0 A;  3IX8 A;  1K56 D;  1PI5 A;  4GJ4 A;  1VET B;  4KZ6 A;  3CJM A;  4PKY A;  5MC7 A;  4B93 A;  1K55 C;  5EFW A;  3LR0 A;  5I94 A;  3Q1F A;  3MKE A;  3PYP A;  1YLW A;  2OOL A;  3CPT B;  4KQR A;  3H9W A;  5IT5 A;  4P6Z M;  1YLP A;  3HLD A;  4GD8 A;  2ZOI A;  2W3G A;  3MXR A;  4KZB A;  1DJA A;  2HF6 A;  3KSH A;  3SH9 A;  3LY3 A;  4ARZ B;  2PR5 A;  4KZA A;  1SKO A;  1JNU A;  4IHQ A;  1H3Q A;  1S4R A;  4HP9 A;  4WUJ A;  4E3L A;  4A5R A;  2VGL M;  4B9O A;  3ZGA B;  1FCN A;  2R9W A;  3HLW A;  4KG5 A;  3TSG A;  4EBL A;  3NDG A;  2PU2 A;  3SH8 A;  3G35 A;  1BSG A;  2ZM8 A;  3M2K A;  5HAQ A;  4E3N A;  5TR7 A;  4OOY A;  3T50 A;  1XGI A;  3FPW A;  5EVE A;  3IF6 B;  1PFL A;  5HPF A;  2XRN A;  4I3J A;  5G4Z A;  3M2J A;  4R3B A;  4OH0 A;  4DJ3 A;  2Z6D A;  1MC0 A;  1PRQ A;  3KX0 X;  4E6W A;  2R9X A;  3G30 A;  1PI4 A;  1RP5 A;  1VM1 A;  4DE3 A;  1MY8 A;  4CLC E;  2DRW A;  4HJ3 A;  3K3C A;  3VFF A;  4K91 A;  2OAP 1;  2WAD A;  1P97 A;  5E43 A;  2WKI A;  4JBF A;  1K6S A;  4S2M A;  1F9I A;  5D3O A;  4EEP A;  4N9K A;  1NYY A;  1LSX A;  4GKU A;  1TF1 A;  4O01 A;  4U3T A;  3H82 B;  3ZG8 B;  3CPT A;  4ESP A;  3ZHH A;  5FQI A;  2HDR A;  4GHI B;  2XA7 M;  5CX7 A;  3UDF A;  1VHM A;  2PRF A;  4BMW A;  4GCZ A;  2J3T D;  4HHD A;  1NJ4 A;  2V9A A;  4OLG A;  3VP0 A;  4F3L B;  3N8R A;  3SW1 A;  1FIK A;  5J4E A;  1N9B A;  5AQ9 A;  3MXQ A;  2Y4A A;  3BLS A;  3QNC A;  3G2Y A;  3ZYT A;  4GS9 B;  2JHE A;  3IH9 A;  5FI6 A;  4EUZ A;  3HLF A;  1JTG A;  3IBJ A;  5LBR A;  1YMS A;  5HWW A;  3OBF A;  5DF7 A;  2H0T A;  5CEC A;  5E2E A;  3IXG A;  3S7O A;  5EVI B;  2M7V A;  4HBT A;  1FSY A;  3U4L P;  3VV4 A;  3ICY A;  2XFT A;  3HJI A;  4UA7 A;  2HV1 A;  3FKV A;  3IF6 A;  5FAP A;  5F69 A;  3LID A;  3TOI A;  3JVU A;  2PD8 A;  5DTS A;  2ZQC A;  4X1L A;  4LLO B;  3UDX A;  1LHY A;  3C5A A;  2OLV A;  4DXB A;  1VQQ A;  4ZJ2 A;  3O88 A;  4PM7 A;  2Y2M A;  1GSW A;  3K2N A;  4OQH A;  4CLC B;  1XGJ A;  1ZG4 A;  1LSW A;  3D72 A;  1BZA A;  4GLQ A;  3QNB A;  2I72 A;  2G2W A;  4LV1 A;  3SOI A;  1LI0 A;  1GCE A;  2HDQ A;  5EEC A;  2PD7 A;  2GZA A;  2JKR I;  4ME4 A;  5HPI A;  4LPZ A;  3KYZ A;  2XEP A;  2GDN A;  3HVF A;  2Y8H A;  3V39 A;  1PIO A;  3LR3 A;  1K54 A;  3ZVW A;  4U0T A;  5FL3 A;  3OCL A;  3UN7 A;  3OPH A;  4GHI A;  3MZE A;  4QPR A;  1GHM A;  3T4Q A;  5AVF A;  5HAP A;  4MEZ A;  1YM1 A;  1PYY A;  1N9L A;  1JWP A;  4GZB A;  5L10 A;  3GVB A;  1W5D A;  4UEY A;  2HPB A;  1XA1 A;  4JGP A;  3ZDJ A;  3EGD C;  4C75 A;  3UE3 A;  3UB6 A;  1HVB A;  1D06 A;  4MDZ A;  1O7E A;  1ZKJ A;  1NLZ A;  3P09 A;  4E6X A;  4F3L A;  3KYQ A;  2L0W A;  1NZO A;  3IX3 A;  2XK1 A;  4IVK A;  2V2F F;  4GS9 A;  1TDL A;  5CEB A;  3G2Z A;  3DTI A;  3Q81 A;  3A0V A;  3JYI A;  4ZAM A;  5HD5 A;  3A3I A;  3B47 A;  5K5B A;  4X6T A;  4XXR A;  4HH3 A;  1L0D A;  1FCO A;  4S2I A;  4NG2 A;  3UB9 A;  2Y2Q A;  4Z1W A;  5EVI A;  2E8I A;  3WS5 A;  3B42 A; 
#chains in the Genus database with same CATH homology
 3BY9 A;  2H28 A;  4JGR A;  3CUE C;  2INW A;  2M7U A;  2HGV A;  1VB6 A;  4R6L A;  5DJU A;  1ZHH B;  2DMW A;  2M1C A;  4RQ9 A;  3A0S A;  3FPV A;  1OTE A;  2J3W A;  3MQQ A;  4PAU A;  2WKQ A;  2K2N A;  2J3T C;  1YAX A;  2K7S A;  4EUV A;  1T18 A;  2V0W A;  4BWI A;  3F1O B;  3BQA A;  3UB7 A;  4CLC A;  1UGU A;  4MN6 A;  1S66 L;  2XSS A;  4E04 A;  4EEU A;  3LR5 A;  3MF0 A;  5KSH A;  4Q0H A;  3TRC A;  4Y2F A;  5HZH A;  4II7 A;  2W3F A;  3CUE A;  4HH2 A;  1XFQ A;  3LI9 A;  5HD3 A;  4ETX A;  4EXO A;  2VJW A;  1P9W A;  1MKM A;  4I3I A;  3C30 A;  5DKL A;  3T4K A;  2YKF A;  2VKS A;  3PBT A;  2JKR M;  2G7U A;  4KQO A;  3BWL A;  2O9A A;  3MJQ A;  3UB8 A;  4IUK A;  4KUO A;  4O0P A;  2A24 A;  3KSI A;  2NUP C;  1IFQ A;  4NKP A;  3VE3 A;  1OTI A;  3E0Y A;  4JGQ A;  1YSQ A;  1X0O A;  3OCN A;  1S1Z A;  1XJ6 A;  3H7W A;  1NWZ A;  2VX8 A;  4Q0I A;  4PKY G;  2W1T A;  3MMH A;  1NLY A;  4KUK A;  3E4Q A;  4HQA A;  3H82 A;  4Y5F A;  1OJG A;  2A2L A;  4HJ4 A;  3T4L A;  2VV7 A;  3LI8 A;  1H8M A;  1V9Y A;  4IJG A;  2L1M A;  5J3W A;  5IU1 A;  5J7E A;  3MR0 A;  3E4P A;  3OC2 A;  4WF0 A;  3GDI A;  4I38 A;  3F1N A;  5DF9 A;  4OOM A;  3NOU C;  2JKT M;  4Y3I A;  3UE6 A;  2OWH A;  3LFV A;  3VOL A;  3EGX C;  5G4Y A;  2QJ7 A;  3C8C A;  5DKK A;  3RTY A;  3PHY A;  1OT9 A;  3R4K A;  3NOP C;  4G3K A;  3TE8 A;  3NJA A;  1TS8 A;  4HI4 A;  1DRM A;  2HJ9 C;  4GJ4 A;  4BJP A;  5A8B A;  3C2W A;  2QJ5 A;  4EU0 A;  3MQO A;  3IBR A;  2WKP A;  1LT0 A;  2D01 A;  4PKY A;  3U2A A;  1LSV A;  3PBR A;  4HIA A;  5MC7 A;  4AFI A;  4B93 A;  3HCY A;  1YKD A;  5EFW A;  3OLO A;  3OOV A;  2V0U A;  2MJ6 A;  4WEJ A;  3LR0 A;  2GX5 A;  3B33 A;  4WEL A;  4DMZ A;  3BJN A;  2CMN A;  3PYP A;  1LL8 A;  3T4S A;  1OTD A;  2OOL A;  5AVE A;  1OTA A;  1P9R A;  2P7J A;  3H9W A;  5IT5 A;  4P6Z M;  3IS2 B;  4NXG A;  2L4R A;  5I5L A;  2ZOI A;  3F1O A;  2W3G A;  2HF6 A;  1GSV A;  5HDS A;  5TBM B;  2PHY A;  3KSH A;  3NOT C;  5DFY A;  1D7E A;  3PBN A;  3O5Y A;  4ZRR A;  4ARZ B;  1N9N A;  2PR5 A;  4NXF A;  1N9O A;  1JNU A;  3S7P A;  4IHQ A;  1S4R A;  1H3Q A;  3T4T A;  1W63 M;  2KX6 A;  4HP9 A;  1MZU A;  2BAS A;  4WUJ A;  1T1C A;  4NEE D;  4GW9 A;  4HY8 A;  4BBT A;  4LRX C;  3LYX A;  4HNB A;  2VV8 A;  2VGL M;  4B9O A;  1XJ2 A;  4WLA A;  3RH8 B;  2NUT C;  4ETZ A;  4EES A;  1P0Z A;  3JVV A;  5F5Y A;  2W0N A;  4EQ1 A;  1XFN A;  4G3W A;  2QHK A;  4I39 A;  4YNR A;  3CAX A;  3T50 A;  3FPW A;  3TJZ C;  2GNX A;  1IOU A;  2P04 A;  3VE4 A;  4LRY C;  5HPF A;  1DP8 A;  3PBS A;  2O0Y A;  2XRN A;  2W27 A;  4I3J A;  5G4Z A;  2B18 A;  2GJ3 A;  1XJ3 A;  1Y28 A;  1TS6 A;  3K3D A;  1KOU A;  4DJ3 A;  3KO6 A;  2O9B A;  2Z6D A;  1MC0 A;  4PHT A;  3KX0 X;  1STZ A;  3F1P B;  3R7W B;  4CLC E;  1UWP X;  4P6Z S;  2KLI A;  3LIC A;  3BQ8 A;  5IS1 A;  4WN5 A;  2I9V A;  2QWS A;  4UQI S;  4HJ3 A;  5L8M A;  3K3C A;  4EET B;  5HDC A;  2OAP 1;  4K08 A;  4OOL A;  4L9E A;  1P97 A;  3PR6 A;  2LB9 A;  3H7W B;  1F9I A;  4EEP A;  3CIT A;  3E98 A;  5KIZ A;  4H6J B;  4HOI A;  1LSX A;  4R38 A;  1TF1 A;  1YSP A;  3MQ0 A;  2W3H A;  4CLC D;  2W1T B;  3EEA A;  4O01 A;  2P08 A;  2D02 A;  3H82 B;  4L9G A;  2VEA A;  4NXB A;  2EA9 A;  1XJ4 A;  2PR6 A;  1ZTU A;  2PDR A;  3FC7 A;  2B02 A;  1T19 A;  2Y79 A;  1OPX A;  3T4J A;  2OWJ A;  2VGL S;  3LIB A;  4GHI B;  3CI6 A;  1ODV A;  2XA7 M;  1GSX A;  5CX7 A;  2HJE A;  1VHM A;  2ZOH A;  4GCZ A;  4WL9 A;  4BMW A;  2J3T D;  5TBM A;  4HHD A;  3KSF A;  4DJ2 A;  3F1N B;  2V9A A;  4XT2 B;  2O99 A;  3GEC A;  1DP6 A;  4IUH A;  2W1R A;  4UQI M;  1NRJ A;  1F5M A;  2W3E A;  4MMN A;  4F3L B;  3NHQ A;  3SW1 A;  5J4E A;  1EW0 A;  4MN7 A;  3MXQ A;  4M4X A;  3CWF A;  3ZYT A;  2FH5 A;  4L9F A;  4GS9 B;  4NXE A;  2JHE A;  3IBJ A;  4CLC C;  5LBR A;  5HWW A;  3P01 A;  4HP4 A;  3EOI A;  3OBF A;  3LIE A;  2VLG A;  3G6O A;  5HL6 A;  3S7O A;  3T4O A;  3DBA A;  4R3A A;  2M7V A;  4MN5 A;  1G6O A;  2VZW A;  3LUQ A;  3RFB A;  3HJK A;  3LR4 A;  3ICY A;  3PXP A;  3VV4 A;  3HJI A;  3TW8 A;  2HV1 A;  4HJ6 A;  4Q0J A;  4WEK A;  3EWK A;  3LID A;  5F69 A;  2JN7 A;  3JVU A;  2FZ0 A;  2PD8 A;  3PBO A;  3LIA A;  3UMD A;  2R78 A;  4LLO B;  5AJG A;  4JGO A;  4KQD A;  3S7Q A;  2O9C A;  3W2Z A;  1GSW A;  2LB5 A;  3F1P A;  3K2N A;  4FOF A;  4R70 A;  5C5K A;  2W3D A;  2QKP A;  3FG8 A;  5F6A A;  3EEH A;  4G3V A;  4YWZ A;  1UWN X;  5TJJ A;  3R7W A;  4CLC B;  1TS7 A;  4BBU A;  2J80 A;  5HWT A;  4LRZ E;  1V9Z A;  1LSW A;  3EQU A;  3D72 A;  2EWW A;  4GLQ A;  5HDD A;  4I3A A;  1OT6 A;  4I5S A;  2WKR A;  2XA7 S;  1OJ5 A;  4YOF A;  5DFX A;  3ULF A;  1G28 A;  2KOI A;  3C38 A;  4EER A;  1TS0 A;  2OAQ 1;  2YKH A;  2ZMF A;  2PD7 A;  2GZA A;  2JKR I;  4ME4 A;  5HPI A;  2PT7 A;  4LPZ A;  3BY8 A;  4H6J A;  2EWV A;  3KYZ A;  3MFX A;  2A24 B;  3EQV A;  2Y8H A;  1S67 L;  3LR3 A;  4MCW A;  4BBV A;  2QYB A;  2Z6C A;  2V1B A;  3P7N A;  5FL3 A;  3CLO A;  1WA9 A;  3OCL A;  4DN0 A;  2VV6 A;  1T1A A;  4GHI A;  4QPR A;  3T4Q A;  1TD5 A;  5AVF A;  1W63 Q;  2PYR A;  1N9L A;  3LIF A;  5HWV A;  3S7N A;  3E4O A;  4EW7 A;  2V1A A;  4UEY A;  1BYW A;  3KSG A;  4XT2 A;  4CQH A;  4JGP A;  2ZMV A;  1DP9 A;  3EGD C;  3BW6 A;  3IS2 A;  3UE3 A;  4L0L A;  2IA2 A;  3UB6 A;  3PBQ A;  1D06 A;  4MDZ A;  4F3L A;  1NLZ A;  3KYQ A;  3D3O A;  2L0W A;  2PYP A;  2K31 A;  2ZBB A;  4FSF A;  5HSQ A;  3A0R A;  4GS9 A;  4ARZ A;  2JKT I;  3A0V A;  4O8G A;  5HD5 A;  5K5B A;  1OTB A;  3B47 A;  4HH3 A;  1S4S A;  2VA0 A;  1S1Y A;  1T1B A;  3UME A;  1F98 A;  3UB9 A;  5DJT A;  2KDK A;  5F68 A;  4Z1W A;  2XRO A;  3ZQ5 A;  3V67 A;  3B42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...