4Z9QA

Crystal structure of oxa-58 with disordered active site
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
242
structure length
223
Chain Sequence
SIIDQNVQALFNEISADAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFIANALIGLENHKATSTEIFKWDGKPRTVPVYQELARRIGPSLMQSELQRIGYGNMQIGTEVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQQVKEMLYVERRGENRLYAKSGWGMAVDPQVGWYVGFVEKADGQVVAFALNMQMKAGDDIALRKQLSLDVLDKLGVFHY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of OXA-58 with disordered active site
rcsb
source organism Acinetobacter baumannii acicu
molecule tags Hydrolase
molecule keywords Beta-lactamase OXA-58
total genus 68
structure length 223
sequence length 242
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4z9qA00
4OOYA 4WM9A 4DKIA 1ES4A 3IF6C 3VP1A 4WMCD 3ZG0A 1E4DA 1SDEA 1KGFA 1NY0A 2ZC5B 1NYMA 4BD0A 4BLMA 4DRTA 2Y2LA 1GCEA 2HP6A 3JYIA 4S2NA 4XUXA 5HAQA 4EV4A 5FQKA 2XEPA 5HW3A 4S2MA 2WAEA 2HDSA 3HREA 5L2FA 1BLCA 2Q9NA 4KG2A 3IXDA 1AXBA 4GDBA 2XLNA 1MWUA 4KENB 2RCXA 1CK3A 4LCMA 5FQQA 3P98A 1RGYA 5GLBA 3E2KA 3O88A 1FR6A 4KZ6A 4BENA 4N9KA 5TGFA 3S22A 4OP8A 3A3DA 4KG5A 4PM8A 1K57A 3GV9A 3G34A 4Y0OA 1BTLA 4WBGA 4Y0TA 1K57C 2FFYA 1K6SA 3PTEA 3BFGA 4X68A 3FKWA 3V3SA 4JKTA 4QD4A 1L2SA 1PWDA 1E3UD 3OPLA 1K4EA 3HLFA 4N1HA 2EXAA 1LHYA 3N8RA 3SS5A 1M6KA 1NYYA 2FFFB 1ZG6A 4N92A 1FOFA 1H8ZA 2XF3A 3MZFA 1KE0A 3D4FA 4U0XA 1YQSA 2P9VB 2QPNA 3WS2A 3N6IA 2H0TA 2XD1A 4IBXA 1XX2A 3C4OA 4YINA 2IWBA 5CECA 4LENA 3UDIA 2J8YA 3AGFA 1K25A 2DRWA 4KZAA 4P0MA 1JVJA 3VFHA 3WWXA 5CTNA 4QHCA 2HDQA 4X56A 3ZVTA 4KZ9A 1W8YA 2Z2LB 2PU4A 4N9LA 3OCNA 1MXOA 2WZXA 1DY6A 4KZ4A 1W8QA 2E8IA 2Y2HA 4FH2A 4M3KA 5I94A 4X55A 3LO7A 3HUMA 2OLUA 4DDSA 1CI8A 4LV3A 2HP5A 3Q7VB 5AQ9A 2HP9A 4IEDA 3UDFA 1BUEA 4R1GA 3C7UA 4LV0A 2XQZA 2IWDA 2PU2A 2WAFA 4E3OA 3C7VA 2RL3A 4LV2A 1GHIA 2ZQCA 4JXWA 1K55A 1MBLA 4OPRA 3OC2A 1RCJA 4MNRA 4GD8A 3ZG9B 3ZFZA 2UWXA 4H8RA 1K55C 1DJCA 5AQBA 1QMEA 2X71A 1C3BA 2ZQ8A 5E2HA 2G2UA 2Z2MB 3IWOA 2Y2MA 4S2IA 3ITBA 4PM5A 3OPHA 4R4SA 4BQMA 2WZZA 2JBFA 3B3XA 5KMWA 2XFTA 1BT5A 1KE4A 5F1GA 3W4OA 4LV1A 3G32A 1SDNA 3OPPA 1YMXA 1Z6FA 5D3OA 4DE3A 3GR2A 2EXBA 2Y2KA 3G30A 4E3LA 3V5MA 2A3UA 2I72A 4RYEA 1ES5A 2ZJ9A 2Y59A 3GRJA 1EWZA 3V39A 4JXSA 1E25A 3Q81A 5FQIA 5M1AA 5JYOA 1Y54A 3G2YA 1PI5A 4Y0UA 1BZAA 4KQRA 4WEJA 4F94A 1LI9A 2ZM0A 5BOHA 1HVBA 3FZCA 5FQ9A 1KGEA 2Y2NA 4GOGA 4MLLA 5DF9A 5KSCA 1PW8A 4A5RA 4Q8IA 4ZTKA 2G2WA 3CJMA 3QHYA 4LCLA 2HDRA 1JTDA 4JPMA 5HAPA 2V2FF 4N1XA 3M2KA 1FCMA 4GZBA 2OSUA 4ID4A 4OLDA 1TEMA 4P85A 3ZNYA 3O87A 1IYQA 5F1FA 3PBSA 4X53A 1GA9A 1K4FA 3MBZA 4X69A 4E3KA 4PM6A 5EVIA 2PBYA 3FV7A 2X01A 5FI7A 4NK3A 4EUZA 5CHMA 5EOEA 2WYXA 1LL9A 5EVIB 5FQMA 2XR0A 4Y7PA 1XPBA 2XGNA 3PBNA 4UHUA 3ZG8B 4E3NA 2Y55A 2XFSA 1JTGA 4RA7A 1IYOA 1L0EA 1WE4A 4QU3A 4IBRA 4IVIA 4GDNA 3O86A 5EPHA 3UE1A 3VOYA 2CC1A 3PAGA 4JF6A 5DF8A 2WK0A 5EUAA 4DDYA 3SS4A 1SKFA 3IHAA 2ZM2A 3HLEA 3IF5A 4RVAA 1N4OA 3HLGA 1YT4A 2OV5A 3WRTA 3FKVA 4R3JA 3E2LA 2ZQ9A 3IF6A 1FSWA 4HEFA 2V20A 4E3JA 2WKIA 1EROA 1I2WA 1SHVA 4FSFA 4X6TA 4L0LA 2DNSA 2EX9A 1LI0A 3BFDA 3PBTA 2J9PA 1FCOA 4JXVA 2ZLYA 1RP5A 5FI2A 3BLSA 2R9WA 3CG5A 4PMAA 3I7JA 5TR7A 1I5QA 1G6AA 3LY4A 5CEDA 3IH9A 3OZHA 5CGSA 3WRZA 4EBNA 3MFDA 4RX2A 2QZ6A 1QMFA 3IF6B 1FR1A 5FAQA 1ZG4A 3P09A 3ZDJA 3NY4A 5E43A 5A90A 1IEMA 1K56A 4Z9QA 4ZJ1A 1DJBA 1M40A 3C4PA 2C5WB 4DF6A 2ZC3B 3RXXA 1IYSA 4YFMA 4S2NC 1KE3A 2R9XA 4JXGA 1KDWA 1S0WA 3HLWA 3ITAA 5E2GA 3ZNTA 3IXGA 2ZD8A 3Q82A 2XK1A 4EWFA 4OQIA 3TSGA 3VP4A 3GVBA 1PWGA 1MY8A 3QNBA 5FDHA 3UE3A 4P87A 1ESUA 1OMEA 2Y91A 3GTCA 4KZBA 2XDMA 1TVFA 2ZM8A 4E6XA 1FQGA 1E3UA 1PYYA 1U60A 3HUNA 3IH8A 5HL1A 4GKUA 2WKEA 2C6WB 3M2JA 2DCFA 2JE5A 4PM9A 5CERA 3VFFA 4R0QA 2J7VA 4D2OA 4GNUA 4FD8A 5DVAA 4C6YA 1PW1A 1MWSA 4JLFA 3W4PA 4KQOA 2Y4AA 4OH0A 3IQAA 4KG6A 3SS3A 4OLGA 3NBLA 1MPLA 3DWZA 3NDGA 3S1YA 2XH9A 3IT9A 4PPRA 5TFQA 2WKHA 4K91A 4P6BA 1IKIA 1FCNA 4ZAMA 1CEGA 4QY5A 1KVLA 5CRFA 5CHUA 2Y2IA 3MXSA 5EVLA 1WYCA 3A3JA 3VP0A 5FQJA 4OVDA 3VP2A 3NCKA 1W7FA 4R23A 2EX2A 3UN7A 2ZC4B 1XA7A 1VM1A 1MWRA 3DW0A 2H0YA 1Q2PA 2ZQDA 4R3BA 3ZVWA 5U47A 1BSGA 3IWQA 2H5SA 4B4XA 2XD5A 3HLBA 1PZPA 3M6HA 5JYPA 4XXRA 1Q2QA 3GMWA 3CZDA 3HVFA 3N7WA 4OOMA 4E3IA 2ZMAA 1IYPA 3UDXA 1BULA 5A93A 3IXHA 2ZC7A 1SCWA 5A91A 3WS1A 3N4IA 4OONA 4U3TA 4BD1A 1GA0A 4CPKA 3IWIA 1ERMA 1LLBA 5HAIA 4EBLA 3HBRA 5F82A 3UE0A 1JWZA 1NZOA 3ZG7B 3G4PA 3UY6A 1KDSA 4NETA 4B4ZA 1DJAA 4QJGA 5M18A 5GHZA 4CJNA 4OQHA 1L0FA 1ZC2A 3BLMA 3BFCA 3IXBA 5CEBA 3BFFA 3NDEA 3BFEA 1NZUA 2P74A 5CXWA 5FAOA 1J9MA 1PWCA 3FWLA 3HLCA 4OQGA 5F83A 4O7DA 3ISGA 2B5RA 1O7EA 1NJ4A 3MKFA 1HD8A 3HLDA 3AGEA 1W5DA 4UA9A 4E6WA 3HUOA 1FSYA 4K0XA 2EX8A 4C75A 4KZ7A 4OOLA 4DE2A 2VGJA 4U0TA 4UA7A 3A3EA 2ZQAA 2WGIA 3PBQA 3SH9A 1ONGA 4S2OA 4BJPA 2EFUA 2Y2PA 2H10A 5FAPA 2Q9MA 3VOZA 3G31A 4OP5A 5EVIC 3MZDA 2WADA 1HTZA 1LL5A 3UPOA 1IKGA 3ZHHA 3TOIA 1PI4A 3Q07A 1XXMA 4WMCA 2VGKA 2A49A 4S2PA 5HARA 1ZKJA 3ZG5A 3GSGA 3QNCA 4WZ4A 1KVMA 1S6RA 4OPQA 4KZ8A 4E3MA 1ESIA 3EQUA 5AQAA 3RJUA 4OPYA 3HL9A 3TG9A 1NXYA 3WS5A 1KGGA 5FASA 4R4RA 1CEFA 3WS4A 1PZOA 5IHVA 1O07A 3FYZA 1NRFA 1MKIA 3MZEA 3PBRA 5EVID 1K54C 1EI5A 4ZDXA 4UA6A 3S4XA 1ES2A 4C3QA 1GHMA 3DWKA 1K54A 3WS0A 5J8XA 4XUZA 3Q1FA 1W79A 3LY3A 1N9BA 4DE1A 5HFOA 3LEZA 5FA7A 1RGZA 3VP3A 5EOOA 3ZGAB 5GHYA 2BLSA 4UAAA 5KSHA 3UPPA 5GL9A 3LCEA 4FH4A 3OCLA 2HPBA 5FI6A 2Y2GA 3G2ZA 1YMSA 1TDGA 2X02A 4OKPA 5DTSA 1H8YA 3GQZA 4KQQA 3M6BA 2JC7A 2WGVA 4JF4A 4JBFA 1YLYA 1JWPA 3O3VA 3MXRA 3BRMA 4S2JA 2ZC6B 2ZQ7A 3VSKA 3UO9A 4EBPA 3VSLA 1H5XA 3DTMA 3BYDA 1L0DA 4BL3A 1ERQA 4HESA 4ZJ3A 3AGDA 3V3RA 5HX9A 5AQ7A 4WEKA 1K38A 5M19A 3N8LA 3W8KA 1I2SA 4QB8A 3A3FA 4MBFA 3IHBA 1GHPA 1L0GA 1WYBA 4MEZA 4WELA 4KZ5A 5E2EA 1PIOA 4RX3A 5GLAA 3MKEA 3VMAA 4WZ5A 3C5AA 4QY6A 1YLPA 1K6RA 1YM1A 3SOIA 4GN2A 4DXCA 1K56D 4WZ5C 4GD6A 4S2LA 5CGWA 3BEBA 5CHJA 5GLDA 3UPNA 4DXBA 4BL2A 2Y2OA 5FSRA 5A92A 1XGIA 4ZBEA 3ZCZA 3RXWA 1BLPA 1YLWA 5GLCA 4HBTA 2IWCA 3UNWA 2WGWA 1XA1A 4K0WA 2P9VA 1HZOA 2Y2JA 3Q7VA 4FCFA 4PM7A 5G18A 3V50A 2QMIA 1BLHA 1XKZA 3SH8A 1CI9A 4KZ3A 1MWTA 2JCHA 2HDUA 3W4QA 4HBUA 4MBHA 5KZHA 3N8SA 3OPRA 5DTTA 5DTKA 2EX6A 5EE8A 1YLTA 2V1ZA 5DF7A 1VQQA 3NIAA 2EFXA 1ONHA 4IVKA 4OQ0A 3BM6A 4MBKA 2GDNA 3NI9A 3Q7ZA 3SH7A 1XP4A 5CTMA 5CGXA 1G68A 5GHXA 4EQIA 2WUQA 5EECA 5FATA 2WGWB 3CMZA 3EQVA 1XGJA 4B88A 3NC8A 3G35A 1ES3A 3BECA 1IELA 3PAEA 4GB7A 4DE0A 1ALQA 3PBOA 1YLJA 1YLZA 2J9OA 3A3IA 4S2KA 4JF5A 2BG1A 4OPZA 1BLSA 1TDLA 4WYYA 5E2FA 4ZJ2A 1JWVA 2OLVA 2Y2QA
chains in the Genus database with same CATH superfamily
1ES4A 3ZG0A 3LIEA 4EETB 2VKSA 2Y8HA 2HP6A 4IHQA 5FQKA 4S2MA 4LLOB 2WAEA 1N9LA 2HDSA 3HREA 2NUTC 3IXDA 1AXBA 3CAXA 3E4PA 1NWZA 4MCWA 2YKHA 5FQQA 2INWA 3E2KA 2MJ6A 3H9WA 2WKPA 3A3DA 4KG5A 4PM8A 3S7QA 3GV9A 4Y0OA 5F6AA 3F1OB 2QJ5A 1K6SA 4X68A 5FEGA 4JKTA 2B18A 1PWDA 1E3UD 2P7JA 2O99A 4N1HA 4CQHA 1NYYA 2FFFB 3MF0A 4N92A 4H6JB 2XF3A 1KE0A 1YQSA 5TBMB 3TE8A 1XX2A 3MS6A 3C4OA 5HWTA 5CECA 3UDIA 2J8YA 2HZ5A 1JVJA 2HDQA 4KZ9A 1EW0A 1W8YA 4YWZA 3IBJA 2PU4A 4ME4A 1MXOA 3BQAA 1W8QA 3HUMA 1TD5A 4LV3A 2HP5A 2PU2A 3C7VA 1VETB 4JXWA 1MBLA 4H8RA 4R3AA 1QMEA 3IWOA 2Y2MA 5HDDA 4PM5A 3OPPA 1SDNA 4DE3A 1YMXA 1Z6FA 4UQIM 3GR2A 4II7A 2A3UA 3GRJA 2ZJ9A 3V39A 1EWZA 3G2YA 4GS9A 1BZAA 4KQRA 2HF6A 4I39A 1KGEA 4P6ZM 1PW8A 2G2WA 1TS0A 4LCLA 1OTBA 1JTDA 4JPMA 5HAPA 2V2FF 4N1XA 3ZNYA 4GZBA 2OSUA 4P85A 5F1FA 3O87A 1IYQA 3O5YA 3PBSA 4I38A 4X53A 5TBMA 2JKFA 2PBYA 5L10A 4NK3A 5EVIB 1LL9A 4Y7PA 1XPBA 1LSXA 3VOYA 5F68A 2PR6A 3LICA 5EUAA 1OPXA 3IHAA 1G6OA 4RVAA 3FPWA 1G28A 3F1NA 2V20A 2WKIA 4FSFA 4L0LA 1LI0A 2QJ7A 3G6OA 3NECA 3BLSA 2W3EA 4PMAA 3I7JA 5TR7A 1I5QA 4ETZA 5CEDA 3R7WB 2GJ3A 2QZ6A 1QMFA 5FAQA 3ZDJA 5E43A 4Z9QA 2C5WB 2ZC3B 5HWVA 2R9XA 4JXGA 2J3WA 3ZNTA 3IXGA 3Q82A 4DN0A 4EWFA 3VP4A 3GVBA 1PWGA 1MY8A 3QNBA 2Y91A 1E3UA 3BW6A 4MMNA 2XROA 3VFFA 2ZMFA 4G3WA 1PW1A 1ZTUA 3IQAA 4EW7A 4KG6A 2L1MA 3LIFA 5EV0A 3S1YA 4LPZA 3HJKA 2H28A 4K91A 5EFWA 1IKIA 1OJGA 2QYBA 5CRFA 5CHUA 3MQ0A 3NCKA 4R23A 2EX2A 3UN7A 2ZC4B 1XA7A 1VM1A 1Q2PA 4B4XA 4R3BA 5HL6A 1XJ6A 1Z09A 4XXRA 1Q2QA 4LRXC 3N7WA 3HVFA 1W63M 4R6LA 3PHYA 4U3TA 1GA0A 3IWIA 1ERMA 2QHKA 5HAIA 2VGLS 2HV1A 3HBRA 3UE0A 2HJEA 3LR0A 2JHEA 1DJAA 2OOLA 5GHZA 2V9AA 3IXBA 2XA7M 4YNRA 4BMWA 1J9MA 5F83A 4O7DA 1O7EA 3CUEA 3MKFA 4UA9A 4K0XA 2EX8A 3C8CA 4OOLA 4UA7A 3PBQA 4S2OA 2EFUA 2Y2PA 2H10A 3ZHHA 3S7PA 4WMCA 3MXQA 1KVMA 2PT7A 1ESIA 3EQUA 2V1BA 3HL9A 4IJGA 4O0PA 3LI8A 3PBRA 5EVID 4UA6A 3S4XA 4C3QA 3U4LP 3WS0A 4XUZA 3LY3A 1XFQA 1RGZA 1S66L 1OTEA 2JKTM 5GHYA 4UAAA 3UPPA 2HPBA 1YMSA 5HD3A 4LFUA 4GJ4A 4KQQA 2JC7A 4JF4A 1YLYA 3BRMA 1TF1A 4Q0IA 4ZJ3A 5HX9A 5AQ7A 4QB8A 1TS8A 3DTIA 1L0GA 4KZ5A 2LB9A 1K56D 3C38A 1P9WA 4GD6A 5CGWA 3OBFA 2HGVA 1YLWA 4HBTA 2WGWA 3Q7VA 3V50A 1BLHA 5A8BA 1CI9A 1MWTA 2HDUA 1YSQA 4MBHA 3N8SA 3OPRA 5DTTA 5DTKA 5EE8A 1YLTA 1ODVA 1CQAA 1DRMA 4EQIA 2UV0E 2WUQA 2WGWB 3EQVA 2JKRM 4DJ3A 1FILA 3NC8A 3G35A 1IELA 1ALQA 2IA2A 5E2FA 1JWVA 4BD0A 2Z6CA 3Q81A 3EGDC 4OOYA 4WL9A 1SDEA 4HJ3A 1NY0A 2PD7A 5DFYA 2W3DA 1NYMA 4BBVA 4BLMA 4DRTA 3KYQA 4S2NA 4CLCD 4EUVA 5HW3A 1BLCA 2Q9NA 2PD8A 1Y4OA 2Q0OA 3T4TA 3BJNA 3A0SA 4PKYA 5GLBA 3O88A 4KZ6A 4BENA 1UWPX 1SZVA 4FUWA 3A0VA 3G34A 1BTLA 3LR4A 1CJFA 1K57C 4MN6A 2PR5A 3VE4A 3PTEA 1IOUA 3FKWA 1MKMA 2WKQA 2JKGA 4U0XA 2P08A 3WS2A 2H0TA 4EU0A 2ZOHA 3QP8A 1D06A 1K25A 2DRWA 4HH3A 4KZAA 4P0MA 4ETXA 5CTNA 4QHCA 5DJUA 2ZBBA 2Z2LB 4N9LA 2OAP1 2Y2HA 3F1NB 2O9BA 2OLUA 1F2KA 1T19A 2WAFA 4E3OA 5DJTA 4OPRA 1GHIA 1RCJA 4GD8A 3ZG9B 2UWXA 2KDKA 1K55C 1DJCA 5AQBA 1C3BA 5E2HA 2G2UA 2Z2MB 4O01A 1F98A 2WZZA 3BWLA 2XFTA 2QWSA 2EXBA 2Y2KA 4I3IA 3V5MA 2Y59A 1MZUA 2J3TC 5JYOA 4IUKA 1PI5A 2VK3A 1F9IA 1V9ZA 2Y2NA 5KIZA 4MDZA 1BYWA 2HDRA 3JPUA 3M2KA 4ID4A 1K4FA 4X69A 4E3KA 4PM6A 3FV7A 2D01A 3H7WB 2X01A 4GHIA 2M7UA 4AFIA 4EUZA 4E3NA 2XR0A 3PBNA 2XGNA 2Y55A 4EQ1A 4RA7A 1L0EA 5EPHA 4PHTA 2CC1A 4DDYA 4EEPA 3HLEA 3IF5A 4LRZE 3K2NA 2OV5A 3S7OA 2PYRA 4R3JA 4BBUA 3IF6A 1I2WA 4UEYA 2EX9A 2PBDP 3PBTA 1FCOA 1RP5A 5FI2A 3T1QB 3LY4A 1WA9A 4EBNA 3MFDA 1D1JA 1ZG4A 3P09A 3NY4A 1M40A 1IYSA 2G7UA 1KE3A 3QP5A 1KDWA 3TRCA 5K5BA 2GZAA 3UE6A 2XK1A 4OQIA 2B95A 1P0ZA 4WN5A 1ESUA 1OMEA 4KZBA 1S1ZA 2XDMA 3ZQ5A 4E6XA 1FQGA 1U60A 4R70A 2WKEA 2C6WB 3M2JA 4ARZB 1T1CA 2GNXA 4C6YA 1MWSA 4KQOA 2Y4AA 4NXFA 1X0OA 4OLGA 3NBLA 1PFLA 3IT9A 3NOTC 5G4YA 4YOFA 1YKDA 1KVLA 4WLAA 3MXSA 1GSVA 3VP2A 2ZQDA 2H5SA 2CMNA 3HLBA 2EWVA 5JYPA 4JGRA 3CZDA 4E3IA 3UDXA 3IXHA 1SCWA 4HJ4A 3P7NA 4BD1A 2QKPA 3CWFA 3KSGA 5EM0A 1JWZA 3G4PA 3NOUC 1KDSA 4QJGA 5M18A 3UB5P 3BFFA 3BFEA 2P74A 3FC7A 1PWCA 3C30A 3FWLA 3ISGA 1W5DA 4E6WA 1FSYA 4QPRA 2EA9A 5AVEA 3A3EA 4WUJA 2ZQAA 2WGIA 1ONGA 4CLCA 3VOZA 2VV6A 5EVIC 1HTZA 1LL5A 4KUOA 3UPOA 3VE3A 2VGKA 2PDRA 2VJWA 2V8CA 1P97A 4WZ4A 4KZ8A 4E3MA 3RJUA 1NXYA 3F1PB 2VV8A 4R4RA 3FYZA 1YAXA 4ZDXA 1ES2A 1GHMA 3B47A 2XRNA 4DE1A 5HFOA 2OWHA 3LYXA 2Y2GA 3P01A 5HDSA 4P6ZS 3G2ZA 1TDGA 2X02A 2WGVA 1JWPA 3MXRA 2YKFA 2ZC6B 3T4QA 3UO9A 1DP9A 3VSLA 2Z6DA 3DTMA 2O0YA 1L0DA 1DP8A 4HHDA 3V3RA 3N8LA 3W8KA 1I2SA 4MBFA 3ULFA 1WYBA 2VGLM 4WELA 4RX3A 5GLAA 3C5AA 4QY6A 4DXCA 4WZ5C 4S2LA 5GLDA 4DXBA 4BL2A 2Y2OA 5FSRA 3T12B 4ZBEA 3RXWA 3EGXC 1OT6A 4H6JA 2P9VA 1T1AA 4FCFA 2QMIA 3SH8A 4KZ3A 2BASA 2ZMVA 4HBUA 2EX6A 2P04A 2V1ZA 5IT5A 1D7EA 1ONHA 4X1LA 5EVEA 3NI9A 3SH7A 5CGXA 5GHXA 2FH5A 3CPTA 5EECA 2M7VA 3BQ8A 3BECA 4GB7A 4DE0A 1YLJA 2J9OA 3A3IA 4S2KA 4UQIS 3E4OA 1BLSA 1TDLA 3T4OA 3UB8A 4WM9A 3IF6C 4WMCD 1E4DA 5C5KA 4G3KA 4K08A 5HPFA 1GCEA 5HAQA 3JYIA 4EV4A 2W1TA 2XEPA 4KG2A 2XLNA 4Q0HA 3NJAA 3CUEC 1FR6A 5TGFA 2VLGA 3KSFA 3OLOA 3S22A 1VETA 3UMEA 4WBGA 3LIAA 1ZHHB 3T1SA 3K3DA 3BFGA 2A24B 3KSIA 4QD4A 1L2SA 3OPLA 3HLFA 3UB9A 4JGPA 3SS5A 1YSPA 4Y15A 1GSWA 1OT9A 1ZG6A 4HY8A 1FOFA 5FEFA 3D4FA 2P9VB 4Y13A 4HP9A 2XD1A 3CPTB 4YINA 2IWBA 4LENA 3AGFA 2D02A 3ZVTA 4IUHA 2JKRI 3OCNA 2W3GA 3RFBA 2WZXA 4KZ4A 1DY6A 4M3KA 2W1TB 3LO7A 4DDSA 1CI8A 2KOIA 5AQ9A 2HP9A 2WKRA 1BUEA 2ZL1B 4R1GA 3UDFA 2XQZA 2IWDA 2RL3A 2ZQCA 3VV4A 3ZFZA 1VEUA 2ZQ8A 4S2IA 3OPHA 2PAVP 4MN7A 3T1XA 3B3XA 1BT5A 5HD5A 5D3OA 2I72A 1YPRA 4JXSA 2ZL1A 4F94A 5BOHA 3FZCA 4HJ6A 4MLLA 5KSCA 4A5RA 2K2NA 3CLOA 2EWWA 5L8MA 4OLDA 1TEMA 3D3OA 3CI6A 4HI4A 1GA9A 3MBZA 1JNUA 3KSHA 5CHMA 2WYXA 2XFSA 1WE4A 4QU3A 4IBRA 4IVIA 4GDNA 3O86A 3PAGA 5DF8A 2WK0A 1S67L 2JKTI 3SS4A 5HDCA 2ZM2A 2AVXA 3D72A 3HLGA 1YT4A 3WRTA 3DBAA 3E2LA 1IFQA 2XSSA 1FSWA 4E3JA 2K7SA 4NXBA 1EROA 5J4EA 2PHYA 2DNSA 2ZOIA 4JXVA 4R38A 4Y17A 2W0NA 2R9WA 4NG2A 3D9YA 4RX2A 3IF6B 1FR1A 1KOUA 1IEMA 1DJBA 1AWIA 2M1CA 1W63Q 4S2NC 5EM1A 5F5YA 1S0WA 3ITAA 5E2GA 4KUKA 2K31A 2A24A 3TSGA 3R7WA 3UE3A 1K0KA 4NKPA 2ZM8A 4QWOA 1PYYA 3IH8A 3T50A 4GKUA 3L9KA 2DCFA 2JE5A 4PM9A 5CERA 3E0YA 4D2OA 4GNUA 1FIKA 3W4PA 4OH0A 1NLZA 3NDGA 3DWZA 2XH9A 4PPRA 2WKHA 2W1RA 4P6BA 1FCNA 4ZAMA 1OJ5A 2KX6A 1OTAA 5EVLA 3A3JA 3SZTA 3VP0A 5L09A 5FQJA 3FG8A 1MWRA 3LUQA 2H0YA 3ZVWA 5U47A 2W3FA 3IWQA 2J80A 1SKOB 5LBRA 4OOMA 2E8JA 2Y79A 4HOIA 3EWKA 1BULA 3WS1A 1VEUB 2VV7A 4CPKA 1LLBA 1S4SA 1NZOA 3UY6A 2VX8A 4NETA 1L0FA 5CEBA 3NDEA 1NZUA 3L7HA 5CXWA 5FAOA 4OQGA 1NJ4A 4MN5A 4C75A 4KZ7A 4F3LB 4DE2A 2VGJA 5FDSA 2W3HA 4BJPA 4XT2A 2Q9MA 3G31A 4OP5A 4EERA 3MZDA 3E4QA 3TOIA 1PI4A 3Q07A 2A49A 4S2PA 3ZG5A 1S6RA 4PKYG 2XA7S 3R4KA 5DKKA 4OPYA 4LGWA 3WS5A 5FASA 1CEFA 3WS4A 5IHVA 3E98A 3B33A 1O07A 1MKIA 3UB6A 1XJ2A 4GS9B 1N9BA 4EESA 3LEZA 5EOOA 4HP4A 3ZGAB 1NLYA 5KSHA 3T4JA 3LCEA 4Q0JA 3TW8A 3UMDA 4XT2B 5CX7A 1H8YA 4GLQA 1T18A 3KYEA 3DTEA 1PNEA 2ZQ7A 1H5XA 4PAUA 3OOVA 3BYDA 4BL3A 4HESA 3AGDA 4WEKA 5M19A 3A3FA 3LIBA 3IHBA 4MEZA 4CLCC 1CF0A 2OWJA 3NOPC 1K6RA 4HH2A 3BEBA 3UPNA 5A92A 1BLPA 5GLCA 2IWCA 3CHWP 1XA1A 4PM7A 5G18A 1XKZA 1F5MA 3QP2A 5KZHA 4DJ2A 1S1YA 3EEAA 5DF7A 3NIAA 4IVKA 4OQ0A 5J3WA 4MBKA 2GDNA 3Q7ZA 3IX8A 1XFNA 2V8FA 3BY8A 5FATA 1XGJA 4B88A 1TS7A 4FOFA 3PAEA 3LEQA 2BG1A 4OPZA 4WYYA 4ZJ2A 2OLVA 4DKIA 3VP1A 3VOLA 1KGFA 2ZC5B 3LGOA 2Y2LA 4JGOA 4XUXA 4JGQA 3MFXA 4B93A 2PYPA 3LI9A 5L2FA 5AVFA 3RH8B 4CLCB 2V0WA 1G5UA 4GDBA 1MWUA 4KENB 2RCXA 1CK3A 4LCMA 3P98A 1RGYA 3IX3A 1SKOA 4N9KA 3QP6A 4OP8A 1K57A 4Y0TA 4DMZA 2FFYA 5I5LA 3QP1A 3KO6A 3IBRA 2L4RA 1NRJA 3EEHA 3V3SA 1J3WA 3JVVA 1K4EA 2EXAA 1LHYA 3N8RA 3ZYTA 1M6KA 3H82A 4Y2FA 3MSHA 1H8ZA 2BTFP 3MZFA 4G3VA 2QPNA 3N6IA 3LFVA 4GHIB 4IBXA 5IU1A 3CITA 1H0MA 2JN7A 2R78A 3WWXA 3VFHA 3IS2B 5MC7A 4X56A 1ACFA 2E8IA 5HPIA 4FH2A 5I94A 4X55A 3Q7VB 4IEDA 3C7UA 4LV0A 1GSXA 4LV2A 4Z1WA 1K55A 3OC2A 4MNRA 3RTYA 4M4XA 2X71A 3K3CA 3ITBA 4HIAA 4LRYC 4R4SA 4BQMA 4ESPA 2JBFA 5KMWA 4L9EA 1KE4A 5F1GA 3W4OA 4LV1A 3G32A 1LSVA 3G30A 2VA0A 3T1RA 3EOIA 4E3LA 4RYEA 1ES5A 1LL8A 1PRQA 5M1AA 1E25A 5FQIA 2W27A 1Y54A 4Y0UA 5HZHA 4WEJA 1LI9A 2ZM0A 1HVBA 5FQ9A 4GOGA 5DF9A 4Q8IA 4ZTKA 4EXOA 3CJMA 3QHYA 2I9VA 1FCMA 4BBTA 3TJZC 5EVIA 2GX5A 4ARZA 5FI7A 3DTKA 5FQMA 5EOEA 5G4ZA 4HQAA 3V67A 3ZG8B 4UHUA 4EEUA 3LR5A 4B9OA 1JTGA 4F3LA 1IYOA 5FL3A 3UE1A 2HJ9C 1XJ3A 4JF6A 2FZ0A 3FPVA 1SKFA 4GW9A 3F1OA 5J7EA 1N4OA 3FKVA 4RQ9A 2ZQ9A 4HEFA 4Y5FA 1SHVA 1XJ4A 4NXGA 4X6TA 3BFDA 4NEED 2J9PA 3GDIA 2ZLYA 3CG5A 1S4RA 1G6AA 3U2AA 3IH9A 3OZHA 5CGSA 3WRZA 3S7NA 5A90A 1K56A 4ZJ1A 1H8MA 3C4PA 4DF6A 3RXXA 4YFMA 3HLWA 2VEAA 2ZD8A 3HCYA 4FTXA 1HLUP 5FDHA 4P87A 3GTCA 4NXEA 1TVFA 3HUNA 5HL1A 3MR0A 4R0QA 2J7VA 4FD8A 5DVAA 4JLFA 3SS3A 1OTDA 3HJIA 1MPLA 3H82B 5TFQA 1TS6A 2O9AA 1CEGA 2VZWA 3PR6A 4QY5A 1H3QA 3MMHA 2Y2IA 1WYCA 4OVDA 3NULA 1W7FA 3B42A 3DW0A 4KQDA 1BSGA 2XD5A 1PZPA 3M6HA 4HNBA 2V0UA 3T4LA 3GMWA 3KYZA 2ZMAA 1IYPA 3PYPA 4Y3IA 5A93A 2ZC7A 5A91A 3QP4A 3N4IA 4OONA 2KLIA 4EBLA 1T1BA 5F82A 4I5SA 3ZG7B 4BWIA 4B4ZA 4CJNA 4OQHA 3BLMA 1ZC2A 3BFCA 3GECA 3ICYA 3HLCA 2B5RA 1HD8A 3HLDA 3AGEA 3MQOA 3T4KA 3HUOA 2O9CA 1UGUA 4U0TA 5DKLA 4D60A 3SH9A 1MC0A 5FAPA 5HWWA 2WADA 3NHQA 1IKGA 3IX4A 1LSWA 1XXMA 5HARA 1ZKJA 2V1AA 3LR3A 3GSGA 3QNCA 4OPQA 5AQAA 3TG9A 1KGGA 3JVUA 5L07A 1PZOA 1NRFA 3MZEA 1VHMA 2J3TD 2PRFA 1VB6A 5AJGA 1K54C 1EI5A 4WF0A 3DWKA 1K54A 5J8XA 3Q1FA 1W79A 2DMWA 5FA7A 5HSQA 3VP3A 3H7WA 1STZA 2BLSA 5F69A 5GL9A 4FH4A 3OCLA 5FI6A 1V9YA 1N9OA 3MQQA 4X1MA 4OKPA 5DTSA 4X25A 3GQZA 1L3LA 3M6BA 4JBFA 3O3VA 4S2JA 3VSKA 3MJQA 4EBPA 3KX0X 1ERQA 1K38A 2OAQ1 4L9GA 3PXPA 4GCZA 1GHPA 2A2LA 3LIDA 1PIOA 5E2EA 3MKEA 3IS2A 3VMAA 4WZ5A 3F1PA 1YLPA 1YM1A 3SOIA 4GN2A 1OTIA 3UB7A 1DP6A 2B02A 1LT0A 3DAVA 5CHJA 3A0RA 1XGIA 4ZRRA 3ZCZA 2LB5A 3UNWA 3C2WA 1UWNX 4I3AA 5IS1A 4K0WA 1HZOA 2Y2JA 1P9RA 3SW1A 4I3JA 4O8GA 2JCHA 1Y28A 2ACGA 3T4SA 3W4QA 4CLCE 1VQQA 2EFXA 3BM6A 2NUPC 1XP4A 5CTMA 3BY9A 1G68A 4E04A 1A0KA 1N9NA 3CMZA 5TJJA 1ES3A 5DFXA 3PBOA 4L9FA 1YLZA 2L0WA 4JF5A 3W2ZA 2Y2QA
chains in the Genus database with same CATH topology
4OOYA 4WM9A 4DKIA 1ES4A 3IF6C 3VP1A 4WMCD 3ZG0A 1E4DA 1SDEA 1KGFA 1NY0A 2ZC5B 1NYMA 4BD0A 4BLMA 4DRTA 2Y2LA 1GCEA 2HP6A 3JYIA 4S2NA 4XUXA 5HAQA 4EV4A 5FQKA 2XEPA 5HW3A 4S2MA 2WAEA 2HDSA 3HREA 5L2FA 1BLCA 2Q9NA 4KG2A 3IXDA 1AXBA 4GDBA 2XLNA 1MWUA 4KENB 2RCXA 1CK3A 4LCMA 5FQQA 3P98A 1RGYA 5GLBA 3E2KA 3O88A 1FR6A 4KZ6A 4BENA 4N9KA 5TGFA 3S22A 4OP8A 3A3DA 4KG5A 4PM8A 1K57A 3GV9A 3G34A 4Y0OA 1BTLA 4WBGA 4Y0TA 1K57C 2FFYA 1K6SA 3PTEA 3BFGA 4X68A 3FKWA 3V3SA 4JKTA 4QD4A 1L2SA 1PWDA 1E3UD 3OPLA 1K4EA 3HLFA 4N1HA 2EXAA 1LHYA 3N8RA 3SS5A 1M6KA 1NYYA 2FFFB 1ZG6A 4N92A 1FOFA 1H8ZA 2XF3A 3MZFA 1KE0A 3D4FA 4U0XA 1YQSA 2P9VB 2QPNA 3WS2A 3N6IA 2H0TA 2XD1A 4IBXA 1XX2A 3C4OA 4YINA 2IWBA 5CECA 4LENA 3UDIA 2J8YA 3AGFA 1K25A 2DRWA 4KZAA 4P0MA 1JVJA 3VFHA 3WWXA 5CTNA 4QHCA 2HDQA 4X56A 3ZVTA 4KZ9A 1W8YA 2Z2LB 2PU4A 4N9LA 3OCNA 1MXOA 2WZXA 1DY6A 4KZ4A 1W8QA 2E8IA 2Y2HA 4FH2A 4M3KA 5I94A 4X55A 3LO7A 3HUMA 2OLUA 4DDSA 1CI8A 4LV3A 2HP5A 3Q7VB 5AQ9A 2HP9A 4IEDA 3UDFA 1BUEA 4R1GA 3C7UA 4LV0A 2XQZA 2IWDA 2PU2A 2WAFA 4E3OA 3C7VA 2RL3A 4LV2A 1GHIA 2ZQCA 4JXWA 1K55A 1MBLA 4OPRA 3OC2A 1RCJA 4MNRA 4GD8A 3ZG9B 3ZFZA 2UWXA 4H8RA 1K55C 1DJCA 5AQBA 1QMEA 2X71A 1C3BA 2ZQ8A 5E2HA 2G2UA 2Z2MB 3IWOA 2Y2MA 4S2IA 3ITBA 4PM5A 3OPHA 4R4SA 4BQMA 2WZZA 2JBFA 3B3XA 5KMWA 2XFTA 1BT5A 1KE4A 5F1GA 3W4OA 4LV1A 3G32A 1SDNA 3OPPA 1YMXA 1Z6FA 5D3OA 4DE3A 3GR2A 2EXBA 2Y2KA 3G30A 4E3LA 3V5MA 2A3UA 2I72A 4RYEA 1ES5A 2ZJ9A 2Y59A 3GRJA 1EWZA 3V39A 4JXSA 1E25A 3Q81A 5FQIA 5M1AA 5JYOA 1Y54A 3G2YA 1PI5A 4Y0UA 1BZAA 4KQRA 4WEJA 4F94A 1LI9A 2ZM0A 5BOHA 1HVBA 3FZCA 5FQ9A 1KGEA 2Y2NA 4GOGA 4MLLA 5DF9A 5KSCA 1PW8A 4A5RA 4Q8IA 4ZTKA 2G2WA 3CJMA 3QHYA 4LCLA 2HDRA 1JTDA 4JPMA 5HAPA 2V2FF 4N1XA 3M2KA 1FCMA 4GZBA 2OSUA 4ID4A 4OLDA 1TEMA 4P85A 3ZNYA 3O87A 1IYQA 5F1FA 3PBSA 4X53A 1GA9A 1K4FA 3MBZA 4X69A 4E3KA 4PM6A 5EVIA 2PBYA 3FV7A 2X01A 5FI7A 4NK3A 4EUZA 5CHMA 5EOEA 2WYXA 1LL9A 5EVIB 5FQMA 2XR0A 4Y7PA 1XPBA 2XGNA 3PBNA 4UHUA 3ZG8B 4E3NA 2Y55A 2XFSA 1JTGA 4RA7A 1IYOA 1L0EA 1WE4A 4QU3A 4IBRA 4IVIA 4GDNA 3O86A 5EPHA 3UE1A 3VOYA 2CC1A 3PAGA 4JF6A 5DF8A 2WK0A 5EUAA 4DDYA 3SS4A 1SKFA 3IHAA 2ZM2A 3HLEA 3IF5A 4RVAA 1N4OA 3HLGA 1YT4A 2OV5A 3WRTA 3FKVA 4R3JA 3E2LA 2ZQ9A 3IF6A 1FSWA 4HEFA 2V20A 4E3JA 2WKIA 1EROA 1I2WA 1SHVA 4FSFA 4X6TA 4L0LA 2DNSA 2EX9A 1LI0A 3BFDA 3PBTA 2J9PA 1FCOA 4JXVA 2ZLYA 1RP5A 5FI2A 3BLSA 2R9WA 3CG5A 4PMAA 3I7JA 5TR7A 1I5QA 1G6AA 3LY4A 5CEDA 3IH9A 3OZHA 5CGSA 3WRZA 4EBNA 3MFDA 4RX2A 2QZ6A 1QMFA 3IF6B 1FR1A 5FAQA 1ZG4A 3P09A 3ZDJA 3NY4A 5E43A 5A90A 1IEMA 1K56A 4Z9QA 4ZJ1A 1DJBA 1M40A 3C4PA 2C5WB 4DF6A 2ZC3B 3RXXA 1IYSA 4YFMA 4S2NC 1KE3A 2R9XA 4JXGA 1KDWA 1S0WA 3HLWA 3ITAA 5E2GA 3ZNTA 3IXGA 2ZD8A 3Q82A 2XK1A 4EWFA 4OQIA 3TSGA 3VP4A 3GVBA 1PWGA 1MY8A 3QNBA 5FDHA 3UE3A 4P87A 1ESUA 1OMEA 2Y91A 3GTCA 4KZBA 2XDMA 1TVFA 2ZM8A 4E6XA 1FQGA 1E3UA 1PYYA 1U60A 3HUNA 3IH8A 5HL1A 4GKUA 2WKEA 2C6WB 3M2JA 2DCFA 2JE5A 4PM9A 5CERA 3VFFA 4R0QA 2J7VA 4D2OA 4GNUA 4FD8A 5DVAA 4C6YA 1PW1A 1MWSA 4JLFA 3W4PA 4KQOA 2Y4AA 4OH0A 3IQAA 4KG6A 3SS3A 4OLGA 3NBLA 1MPLA 3DWZA 3NDGA 3S1YA 2XH9A 3IT9A 4PPRA 5TFQA 2WKHA 4K91A 4P6BA 1IKIA 1FCNA 4ZAMA 1CEGA 4QY5A 1KVLA 5CRFA 5CHUA 2Y2IA 3MXSA 5EVLA 1WYCA 3A3JA 3VP0A 5FQJA 4OVDA 3VP2A 3NCKA 1W7FA 4R23A 2EX2A 3UN7A 2ZC4B 1XA7A 1VM1A 1MWRA 3DW0A 2H0YA 1Q2PA 2ZQDA 4R3BA 3ZVWA 5U47A 1BSGA 3IWQA 2H5SA 4B4XA 2XD5A 3HLBA 1PZPA 3M6HA 5JYPA 4XXRA 1Q2QA 3GMWA 3CZDA 3HVFA 3N7WA 4OOMA 4E3IA 2ZMAA 1IYPA 3UDXA 1BULA 5A93A 3IXHA 2ZC7A 1SCWA 5A91A 3WS1A 3N4IA 4OONA 4U3TA 4BD1A 1GA0A 4CPKA 3IWIA 1ERMA 1LLBA 5HAIA 4EBLA 3HBRA 5F82A 3UE0A 1JWZA 1NZOA 3ZG7B 3G4PA 3UY6A 1KDSA 4NETA 4B4ZA 1DJAA 4QJGA 5M18A 5GHZA 4CJNA 4OQHA 1L0FA 1ZC2A 3BLMA 3BFCA 3IXBA 5CEBA 3BFFA 3NDEA 3BFEA 1NZUA 2P74A 5CXWA 5FAOA 1J9MA 1PWCA 3FWLA 3HLCA 4OQGA 5F83A 4O7DA 3ISGA 2B5RA 1O7EA 1NJ4A 3MKFA 1HD8A 3HLDA 3AGEA 1W5DA 4UA9A 4E6WA 3HUOA 1FSYA 4K0XA 2EX8A 4C75A 4KZ7A 4OOLA 4DE2A 2VGJA 4U0TA 4UA7A 3A3EA 2ZQAA 2WGIA 3PBQA 3SH9A 1ONGA 4S2OA 4BJPA 2EFUA 2Y2PA 2H10A 5FAPA 2Q9MA 3VOZA 3G31A 4OP5A 5EVIC 3MZDA 2WADA 1HTZA 1LL5A 3UPOA 1IKGA 3ZHHA 3TOIA 1PI4A 3Q07A 1XXMA 4WMCA 2VGKA 2A49A 4S2PA 5HARA 1ZKJA 3ZG5A 3GSGA 3QNCA 4WZ4A 1KVMA 1S6RA 4OPQA 4KZ8A 4E3MA 1ESIA 3EQUA 5AQAA 3RJUA 4OPYA 3HL9A 3TG9A 1NXYA 3WS5A 1KGGA 5FASA 4R4RA 1CEFA 3WS4A 1PZOA 5IHVA 1O07A 3FYZA 1NRFA 1MKIA 3MZEA 3PBRA 5EVID 1K54C 1EI5A 4ZDXA 4UA6A 3S4XA 1ES2A 4C3QA 1GHMA 3DWKA 1K54A 3WS0A 5J8XA 4XUZA 3Q1FA 1W79A 3LY3A 1N9BA 4DE1A 5HFOA 3LEZA 5FA7A 1RGZA 3VP3A 5EOOA 3ZGAB 5GHYA 2BLSA 4UAAA 5KSHA 3UPPA 5GL9A 3LCEA 4FH4A 3OCLA 2HPBA 5FI6A 2Y2GA 3G2ZA 1YMSA 1TDGA 2X02A 4OKPA 5DTSA 1H8YA 3GQZA 4KQQA 3M6BA 2JC7A 2WGVA 4JF4A 4JBFA 1YLYA 1JWPA 3O3VA 3MXRA 3BRMA 4S2JA 2ZC6B 2ZQ7A 3VSKA 3UO9A 4EBPA 3VSLA 1H5XA 3DTMA 3BYDA 1L0DA 4BL3A 1ERQA 4HESA 4ZJ3A 3AGDA 3V3RA 5HX9A 5AQ7A 4WEKA 1K38A 5M19A 3N8LA 3W8KA 1I2SA 4QB8A 3A3FA 4MBFA 3IHBA 1GHPA 1L0GA 1WYBA 4MEZA 4WELA 4KZ5A 5E2EA 1PIOA 4RX3A 5GLAA 3MKEA 3VMAA 4WZ5A 3C5AA 4QY6A 1YLPA 1K6RA 1YM1A 3SOIA 4GN2A 4DXCA 1K56D 4WZ5C 4GD6A 4S2LA 5CGWA 3BEBA 5CHJA 5GLDA 3UPNA 4DXBA 4BL2A 2Y2OA 5FSRA 5A92A 1XGIA 4ZBEA 3ZCZA 3RXWA 1BLPA 1YLWA 5GLCA 4HBTA 2IWCA 3UNWA 2WGWA 1XA1A 4K0WA 2P9VA 1HZOA 2Y2JA 3Q7VA 4FCFA 4PM7A 5G18A 3V50A 2QMIA 1BLHA 1XKZA 3SH8A 1CI9A 4KZ3A 1MWTA 2JCHA 2HDUA 3W4QA 4HBUA 4MBHA 5KZHA 3N8SA 3OPRA 5DTTA 5DTKA 2EX6A 5EE8A 1YLTA 2V1ZA 5DF7A 1VQQA 3NIAA 2EFXA 1ONHA 4IVKA 4OQ0A 3BM6A 4MBKA 2GDNA 3NI9A 3Q7ZA 3SH7A 1XP4A 5CTMA 5CGXA 1G68A 5GHXA 4EQIA 2WUQA 5EECA 5FATA 2WGWB 3CMZA 3EQVA 1XGJA 4B88A 3NC8A 3G35A 1ES3A 3BECA 1IELA 3PAEA 4GB7A 4DE0A 1ALQA 3PBOA 1YLJA 1YLZA 2J9OA 3A3IA 4S2KA 4JF5A 2BG1A 4OPZA 1BLSA 1TDLA 4WYYA 5E2FA 4ZJ2A 1JWVA 2OLVA 2Y2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OOY A;  4WM9 A;  4DKI A;  1ES4 A;  3IF6 C;  3VP1 A;  4WMC D;  3ZG0 A;  1E4D A;  1SDE A;  1KGF A;  1NY0 A;  2ZC5 B;  1NYM A;  4BD0 A;  4BLM A;  4DRT A;  2Y2L A;  1GCE A;  2HP6 A;  3JYI A;  4S2N A;  4XUX A;  5HAQ A;  4EV4 A;  5FQK A;  2XEP A;  5HW3 A;  4S2M A;  2WAE A;  2HDS A;  3HRE A;  5L2F A;  1BLC A;  2Q9N A;  4KG2 A;  3IXD A;  1AXB A;  4GDB A;  2XLN A;  1MWU A;  4KEN B;  2RCX A;  1CK3 A;  4LCM A;  5FQQ A;  3P98 A;  1RGY A;  5GLB A;  3E2K A;  3O88 A;  1FR6 A;  4KZ6 A;  4BEN A;  4N9K A;  5TGF A;  3S22 A;  4OP8 A;  3A3D A;  4KG5 A;  4PM8 A;  1K57 A;  3GV9 A;  3G34 A;  4Y0O A;  1BTL A;  4WBG A;  4Y0T A;  1K57 C;  2FFY A;  1K6S A;  3PTE A;  3BFG A;  4X68 A;  3FKW A;  3V3S A;  4JKT A;  4QD4 A;  1L2S A;  1PWD A;  1E3U D;  3OPL A;  1K4E A;  3HLF A;  4N1H A;  2EXA A;  1LHY A;  3N8R A;  3SS5 A;  1M6K A;  1NYY A;  2FFF B;  1ZG6 A;  4N92 A;  1FOF A;  1H8Z A;  2XF3 A;  3MZF A;  1KE0 A;  3D4F A;  4U0X A;  1YQS A;  2P9V B;  2QPN A;  3WS2 A;  3N6I A;  2H0T A;  2XD1 A;  4IBX A;  1XX2 A;  3C4O A;  4YIN A;  2IWB A;  5CEC A;  4LEN A;  3UDI A;  2J8Y A;  3AGF A;  1K25 A;  2DRW A;  4KZA A;  4P0M A;  1JVJ A;  3VFH A;  3WWX A;  5CTN A;  4QHC A;  2HDQ A;  4X56 A;  3ZVT A;  4KZ9 A;  1W8Y A;  2Z2L B;  2PU4 A;  4N9L A;  3OCN A;  1MXO A;  2WZX A;  1DY6 A;  4KZ4 A;  1W8Q A;  2E8I A;  2Y2H A;  4FH2 A;  4M3K A;  5I94 A;  4X55 A;  3LO7 A;  3HUM A;  2OLU A;  4DDS A;  1CI8 A;  4LV3 A;  2HP5 A;  3Q7V B;  5AQ9 A;  2HP9 A;  4IED A;  3UDF A;  1BUE A;  4R1G A;  3C7U A;  4LV0 A;  2XQZ A;  2IWD A;  2PU2 A;  2WAF A;  4E3O A;  3C7V A;  2RL3 A;  4LV2 A;  1GHI A;  2ZQC A;  4JXW A;  1K55 A;  1MBL A;  4OPR A;  3OC2 A;  1RCJ A;  4MNR A;  4GD8 A;  3ZG9 B;  3ZFZ A;  2UWX A;  4H8R A;  1K55 C;  1DJC A;  5AQB A;  1QME A;  2X71 A;  1C3B A;  2ZQ8 A;  5E2H A;  2G2U A;  2Z2M B;  3IWO A;  2Y2M A;  4S2I A;  3ITB A;  4PM5 A;  3OPH A;  4R4S A;  4BQM A;  2WZZ A;  2JBF A;  3B3X A;  5KMW A;  2XFT A;  1BT5 A;  1KE4 A;  5F1G A;  3W4O A;  4LV1 A;  3G32 A;  1SDN A;  3OPP A;  1YMX A;  1Z6F A;  5D3O A;  4DE3 A;  3GR2 A;  2EXB A;  2Y2K A;  3G30 A;  4E3L A;  3V5M A;  2A3U A;  2I72 A;  4RYE A;  1ES5 A;  2ZJ9 A;  2Y59 A;  3GRJ A;  1EWZ A;  3V39 A;  4JXS A;  1E25 A;  3Q81 A;  5FQI A;  5M1A A;  5JYO A;  1Y54 A;  3G2Y A;  1PI5 A;  4Y0U A;  1BZA A;  4KQR A;  4WEJ A;  4F94 A;  1LI9 A;  2ZM0 A;  5BOH A;  1HVB A;  3FZC A;  5FQ9 A;  1KGE A;  2Y2N A;  4GOG A;  4MLL A;  5DF9 A;  5KSC A;  1PW8 A;  4A5R A;  4Q8I A;  4ZTK A;  2G2W A;  3CJM A;  3QHY A;  4LCL A;  2HDR A;  1JTD A;  4JPM A;  5HAP A;  2V2F F;  4N1X A;  3M2K A;  1FCM A;  4GZB A;  2OSU A;  4ID4 A;  4OLD A;  1TEM A;  4P85 A;  3ZNY A;  3O87 A;  1IYQ A;  5F1F A;  3PBS A;  4X53 A;  1GA9 A;  1K4F A;  3MBZ A;  4X69 A;  4E3K A;  4PM6 A;  5EVI A;  2PBY A;  3FV7 A;  2X01 A;  5FI7 A;  4NK3 A;  4EUZ A;  5CHM A;  5EOE A;  2WYX A;  1LL9 A;  5EVI B;  5FQM A;  2XR0 A;  4Y7P A;  1XPB A;  2XGN A;  3PBN A;  4UHU A;  3ZG8 B;  4E3N A;  2Y55 A;  2XFS A;  1JTG A;  4RA7 A;  1IYO A;  1L0E A;  1WE4 A;  4QU3 A;  4IBR A;  4IVI A;  4GDN A;  3O86 A;  5EPH A;  3UE1 A;  3VOY A;  2CC1 A;  3PAG A;  4JF6 A;  5DF8 A;  2WK0 A;  5EUA A;  4DDY A;  3SS4 A;  1SKF A;  3IHA A;  2ZM2 A;  3HLE A;  3IF5 A;  4RVA A;  1N4O A;  3HLG A;  1YT4 A;  2OV5 A;  3WRT A;  3FKV A;  4R3J A;  3E2L A;  2ZQ9 A;  3IF6 A;  1FSW A;  4HEF A;  2V20 A;  4E3J A;  2WKI A;  1ERO A;  1I2W A;  1SHV A;  4FSF A;  4X6T A;  4L0L A;  2DNS A;  2EX9 A;  1LI0 A;  3BFD A;  3PBT A;  2J9P A;  1FCO A;  4JXV A;  2ZLY A;  1RP5 A;  5FI2 A;  3BLS A;  2R9W A;  3CG5 A;  4PMA A;  3I7J A;  5TR7 A;  1I5Q A;  1G6A A;  3LY4 A;  5CED A;  3IH9 A;  3OZH A;  5CGS A;  3WRZ A;  4EBN A;  3MFD A;  4RX2 A;  2QZ6 A;  1QMF A;  3IF6 B;  1FR1 A;  5FAQ A;  1ZG4 A;  3P09 A;  3ZDJ A;  3NY4 A;  5E43 A;  5A90 A;  1IEM A;  1K56 A;  4Z9Q A;  4ZJ1 A;  1DJB A;  1M40 A;  3C4P A;  2C5W B;  4DF6 A;  2ZC3 B;  3RXX A;  1IYS A;  4YFM A;  4S2N C;  1KE3 A;  2R9X A;  4JXG A;  1KDW A;  1S0W A;  3HLW A;  3ITA A;  5E2G A;  3ZNT A;  3IXG A;  2ZD8 A;  3Q82 A;  2XK1 A;  4EWF A;  4OQI A;  3TSG A;  3VP4 A;  3GVB A;  1PWG A;  1MY8 A;  3QNB A;  5FDH A;  3UE3 A;  4P87 A;  1ESU A;  1OME A;  2Y91 A;  3GTC A;  4KZB A;  2XDM A;  1TVF A;  2ZM8 A;  4E6X A;  1FQG A;  1E3U A;  1PYY A;  1U60 A;  3HUN A;  3IH8 A;  5HL1 A;  4GKU A;  2WKE A;  2C6W B;  3M2J A;  2DCF A;  2JE5 A;  4PM9 A;  5CER A;  3VFF A;  4R0Q A;  2J7V A;  4D2O A;  4GNU A;  4FD8 A;  5DVA A;  4C6Y A;  1PW1 A;  1MWS A;  4JLF A;  3W4P A;  4KQO A;  2Y4A A;  4OH0 A;  3IQA A;  4KG6 A;  3SS3 A;  4OLG A;  3NBL A;  1MPL A;  3DWZ A;  3NDG A;  3S1Y A;  2XH9 A;  3IT9 A;  4PPR A;  5TFQ A;  2WKH A;  4K91 A;  4P6B A;  1IKI A;  1FCN A;  4ZAM A;  1CEG A;  4QY5 A;  1KVL A;  5CRF A;  5CHU A;  2Y2I A;  3MXS A;  5EVL A;  1WYC A;  3A3J A;  3VP0 A;  5FQJ A;  4OVD A;  3VP2 A;  3NCK A;  1W7F A;  4R23 A;  2EX2 A;  3UN7 A;  2ZC4 B;  1XA7 A;  1VM1 A;  1MWR A;  3DW0 A;  2H0Y A;  1Q2P A;  2ZQD A;  4R3B A;  3ZVW A;  5U47 A;  1BSG A;  3IWQ A;  2H5S A;  4B4X A;  2XD5 A;  3HLB A;  1PZP A;  3M6H A;  5JYP A;  4XXR A;  1Q2Q A;  3GMW A;  3CZD A;  3HVF A;  3N7W A;  4OOM A;  4E3I A;  2ZMA A;  1IYP A;  3UDX A;  1BUL A;  5A93 A;  3IXH A;  2ZC7 A;  1SCW A;  5A91 A;  3WS1 A;  3N4I A;  4OON A;  4U3T A;  4BD1 A;  1GA0 A;  4CPK A;  3IWI A;  1ERM A;  1LLB A;  5HAI A;  4EBL A;  3HBR A;  5F82 A;  3UE0 A;  1JWZ A;  1NZO A;  3ZG7 B;  3G4P A;  3UY6 A;  1KDS A;  4NET A;  4B4Z A;  1DJA A;  4QJG A;  5M18 A;  5GHZ A;  4CJN A;  4OQH A;  1L0F A;  1ZC2 A;  3BLM A;  3BFC A;  3IXB A;  5CEB A;  3BFF A;  3NDE A;  3BFE A;  1NZU A;  2P74 A;  5CXW A;  5FAO A;  1J9M A;  1PWC A;  3FWL A;  3HLC A;  4OQG A;  5F83 A;  4O7D A;  3ISG A;  2B5R A;  1O7E A;  1NJ4 A;  3MKF A;  1HD8 A;  3HLD A;  3AGE A;  1W5D A;  4UA9 A;  4E6W A;  3HUO A;  1FSY A;  4K0X A;  2EX8 A;  4C75 A;  4KZ7 A;  4OOL A;  4DE2 A;  2VGJ A;  4U0T A;  4UA7 A;  3A3E A;  2ZQA A;  2WGI A;  3PBQ A;  3SH9 A;  1ONG A;  4S2O A;  4BJP A;  2EFU A;  2Y2P A;  2H10 A;  5FAP A;  2Q9M A;  3VOZ A;  3G31 A;  4OP5 A;  5EVI C;  3MZD A;  2WAD A;  1HTZ A;  1LL5 A;  3UPO A;  1IKG A;  3ZHH A;  3TOI A;  1PI4 A;  3Q07 A;  1XXM A;  4WMC A;  2VGK A;  2A49 A;  4S2P A;  5HAR A;  1ZKJ A;  3ZG5 A;  3GSG A;  3QNC A;  4WZ4 A;  1KVM A;  1S6R A;  4OPQ A;  4KZ8 A;  4E3M A;  1ESI A;  3EQU A;  5AQA A;  3RJU A;  4OPY A;  3HL9 A;  3TG9 A;  1NXY A;  3WS5 A;  1KGG A;  5FAS A;  4R4R A;  1CEF A;  3WS4 A;  1PZO A;  5IHV A;  1O07 A;  3FYZ A;  1NRF A;  1MKI A;  3MZE A;  3PBR A;  5EVI D;  1K54 C;  1EI5 A;  4ZDX A;  4UA6 A;  3S4X A;  1ES2 A;  4C3Q A;  1GHM A;  3DWK A;  1K54 A;  3WS0 A;  5J8X A;  4XUZ A;  3Q1F A;  1W79 A;  3LY3 A;  1N9B A;  4DE1 A;  5HFO A;  3LEZ A;  5FA7 A;  1RGZ A;  3VP3 A;  5EOO A;  3ZGA B;  5GHY A;  2BLS A;  4UAA A;  5KSH A;  3UPP A;  5GL9 A;  3LCE A;  4FH4 A;  3OCL A;  2HPB A;  5FI6 A;  2Y2G A;  3G2Z A;  1YMS A;  1TDG A;  2X02 A;  4OKP A;  5DTS A;  1H8Y A;  3GQZ A;  4KQQ A;  3M6B A;  2JC7 A;  2WGV A;  4JF4 A;  4JBF A;  1YLY A;  1JWP A;  3O3V A;  3MXR A;  3BRM A;  4S2J A;  2ZC6 B;  2ZQ7 A;  3VSK A;  3UO9 A;  4EBP A;  3VSL A;  1H5X A;  3DTM A;  3BYD A;  1L0D A;  4BL3 A;  1ERQ A;  4HES A;  4ZJ3 A;  3AGD A;  3V3R A;  5HX9 A;  5AQ7 A;  4WEK A;  1K38 A;  5M19 A;  3N8L A;  3W8K A;  1I2S A;  4QB8 A;  3A3F A;  4MBF A;  3IHB A;  1GHP A;  1L0G A;  1WYB A;  4MEZ A;  4WEL A;  4KZ5 A;  5E2E A;  1PIO A;  4RX3 A;  5GLA A;  3MKE A;  3VMA A;  4WZ5 A;  3C5A A;  4QY6 A;  1YLP A;  1K6R A;  1YM1 A;  3SOI A;  4GN2 A;  4DXC A;  1K56 D;  4WZ5 C;  4GD6 A;  4S2L A;  5CGW A;  3BEB A;  5CHJ A;  5GLD A;  3UPN A;  4DXB A;  4BL2 A;  2Y2O A;  5FSR A;  5A92 A;  1XGI A;  4ZBE A;  3ZCZ A;  3RXW A;  1BLP A;  1YLW A;  5GLC A;  4HBT A;  2IWC A;  3UNW A;  2WGW A;  1XA1 A;  4K0W A;  2P9V A;  1HZO A;  2Y2J A;  3Q7V A;  4FCF A;  4PM7 A;  5G18 A;  3V50 A;  2QMI A;  1BLH A;  1XKZ A;  3SH8 A;  1CI9 A;  4KZ3 A;  1MWT A;  2JCH A;  2HDU A;  3W4Q A;  4HBU A;  4MBH A;  5KZH A;  3N8S A;  3OPR A;  5DTT A;  5DTK A;  2EX6 A;  5EE8 A;  1YLT A;  2V1Z A;  5DF7 A;  1VQQ A;  3NIA A;  2EFX A;  1ONH A;  4IVK A;  4OQ0 A;  3BM6 A;  4MBK A;  2GDN A;  3NI9 A;  3Q7Z A;  3SH7 A;  1XP4 A;  5CTM A;  5CGX A;  1G68 A;  5GHX A;  4EQI A;  2WUQ A;  5EEC A;  5FAT A;  2WGW B;  3CMZ A;  3EQV A;  1XGJ A;  4B88 A;  3NC8 A;  3G35 A;  1ES3 A;  3BEC A;  1IEL A;  3PAE A;  4GB7 A;  4DE0 A;  1ALQ A;  3PBO A;  1YLJ A;  1YLZ A;  2J9O A;  3A3I A;  4S2K A;  4JF5 A;  2BG1 A;  4OPZ A;  1BLS A;  1TDL A;  4WYY A;  5E2F A;  4ZJ2 A;  1JWV A;  2OLV A;  2Y2Q A; 
#chains in the Genus database with same CATH topology
 1ES4 A;  3ZG0 A;  3LIE A;  4EET B;  2VKS A;  2Y8H A;  2HP6 A;  4IHQ A;  5FQK A;  4S2M A;  4LLO B;  2WAE A;  1N9L A;  2HDS A;  3HRE A;  2NUT C;  3IXD A;  1AXB A;  3CAX A;  3E4P A;  1NWZ A;  4MCW A;  2YKH A;  5FQQ A;  2INW A;  3E2K A;  2MJ6 A;  3H9W A;  2WKP A;  3A3D A;  4KG5 A;  4PM8 A;  3S7Q A;  3GV9 A;  4Y0O A;  5F6A A;  3F1O B;  2QJ5 A;  1K6S A;  4X68 A;  5FEG A;  4JKT A;  2B18 A;  1PWD A;  1E3U D;  2P7J A;  2O99 A;  4N1H A;  4CQH A;  1NYY A;  2FFF B;  3MF0 A;  4N92 A;  4H6J B;  2XF3 A;  1KE0 A;  1YQS A;  5TBM B;  3TE8 A;  1XX2 A;  3MS6 A;  3C4O A;  5HWT A;  5CEC A;  3UDI A;  2J8Y A;  2HZ5 A;  1JVJ A;  2HDQ A;  4KZ9 A;  1EW0 A;  1W8Y A;  4YWZ A;  3IBJ A;  2PU4 A;  4ME4 A;  1MXO A;  3BQA A;  1W8Q A;  3HUM A;  1TD5 A;  4LV3 A;  2HP5 A;  2PU2 A;  3C7V A;  1VET B;  4JXW A;  1MBL A;  4H8R A;  4R3A A;  1QME A;  3IWO A;  2Y2M A;  5HDD A;  4PM5 A;  3OPP A;  1SDN A;  4DE3 A;  1YMX A;  1Z6F A;  4UQI M;  3GR2 A;  4II7 A;  2A3U A;  3GRJ A;  2ZJ9 A;  3V39 A;  1EWZ A;  3G2Y A;  4GS9 A;  1BZA A;  4KQR A;  2HF6 A;  4I39 A;  1KGE A;  4P6Z M;  1PW8 A;  2G2W A;  1TS0 A;  4LCL A;  1OTB A;  1JTD A;  4JPM A;  5HAP A;  2V2F F;  4N1X A;  3ZNY A;  4GZB A;  2OSU A;  4P85 A;  5F1F A;  3O87 A;  1IYQ A;  3O5Y A;  3PBS A;  4I38 A;  4X53 A;  5TBM A;  2JKF A;  2PBY A;  5L10 A;  4NK3 A;  5EVI B;  1LL9 A;  4Y7P A;  1XPB A;  1LSX A;  3VOY A;  5F68 A;  2PR6 A;  3LIC A;  5EUA A;  1OPX A;  3IHA A;  1G6O A;  4RVA A;  3FPW A;  1G28 A;  3F1N A;  2V20 A;  2WKI A;  4FSF A;  4L0L A;  1LI0 A;  2QJ7 A;  3G6O A;  3NEC A;  3BLS A;  2W3E A;  4PMA A;  3I7J A;  5TR7 A;  1I5Q A;  4ETZ A;  5CED A;  3R7W B;  2GJ3 A;  2QZ6 A;  1QMF A;  5FAQ A;  3ZDJ A;  5E43 A;  4Z9Q A;  2C5W B;  2ZC3 B;  5HWV A;  2R9X A;  4JXG A;  2J3W A;  3ZNT A;  3IXG A;  3Q82 A;  4DN0 A;  4EWF A;  3VP4 A;  3GVB A;  1PWG A;  1MY8 A;  3QNB A;  2Y91 A;  1E3U A;  3BW6 A;  4MMN A;  2XRO A;  3VFF A;  2ZMF A;  4G3W A;  1PW1 A;  1ZTU A;  3IQA A;  4EW7 A;  4KG6 A;  2L1M A;  3LIF A;  5EV0 A;  3S1Y A;  4LPZ A;  3HJK A;  2H28 A;  4K91 A;  5EFW A;  1IKI A;  1OJG A;  2QYB A;  5CRF A;  5CHU A;  3MQ0 A;  3NCK A;  4R23 A;  2EX2 A;  3UN7 A;  2ZC4 B;  1XA7 A;  1VM1 A;  1Q2P A;  4B4X A;  4R3B A;  5HL6 A;  1XJ6 A;  1Z09 A;  4XXR A;  1Q2Q A;  4LRX C;  3N7W A;  3HVF A;  1W63 M;  4R6L A;  3PHY A;  4U3T A;  1GA0 A;  3IWI A;  1ERM A;  2QHK A;  5HAI A;  2VGL S;  2HV1 A;  3HBR A;  3UE0 A;  2HJE A;  3LR0 A;  2JHE A;  1DJA A;  2OOL A;  5GHZ A;  2V9A A;  3IXB A;  2XA7 M;  4YNR A;  4BMW A;  1J9M A;  5F83 A;  4O7D A;  1O7E A;  3CUE A;  3MKF A;  4UA9 A;  4K0X A;  2EX8 A;  3C8C A;  4OOL A;  4UA7 A;  3PBQ A;  4S2O A;  2EFU A;  2Y2P A;  2H10 A;  3ZHH A;  3S7P A;  4WMC A;  3MXQ A;  1KVM A;  2PT7 A;  1ESI A;  3EQU A;  2V1B A;  3HL9 A;  4IJG A;  4O0P A;  3LI8 A;  3PBR A;  5EVI D;  4UA6 A;  3S4X A;  4C3Q A;  3U4L P;  3WS0 A;  4XUZ A;  3LY3 A;  1XFQ A;  1RGZ A;  1S66 L;  1OTE A;  2JKT M;  5GHY A;  4UAA A;  3UPP A;  2HPB A;  1YMS A;  5HD3 A;  4LFU A;  4GJ4 A;  4KQQ A;  2JC7 A;  4JF4 A;  1YLY A;  3BRM A;  1TF1 A;  4Q0I A;  4ZJ3 A;  5HX9 A;  5AQ7 A;  4QB8 A;  1TS8 A;  3DTI A;  1L0G A;  4KZ5 A;  2LB9 A;  1K56 D;  3C38 A;  1P9W A;  4GD6 A;  5CGW A;  3OBF A;  2HGV A;  1YLW A;  4HBT A;  2WGW A;  3Q7V A;  3V50 A;  1BLH A;  5A8B A;  1CI9 A;  1MWT A;  2HDU A;  1YSQ A;  4MBH A;  3N8S A;  3OPR A;  5DTT A;  5DTK A;  5EE8 A;  1YLT A;  1ODV A;  1CQA A;  1DRM A;  4EQI A;  2UV0 E;  2WUQ A;  2WGW B;  3EQV A;  2JKR M;  4DJ3 A;  1FIL A;  3NC8 A;  3G35 A;  1IEL A;  1ALQ A;  2IA2 A;  5E2F A;  1JWV A;  4BD0 A;  2Z6C A;  3Q81 A;  3EGD C;  4OOY A;  4WL9 A;  1SDE A;  4HJ3 A;  1NY0 A;  2PD7 A;  5DFY A;  2W3D A;  1NYM A;  4BBV A;  4BLM A;  4DRT A;  3KYQ A;  4S2N A;  4CLC D;  4EUV A;  5HW3 A;  1BLC A;  2Q9N A;  2PD8 A;  1Y4O A;  2Q0O A;  3T4T A;  3BJN A;  3A0S A;  4PKY A;  5GLB A;  3O88 A;  4KZ6 A;  4BEN A;  1UWP X;  1SZV A;  4FUW A;  3A0V A;  3G34 A;  1BTL A;  3LR4 A;  1CJF A;  1K57 C;  4MN6 A;  2PR5 A;  3VE4 A;  3PTE A;  1IOU A;  3FKW A;  1MKM A;  2WKQ A;  2JKG A;  4U0X A;  2P08 A;  3WS2 A;  2H0T A;  4EU0 A;  2ZOH A;  3QP8 A;  1D06 A;  1K25 A;  2DRW A;  4HH3 A;  4KZA A;  4P0M A;  4ETX A;  5CTN A;  4QHC A;  5DJU A;  2ZBB A;  2Z2L B;  4N9L A;  2OAP 1;  2Y2H A;  3F1N B;  2O9B A;  2OLU A;  1F2K A;  1T19 A;  2WAF A;  4E3O A;  5DJT A;  4OPR A;  1GHI A;  1RCJ A;  4GD8 A;  3ZG9 B;  2UWX A;  2KDK A;  1K55 C;  1DJC A;  5AQB A;  1C3B A;  5E2H A;  2G2U A;  2Z2M B;  4O01 A;  1F98 A;  2WZZ A;  3BWL A;  2XFT A;  2QWS A;  2EXB A;  2Y2K A;  4I3I A;  3V5M A;  2Y59 A;  1MZU A;  2J3T C;  5JYO A;  4IUK A;  1PI5 A;  2VK3 A;  1F9I A;  1V9Z A;  2Y2N A;  5KIZ A;  4MDZ A;  1BYW A;  2HDR A;  3JPU A;  3M2K A;  4ID4 A;  1K4F A;  4X69 A;  4E3K A;  4PM6 A;  3FV7 A;  2D01 A;  3H7W B;  2X01 A;  4GHI A;  2M7U A;  4AFI A;  4EUZ A;  4E3N A;  2XR0 A;  3PBN A;  2XGN A;  2Y55 A;  4EQ1 A;  4RA7 A;  1L0E A;  5EPH A;  4PHT A;  2CC1 A;  4DDY A;  4EEP A;  3HLE A;  3IF5 A;  4LRZ E;  3K2N A;  2OV5 A;  3S7O A;  2PYR A;  4R3J A;  4BBU A;  3IF6 A;  1I2W A;  4UEY A;  2EX9 A;  2PBD P;  3PBT A;  1FCO A;  1RP5 A;  5FI2 A;  3T1Q B;  3LY4 A;  1WA9 A;  4EBN A;  3MFD A;  1D1J A;  1ZG4 A;  3P09 A;  3NY4 A;  1M40 A;  1IYS A;  2G7U A;  1KE3 A;  3QP5 A;  1KDW A;  3TRC A;  5K5B A;  2GZA A;  3UE6 A;  2XK1 A;  4OQI A;  2B95 A;  1P0Z A;  4WN5 A;  1ESU A;  1OME A;  4KZB A;  1S1Z A;  2XDM A;  3ZQ5 A;  4E6X A;  1FQG A;  1U60 A;  4R70 A;  2WKE A;  2C6W B;  3M2J A;  4ARZ B;  1T1C A;  2GNX A;  4C6Y A;  1MWS A;  4KQO A;  2Y4A A;  4NXF A;  1X0O A;  4OLG A;  3NBL A;  1PFL A;  3IT9 A;  3NOT C;  5G4Y A;  4YOF A;  1YKD A;  1KVL A;  4WLA A;  3MXS A;  1GSV A;  3VP2 A;  2ZQD A;  2H5S A;  2CMN A;  3HLB A;  2EWV A;  5JYP A;  4JGR A;  3CZD A;  4E3I A;  3UDX A;  3IXH A;  1SCW A;  4HJ4 A;  3P7N A;  4BD1 A;  2QKP A;  3CWF A;  3KSG A;  5EM0 A;  1JWZ A;  3G4P A;  3NOU C;  1KDS A;  4QJG A;  5M18 A;  3UB5 P;  3BFF A;  3BFE A;  2P74 A;  3FC7 A;  1PWC A;  3C30 A;  3FWL A;  3ISG A;  1W5D A;  4E6W A;  1FSY A;  4QPR A;  2EA9 A;  5AVE A;  3A3E A;  4WUJ A;  2ZQA A;  2WGI A;  1ONG A;  4CLC A;  3VOZ A;  2VV6 A;  5EVI C;  1HTZ A;  1LL5 A;  4KUO A;  3UPO A;  3VE3 A;  2VGK A;  2PDR A;  2VJW A;  2V8C A;  1P97 A;  4WZ4 A;  4KZ8 A;  4E3M A;  3RJU A;  1NXY A;  3F1P B;  2VV8 A;  4R4R A;  3FYZ A;  1YAX A;  4ZDX A;  1ES2 A;  1GHM A;  3B47 A;  2XRN A;  4DE1 A;  5HFO A;  2OWH A;  3LYX A;  2Y2G A;  3P01 A;  5HDS A;  4P6Z S;  3G2Z A;  1TDG A;  2X02 A;  2WGV A;  1JWP A;  3MXR A;  2YKF A;  2ZC6 B;  3T4Q A;  3UO9 A;  1DP9 A;  3VSL A;  2Z6D A;  3DTM A;  2O0Y A;  1L0D A;  1DP8 A;  4HHD A;  3V3R A;  3N8L A;  3W8K A;  1I2S A;  4MBF A;  3ULF A;  1WYB A;  2VGL M;  4WEL A;  4RX3 A;  5GLA A;  3C5A A;  4QY6 A;  4DXC A;  4WZ5 C;  4S2L A;  5GLD A;  4DXB A;  4BL2 A;  2Y2O A;  5FSR A;  3T12 B;  4ZBE A;  3RXW A;  3EGX C;  1OT6 A;  4H6J A;  2P9V A;  1T1A A;  4FCF A;  2QMI A;  3SH8 A;  4KZ3 A;  2BAS A;  2ZMV A;  4HBU A;  2EX6 A;  2P04 A;  2V1Z A;  5IT5 A;  1D7E A;  1ONH A;  4X1L A;  5EVE A;  3NI9 A;  3SH7 A;  5CGX A;  5GHX A;  2FH5 A;  3CPT A;  5EEC A;  2M7V A;  3BQ8 A;  3BEC A;  4GB7 A;  4DE0 A;  1YLJ A;  2J9O A;  3A3I A;  4S2K A;  4UQI S;  3E4O A;  1BLS A;  1TDL A;  3T4O A;  3UB8 A;  4WM9 A;  3IF6 C;  4WMC D;  1E4D A;  5C5K A;  4G3K A;  4K08 A;  5HPF A;  1GCE A;  5HAQ A;  3JYI A;  4EV4 A;  2W1T A;  2XEP A;  4KG2 A;  2XLN A;  4Q0H A;  3NJA A;  3CUE C;  1FR6 A;  5TGF A;  2VLG A;  3KSF A;  3OLO A;  3S22 A;  1VET A;  3UME A;  4WBG A;  3LIA A;  1ZHH B;  3T1S A;  3K3D A;  3BFG A;  2A24 B;  3KSI A;  4QD4 A;  1L2S A;  3OPL A;  3HLF A;  3UB9 A;  4JGP A;  3SS5 A;  1YSP A;  4Y15 A;  1GSW A;  1OT9 A;  1ZG6 A;  4HY8 A;  1FOF A;  5FEF A;  3D4F A;  2P9V B;  4Y13 A;  4HP9 A;  2XD1 A;  3CPT B;  4YIN A;  2IWB A;  4LEN A;  3AGF A;  2D02 A;  3ZVT A;  4IUH A;  2JKR I;  3OCN A;  2W3G A;  3RFB A;  2WZX A;  4KZ4 A;  1DY6 A;  4M3K A;  2W1T B;  3LO7 A;  4DDS A;  1CI8 A;  2KOI A;  5AQ9 A;  2HP9 A;  2WKR A;  1BUE A;  2ZL1 B;  4R1G A;  3UDF A;  2XQZ A;  2IWD A;  2RL3 A;  2ZQC A;  3VV4 A;  3ZFZ A;  1VEU A;  2ZQ8 A;  4S2I A;  3OPH A;  2PAV P;  4MN7 A;  3T1X A;  3B3X A;  1BT5 A;  5HD5 A;  5D3O A;  2I72 A;  1YPR A;  4JXS A;  2ZL1 A;  4F94 A;  5BOH A;  3FZC A;  4HJ6 A;  4MLL A;  5KSC A;  4A5R A;  2K2N A;  3CLO A;  2EWW A;  5L8M A;  4OLD A;  1TEM A;  3D3O A;  3CI6 A;  4HI4 A;  1GA9 A;  3MBZ A;  1JNU A;  3KSH A;  5CHM A;  2WYX A;  2XFS A;  1WE4 A;  4QU3 A;  4IBR A;  4IVI A;  4GDN A;  3O86 A;  3PAG A;  5DF8 A;  2WK0 A;  1S67 L;  2JKT I;  3SS4 A;  5HDC A;  2ZM2 A;  2AVX A;  3D72 A;  3HLG A;  1YT4 A;  3WRT A;  3DBA A;  3E2L A;  1IFQ A;  2XSS A;  1FSW A;  4E3J A;  2K7S A;  4NXB A;  1ERO A;  5J4E A;  2PHY A;  2DNS A;  2ZOI A;  4JXV A;  4R38 A;  4Y17 A;  2W0N A;  2R9W A;  4NG2 A;  3D9Y A;  4RX2 A;  3IF6 B;  1FR1 A;  1KOU A;  1IEM A;  1DJB A;  1AWI A;  2M1C A;  1W63 Q;  4S2N C;  5EM1 A;  5F5Y A;  1S0W A;  3ITA A;  5E2G A;  4KUK A;  2K31 A;  2A24 A;  3TSG A;  3R7W A;  3UE3 A;  1K0K A;  4NKP A;  2ZM8 A;  4QWO A;  1PYY A;  3IH8 A;  3T50 A;  4GKU A;  3L9K A;  2DCF A;  2JE5 A;  4PM9 A;  5CER A;  3E0Y A;  4D2O A;  4GNU A;  1FIK A;  3W4P A;  4OH0 A;  1NLZ A;  3NDG A;  3DWZ A;  2XH9 A;  4PPR A;  2WKH A;  2W1R A;  4P6B A;  1FCN A;  4ZAM A;  1OJ5 A;  2KX6 A;  1OTA A;  5EVL A;  3A3J A;  3SZT A;  3VP0 A;  5L09 A;  5FQJ A;  3FG8 A;  1MWR A;  3LUQ A;  2H0Y A;  3ZVW A;  5U47 A;  2W3F A;  3IWQ A;  2J80 A;  1SKO B;  5LBR A;  4OOM A;  2E8J A;  2Y79 A;  4HOI A;  3EWK A;  1BUL A;  3WS1 A;  1VEU B;  2VV7 A;  4CPK A;  1LLB A;  1S4S A;  1NZO A;  3UY6 A;  2VX8 A;  4NET A;  1L0F A;  5CEB A;  3NDE A;  1NZU A;  3L7H A;  5CXW A;  5FAO A;  4OQG A;  1NJ4 A;  4MN5 A;  4C75 A;  4KZ7 A;  4F3L B;  4DE2 A;  2VGJ A;  5FDS A;  2W3H A;  4BJP A;  4XT2 A;  2Q9M A;  3G31 A;  4OP5 A;  4EER A;  3MZD A;  3E4Q A;  3TOI A;  1PI4 A;  3Q07 A;  2A49 A;  4S2P A;  3ZG5 A;  1S6R A;  4PKY G;  2XA7 S;  3R4K A;  5DKK A;  4OPY A;  4LGW A;  3WS5 A;  5FAS A;  1CEF A;  3WS4 A;  5IHV A;  3E98 A;  3B33 A;  1O07 A;  1MKI A;  3UB6 A;  1XJ2 A;  4GS9 B;  1N9B A;  4EES A;  3LEZ A;  5EOO A;  4HP4 A;  3ZGA B;  1NLY A;  5KSH A;  3T4J A;  3LCE A;  4Q0J A;  3TW8 A;  3UMD A;  4XT2 B;  5CX7 A;  1H8Y A;  4GLQ A;  1T18 A;  3KYE A;  3DTE A;  1PNE A;  2ZQ7 A;  1H5X A;  4PAU A;  3OOV A;  3BYD A;  4BL3 A;  4HES A;  3AGD A;  4WEK A;  5M19 A;  3A3F A;  3LIB A;  3IHB A;  4MEZ A;  4CLC C;  1CF0 A;  2OWJ A;  3NOP C;  1K6R A;  4HH2 A;  3BEB A;  3UPN A;  5A92 A;  1BLP A;  5GLC A;  2IWC A;  3CHW P;  1XA1 A;  4PM7 A;  5G18 A;  1XKZ A;  1F5M A;  3QP2 A;  5KZH A;  4DJ2 A;  1S1Y A;  3EEA A;  5DF7 A;  3NIA A;  4IVK A;  4OQ0 A;  5J3W A;  4MBK A;  2GDN A;  3Q7Z A;  3IX8 A;  1XFN A;  2V8F A;  3BY8 A;  5FAT A;  1XGJ A;  4B88 A;  1TS7 A;  4FOF A;  3PAE A;  3LEQ A;  2BG1 A;  4OPZ A;  4WYY A;  4ZJ2 A;  2OLV A;  4DKI A;  3VP1 A;  3VOL A;  1KGF A;  2ZC5 B;  3LGO A;  2Y2L A;  4JGO A;  4XUX A;  4JGQ A;  3MFX A;  4B93 A;  2PYP A;  3LI9 A;  5L2F A;  5AVF A;  3RH8 B;  4CLC B;  2V0W A;  1G5U A;  4GDB A;  1MWU A;  4KEN B;  2RCX A;  1CK3 A;  4LCM A;  3P98 A;  1RGY A;  3IX3 A;  1SKO A;  4N9K A;  3QP6 A;  4OP8 A;  1K57 A;  4Y0T A;  4DMZ A;  2FFY A;  5I5L A;  3QP1 A;  3KO6 A;  3IBR A;  2L4R A;  1NRJ A;  3EEH A;  3V3S A;  1J3W A;  3JVV A;  1K4E A;  2EXA A;  1LHY A;  3N8R A;  3ZYT A;  1M6K A;  3H82 A;  4Y2F A;  3MSH A;  1H8Z A;  2BTF P;  3MZF A;  4G3V A;  2QPN A;  3N6I A;  3LFV A;  4GHI B;  4IBX A;  5IU1 A;  3CIT A;  1H0M A;  2JN7 A;  2R78 A;  3WWX A;  3VFH A;  3IS2 B;  5MC7 A;  4X56 A;  1ACF A;  2E8I A;  5HPI A;  4FH2 A;  5I94 A;  4X55 A;  3Q7V B;  4IED A;  3C7U A;  4LV0 A;  1GSX A;  4LV2 A;  4Z1W A;  1K55 A;  3OC2 A;  4MNR A;  3RTY A;  4M4X A;  2X71 A;  3K3C A;  3ITB A;  4HIA A;  4LRY C;  4R4S A;  4BQM A;  4ESP A;  2JBF A;  5KMW A;  4L9E A;  1KE4 A;  5F1G A;  3W4O A;  4LV1 A;  3G32 A;  1LSV A;  3G30 A;  2VA0 A;  3T1R A;  3EOI A;  4E3L A;  4RYE A;  1ES5 A;  1LL8 A;  1PRQ A;  5M1A A;  1E25 A;  5FQI A;  2W27 A;  1Y54 A;  4Y0U A;  5HZH A;  4WEJ A;  1LI9 A;  2ZM0 A;  1HVB A;  5FQ9 A;  4GOG A;  5DF9 A;  4Q8I A;  4ZTK A;  4EXO A;  3CJM A;  3QHY A;  2I9V A;  1FCM A;  4BBT A;  3TJZ C;  5EVI A;  2GX5 A;  4ARZ A;  5FI7 A;  3DTK A;  5FQM A;  5EOE A;  5G4Z A;  4HQA A;  3V67 A;  3ZG8 B;  4UHU A;  4EEU A;  3LR5 A;  4B9O A;  1JTG A;  4F3L A;  1IYO A;  5FL3 A;  3UE1 A;  2HJ9 C;  1XJ3 A;  4JF6 A;  2FZ0 A;  3FPV A;  1SKF A;  4GW9 A;  3F1O A;  5J7E A;  1N4O A;  3FKV A;  4RQ9 A;  2ZQ9 A;  4HEF A;  4Y5F A;  1SHV A;  1XJ4 A;  4NXG A;  4X6T A;  3BFD A;  4NEE D;  2J9P A;  3GDI A;  2ZLY A;  3CG5 A;  1S4R A;  1G6A A;  3U2A A;  3IH9 A;  3OZH A;  5CGS A;  3WRZ A;  3S7N A;  5A90 A;  1K56 A;  4ZJ1 A;  1H8M A;  3C4P A;  4DF6 A;  3RXX A;  4YFM A;  3HLW A;  2VEA A;  2ZD8 A;  3HCY A;  4FTX A;  1HLU P;  5FDH A;  4P87 A;  3GTC A;  4NXE A;  1TVF A;  3HUN A;  5HL1 A;  3MR0 A;  4R0Q A;  2J7V A;  4FD8 A;  5DVA A;  4JLF A;  3SS3 A;  1OTD A;  3HJI A;  1MPL A;  3H82 B;  5TFQ A;  1TS6 A;  2O9A A;  1CEG A;  2VZW A;  3PR6 A;  4QY5 A;  1H3Q A;  3MMH A;  2Y2I A;  1WYC A;  4OVD A;  3NUL A;  1W7F A;  3B42 A;  3DW0 A;  4KQD A;  1BSG A;  2XD5 A;  1PZP A;  3M6H A;  4HNB A;  2V0U A;  3T4L A;  3GMW A;  3KYZ A;  2ZMA A;  1IYP A;  3PYP A;  4Y3I A;  5A93 A;  2ZC7 A;  5A91 A;  3QP4 A;  3N4I A;  4OON A;  2KLI A;  4EBL A;  1T1B A;  5F82 A;  4I5S A;  3ZG7 B;  4BWI A;  4B4Z A;  4CJN A;  4OQH A;  3BLM A;  1ZC2 A;  3BFC A;  3GEC A;  3ICY A;  3HLC A;  2B5R A;  1HD8 A;  3HLD A;  3AGE A;  3MQO A;  3T4K A;  3HUO A;  2O9C A;  1UGU A;  4U0T A;  5DKL A;  4D60 A;  3SH9 A;  1MC0 A;  5FAP A;  5HWW A;  2WAD A;  3NHQ A;  1IKG A;  3IX4 A;  1LSW A;  1XXM A;  5HAR A;  1ZKJ A;  2V1A A;  3LR3 A;  3GSG A;  3QNC A;  4OPQ A;  5AQA A;  3TG9 A;  1KGG A;  3JVU A;  5L07 A;  1PZO A;  1NRF A;  3MZE A;  1VHM A;  2J3T D;  2PRF A;  1VB6 A;  5AJG A;  1K54 C;  1EI5 A;  4WF0 A;  3DWK A;  1K54 A;  5J8X A;  3Q1F A;  1W79 A;  2DMW A;  5FA7 A;  5HSQ A;  3VP3 A;  3H7W A;  1STZ A;  2BLS A;  5F69 A;  5GL9 A;  4FH4 A;  3OCL A;  5FI6 A;  1V9Y A;  1N9O A;  3MQQ A;  4X1M A;  4OKP A;  5DTS A;  4X25 A;  3GQZ A;  1L3L A;  3M6B A;  4JBF A;  3O3V A;  4S2J A;  3VSK A;  3MJQ A;  4EBP A;  3KX0 X;  1ERQ A;  1K38 A;  2OAQ 1;  4L9G A;  3PXP A;  4GCZ A;  1GHP A;  2A2L A;  3LID A;  1PIO A;  5E2E A;  3MKE A;  3IS2 A;  3VMA A;  4WZ5 A;  3F1P A;  1YLP A;  1YM1 A;  3SOI A;  4GN2 A;  1OTI A;  3UB7 A;  1DP6 A;  2B02 A;  1LT0 A;  3DAV A;  5CHJ A;  3A0R A;  1XGI A;  4ZRR A;  3ZCZ A;  2LB5 A;  3UNW A;  3C2W A;  1UWN X;  4I3A A;  5IS1 A;  4K0W A;  1HZO A;  2Y2J A;  1P9R A;  3SW1 A;  4I3J A;  4O8G A;  2JCH A;  1Y28 A;  2ACG A;  3T4S A;  3W4Q A;  4CLC E;  1VQQ A;  2EFX A;  3BM6 A;  2NUP C;  1XP4 A;  5CTM A;  3BY9 A;  1G68 A;  4E04 A;  1A0K A;  1N9N A;  3CMZ A;  5TJJ A;  1ES3 A;  5DFX A;  3PBO A;  4L9F A;  1YLZ A;  2L0W A;  4JF5 A;  3W2Z A;  2Y2Q A; 
#chains in the Genus database with same CATH homology
 4OOY A;  4WM9 A;  4DKI A;  1ES4 A;  3IF6 C;  3VP1 A;  4WMC D;  3ZG0 A;  1E4D A;  1SDE A;  1KGF A;  1NY0 A;  2ZC5 B;  1NYM A;  4BD0 A;  4BLM A;  4DRT A;  2Y2L A;  1GCE A;  2HP6 A;  3JYI A;  4S2N A;  4XUX A;  5HAQ A;  4EV4 A;  5FQK A;  2XEP A;  5HW3 A;  4S2M A;  2WAE A;  2HDS A;  3HRE A;  5L2F A;  1BLC A;  2Q9N A;  4KG2 A;  3IXD A;  1AXB A;  4GDB A;  2XLN A;  1MWU A;  4KEN B;  2RCX A;  1CK3 A;  4LCM A;  5FQQ A;  3P98 A;  1RGY A;  5GLB A;  3E2K A;  3O88 A;  1FR6 A;  4KZ6 A;  4BEN A;  4N9K A;  5TGF A;  3S22 A;  4OP8 A;  3A3D A;  4KG5 A;  4PM8 A;  1K57 A;  3GV9 A;  3G34 A;  4Y0O A;  1BTL A;  4WBG A;  4Y0T A;  1K57 C;  2FFY A;  1K6S A;  3PTE A;  3BFG A;  4X68 A;  3FKW A;  3V3S A;  4JKT A;  4QD4 A;  1L2S A;  1PWD A;  1E3U D;  3OPL A;  1K4E A;  3HLF A;  4N1H A;  2EXA A;  1LHY A;  3N8R A;  3SS5 A;  1M6K A;  1NYY A;  2FFF B;  1ZG6 A;  4N92 A;  1FOF A;  1H8Z A;  2XF3 A;  3MZF A;  1KE0 A;  3D4F A;  4U0X A;  1YQS A;  2P9V B;  2QPN A;  3WS2 A;  3N6I A;  2H0T A;  2XD1 A;  4IBX A;  1XX2 A;  3C4O A;  4YIN A;  2IWB A;  5CEC A;  4LEN A;  3UDI A;  2J8Y A;  3AGF A;  1K25 A;  2DRW A;  4KZA A;  4P0M A;  1JVJ A;  3VFH A;  3WWX A;  5CTN A;  4QHC A;  2HDQ A;  4X56 A;  3ZVT A;  4KZ9 A;  1W8Y A;  2Z2L B;  2PU4 A;  4N9L A;  3OCN A;  1MXO A;  2WZX A;  1DY6 A;  4KZ4 A;  1W8Q A;  2E8I A;  2Y2H A;  4FH2 A;  4M3K A;  5I94 A;  4X55 A;  3LO7 A;  3HUM A;  2OLU A;  4DDS A;  1CI8 A;  4LV3 A;  2HP5 A;  3Q7V B;  5AQ9 A;  2HP9 A;  4IED A;  3UDF A;  1BUE A;  4R1G A;  3C7U A;  4LV0 A;  2XQZ A;  2IWD A;  2PU2 A;  2WAF A;  4E3O A;  3C7V A;  2RL3 A;  4LV2 A;  1GHI A;  2ZQC A;  4JXW A;  1K55 A;  1MBL A;  4OPR A;  3OC2 A;  1RCJ A;  4MNR A;  4GD8 A;  3ZG9 B;  3ZFZ A;  2UWX A;  4H8R A;  1K55 C;  1DJC A;  5AQB A;  1QME A;  2X71 A;  1C3B A;  2ZQ8 A;  5E2H A;  2G2U A;  2Z2M B;  3IWO A;  2Y2M A;  4S2I A;  3ITB A;  4PM5 A;  3OPH A;  4R4S A;  4BQM A;  2WZZ A;  2JBF A;  3B3X A;  5KMW A;  2XFT A;  1BT5 A;  1KE4 A;  5F1G A;  3W4O A;  4LV1 A;  3G32 A;  1SDN A;  3OPP A;  1YMX A;  1Z6F A;  5D3O A;  4DE3 A;  3GR2 A;  2EXB A;  2Y2K A;  3G30 A;  4E3L A;  3V5M A;  2A3U A;  2I72 A;  4RYE A;  1ES5 A;  2ZJ9 A;  2Y59 A;  3GRJ A;  1EWZ A;  3V39 A;  4JXS A;  1E25 A;  3Q81 A;  5FQI A;  5M1A A;  5JYO A;  1Y54 A;  3G2Y A;  1PI5 A;  4Y0U A;  1BZA A;  4KQR A;  4WEJ A;  4F94 A;  1LI9 A;  2ZM0 A;  5BOH A;  1HVB A;  3FZC A;  5FQ9 A;  1KGE A;  2Y2N A;  4GOG A;  4MLL A;  5DF9 A;  5KSC A;  1PW8 A;  4A5R A;  4Q8I A;  4ZTK A;  2G2W A;  3CJM A;  3QHY A;  4LCL A;  2HDR A;  1JTD A;  4JPM A;  5HAP A;  2V2F F;  4N1X A;  3M2K A;  1FCM A;  4GZB A;  2OSU A;  4ID4 A;  4OLD A;  1TEM A;  4P85 A;  3ZNY A;  3O87 A;  1IYQ A;  5F1F A;  3PBS A;  4X53 A;  1GA9 A;  1K4F A;  3MBZ A;  4X69 A;  4E3K A;  4PM6 A;  5EVI A;  2PBY A;  3FV7 A;  2X01 A;  5FI7 A;  4NK3 A;  4EUZ A;  5CHM A;  5EOE A;  2WYX A;  1LL9 A;  5EVI B;  5FQM A;  2XR0 A;  4Y7P A;  1XPB A;  2XGN A;  3PBN A;  4UHU A;  3ZG8 B;  4E3N A;  2Y55 A;  2XFS A;  1JTG A;  4RA7 A;  1IYO A;  1L0E A;  1WE4 A;  4QU3 A;  4IBR A;  4IVI A;  4GDN A;  3O86 A;  5EPH A;  3UE1 A;  3VOY A;  2CC1 A;  3PAG A;  4JF6 A;  5DF8 A;  2WK0 A;  5EUA A;  4DDY A;  3SS4 A;  1SKF A;  3IHA A;  2ZM2 A;  3HLE A;  3IF5 A;  4RVA A;  1N4O A;  3HLG A;  1YT4 A;  2OV5 A;  3WRT A;  3FKV A;  4R3J A;  3E2L A;  2ZQ9 A;  3IF6 A;  1FSW A;  4HEF A;  2V20 A;  4E3J A;  2WKI A;  1ERO A;  1I2W A;  1SHV A;  4FSF A;  4X6T A;  4L0L A;  2DNS A;  2EX9 A;  1LI0 A;  3BFD A;  3PBT A;  2J9P A;  1FCO A;  4JXV A;  2ZLY A;  1RP5 A;  5FI2 A;  3BLS A;  2R9W A;  3CG5 A;  4PMA A;  3I7J A;  5TR7 A;  1I5Q A;  1G6A A;  3LY4 A;  5CED A;  3IH9 A;  3OZH A;  5CGS A;  3WRZ A;  4EBN A;  3MFD A;  4RX2 A;  2QZ6 A;  1QMF A;  3IF6 B;  1FR1 A;  5FAQ A;  1ZG4 A;  3P09 A;  3ZDJ A;  3NY4 A;  5E43 A;  5A90 A;  1IEM A;  1K56 A;  4Z9Q A;  4ZJ1 A;  1DJB A;  1M40 A;  3C4P A;  2C5W B;  4DF6 A;  2ZC3 B;  3RXX A;  1IYS A;  4YFM A;  4S2N C;  1KE3 A;  2R9X A;  4JXG A;  1KDW A;  1S0W A;  3HLW A;  3ITA A;  5E2G A;  3ZNT A;  3IXG A;  2ZD8 A;  3Q82 A;  2XK1 A;  4EWF A;  4OQI A;  3TSG A;  3VP4 A;  3GVB A;  1PWG A;  1MY8 A;  3QNB A;  5FDH A;  3UE3 A;  4P87 A;  1ESU A;  1OME A;  2Y91 A;  3GTC A;  4KZB A;  2XDM A;  1TVF A;  2ZM8 A;  4E6X A;  1FQG A;  1E3U A;  1PYY A;  1U60 A;  3HUN A;  3IH8 A;  5HL1 A;  4GKU A;  2WKE A;  2C6W B;  3M2J A;  2DCF A;  2JE5 A;  4PM9 A;  5CER A;  3VFF A;  4R0Q A;  2J7V A;  4D2O A;  4GNU A;  4FD8 A;  5DVA A;  4C6Y A;  1PW1 A;  1MWS A;  4JLF A;  3W4P A;  4KQO A;  2Y4A A;  4OH0 A;  3IQA A;  4KG6 A;  3SS3 A;  4OLG A;  3NBL A;  1MPL A;  3DWZ A;  3NDG A;  3S1Y A;  2XH9 A;  3IT9 A;  4PPR A;  5TFQ A;  2WKH A;  4K91 A;  4P6B A;  1IKI A;  1FCN A;  4ZAM A;  1CEG A;  4QY5 A;  1KVL A;  5CRF A;  5CHU A;  2Y2I A;  3MXS A;  5EVL A;  1WYC A;  3A3J A;  3VP0 A;  5FQJ A;  4OVD A;  3VP2 A;  3NCK A;  1W7F A;  4R23 A;  2EX2 A;  3UN7 A;  2ZC4 B;  1XA7 A;  1VM1 A;  1MWR A;  3DW0 A;  2H0Y A;  1Q2P A;  2ZQD A;  4R3B A;  3ZVW A;  5U47 A;  1BSG A;  3IWQ A;  2H5S A;  4B4X A;  2XD5 A;  3HLB A;  1PZP A;  3M6H A;  5JYP A;  4XXR A;  1Q2Q A;  3GMW A;  3CZD A;  3HVF A;  3N7W A;  4OOM A;  4E3I A;  2ZMA A;  1IYP A;  3UDX A;  1BUL A;  5A93 A;  3IXH A;  2ZC7 A;  1SCW A;  5A91 A;  3WS1 A;  3N4I A;  4OON A;  4U3T A;  4BD1 A;  1GA0 A;  4CPK A;  3IWI A;  1ERM A;  1LLB A;  5HAI A;  4EBL A;  3HBR A;  5F82 A;  3UE0 A;  1JWZ A;  1NZO A;  3ZG7 B;  3G4P A;  3UY6 A;  1KDS A;  4NET A;  4B4Z A;  1DJA A;  4QJG A;  5M18 A;  5GHZ A;  4CJN A;  4OQH A;  1L0F A;  1ZC2 A;  3BLM A;  3BFC A;  3IXB A;  5CEB A;  3BFF A;  3NDE A;  3BFE A;  1NZU A;  2P74 A;  5CXW A;  5FAO A;  1J9M A;  1PWC A;  3FWL A;  3HLC A;  4OQG A;  5F83 A;  4O7D A;  3ISG A;  2B5R A;  1O7E A;  1NJ4 A;  3MKF A;  1HD8 A;  3HLD A;  3AGE A;  1W5D A;  4UA9 A;  4E6W A;  3HUO A;  1FSY A;  4K0X A;  2EX8 A;  4C75 A;  4KZ7 A;  4OOL A;  4DE2 A;  2VGJ A;  4U0T A;  4UA7 A;  3A3E A;  2ZQA A;  2WGI A;  3PBQ A;  3SH9 A;  1ONG A;  4S2O A;  4BJP A;  2EFU A;  2Y2P A;  2H10 A;  5FAP A;  2Q9M A;  3VOZ A;  3G31 A;  4OP5 A;  5EVI C;  3MZD A;  2WAD A;  1HTZ A;  1LL5 A;  3UPO A;  1IKG A;  3ZHH A;  3TOI A;  1PI4 A;  3Q07 A;  1XXM A;  4WMC A;  2VGK A;  2A49 A;  4S2P A;  5HAR A;  1ZKJ A;  3ZG5 A;  3GSG A;  3QNC A;  4WZ4 A;  1KVM A;  1S6R A;  4OPQ A;  4KZ8 A;  4E3M A;  1ESI A;  3EQU A;  5AQA A;  3RJU A;  4OPY A;  3HL9 A;  3TG9 A;  1NXY A;  3WS5 A;  1KGG A;  5FAS A;  4R4R A;  1CEF A;  3WS4 A;  1PZO A;  5IHV A;  1O07 A;  3FYZ A;  1NRF A;  1MKI A;  3MZE A;  3PBR A;  5EVI D;  1K54 C;  1EI5 A;  4ZDX A;  4UA6 A;  3S4X A;  1ES2 A;  4C3Q A;  1GHM A;  3DWK A;  1K54 A;  3WS0 A;  5J8X A;  4XUZ A;  3Q1F A;  1W79 A;  3LY3 A;  1N9B A;  4DE1 A;  5HFO A;  3LEZ A;  5FA7 A;  1RGZ A;  3VP3 A;  5EOO A;  3ZGA B;  5GHY A;  2BLS A;  4UAA A;  5KSH A;  3UPP A;  5GL9 A;  3LCE A;  4FH4 A;  3OCL A;  2HPB A;  5FI6 A;  2Y2G A;  3G2Z A;  1YMS A;  1TDG A;  2X02 A;  4OKP A;  5DTS A;  1H8Y A;  3GQZ A;  4KQQ A;  3M6B A;  2JC7 A;  2WGV A;  4JF4 A;  4JBF A;  1YLY A;  1JWP A;  3O3V A;  3MXR A;  3BRM A;  4S2J A;  2ZC6 B;  2ZQ7 A;  3VSK A;  3UO9 A;  4EBP A;  3VSL A;  1H5X A;  3DTM A;  3BYD A;  1L0D A;  4BL3 A;  1ERQ A;  4HES A;  4ZJ3 A;  3AGD A;  3V3R A;  5HX9 A;  5AQ7 A;  4WEK A;  1K38 A;  5M19 A;  3N8L A;  3W8K A;  1I2S A;  4QB8 A;  3A3F A;  4MBF A;  3IHB A;  1GHP A;  1L0G A;  1WYB A;  4MEZ A;  4WEL A;  4KZ5 A;  5E2E A;  1PIO A;  4RX3 A;  5GLA A;  3MKE A;  3VMA A;  4WZ5 A;  3C5A A;  4QY6 A;  1YLP A;  1K6R A;  1YM1 A;  3SOI A;  4GN2 A;  4DXC A;  1K56 D;  4WZ5 C;  4GD6 A;  4S2L A;  5CGW A;  3BEB A;  5CHJ A;  5GLD A;  3UPN A;  4DXB A;  4BL2 A;  2Y2O A;  5FSR A;  5A92 A;  1XGI A;  4ZBE A;  3ZCZ A;  3RXW A;  1BLP A;  1YLW A;  5GLC A;  4HBT A;  2IWC A;  3UNW A;  2WGW A;  1XA1 A;  4K0W A;  2P9V A;  1HZO A;  2Y2J A;  3Q7V A;  4FCF A;  4PM7 A;  5G18 A;  3V50 A;  2QMI A;  1BLH A;  1XKZ A;  3SH8 A;  1CI9 A;  4KZ3 A;  1MWT A;  2JCH A;  2HDU A;  3W4Q A;  4HBU A;  4MBH A;  5KZH A;  3N8S A;  3OPR A;  5DTT A;  5DTK A;  2EX6 A;  5EE8 A;  1YLT A;  2V1Z A;  5DF7 A;  1VQQ A;  3NIA A;  2EFX A;  1ONH A;  4IVK A;  4OQ0 A;  3BM6 A;  4MBK A;  2GDN A;  3NI9 A;  3Q7Z A;  3SH7 A;  1XP4 A;  5CTM A;  5CGX A;  1G68 A;  5GHX A;  4EQI A;  2WUQ A;  5EEC A;  5FAT A;  2WGW B;  3CMZ A;  3EQV A;  1XGJ A;  4B88 A;  3NC8 A;  3G35 A;  1ES3 A;  3BEC A;  1IEL A;  3PAE A;  4GB7 A;  4DE0 A;  1ALQ A;  3PBO A;  1YLJ A;  1YLZ A;  2J9O A;  3A3I A;  4S2K A;  4JF5 A;  2BG1 A;  4OPZ A;  1BLS A;  1TDL A;  4WYY A;  5E2F A;  4ZJ2 A;  1JWV A;  2OLV A;  2Y2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...