4Z9QA

Crystal structure of oxa-58 with disordered active site
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
242
structure length
223
Chain Sequence
SIIDQNVQALFNEISADAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFIANALIGLENHKATSTEIFKWDGKPRTVPVYQELARRIGPSLMQSELQRIGYGNMQIGTEVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQQVKEMLYVERRGENRLYAKSGWGMAVDPQVGWYVGFVEKADGQVVAFALNMQMKAGDDIALRKQLSLDVLDKLGVFHY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase OXA-58
publication title Crystal structure of OXA-58 with disordered active site
rcsb
source organism Acinetobacter baumannii acicu
total genus 68
structure length 223
sequence length 242
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4z9qA00
3HLWA 5CGWA 5CXWA 2HDQA 3Q81A 4Y7PA 2XR0A 3HUNA 5FQKA 3PBTA 4S2NC 3UY6A 4E3KA 2HP9A 3E2KA 2XK1A 1KE0A 1EI5A 3BLMA 1FQGA 4IBRA 5DF8A 5AQ7A 5GL9A 4DE2A 5BOHA 1I5QA 5J8XA 3OPPA 4OPRA 5CHUA 1LL5A 2ZC6B 1FR6A 1KDSA 4K91A 1M40A 4P85A 4KG2A 3QHYA 1BLHA 2XH9A 1TVFA 2B5RA 2DRWA 2Y2KA 4R0QA 4EV4A 4X6TA 3N4IA 3O88A 4UA6A 4OOMA 4KZAA 4OVDA 4WBGA 1ERMA 5CTNA 2IWBA 2WGVA 1BZAA 1GHIA 3LEZA 3MZFA 5EOEA 2ZC3B 1WE4A 3ZHHA 3V39A 3EQUA 2J7VA 3M6BA 1KGFA 2PU4A 2Y2PA 3MZDA 4JF6A 3S4XA 4OPQA 2WZZA 2JE5A 1MKIA 5E43A 3I7JA 3ZNTA 3V50A 4PM6A 5FQIA 3B3XA 4EQIA 3G2ZA 1ZKJA 4E3NA 4EUZA 4FSFA 3IWIA 3O3VA 4C75A 4F94A 2EX8A 5EECA 3HVFA 3FKWA 2WGIA 1LLBA 1ESUA 1MXOA 1BT5A 3VP3A 4KZ4A 4KQRA 3WRZA 3SS5A 3GV9A 1ONHA 4P6BA 4E6WA 4BL3A 5EE8A 3UDIA 4GD8A 1TDGA 2HDSA 3PBSA 1E25A 3UO9A 4R3BA 3HLEA 3NI9A 3SOIA 2EFXA 4GOGA 4DDSA 5CERA 1MY8A 2XFTA 1I2SA 3M2KA 2XEPA 3MFDA 2Y2IA 3BECA 3MXSA 3BFFA 1TEMA 3WWXA 2WKHA 2WKIA 3N8SA 4KZ9A 3PBOA 4R4SA 1IYOA 1H5XA 3QNBA 3C4PA 5AQ9A 3G2YA 4JPMA 4OLGA 3ZG7B 1NYYA 2H0YA 2JBFA 3ZG0A 1ZC2A 4JKTA 4KZ6A 1KE4A 4UA9A 1SDNA 3GQZA 4WZ5A 3FWLA 5FAOA 4EBPA 1PZOA 2XLNA 1SKFA 2Z2LB 4WELA 2C6WB 5IHVA 1W8YA 3WS1A 1HVBA 5HAPA 1LI9A 2OV5A 1S6RA 2H0TA 1FCNA 3GMWA 1LHYA 4NK3A 1PZPA 3P98A 4GDBA 4WM9A 4S2OA 2Q9MA 2HDRA 4HBUA 4GB7A 5HX9A 3ZG9B 5CECA 5FSRA 1GA0A 4JXSA 5GHYA 1DJCA 2DCFA 3Q82A 2WADA 2X71A 4X56A 3ZG5A 3VP2A 2Y4AA 5GLCA 3WRTA 4OQHA 3DWZA 1Y54A 3IXBA 1ESIA 4N92A 2OLUA 2J9OA 1IKGA 4JBFA 5HAIA 3GRJA 1JWVA 4CJNA 5KZHA 1VQQA 5L2FA 3UNWA 3JYIA 1MBLA 2EXAA 3MKFA 2V20A 1H8ZA 1ZG6A 1BUEA 5GLBA 5KSCA 1AXBA 3VOZA 3PBRA 2JC7A 5FA7A 4DE0A 2BLSA 4RYEA 3NDGA 1Q2QA 1YLPA 3IHBA 4YINA 1ES3A 4MBFA 1E3UA 1W5DA 2ZMAA 1L2SA 3HLCA 3UPPA 3WS5A 3PTEA 4Y0UA 3TG9A 4QHCA 5FI7A 2HDUA 3BRMA 4GKUA 1K54A 4U0XA 4N9LA 5FATA 4X68A 5CRFA 5FDHA 3A3FA 2H10A 2PBYA 3BM6A 1HZOA 2ZC7A 1NJ4A 5FQMA 3N8LA 3C7UA 4XUXA 4MEZA 2WAFA 3FV7A 4QD4A 4S2LA 2EX9A 5CTMA 1FCOA 3BYDA 4E3IA 2QMIA 5KSHA 5AQBA 3VP0A 2QZ6A 2IWDA 1IYQA 5DTKA 3QNCA 2WKEA 5M1AA 4PPRA 4BLMA 3UPOA 1K6RA 3OPRA 1XA1A 4X69A 5E2GA 3ZG8B 1KVMA 4PM7A 4WZ5C 1MWUA 3HLDA 4WMCA 4BJPA 1YT4A 4HESA 5GLAA 4DXCA 3FYZA 5FI2A 2XDMA 2A3UA 2XFSA 4B4XA 1ALQA 3G34A 4WEJA 1E4DA 2XD1A 1BLPA 5A92A 5CHJA 4UAAA 1SHVA 5CEDA 3IWOA 3C4OA 3WS2A 4IBXA 3NCKA 1KVLA 3AGEA 4Z9QA 3N8RA 4KQOA 3ISGA 3OPHA 4D2OA 4FD8A 2Y2OA 1IELA 3VP4A 4X53A 4H8RA 5DVAA 4WZ4A 4BL2A 5CEBA 3HLGA 4BENA 1PIOA 3HLFA 2UWXA 2WYXA 1LI0A 2J8YA 3WS0A 4X55A 1YLYA 2Y2JA 4OONA 4HBTA 2Y2QA 4FH2A 5AQAA 3SH9A 5HL1A 1C3BA 1OMEA 3BLSA 1CEFA 1CK3A 5CHMA 5A90A 4LCLA 3A3DA 4WEKA 1KE3A 4KG5A 1YMXA 3UDFA 5E2EA 3ITAA 4S2KA 1FOFA 3VSKA 1JWZA 3NBLA 5F1GA 1MWSA 4OH0A 1VM1A 1KGEA 1EROA 1NZUA 1PYYA 2A49A 3S1YA 2EX6A 5TGFA 5FAPA 5FASA 5JYOA 5HFOA 1L0GA 4E3OA 4BD1A 2RL3A 3NC8A 1O7EA 4LV3A 1K25A 1FR1A 1Z6FA 2G2WA 1BLCA 1KGGA 2DNSA 4KG6A 4ZAMA 2ZM0A 2IWCA 1N9BA 1NRFA 1K6SA 1RCJA 4GZBA 1W79A 2XGNA 1I2WA 1WYCA 3FKVA 3W4OA 4E3MA 5M18A 1LL9A 1PI4A 2I72A 3Q07A 2CC1A 2WAEA 4BQMA 4JLFA 3LCEA 3BFGA 4RX2A 3LO7A 2OLVA 1XPBA 2P9VA 2ZJ9A 1YLWA 2Y2NA 3LY3A 3VFHA 3IF6A 4ZJ2A 1ONGA 1PW8A 2WUQA 3UDXA 4LV2A 5DF9A 2R9XA 3CJMA 2WK0A 1K57A 4Y0OA 1XKZA 1XGJA 5DTTA 3IHAA 3A3EA 1K55A 2P74A 1CI8A 5EVIA 3UN7A 1FSYA 4L0LA 3GR2A 1MPLA 3UE3A 3NY4A 5FI6A 3PAGA 3UE1A 1E3UD 4R4RA 2Q9NA 1JTDA 2HPBA 3DW0A 2P9VB 4U0TA 2J9PA 4ZTKA 4PM5A 4C3QA 1PWGA 4JF5A 3BFEA 3IF6B 3S22A 1YM1A 1YLTA 4S2JA 3VP1A 1IKIA 2XD5A 5E2FA 4DDYA 1XP4A 2Y2GA 3W4PA 3SH8A 3Q7VA 1FCMA 2HP6A 1RGYA 4PM8A 1K38A 3IXHA 3N7WA 3A3IA 2ZC4B 1K56A 5EVIB 5FAQA 1YQSA 1ES4A 1MWRA 4E3JA 4O7DA 3E2LA 3M6HA 1MWTA 2ZD8A 3LY4A 3PBQA 4OKPA 4UHUA 4DE1A 4BD0A 4R1GA 1BSGA 2ZQ9A 5G18A 1G6AA 1YLJA 5GLDA 4E3LA 3HREA 4WMCD 2ZQAA 1GA9A 4XXRA 4GNUA 3VSLA 3SS3A 1M6KA 4ID4A 1PWDA 3Q7VB 3DTMA 4RVAA 4OPZA 1J9MA 3G4PA 3CZDA 3MZEA 4ZJ1A 2ZQCA 2GDNA 4EBLA 3W4QA 5FQQA 4B4ZA 3ZCZA 3HUOA 4HEFA 3NDEA 4JXVA 4KZ8A 1PWCA 4OPYA 3IXDA 3OPLA 5M19A 5GHZA 4DKIA 4GDNA 4KZ5A 1NZOA 5FQ9A 1ERQA 3UE0A 4K0WA 2ZLYA 1U60A 3VMAA 1ZG4A 2Y2MA 3AGDA 4DXBA 3G35A 4RX3A 4N1XA 3IF6C 1L0EA 2XQZA 3CMZA 1JWPA 3W8KA 4CPKA 3IF5A 3ZNYA 3ZDJA 2EX2A 1K57C 3RJUA 4OLDA 3D4FA 4KENB 3C7VA 3P09A 1K55C 4FH4A 2G2UA 3BFDA 5EVIC 4MNRA 1O07A 4A5RA 2EXBA 4OQIA 4ZJ3A 4S2MA 2Y91A 2EFUA 3VOYA 3ZVWA 3NIAA 1S0WA 1NXYA 2Z2MB 2ZQ8A 3A3JA 1JVJA 3V3RA 1NYMA 4E6XA 4ZDXA 1BULA 3UPNA 1HD8A 3SH7A 1G68A 1GHPA 2ZC5B 1Q2PA 3O86A 4DE3A 1EWZA 1H8YA 5F82A 4Y0TA 3HBRA 2FFFB 4ZBEA 4QJGA 1N4OA 3Q1FA 4DRTA 1K54C 1SCWA 3GVBA 4UA7A 1JTGA 3MBZA 3OCNA 3RXWA 3OCLA 1L0FA 2Y2HA 5E2HA 2R9WA 4IEDA 1NY0A 4OQGA 3RXXA 1XX2A 1WYBA 4LENA 4S2IA 3ZGAB 3HUMA 1ES5A 4KZ3A 4MBHA 3OC2A 4R23A 4DF6A 3PAEA 1GCEA 2C5WB 2Y55A 4QY6A 2HP5A 2X02A 1RP5A 3GSGA 4MLLA 4QB8A 5JYPA 1CEGA 5HARA 3VFFA 2VGJA 3TOIA 2WZXA 2E8IA 4N1HA 1BLSA 3MKEA 2JCHA 4FCFA 3AGFA 4IVIA 2Y59A 4JF4A 4JXWA 1IYSA 1GHMA 1XA7A 1XGIA 4S2NA 5TR7A 5EPHA 1L0DA 3O87A 5U47A 5F1FA 1DJAA 3ITBA 5A93A 2ZQDA 4Q8IA 5I94A 5EVID 4U3TA 5HW3A 4KZ7A 4LV1A 4N9KA 2ZM2A 4EWFA 1KDWA 4LV0A 3N6IA 5CGXA 2WGWA 2ZQ7A 4OOLA 2ZM8A 2H5SA 1CI9A 3G30A 5DTSA 5D3OA 3WS4A 4S2PA 5A91A 1FSWA 3BEBA 1YLZA 5EOOA 1K4EA 1QMEA 2RCXA 4IVKA 4YFMA 3ZVTA 1IYPA 5TFQA 2V2FF 4MBKA 4LCMA 2XF3A 4NETA 5EVLA 2FFYA 4KZBA 1K56D 1QMFA 3IXGA 3IH8A 5GHXA 2X01A 4JXGA 3V3SA 3MXRA 2WGWB 3ZFZA 4QU3A 2Y2LA 2PU2A 4C6YA 3G31A 1W8QA 2VGKA 3SS4A 3C5AA 1SDEA 4PMAA 2OSUA 5CGSA 3M2JA 4WYYA 1XXMA 4GD6A 1ES2A 3IH9A 3V5MA 4QY5A 5DF7A 3BFCA 4XUZA 4EBNA 5EUAA 3FZCA 3OZHA 1TDLA 4M3KA 4OP5A 1BTLA 4OOYA 4OP8A 4B88A 1YMSA 5HAQA 4P0MA 3GTCA 3TSGA 1W7FA 3EQVA 4OQ0A 1HTZA 2QPNA 4R3JA 1PW1A 3Q7ZA 3IQAA 2BG1A 3DWKA 3G32A 3CG5A 3HL9A 4P87A 1PI5A 3IT9A 4K0XA 4KQQA 5FQJA 3HLBA 3IWQA 4PM9A 1RGZA 1DY6A 1IEMA 1DJBA 4GN2A 5F83A 4RA7A 5KMWA 2V1ZA 1K4FA 3PBNA
chains in the Genus database with same CATH superfamily
2HDQA 3SW1A 1YSQA 3Q81A 4Y7PA 4FUWA 5FQKA 3PBTA 4S2NC 5DF8A 1KE0A 1EI5A 3BLMA 5AQ7A 4DE2A 5BOHA 4LFUA 4OPRA 2GX5A 1FR6A 3F1PB 5FEFA 4P85A 4KG2A 1TVFA 4R0QA 4X6TA 2V1BA 4UA6A 2Z6DA 5A8BA 1ERMA 1FIKA 2IWBA 1XJ2A 3MF0A 1JNUA 4NKPA 5EOEA 3ZHHA 5F68A 2J7VA 2PU4A 3T4KA 2Y2PA 4JF6A 3S4XA 4ZRRA 1MKIA 1PFLA 3B3XA 4FSFA 3IWIA 3S7PA 3HVFA 2WGIA 5L07A 4KQRA 4L9FA 3H82A 3SS5A 3GV9A 2A24B 3UDIA 1TDGA 1E25A 3SOIA 2EFXA 4DDSA 5HD3A 3M2KA 1I2SA 3MFDA 1TEMA 3T4SA 1IYOA 3QNBA 3C4PA 2J3TC 2NUTC 3G2YA 3ZG7B 1NYYA 1KOUA 4JKTA 4KZ6A 4EBPA 1SDNA 1PZOA 2Z2LB 5IHVA 1MZUA 1LHYA 1PZPA 2XRNA 5FL3A 3LI8A 1GA0A 4DJ3A 4JXSA 5F69A 2X71A 1NRJA 2E8JA 5DKKA 2HJ9C 5GLCA 4OQHA 1ESIA 2OLUA 3D72A 3E98A 1S67L 1VQQA 3UNWA 3JYIA 2D02A 3MKFA 5GLBA 5KSCA 2PYRA 3VOZA 5FA7A 4RYEA 3NDGA 1YLPA 2R78A 1W5DA 1L2SA 3WS5A 3TG9A 1K54A 4N9LA 4JGRA 2JHEA 3RH8B 4P6ZS 3E4PA 1P97A 3C7UA 4MEZA 4S2LA 1FCOA 4HI4A 4E3IA 4EW7A 5AQBA 5DTKA 3C30A 2WKEA 4PPRA 4BLMA 1XA1A 4PM7A 1MWUA 4WMCA 3ULFA 5GLAA 1WA9A 3S7NA 4B4XA 3G34A 1TS0A 1E4DA 1OTEA 2XD1A 3W2ZA 2O99A 3A0RA 2KX6A 4IBXA 1KVLA 4PHTA 4H8RA 4G3KA 1S4SA 4BENA 4GW9A 3HLFA 1S1ZA 2WYXA 2WKPA 3C38A 2J8YA 2ZMVA 3IBRA 2V8FA 1YLYA 4X25A 3UB9A 1W63M 1F2KA 4ESPA 3BLSA 4B93A 1CEFA 1CK3A 5A90A 1OJ5A 4WEKA 1KE3A 2OOLA 1FOFA 3NBLA 5F1GA 2OWHA 2KOIA 1PYYA 5FAPA 3QP2A 5JYOA 4BD1A 1O7EA 3HCYA 2JKRI 4LV3A 1TD5A 1YPRA 1OT6A 4H6JA 2XGNA 1LL9A 3Q07A 4I3AA 4JLFA 1P0ZA 1YLWA 5J3WA 1ONGA 1T19A 2DMWA 2WK0A 4I38A 4Y0OA 5DFXA 3LIDA 1FSYA 5FI6A 4Q0IA 3IBJA 4HIAA 2Y8HA 2K31A 1JTDA 1XFQA 4C3QA 1YM1A 4GCZA 3VP1A 1IKIA 1V9ZA 3L7HA 3W4PA 3SH8A 4Z1WA 3Q7VA 2W3GA 3BW6A 3N7WA 5FDSA 1YQSA 1DP9A 1ES4A 1MKMA 1D06A 1MWTA 3IX8A 4D60A 4OKPA 4DE1A 4EU0A 3K3CA 1BSGA 5GLDA 4FTXA 4HY8A 3K2NA 4WMCD 5LBRA 2ZQAA 4F3LB 5IU1A 3JVVA 4RVAA 1J9MA 3CZDA 4ZJ1A 3E4OA 4EESA 1ODVA 1UWNX 4OPYA 3IXDA 4EUVA 1YAXA 3OPLA 5M19A 4KZ5A 2ZLYA 1U60A 3VMAA 2Y2MA 4DXBA 4GJ4A 3CMZA 3CWFA 2Y79A 3P09A 1K55C 2G2UA 1O07A 4A5RA 5K5BA 3PXPA 4S2MA 1S0WA 1S4RA 1NXYA 1LSXA 3MQQA 3A3JA 4EQ1A 3UPNA 1G68A 1BYWA 4DE3A 1EWZA 3ICYA 2FFFB 1VEUB 2LB9A 1K54C 1SCWA 1JTGA 3UB6A 3RTYA 3OCNA 3RXXA 2VV8A 4R3AA 4LENA 1WYBA 1D1JA 2J3WA 4KZ3A 4R23A 2C5WB 4M4XA 2Y55A 4QY6A 2QKPA 2X02A 1RP5A 5JYPA 4LRYC 1CEGA 2VGJA 2JKRM 4KUKA 3AGFA 4IVIA 1IYSA 4S2NA 5EPHA 5F1FA 3O87A 5A93A 1GSVA 4Q8IA 4LV1A 1KDWA 3B47A 4NXEA 2VGLM 2VV6A 4DMZA 5TBMB 5D3OA 3WS4A 5A91A 1K4EA 3H7WA 2RCXA 4IVKA 5EVLA 3EGDC 2FFYA 1F5MA 2ACGA 2WGWB 1ZTUA 2Y2LA 2PU2A 1W8QA 3SS4A 3C5AA 2PD7A 2OSUA 4LPZA 3IH9A 3V5MA 3T1SA 4QY5A 5DF7A 4OP8A 3P7NA 1YMSA 4P0MA 3CAXA 3TSGA 3F1PA 4R3JA 3Q7ZA 3HL9A 3TW8A 3IT9A 3CUEA 3HLBA 3T4OA 5KMWA 1IEMA 1DJBA 4RA7A 3HLWA 3JVUA 1F98A 3KYEA 4E3KA 2XK1A 5GL9A 3OPPA 3IX3A 4G3WA 1KDSA 2V0WA 2XH9A 2DRWA 2B5RA 4EV4A 3KSGA 4ETZA 3PHYA 1NLYA 3LEZA 2ZC3B 4YWZA 3V39A 2A24A 5G4ZA 5E43A 4PM6A 3G2ZA 1T1CA 1ZKJA 3O3VA 2EX8A 3DTEA 1T18A 4KZ4A 1ONHA 1T1AA 3PBSA 3HLEA 3NI9A 4GOGA 5CERA 5L8MA 1MY8A 3MXSA 3BFFA 1OT9A 3F1OB 4R4SA 1H5XA 4OLGA 1XJ3A 1ZC2A 4UA9A 5J8XA 3HJIA 4WELA 4ME4A 3GMWA 3MQOA 3P98A 1YSPA 4WM9A 4S2OA 4HBUA 3PYPA 5HX9A 5FSRA 2DCFA 3Q82A 4X56A 3ZG5A 2Y4AA 1IKGA 5L2FA 1MBLA 2ZL1B 1BUEA 3PBRA 2BLSA 3IHBA 4MBFA 4BBTA 1CQAA 3UPPA 3L9KA 4QHCA 2HDUA 2J3TD 2FZ0A 4I5SA 5J7EA 5CRFA 5FDHA 2H10A 3BM6A 5HWTA 4IJGA 2W1TB 4XUXA 3FV7A 3LUQA 5CTMA 3BYDA 5EFWA 1D7EA 4LGWA 3ZQ5A 4MMNA 1K6RA 3OPRA 4FOFA 4WZ5C 4BJPA 1YT4A 3FYZA 4KUOA 2A3UA 2EA9A 1BLPA 5A92A 4PAUA 3QP5A 5CHJA 3LIBA 1PRQA 1SHVA 3C4OA 3WS2A 1H8MA 2V8CA 3ISGA 2I9VA 1XJ4A 4D2OA 4FD8A 2Y2OA 4BL2A 5CEBA 2Q0OA 2UWXA 1LI0A 4X55A 2Y2JA 2Y2QA 3SH9A 2AVXA 1OMEA 5G4YA 5CHMA 3MXQA 1IOUA 3UDFA 2B02A 4X1MA 5E2EA 2GJ3A 4BBUA 4HQAA 4WLAA 2KLIA 1VM1A 3CPTB 1KGEA 2EX6A 4II7A 2A2LA 3QP1A 3A0VA 1IFQA 3A0SA 5HFOA 3K3DA 2RL3A 3CUEC 4YOFA 3LR5A 1K25A 1FR1A 1Z6FA 1BLCA 1KGGA 4NXBA 4O8GA 2ZM0A 1NRFA 3T4JA 1K6SA 1RCJA 1I2WA 1WYCA 4E3MA 1G28A 3LCEA 3LO7A 2ZJ9A 3VFHA 2Y2NA 3LY3A 1PW8A 3V67A 4LV2A 5DF9A 2R9XA 1VB6A 2M1CA 2OAQ1 1XKZA 1XGJA 2O9CA 3IHAA 2ZOIA 1K55A 1OTAA 1CI8A 4O0PA 3NY4A 3H9WA 3LGOA 2HPBA 2P9VB 4U0TA 2J9PA 4ZTKA 4JF5A 4NEED 3BFEA 3S22A 4S2JA 5AJGA 4F3LA 2XD5A 4DDYA 3LICA 4NXGA 3R4KA 1RGYA 1K38A 3A3IA 2ZC4B 5EVIB 4WL9A 1Z09A 1H3QA 4UHUA 2K7SA 3OLOA 5G18A 1G6AA 4GNUA 2B18A 3SS3A 1OJGA 3G4PA 3LR4A 3UB8A 3ZCZA 5L10A 3NDEA 4E04A 3UB5P 5FQ9A 1ERQA 3RFBA 1ZG4A 4GS9A 4N1XA 4QPRA 4HH3A 4CPKA 3IF5A 1VEUA 3ZNYA 1K57C 4OLDA 4Y17A 3D4FA 5EVIC 2EXBA 4ZJ3A 2EFUA 3NIAA 2VV7A 2W27A 2Z2MB 4E6XA 4CLCB 1Q2PA 4Y0TA 5F82A 3HBRA 2W3HA 1MC0A 2JKTI 1N4OA 3Q1FA 5HDSA 4DRTA 1CF0A 1SKOB 3OCLA 2Y2HA 1UWPX 2JKGA 3E4QA 4S2IA 3ZGAB 3PAEA 3T12B 4I3IA 1Y28A 5TBMA 1BLSA 2O9BA 1L0DA 5U47A 1DJAA 2ZQDA 5I94A 5HW3A 4U3TA 2ZM2A 4EWFA 5CGXA 4CLCC 2WGWA 2ZQ7A 1OTBA 2H5SA 1CI9A 3G30A 4I3JA 3LR3A 1QMEA 3FPWA 5TFQA 2V2FF 4MBKA 1S66L 1TS6A 4JXGA 5DJUA 4C6YA 2VGKA 2WKRA 4PMAA 5CGSA 3M2JA 3LI9A 4GD6A 3BFCA 4EBNA 5EUAA 3LR0A 3OZHA 1HLUP 4O01A 2O9AA 1W7FA 1K0KA 3EQVA 1HTZA 2BG1A 3DWKA 3G32A 3CG5A 4K0XA 4RQ9A 4PM9A 1RGZA 3GECA 5DTTA 3WS1A 2V1ZA 5CX7A 1N9NA 1K4FA 2PHYA 3NOUC 2XR0A 4EERA 2XSSA 3UY6A 4DN0A 4IBRA 2HV1A 1I5QA 1LL5A 2ZC6B 3BQAA 4K91A 2VGLS 3QHYA 1BLHA 2Y2KA 4Y13A 1GSWA 4OOMA 4EXOA 4WBGA 5CTNA 3NECA 4WF0A 4Y5FA 3MZFA 1WE4A 1DP8A 2VZWA 1KGFA 4GS9B 3MZDA 2JE5A 3I7JA 3V50A 5FQIA 2K2NA 4XT2A 3F1OA 4EQIA 4E3NA 4EUZA 1VHMA 2YKHA 1N9LA 1ESUA 2JKTM 3VP3A 3WRZA 2OWJA 4P6BA 4E6WA 5HL6A 4BL3A 5EE8A 2HDSA 1W63Q 4LRZE 4ARZB 1A0KA 2XEPA 1Y4OA 3BECA 5EVEA 4Y3IA 2WKHA 3N8SA 4GHIB 3BQ8A 3IS2A 2EWVA 2JKFA 2EWWA 3ZG0A 4WZ5A 3GQZA 5HAPA 1SKFA 3R7WB 4HOIA 1HVBA 1LI9A 2OV5A 2H0TA 1FCNA 4IUHA 4JGQA 4NK3A 2ZL1A 1ZHHB 4IHQA 4GDBA 1XJ6A 2HDRA 4GB7A 3ZG9B 5CECA 5GHYA 1DJCA 4DJ2A 2WADA 3MQ0A 4BBVA 4EEUA 1Y54A 3LFVA 4JBFA 5KZHA 1H8ZA 1ZG6A 1F9IA 5HSQA 2W1TA 2JC7A 1Q2QA 3T1QB 4YINA 2P08A 1SZVA 4Y0UA 3QP8A 4U0XA 1VETA 5FATA 4Q0JA 5MC7A 5I5LA 2PBYA 1HZOA 2BASA 4WN5A 3N8LA 2WAFA 4QD4A 2QMIA 3EEAA 2IWDA 3VE3A 1IYQA 3QNCA 5M1AA 4X69A 1X0OA 1KVMA 5DJTA 5L09A 3OBFA 3KX0X 5FI2A 2XDMA 4UAAA 3IWOA 3NCKA 3AGEA 4Z9QA 3N8RA 3T1RA 5FEGA 3VOLA 1V9YA 5DVAA 3BWLA 2VEAA 3HLGA 1PIOA 3CPTA 1ACFA 4OONA 2PT7A 5HL1A 1C3BA 3DTKA 1P9RA 1DRMA 1YMXA 2KDKA 4S2KA 3NOTC 1JWZA 1MWSA 2XA7M 1EROA 1NZUA 2A49A 5TGFA 4XT2B 3MJQA 1PNEA 5FASA 2YKFA 4KQDA 3NC8A 3F1NB 3LIFA 3KSFA 2G2WA 2DNSA 4KG6A 4MDZA 4ZAMA 1N9BA 2PRFA 3KYQA 4GZBA 2VK3A 3W4OA 2I72A 2OLVA 2P9VA 4L9GA 5KIZA 3IS2B 4BMWA 3B42A 3D3OA 4ZJ2A 2WUQA 3UDXA 1K57A 4K08A 3A3EA 2O0YA 2PBDP 5EVIA 4G3VA 4L0LA 2VA0A 1MPLA 2L0WA 3GR2A 3UE3A 3UE1A 4R4RA 2Q9NA 4PM5A 5IS1A 1LT0A 3IF6B 1YLTA 2QWSA 4JGPA 3GDIA 3PR6A 1XP4A 3E0YA 2Y2GA 1FCMA 2HP6A 3IXHA 4Y15A 5FAQA 4E3JA 4O7DA 3M6HA 3LY4A 3KSHA 3PBQA 1G5UA 4YNRA 4R1GA 2ZQ9A 1YLJA 4E3LA 3HREA 2PAVP 4MN7A 1GA9A 1UGUA 2P04A 2L1MA 1VETB 1PWDA 2INWA 1N9OA 2V1AA 4MN5A 2MJ6A 3MZEA 2ZQCA 4EBLA 1TF1A 3W4QA 3HUOA 4JXVA 4KZ8A 1PWCA 3T4QA 5GHZA 4DKIA 4GDNA 1NZOA 4CLCA 4BWIA 4RX3A 3IF6C 4CQHA 1L0EA 2XQZA 1S1YA 3W8KA 2W3DA 2EX2A 4KENB 3C7VA 1SKOA 4MNRA 4NG2A 3ZVWA 2ZQ8A 4ZDXA 1BULA 2JN7A 3O86A 4LRXC 1H8YA 4R6LA 4ZBEA 3CHWP 5AVFA 1GSXA 5AVEA 4UA7A 3MBZA 2HGVA 4HH2A 1L0FA 2R9WA 4OQGA 1XX2A 3HUMA 1ES5A 3NOPC 1GCEA 2B95A 4HJ3A 3GSGA 3P01A 3KO6A 4MLLA 3VFFA 2WZXA 4N1HA 3DBAA 4X1LA 4FCFA 2W3EA 4JXWA 1XGIA 1GHMA 3ZYTA 3ITBA 3EOIA 5EVID 4KZ7A 4NXFA 3N6IA 2GZAA 2ZM8A 5DTSA 3T1XA 1OTIA 5EOOA 2VJWA 1IYPA 2ZOHA 4LCMA 4NETA 3VE4A 5F6AA 1QMFA 1G6OA 3IXGA 3IH8A 3V3SA 3MXRA 4QU3A 2NUPC 3G31A 3B33A 1SDEA 5DKLA 4XUZA 2PD8A 2WKQA 3FZCA 4OOYA 4OP5A 4M3KA 5EM0A 1BTLA 1YKDA 5HAQA 4OQ0A 3MR0A 3IQAA 3D9YA 3FC7A 4P87A 5HWWA 4KQQA 3IWQA 4CLCD 4MN6A 1DP6A 4GN2A 5F83A 3EGXC 3PBNA 5HDDA 5CGWA 5CXWA 5EM1A 3HUNA 3FG8A 5C5KA 2HP9A 3E2KA 2QJ7A 1FQGA 5CHUA 1M40A 4JGOA 3N4IA 4HNBA 3O88A 1L3LA 4KZAA 4OVDA 4AFIA 2FH5A 2WGVA 1BZAA 1OTDA 1GHIA 2V9AA 3MFXA 3EQUA 3M6BA 4ARZA 4OPQA 2WZZA 3OOVA 3ZNTA 4UEYA 4GHIA 3TRCA 3CI6A 4C75A 2L4RA 4IUKA 4F94A 5EECA 3FKWA 1LLBA 1MXOA 1BT5A 3R7WA 5J4EA 4GD8A 3UO9A 4R3BA 1STZA 4P6ZM 2Z6CA 2XFTA 1TS8A 2UV0E 2Y2IA 2M7UA 3WWXA 1EW0A 2WKIA 4KZ9A 3PBOA 4HP4A 5AQ9A 4JPMA 4HP9A 2H0YA 2JBFA 3G6OA 1KE4A 5FAOA 3FWLA 3H82B 2XLNA 4HJ6A 2C6WB 1W8YA 1H0MA 1S6RA 2ZMFA 2Q9MA 2PR5A 3DAVA 2BTFP 1NLZA 3U4LP 5HZHA 3S7OA 3VP2A 3WRTA 3DWZA 3IXBA 4N92A 2J9OA 3TE8A 5HAIA 3GRJA 1JWVA 2PDRA 4CJNA 2EXAA 2V20A 1AXBA 5TJJA 4DE0A 1ES3A 4L9EA 1E3UA 2ZMAA 3HLCA 3UMDA 3PTEA 3CLOA 2VLGA 5FI7A 4CLCE 3BRMA 4EETB 2IA2A 3T4LA 3VV4A 2PR6A 4GKUA 2W0NA 4UQIS 4X68A 3A3FA 3UB7A 5IT5A 2ZC7A 1NJ4A 5FQMA 3KYZA 2EX9A 5KSHA 3VP0A 2QZ6A 1LSWA 3S7QA 3UPOA 3ZG8B 5E2GA 2H28A 3HLDA 4HESA 4DXCA 2XFSA 1ALQA 3CITA 4WEJA 5HPIA 4ETXA 4PKYA 5CEDA 4KQOA 3OPHA 1IELA 3VP4A 4X53A 4Q0HA 4WZ4A 3QP4A 3WS0A 4HBTA 4FH2A 5AQAA 3UMEA 5F5YA 4R38A 3LIAA 3F1NA 2OAP1 4LCLA 3A3DA 4KG5A 2QYBA 3ITAA 4UQIM 3VSKA 3C8CA 4OH0A 4EEPA 3S1YA 4HHDA 3SZTA 1L0GA 4E3OA 4WUJA 3MSHA 5EV0A 2IWCA 4Y2FA 1W79A 4R70A 3FKVA 3MMHA 5M18A 1PI4A 4BQMA 2CC1A 2WAEA 3HJKA 2J80A 3BFGA 3O5YA 4RX2A 1XPBA 1P9WA 3IF6A 3IX4A 2W1RA 3CJMA 2P74A 2HZ5A 4H6JB 3UE6A 3UN7A 3BY9A 3LIEA 3PAGA 1E3UD 3KSIA 3DTIA 3LYXA 3DW0A 4PKYG 1PWGA 3NHQA 3NULA 2W3FA 1LSVA 1T1BA 5E2FA 2CMNA 4PM8A 1K56A 2VX8A 2XA7S 1MWRA 3T50A 2D01A 3E2LA 2ZD8A 4HJ4A 2M7VA 4BD0A 3FPVA 2V0UA 4MCWA 4XXRA 3TJZC 3VSLA 1M6KA 4ID4A 1AWIA 2GNXA 3Q7VB 3DTMA 4OPZA 2GDNA 5FQQA 4B4ZA 4HEFA 5HPFA 3T4TA 3UE0A 3BY8A 3LEQA 4K0WA 2G7UA 3AGDA 3G35A 1OPXA 1JWPA 3C2WA 3ZDJA 3RJUA 2VKSA 4FH4A 5HWVA 3BFDA 2QJ5A 4OQIA 2Y91A 3VOYA 4B9OA 3V3RA 1JVJA 1NYMA 1HD8A 3QP6A 3SH7A 1GHPA 2ZC5B 2ZBBA 3BJNA 4QJGA 2HJEA 3GVBA 1NWZA 1FILA 3RXWA 1J3WA 5E2HA 4IEDA 1NY0A 1XFNA 4LLOB 2XROA 5DFYA 2PYPA 4MBHA 3OC2A 4DF6A 2HP5A 4QB8A 3NJAA 5HARA 3TOIA 2E8IA 3MKEA 2JCHA 2QHKA 2Y59A 4JF4A 5TR7A 1XA7A 3JPUA 4GLQA 2P7JA 3U2AA 4N9KA 4LV0A 4I39A 4OOLA 4S2PA 1FSWA 3BEBA 1YLZA 3ZVTA 4YFMA 2XF3A 4KZBA 1K56D 5GHXA 2X01A 3ZFZA 1LL8A 5HDCA 4WYYA 1XXMA 1ES2A 2HF6A 3H7WB 1TS7A 1TDLA 2LB5A 4B88A 3GTCA 3EEHA 2QPNA 4QWOA 1PW1A 3EWKA 3MS6A 1PI5A 5FQJA 1CJFA 1DY6A 5HD5A
chains in the Genus database with same CATH topology
3HLWA 5CGWA 5CXWA 2HDQA 3Q81A 4Y7PA 2XR0A 3HUNA 5FQKA 3PBTA 4S2NC 3UY6A 4E3KA 2HP9A 3E2KA 2XK1A 1KE0A 1EI5A 3BLMA 1FQGA 4IBRA 5DF8A 5AQ7A 5GL9A 4DE2A 5BOHA 1I5QA 5J8XA 3OPPA 4OPRA 5CHUA 1LL5A 2ZC6B 1FR6A 1KDSA 4K91A 1M40A 4P85A 4KG2A 3QHYA 1BLHA 2XH9A 1TVFA 2B5RA 2DRWA 2Y2KA 4R0QA 4EV4A 4X6TA 3N4IA 3O88A 4UA6A 4OOMA 4KZAA 4OVDA 4WBGA 1ERMA 5CTNA 2IWBA 2WGVA 1BZAA 1GHIA 3LEZA 3MZFA 5EOEA 2ZC3B 1WE4A 3ZHHA 3V39A 3EQUA 2J7VA 3M6BA 1KGFA 2PU4A 2Y2PA 3MZDA 4JF6A 3S4XA 4OPQA 2WZZA 2JE5A 1MKIA 5E43A 3I7JA 3ZNTA 3V50A 4PM6A 5FQIA 3B3XA 4EQIA 3G2ZA 1ZKJA 4E3NA 4EUZA 4FSFA 3IWIA 3O3VA 4C75A 4F94A 2EX8A 5EECA 3HVFA 3FKWA 2WGIA 1LLBA 1ESUA 1MXOA 1BT5A 3VP3A 4KZ4A 4KQRA 3WRZA 3SS5A 3GV9A 1ONHA 4P6BA 4E6WA 4BL3A 5EE8A 3UDIA 4GD8A 1TDGA 2HDSA 3PBSA 1E25A 3UO9A 4R3BA 3HLEA 3NI9A 3SOIA 2EFXA 4GOGA 4DDSA 5CERA 1MY8A 2XFTA 1I2SA 3M2KA 2XEPA 3MFDA 2Y2IA 3BECA 3MXSA 3BFFA 1TEMA 3WWXA 2WKHA 2WKIA 3N8SA 4KZ9A 3PBOA 4R4SA 1IYOA 1H5XA 3QNBA 3C4PA 5AQ9A 3G2YA 4JPMA 4OLGA 3ZG7B 1NYYA 2H0YA 2JBFA 3ZG0A 1ZC2A 4JKTA 4KZ6A 1KE4A 4UA9A 1SDNA 3GQZA 4WZ5A 3FWLA 5FAOA 4EBPA 1PZOA 2XLNA 1SKFA 2Z2LB 4WELA 2C6WB 5IHVA 1W8YA 3WS1A 1HVBA 5HAPA 1LI9A 2OV5A 1S6RA 2H0TA 1FCNA 3GMWA 1LHYA 4NK3A 1PZPA 3P98A 4GDBA 4WM9A 4S2OA 2Q9MA 2HDRA 4HBUA 4GB7A 5HX9A 3ZG9B 5CECA 5FSRA 1GA0A 4JXSA 5GHYA 1DJCA 2DCFA 3Q82A 2WADA 2X71A 4X56A 3ZG5A 3VP2A 2Y4AA 5GLCA 3WRTA 4OQHA 3DWZA 1Y54A 3IXBA 1ESIA 4N92A 2OLUA 2J9OA 1IKGA 4JBFA 5HAIA 3GRJA 1JWVA 4CJNA 5KZHA 1VQQA 5L2FA 3UNWA 3JYIA 1MBLA 2EXAA 3MKFA 2V20A 1H8ZA 1ZG6A 1BUEA 5GLBA 5KSCA 1AXBA 3VOZA 3PBRA 2JC7A 5FA7A 4DE0A 2BLSA 4RYEA 3NDGA 1Q2QA 1YLPA 3IHBA 4YINA 1ES3A 4MBFA 1E3UA 1W5DA 2ZMAA 1L2SA 3HLCA 3UPPA 3WS5A 3PTEA 4Y0UA 3TG9A 4QHCA 5FI7A 2HDUA 3BRMA 4GKUA 1K54A 4U0XA 4N9LA 5FATA 4X68A 5CRFA 5FDHA 3A3FA 2H10A 2PBYA 3BM6A 1HZOA 2ZC7A 1NJ4A 5FQMA 3N8LA 3C7UA 4XUXA 4MEZA 2WAFA 3FV7A 4QD4A 4S2LA 2EX9A 5CTMA 1FCOA 3BYDA 4E3IA 2QMIA 5KSHA 5AQBA 3VP0A 2QZ6A 2IWDA 1IYQA 5DTKA 3QNCA 2WKEA 5M1AA 4PPRA 4BLMA 3UPOA 1K6RA 3OPRA 1XA1A 4X69A 5E2GA 3ZG8B 1KVMA 4PM7A 4WZ5C 1MWUA 3HLDA 4WMCA 4BJPA 1YT4A 4HESA 5GLAA 4DXCA 3FYZA 5FI2A 2XDMA 2A3UA 2XFSA 4B4XA 1ALQA 3G34A 4WEJA 1E4DA 2XD1A 1BLPA 5A92A 5CHJA 4UAAA 1SHVA 5CEDA 3IWOA 3C4OA 3WS2A 4IBXA 3NCKA 1KVLA 3AGEA 4Z9QA 3N8RA 4KQOA 3ISGA 3OPHA 4D2OA 4FD8A 2Y2OA 1IELA 3VP4A 4X53A 4H8RA 5DVAA 4WZ4A 4BL2A 5CEBA 3HLGA 4BENA 1PIOA 3HLFA 2UWXA 2WYXA 1LI0A 2J8YA 3WS0A 4X55A 1YLYA 2Y2JA 4OONA 4HBTA 2Y2QA 4FH2A 5AQAA 3SH9A 5HL1A 1C3BA 1OMEA 3BLSA 1CEFA 1CK3A 5CHMA 5A90A 4LCLA 3A3DA 4WEKA 1KE3A 4KG5A 1YMXA 3UDFA 5E2EA 3ITAA 4S2KA 1FOFA 3VSKA 1JWZA 3NBLA 5F1GA 1MWSA 4OH0A 1VM1A 1KGEA 1EROA 1NZUA 1PYYA 2A49A 3S1YA 2EX6A 5TGFA 5FAPA 5FASA 5JYOA 5HFOA 1L0GA 4E3OA 4BD1A 2RL3A 3NC8A 1O7EA 4LV3A 1K25A 1FR1A 1Z6FA 2G2WA 1BLCA 1KGGA 2DNSA 4KG6A 4ZAMA 2ZM0A 2IWCA 1N9BA 1NRFA 1K6SA 1RCJA 4GZBA 1W79A 2XGNA 1I2WA 1WYCA 3FKVA 3W4OA 4E3MA 5M18A 1LL9A 1PI4A 2I72A 3Q07A 2CC1A 2WAEA 4BQMA 4JLFA 3LCEA 3BFGA 4RX2A 3LO7A 2OLVA 1XPBA 2P9VA 2ZJ9A 1YLWA 2Y2NA 3LY3A 3VFHA 3IF6A 4ZJ2A 1ONGA 1PW8A 2WUQA 3UDXA 4LV2A 5DF9A 2R9XA 3CJMA 2WK0A 1K57A 4Y0OA 1XKZA 1XGJA 5DTTA 3IHAA 3A3EA 1K55A 2P74A 1CI8A 5EVIA 3UN7A 1FSYA 4L0LA 3GR2A 1MPLA 3UE3A 3NY4A 5FI6A 3PAGA 3UE1A 1E3UD 4R4RA 2Q9NA 1JTDA 2HPBA 3DW0A 2P9VB 4U0TA 2J9PA 4ZTKA 4PM5A 4C3QA 1PWGA 4JF5A 3BFEA 3IF6B 3S22A 1YM1A 1YLTA 4S2JA 3VP1A 1IKIA 2XD5A 5E2FA 4DDYA 1XP4A 2Y2GA 3W4PA 3SH8A 3Q7VA 1FCMA 2HP6A 1RGYA 4PM8A 1K38A 3IXHA 3N7WA 3A3IA 2ZC4B 1K56A 5EVIB 5FAQA 1YQSA 1ES4A 1MWRA 4E3JA 4O7DA 3E2LA 3M6HA 1MWTA 2ZD8A 3LY4A 3PBQA 4OKPA 4UHUA 4DE1A 4BD0A 4R1GA 1BSGA 2ZQ9A 5G18A 1G6AA 1YLJA 5GLDA 4E3LA 3HREA 4WMCD 2ZQAA 1GA9A 4XXRA 4GNUA 3VSLA 3SS3A 1M6KA 4ID4A 1PWDA 3Q7VB 3DTMA 4RVAA 4OPZA 1J9MA 3G4PA 3CZDA 3MZEA 4ZJ1A 2ZQCA 2GDNA 4EBLA 3W4QA 5FQQA 4B4ZA 3ZCZA 3HUOA 4HEFA 3NDEA 4JXVA 4KZ8A 1PWCA 4OPYA 3IXDA 3OPLA 5M19A 5GHZA 4DKIA 4GDNA 4KZ5A 1NZOA 5FQ9A 1ERQA 3UE0A 4K0WA 2ZLYA 1U60A 3VMAA 1ZG4A 2Y2MA 3AGDA 4DXBA 3G35A 4RX3A 4N1XA 3IF6C 1L0EA 2XQZA 3CMZA 1JWPA 3W8KA 4CPKA 3IF5A 3ZNYA 3ZDJA 2EX2A 1K57C 3RJUA 4OLDA 3D4FA 4KENB 3C7VA 3P09A 1K55C 4FH4A 2G2UA 3BFDA 5EVIC 4MNRA 1O07A 4A5RA 2EXBA 4OQIA 4ZJ3A 4S2MA 2Y91A 2EFUA 3VOYA 3ZVWA 3NIAA 1S0WA 1NXYA 2Z2MB 2ZQ8A 3A3JA 1JVJA 3V3RA 1NYMA 4E6XA 4ZDXA 1BULA 3UPNA 1HD8A 3SH7A 1G68A 1GHPA 2ZC5B 1Q2PA 3O86A 4DE3A 1EWZA 1H8YA 5F82A 4Y0TA 3HBRA 2FFFB 4ZBEA 4QJGA 1N4OA 3Q1FA 4DRTA 1K54C 1SCWA 3GVBA 4UA7A 1JTGA 3MBZA 3OCNA 3RXWA 3OCLA 1L0FA 2Y2HA 5E2HA 2R9WA 4IEDA 1NY0A 4OQGA 3RXXA 1XX2A 1WYBA 4LENA 4S2IA 3ZGAB 3HUMA 1ES5A 4KZ3A 4MBHA 3OC2A 4R23A 4DF6A 3PAEA 1GCEA 2C5WB 2Y55A 4QY6A 2HP5A 2X02A 1RP5A 3GSGA 4MLLA 4QB8A 5JYPA 1CEGA 5HARA 3VFFA 2VGJA 3TOIA 2WZXA 2E8IA 4N1HA 1BLSA 3MKEA 2JCHA 4FCFA 3AGFA 4IVIA 2Y59A 4JF4A 4JXWA 1IYSA 1GHMA 1XA7A 1XGIA 4S2NA 5TR7A 5EPHA 1L0DA 3O87A 5U47A 5F1FA 1DJAA 3ITBA 5A93A 2ZQDA 4Q8IA 5I94A 5EVID 4U3TA 5HW3A 4KZ7A 4LV1A 4N9KA 2ZM2A 4EWFA 1KDWA 4LV0A 3N6IA 5CGXA 2WGWA 2ZQ7A 4OOLA 2ZM8A 2H5SA 1CI9A 3G30A 5DTSA 5D3OA 3WS4A 4S2PA 5A91A 1FSWA 3BEBA 1YLZA 5EOOA 1K4EA 1QMEA 2RCXA 4IVKA 4YFMA 3ZVTA 1IYPA 5TFQA 2V2FF 4MBKA 4LCMA 2XF3A 4NETA 5EVLA 2FFYA 4KZBA 1K56D 1QMFA 3IXGA 3IH8A 5GHXA 2X01A 4JXGA 3V3SA 3MXRA 2WGWB 3ZFZA 4QU3A 2Y2LA 2PU2A 4C6YA 3G31A 1W8QA 2VGKA 3SS4A 3C5AA 1SDEA 4PMAA 2OSUA 5CGSA 3M2JA 4WYYA 1XXMA 4GD6A 1ES2A 3IH9A 3V5MA 4QY5A 5DF7A 3BFCA 4XUZA 4EBNA 5EUAA 3FZCA 3OZHA 1TDLA 4M3KA 4OP5A 1BTLA 4OOYA 4OP8A 4B88A 1YMSA 5HAQA 4P0MA 3GTCA 3TSGA 1W7FA 3EQVA 4OQ0A 1HTZA 2QPNA 4R3JA 1PW1A 3Q7ZA 3IQAA 2BG1A 3DWKA 3G32A 3CG5A 3HL9A 4P87A 1PI5A 3IT9A 4K0XA 4KQQA 5FQJA 3HLBA 3IWQA 4PM9A 1RGZA 1DY6A 1IEMA 1DJBA 4GN2A 5F83A 4RA7A 5KMWA 2V1ZA 1K4FA 3PBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HLW A;  5CGW A;  5CXW A;  2HDQ A;  3Q81 A;  4Y7P A;  2XR0 A;  3HUN A;  5FQK A;  3PBT A;  4S2N C;  3UY6 A;  4E3K A;  2HP9 A;  3E2K A;  2XK1 A;  1KE0 A;  1EI5 A;  3BLM A;  1FQG A;  4IBR A;  5DF8 A;  5AQ7 A;  5GL9 A;  4DE2 A;  5BOH A;  1I5Q A;  5J8X A;  3OPP A;  4OPR A;  5CHU A;  1LL5 A;  2ZC6 B;  1FR6 A;  1KDS A;  4K91 A;  1M40 A;  4P85 A;  4KG2 A;  3QHY A;  1BLH A;  2XH9 A;  1TVF A;  2B5R A;  2DRW A;  2Y2K A;  4R0Q A;  4EV4 A;  4X6T A;  3N4I A;  3O88 A;  4UA6 A;  4OOM A;  4KZA A;  4OVD A;  4WBG A;  1ERM A;  5CTN A;  2IWB A;  2WGV A;  1BZA A;  1GHI A;  3LEZ A;  3MZF A;  5EOE A;  2ZC3 B;  1WE4 A;  3ZHH A;  3V39 A;  3EQU A;  2J7V A;  3M6B A;  1KGF A;  2PU4 A;  2Y2P A;  3MZD A;  4JF6 A;  3S4X A;  4OPQ A;  2WZZ A;  2JE5 A;  1MKI A;  5E43 A;  3I7J A;  3ZNT A;  3V50 A;  4PM6 A;  5FQI A;  3B3X A;  4EQI A;  3G2Z A;  1ZKJ A;  4E3N A;  4EUZ A;  4FSF A;  3IWI A;  3O3V A;  4C75 A;  4F94 A;  2EX8 A;  5EEC A;  3HVF A;  3FKW A;  2WGI A;  1LLB A;  1ESU A;  1MXO A;  1BT5 A;  3VP3 A;  4KZ4 A;  4KQR A;  3WRZ A;  3SS5 A;  3GV9 A;  1ONH A;  4P6B A;  4E6W A;  4BL3 A;  5EE8 A;  3UDI A;  4GD8 A;  1TDG A;  2HDS A;  3PBS A;  1E25 A;  3UO9 A;  4R3B A;  3HLE A;  3NI9 A;  3SOI A;  2EFX A;  4GOG A;  4DDS A;  5CER A;  1MY8 A;  2XFT A;  1I2S A;  3M2K A;  2XEP A;  3MFD A;  2Y2I A;  3BEC A;  3MXS A;  3BFF A;  1TEM A;  3WWX A;  2WKH A;  2WKI A;  3N8S A;  4KZ9 A;  3PBO A;  4R4S A;  1IYO A;  1H5X A;  3QNB A;  3C4P A;  5AQ9 A;  3G2Y A;  4JPM A;  4OLG A;  3ZG7 B;  1NYY A;  2H0Y A;  2JBF A;  3ZG0 A;  1ZC2 A;  4JKT A;  4KZ6 A;  1KE4 A;  4UA9 A;  1SDN A;  3GQZ A;  4WZ5 A;  3FWL A;  5FAO A;  4EBP A;  1PZO A;  2XLN A;  1SKF A;  2Z2L B;  4WEL A;  2C6W B;  5IHV A;  1W8Y A;  3WS1 A;  1HVB A;  5HAP A;  1LI9 A;  2OV5 A;  1S6R A;  2H0T A;  1FCN A;  3GMW A;  1LHY A;  4NK3 A;  1PZP A;  3P98 A;  4GDB A;  4WM9 A;  4S2O A;  2Q9M A;  2HDR A;  4HBU A;  4GB7 A;  5HX9 A;  3ZG9 B;  5CEC A;  5FSR A;  1GA0 A;  4JXS A;  5GHY A;  1DJC A;  2DCF A;  3Q82 A;  2WAD A;  2X71 A;  4X56 A;  3ZG5 A;  3VP2 A;  2Y4A A;  5GLC A;  3WRT A;  4OQH A;  3DWZ A;  1Y54 A;  3IXB A;  1ESI A;  4N92 A;  2OLU A;  2J9O A;  1IKG A;  4JBF A;  5HAI A;  3GRJ A;  1JWV A;  4CJN A;  5KZH A;  1VQQ A;  5L2F A;  3UNW A;  3JYI A;  1MBL A;  2EXA A;  3MKF A;  2V20 A;  1H8Z A;  1ZG6 A;  1BUE A;  5GLB A;  5KSC A;  1AXB A;  3VOZ A;  3PBR A;  2JC7 A;  5FA7 A;  4DE0 A;  2BLS A;  4RYE A;  3NDG A;  1Q2Q A;  1YLP A;  3IHB A;  4YIN A;  1ES3 A;  4MBF A;  1E3U A;  1W5D A;  2ZMA A;  1L2S A;  3HLC A;  3UPP A;  3WS5 A;  3PTE A;  4Y0U A;  3TG9 A;  4QHC A;  5FI7 A;  2HDU A;  3BRM A;  4GKU A;  1K54 A;  4U0X A;  4N9L A;  5FAT A;  4X68 A;  5CRF A;  5FDH A;  3A3F A;  2H10 A;  2PBY A;  3BM6 A;  1HZO A;  2ZC7 A;  1NJ4 A;  5FQM A;  3N8L A;  3C7U A;  4XUX A;  4MEZ A;  2WAF A;  3FV7 A;  4QD4 A;  4S2L A;  2EX9 A;  5CTM A;  1FCO A;  3BYD A;  4E3I A;  2QMI A;  5KSH A;  5AQB A;  3VP0 A;  2QZ6 A;  2IWD A;  1IYQ A;  5DTK A;  3QNC A;  2WKE A;  5M1A A;  4PPR A;  4BLM A;  3UPO A;  1K6R A;  3OPR A;  1XA1 A;  4X69 A;  5E2G A;  3ZG8 B;  1KVM A;  4PM7 A;  4WZ5 C;  1MWU A;  3HLD A;  4WMC A;  4BJP A;  1YT4 A;  4HES A;  5GLA A;  4DXC A;  3FYZ A;  5FI2 A;  2XDM A;  2A3U A;  2XFS A;  4B4X A;  1ALQ A;  3G34 A;  4WEJ A;  1E4D A;  2XD1 A;  1BLP A;  5A92 A;  5CHJ A;  4UAA A;  1SHV A;  5CED A;  3IWO A;  3C4O A;  3WS2 A;  4IBX A;  3NCK A;  1KVL A;  3AGE A;  4Z9Q A;  3N8R A;  4KQO A;  3ISG A;  3OPH A;  4D2O A;  4FD8 A;  2Y2O A;  1IEL A;  3VP4 A;  4X53 A;  4H8R A;  5DVA A;  4WZ4 A;  4BL2 A;  5CEB A;  3HLG A;  4BEN A;  1PIO A;  3HLF A;  2UWX A;  2WYX A;  1LI0 A;  2J8Y A;  3WS0 A;  4X55 A;  1YLY A;  2Y2J A;  4OON A;  4HBT A;  2Y2Q A;  4FH2 A;  5AQA A;  3SH9 A;  5HL1 A;  1C3B A;  1OME A;  3BLS A;  1CEF A;  1CK3 A;  5CHM A;  5A90 A;  4LCL A;  3A3D A;  4WEK A;  1KE3 A;  4KG5 A;  1YMX A;  3UDF A;  5E2E A;  3ITA A;  4S2K A;  1FOF A;  3VSK A;  1JWZ A;  3NBL A;  5F1G A;  1MWS A;  4OH0 A;  1VM1 A;  1KGE A;  1ERO A;  1NZU A;  1PYY A;  2A49 A;  3S1Y A;  2EX6 A;  5TGF A;  5FAP A;  5FAS A;  5JYO A;  5HFO A;  1L0G A;  4E3O A;  4BD1 A;  2RL3 A;  3NC8 A;  1O7E A;  4LV3 A;  1K25 A;  1FR1 A;  1Z6F A;  2G2W A;  1BLC A;  1KGG A;  2DNS A;  4KG6 A;  4ZAM A;  2ZM0 A;  2IWC A;  1N9B A;  1NRF A;  1K6S A;  1RCJ A;  4GZB A;  1W79 A;  2XGN A;  1I2W A;  1WYC A;  3FKV A;  3W4O A;  4E3M A;  5M18 A;  1LL9 A;  1PI4 A;  2I72 A;  3Q07 A;  2CC1 A;  2WAE A;  4BQM A;  4JLF A;  3LCE A;  3BFG A;  4RX2 A;  3LO7 A;  2OLV A;  1XPB A;  2P9V A;  2ZJ9 A;  1YLW A;  2Y2N A;  3LY3 A;  3VFH A;  3IF6 A;  4ZJ2 A;  1ONG A;  1PW8 A;  2WUQ A;  3UDX A;  4LV2 A;  5DF9 A;  2R9X A;  3CJM A;  2WK0 A;  1K57 A;  4Y0O A;  1XKZ A;  1XGJ A;  5DTT A;  3IHA A;  3A3E A;  1K55 A;  2P74 A;  1CI8 A;  5EVI A;  3UN7 A;  1FSY A;  4L0L A;  3GR2 A;  1MPL A;  3UE3 A;  3NY4 A;  5FI6 A;  3PAG A;  3UE1 A;  1E3U D;  4R4R A;  2Q9N A;  1JTD A;  2HPB A;  3DW0 A;  2P9V B;  4U0T A;  2J9P A;  4ZTK A;  4PM5 A;  4C3Q A;  1PWG A;  4JF5 A;  3BFE A;  3IF6 B;  3S22 A;  1YM1 A;  1YLT A;  4S2J A;  3VP1 A;  1IKI A;  2XD5 A;  5E2F A;  4DDY A;  1XP4 A;  2Y2G A;  3W4P A;  3SH8 A;  3Q7V A;  1FCM A;  2HP6 A;  1RGY A;  4PM8 A;  1K38 A;  3IXH A;  3N7W A;  3A3I A;  2ZC4 B;  1K56 A;  5EVI B;  5FAQ A;  1YQS A;  1ES4 A;  1MWR A;  4E3J A;  4O7D A;  3E2L A;  3M6H A;  1MWT A;  2ZD8 A;  3LY4 A;  3PBQ A;  4OKP A;  4UHU A;  4DE1 A;  4BD0 A;  4R1G A;  1BSG A;  2ZQ9 A;  5G18 A;  1G6A A;  1YLJ A;  5GLD A;  4E3L A;  3HRE A;  4WMC D;  2ZQA A;  1GA9 A;  4XXR A;  4GNU A;  3VSL A;  3SS3 A;  1M6K A;  4ID4 A;  1PWD A;  3Q7V B;  3DTM A;  4RVA A;  4OPZ A;  1J9M A;  3G4P A;  3CZD A;  3MZE A;  4ZJ1 A;  2ZQC A;  2GDN A;  4EBL A;  3W4Q A;  5FQQ A;  4B4Z A;  3ZCZ A;  3HUO A;  4HEF A;  3NDE A;  4JXV A;  4KZ8 A;  1PWC A;  4OPY A;  3IXD A;  3OPL A;  5M19 A;  5GHZ A;  4DKI A;  4GDN A;  4KZ5 A;  1NZO A;  5FQ9 A;  1ERQ A;  3UE0 A;  4K0W A;  2ZLY A;  1U60 A;  3VMA A;  1ZG4 A;  2Y2M A;  3AGD A;  4DXB A;  3G35 A;  4RX3 A;  4N1X A;  3IF6 C;  1L0E A;  2XQZ A;  3CMZ A;  1JWP A;  3W8K A;  4CPK A;  3IF5 A;  3ZNY A;  3ZDJ A;  2EX2 A;  1K57 C;  3RJU A;  4OLD A;  3D4F A;  4KEN B;  3C7V A;  3P09 A;  1K55 C;  4FH4 A;  2G2U A;  3BFD A;  5EVI C;  4MNR A;  1O07 A;  4A5R A;  2EXB A;  4OQI A;  4ZJ3 A;  4S2M A;  2Y91 A;  2EFU A;  3VOY A;  3ZVW A;  3NIA A;  1S0W A;  1NXY A;  2Z2M B;  2ZQ8 A;  3A3J A;  1JVJ A;  3V3R A;  1NYM A;  4E6X A;  4ZDX A;  1BUL A;  3UPN A;  1HD8 A;  3SH7 A;  1G68 A;  1GHP A;  2ZC5 B;  1Q2P A;  3O86 A;  4DE3 A;  1EWZ A;  1H8Y A;  5F82 A;  4Y0T A;  3HBR A;  2FFF B;  4ZBE A;  4QJG A;  1N4O A;  3Q1F A;  4DRT A;  1K54 C;  1SCW A;  3GVB A;  4UA7 A;  1JTG A;  3MBZ A;  3OCN A;  3RXW A;  3OCL A;  1L0F A;  2Y2H A;  5E2H A;  2R9W A;  4IED A;  1NY0 A;  4OQG A;  3RXX A;  1XX2 A;  1WYB A;  4LEN A;  4S2I A;  3ZGA B;  3HUM A;  1ES5 A;  4KZ3 A;  4MBH A;  3OC2 A;  4R23 A;  4DF6 A;  3PAE A;  1GCE A;  2C5W B;  2Y55 A;  4QY6 A;  2HP5 A;  2X02 A;  1RP5 A;  3GSG A;  4MLL A;  4QB8 A;  5JYP A;  1CEG A;  5HAR A;  3VFF A;  2VGJ A;  3TOI A;  2WZX A;  2E8I A;  4N1H A;  1BLS A;  3MKE A;  2JCH A;  4FCF A;  3AGF A;  4IVI A;  2Y59 A;  4JF4 A;  4JXW A;  1IYS A;  1GHM A;  1XA7 A;  1XGI A;  4S2N A;  5TR7 A;  5EPH A;  1L0D A;  3O87 A;  5U47 A;  5F1F A;  1DJA A;  3ITB A;  5A93 A;  2ZQD A;  4Q8I A;  5I94 A;  5EVI D;  4U3T A;  5HW3 A;  4KZ7 A;  4LV1 A;  4N9K A;  2ZM2 A;  4EWF A;  1KDW A;  4LV0 A;  3N6I A;  5CGX A;  2WGW A;  2ZQ7 A;  4OOL A;  2ZM8 A;  2H5S A;  1CI9 A;  3G30 A;  5DTS A;  5D3O A;  3WS4 A;  4S2P A;  5A91 A;  1FSW A;  3BEB A;  1YLZ A;  5EOO A;  1K4E A;  1QME A;  2RCX A;  4IVK A;  4YFM A;  3ZVT A;  1IYP A;  5TFQ A;  2V2F F;  4MBK A;  4LCM A;  2XF3 A;  4NET A;  5EVL A;  2FFY A;  4KZB A;  1K56 D;  1QMF A;  3IXG A;  3IH8 A;  5GHX A;  2X01 A;  4JXG A;  3V3S A;  3MXR A;  2WGW B;  3ZFZ A;  4QU3 A;  2Y2L A;  2PU2 A;  4C6Y A;  3G31 A;  1W8Q A;  2VGK A;  3SS4 A;  3C5A A;  1SDE A;  4PMA A;  2OSU A;  5CGS A;  3M2J A;  4WYY A;  1XXM A;  4GD6 A;  1ES2 A;  3IH9 A;  3V5M A;  4QY5 A;  5DF7 A;  3BFC A;  4XUZ A;  4EBN A;  5EUA A;  3FZC A;  3OZH A;  1TDL A;  4M3K A;  4OP5 A;  1BTL A;  4OOY A;  4OP8 A;  4B88 A;  1YMS A;  5HAQ A;  4P0M A;  3GTC A;  3TSG A;  1W7F A;  3EQV A;  4OQ0 A;  1HTZ A;  2QPN A;  4R3J A;  1PW1 A;  3Q7Z A;  3IQA A;  2BG1 A;  3DWK A;  3G32 A;  3CG5 A;  3HL9 A;  4P87 A;  1PI5 A;  3IT9 A;  4K0X A;  4KQQ A;  5FQJ A;  3HLB A;  3IWQ A;  4PM9 A;  1RGZ A;  1DY6 A;  1IEM A;  1DJB A;  4GN2 A;  5F83 A;  4RA7 A;  5KMW A;  2V1Z A;  1K4F A;  3PBN A; 
#chains in the Genus database with same CATH topology
 2HDQ A;  3SW1 A;  1YSQ A;  3Q81 A;  4Y7P A;  4FUW A;  5FQK A;  3PBT A;  4S2N C;  5DF8 A;  1KE0 A;  1EI5 A;  3BLM A;  5AQ7 A;  4DE2 A;  5BOH A;  4LFU A;  4OPR A;  2GX5 A;  1FR6 A;  3F1P B;  5FEF A;  4P85 A;  4KG2 A;  1TVF A;  4R0Q A;  4X6T A;  2V1B A;  4UA6 A;  2Z6D A;  5A8B A;  1ERM A;  1FIK A;  2IWB A;  1XJ2 A;  3MF0 A;  1JNU A;  4NKP A;  5EOE A;  3ZHH A;  5F68 A;  2J7V A;  2PU4 A;  3T4K A;  2Y2P A;  4JF6 A;  3S4X A;  4ZRR A;  1MKI A;  1PFL A;  3B3X A;  4FSF A;  3IWI A;  3S7P A;  3HVF A;  2WGI A;  5L07 A;  4KQR A;  4L9F A;  3H82 A;  3SS5 A;  3GV9 A;  2A24 B;  3UDI A;  1TDG A;  1E25 A;  3SOI A;  2EFX A;  4DDS A;  5HD3 A;  3M2K A;  1I2S A;  3MFD A;  1TEM A;  3T4S A;  1IYO A;  3QNB A;  3C4P A;  2J3T C;  2NUT C;  3G2Y A;  3ZG7 B;  1NYY A;  1KOU A;  4JKT A;  4KZ6 A;  4EBP A;  1SDN A;  1PZO A;  2Z2L B;  5IHV A;  1MZU A;  1LHY A;  1PZP A;  2XRN A;  5FL3 A;  3LI8 A;  1GA0 A;  4DJ3 A;  4JXS A;  5F69 A;  2X71 A;  1NRJ A;  2E8J A;  5DKK A;  2HJ9 C;  5GLC A;  4OQH A;  1ESI A;  2OLU A;  3D72 A;  3E98 A;  1S67 L;  1VQQ A;  3UNW A;  3JYI A;  2D02 A;  3MKF A;  5GLB A;  5KSC A;  2PYR A;  3VOZ A;  5FA7 A;  4RYE A;  3NDG A;  1YLP A;  2R78 A;  1W5D A;  1L2S A;  3WS5 A;  3TG9 A;  1K54 A;  4N9L A;  4JGR A;  2JHE A;  3RH8 B;  4P6Z S;  3E4P A;  1P97 A;  3C7U A;  4MEZ A;  4S2L A;  1FCO A;  4HI4 A;  4E3I A;  4EW7 A;  5AQB A;  5DTK A;  3C30 A;  2WKE A;  4PPR A;  4BLM A;  1XA1 A;  4PM7 A;  1MWU A;  4WMC A;  3ULF A;  5GLA A;  1WA9 A;  3S7N A;  4B4X A;  3G34 A;  1TS0 A;  1E4D A;  1OTE A;  2XD1 A;  3W2Z A;  2O99 A;  3A0R A;  2KX6 A;  4IBX A;  1KVL A;  4PHT A;  4H8R A;  4G3K A;  1S4S A;  4BEN A;  4GW9 A;  3HLF A;  1S1Z A;  2WYX A;  2WKP A;  3C38 A;  2J8Y A;  2ZMV A;  3IBR A;  2V8F A;  1YLY A;  4X25 A;  3UB9 A;  1W63 M;  1F2K A;  4ESP A;  3BLS A;  4B93 A;  1CEF A;  1CK3 A;  5A90 A;  1OJ5 A;  4WEK A;  1KE3 A;  2OOL A;  1FOF A;  3NBL A;  5F1G A;  2OWH A;  2KOI A;  1PYY A;  5FAP A;  3QP2 A;  5JYO A;  4BD1 A;  1O7E A;  3HCY A;  2JKR I;  4LV3 A;  1TD5 A;  1YPR A;  1OT6 A;  4H6J A;  2XGN A;  1LL9 A;  3Q07 A;  4I3A A;  4JLF A;  1P0Z A;  1YLW A;  5J3W A;  1ONG A;  1T19 A;  2DMW A;  2WK0 A;  4I38 A;  4Y0O A;  5DFX A;  3LID A;  1FSY A;  5FI6 A;  4Q0I A;  3IBJ A;  4HIA A;  2Y8H A;  2K31 A;  1JTD A;  1XFQ A;  4C3Q A;  1YM1 A;  4GCZ A;  3VP1 A;  1IKI A;  1V9Z A;  3L7H A;  3W4P A;  3SH8 A;  4Z1W A;  3Q7V A;  2W3G A;  3BW6 A;  3N7W A;  5FDS A;  1YQS A;  1DP9 A;  1ES4 A;  1MKM A;  1D06 A;  1MWT A;  3IX8 A;  4D60 A;  4OKP A;  4DE1 A;  4EU0 A;  3K3C A;  1BSG A;  5GLD A;  4FTX A;  4HY8 A;  3K2N A;  4WMC D;  5LBR A;  2ZQA A;  4F3L B;  5IU1 A;  3JVV A;  4RVA A;  1J9M A;  3CZD A;  4ZJ1 A;  3E4O A;  4EES A;  1ODV A;  1UWN X;  4OPY A;  3IXD A;  4EUV A;  1YAX A;  3OPL A;  5M19 A;  4KZ5 A;  2ZLY A;  1U60 A;  3VMA A;  2Y2M A;  4DXB A;  4GJ4 A;  3CMZ A;  3CWF A;  2Y79 A;  3P09 A;  1K55 C;  2G2U A;  1O07 A;  4A5R A;  5K5B A;  3PXP A;  4S2M A;  1S0W A;  1S4R A;  1NXY A;  1LSX A;  3MQQ A;  3A3J A;  4EQ1 A;  3UPN A;  1G68 A;  1BYW A;  4DE3 A;  1EWZ A;  3ICY A;  2FFF B;  1VEU B;  2LB9 A;  1K54 C;  1SCW A;  1JTG A;  3UB6 A;  3RTY A;  3OCN A;  3RXX A;  2VV8 A;  4R3A A;  4LEN A;  1WYB A;  1D1J A;  2J3W A;  4KZ3 A;  4R23 A;  2C5W B;  4M4X A;  2Y55 A;  4QY6 A;  2QKP A;  2X02 A;  1RP5 A;  5JYP A;  4LRY C;  1CEG A;  2VGJ A;  2JKR M;  4KUK A;  3AGF A;  4IVI A;  1IYS A;  4S2N A;  5EPH A;  5F1F A;  3O87 A;  5A93 A;  1GSV A;  4Q8I A;  4LV1 A;  1KDW A;  3B47 A;  4NXE A;  2VGL M;  2VV6 A;  4DMZ A;  5TBM B;  5D3O A;  3WS4 A;  5A91 A;  1K4E A;  3H7W A;  2RCX A;  4IVK A;  5EVL A;  3EGD C;  2FFY A;  1F5M A;  2ACG A;  2WGW B;  1ZTU A;  2Y2L A;  2PU2 A;  1W8Q A;  3SS4 A;  3C5A A;  2PD7 A;  2OSU A;  4LPZ A;  3IH9 A;  3V5M A;  3T1S A;  4QY5 A;  5DF7 A;  4OP8 A;  3P7N A;  1YMS A;  4P0M A;  3CAX A;  3TSG A;  3F1P A;  4R3J A;  3Q7Z A;  3HL9 A;  3TW8 A;  3IT9 A;  3CUE A;  3HLB A;  3T4O A;  5KMW A;  1IEM A;  1DJB A;  4RA7 A;  3HLW A;  3JVU A;  1F98 A;  3KYE A;  4E3K A;  2XK1 A;  5GL9 A;  3OPP A;  3IX3 A;  4G3W A;  1KDS A;  2V0W A;  2XH9 A;  2DRW A;  2B5R A;  4EV4 A;  3KSG A;  4ETZ A;  3PHY A;  1NLY A;  3LEZ A;  2ZC3 B;  4YWZ A;  3V39 A;  2A24 A;  5G4Z A;  5E43 A;  4PM6 A;  3G2Z A;  1T1C A;  1ZKJ A;  3O3V A;  2EX8 A;  3DTE A;  1T18 A;  4KZ4 A;  1ONH A;  1T1A A;  3PBS A;  3HLE A;  3NI9 A;  4GOG A;  5CER A;  5L8M A;  1MY8 A;  3MXS A;  3BFF A;  1OT9 A;  3F1O B;  4R4S A;  1H5X A;  4OLG A;  1XJ3 A;  1ZC2 A;  4UA9 A;  5J8X A;  3HJI A;  4WEL A;  4ME4 A;  3GMW A;  3MQO A;  3P98 A;  1YSP A;  4WM9 A;  4S2O A;  4HBU A;  3PYP A;  5HX9 A;  5FSR A;  2DCF A;  3Q82 A;  4X56 A;  3ZG5 A;  2Y4A A;  1IKG A;  5L2F A;  1MBL A;  2ZL1 B;  1BUE A;  3PBR A;  2BLS A;  3IHB A;  4MBF A;  4BBT A;  1CQA A;  3UPP A;  3L9K A;  4QHC A;  2HDU A;  2J3T D;  2FZ0 A;  4I5S A;  5J7E A;  5CRF A;  5FDH A;  2H10 A;  3BM6 A;  5HWT A;  4IJG A;  2W1T B;  4XUX A;  3FV7 A;  3LUQ A;  5CTM A;  3BYD A;  5EFW A;  1D7E A;  4LGW A;  3ZQ5 A;  4MMN A;  1K6R A;  3OPR A;  4FOF A;  4WZ5 C;  4BJP A;  1YT4 A;  3FYZ A;  4KUO A;  2A3U A;  2EA9 A;  1BLP A;  5A92 A;  4PAU A;  3QP5 A;  5CHJ A;  3LIB A;  1PRQ A;  1SHV A;  3C4O A;  3WS2 A;  1H8M A;  2V8C A;  3ISG A;  2I9V A;  1XJ4 A;  4D2O A;  4FD8 A;  2Y2O A;  4BL2 A;  5CEB A;  2Q0O A;  2UWX A;  1LI0 A;  4X55 A;  2Y2J A;  2Y2Q A;  3SH9 A;  2AVX A;  1OME A;  5G4Y A;  5CHM A;  3MXQ A;  1IOU A;  3UDF A;  2B02 A;  4X1M A;  5E2E A;  2GJ3 A;  4BBU A;  4HQA A;  4WLA A;  2KLI A;  1VM1 A;  3CPT B;  1KGE A;  2EX6 A;  4II7 A;  2A2L A;  3QP1 A;  3A0V A;  1IFQ A;  3A0S A;  5HFO A;  3K3D A;  2RL3 A;  3CUE C;  4YOF A;  3LR5 A;  1K25 A;  1FR1 A;  1Z6F A;  1BLC A;  1KGG A;  4NXB A;  4O8G A;  2ZM0 A;  1NRF A;  3T4J A;  1K6S A;  1RCJ A;  1I2W A;  1WYC A;  4E3M A;  1G28 A;  3LCE A;  3LO7 A;  2ZJ9 A;  3VFH A;  2Y2N A;  3LY3 A;  1PW8 A;  3V67 A;  4LV2 A;  5DF9 A;  2R9X A;  1VB6 A;  2M1C A;  2OAQ 1;  1XKZ A;  1XGJ A;  2O9C A;  3IHA A;  2ZOI A;  1K55 A;  1OTA A;  1CI8 A;  4O0P A;  3NY4 A;  3H9W A;  3LGO A;  2HPB A;  2P9V B;  4U0T A;  2J9P A;  4ZTK A;  4JF5 A;  4NEE D;  3BFE A;  3S22 A;  4S2J A;  5AJG A;  4F3L A;  2XD5 A;  4DDY A;  3LIC A;  4NXG A;  3R4K A;  1RGY A;  1K38 A;  3A3I A;  2ZC4 B;  5EVI B;  4WL9 A;  1Z09 A;  1H3Q A;  4UHU A;  2K7S A;  3OLO A;  5G18 A;  1G6A A;  4GNU A;  2B18 A;  3SS3 A;  1OJG A;  3G4P A;  3LR4 A;  3UB8 A;  3ZCZ A;  5L10 A;  3NDE A;  4E04 A;  3UB5 P;  5FQ9 A;  1ERQ A;  3RFB A;  1ZG4 A;  4GS9 A;  4N1X A;  4QPR A;  4HH3 A;  4CPK A;  3IF5 A;  1VEU A;  3ZNY A;  1K57 C;  4OLD A;  4Y17 A;  3D4F A;  5EVI C;  2EXB A;  4ZJ3 A;  2EFU A;  3NIA A;  2VV7 A;  2W27 A;  2Z2M B;  4E6X A;  4CLC B;  1Q2P A;  4Y0T A;  5F82 A;  3HBR A;  2W3H A;  1MC0 A;  2JKT I;  1N4O A;  3Q1F A;  5HDS A;  4DRT A;  1CF0 A;  1SKO B;  3OCL A;  2Y2H A;  1UWP X;  2JKG A;  3E4Q A;  4S2I A;  3ZGA B;  3PAE A;  3T12 B;  4I3I A;  1Y28 A;  5TBM A;  1BLS A;  2O9B A;  1L0D A;  5U47 A;  1DJA A;  2ZQD A;  5I94 A;  5HW3 A;  4U3T A;  2ZM2 A;  4EWF A;  5CGX A;  4CLC C;  2WGW A;  2ZQ7 A;  1OTB A;  2H5S A;  1CI9 A;  3G30 A;  4I3J A;  3LR3 A;  1QME A;  3FPW A;  5TFQ A;  2V2F F;  4MBK A;  1S66 L;  1TS6 A;  4JXG A;  5DJU A;  4C6Y A;  2VGK A;  2WKR A;  4PMA A;  5CGS A;  3M2J A;  3LI9 A;  4GD6 A;  3BFC A;  4EBN A;  5EUA A;  3LR0 A;  3OZH A;  1HLU P;  4O01 A;  2O9A A;  1W7F A;  1K0K A;  3EQV A;  1HTZ A;  2BG1 A;  3DWK A;  3G32 A;  3CG5 A;  4K0X A;  4RQ9 A;  4PM9 A;  1RGZ A;  3GEC A;  5DTT A;  3WS1 A;  2V1Z A;  5CX7 A;  1N9N A;  1K4F A;  2PHY A;  3NOU C;  2XR0 A;  4EER A;  2XSS A;  3UY6 A;  4DN0 A;  4IBR A;  2HV1 A;  1I5Q A;  1LL5 A;  2ZC6 B;  3BQA A;  4K91 A;  2VGL S;  3QHY A;  1BLH A;  2Y2K A;  4Y13 A;  1GSW A;  4OOM A;  4EXO A;  4WBG A;  5CTN A;  3NEC A;  4WF0 A;  4Y5F A;  3MZF A;  1WE4 A;  1DP8 A;  2VZW A;  1KGF A;  4GS9 B;  3MZD A;  2JE5 A;  3I7J A;  3V50 A;  5FQI A;  2K2N A;  4XT2 A;  3F1O A;  4EQI A;  4E3N A;  4EUZ A;  1VHM A;  2YKH A;  1N9L A;  1ESU A;  2JKT M;  3VP3 A;  3WRZ A;  2OWJ A;  4P6B A;  4E6W A;  5HL6 A;  4BL3 A;  5EE8 A;  2HDS A;  1W63 Q;  4LRZ E;  4ARZ B;  1A0K A;  2XEP A;  1Y4O A;  3BEC A;  5EVE A;  4Y3I A;  2WKH A;  3N8S A;  4GHI B;  3BQ8 A;  3IS2 A;  2EWV A;  2JKF A;  2EWW A;  3ZG0 A;  4WZ5 A;  3GQZ A;  5HAP A;  1SKF A;  3R7W B;  4HOI A;  1HVB A;  1LI9 A;  2OV5 A;  2H0T A;  1FCN A;  4IUH A;  4JGQ A;  4NK3 A;  2ZL1 A;  1ZHH B;  4IHQ A;  4GDB A;  1XJ6 A;  2HDR A;  4GB7 A;  3ZG9 B;  5CEC A;  5GHY A;  1DJC A;  4DJ2 A;  2WAD A;  3MQ0 A;  4BBV A;  4EEU A;  1Y54 A;  3LFV A;  4JBF A;  5KZH A;  1H8Z A;  1ZG6 A;  1F9I A;  5HSQ A;  2W1T A;  2JC7 A;  1Q2Q A;  3T1Q B;  4YIN A;  2P08 A;  1SZV A;  4Y0U A;  3QP8 A;  4U0X A;  1VET A;  5FAT A;  4Q0J A;  5MC7 A;  5I5L A;  2PBY A;  1HZO A;  2BAS A;  4WN5 A;  3N8L A;  2WAF A;  4QD4 A;  2QMI A;  3EEA A;  2IWD A;  3VE3 A;  1IYQ A;  3QNC A;  5M1A A;  4X69 A;  1X0O A;  1KVM A;  5DJT A;  5L09 A;  3OBF A;  3KX0 X;  5FI2 A;  2XDM A;  4UAA A;  3IWO A;  3NCK A;  3AGE A;  4Z9Q A;  3N8R A;  3T1R A;  5FEG A;  3VOL A;  1V9Y A;  5DVA A;  3BWL A;  2VEA A;  3HLG A;  1PIO A;  3CPT A;  1ACF A;  4OON A;  2PT7 A;  5HL1 A;  1C3B A;  3DTK A;  1P9R A;  1DRM A;  1YMX A;  2KDK A;  4S2K A;  3NOT C;  1JWZ A;  1MWS A;  2XA7 M;  1ERO A;  1NZU A;  2A49 A;  5TGF A;  4XT2 B;  3MJQ A;  1PNE A;  5FAS A;  2YKF A;  4KQD A;  3NC8 A;  3F1N B;  3LIF A;  3KSF A;  2G2W A;  2DNS A;  4KG6 A;  4MDZ A;  4ZAM A;  1N9B A;  2PRF A;  3KYQ A;  4GZB A;  2VK3 A;  3W4O A;  2I72 A;  2OLV A;  2P9V A;  4L9G A;  5KIZ A;  3IS2 B;  4BMW A;  3B42 A;  3D3O A;  4ZJ2 A;  2WUQ A;  3UDX A;  1K57 A;  4K08 A;  3A3E A;  2O0Y A;  2PBD P;  5EVI A;  4G3V A;  4L0L A;  2VA0 A;  1MPL A;  2L0W A;  3GR2 A;  3UE3 A;  3UE1 A;  4R4R A;  2Q9N A;  4PM5 A;  5IS1 A;  1LT0 A;  3IF6 B;  1YLT A;  2QWS A;  4JGP A;  3GDI A;  3PR6 A;  1XP4 A;  3E0Y A;  2Y2G A;  1FCM A;  2HP6 A;  3IXH A;  4Y15 A;  5FAQ A;  4E3J A;  4O7D A;  3M6H A;  3LY4 A;  3KSH A;  3PBQ A;  1G5U A;  4YNR A;  4R1G A;  2ZQ9 A;  1YLJ A;  4E3L A;  3HRE A;  2PAV P;  4MN7 A;  1GA9 A;  1UGU A;  2P04 A;  2L1M A;  1VET B;  1PWD A;  2INW A;  1N9O A;  2V1A A;  4MN5 A;  2MJ6 A;  3MZE A;  2ZQC A;  4EBL A;  1TF1 A;  3W4Q A;  3HUO A;  4JXV A;  4KZ8 A;  1PWC A;  3T4Q A;  5GHZ A;  4DKI A;  4GDN A;  1NZO A;  4CLC A;  4BWI A;  4RX3 A;  3IF6 C;  4CQH A;  1L0E A;  2XQZ A;  1S1Y A;  3W8K A;  2W3D A;  2EX2 A;  4KEN B;  3C7V A;  1SKO A;  4MNR A;  4NG2 A;  3ZVW A;  2ZQ8 A;  4ZDX A;  1BUL A;  2JN7 A;  3O86 A;  4LRX C;  1H8Y A;  4R6L A;  4ZBE A;  3CHW P;  5AVF A;  1GSX A;  5AVE A;  4UA7 A;  3MBZ A;  2HGV A;  4HH2 A;  1L0F A;  2R9W A;  4OQG A;  1XX2 A;  3HUM A;  1ES5 A;  3NOP C;  1GCE A;  2B95 A;  4HJ3 A;  3GSG A;  3P01 A;  3KO6 A;  4MLL A;  3VFF A;  2WZX A;  4N1H A;  3DBA A;  4X1L A;  4FCF A;  2W3E A;  4JXW A;  1XGI A;  1GHM A;  3ZYT A;  3ITB A;  3EOI A;  5EVI D;  4KZ7 A;  4NXF A;  3N6I A;  2GZA A;  2ZM8 A;  5DTS A;  3T1X A;  1OTI A;  5EOO A;  2VJW A;  1IYP A;  2ZOH A;  4LCM A;  4NET A;  3VE4 A;  5F6A A;  1QMF A;  1G6O A;  3IXG A;  3IH8 A;  3V3S A;  3MXR A;  4QU3 A;  2NUP C;  3G31 A;  3B33 A;  1SDE A;  5DKL A;  4XUZ A;  2PD8 A;  2WKQ A;  3FZC A;  4OOY A;  4OP5 A;  4M3K A;  5EM0 A;  1BTL A;  1YKD A;  5HAQ A;  4OQ0 A;  3MR0 A;  3IQA A;  3D9Y A;  3FC7 A;  4P87 A;  5HWW A;  4KQQ A;  3IWQ A;  4CLC D;  4MN6 A;  1DP6 A;  4GN2 A;  5F83 A;  3EGX C;  3PBN A;  5HDD A;  5CGW A;  5CXW A;  5EM1 A;  3HUN A;  3FG8 A;  5C5K A;  2HP9 A;  3E2K A;  2QJ7 A;  1FQG A;  5CHU A;  1M40 A;  4JGO A;  3N4I A;  4HNB A;  3O88 A;  1L3L A;  4KZA A;  4OVD A;  4AFI A;  2FH5 A;  2WGV A;  1BZA A;  1OTD A;  1GHI A;  2V9A A;  3MFX A;  3EQU A;  3M6B A;  4ARZ A;  4OPQ A;  2WZZ A;  3OOV A;  3ZNT A;  4UEY A;  4GHI A;  3TRC A;  3CI6 A;  4C75 A;  2L4R A;  4IUK A;  4F94 A;  5EEC A;  3FKW A;  1LLB A;  1MXO A;  1BT5 A;  3R7W A;  5J4E A;  4GD8 A;  3UO9 A;  4R3B A;  1STZ A;  4P6Z M;  2Z6C A;  2XFT A;  1TS8 A;  2UV0 E;  2Y2I A;  2M7U A;  3WWX A;  1EW0 A;  2WKI A;  4KZ9 A;  3PBO A;  4HP4 A;  5AQ9 A;  4JPM A;  4HP9 A;  2H0Y A;  2JBF A;  3G6O A;  1KE4 A;  5FAO A;  3FWL A;  3H82 B;  2XLN A;  4HJ6 A;  2C6W B;  1W8Y A;  1H0M A;  1S6R A;  2ZMF A;  2Q9M A;  2PR5 A;  3DAV A;  2BTF P;  1NLZ A;  3U4L P;  5HZH A;  3S7O A;  3VP2 A;  3WRT A;  3DWZ A;  3IXB A;  4N92 A;  2J9O A;  3TE8 A;  5HAI A;  3GRJ A;  1JWV A;  2PDR A;  4CJN A;  2EXA A;  2V20 A;  1AXB A;  5TJJ A;  4DE0 A;  1ES3 A;  4L9E A;  1E3U A;  2ZMA A;  3HLC A;  3UMD A;  3PTE A;  3CLO A;  2VLG A;  5FI7 A;  4CLC E;  3BRM A;  4EET B;  2IA2 A;  3T4L A;  3VV4 A;  2PR6 A;  4GKU A;  2W0N A;  4UQI S;  4X68 A;  3A3F A;  3UB7 A;  5IT5 A;  2ZC7 A;  1NJ4 A;  5FQM A;  3KYZ A;  2EX9 A;  5KSH A;  3VP0 A;  2QZ6 A;  1LSW A;  3S7Q A;  3UPO A;  3ZG8 B;  5E2G A;  2H28 A;  3HLD A;  4HES A;  4DXC A;  2XFS A;  1ALQ A;  3CIT A;  4WEJ A;  5HPI A;  4ETX A;  4PKY A;  5CED A;  4KQO A;  3OPH A;  1IEL A;  3VP4 A;  4X53 A;  4Q0H A;  4WZ4 A;  3QP4 A;  3WS0 A;  4HBT A;  4FH2 A;  5AQA A;  3UME A;  5F5Y A;  4R38 A;  3LIA A;  3F1N A;  2OAP 1;  4LCL A;  3A3D A;  4KG5 A;  2QYB A;  3ITA A;  4UQI M;  3VSK A;  3C8C A;  4OH0 A;  4EEP A;  3S1Y A;  4HHD A;  3SZT A;  1L0G A;  4E3O A;  4WUJ A;  3MSH A;  5EV0 A;  2IWC A;  4Y2F A;  1W79 A;  4R70 A;  3FKV A;  3MMH A;  5M18 A;  1PI4 A;  4BQM A;  2CC1 A;  2WAE A;  3HJK A;  2J80 A;  3BFG A;  3O5Y A;  4RX2 A;  1XPB A;  1P9W A;  3IF6 A;  3IX4 A;  2W1R A;  3CJM A;  2P74 A;  2HZ5 A;  4H6J B;  3UE6 A;  3UN7 A;  3BY9 A;  3LIE A;  3PAG A;  1E3U D;  3KSI A;  3DTI A;  3LYX A;  3DW0 A;  4PKY G;  1PWG A;  3NHQ A;  3NUL A;  2W3F A;  1LSV A;  1T1B A;  5E2F A;  2CMN A;  4PM8 A;  1K56 A;  2VX8 A;  2XA7 S;  1MWR A;  3T50 A;  2D01 A;  3E2L A;  2ZD8 A;  4HJ4 A;  2M7V A;  4BD0 A;  3FPV A;  2V0U A;  4MCW A;  4XXR A;  3TJZ C;  3VSL A;  1M6K A;  4ID4 A;  1AWI A;  2GNX A;  3Q7V B;  3DTM A;  4OPZ A;  2GDN A;  5FQQ A;  4B4Z A;  4HEF A;  5HPF A;  3T4T A;  3UE0 A;  3BY8 A;  3LEQ A;  4K0W A;  2G7U A;  3AGD A;  3G35 A;  1OPX A;  1JWP A;  3C2W A;  3ZDJ A;  3RJU A;  2VKS A;  4FH4 A;  5HWV A;  3BFD A;  2QJ5 A;  4OQI A;  2Y91 A;  3VOY A;  4B9O A;  3V3R A;  1JVJ A;  1NYM A;  1HD8 A;  3QP6 A;  3SH7 A;  1GHP A;  2ZC5 B;  2ZBB A;  3BJN A;  4QJG A;  2HJE A;  3GVB A;  1NWZ A;  1FIL A;  3RXW A;  1J3W A;  5E2H A;  4IED A;  1NY0 A;  1XFN A;  4LLO B;  2XRO A;  5DFY A;  2PYP A;  4MBH A;  3OC2 A;  4DF6 A;  2HP5 A;  4QB8 A;  3NJA A;  5HAR A;  3TOI A;  2E8I A;  3MKE A;  2JCH A;  2QHK A;  2Y59 A;  4JF4 A;  5TR7 A;  1XA7 A;  3JPU A;  4GLQ A;  2P7J A;  3U2A A;  4N9K A;  4LV0 A;  4I39 A;  4OOL A;  4S2P A;  1FSW A;  3BEB A;  1YLZ A;  3ZVT A;  4YFM A;  2XF3 A;  4KZB A;  1K56 D;  5GHX A;  2X01 A;  3ZFZ A;  1LL8 A;  5HDC A;  4WYY A;  1XXM A;  1ES2 A;  2HF6 A;  3H7W B;  1TS7 A;  1TDL A;  2LB5 A;  4B88 A;  3GTC A;  3EEH A;  2QPN A;  4QWO A;  1PW1 A;  3EWK A;  3MS6 A;  1PI5 A;  5FQJ A;  1CJF A;  1DY6 A;  5HD5 A; 
#chains in the Genus database with same CATH homology
 3HLW A;  5CGW A;  5CXW A;  2HDQ A;  3Q81 A;  4Y7P A;  2XR0 A;  3HUN A;  5FQK A;  3PBT A;  4S2N C;  3UY6 A;  4E3K A;  2HP9 A;  3E2K A;  2XK1 A;  1KE0 A;  1EI5 A;  3BLM A;  1FQG A;  4IBR A;  5DF8 A;  5AQ7 A;  5GL9 A;  4DE2 A;  5BOH A;  1I5Q A;  5J8X A;  3OPP A;  4OPR A;  5CHU A;  1LL5 A;  2ZC6 B;  1FR6 A;  1KDS A;  4K91 A;  1M40 A;  4P85 A;  4KG2 A;  3QHY A;  1BLH A;  2XH9 A;  1TVF A;  2B5R A;  2DRW A;  2Y2K A;  4R0Q A;  4EV4 A;  4X6T A;  3N4I A;  3O88 A;  4UA6 A;  4OOM A;  4KZA A;  4OVD A;  4WBG A;  1ERM A;  5CTN A;  2IWB A;  2WGV A;  1BZA A;  1GHI A;  3LEZ A;  3MZF A;  5EOE A;  2ZC3 B;  1WE4 A;  3ZHH A;  3V39 A;  3EQU A;  2J7V A;  3M6B A;  1KGF A;  2PU4 A;  2Y2P A;  3MZD A;  4JF6 A;  3S4X A;  4OPQ A;  2WZZ A;  2JE5 A;  1MKI A;  5E43 A;  3I7J A;  3ZNT A;  3V50 A;  4PM6 A;  5FQI A;  3B3X A;  4EQI A;  3G2Z A;  1ZKJ A;  4E3N A;  4EUZ A;  4FSF A;  3IWI A;  3O3V A;  4C75 A;  4F94 A;  2EX8 A;  5EEC A;  3HVF A;  3FKW A;  2WGI A;  1LLB A;  1ESU A;  1MXO A;  1BT5 A;  3VP3 A;  4KZ4 A;  4KQR A;  3WRZ A;  3SS5 A;  3GV9 A;  1ONH A;  4P6B A;  4E6W A;  4BL3 A;  5EE8 A;  3UDI A;  4GD8 A;  1TDG A;  2HDS A;  3PBS A;  1E25 A;  3UO9 A;  4R3B A;  3HLE A;  3NI9 A;  3SOI A;  2EFX A;  4GOG A;  4DDS A;  5CER A;  1MY8 A;  2XFT A;  1I2S A;  3M2K A;  2XEP A;  3MFD A;  2Y2I A;  3BEC A;  3MXS A;  3BFF A;  1TEM A;  3WWX A;  2WKH A;  2WKI A;  3N8S A;  4KZ9 A;  3PBO A;  4R4S A;  1IYO A;  1H5X A;  3QNB A;  3C4P A;  5AQ9 A;  3G2Y A;  4JPM A;  4OLG A;  3ZG7 B;  1NYY A;  2H0Y A;  2JBF A;  3ZG0 A;  1ZC2 A;  4JKT A;  4KZ6 A;  1KE4 A;  4UA9 A;  1SDN A;  3GQZ A;  4WZ5 A;  3FWL A;  5FAO A;  4EBP A;  1PZO A;  2XLN A;  1SKF A;  2Z2L B;  4WEL A;  2C6W B;  5IHV A;  1W8Y A;  3WS1 A;  1HVB A;  5HAP A;  1LI9 A;  2OV5 A;  1S6R A;  2H0T A;  1FCN A;  3GMW A;  1LHY A;  4NK3 A;  1PZP A;  3P98 A;  4GDB A;  4WM9 A;  4S2O A;  2Q9M A;  2HDR A;  4HBU A;  4GB7 A;  5HX9 A;  3ZG9 B;  5CEC A;  5FSR A;  1GA0 A;  4JXS A;  5GHY A;  1DJC A;  2DCF A;  3Q82 A;  2WAD A;  2X71 A;  4X56 A;  3ZG5 A;  3VP2 A;  2Y4A A;  5GLC A;  3WRT A;  4OQH A;  3DWZ A;  1Y54 A;  3IXB A;  1ESI A;  4N92 A;  2OLU A;  2J9O A;  1IKG A;  4JBF A;  5HAI A;  3GRJ A;  1JWV A;  4CJN A;  5KZH A;  1VQQ A;  5L2F A;  3UNW A;  3JYI A;  1MBL A;  2EXA A;  3MKF A;  2V20 A;  1H8Z A;  1ZG6 A;  1BUE A;  5GLB A;  5KSC A;  1AXB A;  3VOZ A;  3PBR A;  2JC7 A;  5FA7 A;  4DE0 A;  2BLS A;  4RYE A;  3NDG A;  1Q2Q A;  1YLP A;  3IHB A;  4YIN A;  1ES3 A;  4MBF A;  1E3U A;  1W5D A;  2ZMA A;  1L2S A;  3HLC A;  3UPP A;  3WS5 A;  3PTE A;  4Y0U A;  3TG9 A;  4QHC A;  5FI7 A;  2HDU A;  3BRM A;  4GKU A;  1K54 A;  4U0X A;  4N9L A;  5FAT A;  4X68 A;  5CRF A;  5FDH A;  3A3F A;  2H10 A;  2PBY A;  3BM6 A;  1HZO A;  2ZC7 A;  1NJ4 A;  5FQM A;  3N8L A;  3C7U A;  4XUX A;  4MEZ A;  2WAF A;  3FV7 A;  4QD4 A;  4S2L A;  2EX9 A;  5CTM A;  1FCO A;  3BYD A;  4E3I A;  2QMI A;  5KSH A;  5AQB A;  3VP0 A;  2QZ6 A;  2IWD A;  1IYQ A;  5DTK A;  3QNC A;  2WKE A;  5M1A A;  4PPR A;  4BLM A;  3UPO A;  1K6R A;  3OPR A;  1XA1 A;  4X69 A;  5E2G A;  3ZG8 B;  1KVM A;  4PM7 A;  4WZ5 C;  1MWU A;  3HLD A;  4WMC A;  4BJP A;  1YT4 A;  4HES A;  5GLA A;  4DXC A;  3FYZ A;  5FI2 A;  2XDM A;  2A3U A;  2XFS A;  4B4X A;  1ALQ A;  3G34 A;  4WEJ A;  1E4D A;  2XD1 A;  1BLP A;  5A92 A;  5CHJ A;  4UAA A;  1SHV A;  5CED A;  3IWO A;  3C4O A;  3WS2 A;  4IBX A;  3NCK A;  1KVL A;  3AGE A;  4Z9Q A;  3N8R A;  4KQO A;  3ISG A;  3OPH A;  4D2O A;  4FD8 A;  2Y2O A;  1IEL A;  3VP4 A;  4X53 A;  4H8R A;  5DVA A;  4WZ4 A;  4BL2 A;  5CEB A;  3HLG A;  4BEN A;  1PIO A;  3HLF A;  2UWX A;  2WYX A;  1LI0 A;  2J8Y A;  3WS0 A;  4X55 A;  1YLY A;  2Y2J A;  4OON A;  4HBT A;  2Y2Q A;  4FH2 A;  5AQA A;  3SH9 A;  5HL1 A;  1C3B A;  1OME A;  3BLS A;  1CEF A;  1CK3 A;  5CHM A;  5A90 A;  4LCL A;  3A3D A;  4WEK A;  1KE3 A;  4KG5 A;  1YMX A;  3UDF A;  5E2E A;  3ITA A;  4S2K A;  1FOF A;  3VSK A;  1JWZ A;  3NBL A;  5F1G A;  1MWS A;  4OH0 A;  1VM1 A;  1KGE A;  1ERO A;  1NZU A;  1PYY A;  2A49 A;  3S1Y A;  2EX6 A;  5TGF A;  5FAP A;  5FAS A;  5JYO A;  5HFO A;  1L0G A;  4E3O A;  4BD1 A;  2RL3 A;  3NC8 A;  1O7E A;  4LV3 A;  1K25 A;  1FR1 A;  1Z6F A;  2G2W A;  1BLC A;  1KGG A;  2DNS A;  4KG6 A;  4ZAM A;  2ZM0 A;  2IWC A;  1N9B A;  1NRF A;  1K6S A;  1RCJ A;  4GZB A;  1W79 A;  2XGN A;  1I2W A;  1WYC A;  3FKV A;  3W4O A;  4E3M A;  5M18 A;  1LL9 A;  1PI4 A;  2I72 A;  3Q07 A;  2CC1 A;  2WAE A;  4BQM A;  4JLF A;  3LCE A;  3BFG A;  4RX2 A;  3LO7 A;  2OLV A;  1XPB A;  2P9V A;  2ZJ9 A;  1YLW A;  2Y2N A;  3LY3 A;  3VFH A;  3IF6 A;  4ZJ2 A;  1ONG A;  1PW8 A;  2WUQ A;  3UDX A;  4LV2 A;  5DF9 A;  2R9X A;  3CJM A;  2WK0 A;  1K57 A;  4Y0O A;  1XKZ A;  1XGJ A;  5DTT A;  3IHA A;  3A3E A;  1K55 A;  2P74 A;  1CI8 A;  5EVI A;  3UN7 A;  1FSY A;  4L0L A;  3GR2 A;  1MPL A;  3UE3 A;  3NY4 A;  5FI6 A;  3PAG A;  3UE1 A;  1E3U D;  4R4R A;  2Q9N A;  1JTD A;  2HPB A;  3DW0 A;  2P9V B;  4U0T A;  2J9P A;  4ZTK A;  4PM5 A;  4C3Q A;  1PWG A;  4JF5 A;  3BFE A;  3IF6 B;  3S22 A;  1YM1 A;  1YLT A;  4S2J A;  3VP1 A;  1IKI A;  2XD5 A;  5E2F A;  4DDY A;  1XP4 A;  2Y2G A;  3W4P A;  3SH8 A;  3Q7V A;  1FCM A;  2HP6 A;  1RGY A;  4PM8 A;  1K38 A;  3IXH A;  3N7W A;  3A3I A;  2ZC4 B;  1K56 A;  5EVI B;  5FAQ A;  1YQS A;  1ES4 A;  1MWR A;  4E3J A;  4O7D A;  3E2L A;  3M6H A;  1MWT A;  2ZD8 A;  3LY4 A;  3PBQ A;  4OKP A;  4UHU A;  4DE1 A;  4BD0 A;  4R1G A;  1BSG A;  2ZQ9 A;  5G18 A;  1G6A A;  1YLJ A;  5GLD A;  4E3L A;  3HRE A;  4WMC D;  2ZQA A;  1GA9 A;  4XXR A;  4GNU A;  3VSL A;  3SS3 A;  1M6K A;  4ID4 A;  1PWD A;  3Q7V B;  3DTM A;  4RVA A;  4OPZ A;  1J9M A;  3G4P A;  3CZD A;  3MZE A;  4ZJ1 A;  2ZQC A;  2GDN A;  4EBL A;  3W4Q A;  5FQQ A;  4B4Z A;  3ZCZ A;  3HUO A;  4HEF A;  3NDE A;  4JXV A;  4KZ8 A;  1PWC A;  4OPY A;  3IXD A;  3OPL A;  5M19 A;  5GHZ A;  4DKI A;  4GDN A;  4KZ5 A;  1NZO A;  5FQ9 A;  1ERQ A;  3UE0 A;  4K0W A;  2ZLY A;  1U60 A;  3VMA A;  1ZG4 A;  2Y2M A;  3AGD A;  4DXB A;  3G35 A;  4RX3 A;  4N1X A;  3IF6 C;  1L0E A;  2XQZ A;  3CMZ A;  1JWP A;  3W8K A;  4CPK A;  3IF5 A;  3ZNY A;  3ZDJ A;  2EX2 A;  1K57 C;  3RJU A;  4OLD A;  3D4F A;  4KEN B;  3C7V A;  3P09 A;  1K55 C;  4FH4 A;  2G2U A;  3BFD A;  5EVI C;  4MNR A;  1O07 A;  4A5R A;  2EXB A;  4OQI A;  4ZJ3 A;  4S2M A;  2Y91 A;  2EFU A;  3VOY A;  3ZVW A;  3NIA A;  1S0W A;  1NXY A;  2Z2M B;  2ZQ8 A;  3A3J A;  1JVJ A;  3V3R A;  1NYM A;  4E6X A;  4ZDX A;  1BUL A;  3UPN A;  1HD8 A;  3SH7 A;  1G68 A;  1GHP A;  2ZC5 B;  1Q2P A;  3O86 A;  4DE3 A;  1EWZ A;  1H8Y A;  5F82 A;  4Y0T A;  3HBR A;  2FFF B;  4ZBE A;  4QJG A;  1N4O A;  3Q1F A;  4DRT A;  1K54 C;  1SCW A;  3GVB A;  4UA7 A;  1JTG A;  3MBZ A;  3OCN A;  3RXW A;  3OCL A;  1L0F A;  2Y2H A;  5E2H A;  2R9W A;  4IED A;  1NY0 A;  4OQG A;  3RXX A;  1XX2 A;  1WYB A;  4LEN A;  4S2I A;  3ZGA B;  3HUM A;  1ES5 A;  4KZ3 A;  4MBH A;  3OC2 A;  4R23 A;  4DF6 A;  3PAE A;  1GCE A;  2C5W B;  2Y55 A;  4QY6 A;  2HP5 A;  2X02 A;  1RP5 A;  3GSG A;  4MLL A;  4QB8 A;  5JYP A;  1CEG A;  5HAR A;  3VFF A;  2VGJ A;  3TOI A;  2WZX A;  2E8I A;  4N1H A;  1BLS A;  3MKE A;  2JCH A;  4FCF A;  3AGF A;  4IVI A;  2Y59 A;  4JF4 A;  4JXW A;  1IYS A;  1GHM A;  1XA7 A;  1XGI A;  4S2N A;  5TR7 A;  5EPH A;  1L0D A;  3O87 A;  5U47 A;  5F1F A;  1DJA A;  3ITB A;  5A93 A;  2ZQD A;  4Q8I A;  5I94 A;  5EVI D;  4U3T A;  5HW3 A;  4KZ7 A;  4LV1 A;  4N9K A;  2ZM2 A;  4EWF A;  1KDW A;  4LV0 A;  3N6I A;  5CGX A;  2WGW A;  2ZQ7 A;  4OOL A;  2ZM8 A;  2H5S A;  1CI9 A;  3G30 A;  5DTS A;  5D3O A;  3WS4 A;  4S2P A;  5A91 A;  1FSW A;  3BEB A;  1YLZ A;  5EOO A;  1K4E A;  1QME A;  2RCX A;  4IVK A;  4YFM A;  3ZVT A;  1IYP A;  5TFQ A;  2V2F F;  4MBK A;  4LCM A;  2XF3 A;  4NET A;  5EVL A;  2FFY A;  4KZB A;  1K56 D;  1QMF A;  3IXG A;  3IH8 A;  5GHX A;  2X01 A;  4JXG A;  3V3S A;  3MXR A;  2WGW B;  3ZFZ A;  4QU3 A;  2Y2L A;  2PU2 A;  4C6Y A;  3G31 A;  1W8Q A;  2VGK A;  3SS4 A;  3C5A A;  1SDE A;  4PMA A;  2OSU A;  5CGS A;  3M2J A;  4WYY A;  1XXM A;  4GD6 A;  1ES2 A;  3IH9 A;  3V5M A;  4QY5 A;  5DF7 A;  3BFC A;  4XUZ A;  4EBN A;  5EUA A;  3FZC A;  3OZH A;  1TDL A;  4M3K A;  4OP5 A;  1BTL A;  4OOY A;  4OP8 A;  4B88 A;  1YMS A;  5HAQ A;  4P0M A;  3GTC A;  3TSG A;  1W7F A;  3EQV A;  4OQ0 A;  1HTZ A;  2QPN A;  4R3J A;  1PW1 A;  3Q7Z A;  3IQA A;  2BG1 A;  3DWK A;  3G32 A;  3CG5 A;  3HL9 A;  4P87 A;  1PI5 A;  3IT9 A;  4K0X A;  4KQQ A;  5FQJ A;  3HLB A;  3IWQ A;  4PM9 A;  1RGZ A;  1DY6 A;  1IEM A;  1DJB A;  4GN2 A;  5F83 A;  4RA7 A;  5KMW A;  2V1Z A;  1K4F A;  3PBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...