4Z9QA

Crystal structure of oxa-58 with disordered active site
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
242
structure length
223
Chain Sequence
SIIDQNVQALFNEISADAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFIANALIGLENHKATSTEIFKWDGKPRTVPVYQELARRIGPSLMQSELQRIGYGNMQIGTEVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQQVKEMLYVERRGENRLYAKSGWGMAVDPQVGWYVGFVEKADGQVVAFALNMQMKAGDDIALRKQLSLDVLDKLGVFHY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase OXA-58
publication title Crystal structure of OXA-58 with disordered active site
rcsb
source organism Acinetobacter baumannii acicu
molecule tags Hydrolase
total genus 68
structure length 223
sequence length 242
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4z9qA00
2IWDA 2PU2A 4N9LA 3TOIA 4GOGA 4LCLA 3SH9A 2XEPA 4DE0A 3IHBA 4UHUA 3O87A 5CRFA 1IELA 1K25A 2WGVA 1ZG6A 3MKFA 4JXSA 5GLBA 3ZVWA 1YLWA 1W8QA 4LCMA 3MXSA 3VP4A 3HLGA 4OQ0A 5CTNA 4E3MA 5JYOA 4WM9A 1ERQA 5FAQA 1L2SA 3PAEA 3HLDA 1TDGA 3GTCA 3E2LA 2X01A 3W4PA 1RGYA 5E2HA 4JBFA 4DDSA 3N8RA 1XA7A 2WZXA 4S2IA 3EQVA 4BD0A 3VSKA 5DF8A 3S4XA 2XGNA 4XUZA 3FKWA 3G4PA 3FKVA 3G30A 4HESA 3WS0A 3DWZA 3HVFA 3A3DA 5GHYA 4U0TA 3CMZA 3NDEA 3AGEA 5F82A 5E2EA 3LO7A 1K4EA 4WYYA 3O88A 3JYIA 3NCKA 3NC8A 1DY6A 4RX2A 4S2MA 1JWZA 5EOEA 5IHVA 4WMCA 5E2FA 4HEFA 1MBLA 2ZC3B 3Q07A 5F1GA 5CERA 3ZHHA 4BQMA 4GD6A 4M3KA 4X53A 3Q82A 3QHYA 3G31A 4YFMA 4YINA 3IXHA 2Y2PA 1K55C 4MBFA 4D2OA 2OLVA 2ZQ7A 1YMSA 3W4QA 5FQJA 5DVAA 2BG1A 4KENB 3D4FA 1HVBA 3UN7A 2WKIA 2XD1A 3IF6B 5JYPA 2C5WB 3Q7VA 1FR1A 4R0QA 3GMWA 4R4SA 3RJUA 4E3LA 1WYBA 3UPNA 4OPQA 4MEZA 1QMFA 4RYEA 3NIAA 1ES2A 1TEMA 2X02A 5M18A 1H8ZA 5AQ7A 1PIOA 3V3SA 1Z6FA 1KVMA 1YT4A 4GDBA 2WGWB 3M6BA 2WAFA 4S2PA 4BD1A 4WZ5A 3UE1A 3O86A 5EE8A 1MWRA 4QB8A 3UY6A 2WZZA 1EWZA 4DXBA 3SH8A 3N8SA 2ZQAA 4R1GA 1GCEA 2ZD8A 3GQZA 2JCHA 1ZKJA 4KZ3A 4OP8A 5EVIC 3NDGA 4DKIA 4R4RA 5A91A 5CEBA 3PTEA 3QNBA 3VFFA 2Y2QA 4DRTA 2QZ6A 1N4OA 2Y91A 4DE3A 1IYQA 4WBGA 3ZG8B 1K56A 5CEDA 1PZPA 2G2WA 4FCFA 3C5AA 1C3BA 2ZQ9A 1I5QA 4KZ7A 5HFOA 4GN2A 3PBNA 2ZM0A 4OOLA 5CGWA 5M1AA 4ZJ3A 1BLPA 1XXMA 1M40A 1L0EA 1YM1A 4KZ4A 3SS3A 3ZVTA 1QMEA 5EPHA 4KZAA 2H10A 1K56D 2OV5A 4IBXA 1JTDA 3BFEA 2HDSA 4KG5A 2RCXA 4E3OA 5AQ9A 4UAAA 4EBLA 4KQOA 1M6KA 1KE3A 3PBSA 3Q7VB 5E2GA 5HW3A 4MNRA 4O7DA 3BFCA 4L0LA 5E43A 2V20A 3VOYA 1AXBA 1ES4A 2ZM2A 4WEJA 2B5RA 1IYSA 4KZ9A 3GV9A 3Q81A 4DXCA 3C7UA 3IWOA 4E3JA 3WS1A 1G6AA 4UA9A 3TG9A 3OC2A 3ZFZA 5HAIA 3VOZA 4Q8IA 1KDSA 2EFXA 5HAQA 2QMIA 3VP0A 1E3UD 1RCJA 2I72A 2Q9MA 5FQIA 3UO9A 3CJMA 2R9XA 4BENA 1K57C 1FCOA 1Q2QA 4JXGA 2DCFA 3MBZA 1IYPA 5GL9A 2HDUA 4LV1A 1IKGA 2WKHA 2Y2OA 3HLCA 2WKEA 1ZG4A 4DDYA 2XK1A 1HTZA 3MFDA 1CI9A 4N92A 4KG6A 1FQGA 5FATA 3C7VA 3BFGA 1BLHA 3A3JA 4JLFA 4KQQA 4ZTKA 1RP5A 2E8IA 1DJAA 2ZJ9A 1NJ4A 1PW8A 4EV4A 2EFUA 2Y59A 2XH9A 3HBRA 3AGFA 1PWCA 4GD8A 5HAPA 5EVIA 1FSYA 1BT5A 2X71A 1YLPA 4ID4A 2Q9NA 1E25A 1XP4A 2Y2LA 3IF6A 1DJBA 2R9WA 3CG5A 4XUXA 1ZC2A 2OSUA 2Y2JA 4MBHA 4WEKA 2V2FF 5EVID 3LY3A 4JF4A 4B4ZA 3VFHA 4OH0A 3HL9A 5HL1A 1NZUA 1MWUA 2WGWA 2ZM8A 2XFTA 2ZMAA 2Y2IA 1PI4A 2HP5A 3ZGAB 3VSLA 3Q7ZA 4PM9A 5FI7A 4KG2A 4CPKA 2XR0A 5FI6A 3ZG5A 1BLSA 4ZDXA 3IXDA 2J8YA 2P74A 4LV0A 4K0XA 4X56A 1GA9A 3IHAA 5FQ9A 1PWGA 4N1XA 4P6BA 5I94A 3CZDA 1BSGA 2WAEA 1ONHA 3BLMA 5F83A 2XFSA 1E4DA 1YLJA 1L0GA 1KGEA 5DF7A 2HDQA 1SDNA 4DF6A 4EUZA 3FV7A 3GRJA 5FDHA 5EVIB 1TDLA 4OP5A 1K54A 2H0YA 2ZQCA 1HZOA 1RGZA 1S0WA 1K57A 2H5SA 1H5XA 2JBFA 4JPMA 3V39A 1O07A 1BLCA 3MXRA 3UPPA 2JC7A 3V3RA 4E6XA 4QU3A 4S2JA 4U3TA 2DNSA 2Y2NA 3M2KA 2PU4A 5CHJA 4RVAA 3W8KA 5FSRA 3HUMA 3VMAA 1IKIA 4MLLA 4QY5A 4X68A 1HD8A 1CI8A 2EX2A 1FCMA 1IYOA 4GDNA 4LV3A 3DW0A 2ZQDA 4LV2A 4U0XA 2EX6A 4Y0UA 4N9KA 5A90A 1MWSA 4GKUA 2EX8A 3C4OA 2HPBA 3VP1A 4C3QA 3G2YA 5BOHA 3DTMA 4OQIA 2WK0A 2J7VA 1EROA 2XF3A 5J8XA 5CGXA 1XA1A 2GDNA 5KSCA 4JXVA 3WS2A 5G18A 5CHUA 4EBNA 3OPPA 2HDRA 3LCEA 3S22A 2XDMA 1ALQA 3UNWA 5CECA 3ZG0A 1CK3A 2V1ZA 4NETA 1CEGA 1XGJA 1ES3A 1YLTA 2FFYA 3UE3A 3FZCA 3BECA 3NY4A 5FA7A 3A3FA 3WWXA 3N4IA 3LEZA 1W79A 1MKIA 1G68A 4FH4A 4IVKA 5EUAA 4Y0TA 5A92A 3PBRA 4PM8A 1NY0A 2WGIA 1MXOA 4N1HA 3ZG7B 5L2FA 1O7EA 4OQHA 5EOOA 1S6RA 4FD8A 1E3UA 5FI2A 3UE0A 5GLDA 4X6TA 4PMAA 3MKEA 4K0WA 5M19A 3HLEA 1KGFA 1VQQA 4PPRA 1MY8A 4X55A 3QNCA 1KDWA 4A5RA 4E3NA 5EVLA 1K55A 2EX9A 3HLBA 2HP9A 3IF5A 1ESUA 4E6WA 5HX9A 3S1YA 4C75A 5AQAA 3PAGA 3LY4A 1Q2PA 5CHMA 2WYXA 4E3IA 1VM1A 3P09A 1EI5A 5CXWA 2ZC6B 4QY6A 3WS5A 3M2JA 4BLMA 3RXWA 3FYZA 2Z2MB 1K6RA 3G32A 4GNUA 4JXWA 1SCWA 2WUQA 3TSGA 4H8RA 2Y2GA 4OQGA 3OPHA 3OPLA 1NYYA 4ZBEA 1KVLA 3VP2A 4B4XA 3G2ZA 3MZDA 5KZHA 4PM7A 1SKFA 4PM6A 2EXBA 4OONA 1GHPA 4OPRA 4P85A 1XKZA 3W4OA 4OPYA 2G2UA 3V50A 1LL9A 3PBOA 4KZBA 1PZOA 2UWXA 4QD4A 1FR6A 3IXGA 1PYYA 3IQAA 4S2NC 1H8YA 1LLBA 3WS4A 4WZ5C 1BUEA 1LI9A 4GB7A 5DTKA 2J9OA 4R23A 5D3OA 4QJGA 1KGGA 4RA7A 1IEMA 1Y54A 3ZG9B 5GHXA 1MWTA 1FSWA 3GSGA 4GZBA 5DTSA 4WELA 2QPNA 1WYCA 4KZ6A 5AQBA 3IWQA 4IVIA 3GR2A 3P98A 2Y2HA 4Y0OA 3O3VA 4OOYA 3N8LA 3WRZA 2ZC4B 3BFDA 1W7FA 3SOIA 3N6IA 4WZ4A 3ITBA 4UA6A 4F94A 4Y7PA 1LI0A 1PWDA 4X69A 1LL5A 1NXYA 2A49A 1GHMA 4ZAMA 2IWBA 2EXAA 3BEBA 3SS4A 1N9BA 4ZJ2A 3IH8A 3IXBA 3VP3A 4OLDA 4CJNA 1SHVA 3A3EA 1ESIA 3DWKA 3OCLA 2HP6A 1NZOA 3A3IA 1OMEA 2P9VB 4R3JA 2A3UA 3ISGA 2XQZA 5FASA 4S2KA 3UDFA 4P0MA 3E2KA 2Y2KA 4OPZA 4DE2A 4NK3A 2Y4AA 3MZFA 1CEFA 4RX3A 1ONGA 3BYDA 4DE1A 1WE4A 1U60A 4P87A 4HBUA 4WMCD 5FAPA 1YLZA 2VGJA 4JF6A 5FQKA 3PBTA 4OLGA 4OVDA 4B88A 1GA0A 4UA7A 5FQMA 3V5MA 3IT9A 1KE0A 1YQSA 4JKTA 1I2WA 5TFQA 1NYMA 2RL3A 2Y55A 5KMWA 4Z9QA 2XD5A 1PI5A 5CTMA 5U47A 1W5DA 1W8YA 4HBTA 5GLCA 3UPOA 5KSHA 2J9PA 3M6HA 4S2NA 2JE5A 4S2LA 1MPLA 1K6SA 1L0FA 3BRMA 5TGFA 4BL3A 1XX2A 5CGSA 3SH7A 2ZC7A 4KZ5A 3MZEA 3Q1FA 3IH9A 3ZNTA 1L0DA 1SDEA 5EECA 3IF6C 4LENA 5TR7A 4R3BA 2C6WB 2BLSA 3RXXA 4KZ8A 4S2OA 1BULA 2CC1A 5DF9A 4FH2A 3OCNA 2IWCA 2OLUA 4EWFA 1YLYA 2ZC5B 1PW1A 1BTLA 3BFFA 1JTGA 1ES5A 3EQUA 4EQIA 1FCNA 4BJPA 3ZCZA 1NRFA 2ZLYA 2Y2MA 1KE4A 3G34A 3ZDJA 4C6YA 4E3KA 3UDXA 1I2SA 3N7WA 3HLFA 1K4FA 4PM5A 4MBKA 3BM6A 5FAOA 3BLSA 3OPRA 4OOMA 3HLWA 5HARA 1JWPA 1K38A 4BL2A 5F1FA 2WADA 4JF5A 1DJCA 3NBLA 3I7JA 4FSFA 1TVFA 3HUNA 1XGIA 4KQRA 1GHIA 2Z2LB 4OKPA 3C4PA 3ITAA 2VGKA 2FFFB 1FOFA 1LHYA 5DTTA 1JWVA 2XLNA 3IWIA 4QHCA 1JVJA 1K54C 3G35A 3OZHA 3PBQA 4K91A 5GHZA 1BZAA 2ZQ8A 5GLAA 1J9MA 2PBYA 5A93A 2H0TA 3ZNYA 3HUOA 4EBPA 3FWLA 3SS5A 3UDIA 4XXRA 4IBRA 3WRTA 4IEDA 1YMXA 1XPBA 3AGDA 3B3XA 3GVBA 4ZJ1A 1ERMA 2P9VA 3NI9A 5FQQA 3HREA 2DRWA
chains in the Genus database with same CATH superfamily
4N9LA 2XEPA 3CUEC 1K25A 3MKFA 3ZVWA 1YLWA 4XT2B 3MXSA 5CTNA 1OTDA 3BQAA 5FAQA 3HLDA 3GTCA 4NG2A 3W4PA 3MF0A 4DDSA 3N8RA 3QP1A 1XA7A 3EQVA 3VSKA 3S4XA 2XGNA 3LIFA 4FOFA 4HESA 3T1RA 2GJ3A 3AGEA 2K31A 3C30A 1DY6A 5E2FA 1MBLA 1VEUB 3NECA 2KX6A 4H6JA 1K55C 1V9ZA 1D1JA 4MBFA 2ZQ7A 5FQJA 5DVAA 2JN7A 3D4FA 3IF6B 2C5WB 4E3LA 4R0QA 4I3IA 4R4SA 3RJUA 3UE6A 3GECA 1WYBA 3C8CA 3UPNA 2FH5A 1TEMA 4EESA 3E0YA 2YKHA 4MMNA 1YT4A 3M6BA 4S2PA 3UY6A 3O86A 5EE8A 3QP4A 1JNUA 4DXBA 3SH8A 3DTIA 1GCEA 2ZD8A 1WA9A 1ZKJA 2VV8A 2O0YA 2W3GA 3PTEA 4Y3IA 2Y2QA 4WBGA 5HD5A 4FCFA 2ZQ9A 1I5QA 2KOIA 5HFOA 3FC7A 1OT9A 1L0EA 3ZVTA 5EPHA 1AWIA 2H10A 1K56D 4R3AA 1JTDA 2RCXA 4UAAA 2PD7A 3T4JA 5HW3A 4O7DA 2B02A 2V20A 1AXBA 3Q81A 4DXCA 2XA7M 3CHWP 4UA9A 3CWFA 3ZFZA 2EFXA 2QMIA 3KO6A 1XJ4A 4Z1WA 5TBMA 2HDUA 3JVUA 4GHIA 4LPZA 3T4QA 4GS9B 4BBVA 1FQGA 4KQQA 2E8IA 4AFIA 2ZJ9A 2GNXA 4WLAA 5FDSA 3AGFA 4GD8A 2OAQ1 1OTBA 4ID4A 2Y2LA 2INWA 3OOVA 2Y2JA 1S1YA 4MBHA 4B4ZA 3VFHA 4OH0A 1N9OA 4M4XA 3L9KA 4DJ3A 3VSLA 3Q7ZA 1VETB 3UB5P 2XR0A 5FI6A 1BLSA 3IXDA 4LV0A 4LRXC 3IHAA 2ZOHA 4ETZA 1BSGA 5F83A 3A0VA 5DF7A 2HDQA 4HIAA 2H0YA 3V39A 1BLCA 3UPPA 3MSHA 4HP9A 4QU3A 4S2JA 3M2KA 1DP9A 4RVAA 3W8KA 5FSRA 4MLLA 4R38A 3KYQA 4X68A 4GDNA 3DW0A 3MQQA 2ZQDA 4LV2A 4Y13A 4Y0UA 2V0WA 1MWSA 4UEYA 2EX8A 3C4OA 3DTEA 2HPBA 2I9VA 5DJTA 1K0KA 5J8XA 5CGXA 2GDNA 2M7VA 5CHUA 3OPPA 2XDMA 3MFXA 3UNWA 4MN5A 2XA7S 4BWIA 3UE3A 5AJGA 3FZCA 4ME4A 1W63M 4FH4A 4PM8A 1TD5A 1O7EA 2PDRA 3IBRA 4IUHA 3UE0A 4PPRA 2J3TD 2H28A 3HLBA 3HJKA 4E6WA 2WYXA 3NOTC 1F98A 4JGPA 2J80A 2WUQA 3RTYA 1NYYA 4ZBEA 1KVLA 3VP2A 3G2ZA 3LGOA 4HJ4A 5HZHA 4OONA 1BYWA 3H82A 2LB5A 1LL9A 1PZOA 1H8YA 3WS4A 4WZ5C 4X1LA 5DTKA 5D3OA 3S7QA 1N9LA 2KDKA 2GX5A 4QPRA 2QPNA 4KZ6A 2FZ0A 2W3DA 2Y2HA 2YKFA 4OOYA 3WRZA 3SOIA 3N6IA 3PHYA 4F94A 1DRMA 1NLZA 1NXYA 3LYXA 4ARZB 4HJ3A 3DWKA 3OCLA 2HP6A 4IJGA 4S2KA 3T4KA 1SKOB 2Y8HA 4NK3A 2Y4AA 3F1OB 1YSQA 2W3FA 3MZFA 1CEFA 4RX3A 1YAXA 2GZAA 1U60A 4P87A 4PHTA 5FQKA 2VGJA 4B88A 1I2WA 1NYMA 4NXFA 5CTMA 3LI8A 4CLCE 3UPOA 3W2ZA 5IU1A 3NJAA 2J9PA 2JE5A 4S2LA 1L0FA 1ZTUA 2ZBBA 5TGFA 1XX2A 1L0DA 4EW7A 1Y4OA 3E4PA 5IT5A 5TR7A 1TS8A 2BLSA 3RXXA 4KZ8A 2OLUA 4EWFA 5K5BA 3KSIA 4HOIA 4Y5FA 1JTGA 1ES5A 2L0WA 4P6ZS 3B42A 1FCNA 3ZCZA 2ZLYA 1KE4A 4C6YA 3UDXA 1I2SA 3VE3A 3HLFA 3ZQ5A 4PM5A 4MN6A 4NKPA 4JF5A 3MR0A 4FSFA 1TVFA 4KQRA 2Z2LB 3ITAA 1S67L 2VGKA 5DFXA 2FFFB 1FOFA 1LHYA 2XLNA 1JVJA 3PBQA 4K91A 3D9YA 2ZQ8A 3CI6A 3UDIA 4IBRA 4O8GA 1YMXA 1ERMA 4I5SA 2DRWA 2IWDA 3CITA 4LCLA 2O99A 1YSPA 4NXEA 3IHBA 1ZG6A 4OQ0A 4E04A 3NHQA 4E3MA 1ERQA 1L2SA 5DKKA 5I5LA 5E2HA 4JBFA 2WZXA 4S2IA 2Q0OA 3BQ8A 5DF8A 3H9WA 3WS0A 3DWZA 3A3DA 3CMZA 3NDEA 5F82A 1UWPX 5E2EA 4WL9A 3LO7A 4F3LB 5IHVA 1JWZA 3D72A 2ZC3B 3Q07A 4M3KA 4X53A 3Q82A 3BY9A 3T50A 5L8MA 3W4QA 2A24B 2XD1A 1TS6A 1FR1A 3T1QB 1H8MA 3LR3A 3P01A 1QMFA 1ES2A 1F2KA 5M18A 4EQ1A 3IBJA 5HWWA 1XJ3A 5L10A 1MWRA 2WZZA 1EWZA 3N8SA 4O01A 3UB6A 5EVIC 4OP8A 4DKIA 2M1CA 4DRTA 2Y91A 3ZG8B 5IS1A 1P9WA 1C3BA 3TW8A 3CPTA 4CLCB 4OOLA 2VZWA 2ZM0A 5CGWA 4ZJ3A 3RH8B 1Z09A 2W1TA 3T4TA 3BJNA 4EBLA 3PBSA 4XT2A 1ES4A 3UB7A 4KZ9A 3IX8A 3WS1A 3BWLA 1G6AA 5HAIA 4Q8IA 2G7UA 2PT7A 2I72A 2Q9MA 3B47A 2UV0E 4JXGA 3MBZA 1H0MA 5A8BA 4RQ9A 4LV1A 3UMEA 4DDYA 1CI9A 4EETB 5J7EA 1STZA 5FATA 1VEUA 1T1BA 3PYPA 1PW8A 2W1TB 4EV4A 2Y59A 3E4QA 2JKTM 5C5KA 1PWCA 5EVIA 1FSYA 2OWHA 2JKGA 5TJJA 1YLPA 1XP4A 2Q9NA 3IF6A 1DJBA 3CG5A 4WEKA 2K2NA 4GCZA 5HL1A 1LSWA 1NZUA 2QWSA 3EGDC 2ZMAA 1PI4A 3ZGAB 2PR5A 4PM9A 4ZRRA 4CPKA 3ZG5A 4X56A 4R70A 1PWGA 4N1XA 5I94A 3CZDA 1YPRA 3BLMA 1KGEA 3LR4A 3FV7A 5L07A 4PKYA 5EVIB 4OP5A 1RGZA 1S0WA 2H5SA 3KYZA 4E6XA 3V3RA 3KSFA 4FTXA 4NEED 4LLOB 3VMAA 4KUKA 1FCMA 4DN0A 2D02A 4LV3A 4GKUA 3CUEA 4NXBA 2QJ7A 3VP1A 4C3QA 4JGRA 5LBRA 1XA1A 4JXVA 3WS2A 5G18A 4EBNA 2V0UA 2HDRA 4GS9A 5G4ZA 2ZL1B 1ALQA 3ZG0A 4NETA 1CEGA 3RFBA 1YLTA 2FFYA 3N4IA 3LEZA 4II7A 1W79A 4LGWA 1MKIA 2JKRM 2P04A 3H7WA 1NY0A 2WGIA 2WKPA 1S6RA 4NXGA 5GLDA 4G3WA 4K0WA 2OOLA 2L4RA 2K7SA 4X55A 1KDWA 1Y28A 5EVLA 1K55A 3IF5A 1VETA 4E3IA 3LY4A 5CHMA 3FG8A 3LIDA 3P09A 1EI5A 3UB8A 5AVFA 4BLMA 4GNUA 3TSGA 3KYEA 4OQGA 1IOUA 3MJQA 4PKYG 4B4XA 1S1ZA 2W3EA 5KZHA 4PM7A 3H7WB 2EXBA 4OPRA 3TE8A 4EU0A 4G3VA 3W4OA 4KZBA 4QD4A 4MDZA 3IQAA 2M7UA 2J9OA 1LT0A 1MC0A 4Y17A 1KGGA 4RA7A 1MWTA 4GZBA 2AVXA 1WYCA 3O3VA 3N8LA 3ZYTA 2ZC4B 4UA6A 4Y7PA 1LI0A 1LL5A 4IHQA 2EXAA 3BEBA 2VKSA 3IH8A 4B93A 3IXBA 1S4SA 4CJNA 5CX7A 1ESIA 2P9VB 3S7NA 3SW1A 3QP6A 3NULA 3CAXA 4OPZA 1L3LA 2VV7A 4JKTA 5FEFA 2Y55A 1SZVA 1LSVA 3EEHA 1W5DA 1W8YA 2ACGA 1OTAA 1K6SA 3BRMA 4IUKA 4BL3A 1S66L 3ZNTA 1SDEA 5EECA 4HY8A 4R3BA 1BULA 2CC1A 2DMWA 2V8CA 1YLYA 1BTLA 5DKLA 3EQUA 4EQIA 4BJPA 2Y2MA 3U2AA 5J4EA 2A2LA 1K4FA 5HARA 3OPRA 4OOMA 1OTEA 3I7JA 4OKPA 3C4PA 4P6ZM 5DTTA 4MCWA 1JWVA 1MZUA 1K54C 5GHZA 1PFLA 3P7NA 3ZNYA 4ARZA 3FWLA 3AGDA 1XJ2A 3OLOA 4ZJ1A 3NI9A 1NLYA 4I3JA 4G3KA 1SKOA 2PRFA 4GOGA 1DP8A 3SH9A 3F1OA 5HWTA 4UHUA 4HJ6A 4JXSA 5GLBA 2CMNA 1W8QA 4LCMA 3VP4A 3HLGA 2HZ5A 3PAEA 1D06A 2Z6CA 5KIZA 2W1RA 2W3HA 4QWOA 4BD0A 4XUZA 3FKWA 3G30A 2VEAA 4WYYA 3D3OA 2J3TC 3JYIA 3NCKA 3NC8A 4RX2A 5EOEA 4HNBA 4BQMA 5F1GA 5CERA 1OPXA 2XRNA 3QHYA 4Q0JA 3G31A 2Y2PA 5HL6A 2OLVA 3R7WB 3T12B 4B9OA 4Y2FA 2BG1A 3VV4A 1F9IA 1HVBA 4WUJA 2WKIA 3GMWA 5G4YA 2VGLS 4OPQA 4MEZA 4RYEA 3NIAA 1H8ZA 3V3SA 1PIOA 1Z6FA 1T19A 4GDBA 2WGWB 2WAFA 3BW6A 1NWZA 2W0NA 4WZ5A 4QB8A 5MC7A 3DBAA 3G6OA 4R1GA 3GQZA 2JCHA 4KZ3A 3NDGA 5A91A 3PXPA 2QZ6A 1N4OA 4WF0A 4DE3A 1IYQA 2L1MA 1PZPA 2G2WA 3C5AA 4KZ7A 5FL3A 3PBNA 5FEGA 3SS3A 4HQAA 1QMEA 2Z6DA 4IBXA 2OV5A 2HDSA 4E3OA 2J3WA 4KQOA 1KE3A 5E2GA 4MNRA 4L0LA 5E43A 3MXQA 1IYSA 2BASA 3B33A 3GV9A 3IWOA 4CLCC 1GSXA 4X25A 3TG9A 3OC2A 5HAQA 3IX3A 3E98A 3VP0A 3UO9A 1RCJA 3CJMA 2R9XA 2VV6A 2OWJA 1Q2QA 2PYRA 5GL9A 1IKGA 2Y2OA 2QYBA 2WKEA 1ZG4A 1P9RA 1HTZA 3MFDA 4F3LA 1EW0A 4KG6A 3F1PB 1BLHA 1RP5A 1DJAA 1NJ4A 1FIKA 4YNRA 1BT5A 2X71A 2A24A 2R9WA 3S7OA 2OSUA 5EVID 3LY3A 5HD3A 1V9YA 2Y2IA 3F1NB 5FI7A 2J8YA 2P74A 5FQ9A 1GA9A 3TRCA 4HHDA 3EOIA 4CLCA 1SDNA 4DF6A 3GRJA 4LRZE 5FDHA 4YOFA 3TJZC 2ZQCA 1HZOA 4JPMA 1H5XA 2JBFA 1OTIA 4KQDA 3MXRA 2O9AA 4U3TA 1X0OA 2Y2NA 2PU4A 5CHJA 3HUMA 1IKIA 4QY5A 1KOUA 5HPFA 4ETXA 2EX2A 1IYOA 2EX6A 3NOUC 1P0ZA 3G2YA 5BOHA 3DTMA 2WK0A 2XF3A 1EROA 5KSCA 2ZMVA 3S22A 5CECA 1CK3A 2V1ZA 1XGJA 1ES3A 3K2NA 5EVEA 3NY4A 4HI4A 4Q0IA 1G68A 5EUAA 5A92A 3PBRA 4GLQA 3ZG7B 4Y15A 2W27A 5EOOA 4FD8A 4EERA 5FI2A 4X6TA 4PMAA 3HLEA 1KGFA 1MKMA 1S4RA 1VQQA 2EWVA 1MY8A 3QNCA 4A5RA 4E3NA 3FPVA 2HP9A 1ESUA 3LIAA 5AQAA 3PAGA 3DAVA 1T1AA 5HWVA 5CXWA 2ZC6B 4QY6A 1TF1A 3K3DA 3WS5A 3M2JA 2Y79A 2Z2MB 1SCWA 4H8RA 2Y2GA 4EUVA 5F68A 2JKFA 4P85A 1XKZA 4OPYA 3V50A 3PBOA 3K3CA 2UWXA 1FR6A 4BBTA 1DP6A 4S2NC 2IA2A 2VJWA 4PAUA 4R23A 4WN5A 4QJGA 4Q0HA 1IEMA 1Y54A 3ZG9B 5GHXA 1FSWA 5AQBA 3IWQA 4IVIA 4LFUA 3P98A 1ZHHB 3QP8A 4WZ4A 2ZL1A 2VK3A 4X69A 1GSVA 1GHMA 4ZAMA 2D01A 2IWBA 3SS4A 1N9BA 3T1SA 4ZJ2A 4OLDA 3S7PA 1G6OA 1SHVA 3QP2A 3A3IA 1OMEA 2A3UA 5FASA 2XQZA 3UDFA 2Y2KA 3LEQA 3BYDA 5FAPA 4WMCD 1YLZA 4JF6A 4OLGA 4OVDA 5FQMA 3V5MA 3IT9A 1YQSA 3R4KA 5F6AA 5TFQA 2RL3A 4Z9QA 1PI5A 5U47A 3EEAA 5GLCA 3IX4A 4DJ2A 5KSHA 4S2NA 2MJ6A 5CGSA 3SH7A 2ZC7A 3T4SA 2ZOIA 4KZ5A 3LR0A 1P97A 4HP4A 2C6WB 4S2OA 3OCNA 3KSGA 3E4OA 3C38A 1PW1A 2HJEA 4H6JB 4MN7A 3G34A 4E3KA 3UB9A 3BM6A 4GJ4A 3BLSA 5FAOA 4BL2A 2WADA 2E8JA 1DJCA 3NBLA 1LL8A 4CQHA 1XGIA 1GHIA 3CLOA 2OAP1 4QHCA 5F5YA 1J9MA 2PBYA 5A93A 3HUOA 3ULFA 4EBPA 2ZMFA 3SS5A 4XXRA 3WRTA 4IEDA 4L9FA 1XPBA 2P9VA 1HLUP 4EEPA 2PU2A 3TOIA 4DE0A 3O87A 5CRFA 1IELA 2WGVA 1OJ5A 3T4LA 2B18A 4WM9A 5JYOA 1TDGA 3E2LA 4L9GA 2X01A 1RGYA 4UQIM 3C2WA 1G28A 3BY8A 3G4PA 3FKVA 3VOLA 3HVFA 5GHYA 5TBMB 4U0TA 4K08A 4GHIB 1A0KA 1K4EA 2V1BA 3O88A 2VX8A 5EFWA 4S2MA 4WMCA 4HEFA 3ZHHA 1UGUA 3A0SA 4GD6A 4BBUA 3JVVA 4YFMA 4YINA 3IXHA 4D2OA 1YMSA 5DJUA 4KENB 3UN7A 5JYPA 1FILA 2B95A 3Q7VA 2XSSA 3ICYA 2X02A 5HPIA 5AQ7A 1KVMA 2O9CA 5HDDA 4BD1A 2R78A 3UE1A 1OT6A 2ZQAA 4X1MA 5EV0A 4R4RA 4L9EA 5CEBA 1T18A 3QNBA 2VGLM 3VFFA 4D60A 1K56A 5CEDA 3OBFA 4GN2A 5M1AA 1BLPA 1XXMA 1M40A 1YM1A 4KZ4A 4KZAA 3BFEA 1NRJA 4KG5A 5AQ9A 1M6KA 3Q7VB 3T4OA 3BFCA 1W63Q 3VOYA 5HDSA 2ZM2A 4WEJA 2B5RA 3C7UA 4BMWA 1TS0A 4E3JA 3VOZA 1KDSA 2VLGA 2V8FA 3KX0X 1E3UD 5FQIA 4BENA 2JKTI 1K57C 1FCOA 1N9NA 2HF6A 2DCFA 1IYPA 2WKHA 3HCYA 3HLCA 3MQOA 2XK1A 4N92A 3C7VA 3BFGA 4UQIS 3A3JA 4JLFA 2HJ9C 4I39A 2KLIA 1XJ6A 3O5YA 4ZTKA 3GDIA 2EFUA 2JHEA 2XH9A 3HBRA 4HH3A 5HAPA 3R7WA 3LICA 1D7EA 4I38A 1E25A 5DFYA 4XUXA 1ZC2A 2VA0A 2V2FF 4JF4A 3HL9A 5AVEA 1MWUA 2WGWA 4FUWA 2ZM8A 2XFTA 2HP5A 1UWNX 4KG2A 3MS6A 3DTKA 4ZDXA 2V1AA 4K0XA 4O0PA 4P6BA 1J3WA 2WAEA 1ONHA 2XFSA 1CJFA 1E4DA 1YLJA 1L0GA 4EUZA 2QJ5A 1TDLA 1K54A 1K57A 5EM1A 2HGVA 2O9BA 4CLCD 5HSQA 1O07A 3H82B 2LB9A 2JC7A 4YWZA 4ESPA 2DNSA 2PYPA 1HD8A 1CI8A 4U0XA 1PRQA 4N9KA 5A90A 3PR6A 2JKRI 2EWWA 4OQIA 2J7VA 3LCEA 3F1PA 1ODVA 1OJGA 2QHKA 3BECA 5FA7A 3A3FA 2P08A 3WWXA 4IVKA 4Y0TA 2NUPC 3T1XA 1MXOA 4N1HA 5L2FA 4OQHA 1E3UA 3LFVA 1CQAA 3MKEA 5M19A 2WKQA 4LRYC 2PAVP 3LI9A 4HH2A 2EX9A 4I3AA 5EM0A 3F1NA 5HX9A 3S1YA 4C75A 1Q2PA 1VM1A 4JGQA 4R6LA 2PHYA 3RXWA 3FYZA 1K6RA 3G32A 4JXWA 3OPHA 2PBDP 3HJIA 3OPLA 3MZDA 1SKFA 4PM6A 1GHPA 3EWKA 3LIBA 3A0RA 1PNEA 2G2UA 3KSHA 3IXGA 1PYYA 2BTFP 1ACFA 1LLBA 1BUEA 1LI9A 4GB7A 3IS2A 3U4LP 5F69A 4EXOA 2HV1A 1H3QA 2V9AA 3GSGA 5DTSA 4WELA 3LIEA 2PD8A 3GR2A 4Y0OA 3BFDA 1W7FA 5HDCA 3ITBA 3QP5A 1PWDA 2A49A 4DMZA 4JGOA 3VP3A 4KUOA 3EGXC 3A3EA 3VE4A 1NZOA 5J3WA 4R3JA 3ISGA 4P0MA 3E2KA 3IS2B 1VHMA 3SZTA 4DE2A 2XROA 1LSXA 4EEUA 1ONGA 4DE1A 1WE4A 4HBUA 3PBTA 1GA0A 4UA7A 1KE0A 1GSWA 3MQ0A 5KMWA 2XD5A 2EA9A 4HBTA 3M6HA 1MPLA 1F5MA 2NUTC 3LUQA 1TS7A 4GW9A 1G5UA 3MZEA 3Q1FA 3IH9A 3IF6C 4LENA 1XFNA 5DF9A 3NOPC 1CF0A 4FH2A 2IWCA 2ZC5B 3MMHA 1YKDA 3BFFA 3FPWA 1NRFA 3V67A 3ZDJA 2QKPA 3N7WA 2P7JA 3L7HA 4MBKA 1VB6A 3HLWA 5F1FA 1JWPA 1K38A 3UMDA 2WKRA 3HUNA 1T1CA 3IWIA 3G35A 3OZHA 1BZAA 5GLAA 2H0TA 1XFQA 5L09A 3LR5A 3B3XA 3CPTB 3GVBA 3JPUA 1IFQA 5FQQA 3HREA 2PR6A
chains in the Genus database with same CATH topology
2IWDA 2PU2A 4N9LA 3TOIA 4GOGA 4LCLA 3SH9A 2XEPA 4DE0A 3IHBA 4UHUA 3O87A 5CRFA 1IELA 1K25A 2WGVA 1ZG6A 3MKFA 4JXSA 5GLBA 3ZVWA 1YLWA 1W8QA 4LCMA 3MXSA 3VP4A 3HLGA 4OQ0A 5CTNA 4E3MA 5JYOA 4WM9A 1ERQA 5FAQA 1L2SA 3PAEA 3HLDA 1TDGA 3GTCA 3E2LA 2X01A 3W4PA 1RGYA 5E2HA 4JBFA 4DDSA 3N8RA 1XA7A 2WZXA 4S2IA 3EQVA 4BD0A 3VSKA 5DF8A 3S4XA 2XGNA 4XUZA 3FKWA 3G4PA 3FKVA 3G30A 4HESA 3WS0A 3DWZA 3HVFA 3A3DA 5GHYA 4U0TA 3CMZA 3NDEA 3AGEA 5F82A 5E2EA 3LO7A 1K4EA 4WYYA 3O88A 3JYIA 3NCKA 3NC8A 1DY6A 4RX2A 4S2MA 1JWZA 5EOEA 5IHVA 4WMCA 5E2FA 4HEFA 1MBLA 2ZC3B 3Q07A 5F1GA 5CERA 3ZHHA 4BQMA 4GD6A 4M3KA 4X53A 3Q82A 3QHYA 3G31A 4YFMA 4YINA 3IXHA 2Y2PA 1K55C 4MBFA 4D2OA 2OLVA 2ZQ7A 1YMSA 3W4QA 5FQJA 5DVAA 2BG1A 4KENB 3D4FA 1HVBA 3UN7A 2WKIA 2XD1A 3IF6B 5JYPA 2C5WB 3Q7VA 1FR1A 4R0QA 3GMWA 4R4SA 3RJUA 4E3LA 1WYBA 3UPNA 4OPQA 4MEZA 1QMFA 4RYEA 3NIAA 1ES2A 1TEMA 2X02A 5M18A 1H8ZA 5AQ7A 1PIOA 3V3SA 1Z6FA 1KVMA 1YT4A 4GDBA 2WGWB 3M6BA 2WAFA 4S2PA 4BD1A 4WZ5A 3UE1A 3O86A 5EE8A 1MWRA 4QB8A 3UY6A 2WZZA 1EWZA 4DXBA 3SH8A 3N8SA 2ZQAA 4R1GA 1GCEA 2ZD8A 3GQZA 2JCHA 1ZKJA 4KZ3A 4OP8A 5EVIC 3NDGA 4DKIA 4R4RA 5A91A 5CEBA 3PTEA 3QNBA 3VFFA 2Y2QA 4DRTA 2QZ6A 1N4OA 2Y91A 4DE3A 1IYQA 4WBGA 3ZG8B 1K56A 5CEDA 1PZPA 2G2WA 4FCFA 3C5AA 1C3BA 2ZQ9A 1I5QA 4KZ7A 5HFOA 4GN2A 3PBNA 2ZM0A 4OOLA 5CGWA 5M1AA 4ZJ3A 1BLPA 1XXMA 1M40A 1L0EA 1YM1A 4KZ4A 3SS3A 3ZVTA 1QMEA 5EPHA 4KZAA 2H10A 1K56D 2OV5A 4IBXA 1JTDA 3BFEA 2HDSA 4KG5A 2RCXA 4E3OA 5AQ9A 4UAAA 4EBLA 4KQOA 1M6KA 1KE3A 3PBSA 3Q7VB 5E2GA 5HW3A 4MNRA 4O7DA 3BFCA 4L0LA 5E43A 2V20A 3VOYA 1AXBA 1ES4A 2ZM2A 4WEJA 2B5RA 1IYSA 4KZ9A 3GV9A 3Q81A 4DXCA 3C7UA 3IWOA 4E3JA 3WS1A 1G6AA 4UA9A 3TG9A 3OC2A 3ZFZA 5HAIA 3VOZA 4Q8IA 1KDSA 2EFXA 5HAQA 2QMIA 3VP0A 1E3UD 1RCJA 2I72A 2Q9MA 5FQIA 3UO9A 3CJMA 2R9XA 4BENA 1K57C 1FCOA 1Q2QA 4JXGA 2DCFA 3MBZA 1IYPA 5GL9A 2HDUA 4LV1A 1IKGA 2WKHA 2Y2OA 3HLCA 2WKEA 1ZG4A 4DDYA 2XK1A 1HTZA 3MFDA 1CI9A 4N92A 4KG6A 1FQGA 5FATA 3C7VA 3BFGA 1BLHA 3A3JA 4JLFA 4KQQA 4ZTKA 1RP5A 2E8IA 1DJAA 2ZJ9A 1NJ4A 1PW8A 4EV4A 2EFUA 2Y59A 2XH9A 3HBRA 3AGFA 1PWCA 4GD8A 5HAPA 5EVIA 1FSYA 1BT5A 2X71A 1YLPA 4ID4A 2Q9NA 1E25A 1XP4A 2Y2LA 3IF6A 1DJBA 2R9WA 3CG5A 4XUXA 1ZC2A 2OSUA 2Y2JA 4MBHA 4WEKA 2V2FF 5EVID 3LY3A 4JF4A 4B4ZA 3VFHA 4OH0A 3HL9A 5HL1A 1NZUA 1MWUA 2WGWA 2ZM8A 2XFTA 2ZMAA 2Y2IA 1PI4A 2HP5A 3ZGAB 3VSLA 3Q7ZA 4PM9A 5FI7A 4KG2A 4CPKA 2XR0A 5FI6A 3ZG5A 1BLSA 4ZDXA 3IXDA 2J8YA 2P74A 4LV0A 4K0XA 4X56A 1GA9A 3IHAA 5FQ9A 1PWGA 4N1XA 4P6BA 5I94A 3CZDA 1BSGA 2WAEA 1ONHA 3BLMA 5F83A 2XFSA 1E4DA 1YLJA 1L0GA 1KGEA 5DF7A 2HDQA 1SDNA 4DF6A 4EUZA 3FV7A 3GRJA 5FDHA 5EVIB 1TDLA 4OP5A 1K54A 2H0YA 2ZQCA 1HZOA 1RGZA 1S0WA 1K57A 2H5SA 1H5XA 2JBFA 4JPMA 3V39A 1O07A 1BLCA 3MXRA 3UPPA 2JC7A 3V3RA 4E6XA 4QU3A 4S2JA 4U3TA 2DNSA 2Y2NA 3M2KA 2PU4A 5CHJA 4RVAA 3W8KA 5FSRA 3HUMA 3VMAA 1IKIA 4MLLA 4QY5A 4X68A 1HD8A 1CI8A 2EX2A 1FCMA 1IYOA 4GDNA 4LV3A 3DW0A 2ZQDA 4LV2A 4U0XA 2EX6A 4Y0UA 4N9KA 5A90A 1MWSA 4GKUA 2EX8A 3C4OA 2HPBA 3VP1A 4C3QA 3G2YA 5BOHA 3DTMA 4OQIA 2WK0A 2J7VA 1EROA 2XF3A 5J8XA 5CGXA 1XA1A 2GDNA 5KSCA 4JXVA 3WS2A 5G18A 5CHUA 4EBNA 3OPPA 2HDRA 3LCEA 3S22A 2XDMA 1ALQA 3UNWA 5CECA 3ZG0A 1CK3A 2V1ZA 4NETA 1CEGA 1XGJA 1ES3A 1YLTA 2FFYA 3UE3A 3FZCA 3BECA 3NY4A 5FA7A 3A3FA 3WWXA 3N4IA 3LEZA 1W79A 1MKIA 1G68A 4FH4A 4IVKA 5EUAA 4Y0TA 5A92A 3PBRA 4PM8A 1NY0A 2WGIA 1MXOA 4N1HA 3ZG7B 5L2FA 1O7EA 4OQHA 5EOOA 1S6RA 4FD8A 1E3UA 5FI2A 3UE0A 5GLDA 4X6TA 4PMAA 3MKEA 4K0WA 5M19A 3HLEA 1KGFA 1VQQA 4PPRA 1MY8A 4X55A 3QNCA 1KDWA 4A5RA 4E3NA 5EVLA 1K55A 2EX9A 3HLBA 2HP9A 3IF5A 1ESUA 4E6WA 5HX9A 3S1YA 4C75A 5AQAA 3PAGA 3LY4A 1Q2PA 5CHMA 2WYXA 4E3IA 1VM1A 3P09A 1EI5A 5CXWA 2ZC6B 4QY6A 3WS5A 3M2JA 4BLMA 3RXWA 3FYZA 2Z2MB 1K6RA 3G32A 4GNUA 4JXWA 1SCWA 2WUQA 3TSGA 4H8RA 2Y2GA 4OQGA 3OPHA 3OPLA 1NYYA 4ZBEA 1KVLA 3VP2A 4B4XA 3G2ZA 3MZDA 5KZHA 4PM7A 1SKFA 4PM6A 2EXBA 4OONA 1GHPA 4OPRA 4P85A 1XKZA 3W4OA 4OPYA 2G2UA 3V50A 1LL9A 3PBOA 4KZBA 1PZOA 2UWXA 4QD4A 1FR6A 3IXGA 1PYYA 3IQAA 4S2NC 1H8YA 1LLBA 3WS4A 4WZ5C 1BUEA 1LI9A 4GB7A 5DTKA 2J9OA 4R23A 5D3OA 4QJGA 1KGGA 4RA7A 1IEMA 1Y54A 3ZG9B 5GHXA 1MWTA 1FSWA 3GSGA 4GZBA 5DTSA 4WELA 2QPNA 1WYCA 4KZ6A 5AQBA 3IWQA 4IVIA 3GR2A 3P98A 2Y2HA 4Y0OA 3O3VA 4OOYA 3N8LA 3WRZA 2ZC4B 3BFDA 1W7FA 3SOIA 3N6IA 4WZ4A 3ITBA 4UA6A 4F94A 4Y7PA 1LI0A 1PWDA 4X69A 1LL5A 1NXYA 2A49A 1GHMA 4ZAMA 2IWBA 2EXAA 3BEBA 3SS4A 1N9BA 4ZJ2A 3IH8A 3IXBA 3VP3A 4OLDA 4CJNA 1SHVA 3A3EA 1ESIA 3DWKA 3OCLA 2HP6A 1NZOA 3A3IA 1OMEA 2P9VB 4R3JA 2A3UA 3ISGA 2XQZA 5FASA 4S2KA 3UDFA 4P0MA 3E2KA 2Y2KA 4OPZA 4DE2A 4NK3A 2Y4AA 3MZFA 1CEFA 4RX3A 1ONGA 3BYDA 4DE1A 1WE4A 1U60A 4P87A 4HBUA 4WMCD 5FAPA 1YLZA 2VGJA 4JF6A 5FQKA 3PBTA 4OLGA 4OVDA 4B88A 1GA0A 4UA7A 5FQMA 3V5MA 3IT9A 1KE0A 1YQSA 4JKTA 1I2WA 5TFQA 1NYMA 2RL3A 2Y55A 5KMWA 4Z9QA 2XD5A 1PI5A 5CTMA 5U47A 1W5DA 1W8YA 4HBTA 5GLCA 3UPOA 5KSHA 2J9PA 3M6HA 4S2NA 2JE5A 4S2LA 1MPLA 1K6SA 1L0FA 3BRMA 5TGFA 4BL3A 1XX2A 5CGSA 3SH7A 2ZC7A 4KZ5A 3MZEA 3Q1FA 3IH9A 3ZNTA 1L0DA 1SDEA 5EECA 3IF6C 4LENA 5TR7A 4R3BA 2C6WB 2BLSA 3RXXA 4KZ8A 4S2OA 1BULA 2CC1A 5DF9A 4FH2A 3OCNA 2IWCA 2OLUA 4EWFA 1YLYA 2ZC5B 1PW1A 1BTLA 3BFFA 1JTGA 1ES5A 3EQUA 4EQIA 1FCNA 4BJPA 3ZCZA 1NRFA 2ZLYA 2Y2MA 1KE4A 3G34A 3ZDJA 4C6YA 4E3KA 3UDXA 1I2SA 3N7WA 3HLFA 1K4FA 4PM5A 4MBKA 3BM6A 5FAOA 3BLSA 3OPRA 4OOMA 3HLWA 5HARA 1JWPA 1K38A 4BL2A 5F1FA 2WADA 4JF5A 1DJCA 3NBLA 3I7JA 4FSFA 1TVFA 3HUNA 1XGIA 4KQRA 1GHIA 2Z2LB 4OKPA 3C4PA 3ITAA 2VGKA 2FFFB 1FOFA 1LHYA 5DTTA 1JWVA 2XLNA 3IWIA 4QHCA 1JVJA 1K54C 3G35A 3OZHA 3PBQA 4K91A 5GHZA 1BZAA 2ZQ8A 5GLAA 1J9MA 2PBYA 5A93A 2H0TA 3ZNYA 3HUOA 4EBPA 3FWLA 3SS5A 3UDIA 4XXRA 4IBRA 3WRTA 4IEDA 1YMXA 1XPBA 3AGDA 3B3XA 3GVBA 4ZJ1A 1ERMA 2P9VA 3NI9A 5FQQA 3HREA 2DRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IWD A;  2PU2 A;  4N9L A;  3TOI A;  4GOG A;  4LCL A;  3SH9 A;  2XEP A;  4DE0 A;  3IHB A;  4UHU A;  3O87 A;  5CRF A;  1IEL A;  1K25 A;  2WGV A;  1ZG6 A;  3MKF A;  4JXS A;  5GLB A;  3ZVW A;  1YLW A;  1W8Q A;  4LCM A;  3MXS A;  3VP4 A;  3HLG A;  4OQ0 A;  5CTN A;  4E3M A;  5JYO A;  4WM9 A;  1ERQ A;  5FAQ A;  1L2S A;  3PAE A;  3HLD A;  1TDG A;  3GTC A;  3E2L A;  2X01 A;  3W4P A;  1RGY A;  5E2H A;  4JBF A;  4DDS A;  3N8R A;  1XA7 A;  2WZX A;  4S2I A;  3EQV A;  4BD0 A;  3VSK A;  5DF8 A;  3S4X A;  2XGN A;  4XUZ A;  3FKW A;  3G4P A;  3FKV A;  3G30 A;  4HES A;  3WS0 A;  3DWZ A;  3HVF A;  3A3D A;  5GHY A;  4U0T A;  3CMZ A;  3NDE A;  3AGE A;  5F82 A;  5E2E A;  3LO7 A;  1K4E A;  4WYY A;  3O88 A;  3JYI A;  3NCK A;  3NC8 A;  1DY6 A;  4RX2 A;  4S2M A;  1JWZ A;  5EOE A;  5IHV A;  4WMC A;  5E2F A;  4HEF A;  1MBL A;  2ZC3 B;  3Q07 A;  5F1G A;  5CER A;  3ZHH A;  4BQM A;  4GD6 A;  4M3K A;  4X53 A;  3Q82 A;  3QHY A;  3G31 A;  4YFM A;  4YIN A;  3IXH A;  2Y2P A;  1K55 C;  4MBF A;  4D2O A;  2OLV A;  2ZQ7 A;  1YMS A;  3W4Q A;  5FQJ A;  5DVA A;  2BG1 A;  4KEN B;  3D4F A;  1HVB A;  3UN7 A;  2WKI A;  2XD1 A;  3IF6 B;  5JYP A;  2C5W B;  3Q7V A;  1FR1 A;  4R0Q A;  3GMW A;  4R4S A;  3RJU A;  4E3L A;  1WYB A;  3UPN A;  4OPQ A;  4MEZ A;  1QMF A;  4RYE A;  3NIA A;  1ES2 A;  1TEM A;  2X02 A;  5M18 A;  1H8Z A;  5AQ7 A;  1PIO A;  3V3S A;  1Z6F A;  1KVM A;  1YT4 A;  4GDB A;  2WGW B;  3M6B A;  2WAF A;  4S2P A;  4BD1 A;  4WZ5 A;  3UE1 A;  3O86 A;  5EE8 A;  1MWR A;  4QB8 A;  3UY6 A;  2WZZ A;  1EWZ A;  4DXB A;  3SH8 A;  3N8S A;  2ZQA A;  4R1G A;  1GCE A;  2ZD8 A;  3GQZ A;  2JCH A;  1ZKJ A;  4KZ3 A;  4OP8 A;  5EVI C;  3NDG A;  4DKI A;  4R4R A;  5A91 A;  5CEB A;  3PTE A;  3QNB A;  3VFF A;  2Y2Q A;  4DRT A;  2QZ6 A;  1N4O A;  2Y91 A;  4DE3 A;  1IYQ A;  4WBG A;  3ZG8 B;  1K56 A;  5CED A;  1PZP A;  2G2W A;  4FCF A;  3C5A A;  1C3B A;  2ZQ9 A;  1I5Q A;  4KZ7 A;  5HFO A;  4GN2 A;  3PBN A;  2ZM0 A;  4OOL A;  5CGW A;  5M1A A;  4ZJ3 A;  1BLP A;  1XXM A;  1M40 A;  1L0E A;  1YM1 A;  4KZ4 A;  3SS3 A;  3ZVT A;  1QME A;  5EPH A;  4KZA A;  2H10 A;  1K56 D;  2OV5 A;  4IBX A;  1JTD A;  3BFE A;  2HDS A;  4KG5 A;  2RCX A;  4E3O A;  5AQ9 A;  4UAA A;  4EBL A;  4KQO A;  1M6K A;  1KE3 A;  3PBS A;  3Q7V B;  5E2G A;  5HW3 A;  4MNR A;  4O7D A;  3BFC A;  4L0L A;  5E43 A;  2V20 A;  3VOY A;  1AXB A;  1ES4 A;  2ZM2 A;  4WEJ A;  2B5R A;  1IYS A;  4KZ9 A;  3GV9 A;  3Q81 A;  4DXC A;  3C7U A;  3IWO A;  4E3J A;  3WS1 A;  1G6A A;  4UA9 A;  3TG9 A;  3OC2 A;  3ZFZ A;  5HAI A;  3VOZ A;  4Q8I A;  1KDS A;  2EFX A;  5HAQ A;  2QMI A;  3VP0 A;  1E3U D;  1RCJ A;  2I72 A;  2Q9M A;  5FQI A;  3UO9 A;  3CJM A;  2R9X A;  4BEN A;  1K57 C;  1FCO A;  1Q2Q A;  4JXG A;  2DCF A;  3MBZ A;  1IYP A;  5GL9 A;  2HDU A;  4LV1 A;  1IKG A;  2WKH A;  2Y2O A;  3HLC A;  2WKE A;  1ZG4 A;  4DDY A;  2XK1 A;  1HTZ A;  3MFD A;  1CI9 A;  4N92 A;  4KG6 A;  1FQG A;  5FAT A;  3C7V A;  3BFG A;  1BLH A;  3A3J A;  4JLF A;  4KQQ A;  4ZTK A;  1RP5 A;  2E8I A;  1DJA A;  2ZJ9 A;  1NJ4 A;  1PW8 A;  4EV4 A;  2EFU A;  2Y59 A;  2XH9 A;  3HBR A;  3AGF A;  1PWC A;  4GD8 A;  5HAP A;  5EVI A;  1FSY A;  1BT5 A;  2X71 A;  1YLP A;  4ID4 A;  2Q9N A;  1E25 A;  1XP4 A;  2Y2L A;  3IF6 A;  1DJB A;  2R9W A;  3CG5 A;  4XUX A;  1ZC2 A;  2OSU A;  2Y2J A;  4MBH A;  4WEK A;  2V2F F;  5EVI D;  3LY3 A;  4JF4 A;  4B4Z A;  3VFH A;  4OH0 A;  3HL9 A;  5HL1 A;  1NZU A;  1MWU A;  2WGW A;  2ZM8 A;  2XFT A;  2ZMA A;  2Y2I A;  1PI4 A;  2HP5 A;  3ZGA B;  3VSL A;  3Q7Z A;  4PM9 A;  5FI7 A;  4KG2 A;  4CPK A;  2XR0 A;  5FI6 A;  3ZG5 A;  1BLS A;  4ZDX A;  3IXD A;  2J8Y A;  2P74 A;  4LV0 A;  4K0X A;  4X56 A;  1GA9 A;  3IHA A;  5FQ9 A;  1PWG A;  4N1X A;  4P6B A;  5I94 A;  3CZD A;  1BSG A;  2WAE A;  1ONH A;  3BLM A;  5F83 A;  2XFS A;  1E4D A;  1YLJ A;  1L0G A;  1KGE A;  5DF7 A;  2HDQ A;  1SDN A;  4DF6 A;  4EUZ A;  3FV7 A;  3GRJ A;  5FDH A;  5EVI B;  1TDL A;  4OP5 A;  1K54 A;  2H0Y A;  2ZQC A;  1HZO A;  1RGZ A;  1S0W A;  1K57 A;  2H5S A;  1H5X A;  2JBF A;  4JPM A;  3V39 A;  1O07 A;  1BLC A;  3MXR A;  3UPP A;  2JC7 A;  3V3R A;  4E6X A;  4QU3 A;  4S2J A;  4U3T A;  2DNS A;  2Y2N A;  3M2K A;  2PU4 A;  5CHJ A;  4RVA A;  3W8K A;  5FSR A;  3HUM A;  3VMA A;  1IKI A;  4MLL A;  4QY5 A;  4X68 A;  1HD8 A;  1CI8 A;  2EX2 A;  1FCM A;  1IYO A;  4GDN A;  4LV3 A;  3DW0 A;  2ZQD A;  4LV2 A;  4U0X A;  2EX6 A;  4Y0U A;  4N9K A;  5A90 A;  1MWS A;  4GKU A;  2EX8 A;  3C4O A;  2HPB A;  3VP1 A;  4C3Q A;  3G2Y A;  5BOH A;  3DTM A;  4OQI A;  2WK0 A;  2J7V A;  1ERO A;  2XF3 A;  5J8X A;  5CGX A;  1XA1 A;  2GDN A;  5KSC A;  4JXV A;  3WS2 A;  5G18 A;  5CHU A;  4EBN A;  3OPP A;  2HDR A;  3LCE A;  3S22 A;  2XDM A;  1ALQ A;  3UNW A;  5CEC A;  3ZG0 A;  1CK3 A;  2V1Z A;  4NET A;  1CEG A;  1XGJ A;  1ES3 A;  1YLT A;  2FFY A;  3UE3 A;  3FZC A;  3BEC A;  3NY4 A;  5FA7 A;  3A3F A;  3WWX A;  3N4I A;  3LEZ A;  1W79 A;  1MKI A;  1G68 A;  4FH4 A;  4IVK A;  5EUA A;  4Y0T A;  5A92 A;  3PBR A;  4PM8 A;  1NY0 A;  2WGI A;  1MXO A;  4N1H A;  3ZG7 B;  5L2F A;  1O7E A;  4OQH A;  5EOO A;  1S6R A;  4FD8 A;  1E3U A;  5FI2 A;  3UE0 A;  5GLD A;  4X6T A;  4PMA A;  3MKE A;  4K0W A;  5M19 A;  3HLE A;  1KGF A;  1VQQ A;  4PPR A;  1MY8 A;  4X55 A;  3QNC A;  1KDW A;  4A5R A;  4E3N A;  5EVL A;  1K55 A;  2EX9 A;  3HLB A;  2HP9 A;  3IF5 A;  1ESU A;  4E6W A;  5HX9 A;  3S1Y A;  4C75 A;  5AQA A;  3PAG A;  3LY4 A;  1Q2P A;  5CHM A;  2WYX A;  4E3I A;  1VM1 A;  3P09 A;  1EI5 A;  5CXW A;  2ZC6 B;  4QY6 A;  3WS5 A;  3M2J A;  4BLM A;  3RXW A;  3FYZ A;  2Z2M B;  1K6R A;  3G32 A;  4GNU A;  4JXW A;  1SCW A;  2WUQ A;  3TSG A;  4H8R A;  2Y2G A;  4OQG A;  3OPH A;  3OPL A;  1NYY A;  4ZBE A;  1KVL A;  3VP2 A;  4B4X A;  3G2Z A;  3MZD A;  5KZH A;  4PM7 A;  1SKF A;  4PM6 A;  2EXB A;  4OON A;  1GHP A;  4OPR A;  4P85 A;  1XKZ A;  3W4O A;  4OPY A;  2G2U A;  3V50 A;  1LL9 A;  3PBO A;  4KZB A;  1PZO A;  2UWX A;  4QD4 A;  1FR6 A;  3IXG A;  1PYY A;  3IQA A;  4S2N C;  1H8Y A;  1LLB A;  3WS4 A;  4WZ5 C;  1BUE A;  1LI9 A;  4GB7 A;  5DTK A;  2J9O A;  4R23 A;  5D3O A;  4QJG A;  1KGG A;  4RA7 A;  1IEM A;  1Y54 A;  3ZG9 B;  5GHX A;  1MWT A;  1FSW A;  3GSG A;  4GZB A;  5DTS A;  4WEL A;  2QPN A;  1WYC A;  4KZ6 A;  5AQB A;  3IWQ A;  4IVI A;  3GR2 A;  3P98 A;  2Y2H A;  4Y0O A;  3O3V A;  4OOY A;  3N8L A;  3WRZ A;  2ZC4 B;  3BFD A;  1W7F A;  3SOI A;  3N6I A;  4WZ4 A;  3ITB A;  4UA6 A;  4F94 A;  4Y7P A;  1LI0 A;  1PWD A;  4X69 A;  1LL5 A;  1NXY A;  2A49 A;  1GHM A;  4ZAM A;  2IWB A;  2EXA A;  3BEB A;  3SS4 A;  1N9B A;  4ZJ2 A;  3IH8 A;  3IXB A;  3VP3 A;  4OLD A;  4CJN A;  1SHV A;  3A3E A;  1ESI A;  3DWK A;  3OCL A;  2HP6 A;  1NZO A;  3A3I A;  1OME A;  2P9V B;  4R3J A;  2A3U A;  3ISG A;  2XQZ A;  5FAS A;  4S2K A;  3UDF A;  4P0M A;  3E2K A;  2Y2K A;  4OPZ A;  4DE2 A;  4NK3 A;  2Y4A A;  3MZF A;  1CEF A;  4RX3 A;  1ONG A;  3BYD A;  4DE1 A;  1WE4 A;  1U60 A;  4P87 A;  4HBU A;  4WMC D;  5FAP A;  1YLZ A;  2VGJ A;  4JF6 A;  5FQK A;  3PBT A;  4OLG A;  4OVD A;  4B88 A;  1GA0 A;  4UA7 A;  5FQM A;  3V5M A;  3IT9 A;  1KE0 A;  1YQS A;  4JKT A;  1I2W A;  5TFQ A;  1NYM A;  2RL3 A;  2Y55 A;  5KMW A;  4Z9Q A;  2XD5 A;  1PI5 A;  5CTM A;  5U47 A;  1W5D A;  1W8Y A;  4HBT A;  5GLC A;  3UPO A;  5KSH A;  2J9P A;  3M6H A;  4S2N A;  2JE5 A;  4S2L A;  1MPL A;  1K6S A;  1L0F A;  3BRM A;  5TGF A;  4BL3 A;  1XX2 A;  5CGS A;  3SH7 A;  2ZC7 A;  4KZ5 A;  3MZE A;  3Q1F A;  3IH9 A;  3ZNT A;  1L0D A;  1SDE A;  5EEC A;  3IF6 C;  4LEN A;  5TR7 A;  4R3B A;  2C6W B;  2BLS A;  3RXX A;  4KZ8 A;  4S2O A;  1BUL A;  2CC1 A;  5DF9 A;  4FH2 A;  3OCN A;  2IWC A;  2OLU A;  4EWF A;  1YLY A;  2ZC5 B;  1PW1 A;  1BTL A;  3BFF A;  1JTG A;  1ES5 A;  3EQU A;  4EQI A;  1FCN A;  4BJP A;  3ZCZ A;  1NRF A;  2ZLY A;  2Y2M A;  1KE4 A;  3G34 A;  3ZDJ A;  4C6Y A;  4E3K A;  3UDX A;  1I2S A;  3N7W A;  3HLF A;  1K4F A;  4PM5 A;  4MBK A;  3BM6 A;  5FAO A;  3BLS A;  3OPR A;  4OOM A;  3HLW A;  5HAR A;  1JWP A;  1K38 A;  4BL2 A;  5F1F A;  2WAD A;  4JF5 A;  1DJC A;  3NBL A;  3I7J A;  4FSF A;  1TVF A;  3HUN A;  1XGI A;  4KQR A;  1GHI A;  2Z2L B;  4OKP A;  3C4P A;  3ITA A;  2VGK A;  2FFF B;  1FOF A;  1LHY A;  5DTT A;  1JWV A;  2XLN A;  3IWI A;  4QHC A;  1JVJ A;  1K54 C;  3G35 A;  3OZH A;  3PBQ A;  4K91 A;  5GHZ A;  1BZA A;  2ZQ8 A;  5GLA A;  1J9M A;  2PBY A;  5A93 A;  2H0T A;  3ZNY A;  3HUO A;  4EBP A;  3FWL A;  3SS5 A;  3UDI A;  4XXR A;  4IBR A;  3WRT A;  4IED A;  1YMX A;  1XPB A;  3AGD A;  3B3X A;  3GVB A;  4ZJ1 A;  1ERM A;  2P9V A;  3NI9 A;  5FQQ A;  3HRE A;  2DRW A; 
#chains in the Genus database with same CATH topology
 4N9L A;  2XEP A;  3CUE C;  1K25 A;  3MKF A;  3ZVW A;  1YLW A;  4XT2 B;  3MXS A;  5CTN A;  1OTD A;  3BQA A;  5FAQ A;  3HLD A;  3GTC A;  4NG2 A;  3W4P A;  3MF0 A;  4DDS A;  3N8R A;  3QP1 A;  1XA7 A;  3EQV A;  3VSK A;  3S4X A;  2XGN A;  3LIF A;  4FOF A;  4HES A;  3T1R A;  2GJ3 A;  3AGE A;  2K31 A;  3C30 A;  1DY6 A;  5E2F A;  1MBL A;  1VEU B;  3NEC A;  2KX6 A;  4H6J A;  1K55 C;  1V9Z A;  1D1J A;  4MBF A;  2ZQ7 A;  5FQJ A;  5DVA A;  2JN7 A;  3D4F A;  3IF6 B;  2C5W B;  4E3L A;  4R0Q A;  4I3I A;  4R4S A;  3RJU A;  3UE6 A;  3GEC A;  1WYB A;  3C8C A;  3UPN A;  2FH5 A;  1TEM A;  4EES A;  3E0Y A;  2YKH A;  4MMN A;  1YT4 A;  3M6B A;  4S2P A;  3UY6 A;  3O86 A;  5EE8 A;  3QP4 A;  1JNU A;  4DXB A;  3SH8 A;  3DTI A;  1GCE A;  2ZD8 A;  1WA9 A;  1ZKJ A;  2VV8 A;  2O0Y A;  2W3G A;  3PTE A;  4Y3I A;  2Y2Q A;  4WBG A;  5HD5 A;  4FCF A;  2ZQ9 A;  1I5Q A;  2KOI A;  5HFO A;  3FC7 A;  1OT9 A;  1L0E A;  3ZVT A;  5EPH A;  1AWI A;  2H10 A;  1K56 D;  4R3A A;  1JTD A;  2RCX A;  4UAA A;  2PD7 A;  3T4J A;  5HW3 A;  4O7D A;  2B02 A;  2V20 A;  1AXB A;  3Q81 A;  4DXC A;  2XA7 M;  3CHW P;  4UA9 A;  3CWF A;  3ZFZ A;  2EFX A;  2QMI A;  3KO6 A;  1XJ4 A;  4Z1W A;  5TBM A;  2HDU A;  3JVU A;  4GHI A;  4LPZ A;  3T4Q A;  4GS9 B;  4BBV A;  1FQG A;  4KQQ A;  2E8I A;  4AFI A;  2ZJ9 A;  2GNX A;  4WLA A;  5FDS A;  3AGF A;  4GD8 A;  2OAQ 1;  1OTB A;  4ID4 A;  2Y2L A;  2INW A;  3OOV A;  2Y2J A;  1S1Y A;  4MBH A;  4B4Z A;  3VFH A;  4OH0 A;  1N9O A;  4M4X A;  3L9K A;  4DJ3 A;  3VSL A;  3Q7Z A;  1VET B;  3UB5 P;  2XR0 A;  5FI6 A;  1BLS A;  3IXD A;  4LV0 A;  4LRX C;  3IHA A;  2ZOH A;  4ETZ A;  1BSG A;  5F83 A;  3A0V A;  5DF7 A;  2HDQ A;  4HIA A;  2H0Y A;  3V39 A;  1BLC A;  3UPP A;  3MSH A;  4HP9 A;  4QU3 A;  4S2J A;  3M2K A;  1DP9 A;  4RVA A;  3W8K A;  5FSR A;  4MLL A;  4R38 A;  3KYQ A;  4X68 A;  4GDN A;  3DW0 A;  3MQQ A;  2ZQD A;  4LV2 A;  4Y13 A;  4Y0U A;  2V0W A;  1MWS A;  4UEY A;  2EX8 A;  3C4O A;  3DTE A;  2HPB A;  2I9V A;  5DJT A;  1K0K A;  5J8X A;  5CGX A;  2GDN A;  2M7V A;  5CHU A;  3OPP A;  2XDM A;  3MFX A;  3UNW A;  4MN5 A;  2XA7 S;  4BWI A;  3UE3 A;  5AJG A;  3FZC A;  4ME4 A;  1W63 M;  4FH4 A;  4PM8 A;  1TD5 A;  1O7E A;  2PDR A;  3IBR A;  4IUH A;  3UE0 A;  4PPR A;  2J3T D;  2H28 A;  3HLB A;  3HJK A;  4E6W A;  2WYX A;  3NOT C;  1F98 A;  4JGP A;  2J80 A;  2WUQ A;  3RTY A;  1NYY A;  4ZBE A;  1KVL A;  3VP2 A;  3G2Z A;  3LGO A;  4HJ4 A;  5HZH A;  4OON A;  1BYW A;  3H82 A;  2LB5 A;  1LL9 A;  1PZO A;  1H8Y A;  3WS4 A;  4WZ5 C;  4X1L A;  5DTK A;  5D3O A;  3S7Q A;  1N9L A;  2KDK A;  2GX5 A;  4QPR A;  2QPN A;  4KZ6 A;  2FZ0 A;  2W3D A;  2Y2H A;  2YKF A;  4OOY A;  3WRZ A;  3SOI A;  3N6I A;  3PHY A;  4F94 A;  1DRM A;  1NLZ A;  1NXY A;  3LYX A;  4ARZ B;  4HJ3 A;  3DWK A;  3OCL A;  2HP6 A;  4IJG A;  4S2K A;  3T4K A;  1SKO B;  2Y8H A;  4NK3 A;  2Y4A A;  3F1O B;  1YSQ A;  2W3F A;  3MZF A;  1CEF A;  4RX3 A;  1YAX A;  2GZA A;  1U60 A;  4P87 A;  4PHT A;  5FQK A;  2VGJ A;  4B88 A;  1I2W A;  1NYM A;  4NXF A;  5CTM A;  3LI8 A;  4CLC E;  3UPO A;  3W2Z A;  5IU1 A;  3NJA A;  2J9P A;  2JE5 A;  4S2L A;  1L0F A;  1ZTU A;  2ZBB A;  5TGF A;  1XX2 A;  1L0D A;  4EW7 A;  1Y4O A;  3E4P A;  5IT5 A;  5TR7 A;  1TS8 A;  2BLS A;  3RXX A;  4KZ8 A;  2OLU A;  4EWF A;  5K5B A;  3KSI A;  4HOI A;  4Y5F A;  1JTG A;  1ES5 A;  2L0W A;  4P6Z S;  3B42 A;  1FCN A;  3ZCZ A;  2ZLY A;  1KE4 A;  4C6Y A;  3UDX A;  1I2S A;  3VE3 A;  3HLF A;  3ZQ5 A;  4PM5 A;  4MN6 A;  4NKP A;  4JF5 A;  3MR0 A;  4FSF A;  1TVF A;  4KQR A;  2Z2L B;  3ITA A;  1S67 L;  2VGK A;  5DFX A;  2FFF B;  1FOF A;  1LHY A;  2XLN A;  1JVJ A;  3PBQ A;  4K91 A;  3D9Y A;  2ZQ8 A;  3CI6 A;  3UDI A;  4IBR A;  4O8G A;  1YMX A;  1ERM A;  4I5S A;  2DRW A;  2IWD A;  3CIT A;  4LCL A;  2O99 A;  1YSP A;  4NXE A;  3IHB A;  1ZG6 A;  4OQ0 A;  4E04 A;  3NHQ A;  4E3M A;  1ERQ A;  1L2S A;  5DKK A;  5I5L A;  5E2H A;  4JBF A;  2WZX A;  4S2I A;  2Q0O A;  3BQ8 A;  5DF8 A;  3H9W A;  3WS0 A;  3DWZ A;  3A3D A;  3CMZ A;  3NDE A;  5F82 A;  1UWP X;  5E2E A;  4WL9 A;  3LO7 A;  4F3L B;  5IHV A;  1JWZ A;  3D72 A;  2ZC3 B;  3Q07 A;  4M3K A;  4X53 A;  3Q82 A;  3BY9 A;  3T50 A;  5L8M A;  3W4Q A;  2A24 B;  2XD1 A;  1TS6 A;  1FR1 A;  3T1Q B;  1H8M A;  3LR3 A;  3P01 A;  1QMF A;  1ES2 A;  1F2K A;  5M18 A;  4EQ1 A;  3IBJ A;  5HWW A;  1XJ3 A;  5L10 A;  1MWR A;  2WZZ A;  1EWZ A;  3N8S A;  4O01 A;  3UB6 A;  5EVI C;  4OP8 A;  4DKI A;  2M1C A;  4DRT A;  2Y91 A;  3ZG8 B;  5IS1 A;  1P9W A;  1C3B A;  3TW8 A;  3CPT A;  4CLC B;  4OOL A;  2VZW A;  2ZM0 A;  5CGW A;  4ZJ3 A;  3RH8 B;  1Z09 A;  2W1T A;  3T4T A;  3BJN A;  4EBL A;  3PBS A;  4XT2 A;  1ES4 A;  3UB7 A;  4KZ9 A;  3IX8 A;  3WS1 A;  3BWL A;  1G6A A;  5HAI A;  4Q8I A;  2G7U A;  2PT7 A;  2I72 A;  2Q9M A;  3B47 A;  2UV0 E;  4JXG A;  3MBZ A;  1H0M A;  5A8B A;  4RQ9 A;  4LV1 A;  3UME A;  4DDY A;  1CI9 A;  4EET B;  5J7E A;  1STZ A;  5FAT A;  1VEU A;  1T1B A;  3PYP A;  1PW8 A;  2W1T B;  4EV4 A;  2Y59 A;  3E4Q A;  2JKT M;  5C5K A;  1PWC A;  5EVI A;  1FSY A;  2OWH A;  2JKG A;  5TJJ A;  1YLP A;  1XP4 A;  2Q9N A;  3IF6 A;  1DJB A;  3CG5 A;  4WEK A;  2K2N A;  4GCZ A;  5HL1 A;  1LSW A;  1NZU A;  2QWS A;  3EGD C;  2ZMA A;  1PI4 A;  3ZGA B;  2PR5 A;  4PM9 A;  4ZRR A;  4CPK A;  3ZG5 A;  4X56 A;  4R70 A;  1PWG A;  4N1X A;  5I94 A;  3CZD A;  1YPR A;  3BLM A;  1KGE A;  3LR4 A;  3FV7 A;  5L07 A;  4PKY A;  5EVI B;  4OP5 A;  1RGZ A;  1S0W A;  2H5S A;  3KYZ A;  4E6X A;  3V3R A;  3KSF A;  4FTX A;  4NEE D;  4LLO B;  3VMA A;  4KUK A;  1FCM A;  4DN0 A;  2D02 A;  4LV3 A;  4GKU A;  3CUE A;  4NXB A;  2QJ7 A;  3VP1 A;  4C3Q A;  4JGR A;  5LBR A;  1XA1 A;  4JXV A;  3WS2 A;  5G18 A;  4EBN A;  2V0U A;  2HDR A;  4GS9 A;  5G4Z A;  2ZL1 B;  1ALQ A;  3ZG0 A;  4NET A;  1CEG A;  3RFB A;  1YLT A;  2FFY A;  3N4I A;  3LEZ A;  4II7 A;  1W79 A;  4LGW A;  1MKI A;  2JKR M;  2P04 A;  3H7W A;  1NY0 A;  2WGI A;  2WKP A;  1S6R A;  4NXG A;  5GLD A;  4G3W A;  4K0W A;  2OOL A;  2L4R A;  2K7S A;  4X55 A;  1KDW A;  1Y28 A;  5EVL A;  1K55 A;  3IF5 A;  1VET A;  4E3I A;  3LY4 A;  5CHM A;  3FG8 A;  3LID A;  3P09 A;  1EI5 A;  3UB8 A;  5AVF A;  4BLM A;  4GNU A;  3TSG A;  3KYE A;  4OQG A;  1IOU A;  3MJQ A;  4PKY G;  4B4X A;  1S1Z A;  2W3E A;  5KZH A;  4PM7 A;  3H7W B;  2EXB A;  4OPR A;  3TE8 A;  4EU0 A;  4G3V A;  3W4O A;  4KZB A;  4QD4 A;  4MDZ A;  3IQA A;  2M7U A;  2J9O A;  1LT0 A;  1MC0 A;  4Y17 A;  1KGG A;  4RA7 A;  1MWT A;  4GZB A;  2AVX A;  1WYC A;  3O3V A;  3N8L A;  3ZYT A;  2ZC4 B;  4UA6 A;  4Y7P A;  1LI0 A;  1LL5 A;  4IHQ A;  2EXA A;  3BEB A;  2VKS A;  3IH8 A;  4B93 A;  3IXB A;  1S4S A;  4CJN A;  5CX7 A;  1ESI A;  2P9V B;  3S7N A;  3SW1 A;  3QP6 A;  3NUL A;  3CAX A;  4OPZ A;  1L3L A;  2VV7 A;  4JKT A;  5FEF A;  2Y55 A;  1SZV A;  1LSV A;  3EEH A;  1W5D A;  1W8Y A;  2ACG A;  1OTA A;  1K6S A;  3BRM A;  4IUK A;  4BL3 A;  1S66 L;  3ZNT A;  1SDE A;  5EEC A;  4HY8 A;  4R3B A;  1BUL A;  2CC1 A;  2DMW A;  2V8C A;  1YLY A;  1BTL A;  5DKL A;  3EQU A;  4EQI A;  4BJP A;  2Y2M A;  3U2A A;  5J4E A;  2A2L A;  1K4F A;  5HAR A;  3OPR A;  4OOM A;  1OTE A;  3I7J A;  4OKP A;  3C4P A;  4P6Z M;  5DTT A;  4MCW A;  1JWV A;  1MZU A;  1K54 C;  5GHZ A;  1PFL A;  3P7N A;  3ZNY A;  4ARZ A;  3FWL A;  3AGD A;  1XJ2 A;  3OLO A;  4ZJ1 A;  3NI9 A;  1NLY A;  4I3J A;  4G3K A;  1SKO A;  2PRF A;  4GOG A;  1DP8 A;  3SH9 A;  3F1O A;  5HWT A;  4UHU A;  4HJ6 A;  4JXS A;  5GLB A;  2CMN A;  1W8Q A;  4LCM A;  3VP4 A;  3HLG A;  2HZ5 A;  3PAE A;  1D06 A;  2Z6C A;  5KIZ A;  2W1R A;  2W3H A;  4QWO A;  4BD0 A;  4XUZ A;  3FKW A;  3G30 A;  2VEA A;  4WYY A;  3D3O A;  2J3T C;  3JYI A;  3NCK A;  3NC8 A;  4RX2 A;  5EOE A;  4HNB A;  4BQM A;  5F1G A;  5CER A;  1OPX A;  2XRN A;  3QHY A;  4Q0J A;  3G31 A;  2Y2P A;  5HL6 A;  2OLV A;  3R7W B;  3T12 B;  4B9O A;  4Y2F A;  2BG1 A;  3VV4 A;  1F9I A;  1HVB A;  4WUJ A;  2WKI A;  3GMW A;  5G4Y A;  2VGL S;  4OPQ A;  4MEZ A;  4RYE A;  3NIA A;  1H8Z A;  3V3S A;  1PIO A;  1Z6F A;  1T19 A;  4GDB A;  2WGW B;  2WAF A;  3BW6 A;  1NWZ A;  2W0N A;  4WZ5 A;  4QB8 A;  5MC7 A;  3DBA A;  3G6O A;  4R1G A;  3GQZ A;  2JCH A;  4KZ3 A;  3NDG A;  5A91 A;  3PXP A;  2QZ6 A;  1N4O A;  4WF0 A;  4DE3 A;  1IYQ A;  2L1M A;  1PZP A;  2G2W A;  3C5A A;  4KZ7 A;  5FL3 A;  3PBN A;  5FEG A;  3SS3 A;  4HQA A;  1QME A;  2Z6D A;  4IBX A;  2OV5 A;  2HDS A;  4E3O A;  2J3W A;  4KQO A;  1KE3 A;  5E2G A;  4MNR A;  4L0L A;  5E43 A;  3MXQ A;  1IYS A;  2BAS A;  3B33 A;  3GV9 A;  3IWO A;  4CLC C;  1GSX A;  4X25 A;  3TG9 A;  3OC2 A;  5HAQ A;  3IX3 A;  3E98 A;  3VP0 A;  3UO9 A;  1RCJ A;  3CJM A;  2R9X A;  2VV6 A;  2OWJ A;  1Q2Q A;  2PYR A;  5GL9 A;  1IKG A;  2Y2O A;  2QYB A;  2WKE A;  1ZG4 A;  1P9R A;  1HTZ A;  3MFD A;  4F3L A;  1EW0 A;  4KG6 A;  3F1P B;  1BLH A;  1RP5 A;  1DJA A;  1NJ4 A;  1FIK A;  4YNR A;  1BT5 A;  2X71 A;  2A24 A;  2R9W A;  3S7O A;  2OSU A;  5EVI D;  3LY3 A;  5HD3 A;  1V9Y A;  2Y2I A;  3F1N B;  5FI7 A;  2J8Y A;  2P74 A;  5FQ9 A;  1GA9 A;  3TRC A;  4HHD A;  3EOI A;  4CLC A;  1SDN A;  4DF6 A;  3GRJ A;  4LRZ E;  5FDH A;  4YOF A;  3TJZ C;  2ZQC A;  1HZO A;  4JPM A;  1H5X A;  2JBF A;  1OTI A;  4KQD A;  3MXR A;  2O9A A;  4U3T A;  1X0O A;  2Y2N A;  2PU4 A;  5CHJ A;  3HUM A;  1IKI A;  4QY5 A;  1KOU A;  5HPF A;  4ETX A;  2EX2 A;  1IYO A;  2EX6 A;  3NOU C;  1P0Z A;  3G2Y A;  5BOH A;  3DTM A;  2WK0 A;  2XF3 A;  1ERO A;  5KSC A;  2ZMV A;  3S22 A;  5CEC A;  1CK3 A;  2V1Z A;  1XGJ A;  1ES3 A;  3K2N A;  5EVE A;  3NY4 A;  4HI4 A;  4Q0I A;  1G68 A;  5EUA A;  5A92 A;  3PBR A;  4GLQ A;  3ZG7 B;  4Y15 A;  2W27 A;  5EOO A;  4FD8 A;  4EER A;  5FI2 A;  4X6T A;  4PMA A;  3HLE A;  1KGF A;  1MKM A;  1S4R A;  1VQQ A;  2EWV A;  1MY8 A;  3QNC A;  4A5R A;  4E3N A;  3FPV A;  2HP9 A;  1ESU A;  3LIA A;  5AQA A;  3PAG A;  3DAV A;  1T1A A;  5HWV A;  5CXW A;  2ZC6 B;  4QY6 A;  1TF1 A;  3K3D A;  3WS5 A;  3M2J A;  2Y79 A;  2Z2M B;  1SCW A;  4H8R A;  2Y2G A;  4EUV A;  5F68 A;  2JKF A;  4P85 A;  1XKZ A;  4OPY A;  3V50 A;  3PBO A;  3K3C A;  2UWX A;  1FR6 A;  4BBT A;  1DP6 A;  4S2N C;  2IA2 A;  2VJW A;  4PAU A;  4R23 A;  4WN5 A;  4QJG A;  4Q0H A;  1IEM A;  1Y54 A;  3ZG9 B;  5GHX A;  1FSW A;  5AQB A;  3IWQ A;  4IVI A;  4LFU A;  3P98 A;  1ZHH B;  3QP8 A;  4WZ4 A;  2ZL1 A;  2VK3 A;  4X69 A;  1GSV A;  1GHM A;  4ZAM A;  2D01 A;  2IWB A;  3SS4 A;  1N9B A;  3T1S A;  4ZJ2 A;  4OLD A;  3S7P A;  1G6O A;  1SHV A;  3QP2 A;  3A3I A;  1OME A;  2A3U A;  5FAS A;  2XQZ A;  3UDF A;  2Y2K A;  3LEQ A;  3BYD A;  5FAP A;  4WMC D;  1YLZ A;  4JF6 A;  4OLG A;  4OVD A;  5FQM A;  3V5M A;  3IT9 A;  1YQS A;  3R4K A;  5F6A A;  5TFQ A;  2RL3 A;  4Z9Q A;  1PI5 A;  5U47 A;  3EEA A;  5GLC A;  3IX4 A;  4DJ2 A;  5KSH A;  4S2N A;  2MJ6 A;  5CGS A;  3SH7 A;  2ZC7 A;  3T4S A;  2ZOI A;  4KZ5 A;  3LR0 A;  1P97 A;  4HP4 A;  2C6W B;  4S2O A;  3OCN A;  3KSG A;  3E4O A;  3C38 A;  1PW1 A;  2HJE A;  4H6J B;  4MN7 A;  3G34 A;  4E3K A;  3UB9 A;  3BM6 A;  4GJ4 A;  3BLS A;  5FAO A;  4BL2 A;  2WAD A;  2E8J A;  1DJC A;  3NBL A;  1LL8 A;  4CQH A;  1XGI A;  1GHI A;  3CLO A;  2OAP 1;  4QHC A;  5F5Y A;  1J9M A;  2PBY A;  5A93 A;  3HUO A;  3ULF A;  4EBP A;  2ZMF A;  3SS5 A;  4XXR A;  3WRT A;  4IED A;  4L9F A;  1XPB A;  2P9V A;  1HLU P;  4EEP A;  2PU2 A;  3TOI A;  4DE0 A;  3O87 A;  5CRF A;  1IEL A;  2WGV A;  1OJ5 A;  3T4L A;  2B18 A;  4WM9 A;  5JYO A;  1TDG A;  3E2L A;  4L9G A;  2X01 A;  1RGY A;  4UQI M;  3C2W A;  1G28 A;  3BY8 A;  3G4P A;  3FKV A;  3VOL A;  3HVF A;  5GHY A;  5TBM B;  4U0T A;  4K08 A;  4GHI B;  1A0K A;  1K4E A;  2V1B A;  3O88 A;  2VX8 A;  5EFW A;  4S2M A;  4WMC A;  4HEF A;  3ZHH A;  1UGU A;  3A0S A;  4GD6 A;  4BBU A;  3JVV A;  4YFM A;  4YIN A;  3IXH A;  4D2O A;  1YMS A;  5DJU A;  4KEN B;  3UN7 A;  5JYP A;  1FIL A;  2B95 A;  3Q7V A;  2XSS A;  3ICY A;  2X02 A;  5HPI A;  5AQ7 A;  1KVM A;  2O9C A;  5HDD A;  4BD1 A;  2R78 A;  3UE1 A;  1OT6 A;  2ZQA A;  4X1M A;  5EV0 A;  4R4R A;  4L9E A;  5CEB A;  1T18 A;  3QNB A;  2VGL M;  3VFF A;  4D60 A;  1K56 A;  5CED A;  3OBF A;  4GN2 A;  5M1A A;  1BLP A;  1XXM A;  1M40 A;  1YM1 A;  4KZ4 A;  4KZA A;  3BFE A;  1NRJ A;  4KG5 A;  5AQ9 A;  1M6K A;  3Q7V B;  3T4O A;  3BFC A;  1W63 Q;  3VOY A;  5HDS A;  2ZM2 A;  4WEJ A;  2B5R A;  3C7U A;  4BMW A;  1TS0 A;  4E3J A;  3VOZ A;  1KDS A;  2VLG A;  2V8F A;  3KX0 X;  1E3U D;  5FQI A;  4BEN A;  2JKT I;  1K57 C;  1FCO A;  1N9N A;  2HF6 A;  2DCF A;  1IYP A;  2WKH A;  3HCY A;  3HLC A;  3MQO A;  2XK1 A;  4N92 A;  3C7V A;  3BFG A;  4UQI S;  3A3J A;  4JLF A;  2HJ9 C;  4I39 A;  2KLI A;  1XJ6 A;  3O5Y A;  4ZTK A;  3GDI A;  2EFU A;  2JHE A;  2XH9 A;  3HBR A;  4HH3 A;  5HAP A;  3R7W A;  3LIC A;  1D7E A;  4I38 A;  1E25 A;  5DFY A;  4XUX A;  1ZC2 A;  2VA0 A;  2V2F F;  4JF4 A;  3HL9 A;  5AVE A;  1MWU A;  2WGW A;  4FUW A;  2ZM8 A;  2XFT A;  2HP5 A;  1UWN X;  4KG2 A;  3MS6 A;  3DTK A;  4ZDX A;  2V1A A;  4K0X A;  4O0P A;  4P6B A;  1J3W A;  2WAE A;  1ONH A;  2XFS A;  1CJF A;  1E4D A;  1YLJ A;  1L0G A;  4EUZ A;  2QJ5 A;  1TDL A;  1K54 A;  1K57 A;  5EM1 A;  2HGV A;  2O9B A;  4CLC D;  5HSQ A;  1O07 A;  3H82 B;  2LB9 A;  2JC7 A;  4YWZ A;  4ESP A;  2DNS A;  2PYP A;  1HD8 A;  1CI8 A;  4U0X A;  1PRQ A;  4N9K A;  5A90 A;  3PR6 A;  2JKR I;  2EWW A;  4OQI A;  2J7V A;  3LCE A;  3F1P A;  1ODV A;  1OJG A;  2QHK A;  3BEC A;  5FA7 A;  3A3F A;  2P08 A;  3WWX A;  4IVK A;  4Y0T A;  2NUP C;  3T1X A;  1MXO A;  4N1H A;  5L2F A;  4OQH A;  1E3U A;  3LFV A;  1CQA A;  3MKE A;  5M19 A;  2WKQ A;  4LRY C;  2PAV P;  3LI9 A;  4HH2 A;  2EX9 A;  4I3A A;  5EM0 A;  3F1N A;  5HX9 A;  3S1Y A;  4C75 A;  1Q2P A;  1VM1 A;  4JGQ A;  4R6L A;  2PHY A;  3RXW A;  3FYZ A;  1K6R A;  3G32 A;  4JXW A;  3OPH A;  2PBD P;  3HJI A;  3OPL A;  3MZD A;  1SKF A;  4PM6 A;  1GHP A;  3EWK A;  3LIB A;  3A0R A;  1PNE A;  2G2U A;  3KSH A;  3IXG A;  1PYY A;  2BTF P;  1ACF A;  1LLB A;  1BUE A;  1LI9 A;  4GB7 A;  3IS2 A;  3U4L P;  5F69 A;  4EXO A;  2HV1 A;  1H3Q A;  2V9A A;  3GSG A;  5DTS A;  4WEL A;  3LIE A;  2PD8 A;  3GR2 A;  4Y0O A;  3BFD A;  1W7F A;  5HDC A;  3ITB A;  3QP5 A;  1PWD A;  2A49 A;  4DMZ A;  4JGO A;  3VP3 A;  4KUO A;  3EGX C;  3A3E A;  3VE4 A;  1NZO A;  5J3W A;  4R3J A;  3ISG A;  4P0M A;  3E2K A;  3IS2 B;  1VHM A;  3SZT A;  4DE2 A;  2XRO A;  1LSX A;  4EEU A;  1ONG A;  4DE1 A;  1WE4 A;  4HBU A;  3PBT A;  1GA0 A;  4UA7 A;  1KE0 A;  1GSW A;  3MQ0 A;  5KMW A;  2XD5 A;  2EA9 A;  4HBT A;  3M6H A;  1MPL A;  1F5M A;  2NUT C;  3LUQ A;  1TS7 A;  4GW9 A;  1G5U A;  3MZE A;  3Q1F A;  3IH9 A;  3IF6 C;  4LEN A;  1XFN A;  5DF9 A;  3NOP C;  1CF0 A;  4FH2 A;  2IWC A;  2ZC5 B;  3MMH A;  1YKD A;  3BFF A;  3FPW A;  1NRF A;  3V67 A;  3ZDJ A;  2QKP A;  3N7W A;  2P7J A;  3L7H A;  4MBK A;  1VB6 A;  3HLW A;  5F1F A;  1JWP A;  1K38 A;  3UMD A;  2WKR A;  3HUN A;  1T1C A;  3IWI A;  3G35 A;  3OZH A;  1BZA A;  5GLA A;  2H0T A;  1XFQ A;  5L09 A;  3LR5 A;  3B3X A;  3CPT B;  3GVB A;  3JPU A;  1IFQ A;  5FQQ A;  3HRE A;  2PR6 A; 
#chains in the Genus database with same CATH homology
 2IWD A;  2PU2 A;  4N9L A;  3TOI A;  4GOG A;  4LCL A;  3SH9 A;  2XEP A;  4DE0 A;  3IHB A;  4UHU A;  3O87 A;  5CRF A;  1IEL A;  1K25 A;  2WGV A;  1ZG6 A;  3MKF A;  4JXS A;  5GLB A;  3ZVW A;  1YLW A;  1W8Q A;  4LCM A;  3MXS A;  3VP4 A;  3HLG A;  4OQ0 A;  5CTN A;  4E3M A;  5JYO A;  4WM9 A;  1ERQ A;  5FAQ A;  1L2S A;  3PAE A;  3HLD A;  1TDG A;  3GTC A;  3E2L A;  2X01 A;  3W4P A;  1RGY A;  5E2H A;  4JBF A;  4DDS A;  3N8R A;  1XA7 A;  2WZX A;  4S2I A;  3EQV A;  4BD0 A;  3VSK A;  5DF8 A;  3S4X A;  2XGN A;  4XUZ A;  3FKW A;  3G4P A;  3FKV A;  3G30 A;  4HES A;  3WS0 A;  3DWZ A;  3HVF A;  3A3D A;  5GHY A;  4U0T A;  3CMZ A;  3NDE A;  3AGE A;  5F82 A;  5E2E A;  3LO7 A;  1K4E A;  4WYY A;  3O88 A;  3JYI A;  3NCK A;  3NC8 A;  1DY6 A;  4RX2 A;  4S2M A;  1JWZ A;  5EOE A;  5IHV A;  4WMC A;  5E2F A;  4HEF A;  1MBL A;  2ZC3 B;  3Q07 A;  5F1G A;  5CER A;  3ZHH A;  4BQM A;  4GD6 A;  4M3K A;  4X53 A;  3Q82 A;  3QHY A;  3G31 A;  4YFM A;  4YIN A;  3IXH A;  2Y2P A;  1K55 C;  4MBF A;  4D2O A;  2OLV A;  2ZQ7 A;  1YMS A;  3W4Q A;  5FQJ A;  5DVA A;  2BG1 A;  4KEN B;  3D4F A;  1HVB A;  3UN7 A;  2WKI A;  2XD1 A;  3IF6 B;  5JYP A;  2C5W B;  3Q7V A;  1FR1 A;  4R0Q A;  3GMW A;  4R4S A;  3RJU A;  4E3L A;  1WYB A;  3UPN A;  4OPQ A;  4MEZ A;  1QMF A;  4RYE A;  3NIA A;  1ES2 A;  1TEM A;  2X02 A;  5M18 A;  1H8Z A;  5AQ7 A;  1PIO A;  3V3S A;  1Z6F A;  1KVM A;  1YT4 A;  4GDB A;  2WGW B;  3M6B A;  2WAF A;  4S2P A;  4BD1 A;  4WZ5 A;  3UE1 A;  3O86 A;  5EE8 A;  1MWR A;  4QB8 A;  3UY6 A;  2WZZ A;  1EWZ A;  4DXB A;  3SH8 A;  3N8S A;  2ZQA A;  4R1G A;  1GCE A;  2ZD8 A;  3GQZ A;  2JCH A;  1ZKJ A;  4KZ3 A;  4OP8 A;  5EVI C;  3NDG A;  4DKI A;  4R4R A;  5A91 A;  5CEB A;  3PTE A;  3QNB A;  3VFF A;  2Y2Q A;  4DRT A;  2QZ6 A;  1N4O A;  2Y91 A;  4DE3 A;  1IYQ A;  4WBG A;  3ZG8 B;  1K56 A;  5CED A;  1PZP A;  2G2W A;  4FCF A;  3C5A A;  1C3B A;  2ZQ9 A;  1I5Q A;  4KZ7 A;  5HFO A;  4GN2 A;  3PBN A;  2ZM0 A;  4OOL A;  5CGW A;  5M1A A;  4ZJ3 A;  1BLP A;  1XXM A;  1M40 A;  1L0E A;  1YM1 A;  4KZ4 A;  3SS3 A;  3ZVT A;  1QME A;  5EPH A;  4KZA A;  2H10 A;  1K56 D;  2OV5 A;  4IBX A;  1JTD A;  3BFE A;  2HDS A;  4KG5 A;  2RCX A;  4E3O A;  5AQ9 A;  4UAA A;  4EBL A;  4KQO A;  1M6K A;  1KE3 A;  3PBS A;  3Q7V B;  5E2G A;  5HW3 A;  4MNR A;  4O7D A;  3BFC A;  4L0L A;  5E43 A;  2V20 A;  3VOY A;  1AXB A;  1ES4 A;  2ZM2 A;  4WEJ A;  2B5R A;  1IYS A;  4KZ9 A;  3GV9 A;  3Q81 A;  4DXC A;  3C7U A;  3IWO A;  4E3J A;  3WS1 A;  1G6A A;  4UA9 A;  3TG9 A;  3OC2 A;  3ZFZ A;  5HAI A;  3VOZ A;  4Q8I A;  1KDS A;  2EFX A;  5HAQ A;  2QMI A;  3VP0 A;  1E3U D;  1RCJ A;  2I72 A;  2Q9M A;  5FQI A;  3UO9 A;  3CJM A;  2R9X A;  4BEN A;  1K57 C;  1FCO A;  1Q2Q A;  4JXG A;  2DCF A;  3MBZ A;  1IYP A;  5GL9 A;  2HDU A;  4LV1 A;  1IKG A;  2WKH A;  2Y2O A;  3HLC A;  2WKE A;  1ZG4 A;  4DDY A;  2XK1 A;  1HTZ A;  3MFD A;  1CI9 A;  4N92 A;  4KG6 A;  1FQG A;  5FAT A;  3C7V A;  3BFG A;  1BLH A;  3A3J A;  4JLF A;  4KQQ A;  4ZTK A;  1RP5 A;  2E8I A;  1DJA A;  2ZJ9 A;  1NJ4 A;  1PW8 A;  4EV4 A;  2EFU A;  2Y59 A;  2XH9 A;  3HBR A;  3AGF A;  1PWC A;  4GD8 A;  5HAP A;  5EVI A;  1FSY A;  1BT5 A;  2X71 A;  1YLP A;  4ID4 A;  2Q9N A;  1E25 A;  1XP4 A;  2Y2L A;  3IF6 A;  1DJB A;  2R9W A;  3CG5 A;  4XUX A;  1ZC2 A;  2OSU A;  2Y2J A;  4MBH A;  4WEK A;  2V2F F;  5EVI D;  3LY3 A;  4JF4 A;  4B4Z A;  3VFH A;  4OH0 A;  3HL9 A;  5HL1 A;  1NZU A;  1MWU A;  2WGW A;  2ZM8 A;  2XFT A;  2ZMA A;  2Y2I A;  1PI4 A;  2HP5 A;  3ZGA B;  3VSL A;  3Q7Z A;  4PM9 A;  5FI7 A;  4KG2 A;  4CPK A;  2XR0 A;  5FI6 A;  3ZG5 A;  1BLS A;  4ZDX A;  3IXD A;  2J8Y A;  2P74 A;  4LV0 A;  4K0X A;  4X56 A;  1GA9 A;  3IHA A;  5FQ9 A;  1PWG A;  4N1X A;  4P6B A;  5I94 A;  3CZD A;  1BSG A;  2WAE A;  1ONH A;  3BLM A;  5F83 A;  2XFS A;  1E4D A;  1YLJ A;  1L0G A;  1KGE A;  5DF7 A;  2HDQ A;  1SDN A;  4DF6 A;  4EUZ A;  3FV7 A;  3GRJ A;  5FDH A;  5EVI B;  1TDL A;  4OP5 A;  1K54 A;  2H0Y A;  2ZQC A;  1HZO A;  1RGZ A;  1S0W A;  1K57 A;  2H5S A;  1H5X A;  2JBF A;  4JPM A;  3V39 A;  1O07 A;  1BLC A;  3MXR A;  3UPP A;  2JC7 A;  3V3R A;  4E6X A;  4QU3 A;  4S2J A;  4U3T A;  2DNS A;  2Y2N A;  3M2K A;  2PU4 A;  5CHJ A;  4RVA A;  3W8K A;  5FSR A;  3HUM A;  3VMA A;  1IKI A;  4MLL A;  4QY5 A;  4X68 A;  1HD8 A;  1CI8 A;  2EX2 A;  1FCM A;  1IYO A;  4GDN A;  4LV3 A;  3DW0 A;  2ZQD A;  4LV2 A;  4U0X A;  2EX6 A;  4Y0U A;  4N9K A;  5A90 A;  1MWS A;  4GKU A;  2EX8 A;  3C4O A;  2HPB A;  3VP1 A;  4C3Q A;  3G2Y A;  5BOH A;  3DTM A;  4OQI A;  2WK0 A;  2J7V A;  1ERO A;  2XF3 A;  5J8X A;  5CGX A;  1XA1 A;  2GDN A;  5KSC A;  4JXV A;  3WS2 A;  5G18 A;  5CHU A;  4EBN A;  3OPP A;  2HDR A;  3LCE A;  3S22 A;  2XDM A;  1ALQ A;  3UNW A;  5CEC A;  3ZG0 A;  1CK3 A;  2V1Z A;  4NET A;  1CEG A;  1XGJ A;  1ES3 A;  1YLT A;  2FFY A;  3UE3 A;  3FZC A;  3BEC A;  3NY4 A;  5FA7 A;  3A3F A;  3WWX A;  3N4I A;  3LEZ A;  1W79 A;  1MKI A;  1G68 A;  4FH4 A;  4IVK A;  5EUA A;  4Y0T A;  5A92 A;  3PBR A;  4PM8 A;  1NY0 A;  2WGI A;  1MXO A;  4N1H A;  3ZG7 B;  5L2F A;  1O7E A;  4OQH A;  5EOO A;  1S6R A;  4FD8 A;  1E3U A;  5FI2 A;  3UE0 A;  5GLD A;  4X6T A;  4PMA A;  3MKE A;  4K0W A;  5M19 A;  3HLE A;  1KGF A;  1VQQ A;  4PPR A;  1MY8 A;  4X55 A;  3QNC A;  1KDW A;  4A5R A;  4E3N A;  5EVL A;  1K55 A;  2EX9 A;  3HLB A;  2HP9 A;  3IF5 A;  1ESU A;  4E6W A;  5HX9 A;  3S1Y A;  4C75 A;  5AQA A;  3PAG A;  3LY4 A;  1Q2P A;  5CHM A;  2WYX A;  4E3I A;  1VM1 A;  3P09 A;  1EI5 A;  5CXW A;  2ZC6 B;  4QY6 A;  3WS5 A;  3M2J A;  4BLM A;  3RXW A;  3FYZ A;  2Z2M B;  1K6R A;  3G32 A;  4GNU A;  4JXW A;  1SCW A;  2WUQ A;  3TSG A;  4H8R A;  2Y2G A;  4OQG A;  3OPH A;  3OPL A;  1NYY A;  4ZBE A;  1KVL A;  3VP2 A;  4B4X A;  3G2Z A;  3MZD A;  5KZH A;  4PM7 A;  1SKF A;  4PM6 A;  2EXB A;  4OON A;  1GHP A;  4OPR A;  4P85 A;  1XKZ A;  3W4O A;  4OPY A;  2G2U A;  3V50 A;  1LL9 A;  3PBO A;  4KZB A;  1PZO A;  2UWX A;  4QD4 A;  1FR6 A;  3IXG A;  1PYY A;  3IQA A;  4S2N C;  1H8Y A;  1LLB A;  3WS4 A;  4WZ5 C;  1BUE A;  1LI9 A;  4GB7 A;  5DTK A;  2J9O A;  4R23 A;  5D3O A;  4QJG A;  1KGG A;  4RA7 A;  1IEM A;  1Y54 A;  3ZG9 B;  5GHX A;  1MWT A;  1FSW A;  3GSG A;  4GZB A;  5DTS A;  4WEL A;  2QPN A;  1WYC A;  4KZ6 A;  5AQB A;  3IWQ A;  4IVI A;  3GR2 A;  3P98 A;  2Y2H A;  4Y0O A;  3O3V A;  4OOY A;  3N8L A;  3WRZ A;  2ZC4 B;  3BFD A;  1W7F A;  3SOI A;  3N6I A;  4WZ4 A;  3ITB A;  4UA6 A;  4F94 A;  4Y7P A;  1LI0 A;  1PWD A;  4X69 A;  1LL5 A;  1NXY A;  2A49 A;  1GHM A;  4ZAM A;  2IWB A;  2EXA A;  3BEB A;  3SS4 A;  1N9B A;  4ZJ2 A;  3IH8 A;  3IXB A;  3VP3 A;  4OLD A;  4CJN A;  1SHV A;  3A3E A;  1ESI A;  3DWK A;  3OCL A;  2HP6 A;  1NZO A;  3A3I A;  1OME A;  2P9V B;  4R3J A;  2A3U A;  3ISG A;  2XQZ A;  5FAS A;  4S2K A;  3UDF A;  4P0M A;  3E2K A;  2Y2K A;  4OPZ A;  4DE2 A;  4NK3 A;  2Y4A A;  3MZF A;  1CEF A;  4RX3 A;  1ONG A;  3BYD A;  4DE1 A;  1WE4 A;  1U60 A;  4P87 A;  4HBU A;  4WMC D;  5FAP A;  1YLZ A;  2VGJ A;  4JF6 A;  5FQK A;  3PBT A;  4OLG A;  4OVD A;  4B88 A;  1GA0 A;  4UA7 A;  5FQM A;  3V5M A;  3IT9 A;  1KE0 A;  1YQS A;  4JKT A;  1I2W A;  5TFQ A;  1NYM A;  2RL3 A;  2Y55 A;  5KMW A;  4Z9Q A;  2XD5 A;  1PI5 A;  5CTM A;  5U47 A;  1W5D A;  1W8Y A;  4HBT A;  5GLC A;  3UPO A;  5KSH A;  2J9P A;  3M6H A;  4S2N A;  2JE5 A;  4S2L A;  1MPL A;  1K6S A;  1L0F A;  3BRM A;  5TGF A;  4BL3 A;  1XX2 A;  5CGS A;  3SH7 A;  2ZC7 A;  4KZ5 A;  3MZE A;  3Q1F A;  3IH9 A;  3ZNT A;  1L0D A;  1SDE A;  5EEC A;  3IF6 C;  4LEN A;  5TR7 A;  4R3B A;  2C6W B;  2BLS A;  3RXX A;  4KZ8 A;  4S2O A;  1BUL A;  2CC1 A;  5DF9 A;  4FH2 A;  3OCN A;  2IWC A;  2OLU A;  4EWF A;  1YLY A;  2ZC5 B;  1PW1 A;  1BTL A;  3BFF A;  1JTG A;  1ES5 A;  3EQU A;  4EQI A;  1FCN A;  4BJP A;  3ZCZ A;  1NRF A;  2ZLY A;  2Y2M A;  1KE4 A;  3G34 A;  3ZDJ A;  4C6Y A;  4E3K A;  3UDX A;  1I2S A;  3N7W A;  3HLF A;  1K4F A;  4PM5 A;  4MBK A;  3BM6 A;  5FAO A;  3BLS A;  3OPR A;  4OOM A;  3HLW A;  5HAR A;  1JWP A;  1K38 A;  4BL2 A;  5F1F A;  2WAD A;  4JF5 A;  1DJC A;  3NBL A;  3I7J A;  4FSF A;  1TVF A;  3HUN A;  1XGI A;  4KQR A;  1GHI A;  2Z2L B;  4OKP A;  3C4P A;  3ITA A;  2VGK A;  2FFF B;  1FOF A;  1LHY A;  5DTT A;  1JWV A;  2XLN A;  3IWI A;  4QHC A;  1JVJ A;  1K54 C;  3G35 A;  3OZH A;  3PBQ A;  4K91 A;  5GHZ A;  1BZA A;  2ZQ8 A;  5GLA A;  1J9M A;  2PBY A;  5A93 A;  2H0T A;  3ZNY A;  3HUO A;  4EBP A;  3FWL A;  3SS5 A;  3UDI A;  4XXR A;  4IBR A;  3WRT A;  4IED A;  1YMX A;  1XPB A;  3AGD A;  3B3X A;  3GVB A;  4ZJ1 A;  1ERM A;  2P9V A;  3NI9 A;  5FQQ A;  3HRE A;  2DRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...