4Z9QA

Crystal structure of oxa-58 with disordered active site
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
242
structure length
223
Chain Sequence
SIIDQNVQALFNEISADAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFIANALIGLENHKATSTEIFKWDGKPRTVPVYQELARRIGPSLMQSELQRIGYGNMQIGTEVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQQVKEMLYVERRGENRLYAKSGWGMAVDPQVGWYVGFVEKADGQVVAFALNMQMKAGDDIALRKQLSLDVLDKLGVFHY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase OXA-58
publication title Crystal structure of OXA-58 with disordered active site
rcsb
source organism Acinetobacter baumannii acicu
molecule tags Hydrolase
total genus 68
structure length 223
sequence length 242
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4z9qA00
2R9XA 5E2HA 2OV5A 3V3RA 4QY5A 2WKEA 2IWDA 2PU4A 3IF5A 4MBKA 5EOEA 4QY6A 4LV0A 3IH9A 5DF9A 1AXBA 4N9KA 5EUAA 4DE2A 1DJAA 3A3IA 3M2KA 3SS3A 1EWZA 3OPLA 3PTEA 3NCKA 3QNBA 1TDLA 4ZTKA 2XQZA 3GR2A 2X01A 1GA9A 2XEPA 2ZQ7A 3B3XA 3BFCA 5EVIA 2X02A 3SH9A 4N92A 2HP9A 3UE0A 4BJPA 3IWOA 3LEZA 4L0LA 2ZQCA 4KZ5A 4WZ5A 4BLMA 1ESIA 2IWCA 3MFDA 3I7JA 2Z2LB 3IXGA 4LV2A 4A5RA 3ISGA 4JF6A 2Y2NA 5A92A 2B5RA 1Q2PA 2Y2KA 4DDYA 3DWZA 4FCFA 3ZHHA 1YLWA 3NIAA 2H10A 3CMZA 4U0TA 1SCWA 2Y2OA 1L2SA 3SS4A 5CECA 3SH7A 2A49A 1JTGA 1MWRA 2Y2QA 2ZJ9A 4UA7A 4Y0TA 4JBFA 4GOGA 1H8ZA 2WKIA 2XD5A 4OOLA 4EV4A 4KG2A 1YMSA 3UE3A 1KGEA 4BD1A 4OPZA 3UPPA 3ZG8B 1FSYA 1BLCA 1VQQA 1GHMA 4BQMA 4R3BA 4LENA 3C4PA 3ZVWA 3VP3A 1K4FA 4QU3A 4R4SA 3OC2A 4Y0UA 3N8SA 3OZHA 5E2EA 1KE0A 4OVDA 2A3UA 2WGWA 4BENA 4K0WA 2DNSA 4KZ8A 4MBHA 5CRFA 1I5QA 3G31A 4JXWA 4GNUA 1PIOA 4IBXA 3C4OA 5DTKA 2EFUA 4WZ5C 3V50A 4B4ZA 1NY0A 1PI5A 1JVJA 3BEBA 3Q7VB 1H5XA 4QD4A 4WM9A 5D3OA 4XUXA 5A90A 4DE1A 1IYPA 4KQOA 2J8YA 3IXBA 3BLMA 4P85A 1KDSA 1ZG6A 3BECA 4JF4A 3ZG0A 4JXGA 3PBRA 4IVKA 4YFMA 2ZM0A 2ZQAA 2HDRA 3BFEA 4NETA 2XK1A 4X56A 1IYOA 2HP6A 2WAFA 1CI9A 4GDBA 4OPQA 4WEJA 3IXDA 3PAGA 5EVLA 4OQIA 2FFFB 2V1ZA 2H0YA 5FI6A 1WE4A 4HESA 1LL5A 1HZOA 3CZDA 1E25A 1ES2A 5EPHA 1FR6A 2V2FF 3GSGA 4R0QA 2JE5A 3GVBA 5AQ7A 2JCHA 3NC8A 1ONHA 5FATA 3VFFA 5HFOA 2P9VB 4KG6A 1N9BA 4KZ7A 4B88A 1GA0A 1Q2QA 1YLPA 3MZEA 5F1GA 2DCFA 1KGFA 2QMIA 3Q1FA 2EXAA 3PBSA 1RGZA 5U47A 3UDXA 5KSCA 1SHVA 4MEZA 1PZOA 4S2PA 3FYZA 3BFDA 3W4QA 1LI9A 3ZGAB 5CTMA 1XA7A 4N1XA 4ZJ2A 3MKFA 4GD6A 3GQZA 1BLSA 1N4OA 3RXXA 5KZHA 5HAIA 2X71A 4ZJ1A 1FQGA 4OLDA 2Y91A 2G2WA 5J8XA 4ID4A 3NI9A 3BLSA 3BM6A 4DF6A 1QMFA 5I94A 1PYYA 4JXSA 1IELA 1ALQA 1JWVA 3VOZA 3ZG9B 1HTZA 3FKVA 4OQGA 4XXRA 2ZM8A 3W4OA 1KDWA 4OP5A 4BD0A 3ZNYA 4C75A 3HREA 1PW8A 2ZM2A 3C7UA 3G2YA 3PBTA 4CPKA 4MLLA 4JXVA 4DXCA 1I2SA 5M19A 2RL3A 2ZC7A 3N8LA 3PAEA 4KZ6A 2ZD8A 2EX6A 3FKWA 2WGVA 3G30A 4OH0A 1S0WA 4OPRA 4ZBEA 4BL2A 4DKIA 4GZBA 2OSUA 3WS1A 4B4XA 4Z9QA 1S6RA 1IEMA 3VSKA 3HLBA 2DRWA 3JYIA 1CEFA 4IEDA 4UA9A 1K54A 3GRJA 1BSGA 3PBNA 4MNRA 2WGIA 1NXYA 3A3FA 4WEKA 2H0TA 4P87A 1QMEA 5DF8A 4D2OA 1FCMA 5AQ9A 4C6YA 1O7EA 3HUMA 3NY4A 4KQQA 4RX2A 1W7FA 5GHYA 1SDEA 1YLZA 5CGXA 2OLUA 3M6HA 4OLGA 2G2UA 3A3DA 1K55A 4U0XA 5M18A 4S2LA 2ZQ9A 3CJMA 3UPOA 2Y2LA 3C5AA 3O86A 2WK0A 4X55A 2WZZA 3HLFA 4OQHA 3SS5A 3ZVTA 1K56D 4KG5A 3DWKA 2CC1A 3WRTA 5EVIB 2WYXA 3N6IA 3VP0A 1K57C 5DTTA 5DTSA 3HLGA 1BULA 4KZ4A 5EOOA 1BUEA 2Y2PA 1KE3A 3VFHA 4RVAA 1KVLA 1MXOA 4S2NA 5CHJA 4KQRA 3MXRA 2XDMA 1NRFA 3HUOA 3NBLA 3SH8A 4KENB 4RX3A 1PW1A 2WKHA 3IT9A 3WRZA 1E4DA 4Y0OA 3IF6A 2EX9A 4DRTA 1G6AA 4PPRA 2EX2A 5FQJA 1G68A 2HP5A 3ZG5A 1MPLA 5E2FA 1K4EA 3W8KA 5EVIC 1XXMA 2Y55A 2PBYA 4IVIA 3BRMA 3C7VA 2V20A 1BZAA 3ITAA 1W79A 1ES4A 3IWQA 3WS5A 4U3TA 1KVMA 1MWUA 5G18A 1TEMA 4R1GA 1LLBA 1GCEA 1RCJA 4E3MA 1J9MA 3UDIA 1IYSA 1DJCA 3DTMA 5GLDA 3V3SA 1GHIA 2VGKA 2FFYA 4OPYA 5F1FA 4HBTA 3S4XA 5KMWA 3HLWA 3UY6A 1FR1A 4JPMA 3UN7A 3WWXA 3Q07A 4QB8A 4X53A 4LV3A 3UO9A 1DY6A 1XP4A 3Q81A 4GKUA 3E2LA 3LO7A 2WGWB 4QJGA 2Y59A 1YLTA 2HDUA 3GMWA 3LY3A 5FAQA 3W4PA 1NYYA 3HBRA 1SDNA 3OPHA 5HL1A 4GD8A 5A91A 1WYCA 3OCLA 3IF6C 4QHCA 5JYOA 3MZFA 4E6XA 2HDSA 3AGEA 4YINA 4OQ0A 5HAPA 1K6RA 2P74A 5HAQA 3G2ZA 4KZBA 2PU2A 3D4FA 4OOYA 1K56A 2ZMAA 3G35A 5FQ9A 1SKFA 2QZ6A 4GB7A 4EBPA 5FAOA 4WMCD 5L2FA 5KSHA 3Q7ZA 2ZQ8A 5DF7A 3PBQA 1ZC2A 4R4RA 1NJ4A 4HEFA 2WADA 1XGIA 3GTCA 4PM6A 4PMAA 3WS0A 4EBLA 1BTLA 4ZDXA 1L0DA 4FSFA 4FH4A 3IH8A 5FQMA 1HD8A 3WS2A 4KZ3A 4JF5A 2UWXA 5EECA 1FCOA 1KGGA 3EQUA 4R3JA 2C5WB 4NK3A 5FQQA 3IHAA 1FSWA 3G34A 1PWGA 4FH2A 4OKPA 1O07A 4X69A 1ERMA 1LI0A 3BFFA 5CXWA 5AQAA 2XGNA 1U60A 4WYYA 5CEBA 3VOYA 4S2OA 4OOMA 2QPNA 1L0FA 5GHZA 2WUQA 3O3VA 2H5SA 3ZG7B 4C3QA 3FWLA 1Y54A 5GL9A 3QNCA 5CHUA 5E43A 4ZAMA 2Q9NA 1CK3A 1M40A 3BYDA 3M2JA 2VGJA 5CHMA 4EBNA 2XFSA 1KE4A 3UDFA 4UA6A 2J9PA 3N8RA 3O88A 2C6WB 3HL9A 4P6BA 3VP2A 1Z6FA 4GDNA 3VSLA 4P0MA 5HX9A 4WZ4A 2ZC5B 1W5DA 4PM9A 1ESUA 3TG9A 4LCLA 1ZG4A 2HDQA 2OLVA 3ITBA 3IWIA 1W8QA 4KZ9A 2XR0A 1PI4A 1YLJA 3LCEA 3Q82A 1IYQA 4E3IA 1YT4A 1LHYA 4MBFA 2I72A 4DXBA 1XPBA 4FD8A 3RXWA 3UNWA 4E6WA 1E3UD 2JC7A 4OP8A 1JWZA 2XD1A 1JWPA 1RGYA 3LY4A 1K25A 4PM8A 3RJUA 5CERA 1XX2A 4X68A 4H8RA 3HVFA 4WMCA 4OONA 1RP5A 4R23A 4XUZA 3A3JA 2XLNA 4E3LA 2XFTA 1I2WA 4EUZA 1TVFA 2ZQDA 3VMAA 5GLCA 1LL9A 3ZNTA 4S2MA 5BOHA 1MY8A 2XF3A 4S2IA 5IHVA 1MWTA 2BG1A 3VP4A 4UHUA 4KZAA 3HLDA 3TOIA 4PM7A 5FA7A 1EI5A 3WS4A 2WZXA 3ZCZA 4GN2A 5FASA 1K54C 2GDNA 3OPPA 1K6SA 3Q7VA 5F82A 3S1YA 3A3EA 1L0GA 2J7VA 3P98A 5HW3A 2ZC4B 5GLBA 5TGFA 3P09A 4IBRA 2HPBA 1PWDA 1M6KA 2RCXA 2XH9A 1YMXA 5TR7A 3G4PA 1W8YA 1K55C 4Q8IA 2R9WA 3EQVA 4E3KA 4E3OA 1JTDA 3IF6B 3IQAA 1BT5A 3NDEA 3HLEA 1ES3A 1MKIA 1CEGA 3NDGA 4O7DA 3FV7A 1ES5A 5CGSA 5M1AA 2Y2GA 5HARA 5EE8A 1NZUA 4LCMA 2EFXA 3BFGA 3IHBA 3TSGA 2Y4AA 2Y2IA 4X6TA 3S22A 3AGFA 5FI2A 3FZCA 3M6BA 5FQKA 1ZKJA 1YM1A 3N4IA 4S2NC 4UAAA 3MBZA 2P9VA 5FAPA 1MBLA 2Y2HA 2Z2MB 3VP1A 4JKTA 2J9OA 1H8YA 4S2KA 2ZC3B 1TDGA 2JBFA 3DW0A 1HVBA 4N1HA 4M3KA 2IWBA 3ZDJA 5CEDA 5FSRA 1FOFA 3G32A 1E3UA 2ZC6B 3QHYA 1CI8A 5EVID 4BL3A 4WELA 3N7WA 1IKIA 4E3JA 4DE0A 2Y2JA 4JLFA 3UE1A 1NYMA 3GV9A 3MZDA 1C3BA 4K0XA 3V39A 5A93A 1NZOA 2Q9MA 4WBGA 4LV1A 5GLAA 3O87A 1FCNA 4F94A 4DE3A 4EQIA 4HBUA 1OMEA 1BLHA 1K38A 1YLYA 5AQBA 1EROA 5DVAA 3PBOA 5FQIA 3AGDA 3E2KA 2Y2MA 2EX8A 1PZPA 3CG5A 1ONGA 5E2GA 4S2JA 1DJBA 3HLCA 1WYBA 4Y7PA 1GHPA 4RYEA 5TFQA 3UPNA 2BLSA 3OCNA 2E8IA 1YQSA 4K91A 5F83A 1ERQA 4CJNA 4N9LA 5CTNA 1XGJA 4ZJ3A 1MWSA 2ZLYA 3MKEA 3IXHA 3SOIA 3HUNA 5GHXA 5FDHA 5CGWA 1L0EA 5FI7A 4EWFA 1IKGA 3OPRA 1BLPA 4DDSA 5JYPA 1VM1A 1XKZA 4PM5A 2EXBA 3ZFZA 1K57A 1XA1A 4RA7A 1PWCA 3MXSA 4E3NA 3V5MA 2WAEA
chains in the Genus database with same CATH superfamily
2WKEA 4LV0A 2LB9A 3IH9A 5DF9A 3U4LP 3PTEA 1TDLA 2A2LA 4ZTKA 3MMHA 3GR2A 2XEPA 1S4SA 5HDDA 2X02A 3SH9A 4N92A 4NEED 5FL3A 2I9VA 3IWOA 3CUEC 2ZQCA 4HJ4A 1OTAA 2XROA 1PRQA 4LV2A 3IXGA 4JF6A 2JHEA 2ZOHA 4NKPA 5L10A 1YLWA 2H10A 3CMZA 4U0TA 3QP8A 2A49A 3IX4A 4UA7A 4Y0TA 3C8CA 1H8ZA 2D02A 1YMSA 3UE3A 4OPZA 1UGUA 4R3BA 4I3JA 4LENA 4WL9A 5FEFA 3C4PA 4QU3A 4R4SA 3O5YA 3OZHA 1J3WA 2WGWA 4MBHA 1I5QA 4GNUA 2B95A 1JVJA 3NULA 4XUXA 4KQOA 3BLMA 1ZG6A 3ZG0A 4YFMA 2K31A 1OTEA 4G3VA 2V1ZA 4K08A 1E25A 2JCHA 3RFBA 2P9VB 1N9BA 4NXEA 1XFQA 4G3KA 3PBSA 2EWVA 1PZOA 1LI9A 4R6LA 1XA7A 4N1XA 4ZJ2A 1BLSA 1N4OA 4NXFA 3T4QA 5L8MA 5HAIA 1FQGA 3CPTB 3DAVA 2Y91A 2G2WA 3BM6A 1PYYA 1IELA 1ALQA 3ZG9B 3TE8A 2ZM8A 3HREA 1OT6A 2OAQ1 4GS9B 1I2SA 3PAEA 4HIAA 2PR6A 3C30A 3G30A 2WGVA 4OH0A 3RH8B 4DKIA 1S1YA 3HLBA 2L0WA 1BSGA 4MNRA 2WGIA 5FEGA 1QMEA 2O99A 5AQ9A 4MMNA 3NY4A 3NOTC 3H7WB 2W3FA 2FZ0A 2OLUA 2G2UA 3A0VA 3A3DA 4LPZA 3EEAA 2JKRM 1EW0A 3C5AA 3T4SA 5DFYA 1K56D 4H6JA 2ACGA 2CC1A 2WYXA 1K57C 5HD5A 1BULA 2L1MA 5EOOA 1BUEA 3T4KA 3VFHA 4RVAA 4KQRA 1NRFA 4KENB 1E4DA 4Y0OA 1G6AA 2EX2A 4MN6A 5FQJA 1G68A 2HP5A 3W8KA 5EVIC 1XXMA 4IVIA 2V20A 1ES4A 3LIFA 1TEMA 1D7EA 1LLBA 1RCJA 2HV1A 1N9LA 1BYWA 1GHIA 4HY8A 2V9AA 4JPMA 3Q07A 4QB8A 4X53A 3H82A 3ULFA 4Y2FA 4QJGA 3HJIA 3R7WB 2HDUA 1SDNA 4QHCA 5JYOA 3MZFA 2HDSA 4YINA 4BBVA 5MC7A 1NLZA 2EA9A 2P74A 3G2ZA 4KZBA 4OOYA 1S66L 2ZMAA 1SKFA 2QZ6A 5L2FA 2ZQ8A 2Z6DA 4R4RA 1NJ4A 4HEFA 1XGIA 3OBFA 2VKSA 2W3HA 4Y3IA 4EBLA 4FH4A 3IH8A 3WS2A 4D60A 2AVXA 4P6ZS 1FCOA 1XJ3A 1PWGA 4FH2A 4OKPA 1ERMA 1LI0A 4O01A 5CXWA 1TS8A 2XGNA 4EU0A 4WYYA 5CEBA 2QPNA 1L0FA 3S7NA 2WUQA 3ZG7B 3MQOA 1GSVA 4LRYC 5E43A 2O0YA 2PHYA 1CK3A 1M40A 2HF6A 3M2JA 2VGJA 1KE4A 5EM1A 3UDFA 4UA6A 2C6WB 3VP2A 3VSLA 4P0MA 2ZC5B 3GECA 3TG9A 4BMWA 2PD8A 1PI4A 3S7QA 1YSPA 1YT4A 4MBFA 4I38A 3UNWA 1YPRA 3F1PB 4PM8A 3KSGA 2ZL1A 5J7EA 3C2WA 5CX7A 4OONA 4E3LA 4JGOA 2XFTA 4Z1WA 3VMAA 1LL9A 1STZA 1MY8A 1P97A 2H28A 4X1LA 3KYZA 3TOIA 4EETB 2WZXA 4L9EA 1K54C 5IS1A 3OPPA 1K6SA 1PFLA 5TGFA 4GJ4A 2HPBA 5HDCA 2XSSA 3G4PA 1LSVA 1W8YA 4E3KA 3BY9A 3NDEA 1ES3A 3P7NA 3FV7A 5CGSA 2Y2GA 4PKYG 3BFGA 2Y4AA 4X6TA 5FQKA 3UB5P 2P9VA 4MCWA 3LIDA 1Z09A 2J9OA 1H8YA 2ZC3B 2YKHA 1HVBA 3G6OA 3UB9A 3IBRA 1E3UA 4WELA 3N7WA 3LGOA 4E3JA 5HSQA 4JLFA 2V1AA 3MZDA 1S1ZA 4BWIA 4WBGA 4LV1A 2W3GA 3CPTA 4JGQA 1FCNA 4F94A 2M1CA 4EQIA 2DMWA 5F5YA 5J3WA 1YLYA 2GZAA 5DVAA 5FQIA 2VJWA 2Y2MA 2P04A 1ONGA 2ZOIA 4YOFA 4GS9A 4RYEA 5TFQA 2BLSA 1ERQA 3LYXA 4N9LA 3ZYTA 2QYBA 3PXPA 3KSFA 3HUNA 3T1XA 3UMEA 1XA1A 4RA7A 3LUQA 3MXSA 3V5MA 2WAEA 2R9XA 3H7WA 4II7A 5E2HA 3IF5A 5EOEA 4QY6A 1VHMA 1D06A 4DE2A 1JNUA 3M2KA 3SS3A 1EWZA 3QNBA 1GA9A 2ZQ7A 2XA7M 2V0UA 1FILA 4BJPA 3LEZA 4WZ5A 4BLMA 2IWCA 5DJUA 5EV0A 3BW6A 2QHKA 1OJGA 2Y2NA 5A92A 1Q2PA 4DDYA 3KYQA 1SCWA 1L2SA 3OLOA 2ZJ9A 4GOGA 4KG2A 5HD3A 3UPPA 3ZG8B 3LIAA 1BLCA 1K4FA 2KLIA 1YSQA 1KE0A 4OVDA 3T4LA 4K0WA 2DNSA 3JVVA 3R7WA 3V50A 2EFUA 4GCZA 2O9AA 1PI5A 3BEBA 1H5XA 5A90A 1ZTUA 2JKTM 4JF4A 4JXGA 3PBRA 4WUJA 2JN7A 2ZBBA 2VGLM 2HDRA 3BFEA 2XK1A 1IYOA 2WAFA 5L07A 1UWPX 1GSWA 2W3EA 4OQIA 2FFFB 1OTIA 1WE4A 1LL5A 3CZDA 1ES2A 1FR6A 3GSGA 4MDZA 4R0QA 2QKPA 5FATA 5A8BA 4UQIS 3MZEA 5F1GA 2QMIA 1LSWA 1VETB 3U2AA 5KSCA 2MJ6A 3W4QA 1F98A 2W0NA 3MKFA 4GD6A 3R4KA 3RXXA 1SKOB 5KZHA 4LRXC 4EEUA 4DF6A 4LRZE 1QMFA 4NXGA 1ACFA 4BD0A 3BWLA 4XXRA 3ZNYA 4ETXA 3LIEA 4JXVA 5M19A 3N8LA 3F1PA 2EX6A 3T1RA 4OPRA 5F6AA 4GZBA 3VOLA 2Z6CA 1IEMA 3VSKA 4R3AA 2DRWA 2NUTC 3JYIA 1CEFA 2VEAA 3S7PA 4HJ6A 2YKFA 4P87A 1G6OA 1FCMA 2PDRA 1V9ZA 1W63M 4EW7A 4OLGA 1TF1A 4U0XA 4KQDA 4S2LA 3CAXA 2VX8A 3DBAA 3O86A 2WK0A 4OQHA 1FIKA 3SS5A 3ZVTA 3WRTA 5EVIB 4KZ4A 4ESPA 2P08A 1MXOA 3MXRA 2A24B 4RX3A 4Q0JA 4DRTA 3ZG5A 5HPFA 5DJTA 3IWQA 4U3TA 1KVMA 1OTDA 5G18A 3LR4A 1OTBA 1DJCA 3CI6A 1G28A 4OPYA 1Y28A 5F1FA 4HBTA 5KMWA 3UN7A 3ZQ5A 2GNXA 3Q81A 3E2LA 3LO7A 2Y59A 5FAQA 3W4PA 5KIZA 1NYYA 3HBRA 4E6XA 3AGEA 4OQ0A 3T4TA 3D3OA 5HAQA 3D4FA 4GB7A 5FAOA 5G4YA 5KSHA 3LIBA 2V1BA 5DF7A 3K2NA 1ZC2A 3E4QA 3WS0A 1H0MA 3NECA 1HD8A 3P01A 4KZ3A 4JF5A 4ZRRA 4CLCA 4X69A 3IS2B 5IT5A 5AQAA 1U60A 3CUEA 1W63Q 4S2OA 5GHZA 3O3VA 4C3QA 2W1TB 3QNCA 4PKYA 2Q9NA 4BBUA 3CWFA 3N8RA 3HL9A 4P6BA 1Z6FA 3E98A 5HX9A 4WZ4A 1XJ6A 3ITBA 3IWIA 1W8QA 4O0PA 1YLJA 1IOUA 1TS6A 4E3IA 4E6WA 1E3UD 4OP8A 5EM0A 1RGYA 5CERA 3OOVA 1XX2A 2M7UA 4X68A 4DMZA 1WA9A 4WMCA 1RP5A 4R23A 4IJGA 4XUZA 4EUZA 3ZNTA 4S2MA 4IHQA 1MWTA 3VP4A 1F5MA 3FC7A 5FA7A 2PRFA 5F82A 1L0GA 5HW3A 2ZC4B 5GLBA 4IBRA 5TJJA 5LBRA 3NOUC 1K55C 2R9WA 1JTDA 3IF6B 3HLEA 1MKIA 1HLUP 5EE8A 3S22A 3MJQA 5FI2A 2B02A 4S2NC 4UAAA 5FAPA 5HWWA 2Z2MB 3VP1A 4JKTA 3DW0A 4M3KA 3ZDJA 4MN7A 1VETA 1CI8A 3QHYA 3LEQA 3GDIA 3UE1A 1NYMA 3GV9A 2OAP1 1SKOA 5A93A 2Q9MA 1OMEA 4I3IA 1MC0A 1OJ5A 5AQBA 4DJ2A 3MQQA 2D01A 4Y7PA 2V8FA 1GHPA 1N9NA 3OCNA 2E8IA 2NUPC 1XGJA 2ZLYA 3MKEA 5CGWA 1L0EA 4EWFA 4DDSA 4GHIB 1XKZA 4DN0A 2EXBA 3ZFZA 1K57A 4E3NA 4MBKA 5AVEA 3NCKA 3KO6A 3MR0A 4YNRA 2XQZA 2X01A 3B3XA 3BFCA 5EVIA 2HP9A 4L0LA 4KZ5A 1ESIA 1PNEA 3MFDA 2A24A 3I7JA 4A5RA 3ISGA 1T1BA 3PYPA 2Y2KA 4FCFA 3NIAA 2WKPA 3SS4A 1H8MA 3SH7A 1JTGA 1MWRA 4BBTA 3HCYA 4OOLA 1DP9A 1FSYA 1VQQA 1GHMA 3ZVWA 4FUWA 4Y0UA 3T12B 1XJ2A 3F1NB 4KZ8A 3G31A 4JXWA 1PIOA 4IBXA 3C4OA 5DTKA 4WZ5C 1NY0A 5EFWA 4WM9A 2ZMVA 5D3OA 1IYPA 3VE3A 4P85A 2QJ5A 4IVKA 4NETA 4R70A 4GDBA 1CI9A 4OPQA 3NHQA 3A0RA 2H0YA 3QP6A 5FI6A 1P9WA 4HESA 1HZOA 1P9RA 5EPHA 2V2FF 4ETZA 3T4JA 2JE5A 3GVBA 5AQ7A 2FH5A 3T50A 1ONHA 2G7UA 3VFFA 1T18A 2XRNA 5HFOA 4KG6A 4KZ7A 4HNBA 1GA0A 5TBMB 1VEUB 2DCFA 1KGFA 1D1JA 3IS2A 3KYEA 1SHVA 4S2PA 3ZGAB 5CTMA 3VE4A 2W1TA 3LI9A 3GQZA 4ZJ1A 2PR5A 4DJ3A 5J8XA 3NI9A 3BLSA 2HJEA 5I94A 4JXSA 3VOZA 3QP4A 1HTZA 3FKVA 3W4OA 4C75A 1PW8A 5I5LA 3PBTA 4CPKA 2RL3A 4RQ9A 4KZ6A 1S0WA 4EERA 3LR3A 4Y17A 3WS1A 4Z9QA 1P0ZA 1S6RA 2R78A 4IEDA 4UA9A 1K54A 3GRJA 1NXYA 4IUHA 2PD7A 4C6YA 4B9OA 4RX2A 4KQQA 1W7FA 3MQ0A 1SDEA 1YLZA 4HH3A 3M6HA 5AVFA 3LICA 1VB6A 2O9BA 1TS0A 3MXQA 5M18A 3KSIA 1G5UA 3QP1A 4HJ3A 4X55A 3HLFA 1MZUA 3DWKA 2XA7S 4PAUA 3N6IA 2W27A 5DTTA 3HLGA 4FOFA 1KE3A 2UV0E 1KVLA 5CHJA 3SH8A 2XDMA 3HUOA 3WRZA 1PW1A 2WKHA 3IT9A 3IF6A 2EX9A 3L9KA 4HOIA 4O8GA 2WKQA 1K4EA 4CLCD 2PBYA 3BRMA 3C7VA 3WS5A 5HPIA 3IX8A 4R1GA 4E3MA 1J9MA 1LSXA 1ZHHB 4F3LB 3V3SA 2VGKA 1IFQA 4GLQA 3UB6A 4LV3A 3UO9A 1DY6A 1XP4A 4G3WA 3LFVA 4PHTA 3GMWA 4CLCE 3B42A 3W2ZA 5HL1A 4GD8A 3RTYA 5A91A 3OCLA 4UQIM 2OWHA 4HI4A 5HAPA 2K2NA 3H82B 4WMCD 3Q7ZA 3SW1A 1CJFA 3PBQA 2WADA 3IX3A 3GTCA 4ZDXA 4PMAA 3QP2A 1L0DA 4FSFA 5FQMA 2LB5A 4CQHA 4GHIA 2UWXA 3FPWA 5EECA 3EQUA 3LR0A 1SZVA 4NK3A 5FQQA 3IHAA 5HWVA 3G34A 1O07A 2QJ7A 2PT7A 4IUKA 4OOMA 2H5SA 1H3QA 4ARZB 5CHUA 3BYDA 4EBNA 5CHMA 3MSHA 2J9PA 1LT0A 3LR5A 1ESUA 3F1OB 1F2KA 4LCLA 1ZG4A 2HDQA 5DFXA 2OLVA 2KX6A 2XR0A 3T1QB 3SZTA 4EUVA 3LCEA 3Q82A 4XT2B 1IYQA 2B18A 1LHYA 4R38A 4DXBA 1XPBA 3RXWA 4JGRA 1DP8A 1K25A 4CLCC 3H9WA 1NWZA 2BASA 2VV7A 4H8RA 3A3JA 1I2WA 1TVFA 2ZQDA 2XF3A 5IHVA 2BG1A 3F1NA 1GSXA 4KZAA 3HLDA 4PM7A 3WS4A 1EI5A 3ZCZA 4GN2A 2GDNA 2K7SA 3BJNA 3S1YA 2ZL1B 2J7VA 3BY8A 4M4XA 3P98A 3P09A 4LFUA 1M6KA 2RCXA 2XH9A 4Q8IA 3EQVA 3VV4A 3NDGA 4O7DA 1ES5A 5M1AA 1NZUA 3E0YA 5G4ZA 1YKDA 3ICYA 3FZCA 3M6BA 1ZKJA 3N4IA 5J4EA 3MBZA 2GJ3A 4Q0HA 5TBMA 4S2KA 2IWBA 1TDGA 1VEUA 4N1HA 5FSRA 3G32A 2KDKA 1OT9A 3MF0A 2ZC6B 5EVID 4EESA 4DE0A 1C3BA 2KOIA 3O87A 4DE3A 4HBUA 3PR6A 1NLYA 2VV8A 3PHYA 3CLOA 3AGDA 3E2KA 2EX8A 1PZPA 5E2GA 4S2JA 4LGWA 1DJBA 1WYBA 1YQSA 4CJNA 5F83A 5CTNA 1MWSA 3UB8A 3SOIA 5GHXA 5FDHA 4PM5A 1T1AA 3LY4A 4YWZA 2OV5A 3V3RA 4QY5A 4EQ1A 2IWDA 2PU4A 3K3CA 4Q0IA 1AXBA 4N9KA 5EUAA 2OWJA 1DJAA 3A3IA 3OPLA 4FTXA 1DP6A 3UE0A 2BTFP 2W3DA 2VZWA 2Z2LB 2B5RA 3DWZA 4HQAA 3ZHHA 2Y2OA 5CECA 2Y2QA 1MKMA 2E8JA 4JBFA 2WKIA 2XD5A 2J3WA 4EV4A 4F3LA 1KGEA 4BD1A 4BQMA 4MN5A 3VP3A 3OC2A 3N8SA 3B47A 5E2EA 2A3UA 4BENA 5CRFA 2PYPA 4B4ZA 4L9FA 4QD4A 3Q7VB 4DE1A 5DKLA 2J8YA 3IXBA 1KDSA 2HZ5A 3BECA 2ZM0A 2ZQAA 2QWSA 4X56A 2HP6A 4WEJA 2Y79A 3IXDA 3PAGA 5EVLA 3EOIA 1F9IA 4WF0A 3NOPC 1A0KA 4ME4A 4X25A 2L4RA 3DTEA 3NC8A 4B93A 4P6ZM 4B88A 1Q2QA 1YLPA 4Y15A 3Q1FA 2EXAA 1RGZA 5U47A 3UDXA 2JKGA 4MEZA 4WLAA 3FYZA 3BFDA 1T19A 4ARZA 2CMNA 2X71A 4OLDA 4ID4A 1Y4OA 3E4PA 2J80A 1JWVA 2J3TD 4OQGA 1KDWA 3F1OA 4OP5A 3D72A 5DKKA 2ZM2A 3C7UA 4NG2A 3G2YA 4MLLA 4XT2A 4DXCA 3UE6A 2ZC7A 2JKTI 2ZD8A 3FKWA 4ZBEA 4BL2A 2OSUA 4B4XA 3BQ8A 4L9GA 3FPVA 2PBDP 3PBNA 3A3FA 4WEKA 2H0TA 3EWKA 5DF8A 3EGDC 4D2OA 1KOUA 1O7EA 3HUMA 5GHYA 3EEHA 2M7VA 2V0WA 5CGXA 3D9YA 4X1MA 5HL6A 3BQAA 1S4RA 1K55A 2ZQ9A 3CJMA 3UPOA 5C5KA 2Y2LA 2WZZA 4I5SA 4KG5A 3LI8A 4E04A 3T4OA 3VP0A 3V67A 1L3LA 5DTSA 5F68A 2Y2PA 3DTIA 2ZMFA 4S2NA 3NBLA 2EWWA 3B33A 4PPRA 1MPLA 5E2FA 2P7JA 3JVUA 2Y55A 1BZAA 3ITAA 1W79A 1MWUA 1GCEA 1V9YA 4HHDA 3UDIA 1IYSA 3DTMA 5GLDA 4HP9A 2FFYA 3S4XA 3HLWA 3UY6A 1FR1A 3WWXA 2Y8HA 1K0KA 4EEPA 2V8CA 4GKUA 3CITA 2WGWB 1LL8A 1YLTA 1X0OA 2W1RA 3LY3A 4I39A 2WKRA 3OPHA 1WYCA 3IF6C 1K6RA 1N9OA 2J3TC 2PU2A 1CF0A 4EXOA 1K56A 3CHWP 3G35A 5FQ9A 4HH2A 4AFIA 4Y13A 4EBPA 4GW9A 4PM6A 1BTLA 2GX5A 3UB7A 4Y5FA 3TJZC 1KGGA 4R3JA 2C5WB 4HP4A 1TS7A 1FSWA 1TD5A 5FDSA 3A0SA 3BFFA 3VOYA 5IU1A 2O9CA 5F69A 3FWLA 1Y54A 3C38A 5GL9A 4ZAMA 2IA2A 3EGXC 2XFSA 3O88A 3DTKA 4GDNA 4QWOA 1XFNA 1W5DA 4PM9A 4CLCB 4KZ9A 2INWA 4LLOB 2OOLA 2PAVP 2I72A 4FD8A 4JGPA 2JC7A 1JWZA 2XD1A 1JWPA 3RJUA 3JPUA 3HVFA 2Q0OA 1T1CA 4WN5A 2XLNA 3KSHA 5GLCA 1UWNX 5HZHA 5BOHA 1XJ4A 4S2IA 4UHUA 3L7HA 3TRCA 1OPXA 3KX0X 5FASA 4H6JB 3Q7VA 3A3EA 2PYRA 4KUKA 1YAXA 1PWDA 4KUOA 1YMXA 5TR7A 2HJ9C 5L09A 3S7OA 4E3OA 3IQAA 3UMDA 1BT5A 5AJGA 1CEGA 5HARA 5HDSA 4LCMA 1ODVA 2EFXA 3IHBA 3TSGA 2Y2IA 3NJAA 1AWIA 3AGFA 4I3AA 1YM1A 3QP5A 1MBLA 2Y2HA 4QPRA 2JBFA 5CEDA 3T1SA 3MFXA 1FOFA 2JKRI 3E4OA 2VGLS 4BL3A 1IKIA 3K3DA 2VA0A 2Y2JA 5HWTA 3FG8A 3V39A 4K0XA 3IBJA 1S67L 1NZOA 5GLAA 5EVEA 4UEYA 1CQAA 1BLHA 1K38A 1EROA 3PBOA 3TW8A 3CG5A 2VV6A 3HLCA 3HJKA 2HGVA 2JKFA 3UPNA 2VLGA 4K91A 1DRMA 4ZJ3A 3IXHA 2VK3A 5FI7A 3MS6A 1IKGA 3OPRA 1BLPA 5JYPA 1VM1A 1NRJA 5K5BA 1PWCA 4NXBA
chains in the Genus database with same CATH topology
2R9XA 5E2HA 2OV5A 3V3RA 4QY5A 2WKEA 2IWDA 2PU4A 3IF5A 4MBKA 5EOEA 4QY6A 4LV0A 3IH9A 5DF9A 1AXBA 4N9KA 5EUAA 4DE2A 1DJAA 3A3IA 3M2KA 3SS3A 1EWZA 3OPLA 3PTEA 3NCKA 3QNBA 1TDLA 4ZTKA 2XQZA 3GR2A 2X01A 1GA9A 2XEPA 2ZQ7A 3B3XA 3BFCA 5EVIA 2X02A 3SH9A 4N92A 2HP9A 3UE0A 4BJPA 3IWOA 3LEZA 4L0LA 2ZQCA 4KZ5A 4WZ5A 4BLMA 1ESIA 2IWCA 3MFDA 3I7JA 2Z2LB 3IXGA 4LV2A 4A5RA 3ISGA 4JF6A 2Y2NA 5A92A 2B5RA 1Q2PA 2Y2KA 4DDYA 3DWZA 4FCFA 3ZHHA 1YLWA 3NIAA 2H10A 3CMZA 4U0TA 1SCWA 2Y2OA 1L2SA 3SS4A 5CECA 3SH7A 2A49A 1JTGA 1MWRA 2Y2QA 2ZJ9A 4UA7A 4Y0TA 4JBFA 4GOGA 1H8ZA 2WKIA 2XD5A 4OOLA 4EV4A 4KG2A 1YMSA 3UE3A 1KGEA 4BD1A 4OPZA 3UPPA 3ZG8B 1FSYA 1BLCA 1VQQA 1GHMA 4BQMA 4R3BA 4LENA 3C4PA 3ZVWA 3VP3A 1K4FA 4QU3A 4R4SA 3OC2A 4Y0UA 3N8SA 3OZHA 5E2EA 1KE0A 4OVDA 2A3UA 2WGWA 4BENA 4K0WA 2DNSA 4KZ8A 4MBHA 5CRFA 1I5QA 3G31A 4JXWA 4GNUA 1PIOA 4IBXA 3C4OA 5DTKA 2EFUA 4WZ5C 3V50A 4B4ZA 1NY0A 1PI5A 1JVJA 3BEBA 3Q7VB 1H5XA 4QD4A 4WM9A 5D3OA 4XUXA 5A90A 4DE1A 1IYPA 4KQOA 2J8YA 3IXBA 3BLMA 4P85A 1KDSA 1ZG6A 3BECA 4JF4A 3ZG0A 4JXGA 3PBRA 4IVKA 4YFMA 2ZM0A 2ZQAA 2HDRA 3BFEA 4NETA 2XK1A 4X56A 1IYOA 2HP6A 2WAFA 1CI9A 4GDBA 4OPQA 4WEJA 3IXDA 3PAGA 5EVLA 4OQIA 2FFFB 2V1ZA 2H0YA 5FI6A 1WE4A 4HESA 1LL5A 1HZOA 3CZDA 1E25A 1ES2A 5EPHA 1FR6A 2V2FF 3GSGA 4R0QA 2JE5A 3GVBA 5AQ7A 2JCHA 3NC8A 1ONHA 5FATA 3VFFA 5HFOA 2P9VB 4KG6A 1N9BA 4KZ7A 4B88A 1GA0A 1Q2QA 1YLPA 3MZEA 5F1GA 2DCFA 1KGFA 2QMIA 3Q1FA 2EXAA 3PBSA 1RGZA 5U47A 3UDXA 5KSCA 1SHVA 4MEZA 1PZOA 4S2PA 3FYZA 3BFDA 3W4QA 1LI9A 3ZGAB 5CTMA 1XA7A 4N1XA 4ZJ2A 3MKFA 4GD6A 3GQZA 1BLSA 1N4OA 3RXXA 5KZHA 5HAIA 2X71A 4ZJ1A 1FQGA 4OLDA 2Y91A 2G2WA 5J8XA 4ID4A 3NI9A 3BLSA 3BM6A 4DF6A 1QMFA 5I94A 1PYYA 4JXSA 1IELA 1ALQA 1JWVA 3VOZA 3ZG9B 1HTZA 3FKVA 4OQGA 4XXRA 2ZM8A 3W4OA 1KDWA 4OP5A 4BD0A 3ZNYA 4C75A 3HREA 1PW8A 2ZM2A 3C7UA 3G2YA 3PBTA 4CPKA 4MLLA 4JXVA 4DXCA 1I2SA 5M19A 2RL3A 2ZC7A 3N8LA 3PAEA 4KZ6A 2ZD8A 2EX6A 3FKWA 2WGVA 3G30A 4OH0A 1S0WA 4OPRA 4ZBEA 4BL2A 4DKIA 4GZBA 2OSUA 3WS1A 4B4XA 4Z9QA 1S6RA 1IEMA 3VSKA 3HLBA 2DRWA 3JYIA 1CEFA 4IEDA 4UA9A 1K54A 3GRJA 1BSGA 3PBNA 4MNRA 2WGIA 1NXYA 3A3FA 4WEKA 2H0TA 4P87A 1QMEA 5DF8A 4D2OA 1FCMA 5AQ9A 4C6YA 1O7EA 3HUMA 3NY4A 4KQQA 4RX2A 1W7FA 5GHYA 1SDEA 1YLZA 5CGXA 2OLUA 3M6HA 4OLGA 2G2UA 3A3DA 1K55A 4U0XA 5M18A 4S2LA 2ZQ9A 3CJMA 3UPOA 2Y2LA 3C5AA 3O86A 2WK0A 4X55A 2WZZA 3HLFA 4OQHA 3SS5A 3ZVTA 1K56D 4KG5A 3DWKA 2CC1A 3WRTA 5EVIB 2WYXA 3N6IA 3VP0A 1K57C 5DTTA 5DTSA 3HLGA 1BULA 4KZ4A 5EOOA 1BUEA 2Y2PA 1KE3A 3VFHA 4RVAA 1KVLA 1MXOA 4S2NA 5CHJA 4KQRA 3MXRA 2XDMA 1NRFA 3HUOA 3NBLA 3SH8A 4KENB 4RX3A 1PW1A 2WKHA 3IT9A 3WRZA 1E4DA 4Y0OA 3IF6A 2EX9A 4DRTA 1G6AA 4PPRA 2EX2A 5FQJA 1G68A 2HP5A 3ZG5A 1MPLA 5E2FA 1K4EA 3W8KA 5EVIC 1XXMA 2Y55A 2PBYA 4IVIA 3BRMA 3C7VA 2V20A 1BZAA 3ITAA 1W79A 1ES4A 3IWQA 3WS5A 4U3TA 1KVMA 1MWUA 5G18A 1TEMA 4R1GA 1LLBA 1GCEA 1RCJA 4E3MA 1J9MA 3UDIA 1IYSA 1DJCA 3DTMA 5GLDA 3V3SA 1GHIA 2VGKA 2FFYA 4OPYA 5F1FA 4HBTA 3S4XA 5KMWA 3HLWA 3UY6A 1FR1A 4JPMA 3UN7A 3WWXA 3Q07A 4QB8A 4X53A 4LV3A 3UO9A 1DY6A 1XP4A 3Q81A 4GKUA 3E2LA 3LO7A 2WGWB 4QJGA 2Y59A 1YLTA 2HDUA 3GMWA 3LY3A 5FAQA 3W4PA 1NYYA 3HBRA 1SDNA 3OPHA 5HL1A 4GD8A 5A91A 1WYCA 3OCLA 3IF6C 4QHCA 5JYOA 3MZFA 4E6XA 2HDSA 3AGEA 4YINA 4OQ0A 5HAPA 1K6RA 2P74A 5HAQA 3G2ZA 4KZBA 2PU2A 3D4FA 4OOYA 1K56A 2ZMAA 3G35A 5FQ9A 1SKFA 2QZ6A 4GB7A 4EBPA 5FAOA 4WMCD 5L2FA 5KSHA 3Q7ZA 2ZQ8A 5DF7A 3PBQA 1ZC2A 4R4RA 1NJ4A 4HEFA 2WADA 1XGIA 3GTCA 4PM6A 4PMAA 3WS0A 4EBLA 1BTLA 4ZDXA 1L0DA 4FSFA 4FH4A 3IH8A 5FQMA 1HD8A 3WS2A 4KZ3A 4JF5A 2UWXA 5EECA 1FCOA 1KGGA 3EQUA 4R3JA 2C5WB 4NK3A 5FQQA 3IHAA 1FSWA 3G34A 1PWGA 4FH2A 4OKPA 1O07A 4X69A 1ERMA 1LI0A 3BFFA 5CXWA 5AQAA 2XGNA 1U60A 4WYYA 5CEBA 3VOYA 4S2OA 4OOMA 2QPNA 1L0FA 5GHZA 2WUQA 3O3VA 2H5SA 3ZG7B 4C3QA 3FWLA 1Y54A 5GL9A 3QNCA 5CHUA 5E43A 4ZAMA 2Q9NA 1CK3A 1M40A 3BYDA 3M2JA 2VGJA 5CHMA 4EBNA 2XFSA 1KE4A 3UDFA 4UA6A 2J9PA 3N8RA 3O88A 2C6WB 3HL9A 4P6BA 3VP2A 1Z6FA 4GDNA 3VSLA 4P0MA 5HX9A 4WZ4A 2ZC5B 1W5DA 4PM9A 1ESUA 3TG9A 4LCLA 1ZG4A 2HDQA 2OLVA 3ITBA 3IWIA 1W8QA 4KZ9A 2XR0A 1PI4A 1YLJA 3LCEA 3Q82A 1IYQA 4E3IA 1YT4A 1LHYA 4MBFA 2I72A 4DXBA 1XPBA 4FD8A 3RXWA 3UNWA 4E6WA 1E3UD 2JC7A 4OP8A 1JWZA 2XD1A 1JWPA 1RGYA 3LY4A 1K25A 4PM8A 3RJUA 5CERA 1XX2A 4X68A 4H8RA 3HVFA 4WMCA 4OONA 1RP5A 4R23A 4XUZA 3A3JA 2XLNA 4E3LA 2XFTA 1I2WA 4EUZA 1TVFA 2ZQDA 3VMAA 5GLCA 1LL9A 3ZNTA 4S2MA 5BOHA 1MY8A 2XF3A 4S2IA 5IHVA 1MWTA 2BG1A 3VP4A 4UHUA 4KZAA 3HLDA 3TOIA 4PM7A 5FA7A 1EI5A 3WS4A 2WZXA 3ZCZA 4GN2A 5FASA 1K54C 2GDNA 3OPPA 1K6SA 3Q7VA 5F82A 3S1YA 3A3EA 1L0GA 2J7VA 3P98A 5HW3A 2ZC4B 5GLBA 5TGFA 3P09A 4IBRA 2HPBA 1PWDA 1M6KA 2RCXA 2XH9A 1YMXA 5TR7A 3G4PA 1W8YA 1K55C 4Q8IA 2R9WA 3EQVA 4E3KA 4E3OA 1JTDA 3IF6B 3IQAA 1BT5A 3NDEA 3HLEA 1ES3A 1MKIA 1CEGA 3NDGA 4O7DA 3FV7A 1ES5A 5CGSA 5M1AA 2Y2GA 5HARA 5EE8A 1NZUA 4LCMA 2EFXA 3BFGA 3IHBA 3TSGA 2Y4AA 2Y2IA 4X6TA 3S22A 3AGFA 5FI2A 3FZCA 3M6BA 5FQKA 1ZKJA 1YM1A 3N4IA 4S2NC 4UAAA 3MBZA 2P9VA 5FAPA 1MBLA 2Y2HA 2Z2MB 3VP1A 4JKTA 2J9OA 1H8YA 4S2KA 2ZC3B 1TDGA 2JBFA 3DW0A 1HVBA 4N1HA 4M3KA 2IWBA 3ZDJA 5CEDA 5FSRA 1FOFA 3G32A 1E3UA 2ZC6B 3QHYA 1CI8A 5EVID 4BL3A 4WELA 3N7WA 1IKIA 4E3JA 4DE0A 2Y2JA 4JLFA 3UE1A 1NYMA 3GV9A 3MZDA 1C3BA 4K0XA 3V39A 5A93A 1NZOA 2Q9MA 4WBGA 4LV1A 5GLAA 3O87A 1FCNA 4F94A 4DE3A 4EQIA 4HBUA 1OMEA 1BLHA 1K38A 1YLYA 5AQBA 1EROA 5DVAA 3PBOA 5FQIA 3AGDA 3E2KA 2Y2MA 2EX8A 1PZPA 3CG5A 1ONGA 5E2GA 4S2JA 1DJBA 3HLCA 1WYBA 4Y7PA 1GHPA 4RYEA 5TFQA 3UPNA 2BLSA 3OCNA 2E8IA 1YQSA 4K91A 5F83A 1ERQA 4CJNA 4N9LA 5CTNA 1XGJA 4ZJ3A 1MWSA 2ZLYA 3MKEA 3IXHA 3SOIA 3HUNA 5GHXA 5FDHA 5CGWA 1L0EA 5FI7A 4EWFA 1IKGA 3OPRA 1BLPA 4DDSA 5JYPA 1VM1A 1XKZA 4PM5A 2EXBA 3ZFZA 1K57A 1XA1A 4RA7A 1PWCA 3MXSA 4E3NA 3V5MA 2WAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R9X A;  5E2H A;  2OV5 A;  3V3R A;  4QY5 A;  2WKE A;  2IWD A;  2PU4 A;  3IF5 A;  4MBK A;  5EOE A;  4QY6 A;  4LV0 A;  3IH9 A;  5DF9 A;  1AXB A;  4N9K A;  5EUA A;  4DE2 A;  1DJA A;  3A3I A;  3M2K A;  3SS3 A;  1EWZ A;  3OPL A;  3PTE A;  3NCK A;  3QNB A;  1TDL A;  4ZTK A;  2XQZ A;  3GR2 A;  2X01 A;  1GA9 A;  2XEP A;  2ZQ7 A;  3B3X A;  3BFC A;  5EVI A;  2X02 A;  3SH9 A;  4N92 A;  2HP9 A;  3UE0 A;  4BJP A;  3IWO A;  3LEZ A;  4L0L A;  2ZQC A;  4KZ5 A;  4WZ5 A;  4BLM A;  1ESI A;  2IWC A;  3MFD A;  3I7J A;  2Z2L B;  3IXG A;  4LV2 A;  4A5R A;  3ISG A;  4JF6 A;  2Y2N A;  5A92 A;  2B5R A;  1Q2P A;  2Y2K A;  4DDY A;  3DWZ A;  4FCF A;  3ZHH A;  1YLW A;  3NIA A;  2H10 A;  3CMZ A;  4U0T A;  1SCW A;  2Y2O A;  1L2S A;  3SS4 A;  5CEC A;  3SH7 A;  2A49 A;  1JTG A;  1MWR A;  2Y2Q A;  2ZJ9 A;  4UA7 A;  4Y0T A;  4JBF A;  4GOG A;  1H8Z A;  2WKI A;  2XD5 A;  4OOL A;  4EV4 A;  4KG2 A;  1YMS A;  3UE3 A;  1KGE A;  4BD1 A;  4OPZ A;  3UPP A;  3ZG8 B;  1FSY A;  1BLC A;  1VQQ A;  1GHM A;  4BQM A;  4R3B A;  4LEN A;  3C4P A;  3ZVW A;  3VP3 A;  1K4F A;  4QU3 A;  4R4S A;  3OC2 A;  4Y0U A;  3N8S A;  3OZH A;  5E2E A;  1KE0 A;  4OVD A;  2A3U A;  2WGW A;  4BEN A;  4K0W A;  2DNS A;  4KZ8 A;  4MBH A;  5CRF A;  1I5Q A;  3G31 A;  4JXW A;  4GNU A;  1PIO A;  4IBX A;  3C4O A;  5DTK A;  2EFU A;  4WZ5 C;  3V50 A;  4B4Z A;  1NY0 A;  1PI5 A;  1JVJ A;  3BEB A;  3Q7V B;  1H5X A;  4QD4 A;  4WM9 A;  5D3O A;  4XUX A;  5A90 A;  4DE1 A;  1IYP A;  4KQO A;  2J8Y A;  3IXB A;  3BLM A;  4P85 A;  1KDS A;  1ZG6 A;  3BEC A;  4JF4 A;  3ZG0 A;  4JXG A;  3PBR A;  4IVK A;  4YFM A;  2ZM0 A;  2ZQA A;  2HDR A;  3BFE A;  4NET A;  2XK1 A;  4X56 A;  1IYO A;  2HP6 A;  2WAF A;  1CI9 A;  4GDB A;  4OPQ A;  4WEJ A;  3IXD A;  3PAG A;  5EVL A;  4OQI A;  2FFF B;  2V1Z A;  2H0Y A;  5FI6 A;  1WE4 A;  4HES A;  1LL5 A;  1HZO A;  3CZD A;  1E25 A;  1ES2 A;  5EPH A;  1FR6 A;  2V2F F;  3GSG A;  4R0Q A;  2JE5 A;  3GVB A;  5AQ7 A;  2JCH A;  3NC8 A;  1ONH A;  5FAT A;  3VFF A;  5HFO A;  2P9V B;  4KG6 A;  1N9B A;  4KZ7 A;  4B88 A;  1GA0 A;  1Q2Q A;  1YLP A;  3MZE A;  5F1G A;  2DCF A;  1KGF A;  2QMI A;  3Q1F A;  2EXA A;  3PBS A;  1RGZ A;  5U47 A;  3UDX A;  5KSC A;  1SHV A;  4MEZ A;  1PZO A;  4S2P A;  3FYZ A;  3BFD A;  3W4Q A;  1LI9 A;  3ZGA B;  5CTM A;  1XA7 A;  4N1X A;  4ZJ2 A;  3MKF A;  4GD6 A;  3GQZ A;  1BLS A;  1N4O A;  3RXX A;  5KZH A;  5HAI A;  2X71 A;  4ZJ1 A;  1FQG A;  4OLD A;  2Y91 A;  2G2W A;  5J8X A;  4ID4 A;  3NI9 A;  3BLS A;  3BM6 A;  4DF6 A;  1QMF A;  5I94 A;  1PYY A;  4JXS A;  1IEL A;  1ALQ A;  1JWV A;  3VOZ A;  3ZG9 B;  1HTZ A;  3FKV A;  4OQG A;  4XXR A;  2ZM8 A;  3W4O A;  1KDW A;  4OP5 A;  4BD0 A;  3ZNY A;  4C75 A;  3HRE A;  1PW8 A;  2ZM2 A;  3C7U A;  3G2Y A;  3PBT A;  4CPK A;  4MLL A;  4JXV A;  4DXC A;  1I2S A;  5M19 A;  2RL3 A;  2ZC7 A;  3N8L A;  3PAE A;  4KZ6 A;  2ZD8 A;  2EX6 A;  3FKW A;  2WGV A;  3G30 A;  4OH0 A;  1S0W A;  4OPR A;  4ZBE A;  4BL2 A;  4DKI A;  4GZB A;  2OSU A;  3WS1 A;  4B4X A;  4Z9Q A;  1S6R A;  1IEM A;  3VSK A;  3HLB A;  2DRW A;  3JYI A;  1CEF A;  4IED A;  4UA9 A;  1K54 A;  3GRJ A;  1BSG A;  3PBN A;  4MNR A;  2WGI A;  1NXY A;  3A3F A;  4WEK A;  2H0T A;  4P87 A;  1QME A;  5DF8 A;  4D2O A;  1FCM A;  5AQ9 A;  4C6Y A;  1O7E A;  3HUM A;  3NY4 A;  4KQQ A;  4RX2 A;  1W7F A;  5GHY A;  1SDE A;  1YLZ A;  5CGX A;  2OLU A;  3M6H A;  4OLG A;  2G2U A;  3A3D A;  1K55 A;  4U0X A;  5M18 A;  4S2L A;  2ZQ9 A;  3CJM A;  3UPO A;  2Y2L A;  3C5A A;  3O86 A;  2WK0 A;  4X55 A;  2WZZ A;  3HLF A;  4OQH A;  3SS5 A;  3ZVT A;  1K56 D;  4KG5 A;  3DWK A;  2CC1 A;  3WRT A;  5EVI B;  2WYX A;  3N6I A;  3VP0 A;  1K57 C;  5DTT A;  5DTS A;  3HLG A;  1BUL A;  4KZ4 A;  5EOO A;  1BUE A;  2Y2P A;  1KE3 A;  3VFH A;  4RVA A;  1KVL A;  1MXO A;  4S2N A;  5CHJ A;  4KQR A;  3MXR A;  2XDM A;  1NRF A;  3HUO A;  3NBL A;  3SH8 A;  4KEN B;  4RX3 A;  1PW1 A;  2WKH A;  3IT9 A;  3WRZ A;  1E4D A;  4Y0O A;  3IF6 A;  2EX9 A;  4DRT A;  1G6A A;  4PPR A;  2EX2 A;  5FQJ A;  1G68 A;  2HP5 A;  3ZG5 A;  1MPL A;  5E2F A;  1K4E A;  3W8K A;  5EVI C;  1XXM A;  2Y55 A;  2PBY A;  4IVI A;  3BRM A;  3C7V A;  2V20 A;  1BZA A;  3ITA A;  1W79 A;  1ES4 A;  3IWQ A;  3WS5 A;  4U3T A;  1KVM A;  1MWU A;  5G18 A;  1TEM A;  4R1G A;  1LLB A;  1GCE A;  1RCJ A;  4E3M A;  1J9M A;  3UDI A;  1IYS A;  1DJC A;  3DTM A;  5GLD A;  3V3S A;  1GHI A;  2VGK A;  2FFY A;  4OPY A;  5F1F A;  4HBT A;  3S4X A;  5KMW A;  3HLW A;  3UY6 A;  1FR1 A;  4JPM A;  3UN7 A;  3WWX A;  3Q07 A;  4QB8 A;  4X53 A;  4LV3 A;  3UO9 A;  1DY6 A;  1XP4 A;  3Q81 A;  4GKU A;  3E2L A;  3LO7 A;  2WGW B;  4QJG A;  2Y59 A;  1YLT A;  2HDU A;  3GMW A;  3LY3 A;  5FAQ A;  3W4P A;  1NYY A;  3HBR A;  1SDN A;  3OPH A;  5HL1 A;  4GD8 A;  5A91 A;  1WYC A;  3OCL A;  3IF6 C;  4QHC A;  5JYO A;  3MZF A;  4E6X A;  2HDS A;  3AGE A;  4YIN A;  4OQ0 A;  5HAP A;  1K6R A;  2P74 A;  5HAQ A;  3G2Z A;  4KZB A;  2PU2 A;  3D4F A;  4OOY A;  1K56 A;  2ZMA A;  3G35 A;  5FQ9 A;  1SKF A;  2QZ6 A;  4GB7 A;  4EBP A;  5FAO A;  4WMC D;  5L2F A;  5KSH A;  3Q7Z A;  2ZQ8 A;  5DF7 A;  3PBQ A;  1ZC2 A;  4R4R A;  1NJ4 A;  4HEF A;  2WAD A;  1XGI A;  3GTC A;  4PM6 A;  4PMA A;  3WS0 A;  4EBL A;  1BTL A;  4ZDX A;  1L0D A;  4FSF A;  4FH4 A;  3IH8 A;  5FQM A;  1HD8 A;  3WS2 A;  4KZ3 A;  4JF5 A;  2UWX A;  5EEC A;  1FCO A;  1KGG A;  3EQU A;  4R3J A;  2C5W B;  4NK3 A;  5FQQ A;  3IHA A;  1FSW A;  3G34 A;  1PWG A;  4FH2 A;  4OKP A;  1O07 A;  4X69 A;  1ERM A;  1LI0 A;  3BFF A;  5CXW A;  5AQA A;  2XGN A;  1U60 A;  4WYY A;  5CEB A;  3VOY A;  4S2O A;  4OOM A;  2QPN A;  1L0F A;  5GHZ A;  2WUQ A;  3O3V A;  2H5S A;  3ZG7 B;  4C3Q A;  3FWL A;  1Y54 A;  5GL9 A;  3QNC A;  5CHU A;  5E43 A;  4ZAM A;  2Q9N A;  1CK3 A;  1M40 A;  3BYD A;  3M2J A;  2VGJ A;  5CHM A;  4EBN A;  2XFS A;  1KE4 A;  3UDF A;  4UA6 A;  2J9P A;  3N8R A;  3O88 A;  2C6W B;  3HL9 A;  4P6B A;  3VP2 A;  1Z6F A;  4GDN A;  3VSL A;  4P0M A;  5HX9 A;  4WZ4 A;  2ZC5 B;  1W5D A;  4PM9 A;  1ESU A;  3TG9 A;  4LCL A;  1ZG4 A;  2HDQ A;  2OLV A;  3ITB A;  3IWI A;  1W8Q A;  4KZ9 A;  2XR0 A;  1PI4 A;  1YLJ A;  3LCE A;  3Q82 A;  1IYQ A;  4E3I A;  1YT4 A;  1LHY A;  4MBF A;  2I72 A;  4DXB A;  1XPB A;  4FD8 A;  3RXW A;  3UNW A;  4E6W A;  1E3U D;  2JC7 A;  4OP8 A;  1JWZ A;  2XD1 A;  1JWP A;  1RGY A;  3LY4 A;  1K25 A;  4PM8 A;  3RJU A;  5CER A;  1XX2 A;  4X68 A;  4H8R A;  3HVF A;  4WMC A;  4OON A;  1RP5 A;  4R23 A;  4XUZ A;  3A3J A;  2XLN A;  4E3L A;  2XFT A;  1I2W A;  4EUZ A;  1TVF A;  2ZQD A;  3VMA A;  5GLC A;  1LL9 A;  3ZNT A;  4S2M A;  5BOH A;  1MY8 A;  2XF3 A;  4S2I A;  5IHV A;  1MWT A;  2BG1 A;  3VP4 A;  4UHU A;  4KZA A;  3HLD A;  3TOI A;  4PM7 A;  5FA7 A;  1EI5 A;  3WS4 A;  2WZX A;  3ZCZ A;  4GN2 A;  5FAS A;  1K54 C;  2GDN A;  3OPP A;  1K6S A;  3Q7V A;  5F82 A;  3S1Y A;  3A3E A;  1L0G A;  2J7V A;  3P98 A;  5HW3 A;  2ZC4 B;  5GLB A;  5TGF A;  3P09 A;  4IBR A;  2HPB A;  1PWD A;  1M6K A;  2RCX A;  2XH9 A;  1YMX A;  5TR7 A;  3G4P A;  1W8Y A;  1K55 C;  4Q8I A;  2R9W A;  3EQV A;  4E3K A;  4E3O A;  1JTD A;  3IF6 B;  3IQA A;  1BT5 A;  3NDE A;  3HLE A;  1ES3 A;  1MKI A;  1CEG A;  3NDG A;  4O7D A;  3FV7 A;  1ES5 A;  5CGS A;  5M1A A;  2Y2G A;  5HAR A;  5EE8 A;  1NZU A;  4LCM A;  2EFX A;  3BFG A;  3IHB A;  3TSG A;  2Y4A A;  2Y2I A;  4X6T A;  3S22 A;  3AGF A;  5FI2 A;  3FZC A;  3M6B A;  5FQK A;  1ZKJ A;  1YM1 A;  3N4I A;  4S2N C;  4UAA A;  3MBZ A;  2P9V A;  5FAP A;  1MBL A;  2Y2H A;  2Z2M B;  3VP1 A;  4JKT A;  2J9O A;  1H8Y A;  4S2K A;  2ZC3 B;  1TDG A;  2JBF A;  3DW0 A;  1HVB A;  4N1H A;  4M3K A;  2IWB A;  3ZDJ A;  5CED A;  5FSR A;  1FOF A;  3G32 A;  1E3U A;  2ZC6 B;  3QHY A;  1CI8 A;  5EVI D;  4BL3 A;  4WEL A;  3N7W A;  1IKI A;  4E3J A;  4DE0 A;  2Y2J A;  4JLF A;  3UE1 A;  1NYM A;  3GV9 A;  3MZD A;  1C3B A;  4K0X A;  3V39 A;  5A93 A;  1NZO A;  2Q9M A;  4WBG A;  4LV1 A;  5GLA A;  3O87 A;  1FCN A;  4F94 A;  4DE3 A;  4EQI A;  4HBU A;  1OME A;  1BLH A;  1K38 A;  1YLY A;  5AQB A;  1ERO A;  5DVA A;  3PBO A;  5FQI A;  3AGD A;  3E2K A;  2Y2M A;  2EX8 A;  1PZP A;  3CG5 A;  1ONG A;  5E2G A;  4S2J A;  1DJB A;  3HLC A;  1WYB A;  4Y7P A;  1GHP A;  4RYE A;  5TFQ A;  3UPN A;  2BLS A;  3OCN A;  2E8I A;  1YQS A;  4K91 A;  5F83 A;  1ERQ A;  4CJN A;  4N9L A;  5CTN A;  1XGJ A;  4ZJ3 A;  1MWS A;  2ZLY A;  3MKE A;  3IXH A;  3SOI A;  3HUN A;  5GHX A;  5FDH A;  5CGW A;  1L0E A;  5FI7 A;  4EWF A;  1IKG A;  3OPR A;  1BLP A;  4DDS A;  5JYP A;  1VM1 A;  1XKZ A;  4PM5 A;  2EXB A;  3ZFZ A;  1K57 A;  1XA1 A;  4RA7 A;  1PWC A;  3MXS A;  4E3N A;  3V5M A;  2WAE A; 
#chains in the Genus database with same CATH topology
 2WKE A;  4LV0 A;  2LB9 A;  3IH9 A;  5DF9 A;  3U4L P;  3PTE A;  1TDL A;  2A2L A;  4ZTK A;  3MMH A;  3GR2 A;  2XEP A;  1S4S A;  5HDD A;  2X02 A;  3SH9 A;  4N92 A;  4NEE D;  5FL3 A;  2I9V A;  3IWO A;  3CUE C;  2ZQC A;  4HJ4 A;  1OTA A;  2XRO A;  1PRQ A;  4LV2 A;  3IXG A;  4JF6 A;  2JHE A;  2ZOH A;  4NKP A;  5L10 A;  1YLW A;  2H10 A;  3CMZ A;  4U0T A;  3QP8 A;  2A49 A;  3IX4 A;  4UA7 A;  4Y0T A;  3C8C A;  1H8Z A;  2D02 A;  1YMS A;  3UE3 A;  4OPZ A;  1UGU A;  4R3B A;  4I3J A;  4LEN A;  4WL9 A;  5FEF A;  3C4P A;  4QU3 A;  4R4S A;  3O5Y A;  3OZH A;  1J3W A;  2WGW A;  4MBH A;  1I5Q A;  4GNU A;  2B95 A;  1JVJ A;  3NUL A;  4XUX A;  4KQO A;  3BLM A;  1ZG6 A;  3ZG0 A;  4YFM A;  2K31 A;  1OTE A;  4G3V A;  2V1Z A;  4K08 A;  1E25 A;  2JCH A;  3RFB A;  2P9V B;  1N9B A;  4NXE A;  1XFQ A;  4G3K A;  3PBS A;  2EWV A;  1PZO A;  1LI9 A;  4R6L A;  1XA7 A;  4N1X A;  4ZJ2 A;  1BLS A;  1N4O A;  4NXF A;  3T4Q A;  5L8M A;  5HAI A;  1FQG A;  3CPT B;  3DAV A;  2Y91 A;  2G2W A;  3BM6 A;  1PYY A;  1IEL A;  1ALQ A;  3ZG9 B;  3TE8 A;  2ZM8 A;  3HRE A;  1OT6 A;  2OAQ 1;  4GS9 B;  1I2S A;  3PAE A;  4HIA A;  2PR6 A;  3C30 A;  3G30 A;  2WGV A;  4OH0 A;  3RH8 B;  4DKI A;  1S1Y A;  3HLB A;  2L0W A;  1BSG A;  4MNR A;  2WGI A;  5FEG A;  1QME A;  2O99 A;  5AQ9 A;  4MMN A;  3NY4 A;  3NOT C;  3H7W B;  2W3F A;  2FZ0 A;  2OLU A;  2G2U A;  3A0V A;  3A3D A;  4LPZ A;  3EEA A;  2JKR M;  1EW0 A;  3C5A A;  3T4S A;  5DFY A;  1K56 D;  4H6J A;  2ACG A;  2CC1 A;  2WYX A;  1K57 C;  5HD5 A;  1BUL A;  2L1M A;  5EOO A;  1BUE A;  3T4K A;  3VFH A;  4RVA A;  4KQR A;  1NRF A;  4KEN B;  1E4D A;  4Y0O A;  1G6A A;  2EX2 A;  4MN6 A;  5FQJ A;  1G68 A;  2HP5 A;  3W8K A;  5EVI C;  1XXM A;  4IVI A;  2V20 A;  1ES4 A;  3LIF A;  1TEM A;  1D7E A;  1LLB A;  1RCJ A;  2HV1 A;  1N9L A;  1BYW A;  1GHI A;  4HY8 A;  2V9A A;  4JPM A;  3Q07 A;  4QB8 A;  4X53 A;  3H82 A;  3ULF A;  4Y2F A;  4QJG A;  3HJI A;  3R7W B;  2HDU A;  1SDN A;  4QHC A;  5JYO A;  3MZF A;  2HDS A;  4YIN A;  4BBV A;  5MC7 A;  1NLZ A;  2EA9 A;  2P74 A;  3G2Z A;  4KZB A;  4OOY A;  1S66 L;  2ZMA A;  1SKF A;  2QZ6 A;  5L2F A;  2ZQ8 A;  2Z6D A;  4R4R A;  1NJ4 A;  4HEF A;  1XGI A;  3OBF A;  2VKS A;  2W3H A;  4Y3I A;  4EBL A;  4FH4 A;  3IH8 A;  3WS2 A;  4D60 A;  2AVX A;  4P6Z S;  1FCO A;  1XJ3 A;  1PWG A;  4FH2 A;  4OKP A;  1ERM A;  1LI0 A;  4O01 A;  5CXW A;  1TS8 A;  2XGN A;  4EU0 A;  4WYY A;  5CEB A;  2QPN A;  1L0F A;  3S7N A;  2WUQ A;  3ZG7 B;  3MQO A;  1GSV A;  4LRY C;  5E43 A;  2O0Y A;  2PHY A;  1CK3 A;  1M40 A;  2HF6 A;  3M2J A;  2VGJ A;  1KE4 A;  5EM1 A;  3UDF A;  4UA6 A;  2C6W B;  3VP2 A;  3VSL A;  4P0M A;  2ZC5 B;  3GEC A;  3TG9 A;  4BMW A;  2PD8 A;  1PI4 A;  3S7Q A;  1YSP A;  1YT4 A;  4MBF A;  4I38 A;  3UNW A;  1YPR A;  3F1P B;  4PM8 A;  3KSG A;  2ZL1 A;  5J7E A;  3C2W A;  5CX7 A;  4OON A;  4E3L A;  4JGO A;  2XFT A;  4Z1W A;  3VMA A;  1LL9 A;  1STZ A;  1MY8 A;  1P97 A;  2H28 A;  4X1L A;  3KYZ A;  3TOI A;  4EET B;  2WZX A;  4L9E A;  1K54 C;  5IS1 A;  3OPP A;  1K6S A;  1PFL A;  5TGF A;  4GJ4 A;  2HPB A;  5HDC A;  2XSS A;  3G4P A;  1LSV A;  1W8Y A;  4E3K A;  3BY9 A;  3NDE A;  1ES3 A;  3P7N A;  3FV7 A;  5CGS A;  2Y2G A;  4PKY G;  3BFG A;  2Y4A A;  4X6T A;  5FQK A;  3UB5 P;  2P9V A;  4MCW A;  3LID A;  1Z09 A;  2J9O A;  1H8Y A;  2ZC3 B;  2YKH A;  1HVB A;  3G6O A;  3UB9 A;  3IBR A;  1E3U A;  4WEL A;  3N7W A;  3LGO A;  4E3J A;  5HSQ A;  4JLF A;  2V1A A;  3MZD A;  1S1Z A;  4BWI A;  4WBG A;  4LV1 A;  2W3G A;  3CPT A;  4JGQ A;  1FCN A;  4F94 A;  2M1C A;  4EQI A;  2DMW A;  5F5Y A;  5J3W A;  1YLY A;  2GZA A;  5DVA A;  5FQI A;  2VJW A;  2Y2M A;  2P04 A;  1ONG A;  2ZOI A;  4YOF A;  4GS9 A;  4RYE A;  5TFQ A;  2BLS A;  1ERQ A;  3LYX A;  4N9L A;  3ZYT A;  2QYB A;  3PXP A;  3KSF A;  3HUN A;  3T1X A;  3UME A;  1XA1 A;  4RA7 A;  3LUQ A;  3MXS A;  3V5M A;  2WAE A;  2R9X A;  3H7W A;  4II7 A;  5E2H A;  3IF5 A;  5EOE A;  4QY6 A;  1VHM A;  1D06 A;  4DE2 A;  1JNU A;  3M2K A;  3SS3 A;  1EWZ A;  3QNB A;  1GA9 A;  2ZQ7 A;  2XA7 M;  2V0U A;  1FIL A;  4BJP A;  3LEZ A;  4WZ5 A;  4BLM A;  2IWC A;  5DJU A;  5EV0 A;  3BW6 A;  2QHK A;  1OJG A;  2Y2N A;  5A92 A;  1Q2P A;  4DDY A;  3KYQ A;  1SCW A;  1L2S A;  3OLO A;  2ZJ9 A;  4GOG A;  4KG2 A;  5HD3 A;  3UPP A;  3ZG8 B;  3LIA A;  1BLC A;  1K4F A;  2KLI A;  1YSQ A;  1KE0 A;  4OVD A;  3T4L A;  4K0W A;  2DNS A;  3JVV A;  3R7W A;  3V50 A;  2EFU A;  4GCZ A;  2O9A A;  1PI5 A;  3BEB A;  1H5X A;  5A90 A;  1ZTU A;  2JKT M;  4JF4 A;  4JXG A;  3PBR A;  4WUJ A;  2JN7 A;  2ZBB A;  2VGL M;  2HDR A;  3BFE A;  2XK1 A;  1IYO A;  2WAF A;  5L07 A;  1UWP X;  1GSW A;  2W3E A;  4OQI A;  2FFF B;  1OTI A;  1WE4 A;  1LL5 A;  3CZD A;  1ES2 A;  1FR6 A;  3GSG A;  4MDZ A;  4R0Q A;  2QKP A;  5FAT A;  5A8B A;  4UQI S;  3MZE A;  5F1G A;  2QMI A;  1LSW A;  1VET B;  3U2A A;  5KSC A;  2MJ6 A;  3W4Q A;  1F98 A;  2W0N A;  3MKF A;  4GD6 A;  3R4K A;  3RXX A;  1SKO B;  5KZH A;  4LRX C;  4EEU A;  4DF6 A;  4LRZ E;  1QMF A;  4NXG A;  1ACF A;  4BD0 A;  3BWL A;  4XXR A;  3ZNY A;  4ETX A;  3LIE A;  4JXV A;  5M19 A;  3N8L A;  3F1P A;  2EX6 A;  3T1R A;  4OPR A;  5F6A A;  4GZB A;  3VOL A;  2Z6C A;  1IEM A;  3VSK A;  4R3A A;  2DRW A;  2NUT C;  3JYI A;  1CEF A;  2VEA A;  3S7P A;  4HJ6 A;  2YKF A;  4P87 A;  1G6O A;  1FCM A;  2PDR A;  1V9Z A;  1W63 M;  4EW7 A;  4OLG A;  1TF1 A;  4U0X A;  4KQD A;  4S2L A;  3CAX A;  2VX8 A;  3DBA A;  3O86 A;  2WK0 A;  4OQH A;  1FIK A;  3SS5 A;  3ZVT A;  3WRT A;  5EVI B;  4KZ4 A;  4ESP A;  2P08 A;  1MXO A;  3MXR A;  2A24 B;  4RX3 A;  4Q0J A;  4DRT A;  3ZG5 A;  5HPF A;  5DJT A;  3IWQ A;  4U3T A;  1KVM A;  1OTD A;  5G18 A;  3LR4 A;  1OTB A;  1DJC A;  3CI6 A;  1G28 A;  4OPY A;  1Y28 A;  5F1F A;  4HBT A;  5KMW A;  3UN7 A;  3ZQ5 A;  2GNX A;  3Q81 A;  3E2L A;  3LO7 A;  2Y59 A;  5FAQ A;  3W4P A;  5KIZ A;  1NYY A;  3HBR A;  4E6X A;  3AGE A;  4OQ0 A;  3T4T A;  3D3O A;  5HAQ A;  3D4F A;  4GB7 A;  5FAO A;  5G4Y A;  5KSH A;  3LIB A;  2V1B A;  5DF7 A;  3K2N A;  1ZC2 A;  3E4Q A;  3WS0 A;  1H0M A;  3NEC A;  1HD8 A;  3P01 A;  4KZ3 A;  4JF5 A;  4ZRR A;  4CLC A;  4X69 A;  3IS2 B;  5IT5 A;  5AQA A;  1U60 A;  3CUE A;  1W63 Q;  4S2O A;  5GHZ A;  3O3V A;  4C3Q A;  2W1T B;  3QNC A;  4PKY A;  2Q9N A;  4BBU A;  3CWF A;  3N8R A;  3HL9 A;  4P6B A;  1Z6F A;  3E98 A;  5HX9 A;  4WZ4 A;  1XJ6 A;  3ITB A;  3IWI A;  1W8Q A;  4O0P A;  1YLJ A;  1IOU A;  1TS6 A;  4E3I A;  4E6W A;  1E3U D;  4OP8 A;  5EM0 A;  1RGY A;  5CER A;  3OOV A;  1XX2 A;  2M7U A;  4X68 A;  4DMZ A;  1WA9 A;  4WMC A;  1RP5 A;  4R23 A;  4IJG A;  4XUZ A;  4EUZ A;  3ZNT A;  4S2M A;  4IHQ A;  1MWT A;  3VP4 A;  1F5M A;  3FC7 A;  5FA7 A;  2PRF A;  5F82 A;  1L0G A;  5HW3 A;  2ZC4 B;  5GLB A;  4IBR A;  5TJJ A;  5LBR A;  3NOU C;  1K55 C;  2R9W A;  1JTD A;  3IF6 B;  3HLE A;  1MKI A;  1HLU P;  5EE8 A;  3S22 A;  3MJQ A;  5FI2 A;  2B02 A;  4S2N C;  4UAA A;  5FAP A;  5HWW A;  2Z2M B;  3VP1 A;  4JKT A;  3DW0 A;  4M3K A;  3ZDJ A;  4MN7 A;  1VET A;  1CI8 A;  3QHY A;  3LEQ A;  3GDI A;  3UE1 A;  1NYM A;  3GV9 A;  2OAP 1;  1SKO A;  5A93 A;  2Q9M A;  1OME A;  4I3I A;  1MC0 A;  1OJ5 A;  5AQB A;  4DJ2 A;  3MQQ A;  2D01 A;  4Y7P A;  2V8F A;  1GHP A;  1N9N A;  3OCN A;  2E8I A;  2NUP C;  1XGJ A;  2ZLY A;  3MKE A;  5CGW A;  1L0E A;  4EWF A;  4DDS A;  4GHI B;  1XKZ A;  4DN0 A;  2EXB A;  3ZFZ A;  1K57 A;  4E3N A;  4MBK A;  5AVE A;  3NCK A;  3KO6 A;  3MR0 A;  4YNR A;  2XQZ A;  2X01 A;  3B3X A;  3BFC A;  5EVI A;  2HP9 A;  4L0L A;  4KZ5 A;  1ESI A;  1PNE A;  3MFD A;  2A24 A;  3I7J A;  4A5R A;  3ISG A;  1T1B A;  3PYP A;  2Y2K A;  4FCF A;  3NIA A;  2WKP A;  3SS4 A;  1H8M A;  3SH7 A;  1JTG A;  1MWR A;  4BBT A;  3HCY A;  4OOL A;  1DP9 A;  1FSY A;  1VQQ A;  1GHM A;  3ZVW A;  4FUW A;  4Y0U A;  3T12 B;  1XJ2 A;  3F1N B;  4KZ8 A;  3G31 A;  4JXW A;  1PIO A;  4IBX A;  3C4O A;  5DTK A;  4WZ5 C;  1NY0 A;  5EFW A;  4WM9 A;  2ZMV A;  5D3O A;  1IYP A;  3VE3 A;  4P85 A;  2QJ5 A;  4IVK A;  4NET A;  4R70 A;  4GDB A;  1CI9 A;  4OPQ A;  3NHQ A;  3A0R A;  2H0Y A;  3QP6 A;  5FI6 A;  1P9W A;  4HES A;  1HZO A;  1P9R A;  5EPH A;  2V2F F;  4ETZ A;  3T4J A;  2JE5 A;  3GVB A;  5AQ7 A;  2FH5 A;  3T50 A;  1ONH A;  2G7U A;  3VFF A;  1T18 A;  2XRN A;  5HFO A;  4KG6 A;  4KZ7 A;  4HNB A;  1GA0 A;  5TBM B;  1VEU B;  2DCF A;  1KGF A;  1D1J A;  3IS2 A;  3KYE A;  1SHV A;  4S2P A;  3ZGA B;  5CTM A;  3VE4 A;  2W1T A;  3LI9 A;  3GQZ A;  4ZJ1 A;  2PR5 A;  4DJ3 A;  5J8X A;  3NI9 A;  3BLS A;  2HJE A;  5I94 A;  4JXS A;  3VOZ A;  3QP4 A;  1HTZ A;  3FKV A;  3W4O A;  4C75 A;  1PW8 A;  5I5L A;  3PBT A;  4CPK A;  2RL3 A;  4RQ9 A;  4KZ6 A;  1S0W A;  4EER A;  3LR3 A;  4Y17 A;  3WS1 A;  4Z9Q A;  1P0Z A;  1S6R A;  2R78 A;  4IED A;  4UA9 A;  1K54 A;  3GRJ A;  1NXY A;  4IUH A;  2PD7 A;  4C6Y A;  4B9O A;  4RX2 A;  4KQQ A;  1W7F A;  3MQ0 A;  1SDE A;  1YLZ A;  4HH3 A;  3M6H A;  5AVF A;  3LIC A;  1VB6 A;  2O9B A;  1TS0 A;  3MXQ A;  5M18 A;  3KSI A;  1G5U A;  3QP1 A;  4HJ3 A;  4X55 A;  3HLF A;  1MZU A;  3DWK A;  2XA7 S;  4PAU A;  3N6I A;  2W27 A;  5DTT A;  3HLG A;  4FOF A;  1KE3 A;  2UV0 E;  1KVL A;  5CHJ A;  3SH8 A;  2XDM A;  3HUO A;  3WRZ A;  1PW1 A;  2WKH A;  3IT9 A;  3IF6 A;  2EX9 A;  3L9K A;  4HOI A;  4O8G A;  2WKQ A;  1K4E A;  4CLC D;  2PBY A;  3BRM A;  3C7V A;  3WS5 A;  5HPI A;  3IX8 A;  4R1G A;  4E3M A;  1J9M A;  1LSX A;  1ZHH B;  4F3L B;  3V3S A;  2VGK A;  1IFQ A;  4GLQ A;  3UB6 A;  4LV3 A;  3UO9 A;  1DY6 A;  1XP4 A;  4G3W A;  3LFV A;  4PHT A;  3GMW A;  4CLC E;  3B42 A;  3W2Z A;  5HL1 A;  4GD8 A;  3RTY A;  5A91 A;  3OCL A;  4UQI M;  2OWH A;  4HI4 A;  5HAP A;  2K2N A;  3H82 B;  4WMC D;  3Q7Z A;  3SW1 A;  1CJF A;  3PBQ A;  2WAD A;  3IX3 A;  3GTC A;  4ZDX A;  4PMA A;  3QP2 A;  1L0D A;  4FSF A;  5FQM A;  2LB5 A;  4CQH A;  4GHI A;  2UWX A;  3FPW A;  5EEC A;  3EQU A;  3LR0 A;  1SZV A;  4NK3 A;  5FQQ A;  3IHA A;  5HWV A;  3G34 A;  1O07 A;  2QJ7 A;  2PT7 A;  4IUK A;  4OOM A;  2H5S A;  1H3Q A;  4ARZ B;  5CHU A;  3BYD A;  4EBN A;  5CHM A;  3MSH A;  2J9P A;  1LT0 A;  3LR5 A;  1ESU A;  3F1O B;  1F2K A;  4LCL A;  1ZG4 A;  2HDQ A;  5DFX A;  2OLV A;  2KX6 A;  2XR0 A;  3T1Q B;  3SZT A;  4EUV A;  3LCE A;  3Q82 A;  4XT2 B;  1IYQ A;  2B18 A;  1LHY A;  4R38 A;  4DXB A;  1XPB A;  3RXW A;  4JGR A;  1DP8 A;  1K25 A;  4CLC C;  3H9W A;  1NWZ A;  2BAS A;  2VV7 A;  4H8R A;  3A3J A;  1I2W A;  1TVF A;  2ZQD A;  2XF3 A;  5IHV A;  2BG1 A;  3F1N A;  1GSX A;  4KZA A;  3HLD A;  4PM7 A;  3WS4 A;  1EI5 A;  3ZCZ A;  4GN2 A;  2GDN A;  2K7S A;  3BJN A;  3S1Y A;  2ZL1 B;  2J7V A;  3BY8 A;  4M4X A;  3P98 A;  3P09 A;  4LFU A;  1M6K A;  2RCX A;  2XH9 A;  4Q8I A;  3EQV A;  3VV4 A;  3NDG A;  4O7D A;  1ES5 A;  5M1A A;  1NZU A;  3E0Y A;  5G4Z A;  1YKD A;  3ICY A;  3FZC A;  3M6B A;  1ZKJ A;  3N4I A;  5J4E A;  3MBZ A;  2GJ3 A;  4Q0H A;  5TBM A;  4S2K A;  2IWB A;  1TDG A;  1VEU A;  4N1H A;  5FSR A;  3G32 A;  2KDK A;  1OT9 A;  3MF0 A;  2ZC6 B;  5EVI D;  4EES A;  4DE0 A;  1C3B A;  2KOI A;  3O87 A;  4DE3 A;  4HBU A;  3PR6 A;  1NLY A;  2VV8 A;  3PHY A;  3CLO A;  3AGD A;  3E2K A;  2EX8 A;  1PZP A;  5E2G A;  4S2J A;  4LGW A;  1DJB A;  1WYB A;  1YQS A;  4CJN A;  5F83 A;  5CTN A;  1MWS A;  3UB8 A;  3SOI A;  5GHX A;  5FDH A;  4PM5 A;  1T1A A;  3LY4 A;  4YWZ A;  2OV5 A;  3V3R A;  4QY5 A;  4EQ1 A;  2IWD A;  2PU4 A;  3K3C A;  4Q0I A;  1AXB A;  4N9K A;  5EUA A;  2OWJ A;  1DJA A;  3A3I A;  3OPL A;  4FTX A;  1DP6 A;  3UE0 A;  2BTF P;  2W3D A;  2VZW A;  2Z2L B;  2B5R A;  3DWZ A;  4HQA A;  3ZHH A;  2Y2O A;  5CEC A;  2Y2Q A;  1MKM A;  2E8J A;  4JBF A;  2WKI A;  2XD5 A;  2J3W A;  4EV4 A;  4F3L A;  1KGE A;  4BD1 A;  4BQM A;  4MN5 A;  3VP3 A;  3OC2 A;  3N8S A;  3B47 A;  5E2E A;  2A3U A;  4BEN A;  5CRF A;  2PYP A;  4B4Z A;  4L9F A;  4QD4 A;  3Q7V B;  4DE1 A;  5DKL A;  2J8Y A;  3IXB A;  1KDS A;  2HZ5 A;  3BEC A;  2ZM0 A;  2ZQA A;  2QWS A;  4X56 A;  2HP6 A;  4WEJ A;  2Y79 A;  3IXD A;  3PAG A;  5EVL A;  3EOI A;  1F9I A;  4WF0 A;  3NOP C;  1A0K A;  4ME4 A;  4X25 A;  2L4R A;  3DTE A;  3NC8 A;  4B93 A;  4P6Z M;  4B88 A;  1Q2Q A;  1YLP A;  4Y15 A;  3Q1F A;  2EXA A;  1RGZ A;  5U47 A;  3UDX A;  2JKG A;  4MEZ A;  4WLA A;  3FYZ A;  3BFD A;  1T19 A;  4ARZ A;  2CMN A;  2X71 A;  4OLD A;  4ID4 A;  1Y4O A;  3E4P A;  2J80 A;  1JWV A;  2J3T D;  4OQG A;  1KDW A;  3F1O A;  4OP5 A;  3D72 A;  5DKK A;  2ZM2 A;  3C7U A;  4NG2 A;  3G2Y A;  4MLL A;  4XT2 A;  4DXC A;  3UE6 A;  2ZC7 A;  2JKT I;  2ZD8 A;  3FKW A;  4ZBE A;  4BL2 A;  2OSU A;  4B4X A;  3BQ8 A;  4L9G A;  3FPV A;  2PBD P;  3PBN A;  3A3F A;  4WEK A;  2H0T A;  3EWK A;  5DF8 A;  3EGD C;  4D2O A;  1KOU A;  1O7E A;  3HUM A;  5GHY A;  3EEH A;  2M7V A;  2V0W A;  5CGX A;  3D9Y A;  4X1M A;  5HL6 A;  3BQA A;  1S4R A;  1K55 A;  2ZQ9 A;  3CJM A;  3UPO A;  5C5K A;  2Y2L A;  2WZZ A;  4I5S A;  4KG5 A;  3LI8 A;  4E04 A;  3T4O A;  3VP0 A;  3V67 A;  1L3L A;  5DTS A;  5F68 A;  2Y2P A;  3DTI A;  2ZMF A;  4S2N A;  3NBL A;  2EWW A;  3B33 A;  4PPR A;  1MPL A;  5E2F A;  2P7J A;  3JVU A;  2Y55 A;  1BZA A;  3ITA A;  1W79 A;  1MWU A;  1GCE A;  1V9Y A;  4HHD A;  3UDI A;  1IYS A;  3DTM A;  5GLD A;  4HP9 A;  2FFY A;  3S4X A;  3HLW A;  3UY6 A;  1FR1 A;  3WWX A;  2Y8H A;  1K0K A;  4EEP A;  2V8C A;  4GKU A;  3CIT A;  2WGW B;  1LL8 A;  1YLT A;  1X0O A;  2W1R A;  3LY3 A;  4I39 A;  2WKR A;  3OPH A;  1WYC A;  3IF6 C;  1K6R A;  1N9O A;  2J3T C;  2PU2 A;  1CF0 A;  4EXO A;  1K56 A;  3CHW P;  3G35 A;  5FQ9 A;  4HH2 A;  4AFI A;  4Y13 A;  4EBP A;  4GW9 A;  4PM6 A;  1BTL A;  2GX5 A;  3UB7 A;  4Y5F A;  3TJZ C;  1KGG A;  4R3J A;  2C5W B;  4HP4 A;  1TS7 A;  1FSW A;  1TD5 A;  5FDS A;  3A0S A;  3BFF A;  3VOY A;  5IU1 A;  2O9C A;  5F69 A;  3FWL A;  1Y54 A;  3C38 A;  5GL9 A;  4ZAM A;  2IA2 A;  3EGX C;  2XFS A;  3O88 A;  3DTK A;  4GDN A;  4QWO A;  1XFN A;  1W5D A;  4PM9 A;  4CLC B;  4KZ9 A;  2INW A;  4LLO B;  2OOL A;  2PAV P;  2I72 A;  4FD8 A;  4JGP A;  2JC7 A;  1JWZ A;  2XD1 A;  1JWP A;  3RJU A;  3JPU A;  3HVF A;  2Q0O A;  1T1C A;  4WN5 A;  2XLN A;  3KSH A;  5GLC A;  1UWN X;  5HZH A;  5BOH A;  1XJ4 A;  4S2I A;  4UHU A;  3L7H A;  3TRC A;  1OPX A;  3KX0 X;  5FAS A;  4H6J B;  3Q7V A;  3A3E A;  2PYR A;  4KUK A;  1YAX A;  1PWD A;  4KUO A;  1YMX A;  5TR7 A;  2HJ9 C;  5L09 A;  3S7O A;  4E3O A;  3IQA A;  3UMD A;  1BT5 A;  5AJG A;  1CEG A;  5HAR A;  5HDS A;  4LCM A;  1ODV A;  2EFX A;  3IHB A;  3TSG A;  2Y2I A;  3NJA A;  1AWI A;  3AGF A;  4I3A A;  1YM1 A;  3QP5 A;  1MBL A;  2Y2H A;  4QPR A;  2JBF A;  5CED A;  3T1S A;  3MFX A;  1FOF A;  2JKR I;  3E4O A;  2VGL S;  4BL3 A;  1IKI A;  3K3D A;  2VA0 A;  2Y2J A;  5HWT A;  3FG8 A;  3V39 A;  4K0X A;  3IBJ A;  1S67 L;  1NZO A;  5GLA A;  5EVE A;  4UEY A;  1CQA A;  1BLH A;  1K38 A;  1ERO A;  3PBO A;  3TW8 A;  3CG5 A;  2VV6 A;  3HLC A;  3HJK A;  2HGV A;  2JKF A;  3UPN A;  2VLG A;  4K91 A;  1DRM A;  4ZJ3 A;  3IXH A;  2VK3 A;  5FI7 A;  3MS6 A;  1IKG A;  3OPR A;  1BLP A;  5JYP A;  1VM1 A;  1NRJ A;  5K5B A;  1PWC A;  4NXB A; 
#chains in the Genus database with same CATH homology
 2R9X A;  5E2H A;  2OV5 A;  3V3R A;  4QY5 A;  2WKE A;  2IWD A;  2PU4 A;  3IF5 A;  4MBK A;  5EOE A;  4QY6 A;  4LV0 A;  3IH9 A;  5DF9 A;  1AXB A;  4N9K A;  5EUA A;  4DE2 A;  1DJA A;  3A3I A;  3M2K A;  3SS3 A;  1EWZ A;  3OPL A;  3PTE A;  3NCK A;  3QNB A;  1TDL A;  4ZTK A;  2XQZ A;  3GR2 A;  2X01 A;  1GA9 A;  2XEP A;  2ZQ7 A;  3B3X A;  3BFC A;  5EVI A;  2X02 A;  3SH9 A;  4N92 A;  2HP9 A;  3UE0 A;  4BJP A;  3IWO A;  3LEZ A;  4L0L A;  2ZQC A;  4KZ5 A;  4WZ5 A;  4BLM A;  1ESI A;  2IWC A;  3MFD A;  3I7J A;  2Z2L B;  3IXG A;  4LV2 A;  4A5R A;  3ISG A;  4JF6 A;  2Y2N A;  5A92 A;  2B5R A;  1Q2P A;  2Y2K A;  4DDY A;  3DWZ A;  4FCF A;  3ZHH A;  1YLW A;  3NIA A;  2H10 A;  3CMZ A;  4U0T A;  1SCW A;  2Y2O A;  1L2S A;  3SS4 A;  5CEC A;  3SH7 A;  2A49 A;  1JTG A;  1MWR A;  2Y2Q A;  2ZJ9 A;  4UA7 A;  4Y0T A;  4JBF A;  4GOG A;  1H8Z A;  2WKI A;  2XD5 A;  4OOL A;  4EV4 A;  4KG2 A;  1YMS A;  3UE3 A;  1KGE A;  4BD1 A;  4OPZ A;  3UPP A;  3ZG8 B;  1FSY A;  1BLC A;  1VQQ A;  1GHM A;  4BQM A;  4R3B A;  4LEN A;  3C4P A;  3ZVW A;  3VP3 A;  1K4F A;  4QU3 A;  4R4S A;  3OC2 A;  4Y0U A;  3N8S A;  3OZH A;  5E2E A;  1KE0 A;  4OVD A;  2A3U A;  2WGW A;  4BEN A;  4K0W A;  2DNS A;  4KZ8 A;  4MBH A;  5CRF A;  1I5Q A;  3G31 A;  4JXW A;  4GNU A;  1PIO A;  4IBX A;  3C4O A;  5DTK A;  2EFU A;  4WZ5 C;  3V50 A;  4B4Z A;  1NY0 A;  1PI5 A;  1JVJ A;  3BEB A;  3Q7V B;  1H5X A;  4QD4 A;  4WM9 A;  5D3O A;  4XUX A;  5A90 A;  4DE1 A;  1IYP A;  4KQO A;  2J8Y A;  3IXB A;  3BLM A;  4P85 A;  1KDS A;  1ZG6 A;  3BEC A;  4JF4 A;  3ZG0 A;  4JXG A;  3PBR A;  4IVK A;  4YFM A;  2ZM0 A;  2ZQA A;  2HDR A;  3BFE A;  4NET A;  2XK1 A;  4X56 A;  1IYO A;  2HP6 A;  2WAF A;  1CI9 A;  4GDB A;  4OPQ A;  4WEJ A;  3IXD A;  3PAG A;  5EVL A;  4OQI A;  2FFF B;  2V1Z A;  2H0Y A;  5FI6 A;  1WE4 A;  4HES A;  1LL5 A;  1HZO A;  3CZD A;  1E25 A;  1ES2 A;  5EPH A;  1FR6 A;  2V2F F;  3GSG A;  4R0Q A;  2JE5 A;  3GVB A;  5AQ7 A;  2JCH A;  3NC8 A;  1ONH A;  5FAT A;  3VFF A;  5HFO A;  2P9V B;  4KG6 A;  1N9B A;  4KZ7 A;  4B88 A;  1GA0 A;  1Q2Q A;  1YLP A;  3MZE A;  5F1G A;  2DCF A;  1KGF A;  2QMI A;  3Q1F A;  2EXA A;  3PBS A;  1RGZ A;  5U47 A;  3UDX A;  5KSC A;  1SHV A;  4MEZ A;  1PZO A;  4S2P A;  3FYZ A;  3BFD A;  3W4Q A;  1LI9 A;  3ZGA B;  5CTM A;  1XA7 A;  4N1X A;  4ZJ2 A;  3MKF A;  4GD6 A;  3GQZ A;  1BLS A;  1N4O A;  3RXX A;  5KZH A;  5HAI A;  2X71 A;  4ZJ1 A;  1FQG A;  4OLD A;  2Y91 A;  2G2W A;  5J8X A;  4ID4 A;  3NI9 A;  3BLS A;  3BM6 A;  4DF6 A;  1QMF A;  5I94 A;  1PYY A;  4JXS A;  1IEL A;  1ALQ A;  1JWV A;  3VOZ A;  3ZG9 B;  1HTZ A;  3FKV A;  4OQG A;  4XXR A;  2ZM8 A;  3W4O A;  1KDW A;  4OP5 A;  4BD0 A;  3ZNY A;  4C75 A;  3HRE A;  1PW8 A;  2ZM2 A;  3C7U A;  3G2Y A;  3PBT A;  4CPK A;  4MLL A;  4JXV A;  4DXC A;  1I2S A;  5M19 A;  2RL3 A;  2ZC7 A;  3N8L A;  3PAE A;  4KZ6 A;  2ZD8 A;  2EX6 A;  3FKW A;  2WGV A;  3G30 A;  4OH0 A;  1S0W A;  4OPR A;  4ZBE A;  4BL2 A;  4DKI A;  4GZB A;  2OSU A;  3WS1 A;  4B4X A;  4Z9Q A;  1S6R A;  1IEM A;  3VSK A;  3HLB A;  2DRW A;  3JYI A;  1CEF A;  4IED A;  4UA9 A;  1K54 A;  3GRJ A;  1BSG A;  3PBN A;  4MNR A;  2WGI A;  1NXY A;  3A3F A;  4WEK A;  2H0T A;  4P87 A;  1QME A;  5DF8 A;  4D2O A;  1FCM A;  5AQ9 A;  4C6Y A;  1O7E A;  3HUM A;  3NY4 A;  4KQQ A;  4RX2 A;  1W7F A;  5GHY A;  1SDE A;  1YLZ A;  5CGX A;  2OLU A;  3M6H A;  4OLG A;  2G2U A;  3A3D A;  1K55 A;  4U0X A;  5M18 A;  4S2L A;  2ZQ9 A;  3CJM A;  3UPO A;  2Y2L A;  3C5A A;  3O86 A;  2WK0 A;  4X55 A;  2WZZ A;  3HLF A;  4OQH A;  3SS5 A;  3ZVT A;  1K56 D;  4KG5 A;  3DWK A;  2CC1 A;  3WRT A;  5EVI B;  2WYX A;  3N6I A;  3VP0 A;  1K57 C;  5DTT A;  5DTS A;  3HLG A;  1BUL A;  4KZ4 A;  5EOO A;  1BUE A;  2Y2P A;  1KE3 A;  3VFH A;  4RVA A;  1KVL A;  1MXO A;  4S2N A;  5CHJ A;  4KQR A;  3MXR A;  2XDM A;  1NRF A;  3HUO A;  3NBL A;  3SH8 A;  4KEN B;  4RX3 A;  1PW1 A;  2WKH A;  3IT9 A;  3WRZ A;  1E4D A;  4Y0O A;  3IF6 A;  2EX9 A;  4DRT A;  1G6A A;  4PPR A;  2EX2 A;  5FQJ A;  1G68 A;  2HP5 A;  3ZG5 A;  1MPL A;  5E2F A;  1K4E A;  3W8K A;  5EVI C;  1XXM A;  2Y55 A;  2PBY A;  4IVI A;  3BRM A;  3C7V A;  2V20 A;  1BZA A;  3ITA A;  1W79 A;  1ES4 A;  3IWQ A;  3WS5 A;  4U3T A;  1KVM A;  1MWU A;  5G18 A;  1TEM A;  4R1G A;  1LLB A;  1GCE A;  1RCJ A;  4E3M A;  1J9M A;  3UDI A;  1IYS A;  1DJC A;  3DTM A;  5GLD A;  3V3S A;  1GHI A;  2VGK A;  2FFY A;  4OPY A;  5F1F A;  4HBT A;  3S4X A;  5KMW A;  3HLW A;  3UY6 A;  1FR1 A;  4JPM A;  3UN7 A;  3WWX A;  3Q07 A;  4QB8 A;  4X53 A;  4LV3 A;  3UO9 A;  1DY6 A;  1XP4 A;  3Q81 A;  4GKU A;  3E2L A;  3LO7 A;  2WGW B;  4QJG A;  2Y59 A;  1YLT A;  2HDU A;  3GMW A;  3LY3 A;  5FAQ A;  3W4P A;  1NYY A;  3HBR A;  1SDN A;  3OPH A;  5HL1 A;  4GD8 A;  5A91 A;  1WYC A;  3OCL A;  3IF6 C;  4QHC A;  5JYO A;  3MZF A;  4E6X A;  2HDS A;  3AGE A;  4YIN A;  4OQ0 A;  5HAP A;  1K6R A;  2P74 A;  5HAQ A;  3G2Z A;  4KZB A;  2PU2 A;  3D4F A;  4OOY A;  1K56 A;  2ZMA A;  3G35 A;  5FQ9 A;  1SKF A;  2QZ6 A;  4GB7 A;  4EBP A;  5FAO A;  4WMC D;  5L2F A;  5KSH A;  3Q7Z A;  2ZQ8 A;  5DF7 A;  3PBQ A;  1ZC2 A;  4R4R A;  1NJ4 A;  4HEF A;  2WAD A;  1XGI A;  3GTC A;  4PM6 A;  4PMA A;  3WS0 A;  4EBL A;  1BTL A;  4ZDX A;  1L0D A;  4FSF A;  4FH4 A;  3IH8 A;  5FQM A;  1HD8 A;  3WS2 A;  4KZ3 A;  4JF5 A;  2UWX A;  5EEC A;  1FCO A;  1KGG A;  3EQU A;  4R3J A;  2C5W B;  4NK3 A;  5FQQ A;  3IHA A;  1FSW A;  3G34 A;  1PWG A;  4FH2 A;  4OKP A;  1O07 A;  4X69 A;  1ERM A;  1LI0 A;  3BFF A;  5CXW A;  5AQA A;  2XGN A;  1U60 A;  4WYY A;  5CEB A;  3VOY A;  4S2O A;  4OOM A;  2QPN A;  1L0F A;  5GHZ A;  2WUQ A;  3O3V A;  2H5S A;  3ZG7 B;  4C3Q A;  3FWL A;  1Y54 A;  5GL9 A;  3QNC A;  5CHU A;  5E43 A;  4ZAM A;  2Q9N A;  1CK3 A;  1M40 A;  3BYD A;  3M2J A;  2VGJ A;  5CHM A;  4EBN A;  2XFS A;  1KE4 A;  3UDF A;  4UA6 A;  2J9P A;  3N8R A;  3O88 A;  2C6W B;  3HL9 A;  4P6B A;  3VP2 A;  1Z6F A;  4GDN A;  3VSL A;  4P0M A;  5HX9 A;  4WZ4 A;  2ZC5 B;  1W5D A;  4PM9 A;  1ESU A;  3TG9 A;  4LCL A;  1ZG4 A;  2HDQ A;  2OLV A;  3ITB A;  3IWI A;  1W8Q A;  4KZ9 A;  2XR0 A;  1PI4 A;  1YLJ A;  3LCE A;  3Q82 A;  1IYQ A;  4E3I A;  1YT4 A;  1LHY A;  4MBF A;  2I72 A;  4DXB A;  1XPB A;  4FD8 A;  3RXW A;  3UNW A;  4E6W A;  1E3U D;  2JC7 A;  4OP8 A;  1JWZ A;  2XD1 A;  1JWP A;  1RGY A;  3LY4 A;  1K25 A;  4PM8 A;  3RJU A;  5CER A;  1XX2 A;  4X68 A;  4H8R A;  3HVF A;  4WMC A;  4OON A;  1RP5 A;  4R23 A;  4XUZ A;  3A3J A;  2XLN A;  4E3L A;  2XFT A;  1I2W A;  4EUZ A;  1TVF A;  2ZQD A;  3VMA A;  5GLC A;  1LL9 A;  3ZNT A;  4S2M A;  5BOH A;  1MY8 A;  2XF3 A;  4S2I A;  5IHV A;  1MWT A;  2BG1 A;  3VP4 A;  4UHU A;  4KZA A;  3HLD A;  3TOI A;  4PM7 A;  5FA7 A;  1EI5 A;  3WS4 A;  2WZX A;  3ZCZ A;  4GN2 A;  5FAS A;  1K54 C;  2GDN A;  3OPP A;  1K6S A;  3Q7V A;  5F82 A;  3S1Y A;  3A3E A;  1L0G A;  2J7V A;  3P98 A;  5HW3 A;  2ZC4 B;  5GLB A;  5TGF A;  3P09 A;  4IBR A;  2HPB A;  1PWD A;  1M6K A;  2RCX A;  2XH9 A;  1YMX A;  5TR7 A;  3G4P A;  1W8Y A;  1K55 C;  4Q8I A;  2R9W A;  3EQV A;  4E3K A;  4E3O A;  1JTD A;  3IF6 B;  3IQA A;  1BT5 A;  3NDE A;  3HLE A;  1ES3 A;  1MKI A;  1CEG A;  3NDG A;  4O7D A;  3FV7 A;  1ES5 A;  5CGS A;  5M1A A;  2Y2G A;  5HAR A;  5EE8 A;  1NZU A;  4LCM A;  2EFX A;  3BFG A;  3IHB A;  3TSG A;  2Y4A A;  2Y2I A;  4X6T A;  3S22 A;  3AGF A;  5FI2 A;  3FZC A;  3M6B A;  5FQK A;  1ZKJ A;  1YM1 A;  3N4I A;  4S2N C;  4UAA A;  3MBZ A;  2P9V A;  5FAP A;  1MBL A;  2Y2H A;  2Z2M B;  3VP1 A;  4JKT A;  2J9O A;  1H8Y A;  4S2K A;  2ZC3 B;  1TDG A;  2JBF A;  3DW0 A;  1HVB A;  4N1H A;  4M3K A;  2IWB A;  3ZDJ A;  5CED A;  5FSR A;  1FOF A;  3G32 A;  1E3U A;  2ZC6 B;  3QHY A;  1CI8 A;  5EVI D;  4BL3 A;  4WEL A;  3N7W A;  1IKI A;  4E3J A;  4DE0 A;  2Y2J A;  4JLF A;  3UE1 A;  1NYM A;  3GV9 A;  3MZD A;  1C3B A;  4K0X A;  3V39 A;  5A93 A;  1NZO A;  2Q9M A;  4WBG A;  4LV1 A;  5GLA A;  3O87 A;  1FCN A;  4F94 A;  4DE3 A;  4EQI A;  4HBU A;  1OME A;  1BLH A;  1K38 A;  1YLY A;  5AQB A;  1ERO A;  5DVA A;  3PBO A;  5FQI A;  3AGD A;  3E2K A;  2Y2M A;  2EX8 A;  1PZP A;  3CG5 A;  1ONG A;  5E2G A;  4S2J A;  1DJB A;  3HLC A;  1WYB A;  4Y7P A;  1GHP A;  4RYE A;  5TFQ A;  3UPN A;  2BLS A;  3OCN A;  2E8I A;  1YQS A;  4K91 A;  5F83 A;  1ERQ A;  4CJN A;  4N9L A;  5CTN A;  1XGJ A;  4ZJ3 A;  1MWS A;  2ZLY A;  3MKE A;  3IXH A;  3SOI A;  3HUN A;  5GHX A;  5FDH A;  5CGW A;  1L0E A;  5FI7 A;  4EWF A;  1IKG A;  3OPR A;  1BLP A;  4DDS A;  5JYP A;  1VM1 A;  1XKZ A;  4PM5 A;  2EXB A;  3ZFZ A;  1K57 A;  1XA1 A;  4RA7 A;  1PWC A;  3MXS A;  4E3N A;  3V5M A;  2WAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...