5KMWA

Toho1 beta lactamase mutant e166a/r274n/r276n -benzyl penicillin complex
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
256
structure length
256
Chain Sequence
VQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase Toho-1
publication title TOHO1 Beta lactamase mutant E166A/R274N/R276N -benzyl penicillin complex
rcsb
source organism Escherichia coli
total genus 91
structure length 256
sequence length 256
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5kmwA00
4JF4A 4QY5A 1C3BA 3E2KA 2WGWA 3B3XA 4KQOA 1JVJA 3SH9A 3AGFA 4KQQA 4OOMA 3CJMA 5EVIB 1M40A 5A92A 5CTMA 2H5SA 3ZDJA 3UE1A 3ZCZA 2HDUA 3V5MA 3HLFA 4S2JA 4OONA 1SDNA 4X6TA 2EX2A 4B88A 2H0YA 5E43A 5EVLA 3Q1FA 2V1ZA 4BD1A 4LCMA 5EVID 1GA9A 4DF6A 4KG5A 3E2LA 4X56A 5CEBA 3VP0A 4P85A 2XH9A 1FCNA 1K54A 2ZQ9A 1G68A 4S2IA 5FI7A 4FSFA 4N1XA 1FSWA 4BQMA 1HZOA 2ZLYA 4EQIA 1PWDA 2WKEA 4LENA 1SCWA 3ZG5A 2OLUA 4E3IA 4OKPA 1L0DA 5FQ9A 4OLGA 1KDWA 3DWZA 5GLCA 3GMWA 4KZAA 3ISGA 5DVAA 3BFCA 2Y59A 3SS4A 1K57C 3IHAA 4U0TA 3UPNA 5KZHA 3D4FA 4WYYA 5FQJA 2WAFA 5CHMA 1LHYA 1RP5A 3GV9A 4R4RA 2EX8A 3MFDA 1QMEA 2EX6A 4HEFA 4S2KA 4E3MA 2X02A 5TGFA 3WS4A 4WMCA 1YLWA 2XFSA 3N8LA 3SS3A 5FAOA 4DE2A 3V39A 4FH4A 4EBNA 1IYOA 4DDYA 3HREA 1MWSA 3VFHA 2PBYA 3ZHHA 5D3OA 2GDNA 3QNCA 3IF5A 1IELA 4WZ5A 3MKFA 2DCFA 2Y55A 4Y0OA 5KSCA 3HUOA 2WAEA 5F83A 4WMCD 1EI5A 2WKIA 1JTGA 3N7WA 4N9LA 4OP5A 1FQGA 4LCLA 5EVIC 1E3UD 3SOIA 3FV7A 3RXWA 3OPPA 2P9VB 1ONHA 2J8YA 3C7UA 3NY4A 4KZ6A 5KSHA 3ZG8B 1XA7A 2QZ6A 4YINA 1HVBA 3HUMA 5DF8A 2Z2LB 3DW0A 3GTCA 2WADA 1LL5A 2J9OA 1KGEA 1H8ZA 1TDGA 3FKVA 5TR7A 2OLVA 2Y2MA 3Q07A 3SH8A 4WEKA 1YMSA 5CERA 1NY0A 5EOOA 4K91A 3G32A 5EPHA 4F94A 3ZG9B 1XP4A 3VP2A 2WZXA 2ZC5B 4KZ4A 3G31A 1L0FA 1CEGA 4JF6A 2Y2GA 4O7DA 5EUAA 3GVBA 5U47A 1YLTA 1YLZA 4FH2A 4OOLA 5CTNA 4A5RA 2ZQDA 4FCFA 1MWTA 1KGGA 1YQSA 3HLCA 4KZ3A 1I2WA 3IQAA 3DWKA 5EE8A 3WRZA 4MBKA 4E3JA 3NC8A 2Q9NA 1E4DA 1TDLA 4MLLA 3W4OA 4BJPA 4EBLA 3PBOA 1K4EA 4EBPA 5EECA 3IXBA 5M1AA 1NRFA 4X55A 4OP8A 2C6WB 1JWVA 1EROA 4RX3A 5GHZA 1K55C 5JYPA 1MPLA 4E3NA 1W79A 5DTTA 1HTZA 2HP9A 4KG2A 3G4PA 5CXWA 1PWGA 2RL3A 2WGWB 4WBGA 3C7VA 4HBUA 4Q8IA 1W7FA 4P6BA 3CMZA 5FI6A 2XEPA 4BLMA 4JXGA 3N6IA 1PZOA 4FD8A 2R9XA 5HAPA 3HLGA 3UPPA 4XUXA 1XXMA 2C5WB 4JBFA 1BLHA 1PI5A 1TVFA 2FFFB 2Y2QA 3C4OA 2E8IA 4EUZA 3VOZA 1W5DA 2ZC4B 3WS2A 2ZC3B 4BL3A 1KE4A 5CHJA 4DXCA 1LI0A 2X01A 2H10A 4KZ8A 4JF5A 1DJCA 4JXVA 4OOYA 3IF6A 1S6RA 3OPRA 3Q7VA 1WE4A 3VSLA 3FYZA 4R3JA 2VGKA 2ZQ8A 3G2ZA 1L0EA 2XGNA 3ZNYA 5FAQA 1H8YA 1SHVA 4GDNA 2ZMAA 3ZFZA 3UE0A 4JXSA 4PM5A 3FKWA 3IWIA 2HDRA 4GD6A 3VP3A 1PIOA 2V2FF 4S2PA 3UDIA 1TEMA 3PBTA 4RYEA 4U3TA 1PW1A 2HDQA 3BFFA 2HDSA 3C4PA 3IWQA 4P0MA 1BT5A 1ALQA 1GCEA 3ITBA 3OZHA 5FI2A 4QJGA 3OPHA 1MY8A 3HLWA 5CGWA 1W8YA 5FQIA 2Y2OA 5CEDA 3HLEA 5HAIA 3CG5A 1XGJA 1IKIA 1CI9A 4K0XA 2XK1A 5GHXA 1BZAA 3GR2A 4DE0A 4NETA 3BFGA 3Q82A 4DXBA 3ITAA 4E3KA 2OV5A 1BSGA 4ID4A 3BRMA 1FSYA 1K56A 4E6XA 3GQZA 1FOFA 1O07A 3ZVWA 4KZ5A 1GA0A 5GHYA 4NK3A 1PWCA 1JWZA 3FZCA 4OPYA 4UA9A 3M2KA 3IH8A 5E2HA 3RXXA 4GD8A 4X53A 3MKEA 4OQ0A 4S2NA 1FCOA 2Y2NA 4MEZA 3BYDA 1VQQA 5DF7A 3SH7A 4UHUA 3V50A 1N9BA 3GSGA 3VSKA 2DNSA 3PAGA 2ZM0A 3NCKA 5AQBA 3P09A 1IYPA 3HBRA 3BECA 1WYCA 4QHCA 5FAPA 3ZGAB 3PBRA 1YT4A 2PU2A 4PM8A 2P74A 4RX2A 3O3VA 4GNUA 4C3QA 3IXGA 5JYOA 1G6AA 5HX9A 3W4PA 2B5RA 2ZJ9A 5DF9A 3S22A 2Y2JA 4EV4A 4X69A 1I5QA 3LY3A 4IVKA 5HL1A 1PZPA 5FA7A 4DKIA 1CK3A 1XA1A 3NI9A 2FFYA 2XQZA 1RCJA 4OVDA 4YFMA 2ZM8A 1CEFA 2XDMA 4K0WA 1ES3A 1FCMA 1KVLA 4MBFA 2Y4AA 1RGZA 1Z6FA 4JLFA 3QHYA 4ZJ1A 4KQRA 4UA7A 3M2JA 3VFFA 4R3BA 1BULA 2IWCA 4OPZA 5TFQA 3G35A 5CECA 1ZG6A 1OMEA 5EOEA 3UN7A 1ONGA 4KZ9A 1Q2QA 5E2EA 3IH9A 2Q9MA 4ZAMA 3RJUA 1IYQA 5FDHA 3OC2A 5HW3A 1K6SA 2H0TA 1DY6A 4M3KA 3LEZA 4ZBEA 4OH0A 3W4QA 5FASA 3O88A 1L0GA 5F1FA 1NZUA 5F82A 3S1YA 3S4XA 4QU3A 4R1GA 4ZDXA 3QNBA 4OPQA 1DJBA 1JTDA 5AQAA 2WGVA 3NDEA 2XD1A 2G2UA 4GKUA 4QD4A 5FQKA 1KE3A 1FR6A 3AGDA 1IYSA 2XF3A 3IXHA 4WZ5C 1SDEA 5CRFA 4IBXA 4HESA 4B4XA 2QPNA 4N1HA 1PYYA 4U0XA 3UDXA 2I72A 3W8KA 2UWXA 4IBRA 2Z2MB 3V3RA 3A3JA 4P87A 3VMAA 5HAQA 3LCEA 5J8XA 1NYMA 3OCLA 2HPBA 5CGXA 1IKGA 3G2YA 3VP1A 4LV0A 1K57A 3WWXA 1S0WA 1QMFA 4WEJA 1ESIA 3BLMA 3HLBA 3PBSA 3ZG0A 4WZ4A 2EXAA 4CPKA 2Y91A 1XX2A 2Y2PA 4GN2A 4OPRA 1XGIA 4N92A 5HARA 1RGYA 3OCNA 1YLPA 4JKTA 4IEDA 5GLAA 3UNWA 4WM9A 3JYIA 3LO7A 4GZBA 3N8RA 4MNRA 4Y0TA 3A3EA 4OLDA 2XFTA 5FSRA 1J9MA 1NZOA 3HL9A 4JPMA 2EX9A 3UPOA 3IF6B 3Q7VB 1BLSA 1PI4A 4DRTA 5M18A 4LV1A 1NJ4A 1XKZA 4ZTKA 3WS1A 5I94A 4UA6A 4ZJ2A 5EVIA 4E6WA 1XPBA 3OPLA 3BFDA 4KENB 2XR0A 2HP6A 3A3DA 4KZ7A 5F1GA 4LV3A 5FQQA 5GL9A 4QY6A 3EQVA 2V20A 4GB7A 4X68A 4MBHA 2ZQAA 3IT9A 2HP5A 2BLSA 3PAEA 1ZC2A 2EXBA 1BUEA 1MBLA 1Y54A 5G18A 4E3LA 1LI9A 3IHBA 2Y2KA 4R4SA 3MZDA 2X71A 4PM6A 4JXWA 1WYBA 4E3OA 3ZG7B 2A49A 3SS5A 4L0LA 1FR1A 2DRWA 5GLBA 4BD0A 4XXRA 3UE3A 1GHIA 3IXDA 1MWUA 2QMIA 4PM9A 3VP4A 5L2FA 1MXOA 3Q7ZA 5FQMA 4S2LA 2JC7A 1JWPA 5CGSA 1AXBA 4R0QA 4S2OA 2ZM2A 1L2SA 5A93A 2CC1A 4BL2A 1K56D 3O86A 2WUQA 3VOYA 3HVFA 2ZQCA 1NXYA 2A3UA 2IWBA 5FATA 3LY4A 1MKIA 4RA7A 2Y2LA 4Y0UA 4B4ZA 3MXSA 1E3UA 2ZQ7A 4CJNA 2WK0A 3BLSA 5KMWA 2G2WA 1ERMA 3FWLA 4XUZA 2EFUA 1Q2PA 3A3FA 4LV2A 4GDBA 4QB8A 4Z9QA 1ES2A 4S2MA 1GHMA 4Y7PA 1BLCA 3HLDA 1K54C 3A3IA 5AQ7A 3IF6C 3TSGA 1SKFA 4PM7A 3O87A 3M6HA 1K55A 1LL9A 4N9KA 2Y2HA 1YLYA 1KVMA 1KGFA 4OQIA 1ZKJA 2XLNA 3NIAA 5M19A 4WELA 2WKHA 2ZC7A 1KDSA 2P9VA 1BLPA 2JBFA 5HFOA 5GLDA 3HUNA 1H5XA 1K25A 4KG6A 1ESUA 3C5AA 3UDFA 3G30A 3ZNTA 1EWZA 5BOHA 5A90A 3GRJA 1U60A 3P98A 3WS0A 3MXRA 3WS5A 4R23A 3ZVTA 1ZG4A 3EQUA 3WRTA 1GHPA 5E2FA 3MZFA 1HD8A 3N8SA 3BEBA 1ERQA 1O7EA 3Q81A 5DTSA 4DDSA 2J9PA 3MZEA 2Y2IA 3PBQA 1K6RA 3M6BA 1CI8A 4DE3A 3PTEA 2WYXA 2IWDA 4EWFA 4C6YA 4S2NC 3NDGA 4UAAA 2J7VA 1MWRA 3G34A 1YM1A 1VM1A 2PU4A 4HBTA 1W8QA 5IHVA 2ZD8A 5CHUA 2BG1A 2R9WA 4RVAA 5E2GA 2JCHA 3MBZA 1E25A 3N4IA 1N4OA 4KZBA 4C75A 1K4FA 4OQGA 4PMAA 4IVIA 2OSUA 3I7JA 5AQ9A 3TOIA 2VGJA 2WGIA 1ES5A 4PPRA 1M6KA 3V3SA 4H8RA 4ZJ3A 1I2SA 2EFXA 1LLBA 1K38A 1BTLA 3PBNA 2RCXA 3TG9A 1KE0A 3UY6A 4BENA 2WZZA 1NYYA 3BM6A 1YMXA 3NBLA 1DJAA 3CZDA 4GOGA 2XD5A 4OQHA 3DTMA 5A91A 3BFEA 2JE5A 2ZC6B 3IWOA 5DTKA 1ES4A 3AGEA 1YLJA 1PW8A 3UO9A 4D2OA 1IEMA 4DE1A
chains in the Genus database with same CATH superfamily
3SW1A 3D72A 4EUVA 3B3XA 3MXQA 1GSXA 2W3DA 3AGFA 4KQQA 3CJMA 3E4QA 3LI8A 3ZCZA 2HDUA 3V5MA 4OONA 1OTIA 3EOIA 5EVID 4KG5A 4P85A 4N1XA 2GJ3A 4KUKA 2WKEA 1TF1A 3LIEA 3ZG5A 3DBAA 2ZMVA 4R38A 3LUQA 3GMWA 5DKKA 3SS4A 4ARZB 4IUKA 4WYYA 1LHYA 3UB8A 4R4RA 2EX8A 4FUWA 1OTEA 4FH4A 4EBNA 4DDYA 3VFHA 1G28A 2GDNA 1LL8A 2ZOIA 1AWIA 2Y55A 5KSCA 2E8JA 2V0UA 3UMDA 3PR6A 5F83A 1EI5A 5EVIC 3SOIA 5EM1A 1SZVA 1XJ4A 2P9VB 1ONHA 4YINA 4HHDA 3GTCA 4B9OA 1F9IA 4NKPA 1S67L 2J9OA 1D1JA 2VA0A 4NXFA 4BBVA 3UB7A 1H8MA 4GHIB 5EOOA 5AVFA 5EPHA 4F94A 4M4XA 3VP2A 3NOUC 4KZ4A 3LR4A 1GSWA 1I2WA 3IQAA 2OOLA 4MBKA 2VZWA 4P6ZS 1NRFA 2JKRM 4Y15A 2KDKA 5GHZA 5JYPA 5DTTA 1HTZA 3BY9A 5CXWA 3EEAA 4WBGA 3C7VA 1W7FA 5FI6A 2PBDP 1PZOA 5J4EA 2EWVA 4XUXA 2C5WB 4JBFA 1TVFA 2W3FA 3LYXA 1H0MA 2ZC3B 4BMWA 4BL3A 3RTYA 5CHJA 5FL3A 4KZ8A 4JXVA 1DJCA 3JVVA 3VSLA 5FAQA 4GDNA 2B95A 4Q0HA 5F68A 2V2FF 3PBTA 3F1OA 1PW1A 2HDQA 2DMWA 3VE4A 3HLWA 5CGWA 1W8YA 5FQIA 1MC0A 2EWWA 4K0XA 2XK1A 3GR2A 2PYPA 2HZ5A 2YKHA 4LRYC 1PFLA 3GQZA 4KZ5A 1GA0A 4GD8A 4OQ0A 4S2NA 4BBTA 1CJFA 5DF7A 5HWTA 3SH7A 1N9BA 3GSGA 2DNSA 5FEFA 3NCKA 3C8CA 1IYPA 3HBRA 3CITA 3ZGAB 5EV0A 5JYOA 2W1TB 5HX9A 4EV4A 5DF9A 3T1RA 4X69A 5FA7A 4DKIA 1XA1A 1G6OA 2ZM8A 2XDMA 4K0WA 3T1SA 1ES3A 1FCMA 4WUJA 2PYRA 4BBUA 4JLFA 4ZDXA 3QHYA 4UA7A 2JKRI 4OPZA 3G35A 5E2EA 3A0SA 3H82A 3IH9A 4NG2A 4ZAMA 3RJUA 4HH2A 1IYQA 2L0WA 4M3KA 3LEZA 2K7SA 1L0GA 5F82A 4R1GA 4QPRA 2FH5A 2XD1A 2G2UA 2PHYA 3BWLA 4GKUA 2XF3A 4WZ5C 4HESA 5TBMA 2QPNA 3UDXA 2VGLS 2D02A 2WKRA 3OCLA 1QMFA 3A0VA 4IUHA 2Y2PA 2O99A 1XGIA 3OCNA 5GLAA 4Y0TA 3UE6A 3UPOA 1BLSA 3LFVA 3WS1A 5EVIA 5DKLA 1XPBA 3OPLA 5TJJA 5F1GA 2HP6A 3A3DA 5FQQA 3EQVA 3F1OB 3DTIA 2V20A 4GB7A 3FPVA 3HJIA 3NHQA 1NLYA 2Y2KA 1WA9A 4E3OA 1FR1A 4I39A 2PR6A 4EEUA 4PM9A 3VP4A 4HI4A 1MXOA 1F5MA 5HD3A 1L2SA 4X25A 4CLCE 5A93A 2CC1A 1K56D 3O86A 2JKGA 1NXYA 4ZRRA 5FATA 4Y0UA 3MXSA 2ZQ7A 3BLSA 1CQAA 4LV2A 4QB8A 3S7OA 4Z9QA 1ES2A 4S2MA 4Y7PA 3TSGA 1SKFA 4Y3IA 4WF0A 4WELA 2ZC7A 5HFOA 4EETB 5GLDA 3H82B 1ESUA 3UDFA 1EWZA 2KX6A 3WS0A 3WS5A 5E2FA 3FC7A 3N8SA 3BEBA 1ERQA 2YKFA 2J9PA 3MZEA 1K6RA 1CI8A 1Y28A 3E98A 5TBMB 4C6YA 1MWRA 3B47A 3RFBA 1VM1A 5J3WA 2ZD8A 4RVAA 1DP8A 2OAP1 4CLCD 1K4FA 4OQGA 2OSUA 3H7WA 3I7JA 3MR0A 1ES5A 4PPRA 3E4PA 2Y8HA 3FPWA 3UY6A 3T1QB 1YMXA 3IS2A 2XD5A 4EESA 2ZC6B 4PKYG 3LIDA 3T4SA 1PW8A 1IEMA 4DMZA 3SH9A 5EVIB 1TS0A 1PNEA 5CTMA 2O0YA 2H5SA 5HSQA 1KOUA 3UE1A 4S2JA 2EX2A 5E43A 3F1NA 3KYZA 3Q1FA 1STZA 2J3TD 4X56A 4LRZE 1Y4OA 4LRXC 1K54A 4FSFA 2HJEA 1HZOA 2J3WA 2ZLYA 1PWDA 3UB6A 2OLUA 4E3IA 4OKPA 5FQ9A 4OLGA 3CLOA 5DVAA 2Y59A 5F5YA 2W0NA 5KZHA 3D4FA 5FQJA 1EW0A 3MFDA 2EX6A 5A90A 4S2KA 4E3MA 4WMCA 3N8LA 5FAOA 3LR0A 1IYOA 1P97A 1IELA 4WZ5A 3HUOA 1LSXA 2WKIA 1FQGA 4LCLA 2J3TC 1TS7A 3EGXC 3KYQA 4F3LA 3RXWA 1DRMA 2J8YA 3C7UA 3NULA 2H28A 3IX8A 2QZ6A 1HVBA 5DF8A 4B93A 2Z2LB 3DW0A 1LL5A 5IS1A 1S1YA 5TR7A 3UMEA 3K3CA 3Q07A 3SH8A 1FILA 1YMSA 5CERA 4K91A 3MQ0A 2KLIA 4FTXA 2V8FA 1XP4A 2ZC5B 2P7JA 4JF6A 1L0FA 1CEGA 5EUAA 5U47A 1YLTA 1YLZA 4A5RA 4OOLA 3HLCA 1V9YA 3DWKA 3H7WB 5EE8A 3WRZA 4MLLA 1TDLA 3KSIA 4EBPA 3T1XA 1JWVA 3CPTA 4RX3A 4X1LA 3CAXA 1ZTUA 1K55C 4HY8A 4KG2A 3G4PA 3JVUA 4HBUA 3KO6A 1OTDA 1UWPX 2XEPA 4BWIA 3N6IA 1CF0A 3UPPA 4Q0JA 3IX4A 3G6OA 4EUZA 3F1NB 1W5DA 2ZC4B 2OWJA 4DXCA 2H10A 4JF5A 1H3QA 4OOYA 1S6RA 3OPRA 3FYZA 2Q0OA 3ZNYA 1H8YA 3ZFZA 3UE0A 5EVEA 4JXSA 4EW7A 5HWVA 4GD6A 3UDIA 4RYEA 3C4PA 2HDSA 3IWQA 4P0MA 1ALQA 4QJGA 3ITBA 1VHMA 5CEDA 3MF0A 1XGJA 4DXBA 3TRCA 3MSHA 4ID4A 3BRMA 4K08A 3S7QA 1K56A 4E6XA 1FOFA 4NK3A 4UA9A 4OPYA 3M2KA 3IH8A 1FCOA 4UHUA 4F3LB 4KUOA 3PAGA 5AQBA 4Y17A 4QHCA 1DP9A 5FAPA 3EWKA 3BJNA 2W1TA 3QP5A 1YSPA 1I5QA 3PYPA 1PZPA 1CK3A 2CMNA 1CEFA 1KVLA 1OTAA 2Y4AA 3W8KA 3VFFA 1ACFA 4R3BA 1BULA 5TFQA 3O5YA 1OMEA 5EOEA 1S66L 3NOTC 4KZ9A 1Q2QA 2Q9MA 5FDHA 3OC2A 5HW3A 2QKPA 1T1AA 4ZBEA 1S1ZA 3W4QA 5FASA 3O88A 3S1YA 3C38A 2BASA 2OAQ1 1P9RA 1JTDA 3NDEA 5FQKA 4HJ6A 4CLCA 3CPTB 4IBXA 4B4XA 5HDSA 4N1HA 2UWXA 2Z2MB 5J8XA 2HPBA 5CGXA 1IKGA 4LV0A 2L1MA 4WEJA 4OPRA 2PT7A 4GN2A 3W2ZA 4N92A 5HARA 1T1BA 4GCZA 3E4OA 3UNWA 5IT5A 4GZBA 2XFTA 3OLOA 1J9MA 2HF6A 3HL9A 2EX9A 3D9YA 1PI4A 4DRTA 4I3JA 4JGQA 3F1PB 4MN7A 4UA6A 4NXBA 4EU0A 4KENB 1N9LA 4LV3A 4WLAA 4X68A 3CUEC 2K31A 2ZQAA 3IT9A 2HP5A 2JN7A 4II7A 5L07A 5G18A 1LI9A 4ESPA 2X71A 4JXWA 1WYBA 1BYWA 4O8GA 3T4TA 4L0LA 2PD8A 1GHIA 3IXDA 1MWUA 5G4YA 2VX8A 2JC7A 1JWPA 1AXBA 3PHYA 4R0QA 3CI6A 4KQDA 1SKOA 1OPXA 3KX0X 2M7UA 2LB5A 3HVFA 2WKQA 2A3UA 4RA7A 4B4ZA 2Y2LA 3H9WA 5HDCA 4D60A 1ERMA 1NRJA 2EFUA 2VKSA 3A3FA 1GHMA 1K54C 4PM7A 3M6HA 1K55A 1G5UA 1KVMA 2XLNA 3VOLA 4EERA 3TJZC 4KG6A 4JGRA 3ZQ5A 1U60A 3P98A 3ZVTA 4R23A 3Q81A 5DTSA 1O7EA 4DDSA 2VV6A 5HWWA 3PBQA 3M6BA 3LIAA 4CLCB 1OJGA 3PTEA 2WYXA 3MQQA 2G7UA 4ME4A 2A24A 3G34A 5IHVA 1W8QA 4YOFA 2BG1A 2IA2A 2JCHA 3MBZA 1E25A 3N4IA 4KZBA 5AQ9A 2WGIA 3V3SA 4H8RA 4JGPA 2EFXA 3BQAA 3TG9A 1D7EA 4MMNA 5A91A 2JE5A 5DTKA 3AGEA 3UO9A 4D2OA 4QY5A 2WGWA 4KQOA 4OOMA 1M40A 2LB9A 4JGOA 1SDNA 2B18A 4X6TA 4B88A 1TS6A 2V1ZA 1GA9A 3EEHA 3E2LA 2XH9A 4MN6A 5CX7A 1LT0A 2ZQ9A 3ZYTA 1G68A 4S2IA 5FI7A 4LENA 1SCWA 4DN0A 1VETA 2INWA 1KDWA 5GLCA 4KZAA 3BFCA 4LGWA 1K57C 3MS6A 3IHAA 5KIZA 1SKOB 2M7VA 3KSGA 1D06A 1QMEA 2X02A 5TGFA 3WS4A 1YLWA 4X1MA 1ZHHB 3P7NA 1MWSA 3ZHHA 5D3OA 2UV0E 2QJ7A 1XFNA 5DFYA 2DCFA 4Y0OA 2WAEA 4O01A 3U2AA 4N9LA 1JTGA 3N7WA 4OP5A 1E3UD 3FV7A 3OPPA 2R78A 3NY4A 4I3AA 2HJ9C 5HD5A 3ZG8B 1XA7A 1V9ZA 2HGVA 3HUMA 1J3WA 2AVXA 1TDGA 3FKVA 3HCYA 2OLVA 4WEKA 4HNBA 4LFUA 4NEED 3G31A 3MFXA 2A24B 3GVBA 5CTNA 2K2NA 2ZQDA 1MWTA 1YQSA 4KZ3A 4UQIM 3CUEA 4E3JA 3NC8A 2Q9NA 1E4DA 4EBLA 1NLZA 3PBOA 1K4EA 2EA9A 4X55A 5I5LA 2V9AA 1MPLA 2ZOHA 2QYBA 5FEGA 3S7NA 1PWGA 2RL3A 2WGWB 1LSVA 4I38A 3T4KA 4Q8IA 3CMZA 4BLMA 1MKMA 1P9WA 4FD8A 2R9XA 3HLGA 2VEAA 4WN5A 1XXMA 3B42A 1PI5A 2Y2QA 2E8IA 3VOZA 4HP4A 3WS2A 1KE4A 3D3OA 1NWZA 1LI0A 2X01A 5L8MA 4CLCC 3DAVA 1L0EA 2XGNA 1SHVA 3LR5A 4PM5A 1VETB 3FKWA 3IWIA 2HDRA 4U3TA 3NJAA 1GCEA 5FI2A 3OPHA 1MY8A 2Y2OA 3HLEA 3CG5A 5GHXA 1BZAA 4DE0A 4NETA 3ITAA 4E3KA 2OV5A 4Y2FA 1BSGA 2P04A 4Y13A 1O07A 5A8BA 2KOIA 5GHYA 4DJ3A 1PWCA 1JWZA 3FZCA 3RXXA 3T50A 3LI9A 2Y2NA 5HPIA 3BYDA 1VQQA 3OOVA 4L9EA 2ZM0A 3DTKA 3P09A 2GNXA 2V1AA 2O9CA 1YT4A 4RX2A 3O3VA 4GNUA 3IXGA 1G6AA 2JKFA 2B5RA 3S22A 2PAVP 2Y2JA 3LIBA 3LY3A 4HP9A 4IVKA 5HL1A 2FFYA 2XQZA 1RCJA 3GECA 4OVDA 3UB9A 4MBFA 1T18A 1RGZA 4KQRA 3M2JA 3QP8A 1F98A 3UN7A 3P01A 3MQOA 1PRQA 4OH0A 3NECA 4PAUA 1NZUA 3S4XA 4QU3A 3KYEA 1DJBA 2A2LA 4QD4A 2QHKA 1FR6A 1IYSA 2NUTC 3IXHA 4U0XA 2XRNA 1OJ5A 1YKDA 4P87A 3LCEA 1NYMA 3G2YA 1K57A 3BW6A 3ZG0A 4WZ4A 2EXAA 4CPKA 1XX2A 5HPFA 1YLPA 2W3HA 2XROA 4OLDA 5FSRA 1YAXA 1OT9A 2HV1A 4ZTKA 1XKZA 5I94A 4ZJ2A 3F1PA 2WKPA 3BFDA 2XR0A 2NUPC 4QY6A 4LPZA 4EEPA 4MBHA 2BLSA 2V0WA 3PAEA 1BUEA 4E3LA 1YPRA 3ZG7B 2A49A 2PR5A 2DRWA 5LBRA 3UE3A 3U4LP 2QMIA 4ETXA 3MMHA 3Q7ZA 4S2LA 4XT2A 2ZM2A 2D01A 3HJKA 3L7HA 5HDDA 3VE3A 3EGDC 4MCWA 2IWBA 3LY4A 1E3UA 4CJNA 2WK0A 3T4LA 5KMWA 3FWLA 3DTEA 3IF6C 3LR3A 3L9KA 1LL9A 2Y2HA 4QWOA 5M19A 1BLPA 2JBFA 1H5XA 1K25A 1VEUA 3G30A 5BOHA 3GRJA 1N9OA 3EQUA 3VV4A 4FOFA 2VGLM 4L9GA 2Y2IA 1UWNX 4UEYA 3KSFA 4DE3A 4EWFA 2IWDA 2M1CA 2VV7A 3C30A 1XFQA 3NDGA 3QP6A 1A0KA 3T12B 1YM1A 2PU4A 4HBTA 5MC7A 3IX3A 4EQ1A 4WL9A 5E2GA 1N4OA 4C75A 1OT6A 2VGJA 1M6KA 4ZJ3A 1I2SA 1LLBA 1K38A 1KE0A 1NYYA 2JHEA 4HJ3A 3ICYA 5K5BA 2Z6CA 2VK3A 2GX5A 4DE1A 2J80A 4JF4A 1T1CA 1C3BA 3E2KA 4G3WA 1JVJA 4RQ9A 5A92A 4EXOA 5F6AA 3ZDJA 3HLFA 2H0YA 4R3AA 5L10A 4ETZA 5EVLA 4BD1A 4LCMA 4DF6A 1XJ3A 2PRFA 5CEBA 3VP0A 1TS8A 1FCNA 1XJ2A 4BQMA 1FSWA 4EQIA 5AJGA 3TW8A 3CHWP 1X0OA 1L0DA 3DWZA 4XT2B 3ISGA 1Z09A 4U0TA 3UPNA 2O9AA 2WAFA 5CHMA 1RP5A 3GV9A 5FDSA 4HEFA 5M18A 1K0KA 3E0YA 4DE2A 2XFSA 3SS3A 3V39A 4HQAA 3HREA 2PBYA 3QNCA 3IF5A 3LIFA 3MKFA 5AVEA 1OTBA 4WMCD 5DJTA 3V67A 4KZ6A 1VEUB 5KSHA 2PD7A 2WADA 1KGEA 1H8ZA 4GS9A 1P0ZA 3R7WA 2Y2MA 1NY0A 3G32A 2Y79A 3ZG9B 1W63M 3K3DA 2WZXA 2Y2GA 4O7DA 3C2WA 4FH2A 4FCFA 1KGGA 1GSVA 3W4OA 4BJPA 5EECA 3IXBA 3T4QA 5M1AA 4OP8A 2C6WB 2ZMFA 1FIKA 1EROA 3PXPA 4E3NA 1W79A 2HP9A 3BQ8A 3IBRA 2W27A 4P6BA 4MDZA 3UB5P 5EM0A 4JXGA 5HAPA 3MJQA 3QP4A 3BY8A 3QP1A 2P08A 4Z1WA 1BLHA 3C4OA 2FFFB 3NOPC 3K2NA 1T19A 1YSQA 3IF6A 1L3LA 3Q7VA 1WE4A 4R3JA 2VGKA 2ZQ8A 3G2ZA 2ZMAA 3VP3A 1PIOA 4S2PA 1TEMA 3FG8A 3BFFA 1BT5A 3OZHA 5HAIA 1IKIA 1CI9A 4G3KA 2VV8A 5DFXA 3BFGA 3Q82A 1FSYA 3GDIA 3ZVWA 2ACGA 2BTFP 5E2HA 4X53A 3MKEA 4MEZA 3V50A 1VB6A 3VSKA 3LICA 1LSWA 4AFIA 3BECA 1WYCA 3QP2A 4CQHA 4LLOB 3PBRA 2PU2A 2B02A 2P74A 4PM8A 4C3QA 1W63Q 2PDRA 3W4PA 2ZJ9A 5EFWA 2JKTM 4IJGA 2XA7M 4I3IA 3NI9A 4GS9B 4YFMA 3R7WB 3RH8B 4O0PA 3T4OA 4E04A 4GLQA 2ZL1A 1Z6FA 4ZJ1A 5DJUA 1MZUA 4PHTA 5CECA 2IWCA 2VJWA 1ZG6A 1ONGA 1K6SA 2H0TA 2ZBBA 1DY6A 5J7EA 2XSSA 3S7PA 1F2KA 5F1FA 4G3VA 5F69A 3QNBA 4OPQA 3TE8A 5AQAA 2WGVA 2I9VA 1KE3A 3AGDA 4HIAA 1SDEA 2MJ6A 4HJ4A 5CRFA 4HH3A 1TD5A 1PYYA 5HZHA 5IU1A 2I72A 4H6JA 4IBRA 3V3RA 5HAQA 3A3JA 3VMAA 4GW9A 3VP1A 2W3GA 2O9BA 3WWXA 1S0WA 1ESIA 3BLMA 4Q0IA 3HLBA 2OWHA 3PBSA 1IFQA 2Y91A 2W1RA 4PKYA 1RGYA 4JKTA 1ODVA 4IEDA 4WM9A 3JYIA 3LO7A 4MNRA 3N8RA 3A3EA 2QWSA 2Z6DA 1NZOA 1S4SA 1S4RA 4JPMA 4DJ2A 3IF6B 3Q7VB 4LV1A 1NJ4A 4R6LA 4E6WA 4KZ7A 5HL6A 5GL9A 3IBJA 1ZC2A 2EXBA 1MBLA 1Y54A 5C5KA 4R4SA 3IHBA 3MZDA 4PM6A 4YNRA 3SS5A 2JKTI 4NXGA 5GLBA 4BD0A 4XXRA 5L2FA 4GJ4A 2VLGA 5FQMA 2V8CA 4NXEA 3OBFA 5CGSA 4ARZA 4S2OA 4HOIA 1DP6A 4L9FA 4BL2A 2WUQA 4YWZA 3VOYA 2ZQCA 4IHQA 1MKIA 1N9NA 4I5SA 2QJ5A 2G2WA 4XUZA 1Q2PA 4GDBA 3SZTA 1BLCA 3HLDA 3A3IA 5AQ7A 2L4RA 3O87A 4N9KA 3R4KA 2ZL1B 1YLYA 1KGFA 4OQIA 1ZKJA 3JPUA 3NIAA 1UGUA 2WKHA 4Y5FA 1KDSA 2P9VA 3T4JA 3HUNA 2FZ0A 5L09A 3C5AA 3ZNTA 4P6ZM 2GZAA 3LGOA 4R70A 3MXRA 1ZG4A 3WRTA 1GHPA 4GHIA 3MZFA 1HD8A 1HLUP 2XA7S 3ULFA 2V1BA 1JNUA 4S2NC 4UAAA 2J7VA 4H6JB 4MN5A 2W3EA 3KSHA 5CHUA 2R9WA 4PMAA 4IVIA 1XJ6A 3TOIA 3PBNA 1BTLA 2RCXA 1IOUA 3IS2B 4BENA 2WZZA 3NBLA 3BM6A 5G4ZA 4OQHA 1DJAA 3A0RA 3CZDA 3LEQA 3DTMA 4GOGA 4UQIS 3BFEA 3CWFA 3IWOA 1ES4A 1YLJA 3B33A
chains in the Genus database with same CATH topology
4JF4A 4QY5A 1C3BA 3E2KA 2WGWA 3B3XA 4KQOA 1JVJA 3SH9A 3AGFA 4KQQA 4OOMA 3CJMA 5EVIB 1M40A 5A92A 5CTMA 2H5SA 3ZDJA 3UE1A 3ZCZA 2HDUA 3V5MA 3HLFA 4S2JA 4OONA 1SDNA 4X6TA 2EX2A 4B88A 2H0YA 5E43A 5EVLA 3Q1FA 2V1ZA 4BD1A 4LCMA 5EVID 1GA9A 4DF6A 4KG5A 3E2LA 4X56A 5CEBA 3VP0A 4P85A 2XH9A 1FCNA 1K54A 2ZQ9A 1G68A 4S2IA 5FI7A 4FSFA 4N1XA 1FSWA 4BQMA 1HZOA 2ZLYA 4EQIA 1PWDA 2WKEA 4LENA 1SCWA 3ZG5A 2OLUA 4E3IA 4OKPA 1L0DA 5FQ9A 4OLGA 1KDWA 3DWZA 5GLCA 3GMWA 4KZAA 3ISGA 5DVAA 3BFCA 2Y59A 3SS4A 1K57C 3IHAA 4U0TA 3UPNA 5KZHA 3D4FA 4WYYA 5FQJA 2WAFA 5CHMA 1LHYA 1RP5A 3GV9A 4R4RA 2EX8A 3MFDA 1QMEA 2EX6A 4HEFA 4S2KA 4E3MA 2X02A 5TGFA 3WS4A 4WMCA 1YLWA 2XFSA 3N8LA 3SS3A 5FAOA 4DE2A 3V39A 4FH4A 4EBNA 1IYOA 4DDYA 3HREA 1MWSA 3VFHA 2PBYA 3ZHHA 5D3OA 2GDNA 3QNCA 3IF5A 1IELA 4WZ5A 3MKFA 2DCFA 2Y55A 4Y0OA 5KSCA 3HUOA 2WAEA 5F83A 4WMCD 1EI5A 2WKIA 1JTGA 3N7WA 4N9LA 4OP5A 1FQGA 4LCLA 5EVIC 1E3UD 3SOIA 3FV7A 3RXWA 3OPPA 2P9VB 1ONHA 2J8YA 3C7UA 3NY4A 4KZ6A 5KSHA 3ZG8B 1XA7A 2QZ6A 4YINA 1HVBA 3HUMA 5DF8A 2Z2LB 3DW0A 3GTCA 2WADA 1LL5A 2J9OA 1KGEA 1H8ZA 1TDGA 3FKVA 5TR7A 2OLVA 2Y2MA 3Q07A 3SH8A 4WEKA 1YMSA 5CERA 1NY0A 5EOOA 4K91A 3G32A 5EPHA 4F94A 3ZG9B 1XP4A 3VP2A 2WZXA 2ZC5B 4KZ4A 3G31A 1L0FA 1CEGA 4JF6A 2Y2GA 4O7DA 5EUAA 3GVBA 5U47A 1YLTA 1YLZA 4FH2A 4OOLA 5CTNA 4A5RA 2ZQDA 4FCFA 1MWTA 1KGGA 1YQSA 3HLCA 4KZ3A 1I2WA 3IQAA 3DWKA 5EE8A 3WRZA 4MBKA 4E3JA 3NC8A 2Q9NA 1E4DA 1TDLA 4MLLA 3W4OA 4BJPA 4EBLA 3PBOA 1K4EA 4EBPA 5EECA 3IXBA 5M1AA 1NRFA 4X55A 4OP8A 2C6WB 1JWVA 1EROA 4RX3A 5GHZA 1K55C 5JYPA 1MPLA 4E3NA 1W79A 5DTTA 1HTZA 2HP9A 4KG2A 3G4PA 5CXWA 1PWGA 2RL3A 2WGWB 4WBGA 3C7VA 4HBUA 4Q8IA 1W7FA 4P6BA 3CMZA 5FI6A 2XEPA 4BLMA 4JXGA 3N6IA 1PZOA 4FD8A 2R9XA 5HAPA 3HLGA 3UPPA 4XUXA 1XXMA 2C5WB 4JBFA 1BLHA 1PI5A 1TVFA 2FFFB 2Y2QA 3C4OA 2E8IA 4EUZA 3VOZA 1W5DA 2ZC4B 3WS2A 2ZC3B 4BL3A 1KE4A 5CHJA 4DXCA 1LI0A 2X01A 2H10A 4KZ8A 4JF5A 1DJCA 4JXVA 4OOYA 3IF6A 1S6RA 3OPRA 3Q7VA 1WE4A 3VSLA 3FYZA 4R3JA 2VGKA 2ZQ8A 3G2ZA 1L0EA 2XGNA 3ZNYA 5FAQA 1H8YA 1SHVA 4GDNA 2ZMAA 3ZFZA 3UE0A 4JXSA 4PM5A 3FKWA 3IWIA 2HDRA 4GD6A 3VP3A 1PIOA 2V2FF 4S2PA 3UDIA 1TEMA 3PBTA 4RYEA 4U3TA 1PW1A 2HDQA 3BFFA 2HDSA 3C4PA 3IWQA 4P0MA 1BT5A 1ALQA 1GCEA 3ITBA 3OZHA 5FI2A 4QJGA 3OPHA 1MY8A 3HLWA 5CGWA 1W8YA 5FQIA 2Y2OA 5CEDA 3HLEA 5HAIA 3CG5A 1XGJA 1IKIA 1CI9A 4K0XA 2XK1A 5GHXA 1BZAA 3GR2A 4DE0A 4NETA 3BFGA 3Q82A 4DXBA 3ITAA 4E3KA 2OV5A 1BSGA 4ID4A 3BRMA 1FSYA 1K56A 4E6XA 3GQZA 1FOFA 1O07A 3ZVWA 4KZ5A 1GA0A 5GHYA 4NK3A 1PWCA 1JWZA 3FZCA 4OPYA 4UA9A 3M2KA 3IH8A 5E2HA 3RXXA 4GD8A 4X53A 3MKEA 4OQ0A 4S2NA 1FCOA 2Y2NA 4MEZA 3BYDA 1VQQA 5DF7A 3SH7A 4UHUA 3V50A 1N9BA 3GSGA 3VSKA 2DNSA 3PAGA 2ZM0A 3NCKA 5AQBA 3P09A 1IYPA 3HBRA 3BECA 1WYCA 4QHCA 5FAPA 3ZGAB 3PBRA 1YT4A 2PU2A 4PM8A 2P74A 4RX2A 3O3VA 4GNUA 4C3QA 3IXGA 5JYOA 1G6AA 5HX9A 3W4PA 2B5RA 2ZJ9A 5DF9A 3S22A 2Y2JA 4EV4A 4X69A 1I5QA 3LY3A 4IVKA 5HL1A 1PZPA 5FA7A 4DKIA 1CK3A 1XA1A 3NI9A 2FFYA 2XQZA 1RCJA 4OVDA 4YFMA 2ZM8A 1CEFA 2XDMA 4K0WA 1ES3A 1FCMA 1KVLA 4MBFA 2Y4AA 1RGZA 1Z6FA 4JLFA 3QHYA 4ZJ1A 4KQRA 4UA7A 3M2JA 3VFFA 4R3BA 1BULA 2IWCA 4OPZA 5TFQA 3G35A 5CECA 1ZG6A 1OMEA 5EOEA 3UN7A 1ONGA 4KZ9A 1Q2QA 5E2EA 3IH9A 2Q9MA 4ZAMA 3RJUA 1IYQA 5FDHA 3OC2A 5HW3A 1K6SA 2H0TA 1DY6A 4M3KA 3LEZA 4ZBEA 4OH0A 3W4QA 5FASA 3O88A 1L0GA 5F1FA 1NZUA 5F82A 3S1YA 3S4XA 4QU3A 4R1GA 4ZDXA 3QNBA 4OPQA 1DJBA 1JTDA 5AQAA 2WGVA 3NDEA 2XD1A 2G2UA 4GKUA 4QD4A 5FQKA 1KE3A 1FR6A 3AGDA 1IYSA 2XF3A 3IXHA 4WZ5C 1SDEA 5CRFA 4IBXA 4HESA 4B4XA 2QPNA 4N1HA 1PYYA 4U0XA 3UDXA 2I72A 3W8KA 2UWXA 4IBRA 2Z2MB 3V3RA 3A3JA 4P87A 3VMAA 5HAQA 3LCEA 5J8XA 1NYMA 3OCLA 2HPBA 5CGXA 1IKGA 3G2YA 3VP1A 4LV0A 1K57A 3WWXA 1S0WA 1QMFA 4WEJA 1ESIA 3BLMA 3HLBA 3PBSA 3ZG0A 4WZ4A 2EXAA 4CPKA 2Y91A 1XX2A 2Y2PA 4GN2A 4OPRA 1XGIA 4N92A 5HARA 1RGYA 3OCNA 1YLPA 4JKTA 4IEDA 5GLAA 3UNWA 4WM9A 3JYIA 3LO7A 4GZBA 3N8RA 4MNRA 4Y0TA 3A3EA 4OLDA 2XFTA 5FSRA 1J9MA 1NZOA 3HL9A 4JPMA 2EX9A 3UPOA 3IF6B 3Q7VB 1BLSA 1PI4A 4DRTA 5M18A 4LV1A 1NJ4A 1XKZA 4ZTKA 3WS1A 5I94A 4UA6A 4ZJ2A 5EVIA 4E6WA 1XPBA 3OPLA 3BFDA 4KENB 2XR0A 2HP6A 3A3DA 4KZ7A 5F1GA 4LV3A 5FQQA 5GL9A 4QY6A 3EQVA 2V20A 4GB7A 4X68A 4MBHA 2ZQAA 3IT9A 2HP5A 2BLSA 3PAEA 1ZC2A 2EXBA 1BUEA 1MBLA 1Y54A 5G18A 4E3LA 1LI9A 3IHBA 2Y2KA 4R4SA 3MZDA 2X71A 4PM6A 4JXWA 1WYBA 4E3OA 3ZG7B 2A49A 3SS5A 4L0LA 1FR1A 2DRWA 5GLBA 4BD0A 4XXRA 3UE3A 1GHIA 3IXDA 1MWUA 2QMIA 4PM9A 3VP4A 5L2FA 1MXOA 3Q7ZA 5FQMA 4S2LA 2JC7A 1JWPA 5CGSA 1AXBA 4R0QA 4S2OA 2ZM2A 1L2SA 5A93A 2CC1A 4BL2A 1K56D 3O86A 2WUQA 3VOYA 3HVFA 2ZQCA 1NXYA 2A3UA 2IWBA 5FATA 3LY4A 1MKIA 4RA7A 2Y2LA 4Y0UA 4B4ZA 3MXSA 1E3UA 2ZQ7A 4CJNA 2WK0A 3BLSA 5KMWA 2G2WA 1ERMA 3FWLA 4XUZA 2EFUA 1Q2PA 3A3FA 4LV2A 4GDBA 4QB8A 4Z9QA 1ES2A 4S2MA 1GHMA 4Y7PA 1BLCA 3HLDA 1K54C 3A3IA 5AQ7A 3IF6C 3TSGA 1SKFA 4PM7A 3O87A 3M6HA 1K55A 1LL9A 4N9KA 2Y2HA 1YLYA 1KVMA 1KGFA 4OQIA 1ZKJA 2XLNA 3NIAA 5M19A 4WELA 2WKHA 2ZC7A 1KDSA 2P9VA 1BLPA 2JBFA 5HFOA 5GLDA 3HUNA 1H5XA 1K25A 4KG6A 1ESUA 3C5AA 3UDFA 3G30A 3ZNTA 1EWZA 5BOHA 5A90A 3GRJA 1U60A 3P98A 3WS0A 3MXRA 3WS5A 4R23A 3ZVTA 1ZG4A 3EQUA 3WRTA 1GHPA 5E2FA 3MZFA 1HD8A 3N8SA 3BEBA 1ERQA 1O7EA 3Q81A 5DTSA 4DDSA 2J9PA 3MZEA 2Y2IA 3PBQA 1K6RA 3M6BA 1CI8A 4DE3A 3PTEA 2WYXA 2IWDA 4EWFA 4C6YA 4S2NC 3NDGA 4UAAA 2J7VA 1MWRA 3G34A 1YM1A 1VM1A 2PU4A 4HBTA 1W8QA 5IHVA 2ZD8A 5CHUA 2BG1A 2R9WA 4RVAA 5E2GA 2JCHA 3MBZA 1E25A 3N4IA 1N4OA 4KZBA 4C75A 1K4FA 4OQGA 4PMAA 4IVIA 2OSUA 3I7JA 5AQ9A 3TOIA 2VGJA 2WGIA 1ES5A 4PPRA 1M6KA 3V3SA 4H8RA 4ZJ3A 1I2SA 2EFXA 1LLBA 1K38A 1BTLA 3PBNA 2RCXA 3TG9A 1KE0A 3UY6A 4BENA 2WZZA 1NYYA 3BM6A 1YMXA 3NBLA 1DJAA 3CZDA 4GOGA 2XD5A 4OQHA 3DTMA 5A91A 3BFEA 2JE5A 2ZC6B 3IWOA 5DTKA 1ES4A 3AGEA 1YLJA 1PW8A 3UO9A 4D2OA 1IEMA 4DE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JF4 A;  4QY5 A;  1C3B A;  3E2K A;  2WGW A;  3B3X A;  4KQO A;  1JVJ A;  3SH9 A;  3AGF A;  4KQQ A;  4OOM A;  3CJM A;  5EVI B;  1M40 A;  5A92 A;  5CTM A;  2H5S A;  3ZDJ A;  3UE1 A;  3ZCZ A;  2HDU A;  3V5M A;  3HLF A;  4S2J A;  4OON A;  1SDN A;  4X6T A;  2EX2 A;  4B88 A;  2H0Y A;  5E43 A;  5EVL A;  3Q1F A;  2V1Z A;  4BD1 A;  4LCM A;  5EVI D;  1GA9 A;  4DF6 A;  4KG5 A;  3E2L A;  4X56 A;  5CEB A;  3VP0 A;  4P85 A;  2XH9 A;  1FCN A;  1K54 A;  2ZQ9 A;  1G68 A;  4S2I A;  5FI7 A;  4FSF A;  4N1X A;  1FSW A;  4BQM A;  1HZO A;  2ZLY A;  4EQI A;  1PWD A;  2WKE A;  4LEN A;  1SCW A;  3ZG5 A;  2OLU A;  4E3I A;  4OKP A;  1L0D A;  5FQ9 A;  4OLG A;  1KDW A;  3DWZ A;  5GLC A;  3GMW A;  4KZA A;  3ISG A;  5DVA A;  3BFC A;  2Y59 A;  3SS4 A;  1K57 C;  3IHA A;  4U0T A;  3UPN A;  5KZH A;  3D4F A;  4WYY A;  5FQJ A;  2WAF A;  5CHM A;  1LHY A;  1RP5 A;  3GV9 A;  4R4R A;  2EX8 A;  3MFD A;  1QME A;  2EX6 A;  4HEF A;  4S2K A;  4E3M A;  2X02 A;  5TGF A;  3WS4 A;  4WMC A;  1YLW A;  2XFS A;  3N8L A;  3SS3 A;  5FAO A;  4DE2 A;  3V39 A;  4FH4 A;  4EBN A;  1IYO A;  4DDY A;  3HRE A;  1MWS A;  3VFH A;  2PBY A;  3ZHH A;  5D3O A;  2GDN A;  3QNC A;  3IF5 A;  1IEL A;  4WZ5 A;  3MKF A;  2DCF A;  2Y55 A;  4Y0O A;  5KSC A;  3HUO A;  2WAE A;  5F83 A;  4WMC D;  1EI5 A;  2WKI A;  1JTG A;  3N7W A;  4N9L A;  4OP5 A;  1FQG A;  4LCL A;  5EVI C;  1E3U D;  3SOI A;  3FV7 A;  3RXW A;  3OPP A;  2P9V B;  1ONH A;  2J8Y A;  3C7U A;  3NY4 A;  4KZ6 A;  5KSH A;  3ZG8 B;  1XA7 A;  2QZ6 A;  4YIN A;  1HVB A;  3HUM A;  5DF8 A;  2Z2L B;  3DW0 A;  3GTC A;  2WAD A;  1LL5 A;  2J9O A;  1KGE A;  1H8Z A;  1TDG A;  3FKV A;  5TR7 A;  2OLV A;  2Y2M A;  3Q07 A;  3SH8 A;  4WEK A;  1YMS A;  5CER A;  1NY0 A;  5EOO A;  4K91 A;  3G32 A;  5EPH A;  4F94 A;  3ZG9 B;  1XP4 A;  3VP2 A;  2WZX A;  2ZC5 B;  4KZ4 A;  3G31 A;  1L0F A;  1CEG A;  4JF6 A;  2Y2G A;  4O7D A;  5EUA A;  3GVB A;  5U47 A;  1YLT A;  1YLZ A;  4FH2 A;  4OOL A;  5CTN A;  4A5R A;  2ZQD A;  4FCF A;  1MWT A;  1KGG A;  1YQS A;  3HLC A;  4KZ3 A;  1I2W A;  3IQA A;  3DWK A;  5EE8 A;  3WRZ A;  4MBK A;  4E3J A;  3NC8 A;  2Q9N A;  1E4D A;  1TDL A;  4MLL A;  3W4O A;  4BJP A;  4EBL A;  3PBO A;  1K4E A;  4EBP A;  5EEC A;  3IXB A;  5M1A A;  1NRF A;  4X55 A;  4OP8 A;  2C6W B;  1JWV A;  1ERO A;  4RX3 A;  5GHZ A;  1K55 C;  5JYP A;  1MPL A;  4E3N A;  1W79 A;  5DTT A;  1HTZ A;  2HP9 A;  4KG2 A;  3G4P A;  5CXW A;  1PWG A;  2RL3 A;  2WGW B;  4WBG A;  3C7V A;  4HBU A;  4Q8I A;  1W7F A;  4P6B A;  3CMZ A;  5FI6 A;  2XEP A;  4BLM A;  4JXG A;  3N6I A;  1PZO A;  4FD8 A;  2R9X A;  5HAP A;  3HLG A;  3UPP A;  4XUX A;  1XXM A;  2C5W B;  4JBF A;  1BLH A;  1PI5 A;  1TVF A;  2FFF B;  2Y2Q A;  3C4O A;  2E8I A;  4EUZ A;  3VOZ A;  1W5D A;  2ZC4 B;  3WS2 A;  2ZC3 B;  4BL3 A;  1KE4 A;  5CHJ A;  4DXC A;  1LI0 A;  2X01 A;  2H10 A;  4KZ8 A;  4JF5 A;  1DJC A;  4JXV A;  4OOY A;  3IF6 A;  1S6R A;  3OPR A;  3Q7V A;  1WE4 A;  3VSL A;  3FYZ A;  4R3J A;  2VGK A;  2ZQ8 A;  3G2Z A;  1L0E A;  2XGN A;  3ZNY A;  5FAQ A;  1H8Y A;  1SHV A;  4GDN A;  2ZMA A;  3ZFZ A;  3UE0 A;  4JXS A;  4PM5 A;  3FKW A;  3IWI A;  2HDR A;  4GD6 A;  3VP3 A;  1PIO A;  2V2F F;  4S2P A;  3UDI A;  1TEM A;  3PBT A;  4RYE A;  4U3T A;  1PW1 A;  2HDQ A;  3BFF A;  2HDS A;  3C4P A;  3IWQ A;  4P0M A;  1BT5 A;  1ALQ A;  1GCE A;  3ITB A;  3OZH A;  5FI2 A;  4QJG A;  3OPH A;  1MY8 A;  3HLW A;  5CGW A;  1W8Y A;  5FQI A;  2Y2O A;  5CED A;  3HLE A;  5HAI A;  3CG5 A;  1XGJ A;  1IKI A;  1CI9 A;  4K0X A;  2XK1 A;  5GHX A;  1BZA A;  3GR2 A;  4DE0 A;  4NET A;  3BFG A;  3Q82 A;  4DXB A;  3ITA A;  4E3K A;  2OV5 A;  1BSG A;  4ID4 A;  3BRM A;  1FSY A;  1K56 A;  4E6X A;  3GQZ A;  1FOF A;  1O07 A;  3ZVW A;  4KZ5 A;  1GA0 A;  5GHY A;  4NK3 A;  1PWC A;  1JWZ A;  3FZC A;  4OPY A;  4UA9 A;  3M2K A;  3IH8 A;  5E2H A;  3RXX A;  4GD8 A;  4X53 A;  3MKE A;  4OQ0 A;  4S2N A;  1FCO A;  2Y2N A;  4MEZ A;  3BYD A;  1VQQ A;  5DF7 A;  3SH7 A;  4UHU A;  3V50 A;  1N9B A;  3GSG A;  3VSK A;  2DNS A;  3PAG A;  2ZM0 A;  3NCK A;  5AQB A;  3P09 A;  1IYP A;  3HBR A;  3BEC A;  1WYC A;  4QHC A;  5FAP A;  3ZGA B;  3PBR A;  1YT4 A;  2PU2 A;  4PM8 A;  2P74 A;  4RX2 A;  3O3V A;  4GNU A;  4C3Q A;  3IXG A;  5JYO A;  1G6A A;  5HX9 A;  3W4P A;  2B5R A;  2ZJ9 A;  5DF9 A;  3S22 A;  2Y2J A;  4EV4 A;  4X69 A;  1I5Q A;  3LY3 A;  4IVK A;  5HL1 A;  1PZP A;  5FA7 A;  4DKI A;  1CK3 A;  1XA1 A;  3NI9 A;  2FFY A;  2XQZ A;  1RCJ A;  4OVD A;  4YFM A;  2ZM8 A;  1CEF A;  2XDM A;  4K0W A;  1ES3 A;  1FCM A;  1KVL A;  4MBF A;  2Y4A A;  1RGZ A;  1Z6F A;  4JLF A;  3QHY A;  4ZJ1 A;  4KQR A;  4UA7 A;  3M2J A;  3VFF A;  4R3B A;  1BUL A;  2IWC A;  4OPZ A;  5TFQ A;  3G35 A;  5CEC A;  1ZG6 A;  1OME A;  5EOE A;  3UN7 A;  1ONG A;  4KZ9 A;  1Q2Q A;  5E2E A;  3IH9 A;  2Q9M A;  4ZAM A;  3RJU A;  1IYQ A;  5FDH A;  3OC2 A;  5HW3 A;  1K6S A;  2H0T A;  1DY6 A;  4M3K A;  3LEZ A;  4ZBE A;  4OH0 A;  3W4Q A;  5FAS A;  3O88 A;  1L0G A;  5F1F A;  1NZU A;  5F82 A;  3S1Y A;  3S4X A;  4QU3 A;  4R1G A;  4ZDX A;  3QNB A;  4OPQ A;  1DJB A;  1JTD A;  5AQA A;  2WGV A;  3NDE A;  2XD1 A;  2G2U A;  4GKU A;  4QD4 A;  5FQK A;  1KE3 A;  1FR6 A;  3AGD A;  1IYS A;  2XF3 A;  3IXH A;  4WZ5 C;  1SDE A;  5CRF A;  4IBX A;  4HES A;  4B4X A;  2QPN A;  4N1H A;  1PYY A;  4U0X A;  3UDX A;  2I72 A;  3W8K A;  2UWX A;  4IBR A;  2Z2M B;  3V3R A;  3A3J A;  4P87 A;  3VMA A;  5HAQ A;  3LCE A;  5J8X A;  1NYM A;  3OCL A;  2HPB A;  5CGX A;  1IKG A;  3G2Y A;  3VP1 A;  4LV0 A;  1K57 A;  3WWX A;  1S0W A;  1QMF A;  4WEJ A;  1ESI A;  3BLM A;  3HLB A;  3PBS A;  3ZG0 A;  4WZ4 A;  2EXA A;  4CPK A;  2Y91 A;  1XX2 A;  2Y2P A;  4GN2 A;  4OPR A;  1XGI A;  4N92 A;  5HAR A;  1RGY A;  3OCN A;  1YLP A;  4JKT A;  4IED A;  5GLA A;  3UNW A;  4WM9 A;  3JYI A;  3LO7 A;  4GZB A;  3N8R A;  4MNR A;  4Y0T A;  3A3E A;  4OLD A;  2XFT A;  5FSR A;  1J9M A;  1NZO A;  3HL9 A;  4JPM A;  2EX9 A;  3UPO A;  3IF6 B;  3Q7V B;  1BLS A;  1PI4 A;  4DRT A;  5M18 A;  4LV1 A;  1NJ4 A;  1XKZ A;  4ZTK A;  3WS1 A;  5I94 A;  4UA6 A;  4ZJ2 A;  5EVI A;  4E6W A;  1XPB A;  3OPL A;  3BFD A;  4KEN B;  2XR0 A;  2HP6 A;  3A3D A;  4KZ7 A;  5F1G A;  4LV3 A;  5FQQ A;  5GL9 A;  4QY6 A;  3EQV A;  2V20 A;  4GB7 A;  4X68 A;  4MBH A;  2ZQA A;  3IT9 A;  2HP5 A;  2BLS A;  3PAE A;  1ZC2 A;  2EXB A;  1BUE A;  1MBL A;  1Y54 A;  5G18 A;  4E3L A;  1LI9 A;  3IHB A;  2Y2K A;  4R4S A;  3MZD A;  2X71 A;  4PM6 A;  4JXW A;  1WYB A;  4E3O A;  3ZG7 B;  2A49 A;  3SS5 A;  4L0L A;  1FR1 A;  2DRW A;  5GLB A;  4BD0 A;  4XXR A;  3UE3 A;  1GHI A;  3IXD A;  1MWU A;  2QMI A;  4PM9 A;  3VP4 A;  5L2F A;  1MXO A;  3Q7Z A;  5FQM A;  4S2L A;  2JC7 A;  1JWP A;  5CGS A;  1AXB A;  4R0Q A;  4S2O A;  2ZM2 A;  1L2S A;  5A93 A;  2CC1 A;  4BL2 A;  1K56 D;  3O86 A;  2WUQ A;  3VOY A;  3HVF A;  2ZQC A;  1NXY A;  2A3U A;  2IWB A;  5FAT A;  3LY4 A;  1MKI A;  4RA7 A;  2Y2L A;  4Y0U A;  4B4Z A;  3MXS A;  1E3U A;  2ZQ7 A;  4CJN A;  2WK0 A;  3BLS A;  5KMW A;  2G2W A;  1ERM A;  3FWL A;  4XUZ A;  2EFU A;  1Q2P A;  3A3F A;  4LV2 A;  4GDB A;  4QB8 A;  4Z9Q A;  1ES2 A;  4S2M A;  1GHM A;  4Y7P A;  1BLC A;  3HLD A;  1K54 C;  3A3I A;  5AQ7 A;  3IF6 C;  3TSG A;  1SKF A;  4PM7 A;  3O87 A;  3M6H A;  1K55 A;  1LL9 A;  4N9K A;  2Y2H A;  1YLY A;  1KVM A;  1KGF A;  4OQI A;  1ZKJ A;  2XLN A;  3NIA A;  5M19 A;  4WEL A;  2WKH A;  2ZC7 A;  1KDS A;  2P9V A;  1BLP A;  2JBF A;  5HFO A;  5GLD A;  3HUN A;  1H5X A;  1K25 A;  4KG6 A;  1ESU A;  3C5A A;  3UDF A;  3G30 A;  3ZNT A;  1EWZ A;  5BOH A;  5A90 A;  3GRJ A;  1U60 A;  3P98 A;  3WS0 A;  3MXR A;  3WS5 A;  4R23 A;  3ZVT A;  1ZG4 A;  3EQU A;  3WRT A;  1GHP A;  5E2F A;  3MZF A;  1HD8 A;  3N8S A;  3BEB A;  1ERQ A;  1O7E A;  3Q81 A;  5DTS A;  4DDS A;  2J9P A;  3MZE A;  2Y2I A;  3PBQ A;  1K6R A;  3M6B A;  1CI8 A;  4DE3 A;  3PTE A;  2WYX A;  2IWD A;  4EWF A;  4C6Y A;  4S2N C;  3NDG A;  4UAA A;  2J7V A;  1MWR A;  3G34 A;  1YM1 A;  1VM1 A;  2PU4 A;  4HBT A;  1W8Q A;  5IHV A;  2ZD8 A;  5CHU A;  2BG1 A;  2R9W A;  4RVA A;  5E2G A;  2JCH A;  3MBZ A;  1E25 A;  3N4I A;  1N4O A;  4KZB A;  4C75 A;  1K4F A;  4OQG A;  4PMA A;  4IVI A;  2OSU A;  3I7J A;  5AQ9 A;  3TOI A;  2VGJ A;  2WGI A;  1ES5 A;  4PPR A;  1M6K A;  3V3S A;  4H8R A;  4ZJ3 A;  1I2S A;  2EFX A;  1LLB A;  1K38 A;  1BTL A;  3PBN A;  2RCX A;  3TG9 A;  1KE0 A;  3UY6 A;  4BEN A;  2WZZ A;  1NYY A;  3BM6 A;  1YMX A;  3NBL A;  1DJA A;  3CZD A;  4GOG A;  2XD5 A;  4OQH A;  3DTM A;  5A91 A;  3BFE A;  2JE5 A;  2ZC6 B;  3IWO A;  5DTK A;  1ES4 A;  3AGE A;  1YLJ A;  1PW8 A;  3UO9 A;  4D2O A;  1IEM A;  4DE1 A; 
#chains in the Genus database with same CATH topology
 3SW1 A;  3D72 A;  4EUV A;  3B3X A;  3MXQ A;  1GSX A;  2W3D A;  3AGF A;  4KQQ A;  3CJM A;  3E4Q A;  3LI8 A;  3ZCZ A;  2HDU A;  3V5M A;  4OON A;  1OTI A;  3EOI A;  5EVI D;  4KG5 A;  4P85 A;  4N1X A;  2GJ3 A;  4KUK A;  2WKE A;  1TF1 A;  3LIE A;  3ZG5 A;  3DBA A;  2ZMV A;  4R38 A;  3LUQ A;  3GMW A;  5DKK A;  3SS4 A;  4ARZ B;  4IUK A;  4WYY A;  1LHY A;  3UB8 A;  4R4R A;  2EX8 A;  4FUW A;  1OTE A;  4FH4 A;  4EBN A;  4DDY A;  3VFH A;  1G28 A;  2GDN A;  1LL8 A;  2ZOI A;  1AWI A;  2Y55 A;  5KSC A;  2E8J A;  2V0U A;  3UMD A;  3PR6 A;  5F83 A;  1EI5 A;  5EVI C;  3SOI A;  5EM1 A;  1SZV A;  1XJ4 A;  2P9V B;  1ONH A;  4YIN A;  4HHD A;  3GTC A;  4B9O A;  1F9I A;  4NKP A;  1S67 L;  2J9O A;  1D1J A;  2VA0 A;  4NXF A;  4BBV A;  3UB7 A;  1H8M A;  4GHI B;  5EOO A;  5AVF A;  5EPH A;  4F94 A;  4M4X A;  3VP2 A;  3NOU C;  4KZ4 A;  3LR4 A;  1GSW A;  1I2W A;  3IQA A;  2OOL A;  4MBK A;  2VZW A;  4P6Z S;  1NRF A;  2JKR M;  4Y15 A;  2KDK A;  5GHZ A;  5JYP A;  5DTT A;  1HTZ A;  3BY9 A;  5CXW A;  3EEA A;  4WBG A;  3C7V A;  1W7F A;  5FI6 A;  2PBD P;  1PZO A;  5J4E A;  2EWV A;  4XUX A;  2C5W B;  4JBF A;  1TVF A;  2W3F A;  3LYX A;  1H0M A;  2ZC3 B;  4BMW A;  4BL3 A;  3RTY A;  5CHJ A;  5FL3 A;  4KZ8 A;  4JXV A;  1DJC A;  3JVV A;  3VSL A;  5FAQ A;  4GDN A;  2B95 A;  4Q0H A;  5F68 A;  2V2F F;  3PBT A;  3F1O A;  1PW1 A;  2HDQ A;  2DMW A;  3VE4 A;  3HLW A;  5CGW A;  1W8Y A;  5FQI A;  1MC0 A;  2EWW A;  4K0X A;  2XK1 A;  3GR2 A;  2PYP A;  2HZ5 A;  2YKH A;  4LRY C;  1PFL A;  3GQZ A;  4KZ5 A;  1GA0 A;  4GD8 A;  4OQ0 A;  4S2N A;  4BBT A;  1CJF A;  5DF7 A;  5HWT A;  3SH7 A;  1N9B A;  3GSG A;  2DNS A;  5FEF A;  3NCK A;  3C8C A;  1IYP A;  3HBR A;  3CIT A;  3ZGA B;  5EV0 A;  5JYO A;  2W1T B;  5HX9 A;  4EV4 A;  5DF9 A;  3T1R A;  4X69 A;  5FA7 A;  4DKI A;  1XA1 A;  1G6O A;  2ZM8 A;  2XDM A;  4K0W A;  3T1S A;  1ES3 A;  1FCM A;  4WUJ A;  2PYR A;  4BBU A;  4JLF A;  4ZDX A;  3QHY A;  4UA7 A;  2JKR I;  4OPZ A;  3G35 A;  5E2E A;  3A0S A;  3H82 A;  3IH9 A;  4NG2 A;  4ZAM A;  3RJU A;  4HH2 A;  1IYQ A;  2L0W A;  4M3K A;  3LEZ A;  2K7S A;  1L0G A;  5F82 A;  4R1G A;  4QPR A;  2FH5 A;  2XD1 A;  2G2U A;  2PHY A;  3BWL A;  4GKU A;  2XF3 A;  4WZ5 C;  4HES A;  5TBM A;  2QPN A;  3UDX A;  2VGL S;  2D02 A;  2WKR A;  3OCL A;  1QMF A;  3A0V A;  4IUH A;  2Y2P A;  2O99 A;  1XGI A;  3OCN A;  5GLA A;  4Y0T A;  3UE6 A;  3UPO A;  1BLS A;  3LFV A;  3WS1 A;  5EVI A;  5DKL A;  1XPB A;  3OPL A;  5TJJ A;  5F1G A;  2HP6 A;  3A3D A;  5FQQ A;  3EQV A;  3F1O B;  3DTI A;  2V20 A;  4GB7 A;  3FPV A;  3HJI A;  3NHQ A;  1NLY A;  2Y2K A;  1WA9 A;  4E3O A;  1FR1 A;  4I39 A;  2PR6 A;  4EEU A;  4PM9 A;  3VP4 A;  4HI4 A;  1MXO A;  1F5M A;  5HD3 A;  1L2S A;  4X25 A;  4CLC E;  5A93 A;  2CC1 A;  1K56 D;  3O86 A;  2JKG A;  1NXY A;  4ZRR A;  5FAT A;  4Y0U A;  3MXS A;  2ZQ7 A;  3BLS A;  1CQA A;  4LV2 A;  4QB8 A;  3S7O A;  4Z9Q A;  1ES2 A;  4S2M A;  4Y7P A;  3TSG A;  1SKF A;  4Y3I A;  4WF0 A;  4WEL A;  2ZC7 A;  5HFO A;  4EET B;  5GLD A;  3H82 B;  1ESU A;  3UDF A;  1EWZ A;  2KX6 A;  3WS0 A;  3WS5 A;  5E2F A;  3FC7 A;  3N8S A;  3BEB A;  1ERQ A;  2YKF A;  2J9P A;  3MZE A;  1K6R A;  1CI8 A;  1Y28 A;  3E98 A;  5TBM B;  4C6Y A;  1MWR A;  3B47 A;  3RFB A;  1VM1 A;  5J3W A;  2ZD8 A;  4RVA A;  1DP8 A;  2OAP 1;  4CLC D;  1K4F A;  4OQG A;  2OSU A;  3H7W A;  3I7J A;  3MR0 A;  1ES5 A;  4PPR A;  3E4P A;  2Y8H A;  3FPW A;  3UY6 A;  3T1Q B;  1YMX A;  3IS2 A;  2XD5 A;  4EES A;  2ZC6 B;  4PKY G;  3LID A;  3T4S A;  1PW8 A;  1IEM A;  4DMZ A;  3SH9 A;  5EVI B;  1TS0 A;  1PNE A;  5CTM A;  2O0Y A;  2H5S A;  5HSQ A;  1KOU A;  3UE1 A;  4S2J A;  2EX2 A;  5E43 A;  3F1N A;  3KYZ A;  3Q1F A;  1STZ A;  2J3T D;  4X56 A;  4LRZ E;  1Y4O A;  4LRX C;  1K54 A;  4FSF A;  2HJE A;  1HZO A;  2J3W A;  2ZLY A;  1PWD A;  3UB6 A;  2OLU A;  4E3I A;  4OKP A;  5FQ9 A;  4OLG A;  3CLO A;  5DVA A;  2Y59 A;  5F5Y A;  2W0N A;  5KZH A;  3D4F A;  5FQJ A;  1EW0 A;  3MFD A;  2EX6 A;  5A90 A;  4S2K A;  4E3M A;  4WMC A;  3N8L A;  5FAO A;  3LR0 A;  1IYO A;  1P97 A;  1IEL A;  4WZ5 A;  3HUO A;  1LSX A;  2WKI A;  1FQG A;  4LCL A;  2J3T C;  1TS7 A;  3EGX C;  3KYQ A;  4F3L A;  3RXW A;  1DRM A;  2J8Y A;  3C7U A;  3NUL A;  2H28 A;  3IX8 A;  2QZ6 A;  1HVB A;  5DF8 A;  4B93 A;  2Z2L B;  3DW0 A;  1LL5 A;  5IS1 A;  1S1Y A;  5TR7 A;  3UME A;  3K3C A;  3Q07 A;  3SH8 A;  1FIL A;  1YMS A;  5CER A;  4K91 A;  3MQ0 A;  2KLI A;  4FTX A;  2V8F A;  1XP4 A;  2ZC5 B;  2P7J A;  4JF6 A;  1L0F A;  1CEG A;  5EUA A;  5U47 A;  1YLT A;  1YLZ A;  4A5R A;  4OOL A;  3HLC A;  1V9Y A;  3DWK A;  3H7W B;  5EE8 A;  3WRZ A;  4MLL A;  1TDL A;  3KSI A;  4EBP A;  3T1X A;  1JWV A;  3CPT A;  4RX3 A;  4X1L A;  3CAX A;  1ZTU A;  1K55 C;  4HY8 A;  4KG2 A;  3G4P A;  3JVU A;  4HBU A;  3KO6 A;  1OTD A;  1UWP X;  2XEP A;  4BWI A;  3N6I A;  1CF0 A;  3UPP A;  4Q0J A;  3IX4 A;  3G6O A;  4EUZ A;  3F1N B;  1W5D A;  2ZC4 B;  2OWJ A;  4DXC A;  2H10 A;  4JF5 A;  1H3Q A;  4OOY A;  1S6R A;  3OPR A;  3FYZ A;  2Q0O A;  3ZNY A;  1H8Y A;  3ZFZ A;  3UE0 A;  5EVE A;  4JXS A;  4EW7 A;  5HWV A;  4GD6 A;  3UDI A;  4RYE A;  3C4P A;  2HDS A;  3IWQ A;  4P0M A;  1ALQ A;  4QJG A;  3ITB A;  1VHM A;  5CED A;  3MF0 A;  1XGJ A;  4DXB A;  3TRC A;  3MSH A;  4ID4 A;  3BRM A;  4K08 A;  3S7Q A;  1K56 A;  4E6X A;  1FOF A;  4NK3 A;  4UA9 A;  4OPY A;  3M2K A;  3IH8 A;  1FCO A;  4UHU A;  4F3L B;  4KUO A;  3PAG A;  5AQB A;  4Y17 A;  4QHC A;  1DP9 A;  5FAP A;  3EWK A;  3BJN A;  2W1T A;  3QP5 A;  1YSP A;  1I5Q A;  3PYP A;  1PZP A;  1CK3 A;  2CMN A;  1CEF A;  1KVL A;  1OTA A;  2Y4A A;  3W8K A;  3VFF A;  1ACF A;  4R3B A;  1BUL A;  5TFQ A;  3O5Y A;  1OME A;  5EOE A;  1S66 L;  3NOT C;  4KZ9 A;  1Q2Q A;  2Q9M A;  5FDH A;  3OC2 A;  5HW3 A;  2QKP A;  1T1A A;  4ZBE A;  1S1Z A;  3W4Q A;  5FAS A;  3O88 A;  3S1Y A;  3C38 A;  2BAS A;  2OAQ 1;  1P9R A;  1JTD A;  3NDE A;  5FQK A;  4HJ6 A;  4CLC A;  3CPT B;  4IBX A;  4B4X A;  5HDS A;  4N1H A;  2UWX A;  2Z2M B;  5J8X A;  2HPB A;  5CGX A;  1IKG A;  4LV0 A;  2L1M A;  4WEJ A;  4OPR A;  2PT7 A;  4GN2 A;  3W2Z A;  4N92 A;  5HAR A;  1T1B A;  4GCZ A;  3E4O A;  3UNW A;  5IT5 A;  4GZB A;  2XFT A;  3OLO A;  1J9M A;  2HF6 A;  3HL9 A;  2EX9 A;  3D9Y A;  1PI4 A;  4DRT A;  4I3J A;  4JGQ A;  3F1P B;  4MN7 A;  4UA6 A;  4NXB A;  4EU0 A;  4KEN B;  1N9L A;  4LV3 A;  4WLA A;  4X68 A;  3CUE C;  2K31 A;  2ZQA A;  3IT9 A;  2HP5 A;  2JN7 A;  4II7 A;  5L07 A;  5G18 A;  1LI9 A;  4ESP A;  2X71 A;  4JXW A;  1WYB A;  1BYW A;  4O8G A;  3T4T A;  4L0L A;  2PD8 A;  1GHI A;  3IXD A;  1MWU A;  5G4Y A;  2VX8 A;  2JC7 A;  1JWP A;  1AXB A;  3PHY A;  4R0Q A;  3CI6 A;  4KQD A;  1SKO A;  1OPX A;  3KX0 X;  2M7U A;  2LB5 A;  3HVF A;  2WKQ A;  2A3U A;  4RA7 A;  4B4Z A;  2Y2L A;  3H9W A;  5HDC A;  4D60 A;  1ERM A;  1NRJ A;  2EFU A;  2VKS A;  3A3F A;  1GHM A;  1K54 C;  4PM7 A;  3M6H A;  1K55 A;  1G5U A;  1KVM A;  2XLN A;  3VOL A;  4EER A;  3TJZ C;  4KG6 A;  4JGR A;  3ZQ5 A;  1U60 A;  3P98 A;  3ZVT A;  4R23 A;  3Q81 A;  5DTS A;  1O7E A;  4DDS A;  2VV6 A;  5HWW A;  3PBQ A;  3M6B A;  3LIA A;  4CLC B;  1OJG A;  3PTE A;  2WYX A;  3MQQ A;  2G7U A;  4ME4 A;  2A24 A;  3G34 A;  5IHV A;  1W8Q A;  4YOF A;  2BG1 A;  2IA2 A;  2JCH A;  3MBZ A;  1E25 A;  3N4I A;  4KZB A;  5AQ9 A;  2WGI A;  3V3S A;  4H8R A;  4JGP A;  2EFX A;  3BQA A;  3TG9 A;  1D7E A;  4MMN A;  5A91 A;  2JE5 A;  5DTK A;  3AGE A;  3UO9 A;  4D2O A;  4QY5 A;  2WGW A;  4KQO A;  4OOM A;  1M40 A;  2LB9 A;  4JGO A;  1SDN A;  2B18 A;  4X6T A;  4B88 A;  1TS6 A;  2V1Z A;  1GA9 A;  3EEH A;  3E2L A;  2XH9 A;  4MN6 A;  5CX7 A;  1LT0 A;  2ZQ9 A;  3ZYT A;  1G68 A;  4S2I A;  5FI7 A;  4LEN A;  1SCW A;  4DN0 A;  1VET A;  2INW A;  1KDW A;  5GLC A;  4KZA A;  3BFC A;  4LGW A;  1K57 C;  3MS6 A;  3IHA A;  5KIZ A;  1SKO B;  2M7V A;  3KSG A;  1D06 A;  1QME A;  2X02 A;  5TGF A;  3WS4 A;  1YLW A;  4X1M A;  1ZHH B;  3P7N A;  1MWS A;  3ZHH A;  5D3O A;  2UV0 E;  2QJ7 A;  1XFN A;  5DFY A;  2DCF A;  4Y0O A;  2WAE A;  4O01 A;  3U2A A;  4N9L A;  1JTG A;  3N7W A;  4OP5 A;  1E3U D;  3FV7 A;  3OPP A;  2R78 A;  3NY4 A;  4I3A A;  2HJ9 C;  5HD5 A;  3ZG8 B;  1XA7 A;  1V9Z A;  2HGV A;  3HUM A;  1J3W A;  2AVX A;  1TDG A;  3FKV A;  3HCY A;  2OLV A;  4WEK A;  4HNB A;  4LFU A;  4NEE D;  3G31 A;  3MFX A;  2A24 B;  3GVB A;  5CTN A;  2K2N A;  2ZQD A;  1MWT A;  1YQS A;  4KZ3 A;  4UQI M;  3CUE A;  4E3J A;  3NC8 A;  2Q9N A;  1E4D A;  4EBL A;  1NLZ A;  3PBO A;  1K4E A;  2EA9 A;  4X55 A;  5I5L A;  2V9A A;  1MPL A;  2ZOH A;  2QYB A;  5FEG A;  3S7N A;  1PWG A;  2RL3 A;  2WGW B;  1LSV A;  4I38 A;  3T4K A;  4Q8I A;  3CMZ A;  4BLM A;  1MKM A;  1P9W A;  4FD8 A;  2R9X A;  3HLG A;  2VEA A;  4WN5 A;  1XXM A;  3B42 A;  1PI5 A;  2Y2Q A;  2E8I A;  3VOZ A;  4HP4 A;  3WS2 A;  1KE4 A;  3D3O A;  1NWZ A;  1LI0 A;  2X01 A;  5L8M A;  4CLC C;  3DAV A;  1L0E A;  2XGN A;  1SHV A;  3LR5 A;  4PM5 A;  1VET B;  3FKW A;  3IWI A;  2HDR A;  4U3T A;  3NJA A;  1GCE A;  5FI2 A;  3OPH A;  1MY8 A;  2Y2O A;  3HLE A;  3CG5 A;  5GHX A;  1BZA A;  4DE0 A;  4NET A;  3ITA A;  4E3K A;  2OV5 A;  4Y2F A;  1BSG A;  2P04 A;  4Y13 A;  1O07 A;  5A8B A;  2KOI A;  5GHY A;  4DJ3 A;  1PWC A;  1JWZ A;  3FZC A;  3RXX A;  3T50 A;  3LI9 A;  2Y2N A;  5HPI A;  3BYD A;  1VQQ A;  3OOV A;  4L9E A;  2ZM0 A;  3DTK A;  3P09 A;  2GNX A;  2V1A A;  2O9C A;  1YT4 A;  4RX2 A;  3O3V A;  4GNU A;  3IXG A;  1G6A A;  2JKF A;  2B5R A;  3S22 A;  2PAV P;  2Y2J A;  3LIB A;  3LY3 A;  4HP9 A;  4IVK A;  5HL1 A;  2FFY A;  2XQZ A;  1RCJ A;  3GEC A;  4OVD A;  3UB9 A;  4MBF A;  1T18 A;  1RGZ A;  4KQR A;  3M2J A;  3QP8 A;  1F98 A;  3UN7 A;  3P01 A;  3MQO A;  1PRQ A;  4OH0 A;  3NEC A;  4PAU A;  1NZU A;  3S4X A;  4QU3 A;  3KYE A;  1DJB A;  2A2L A;  4QD4 A;  2QHK A;  1FR6 A;  1IYS A;  2NUT C;  3IXH A;  4U0X A;  2XRN A;  1OJ5 A;  1YKD A;  4P87 A;  3LCE A;  1NYM A;  3G2Y A;  1K57 A;  3BW6 A;  3ZG0 A;  4WZ4 A;  2EXA A;  4CPK A;  1XX2 A;  5HPF A;  1YLP A;  2W3H A;  2XRO A;  4OLD A;  5FSR A;  1YAX A;  1OT9 A;  2HV1 A;  4ZTK A;  1XKZ A;  5I94 A;  4ZJ2 A;  3F1P A;  2WKP A;  3BFD A;  2XR0 A;  2NUP C;  4QY6 A;  4LPZ A;  4EEP A;  4MBH A;  2BLS A;  2V0W A;  3PAE A;  1BUE A;  4E3L A;  1YPR A;  3ZG7 B;  2A49 A;  2PR5 A;  2DRW A;  5LBR A;  3UE3 A;  3U4L P;  2QMI A;  4ETX A;  3MMH A;  3Q7Z A;  4S2L A;  4XT2 A;  2ZM2 A;  2D01 A;  3HJK A;  3L7H A;  5HDD A;  3VE3 A;  3EGD C;  4MCW A;  2IWB A;  3LY4 A;  1E3U A;  4CJN A;  2WK0 A;  3T4L A;  5KMW A;  3FWL A;  3DTE A;  3IF6 C;  3LR3 A;  3L9K A;  1LL9 A;  2Y2H A;  4QWO A;  5M19 A;  1BLP A;  2JBF A;  1H5X A;  1K25 A;  1VEU A;  3G30 A;  5BOH A;  3GRJ A;  1N9O A;  3EQU A;  3VV4 A;  4FOF A;  2VGL M;  4L9G A;  2Y2I A;  1UWN X;  4UEY A;  3KSF A;  4DE3 A;  4EWF A;  2IWD A;  2M1C A;  2VV7 A;  3C30 A;  1XFQ A;  3NDG A;  3QP6 A;  1A0K A;  3T12 B;  1YM1 A;  2PU4 A;  4HBT A;  5MC7 A;  3IX3 A;  4EQ1 A;  4WL9 A;  5E2G A;  1N4O A;  4C75 A;  1OT6 A;  2VGJ A;  1M6K A;  4ZJ3 A;  1I2S A;  1LLB A;  1K38 A;  1KE0 A;  1NYY A;  2JHE A;  4HJ3 A;  3ICY A;  5K5B A;  2Z6C A;  2VK3 A;  2GX5 A;  4DE1 A;  2J80 A;  4JF4 A;  1T1C A;  1C3B A;  3E2K A;  4G3W A;  1JVJ A;  4RQ9 A;  5A92 A;  4EXO A;  5F6A A;  3ZDJ A;  3HLF A;  2H0Y A;  4R3A A;  5L10 A;  4ETZ A;  5EVL A;  4BD1 A;  4LCM A;  4DF6 A;  1XJ3 A;  2PRF A;  5CEB A;  3VP0 A;  1TS8 A;  1FCN A;  1XJ2 A;  4BQM A;  1FSW A;  4EQI A;  5AJG A;  3TW8 A;  3CHW P;  1X0O A;  1L0D A;  3DWZ A;  4XT2 B;  3ISG A;  1Z09 A;  4U0T A;  3UPN A;  2O9A A;  2WAF A;  5CHM A;  1RP5 A;  3GV9 A;  5FDS A;  4HEF A;  5M18 A;  1K0K A;  3E0Y A;  4DE2 A;  2XFS A;  3SS3 A;  3V39 A;  4HQA A;  3HRE A;  2PBY A;  3QNC A;  3IF5 A;  3LIF A;  3MKF A;  5AVE A;  1OTB A;  4WMC D;  5DJT A;  3V67 A;  4KZ6 A;  1VEU B;  5KSH A;  2PD7 A;  2WAD A;  1KGE A;  1H8Z A;  4GS9 A;  1P0Z A;  3R7W A;  2Y2M A;  1NY0 A;  3G32 A;  2Y79 A;  3ZG9 B;  1W63 M;  3K3D A;  2WZX A;  2Y2G A;  4O7D A;  3C2W A;  4FH2 A;  4FCF A;  1KGG A;  1GSV A;  3W4O A;  4BJP A;  5EEC A;  3IXB A;  3T4Q A;  5M1A A;  4OP8 A;  2C6W B;  2ZMF A;  1FIK A;  1ERO A;  3PXP A;  4E3N A;  1W79 A;  2HP9 A;  3BQ8 A;  3IBR A;  2W27 A;  4P6B A;  4MDZ A;  3UB5 P;  5EM0 A;  4JXG A;  5HAP A;  3MJQ A;  3QP4 A;  3BY8 A;  3QP1 A;  2P08 A;  4Z1W A;  1BLH A;  3C4O A;  2FFF B;  3NOP C;  3K2N A;  1T19 A;  1YSQ A;  3IF6 A;  1L3L A;  3Q7V A;  1WE4 A;  4R3J A;  2VGK A;  2ZQ8 A;  3G2Z A;  2ZMA A;  3VP3 A;  1PIO A;  4S2P A;  1TEM A;  3FG8 A;  3BFF A;  1BT5 A;  3OZH A;  5HAI A;  1IKI A;  1CI9 A;  4G3K A;  2VV8 A;  5DFX A;  3BFG A;  3Q82 A;  1FSY A;  3GDI A;  3ZVW A;  2ACG A;  2BTF P;  5E2H A;  4X53 A;  3MKE A;  4MEZ A;  3V50 A;  1VB6 A;  3VSK A;  3LIC A;  1LSW A;  4AFI A;  3BEC A;  1WYC A;  3QP2 A;  4CQH A;  4LLO B;  3PBR A;  2PU2 A;  2B02 A;  2P74 A;  4PM8 A;  4C3Q A;  1W63 Q;  2PDR A;  3W4P A;  2ZJ9 A;  5EFW A;  2JKT M;  4IJG A;  2XA7 M;  4I3I A;  3NI9 A;  4GS9 B;  4YFM A;  3R7W B;  3RH8 B;  4O0P A;  3T4O A;  4E04 A;  4GLQ A;  2ZL1 A;  1Z6F A;  4ZJ1 A;  5DJU A;  1MZU A;  4PHT A;  5CEC A;  2IWC A;  2VJW A;  1ZG6 A;  1ONG A;  1K6S A;  2H0T A;  2ZBB A;  1DY6 A;  5J7E A;  2XSS A;  3S7P A;  1F2K A;  5F1F A;  4G3V A;  5F69 A;  3QNB A;  4OPQ A;  3TE8 A;  5AQA A;  2WGV A;  2I9V A;  1KE3 A;  3AGD A;  4HIA A;  1SDE A;  2MJ6 A;  4HJ4 A;  5CRF A;  4HH3 A;  1TD5 A;  1PYY A;  5HZH A;  5IU1 A;  2I72 A;  4H6J A;  4IBR A;  3V3R A;  5HAQ A;  3A3J A;  3VMA A;  4GW9 A;  3VP1 A;  2W3G A;  2O9B A;  3WWX A;  1S0W A;  1ESI A;  3BLM A;  4Q0I A;  3HLB A;  2OWH A;  3PBS A;  1IFQ A;  2Y91 A;  2W1R A;  4PKY A;  1RGY A;  4JKT A;  1ODV A;  4IED A;  4WM9 A;  3JYI A;  3LO7 A;  4MNR A;  3N8R A;  3A3E A;  2QWS A;  2Z6D A;  1NZO A;  1S4S A;  1S4R A;  4JPM A;  4DJ2 A;  3IF6 B;  3Q7V B;  4LV1 A;  1NJ4 A;  4R6L A;  4E6W A;  4KZ7 A;  5HL6 A;  5GL9 A;  3IBJ A;  1ZC2 A;  2EXB A;  1MBL A;  1Y54 A;  5C5K A;  4R4S A;  3IHB A;  3MZD A;  4PM6 A;  4YNR A;  3SS5 A;  2JKT I;  4NXG A;  5GLB A;  4BD0 A;  4XXR A;  5L2F A;  4GJ4 A;  2VLG A;  5FQM A;  2V8C A;  4NXE A;  3OBF A;  5CGS A;  4ARZ A;  4S2O A;  4HOI A;  1DP6 A;  4L9F A;  4BL2 A;  2WUQ A;  4YWZ A;  3VOY A;  2ZQC A;  4IHQ A;  1MKI A;  1N9N A;  4I5S A;  2QJ5 A;  2G2W A;  4XUZ A;  1Q2P A;  4GDB A;  3SZT A;  1BLC A;  3HLD A;  3A3I A;  5AQ7 A;  2L4R A;  3O87 A;  4N9K A;  3R4K A;  2ZL1 B;  1YLY A;  1KGF A;  4OQI A;  1ZKJ A;  3JPU A;  3NIA A;  1UGU A;  2WKH A;  4Y5F A;  1KDS A;  2P9V A;  3T4J A;  3HUN A;  2FZ0 A;  5L09 A;  3C5A A;  3ZNT A;  4P6Z M;  2GZA A;  3LGO A;  4R70 A;  3MXR A;  1ZG4 A;  3WRT A;  1GHP A;  4GHI A;  3MZF A;  1HD8 A;  1HLU P;  2XA7 S;  3ULF A;  2V1B A;  1JNU A;  4S2N C;  4UAA A;  2J7V A;  4H6J B;  4MN5 A;  2W3E A;  3KSH A;  5CHU A;  2R9W A;  4PMA A;  4IVI A;  1XJ6 A;  3TOI A;  3PBN A;  1BTL A;  2RCX A;  1IOU A;  3IS2 B;  4BEN A;  2WZZ A;  3NBL A;  3BM6 A;  5G4Z A;  4OQH A;  1DJA A;  3A0R A;  3CZD A;  3LEQ A;  3DTM A;  4GOG A;  4UQI S;  3BFE A;  3CWF A;  3IWO A;  1ES4 A;  1YLJ A;  3B33 A; 
#chains in the Genus database with same CATH homology
 4JF4 A;  4QY5 A;  1C3B A;  3E2K A;  2WGW A;  3B3X A;  4KQO A;  1JVJ A;  3SH9 A;  3AGF A;  4KQQ A;  4OOM A;  3CJM A;  5EVI B;  1M40 A;  5A92 A;  5CTM A;  2H5S A;  3ZDJ A;  3UE1 A;  3ZCZ A;  2HDU A;  3V5M A;  3HLF A;  4S2J A;  4OON A;  1SDN A;  4X6T A;  2EX2 A;  4B88 A;  2H0Y A;  5E43 A;  5EVL A;  3Q1F A;  2V1Z A;  4BD1 A;  4LCM A;  5EVI D;  1GA9 A;  4DF6 A;  4KG5 A;  3E2L A;  4X56 A;  5CEB A;  3VP0 A;  4P85 A;  2XH9 A;  1FCN A;  1K54 A;  2ZQ9 A;  1G68 A;  4S2I A;  5FI7 A;  4FSF A;  4N1X A;  1FSW A;  4BQM A;  1HZO A;  2ZLY A;  4EQI A;  1PWD A;  2WKE A;  4LEN A;  1SCW A;  3ZG5 A;  2OLU A;  4E3I A;  4OKP A;  1L0D A;  5FQ9 A;  4OLG A;  1KDW A;  3DWZ A;  5GLC A;  3GMW A;  4KZA A;  3ISG A;  5DVA A;  3BFC A;  2Y59 A;  3SS4 A;  1K57 C;  3IHA A;  4U0T A;  3UPN A;  5KZH A;  3D4F A;  4WYY A;  5FQJ A;  2WAF A;  5CHM A;  1LHY A;  1RP5 A;  3GV9 A;  4R4R A;  2EX8 A;  3MFD A;  1QME A;  2EX6 A;  4HEF A;  4S2K A;  4E3M A;  2X02 A;  5TGF A;  3WS4 A;  4WMC A;  1YLW A;  2XFS A;  3N8L A;  3SS3 A;  5FAO A;  4DE2 A;  3V39 A;  4FH4 A;  4EBN A;  1IYO A;  4DDY A;  3HRE A;  1MWS A;  3VFH A;  2PBY A;  3ZHH A;  5D3O A;  2GDN A;  3QNC A;  3IF5 A;  1IEL A;  4WZ5 A;  3MKF A;  2DCF A;  2Y55 A;  4Y0O A;  5KSC A;  3HUO A;  2WAE A;  5F83 A;  4WMC D;  1EI5 A;  2WKI A;  1JTG A;  3N7W A;  4N9L A;  4OP5 A;  1FQG A;  4LCL A;  5EVI C;  1E3U D;  3SOI A;  3FV7 A;  3RXW A;  3OPP A;  2P9V B;  1ONH A;  2J8Y A;  3C7U A;  3NY4 A;  4KZ6 A;  5KSH A;  3ZG8 B;  1XA7 A;  2QZ6 A;  4YIN A;  1HVB A;  3HUM A;  5DF8 A;  2Z2L B;  3DW0 A;  3GTC A;  2WAD A;  1LL5 A;  2J9O A;  1KGE A;  1H8Z A;  1TDG A;  3FKV A;  5TR7 A;  2OLV A;  2Y2M A;  3Q07 A;  3SH8 A;  4WEK A;  1YMS A;  5CER A;  1NY0 A;  5EOO A;  4K91 A;  3G32 A;  5EPH A;  4F94 A;  3ZG9 B;  1XP4 A;  3VP2 A;  2WZX A;  2ZC5 B;  4KZ4 A;  3G31 A;  1L0F A;  1CEG A;  4JF6 A;  2Y2G A;  4O7D A;  5EUA A;  3GVB A;  5U47 A;  1YLT A;  1YLZ A;  4FH2 A;  4OOL A;  5CTN A;  4A5R A;  2ZQD A;  4FCF A;  1MWT A;  1KGG A;  1YQS A;  3HLC A;  4KZ3 A;  1I2W A;  3IQA A;  3DWK A;  5EE8 A;  3WRZ A;  4MBK A;  4E3J A;  3NC8 A;  2Q9N A;  1E4D A;  1TDL A;  4MLL A;  3W4O A;  4BJP A;  4EBL A;  3PBO A;  1K4E A;  4EBP A;  5EEC A;  3IXB A;  5M1A A;  1NRF A;  4X55 A;  4OP8 A;  2C6W B;  1JWV A;  1ERO A;  4RX3 A;  5GHZ A;  1K55 C;  5JYP A;  1MPL A;  4E3N A;  1W79 A;  5DTT A;  1HTZ A;  2HP9 A;  4KG2 A;  3G4P A;  5CXW A;  1PWG A;  2RL3 A;  2WGW B;  4WBG A;  3C7V A;  4HBU A;  4Q8I A;  1W7F A;  4P6B A;  3CMZ A;  5FI6 A;  2XEP A;  4BLM A;  4JXG A;  3N6I A;  1PZO A;  4FD8 A;  2R9X A;  5HAP A;  3HLG A;  3UPP A;  4XUX A;  1XXM A;  2C5W B;  4JBF A;  1BLH A;  1PI5 A;  1TVF A;  2FFF B;  2Y2Q A;  3C4O A;  2E8I A;  4EUZ A;  3VOZ A;  1W5D A;  2ZC4 B;  3WS2 A;  2ZC3 B;  4BL3 A;  1KE4 A;  5CHJ A;  4DXC A;  1LI0 A;  2X01 A;  2H10 A;  4KZ8 A;  4JF5 A;  1DJC A;  4JXV A;  4OOY A;  3IF6 A;  1S6R A;  3OPR A;  3Q7V A;  1WE4 A;  3VSL A;  3FYZ A;  4R3J A;  2VGK A;  2ZQ8 A;  3G2Z A;  1L0E A;  2XGN A;  3ZNY A;  5FAQ A;  1H8Y A;  1SHV A;  4GDN A;  2ZMA A;  3ZFZ A;  3UE0 A;  4JXS A;  4PM5 A;  3FKW A;  3IWI A;  2HDR A;  4GD6 A;  3VP3 A;  1PIO A;  2V2F F;  4S2P A;  3UDI A;  1TEM A;  3PBT A;  4RYE A;  4U3T A;  1PW1 A;  2HDQ A;  3BFF A;  2HDS A;  3C4P A;  3IWQ A;  4P0M A;  1BT5 A;  1ALQ A;  1GCE A;  3ITB A;  3OZH A;  5FI2 A;  4QJG A;  3OPH A;  1MY8 A;  3HLW A;  5CGW A;  1W8Y A;  5FQI A;  2Y2O A;  5CED A;  3HLE A;  5HAI A;  3CG5 A;  1XGJ A;  1IKI A;  1CI9 A;  4K0X A;  2XK1 A;  5GHX A;  1BZA A;  3GR2 A;  4DE0 A;  4NET A;  3BFG A;  3Q82 A;  4DXB A;  3ITA A;  4E3K A;  2OV5 A;  1BSG A;  4ID4 A;  3BRM A;  1FSY A;  1K56 A;  4E6X A;  3GQZ A;  1FOF A;  1O07 A;  3ZVW A;  4KZ5 A;  1GA0 A;  5GHY A;  4NK3 A;  1PWC A;  1JWZ A;  3FZC A;  4OPY A;  4UA9 A;  3M2K A;  3IH8 A;  5E2H A;  3RXX A;  4GD8 A;  4X53 A;  3MKE A;  4OQ0 A;  4S2N A;  1FCO A;  2Y2N A;  4MEZ A;  3BYD A;  1VQQ A;  5DF7 A;  3SH7 A;  4UHU A;  3V50 A;  1N9B A;  3GSG A;  3VSK A;  2DNS A;  3PAG A;  2ZM0 A;  3NCK A;  5AQB A;  3P09 A;  1IYP A;  3HBR A;  3BEC A;  1WYC A;  4QHC A;  5FAP A;  3ZGA B;  3PBR A;  1YT4 A;  2PU2 A;  4PM8 A;  2P74 A;  4RX2 A;  3O3V A;  4GNU A;  4C3Q A;  3IXG A;  5JYO A;  1G6A A;  5HX9 A;  3W4P A;  2B5R A;  2ZJ9 A;  5DF9 A;  3S22 A;  2Y2J A;  4EV4 A;  4X69 A;  1I5Q A;  3LY3 A;  4IVK A;  5HL1 A;  1PZP A;  5FA7 A;  4DKI A;  1CK3 A;  1XA1 A;  3NI9 A;  2FFY A;  2XQZ A;  1RCJ A;  4OVD A;  4YFM A;  2ZM8 A;  1CEF A;  2XDM A;  4K0W A;  1ES3 A;  1FCM A;  1KVL A;  4MBF A;  2Y4A A;  1RGZ A;  1Z6F A;  4JLF A;  3QHY A;  4ZJ1 A;  4KQR A;  4UA7 A;  3M2J A;  3VFF A;  4R3B A;  1BUL A;  2IWC A;  4OPZ A;  5TFQ A;  3G35 A;  5CEC A;  1ZG6 A;  1OME A;  5EOE A;  3UN7 A;  1ONG A;  4KZ9 A;  1Q2Q A;  5E2E A;  3IH9 A;  2Q9M A;  4ZAM A;  3RJU A;  1IYQ A;  5FDH A;  3OC2 A;  5HW3 A;  1K6S A;  2H0T A;  1DY6 A;  4M3K A;  3LEZ A;  4ZBE A;  4OH0 A;  3W4Q A;  5FAS A;  3O88 A;  1L0G A;  5F1F A;  1NZU A;  5F82 A;  3S1Y A;  3S4X A;  4QU3 A;  4R1G A;  4ZDX A;  3QNB A;  4OPQ A;  1DJB A;  1JTD A;  5AQA A;  2WGV A;  3NDE A;  2XD1 A;  2G2U A;  4GKU A;  4QD4 A;  5FQK A;  1KE3 A;  1FR6 A;  3AGD A;  1IYS A;  2XF3 A;  3IXH A;  4WZ5 C;  1SDE A;  5CRF A;  4IBX A;  4HES A;  4B4X A;  2QPN A;  4N1H A;  1PYY A;  4U0X A;  3UDX A;  2I72 A;  3W8K A;  2UWX A;  4IBR A;  2Z2M B;  3V3R A;  3A3J A;  4P87 A;  3VMA A;  5HAQ A;  3LCE A;  5J8X A;  1NYM A;  3OCL A;  2HPB A;  5CGX A;  1IKG A;  3G2Y A;  3VP1 A;  4LV0 A;  1K57 A;  3WWX A;  1S0W A;  1QMF A;  4WEJ A;  1ESI A;  3BLM A;  3HLB A;  3PBS A;  3ZG0 A;  4WZ4 A;  2EXA A;  4CPK A;  2Y91 A;  1XX2 A;  2Y2P A;  4GN2 A;  4OPR A;  1XGI A;  4N92 A;  5HAR A;  1RGY A;  3OCN A;  1YLP A;  4JKT A;  4IED A;  5GLA A;  3UNW A;  4WM9 A;  3JYI A;  3LO7 A;  4GZB A;  3N8R A;  4MNR A;  4Y0T A;  3A3E A;  4OLD A;  2XFT A;  5FSR A;  1J9M A;  1NZO A;  3HL9 A;  4JPM A;  2EX9 A;  3UPO A;  3IF6 B;  3Q7V B;  1BLS A;  1PI4 A;  4DRT A;  5M18 A;  4LV1 A;  1NJ4 A;  1XKZ A;  4ZTK A;  3WS1 A;  5I94 A;  4UA6 A;  4ZJ2 A;  5EVI A;  4E6W A;  1XPB A;  3OPL A;  3BFD A;  4KEN B;  2XR0 A;  2HP6 A;  3A3D A;  4KZ7 A;  5F1G A;  4LV3 A;  5FQQ A;  5GL9 A;  4QY6 A;  3EQV A;  2V20 A;  4GB7 A;  4X68 A;  4MBH A;  2ZQA A;  3IT9 A;  2HP5 A;  2BLS A;  3PAE A;  1ZC2 A;  2EXB A;  1BUE A;  1MBL A;  1Y54 A;  5G18 A;  4E3L A;  1LI9 A;  3IHB A;  2Y2K A;  4R4S A;  3MZD A;  2X71 A;  4PM6 A;  4JXW A;  1WYB A;  4E3O A;  3ZG7 B;  2A49 A;  3SS5 A;  4L0L A;  1FR1 A;  2DRW A;  5GLB A;  4BD0 A;  4XXR A;  3UE3 A;  1GHI A;  3IXD A;  1MWU A;  2QMI A;  4PM9 A;  3VP4 A;  5L2F A;  1MXO A;  3Q7Z A;  5FQM A;  4S2L A;  2JC7 A;  1JWP A;  5CGS A;  1AXB A;  4R0Q A;  4S2O A;  2ZM2 A;  1L2S A;  5A93 A;  2CC1 A;  4BL2 A;  1K56 D;  3O86 A;  2WUQ A;  3VOY A;  3HVF A;  2ZQC A;  1NXY A;  2A3U A;  2IWB A;  5FAT A;  3LY4 A;  1MKI A;  4RA7 A;  2Y2L A;  4Y0U A;  4B4Z A;  3MXS A;  1E3U A;  2ZQ7 A;  4CJN A;  2WK0 A;  3BLS A;  5KMW A;  2G2W A;  1ERM A;  3FWL A;  4XUZ A;  2EFU A;  1Q2P A;  3A3F A;  4LV2 A;  4GDB A;  4QB8 A;  4Z9Q A;  1ES2 A;  4S2M A;  1GHM A;  4Y7P A;  1BLC A;  3HLD A;  1K54 C;  3A3I A;  5AQ7 A;  3IF6 C;  3TSG A;  1SKF A;  4PM7 A;  3O87 A;  3M6H A;  1K55 A;  1LL9 A;  4N9K A;  2Y2H A;  1YLY A;  1KVM A;  1KGF A;  4OQI A;  1ZKJ A;  2XLN A;  3NIA A;  5M19 A;  4WEL A;  2WKH A;  2ZC7 A;  1KDS A;  2P9V A;  1BLP A;  2JBF A;  5HFO A;  5GLD A;  3HUN A;  1H5X A;  1K25 A;  4KG6 A;  1ESU A;  3C5A A;  3UDF A;  3G30 A;  3ZNT A;  1EWZ A;  5BOH A;  5A90 A;  3GRJ A;  1U60 A;  3P98 A;  3WS0 A;  3MXR A;  3WS5 A;  4R23 A;  3ZVT A;  1ZG4 A;  3EQU A;  3WRT A;  1GHP A;  5E2F A;  3MZF A;  1HD8 A;  3N8S A;  3BEB A;  1ERQ A;  1O7E A;  3Q81 A;  5DTS A;  4DDS A;  2J9P A;  3MZE A;  2Y2I A;  3PBQ A;  1K6R A;  3M6B A;  1CI8 A;  4DE3 A;  3PTE A;  2WYX A;  2IWD A;  4EWF A;  4C6Y A;  4S2N C;  3NDG A;  4UAA A;  2J7V A;  1MWR A;  3G34 A;  1YM1 A;  1VM1 A;  2PU4 A;  4HBT A;  1W8Q A;  5IHV A;  2ZD8 A;  5CHU A;  2BG1 A;  2R9W A;  4RVA A;  5E2G A;  2JCH A;  3MBZ A;  1E25 A;  3N4I A;  1N4O A;  4KZB A;  4C75 A;  1K4F A;  4OQG A;  4PMA A;  4IVI A;  2OSU A;  3I7J A;  5AQ9 A;  3TOI A;  2VGJ A;  2WGI A;  1ES5 A;  4PPR A;  1M6K A;  3V3S A;  4H8R A;  4ZJ3 A;  1I2S A;  2EFX A;  1LLB A;  1K38 A;  1BTL A;  3PBN A;  2RCX A;  3TG9 A;  1KE0 A;  3UY6 A;  4BEN A;  2WZZ A;  1NYY A;  3BM6 A;  1YMX A;  3NBL A;  1DJA A;  3CZD A;  4GOG A;  2XD5 A;  4OQH A;  3DTM A;  5A91 A;  3BFE A;  2JE5 A;  2ZC6 B;  3IWO A;  5DTK A;  1ES4 A;  3AGE A;  1YLJ A;  1PW8 A;  3UO9 A;  4D2O A;  1IEM A;  4DE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...