5KMWA

Toho1 beta lactamase mutant e166a/r274n/r276n -benzyl penicillin complex
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
256
structure length
256
Chain Sequence
VQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase Toho-1
publication title TOHO1 Beta lactamase mutant E166A/R274N/R276N -benzyl penicillin complex
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 91
structure length 256
sequence length 256
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5kmwA00
1L0GA 3C4OA 5F1GA 1K54C 1K55A 3MFDA 1L2SA 3AGFA 4DE2A 4JKTA 4ZJ2A 1FCOA 4JBFA 2ZQ8A 3Q7VA 4OQHA 5E2FA 4PM7A 1E3UA 2P74A 5D3OA 2PU4A 3FWLA 2Y2LA 4EWFA 4GOGA 5HARA 4BL3A 4Y7PA 3ZNTA 4HBUA 1Q2QA 3DWZA 1MPLA 3N8RA 3ZG9B 2X71A 4NETA 2IWDA 1RGYA 3W8KA 1SDEA 3IXHA 5AQBA 5FQKA 1U60A 4S2NA 3DW0A 3CZDA 3PAGA 3Q7ZA 4PM6A 5EOOA 2DRWA 3V3SA 3Q82A 4R4SA 1LLBA 4KZ5A 2XFTA 2HDQA 3MXRA 1W5DA 2XK1A 2ZLYA 4N92A 5HW3A 4Y0UA 3ZG8B 3NCKA 4U0XA 1SCWA 1XPBA 3A3IA 3UY6A 2EX6A 2ZJ9A 3V50A 4N1XA 5A90A 2RCXA 3M2KA 5DTKA 1IYOA 4X68A 2H0TA 4K91A 4HEFA 4OP5A 4GD6A 4EBLA 1BT5A 3TSGA 4KG5A 5A92A 2HP5A 3UPPA 4OPQA 3TG9A 1FQGA 3HREA 2ZM2A 3DTMA 2Y2IA 4RX3A 5CTMA 4K0XA 4WYYA 5EECA 5HX9A 1YM1A 3MKFA 3SH8A 3IF6C 4ZDXA 1N9BA 2QPNA 3HLEA 3HLGA 3OCLA 3OPLA 3G34A 1W7FA 4OQGA 3WS1A 2V2FF 3IF5A 3V3RA 3PBNA 1PIOA 3VFFA 1ES3A 3G32A 3WRTA 2H10A 3FZCA 1ZG4A 1BLCA 3IHBA 3IXGA 2QMIA 3M2JA 4P87A 5EVIC 5A93A 4OKPA 4D2OA 4X56A 1NRFA 3MKEA 1PWCA 4JXVA 2XD1A 3IXDA 2XLNA 4U3TA 4DRTA 4WZ5C 2XQZA 2ZQDA 1JTDA 1GHMA 4Z9QA 1PZPA 1RCJA 4WEKA 2WKIA 4OOMA 1NY0A 3ZFZA 4LV2A 1KDSA 2FFFB 4ZBEA 1YT4A 3IWIA 1G68A 4PM9A 4PPRA 4EQIA 3UE0A 3UO9A 4WEJA 1PI4A 2HDUA 4ZJ1A 3ZDJA 5BOHA 2Y2NA 4B4XA 5CRFA 5FQ9A 3Q07A 2OV5A 5I94A 5CGSA 3SOIA 5KSHA 3C4PA 2ZQCA 3C7UA 4EBPA 1K38A 2Y2QA 4B88A 4RYEA 4CPKA 3ITAA 2HPBA 3G2ZA 1FSWA 2WGWB 3MBZA 4WELA 5FA7A 4F94A 1XXMA 1FCNA 1ZG6A 2J9PA 4PMAA 2J9OA 5KSCA 4HESA 3GTCA 2PU2A 2EX8A 3S4XA 4N1HA 4E3NA 1NJ4A 4IBXA 5U47A 1KE3A 1YLWA 4OOYA 1JWPA 1BUEA 2Y91A 1L0EA 2ZQ9A 3BECA 4QD4A 4OP8A 3UDFA 1J9MA 1TVFA 1LL9A 2ZC4B 2WGVA 2Z2LB 3LO7A 3WS4A 4N9KA 3UDXA 1YLYA 3NDGA 1O07A 4P6BA 3C5AA 3ZGAB 4DKIA 4GN2A 4XUZA 1ZC2A 1FR6A 4IEDA 3MZFA 2IWBA 3N8LA 1YLPA 2ZC7A 5GLDA 5M1AA 4S2MA 2WADA 3IH8A 1YLZA 3IWOA 2OLVA 3M6HA 1Y54A 5GLCA 3S1YA 4EBNA 1IYSA 3G31A 4EV4A 2J7VA 1BLSA 5KMWA 4UA9A 1EROA 5FAOA 1JTGA 4JF4A 4BD1A 4UA7A 4M3KA 3UPNA 4ZAMA 4U0TA 4MBHA 3V5MA 1E25A 1IYPA 4R1GA 4KG6A 4C75A 2Y2KA 1ES2A 2WKHA 3GRJA 5M19A 2BG1A 1K25A 4KZAA 3SS4A 3SS5A 1LL5A 3G4PA 2P9VA 5EE8A 4P0MA 3IHAA 4BD0A 1KVMA 5J8XA 3N8SA 4RVAA 5DF8A 3BYDA 2JC7A 4L0LA 4P85A 4QHCA 1VM1A 5CHJA 2JBFA 2XFSA 3N7WA 5DTSA 5CERA 4OH0A 5F82A 1LHYA 3OCNA 3CMZA 4WZ4A 2UWXA 4DE0A 2RL3A 1ESUA 2Y2MA 3VP4A 2VGJA 2EXAA 1M6KA 4KQQA 1KE4A 1TDLA 2Y2GA 2GDNA 5EOEA 2ZC3B 4GDBA 4IVIA 4KQOA 4FCFA 3V39A 4BLMA 3LY3A 5TFQA 3W4QA 1MXOA 3HBRA 4JF6A 5FSRA 3VP0A 3DWKA 3A3EA 5GLBA 1KGEA 2R9WA 1C3BA 2ZQAA 3ZHHA 5FQJA 1NZOA 5EVID 1K6SA 5CXWA 3CG5A 3RJUA 2V1ZA 1KE0A 3SS3A 3W4PA 3IXBA 4MLLA 4UHUA 3BRMA 2OSUA 3O3VA 2H0YA 3HVFA 4OPZA 4RX2A 4S2OA 5A91A 3PBQA 3IF6A 1I5QA 4EUZA 4WM9A 3PBOA 4H8RA 1MWUA 4K0WA 3HL9A 3CJMA 4QB8A 2Y59A 2X01A 3SH9A 5GHYA 2Y2PA 4BQMA 5DVAA 3P09A 1KVLA 2JE5A 3Q7VB 4UA6A 3HLCA 1HVBA 1HD8A 1XGJA 2IWCA 3OPHA 5DF7A 3HLFA 4OVDA 1SHVA 5EVIA 1Q2PA 1VQQA 1MWSA 1XGIA 5CTNA 3NC8A 4ZTKA 3UN7A 2XEPA 1DJCA 3MXSA 4DF6A 4E3MA 1NYYA 3QNBA 2Z2MB 5CGXA 1I2SA 4B4ZA 4GD8A 4NK3A 3VOZA 4WZ5A 3WS0A 2P9VB 1CK3A 4KZ3A 1MKIA 4GNUA 3A3DA 4JLFA 4KG2A 2WAFA 1WE4A 4QY6A 1XP4A 2G2UA 2WKEA 5GL9A 4OLDA 1H5XA 4GDNA 2Y2HA 4S2PA 4OPYA 1ONHA 3WS2A 5F1FA 5AQ7A 1ERQA 3Q1FA 4JPMA 3O88A 1CEFA 2B5RA 1K56D 5TGFA 1H8YA 5AQ9A 3VP3A 2BLSA 3NY4A 4BJPA 1L0DA 3LY4A 4LV0A 3BLMA 3C7VA 3NI9A 5F83A 4DDYA 2ZD8A 1HTZA 1WYBA 4QY5A 1SKFA 2C5WB 1LI9A 3BFEA 3FKWA 2PBYA 1MWRA 2I72A 5AQAA 3GV9A 5GHZA 3GSGA 4PM8A 1BULA 5DF9A 2XD5A 4FH4A 1MWTA 4X6TA 3ZG0A 3SH7A 1K56A 3E2KA 4GZBA 3N6IA 1S6RA 1K57C 2ZMAA 3ZCZA 1SDNA 3HUMA 5CEDA 4XUXA 3I7JA 4R0QA 1ES4A 2WZZA 3BFGA 5G18A 3O86A 3VP2A 1XKZA 5DTTA 4DE1A 3GMWA 3ZNYA 1ALQA 2XR0A 2ZM0A 5FQQA 4FH2A 4KZBA 1KDWA 1L0FA 3O87A 3ZG5A 5TR7A 5EUAA 3MZEA 1E3UD 1GCEA 4YFMA 1K54A 4FD8A 3IQAA 1IEMA 1IYQA 4Y0OA 1JVJA 4DE3A 1K55C 5CECA 2A49A 1DJAA 2EFUA 2WZXA 2FFYA 3HUOA 4S2KA 2HP6A 2WGIA 4OONA 2X02A 4BL2A 1ERMA 3VSKA 1BLPA 2G2WA 5HFOA 4S2JA 4KENB 1OMEA 1XA7A 3HLWA 3HLDA 3PBSA 1JWZA 3G35A 2HDRA 4LV3A 3S22A 3GVBA 4OQ0A 1BTLA 1ZKJA 3UNWA 4KZ7A 3AGEA 5HL1A 5FDHA 4ZJ3A 3P98A 4S2NC 4ID4A 3IH9A 3WRZA 5FAPA 4WBGA 3D4FA 1O7EA 1PZOA 2ZC6B 1H8ZA 5L2FA 4GB7A 4R4RA 4YINA 4GKUA 5EPHA 4RA7A 2ZC5B 2ZQ7A 1S0WA 3BFFA 3FKVA 4KZ9A 1Z6FA 5JYOA 1TEMA 3TOIA 1FSYA 2XGNA 2A3UA 3NDEA 3EQUA 1RGZA 4OQIA 4MBKA 5FASA 3NIAA 4XXRA 3UDIA 2EX9A 1FOFA 2CC1A 1RP5A 3GR2A 3WS5A 1ES5A 1XX2A 2WGWA 2WYXA 3VP1A 3IWQA 1BLHA 4DXBA 2C6WB 3MZDA 1ONGA 4C3QA 5CEBA 2QZ6A 4X53A 1YQSA 4DXCA 5HAQA 1GHPA 3HLBA 1PW8A 3E2LA 3AGDA 1YMSA 3EQVA 3PBTA 5GHXA 3RXXA 5HAPA 2WUQA 3GQZA 1PWDA 2J8YA 1PI5A 4PM5A 1ESIA 1AXBA 1W8YA 3BEBA 1YMXA 1DJBA 2EX2A 3ZVWA 5CHUA 4E6XA 1GHIA 1NXYA 4X55A 5CHMA 3VOYA 4QJGA 5FI6A 1IKGA 4KZ8A 3OPRA 3OZHA 1CI9A 3BM6A 3G30A 4KZ4A 4FSFA 5EVLA 4IBRA 5HAIA 3UPOA 1PWGA 3N4IA 5GLAA 3NBLA 3BFDA 1K4EA 3ITBA 1HZOA 4LCLA 2HDSA 1KGGA 4Y0TA 3G2YA 2XDMA 3JYIA 1YLTA 1N4OA 4Q8IA 2Y55A 3ZVTA 1W8QA 1GA9A 3UE3A 3PBRA 2E8IA 3A3FA 3ZG7B 3A3JA 2HP9A 4E3LA 4JF5A 1KGFA 3HUNA 3IT9A 1CI8A 1IKIA 2JCHA 3W4OA 4KQRA 4WMCD 1IELA 2V20A 3BFCA 1TDGA 3QNCA 2XH9A 2Y2OA 5E43A 4E6WA 2H5SA 3B3XA 4R3JA 1CEGA 1FCMA 3PAEA 2DCFA 5M18A 1K6RA 5IHVA 3M6BA 5FI7A 2OLUA 3LCEA 1QMEA 3ISGA 1E4DA 1QMFA 4JXSA 4OLGA 3VMAA 4CJNA 1FR1A 1W79A 2ZM8A 3FV7A 4JXWA 4E3JA 1YLJA 5FQIA 4E3KA 4OOLA 5E2HA 3VSLA 1MBLA 3OPPA 1GA0A 1NYMA 4WMCA 1BZAA 1WYCA 4LCMA 5E2GA 3WWXA 1PW1A 5JYPA 2DNSA 4X69A 3RXWA 1XA1A 4IVKA 4R23A 3IF6B 4MEZA 1K57A 1G6AA 1BSGA 2XF3A 4E3OA 4A5RA 4N9LA 3OC2A 4E3IA 3Q81A 5FI2A 3LEZA 1DY6A 4HBTA 2Q9MA 3UE1A 4S2LA 5EVIB 2R9XA 1I2WA 5FAQA 4KZ6A 1NZUA 4BENA 3FYZA 1EWZA 4LENA 4S2IA 4C6YA 1PYYA 2WK0A 2Y4AA 3BLSA 2Q9NA 5KZHA 2Y2JA 1LI0A 4JXGA 4LV1A 4MBFA 4UAAA 5CGWA 5FQMA 3QHYA 4QU3A 1M40A 1EI5A 4O7DA 1JWVA 1K4FA 2EXBA 5FATA 4OPRA 2VGKA 4R3BA 3PTEA 1MY8A 2EFXA 4DDSA 3VFHA 4MNRA 2WAEA 5E2EA
chains in the Genus database with same CATH superfamily
1L0GA 3C4OA 5F1GA 1L2SA 4DE2A 4ZJ2A 4JBFA 3KSIA 2D01A 2LB9A 2K2NA 4F3LB 3T4SA 3IXHA 1U60A 4WN5A 1IOUA 2UV0E 2HDQA 2XK1A 2XSSA 5HW3A 4KUKA 2W1TB 4U0XA 3A3IA 3H82A 4N1XA 2ZBBA 4HEFA 4NXEA 2A2LA 4EBLA 2GJ3A 3TSGA 1OPXA 2V8CA 2OWHA 4G3WA 4HJ3A 4MCWA 4RX3A 2Y2IA 4K0XA 3SH8A 5IT5A 5HD5A 2EA9A 3EWKA 4UQIS 1PIOA 3F1PB 3WRTA 2H10A 1ZG4A 1BLCA 4D2OA 1D1JA 4X1LA 1F98A 1JTDA 3BW6A 3S7OA 4XT2B 4OOMA 1KDSA 4PM9A 4EQIA 1ZHHB 5CRFA 2L4RA 5CGSA 4CLCA 2ZQCA 2HPBA 4F94A 1FCNA 4BBVA 2J9OA 3MXQA 5J7EA 4E3NA 4KQDA 3ZYTA 1YLWA 2PRFA 2ZQ9A 1L0EA 3BECA 1J9MA 1TVFA 3WS4A 2VV8A 1T18A 3B33A 3UB7A 3ZGAB 4XUZA 1ZC2A 2L1MA 1VEUB 2IWBA 4WLAA 1L3LA 3KYZA 4E04A 1YLZA 3M6HA 2D02A 4EW7A 3G31A 4EV4A 5KMWA 4UA7A 3UPNA 3V5MA 1E25A 1XFQA 3W2ZA 4DMZA 1NLZA 2WKHA 1ACFA 2BG1A 2JN7A 4EEUA 2B18A 3CHWP 2P9VA 3T4OA 2V8FA 4P0MA 4BD0A 1KVMA 1XJ2A 5DF8A 5DTSA 3CMZA 3LUQA 3PYPA 3CUEC 1ESUA 2Y2MA 4BBTA 1M6KA 4HI4A 2GDNA 3QP6A 4GDBA 4KQOA 4BLMA 5TFQA 3RFBA 1C3BA 5FQJA 4HH3A 1NZOA 5EVID 3CG5A 3RJUA 3LI8A 4MLLA 2OSUA 4S2OA 3H7WB 3PBQA 4WM9A 1VHMA 5DVAA 4UA6A 2JE5A 3F1NA 4OVDA 1SHVA 2I9VA 1XGIA 1MWSA 3NC8A 1G28A 3BJNA 2Z2MB 3NOTC 4GNUA 4JLFA 2G2UA 4JGPA 4OPYA 3QP4A 5F1FA 1J3WA 3VE4A 5AQ9A 3T12B 1OTDA 3H82B 2J3TD 2VGLM 3BLMA 3NI9A 2ZD8A 5A8BA 2C5WB 1T1CA 3R7WA 1MWRA 3GV9A 4HIAA 3FPWA 3UB9A 3ZG0A 2VX8A 5F68A 1DRMA 1SDNA 5CEDA 3QP2A 1ES4A 3A0VA 4R38A 1LT0A 5EFWA 3HCYA 3O86A 3D3OA 5DTTA 2XR0A 2DMWA 5FQQA 4FH2A 4KZBA 4GJ4A 5TR7A 5EUAA 4WUJA 3RH8B 4DJ3A 5HWWA 3CPTA 1IYQA 1K55C 1DJAA 2FFYA 2WGIA 4CLCB 3VSKA 1UWPX 5HFOA 1HLUP 4KENB 3K3CA 4BWIA 1JWZA 3S22A 4LV3A 3GVBA 4OQ0A 4B9OA 1ZKJA 5HL1A 3E4QA 3P98A 4S2NC 3VOLA 1PZOA 4FOFA 5L2FA 3CUEA 3C8CA 5MC7A 4KZ9A 2AVXA 5TBMB 3A0SA 3EQUA 1RGZA 3JPUA 5FASA 2EX9A 3GR2A 1AWIA 2C6WB 4CLCE 3MZDA 5CEBA 2QZ6A 4X53A 3PBTA 3AGDA 3RXXA 2WUQA 1PWDA 2J8YA 4PM5A 1TS7A 1W8YA 3FC7A 1DJBA 2EX2A 4E6XA 2XRNA 5CHMA 5FI6A 4KZ8A 3BM6A 5HAIA 3UPOA 3F1OA 3CITA 4LCLA 2HDSA 2V9AA 4NXGA 3G2YA 2M7UA 4GHIA 2E8IA 3T1SA 4L9FA 2JKRM 1CI8A 3LI9A 4KQRA 3QNCA 2OWJA 4E6WA 2Y2OA 1CEGA 3PAEA 5M18A 4EETB 3M6BA 2HF6A 1E4DA 1QMFA 1STZA 3LYXA 1W79A 4E3KA 4Q0IA 5E2HA 1T1AA 1IFQA 1NYMA 4IHQA 1WYCA 2V1AA 4HHDA 5JYPA 4X69A 1XA1A 5HDDA 4MEZA 1G6AA 4E3OA 4A5RA 4N9LA 4Y2FA 3LEZA 1DY6A 4JGQA 4MN6A 3F1NB 3JVUA 4KZ6A 2JHEA 3FYZA 2WKQA 2Y4AA 5KZHA 1LI0A 4UAAA 3T4JA 4O7DA 2Y8HA 1JWVA 4YOFA 3PTEA 3F1PA 5FEFA 4LRXC 1K54C 1K55A 5EM0A 3BWLA 4OQHA 4PM7A 2P74A 5D3OA 3FWLA 3PR6A 4XT2A 3PXPA 2X71A 4NETA 1RGYA 1SDEA 5AQBA 4S2NA 5EOOA 3CZDA 3Q7ZA 3V3SA 1LLBA 3DTIA 3MXRA 1W5DA 2V0WA 3UE6A 3IX3A 1G6OA 1H0MA 3ZG8B 1SCWA 3UY6A 3V50A 3KSFA 3KO6A 4Q0JA 5A90A 1EW0A 3M2KA 1IYOA 5A92A 5TJJA 4OPQA 1FQGA 5HD3A 3D9YA 3CPTB 3OPLA 2VV7A 1W7FA 4OQGA 3V3RA 3PBNA 1OT9A 3VFFA 3LICA 3M2JA 4OKPA 4CLCD 3MKEA 4B93A 4GLQA 4JXVA 3IXDA 4DRTA 2XQZA 1PZPA 5F69A 4BBUA 1PRQA 1NY0A 3ZFZA 4LV2A 2FFFB 1YT4A 3IWIA 1G68A 4PPRA 3UE0A 2HGVA 4WEJA 1PI4A 3GECA 3Q07A 1GSXA 5I5LA 4Y13A 4EBPA 2M7VA 4FTXA 1T19A 2KDKA 3ITAA 3ULFA 5L07A 1ZG6A 2J9PA 3RTYA 4WF0A 3UB6A 3S4XA 4IBXA 4OOYA 1JWPA 1G5UA 1LSWA 4PKYG 3LO7A 4N9KA 3D72A 4R6LA 3IS2A 1O07A 4EUVA 4P6BA 4YWZA 2JKRI 1FR6A 3MZFA 3F1OB 1FILA 2HV1A 3N8LA 4IUKA 2ZC7A 5GLDA 1NLYA 4S2MA 5HSQA 3IH8A 3IWOA 1Y54A 4GHIB 4I3IA 3S1YA 4MN7A 4EBNA 2W3DA 2J7VA 1BLSA 5AVEA 5FAOA 4JF4A 2K31A 5EVEA 1IYPA 4C75A 2GZAA 2FZ0A 3SS5A 1LL5A 5EE8A 3BQAA 3CLOA 4EU0A 3N8SA 4RVAA 5HDSA 2NUTC 2JC7A 4L0LA 4QHCA 1DP6A 2VEAA 5CERA 5F82A 2PR6A 1S66L 1OTIA 2RL3A 3MR0A 1PNEA 1V9YA 2XA7S 3T1RA 2H28A 4IVIA 3V39A 3LY3A 4JF6A 5FSRA 3DWKA 5GLBA 2QYBA 1KGEA 3ZHHA 2V1ZA 3SS3A 3IXBA 4HNBA 3ICYA 4UHUA 3O3VA 4OPZA 2H0YA 4RX2A 2ZMVA 5A91A 1I5QA 1VB6A 4H8RA 4K0WA 4EESA 1CJFA 4QB8A 2X01A 5GHYA 2Y2PA 1LSVA 4ZJ1A 3HLCA 1HVBA 1XGJA 3T50A 4ZTKA 1Q2PA 3UN7A 2XEPA 1DJCA 3MXSA 1JNUA 3P7NA 4GD8A 4NK3A 3DAVA 4WL9A 1XP4A 1YPRA 2IA2A 2Y2HA 4S2PA 5AQ7A 3Q1FA 4JPMA 3O88A 1CEFA 2B5RA 4O8GA 5TGFA 5DKLA 1L0DA 3LY4A 3C7VA 1WYBA 4ESPA 3FKWA 1N9LA 3U2AA 5GHZA 4PM8A 5TBMA 1BULA 4FH4A 4DN0A 1MWTA 1UWNX 4X6TA 3SH7A 1K56A 5HWVA 4HJ6A 2XROA 1S6RA 1K57C 2ZMAA 5IU1A 3ZCZA 4JGRA 4XUXA 4R0QA 2VZWA 3BFGA 5G18A 2MJ6A 3VP2A 2WKPA 3GMWA 3ZNYA 2EWWA 2A24A 4LRZE 1KDWA 4P6ZM 1E3UD 1GCEA 3LIAA 4MDZA 1JVJA 1H3QA 4QWOA 3MSHA 2EFUA 2JKGA 2HP6A 2OOLA 4OONA 4BL2A 1BLPA 1XA7A 1S67L 2J3WA 4ZJ3A 2V1BA 4Y5FA 3WRZA 3D4FA 2ZC6B 5G4YA 4GB7A 1S1YA 2ZC5B 2ZQ7A 2O0YA 3BFFA 2A3UA 2CMNA 3IS2B 2PDRA 1RP5A 3WS5A 2K7SA 1XX2A 2WGWA 3V67A 4DXBA 3LIEA 1YQSA 4DXCA 5HAQA 1GHPA 3EQVA 1YMSA 3LGOA 1OT6A 3GQZA 4EQ1A 1YMXA 3ZVWA 4X55A 1IKGA 3OPRA 4FSFA 2QJ5A 1PWGA 3NBLA 3BFDA 1K4EA 2P08A 1XJ3A 3SW1A 4Y0TA 1SZVA 1OTAA 2XDMA 3JYIA 3T4QA 1NRJA 3A3FA 3A3JA 2HP9A 4E3LA 3IX8A 1KGFA 1IKIA 5HDCA 2XH9A 5E43A 4R3JA 1FCMA 2DCFA 4R70A 1K6RA 1VETA 1NWZA 1DP8A 5FI7A 2OLUA 4GCZA 3ISGA 4JXSA 4JXWA 3FV7A 4E3JA 3LR0A 3LIBA 3K3DA 4LCMA 3WWXA 2DNSA 1DP9A 3NECA 4IVKA 1K57A 1XJ4A 1BSGA 3QP8A 2O9BA 5J4EA 3Q81A 2YKHA 2R9XA 2PD7A 1FIKA 2WK0A 2Y2JA 2HZ5A 5CGWA 5FQMA 1YKDA 1M40A 3NOUC 1K4FA 2EXBA 5FATA 4OPRA 2VA0A 1T1BA 2O9CA 2EFXA 2YKFA 5EM1A 4JKTA 2ZQ8A 3BQ8A 5E2FA 1E3UA 2W3HA 4Y7PA 3ZNTA 3C2WA 3S7QA 3ZG9B 2IWDA 4ETZA 2VGLS 3W8KA 5FQKA 3DW0A 4PM6A 2DRWA 3Q82A 3DBAA 2ZLYA 4Y0UA 3NCKA 4HH2A 4I39A 4Y15A 2W27A 4Y17A 1SKOB 3K2NA 1BT5A 4KG5A 1YSPA 2A24B 3UPPA 1D7EA 3TG9A 3HREA 3DTMA 5HX9A 1YM1A 3MKFA 4ZDXA 3IF6C 3B47A 1N9BA 3OCLA 2V2FF 3LIFA 3GDIA 1ES3A 3IHBA 3IXGA 4P87A 2KOIA 5A93A 3UMEA 3BY8A 4LFUA 2L0WA 4GS9A 2ZQDA 2OAP1 4Z9QA 4WEKA 5EV0A 1GSWA 2BTFP 2BASA 3ZDJA 3T1QB 2Y2NA 4B4XA 2O99A 2OV5A 5KSHA 3LR4A 2Y2QA 4CPKA 5L8MA 1FSWA 2WGWB 3MBZA 3KSHA 1K0KA 4PMAA 5KSCA 4HESA 3GTCA 2W3FA 2EX8A 2HJEA 4N1HA 1NJ4A 1H8MA 1KE3A 1OJ5A 1W63M 2Y91A 4OP8A 1LL9A 3NJAA 3UDXA 1YLYA 4O01A 3C5AA 1MC0A 3JVVA 4GN2A 2PD8A 2VKSA 4IEDA 2GX5A 2W3GA 3DTKA 2OLVA 4IUHA 4I38A 1EROA 1JTGA 4BD1A 4ZAMA 4U0TA 4ARZA 1OJGA 4R1GA 2Y2KA 1OTEA 1ES2A 3QP1A 1KOUA 1K25A 4KZAA 3SS4A 5FL3A 1VETB 3G4PA 5HZHA 5J8XA 3BYDA 2XFSA 3HJKA 2PHYA 2INWA 1LHYA 3BY9A 3E4PA 3MF0A 4DE0A 2VGJA 4DJ2A 2P7JA 4KQQA 4I3AA 5EOEA 1F2KA 2ZC3B 4FCFA 4NEED 1MXOA 3VP0A 4EEPA 2R9WA 2EWVA 2ZQAA 1K6SA 5CXWA 2R78A 2WKRA 3W4PA 2P04A 3HVFA 4MN5A 3IF6A 1MWUA 4GW9A 3HL9A 3SH9A 1CQAA 1ZTUA 1TS6A 1LL8A 5G4ZA 4D60A 3OPHA 3OBFA 5DF7A 4DF6A 5CGXA 4B4ZA 3VOZA 3WS0A 4KZ3A 3EGXC 1MKIA 3A3DA 3E0YA 2ZL1A 5GL9A 1H5XA 4FUWA 5HPFA 1ONHA 1ERQA 1K56D 1H8YA 3T1XA 3VP3A 2BLSA 1Z09A 2HJ9C 3NY4A 1S4SA 4DDYA 1HTZA 4X1MA 4ETXA 1SKFA 1LI9A 5AQAA 3U4LP 3GSGA 2XD5A 4GZBA 1XFNA 2QHKA 2WZZA 4JGOA 2PBDP 1ALQA 2ZM0A 4GS9B 3ZG5A 2VLGA 5DJTA 4YFMA 1K54A 3IQAA 4UQIM 1IEMA 5CECA 1ERMA 3FPVA 2QWSA 3HLWA 3HLDA 3PBSA 3G35A 2HDRA 3MS6A 3KYQA 4KZ7A 3AGEA 3T4KA 5FDHA 2ZMFA 5FAPA 4WBGA 1O7EA 2GNXA 4GKUA 5EPHA 3FKVA 3TOIA 2XGNA 3NOPC 1YAXA 4OQIA 4MBKA 4L9EA 4R3AA 3NIAA 2Z6CA 2WYXA 3VP1A 1TS0A 3IWQA 1BLHA 4PKYA 4HY8A 4C3QA 1ONGA 3E2LA 3L7HA 5GHXA 1N9NA 2QKPA 5HAPA 3MQ0A 1PI5A 1ESIA 1AXBA 3BEBA 3LR3A 1NXYA 4NG2A 3VOYA 4EERA 4ARZB 4RQ9A 3OZHA 2QJ7A 2Y79A 4KZ4A 3E4OA 5EVLA 3ITBA 1P97A 1YLTA 1N4OA 4Q8IA 2Y55A 1W8QA 1GA9A 3UE3A 2OAQ1 2W0NA 3MQQA 5HPIA 4JF5A 1WA9A 4LGWA 2JCHA 2V20A 1TDGA 2H5SA 1X0OA 2G7UA 2ACGA 3A0RA 3VMAA 4CJNA 2Z6DA 1FR1A 3UB5P 2ZM8A 3EGDC 5CX7A 1MBLA 3OPPA 2PT7A 4WMCA 3RXWA 3IF6B 1SKOA 3VV4A 4I3JA 2ZOIA 4HBTA 2Q9MA 3UE1A 3TW8A 4H6JA 1I2WA 5FAQA 4BENA 4LENA 1PYYA 3BLSA 4LV1A 3QHYA 1EI5A 3UB8A 3QP5A 2VGKA 2ZL1B 3O5YA 3VFHA 5AVFA 5E2EA 3MFDA 3AGFA 1ODVA 1FCOA 3Q7VA 3LIDA 4CQHA 2PU4A 2Y2LA 4EWFA 4GOGA 5HARA 4BL3A 4HBUA 1Q2QA 3DWZA 1MPLA 3N8RA 3NHQA 1PFLA 3PAGA 4R4SA 4KZ5A 2XFTA 4NXFA 5IS1A 4N92A 1XPBA 3H9WA 2EX6A 2ZJ9A 1D06A 2RCXA 5DTKA 4X68A 4LLOB 2H0TA 3C38A 3B42A 4K91A 4OP5A 4Q0HA 4GD6A 3T4LA 3TRCA 2HP5A 3E98A 3SZTA 1Y4OA 2ZM2A 5CTMA 4WYYA 5EECA 2ZOHA 4P6ZS 2QPNA 3HLEA 3HLGA 1A0KA 1Y28A 3G34A 3WS1A 3IF5A 4G3KA 4HQAA 1TF1A 3G32A 3FZCA 1N9OA 2QMIA 5EVIC 3LFVA 4BMWA 4X56A 1NRFA 2M1CA 1PWCA 2XD1A 2B02A 2XLNA 4U3TA 4NKPA 4WZ5C 4O0PA 1GHMA 3KX0X 1RCJA 3C30A 2WKIA 4K08A 3EEHA 3NULA 2JKFA 5DJUA 4ZBEA 3MMHA 1P9RA 3UO9A 1S1ZA 2HDUA 5BOHA 5FQ9A 5I94A 3SOIA 3C4PA 2PYPA 3C7UA 3KSGA 1K38A 4B88A 4RYEA 3G2ZA 5FA7A 4WELA 1XXMA 5L09A 4NXBA 1MKMA 2PU2A 5U47A 1BUEA 3VE3A 1F9IA 4QD4A 3UDFA 2ZC4B 3PHYA 2WGVA 2Z2LB 1P9WA 2KLIA 3HJIA 2Q0OA 3NDGA 2J3TC 5KIZA 4DKIA 4EXOA 4AFIA 3L9KA 1YLPA 5M1AA 2WADA 3TE8A 5GLCA 2VJWA 1IYSA 4UA9A 4M3KA 4MBHA 2VV6A 4KG6A 4M4XA 4MMNA 3GRJA 5M19A 5DFYA 2E8JA 3IHAA 5FEGA 4P85A 2W3EA 1VM1A 3G6OA 5CHJA 3TJZC 2JBFA 3N7WA 4OH0A 4Y3IA 3OCNA 4WZ4A 2UWXA 1GSVA 5FDSA 5C5KA 4UEYA 3VP4A 2EXAA 3LEQA 4G3VA 1KE4A 1TDLA 2VK3A 3S7NA 2Y2GA 4KUOA 2PYRA 3W4QA 3HBRA 2W1RA 3MJQA 3A3EA 1TD5A 4H6JB 4II7A 1KE0A 3BRMA 4EUZA 1P0ZA 1CF0A 4ME4A 1BYWA 3PBOA 3CJMA 2Y59A 3CI6A 4BQMA 5HWTA 3P09A 1KVLA 3Q7VB 2IWCA 1HD8A 4L9GA 3HLFA 5EVIA 1VQQA 4E3MA 5CTNA 1NYYA 3QNBA 1I2SA 4WZ5A 2P9VB 1CK3A 2PAVP 4KG2A 2WAFA 1WE4A 4QY6A 4YNRA 2WKEA 4OLDA 1LSXA 2O9AA 4GDNA 3FG8A 3WS2A 3DTEA 5DFXA 4BJPA 4LV0A 1MZUA 5F83A 2JKTM 4F3LA 5F6AA 4QY5A 3BFEA 2PBYA 5F5YA 2I72A 3KYEA 5DF9A 3E2KA 4PHTA 4Z1WA 3N6IA 3LR5A 2NUPC 2W1TA 3R4KA 3HUMA 4X25A 4PAUA 3I7JA 1V9ZA 1XKZA 3IX4A 2FH5A 4DE1A 1L0FA 3O87A 1OTBA 2KX6A 3MZEA 3OOVA 4FD8A 4I5SA 2B95A 4Y0OA 4DE3A 3IBJA 5HL6A 2A49A 2WZXA 2V0UA 3HUOA 4S2KA 4HP9A 1YSQA 5AJGA 2X02A 5L10A 2G2WA 4S2JA 1OMEA 1S4RA 2PR5A 1BTLA 3UNWA 4HOIA 4ID4A 3IH9A 1H8ZA 4YINA 4R4RA 3S7PA 4RA7A 5J3WA 1S0WA 3IBRA 3R7WB 4LPZA 1Z6FA 5JYOA 3OLOA 1TEMA 1FSYA 3NDEA 4QPRA 4XXRA 3UDIA 1FOFA 2CC1A 4HJ4A 1ES5A 3HLBA 1PW8A 4ZRRA 3CWFA 5CHUA 1GHIA 4QJGA 5DKKA 1CI9A 3G30A 3CAXA 4IBRA 1VEUA 3N4IA 5GLAA 1HZOA 3EEAA 1KGGA 3ZVTA 3PBRA 4HP4A 3ZG7B 3EOIA 5LBRA 3IT9A 3HUNA 3W4OA 3T4TA 4WMCD 1IELA 3BFCA 3B3XA 4CLCC 5IHVA 1W63Q 3LCEA 1QMEA 4IJGA 1XJ6A 4OLGA 1F5MA 1YLJA 5FQIA 4OOLA 3VSLA 3UMDA 1GA0A 1BZAA 5E2GA 2XA7M 1PW1A 4R23A 2LB5A 3MFXA 2XF3A 2J80A 3OC2A 4E3IA 5FI2A 1TS8A 4S2LA 3P01A 5EVIB 1UGUA 1NZUA 1EWZA 4S2IA 4C6YA 3MQOA 2Q9NA 4JXGA 4MBFA 4QU3A 3ZQ5A 2JKTI 3H7WA 4R3BA 5K5BA 4LRYC 1MY8A 4DDSA 4MNRA 2WAEA
chains in the Genus database with same CATH topology
1L0GA 3C4OA 5F1GA 1K54C 1K55A 3MFDA 1L2SA 3AGFA 4DE2A 4JKTA 4ZJ2A 1FCOA 4JBFA 2ZQ8A 3Q7VA 4OQHA 5E2FA 4PM7A 1E3UA 2P74A 5D3OA 2PU4A 3FWLA 2Y2LA 4EWFA 4GOGA 5HARA 4BL3A 4Y7PA 3ZNTA 4HBUA 1Q2QA 3DWZA 1MPLA 3N8RA 3ZG9B 2X71A 4NETA 2IWDA 1RGYA 3W8KA 1SDEA 3IXHA 5AQBA 5FQKA 1U60A 4S2NA 3DW0A 3CZDA 3PAGA 3Q7ZA 4PM6A 5EOOA 2DRWA 3V3SA 3Q82A 4R4SA 1LLBA 4KZ5A 2XFTA 2HDQA 3MXRA 1W5DA 2XK1A 2ZLYA 4N92A 5HW3A 4Y0UA 3ZG8B 3NCKA 4U0XA 1SCWA 1XPBA 3A3IA 3UY6A 2EX6A 2ZJ9A 3V50A 4N1XA 5A90A 2RCXA 3M2KA 5DTKA 1IYOA 4X68A 2H0TA 4K91A 4HEFA 4OP5A 4GD6A 4EBLA 1BT5A 3TSGA 4KG5A 5A92A 2HP5A 3UPPA 4OPQA 3TG9A 1FQGA 3HREA 2ZM2A 3DTMA 2Y2IA 4RX3A 5CTMA 4K0XA 4WYYA 5EECA 5HX9A 1YM1A 3MKFA 3SH8A 3IF6C 4ZDXA 1N9BA 2QPNA 3HLEA 3HLGA 3OCLA 3OPLA 3G34A 1W7FA 4OQGA 3WS1A 2V2FF 3IF5A 3V3RA 3PBNA 1PIOA 3VFFA 1ES3A 3G32A 3WRTA 2H10A 3FZCA 1ZG4A 1BLCA 3IHBA 3IXGA 2QMIA 3M2JA 4P87A 5EVIC 5A93A 4OKPA 4D2OA 4X56A 1NRFA 3MKEA 1PWCA 4JXVA 2XD1A 3IXDA 2XLNA 4U3TA 4DRTA 4WZ5C 2XQZA 2ZQDA 1JTDA 1GHMA 4Z9QA 1PZPA 1RCJA 4WEKA 2WKIA 4OOMA 1NY0A 3ZFZA 4LV2A 1KDSA 2FFFB 4ZBEA 1YT4A 3IWIA 1G68A 4PM9A 4PPRA 4EQIA 3UE0A 3UO9A 4WEJA 1PI4A 2HDUA 4ZJ1A 3ZDJA 5BOHA 2Y2NA 4B4XA 5CRFA 5FQ9A 3Q07A 2OV5A 5I94A 5CGSA 3SOIA 5KSHA 3C4PA 2ZQCA 3C7UA 4EBPA 1K38A 2Y2QA 4B88A 4RYEA 4CPKA 3ITAA 2HPBA 3G2ZA 1FSWA 2WGWB 3MBZA 4WELA 5FA7A 4F94A 1XXMA 1FCNA 1ZG6A 2J9PA 4PMAA 2J9OA 5KSCA 4HESA 3GTCA 2PU2A 2EX8A 3S4XA 4N1HA 4E3NA 1NJ4A 4IBXA 5U47A 1KE3A 1YLWA 4OOYA 1JWPA 1BUEA 2Y91A 1L0EA 2ZQ9A 3BECA 4QD4A 4OP8A 3UDFA 1J9MA 1TVFA 1LL9A 2ZC4B 2WGVA 2Z2LB 3LO7A 3WS4A 4N9KA 3UDXA 1YLYA 3NDGA 1O07A 4P6BA 3C5AA 3ZGAB 4DKIA 4GN2A 4XUZA 1ZC2A 1FR6A 4IEDA 3MZFA 2IWBA 3N8LA 1YLPA 2ZC7A 5GLDA 5M1AA 4S2MA 2WADA 3IH8A 1YLZA 3IWOA 2OLVA 3M6HA 1Y54A 5GLCA 3S1YA 4EBNA 1IYSA 3G31A 4EV4A 2J7VA 1BLSA 5KMWA 4UA9A 1EROA 5FAOA 1JTGA 4JF4A 4BD1A 4UA7A 4M3KA 3UPNA 4ZAMA 4U0TA 4MBHA 3V5MA 1E25A 1IYPA 4R1GA 4KG6A 4C75A 2Y2KA 1ES2A 2WKHA 3GRJA 5M19A 2BG1A 1K25A 4KZAA 3SS4A 3SS5A 1LL5A 3G4PA 2P9VA 5EE8A 4P0MA 3IHAA 4BD0A 1KVMA 5J8XA 3N8SA 4RVAA 5DF8A 3BYDA 2JC7A 4L0LA 4P85A 4QHCA 1VM1A 5CHJA 2JBFA 2XFSA 3N7WA 5DTSA 5CERA 4OH0A 5F82A 1LHYA 3OCNA 3CMZA 4WZ4A 2UWXA 4DE0A 2RL3A 1ESUA 2Y2MA 3VP4A 2VGJA 2EXAA 1M6KA 4KQQA 1KE4A 1TDLA 2Y2GA 2GDNA 5EOEA 2ZC3B 4GDBA 4IVIA 4KQOA 4FCFA 3V39A 4BLMA 3LY3A 5TFQA 3W4QA 1MXOA 3HBRA 4JF6A 5FSRA 3VP0A 3DWKA 3A3EA 5GLBA 1KGEA 2R9WA 1C3BA 2ZQAA 3ZHHA 5FQJA 1NZOA 5EVID 1K6SA 5CXWA 3CG5A 3RJUA 2V1ZA 1KE0A 3SS3A 3W4PA 3IXBA 4MLLA 4UHUA 3BRMA 2OSUA 3O3VA 2H0YA 3HVFA 4OPZA 4RX2A 4S2OA 5A91A 3PBQA 3IF6A 1I5QA 4EUZA 4WM9A 3PBOA 4H8RA 1MWUA 4K0WA 3HL9A 3CJMA 4QB8A 2Y59A 2X01A 3SH9A 5GHYA 2Y2PA 4BQMA 5DVAA 3P09A 1KVLA 2JE5A 3Q7VB 4UA6A 3HLCA 1HVBA 1HD8A 1XGJA 2IWCA 3OPHA 5DF7A 3HLFA 4OVDA 1SHVA 5EVIA 1Q2PA 1VQQA 1MWSA 1XGIA 5CTNA 3NC8A 4ZTKA 3UN7A 2XEPA 1DJCA 3MXSA 4DF6A 4E3MA 1NYYA 3QNBA 2Z2MB 5CGXA 1I2SA 4B4ZA 4GD8A 4NK3A 3VOZA 4WZ5A 3WS0A 2P9VB 1CK3A 4KZ3A 1MKIA 4GNUA 3A3DA 4JLFA 4KG2A 2WAFA 1WE4A 4QY6A 1XP4A 2G2UA 2WKEA 5GL9A 4OLDA 1H5XA 4GDNA 2Y2HA 4S2PA 4OPYA 1ONHA 3WS2A 5F1FA 5AQ7A 1ERQA 3Q1FA 4JPMA 3O88A 1CEFA 2B5RA 1K56D 5TGFA 1H8YA 5AQ9A 3VP3A 2BLSA 3NY4A 4BJPA 1L0DA 3LY4A 4LV0A 3BLMA 3C7VA 3NI9A 5F83A 4DDYA 2ZD8A 1HTZA 1WYBA 4QY5A 1SKFA 2C5WB 1LI9A 3BFEA 3FKWA 2PBYA 1MWRA 2I72A 5AQAA 3GV9A 5GHZA 3GSGA 4PM8A 1BULA 5DF9A 2XD5A 4FH4A 1MWTA 4X6TA 3ZG0A 3SH7A 1K56A 3E2KA 4GZBA 3N6IA 1S6RA 1K57C 2ZMAA 3ZCZA 1SDNA 3HUMA 5CEDA 4XUXA 3I7JA 4R0QA 1ES4A 2WZZA 3BFGA 5G18A 3O86A 3VP2A 1XKZA 5DTTA 4DE1A 3GMWA 3ZNYA 1ALQA 2XR0A 2ZM0A 5FQQA 4FH2A 4KZBA 1KDWA 1L0FA 3O87A 3ZG5A 5TR7A 5EUAA 3MZEA 1E3UD 1GCEA 4YFMA 1K54A 4FD8A 3IQAA 1IEMA 1IYQA 4Y0OA 1JVJA 4DE3A 1K55C 5CECA 2A49A 1DJAA 2EFUA 2WZXA 2FFYA 3HUOA 4S2KA 2HP6A 2WGIA 4OONA 2X02A 4BL2A 1ERMA 3VSKA 1BLPA 2G2WA 5HFOA 4S2JA 4KENB 1OMEA 1XA7A 3HLWA 3HLDA 3PBSA 1JWZA 3G35A 2HDRA 4LV3A 3S22A 3GVBA 4OQ0A 1BTLA 1ZKJA 3UNWA 4KZ7A 3AGEA 5HL1A 5FDHA 4ZJ3A 3P98A 4S2NC 4ID4A 3IH9A 3WRZA 5FAPA 4WBGA 3D4FA 1O7EA 1PZOA 2ZC6B 1H8ZA 5L2FA 4GB7A 4R4RA 4YINA 4GKUA 5EPHA 4RA7A 2ZC5B 2ZQ7A 1S0WA 3BFFA 3FKVA 4KZ9A 1Z6FA 5JYOA 1TEMA 3TOIA 1FSYA 2XGNA 2A3UA 3NDEA 3EQUA 1RGZA 4OQIA 4MBKA 5FASA 3NIAA 4XXRA 3UDIA 2EX9A 1FOFA 2CC1A 1RP5A 3GR2A 3WS5A 1ES5A 1XX2A 2WGWA 2WYXA 3VP1A 3IWQA 1BLHA 4DXBA 2C6WB 3MZDA 1ONGA 4C3QA 5CEBA 2QZ6A 4X53A 1YQSA 4DXCA 5HAQA 1GHPA 3HLBA 1PW8A 3E2LA 3AGDA 1YMSA 3EQVA 3PBTA 5GHXA 3RXXA 5HAPA 2WUQA 3GQZA 1PWDA 2J8YA 1PI5A 4PM5A 1ESIA 1AXBA 1W8YA 3BEBA 1YMXA 1DJBA 2EX2A 3ZVWA 5CHUA 4E6XA 1GHIA 1NXYA 4X55A 5CHMA 3VOYA 4QJGA 5FI6A 1IKGA 4KZ8A 3OPRA 3OZHA 1CI9A 3BM6A 3G30A 4KZ4A 4FSFA 5EVLA 4IBRA 5HAIA 3UPOA 1PWGA 3N4IA 5GLAA 3NBLA 3BFDA 1K4EA 3ITBA 1HZOA 4LCLA 2HDSA 1KGGA 4Y0TA 3G2YA 2XDMA 3JYIA 1YLTA 1N4OA 4Q8IA 2Y55A 3ZVTA 1W8QA 1GA9A 3UE3A 3PBRA 2E8IA 3A3FA 3ZG7B 3A3JA 2HP9A 4E3LA 4JF5A 1KGFA 3HUNA 3IT9A 1CI8A 1IKIA 2JCHA 3W4OA 4KQRA 4WMCD 1IELA 2V20A 3BFCA 1TDGA 3QNCA 2XH9A 2Y2OA 5E43A 4E6WA 2H5SA 3B3XA 4R3JA 1CEGA 1FCMA 3PAEA 2DCFA 5M18A 1K6RA 5IHVA 3M6BA 5FI7A 2OLUA 3LCEA 1QMEA 3ISGA 1E4DA 1QMFA 4JXSA 4OLGA 3VMAA 4CJNA 1FR1A 1W79A 2ZM8A 3FV7A 4JXWA 4E3JA 1YLJA 5FQIA 4E3KA 4OOLA 5E2HA 3VSLA 1MBLA 3OPPA 1GA0A 1NYMA 4WMCA 1BZAA 1WYCA 4LCMA 5E2GA 3WWXA 1PW1A 5JYPA 2DNSA 4X69A 3RXWA 1XA1A 4IVKA 4R23A 3IF6B 4MEZA 1K57A 1G6AA 1BSGA 2XF3A 4E3OA 4A5RA 4N9LA 3OC2A 4E3IA 3Q81A 5FI2A 3LEZA 1DY6A 4HBTA 2Q9MA 3UE1A 4S2LA 5EVIB 2R9XA 1I2WA 5FAQA 4KZ6A 1NZUA 4BENA 3FYZA 1EWZA 4LENA 4S2IA 4C6YA 1PYYA 2WK0A 2Y4AA 3BLSA 2Q9NA 5KZHA 2Y2JA 1LI0A 4JXGA 4LV1A 4MBFA 4UAAA 5CGWA 5FQMA 3QHYA 4QU3A 1M40A 1EI5A 4O7DA 1JWVA 1K4FA 2EXBA 5FATA 4OPRA 2VGKA 4R3BA 3PTEA 1MY8A 2EFXA 4DDSA 3VFHA 4MNRA 2WAEA 5E2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0G A;  3C4O A;  5F1G A;  1K54 C;  1K55 A;  3MFD A;  1L2S A;  3AGF A;  4DE2 A;  4JKT A;  4ZJ2 A;  1FCO A;  4JBF A;  2ZQ8 A;  3Q7V A;  4OQH A;  5E2F A;  4PM7 A;  1E3U A;  2P74 A;  5D3O A;  2PU4 A;  3FWL A;  2Y2L A;  4EWF A;  4GOG A;  5HAR A;  4BL3 A;  4Y7P A;  3ZNT A;  4HBU A;  1Q2Q A;  3DWZ A;  1MPL A;  3N8R A;  3ZG9 B;  2X71 A;  4NET A;  2IWD A;  1RGY A;  3W8K A;  1SDE A;  3IXH A;  5AQB A;  5FQK A;  1U60 A;  4S2N A;  3DW0 A;  3CZD A;  3PAG A;  3Q7Z A;  4PM6 A;  5EOO A;  2DRW A;  3V3S A;  3Q82 A;  4R4S A;  1LLB A;  4KZ5 A;  2XFT A;  2HDQ A;  3MXR A;  1W5D A;  2XK1 A;  2ZLY A;  4N92 A;  5HW3 A;  4Y0U A;  3ZG8 B;  3NCK A;  4U0X A;  1SCW A;  1XPB A;  3A3I A;  3UY6 A;  2EX6 A;  2ZJ9 A;  3V50 A;  4N1X A;  5A90 A;  2RCX A;  3M2K A;  5DTK A;  1IYO A;  4X68 A;  2H0T A;  4K91 A;  4HEF A;  4OP5 A;  4GD6 A;  4EBL A;  1BT5 A;  3TSG A;  4KG5 A;  5A92 A;  2HP5 A;  3UPP A;  4OPQ A;  3TG9 A;  1FQG A;  3HRE A;  2ZM2 A;  3DTM A;  2Y2I A;  4RX3 A;  5CTM A;  4K0X A;  4WYY A;  5EEC A;  5HX9 A;  1YM1 A;  3MKF A;  3SH8 A;  3IF6 C;  4ZDX A;  1N9B A;  2QPN A;  3HLE A;  3HLG A;  3OCL A;  3OPL A;  3G34 A;  1W7F A;  4OQG A;  3WS1 A;  2V2F F;  3IF5 A;  3V3R A;  3PBN A;  1PIO A;  3VFF A;  1ES3 A;  3G32 A;  3WRT A;  2H10 A;  3FZC A;  1ZG4 A;  1BLC A;  3IHB A;  3IXG A;  2QMI A;  3M2J A;  4P87 A;  5EVI C;  5A93 A;  4OKP A;  4D2O A;  4X56 A;  1NRF A;  3MKE A;  1PWC A;  4JXV A;  2XD1 A;  3IXD A;  2XLN A;  4U3T A;  4DRT A;  4WZ5 C;  2XQZ A;  2ZQD A;  1JTD A;  1GHM A;  4Z9Q A;  1PZP A;  1RCJ A;  4WEK A;  2WKI A;  4OOM A;  1NY0 A;  3ZFZ A;  4LV2 A;  1KDS A;  2FFF B;  4ZBE A;  1YT4 A;  3IWI A;  1G68 A;  4PM9 A;  4PPR A;  4EQI A;  3UE0 A;  3UO9 A;  4WEJ A;  1PI4 A;  2HDU A;  4ZJ1 A;  3ZDJ A;  5BOH A;  2Y2N A;  4B4X A;  5CRF A;  5FQ9 A;  3Q07 A;  2OV5 A;  5I94 A;  5CGS A;  3SOI A;  5KSH A;  3C4P A;  2ZQC A;  3C7U A;  4EBP A;  1K38 A;  2Y2Q A;  4B88 A;  4RYE A;  4CPK A;  3ITA A;  2HPB A;  3G2Z A;  1FSW A;  2WGW B;  3MBZ A;  4WEL A;  5FA7 A;  4F94 A;  1XXM A;  1FCN A;  1ZG6 A;  2J9P A;  4PMA A;  2J9O A;  5KSC A;  4HES A;  3GTC A;  2PU2 A;  2EX8 A;  3S4X A;  4N1H A;  4E3N A;  1NJ4 A;  4IBX A;  5U47 A;  1KE3 A;  1YLW A;  4OOY A;  1JWP A;  1BUE A;  2Y91 A;  1L0E A;  2ZQ9 A;  3BEC A;  4QD4 A;  4OP8 A;  3UDF A;  1J9M A;  1TVF A;  1LL9 A;  2ZC4 B;  2WGV A;  2Z2L B;  3LO7 A;  3WS4 A;  4N9K A;  3UDX A;  1YLY A;  3NDG A;  1O07 A;  4P6B A;  3C5A A;  3ZGA B;  4DKI A;  4GN2 A;  4XUZ A;  1ZC2 A;  1FR6 A;  4IED A;  3MZF A;  2IWB A;  3N8L A;  1YLP A;  2ZC7 A;  5GLD A;  5M1A A;  4S2M A;  2WAD A;  3IH8 A;  1YLZ A;  3IWO A;  2OLV A;  3M6H A;  1Y54 A;  5GLC A;  3S1Y A;  4EBN A;  1IYS A;  3G31 A;  4EV4 A;  2J7V A;  1BLS A;  5KMW A;  4UA9 A;  1ERO A;  5FAO A;  1JTG A;  4JF4 A;  4BD1 A;  4UA7 A;  4M3K A;  3UPN A;  4ZAM A;  4U0T A;  4MBH A;  3V5M A;  1E25 A;  1IYP A;  4R1G A;  4KG6 A;  4C75 A;  2Y2K A;  1ES2 A;  2WKH A;  3GRJ A;  5M19 A;  2BG1 A;  1K25 A;  4KZA A;  3SS4 A;  3SS5 A;  1LL5 A;  3G4P A;  2P9V A;  5EE8 A;  4P0M A;  3IHA A;  4BD0 A;  1KVM A;  5J8X A;  3N8S A;  4RVA A;  5DF8 A;  3BYD A;  2JC7 A;  4L0L A;  4P85 A;  4QHC A;  1VM1 A;  5CHJ A;  2JBF A;  2XFS A;  3N7W A;  5DTS A;  5CER A;  4OH0 A;  5F82 A;  1LHY A;  3OCN A;  3CMZ A;  4WZ4 A;  2UWX A;  4DE0 A;  2RL3 A;  1ESU A;  2Y2M A;  3VP4 A;  2VGJ A;  2EXA A;  1M6K A;  4KQQ A;  1KE4 A;  1TDL A;  2Y2G A;  2GDN A;  5EOE A;  2ZC3 B;  4GDB A;  4IVI A;  4KQO A;  4FCF A;  3V39 A;  4BLM A;  3LY3 A;  5TFQ A;  3W4Q A;  1MXO A;  3HBR A;  4JF6 A;  5FSR A;  3VP0 A;  3DWK A;  3A3E A;  5GLB A;  1KGE A;  2R9W A;  1C3B A;  2ZQA A;  3ZHH A;  5FQJ A;  1NZO A;  5EVI D;  1K6S A;  5CXW A;  3CG5 A;  3RJU A;  2V1Z A;  1KE0 A;  3SS3 A;  3W4P A;  3IXB A;  4MLL A;  4UHU A;  3BRM A;  2OSU A;  3O3V A;  2H0Y A;  3HVF A;  4OPZ A;  4RX2 A;  4S2O A;  5A91 A;  3PBQ A;  3IF6 A;  1I5Q A;  4EUZ A;  4WM9 A;  3PBO A;  4H8R A;  1MWU A;  4K0W A;  3HL9 A;  3CJM A;  4QB8 A;  2Y59 A;  2X01 A;  3SH9 A;  5GHY A;  2Y2P A;  4BQM A;  5DVA A;  3P09 A;  1KVL A;  2JE5 A;  3Q7V B;  4UA6 A;  3HLC A;  1HVB A;  1HD8 A;  1XGJ A;  2IWC A;  3OPH A;  5DF7 A;  3HLF A;  4OVD A;  1SHV A;  5EVI A;  1Q2P A;  1VQQ A;  1MWS A;  1XGI A;  5CTN A;  3NC8 A;  4ZTK A;  3UN7 A;  2XEP A;  1DJC A;  3MXS A;  4DF6 A;  4E3M A;  1NYY A;  3QNB A;  2Z2M B;  5CGX A;  1I2S A;  4B4Z A;  4GD8 A;  4NK3 A;  3VOZ A;  4WZ5 A;  3WS0 A;  2P9V B;  1CK3 A;  4KZ3 A;  1MKI A;  4GNU A;  3A3D A;  4JLF A;  4KG2 A;  2WAF A;  1WE4 A;  4QY6 A;  1XP4 A;  2G2U A;  2WKE A;  5GL9 A;  4OLD A;  1H5X A;  4GDN A;  2Y2H A;  4S2P A;  4OPY A;  1ONH A;  3WS2 A;  5F1F A;  5AQ7 A;  1ERQ A;  3Q1F A;  4JPM A;  3O88 A;  1CEF A;  2B5R A;  1K56 D;  5TGF A;  1H8Y A;  5AQ9 A;  3VP3 A;  2BLS A;  3NY4 A;  4BJP A;  1L0D A;  3LY4 A;  4LV0 A;  3BLM A;  3C7V A;  3NI9 A;  5F83 A;  4DDY A;  2ZD8 A;  1HTZ A;  1WYB A;  4QY5 A;  1SKF A;  2C5W B;  1LI9 A;  3BFE A;  3FKW A;  2PBY A;  1MWR A;  2I72 A;  5AQA A;  3GV9 A;  5GHZ A;  3GSG A;  4PM8 A;  1BUL A;  5DF9 A;  2XD5 A;  4FH4 A;  1MWT A;  4X6T A;  3ZG0 A;  3SH7 A;  1K56 A;  3E2K A;  4GZB A;  3N6I A;  1S6R A;  1K57 C;  2ZMA A;  3ZCZ A;  1SDN A;  3HUM A;  5CED A;  4XUX A;  3I7J A;  4R0Q A;  1ES4 A;  2WZZ A;  3BFG A;  5G18 A;  3O86 A;  3VP2 A;  1XKZ A;  5DTT A;  4DE1 A;  3GMW A;  3ZNY A;  1ALQ A;  2XR0 A;  2ZM0 A;  5FQQ A;  4FH2 A;  4KZB A;  1KDW A;  1L0F A;  3O87 A;  3ZG5 A;  5TR7 A;  5EUA A;  3MZE A;  1E3U D;  1GCE A;  4YFM A;  1K54 A;  4FD8 A;  3IQA A;  1IEM A;  1IYQ A;  4Y0O A;  1JVJ A;  4DE3 A;  1K55 C;  5CEC A;  2A49 A;  1DJA A;  2EFU A;  2WZX A;  2FFY A;  3HUO A;  4S2K A;  2HP6 A;  2WGI A;  4OON A;  2X02 A;  4BL2 A;  1ERM A;  3VSK A;  1BLP A;  2G2W A;  5HFO A;  4S2J A;  4KEN B;  1OME A;  1XA7 A;  3HLW A;  3HLD A;  3PBS A;  1JWZ A;  3G35 A;  2HDR A;  4LV3 A;  3S22 A;  3GVB A;  4OQ0 A;  1BTL A;  1ZKJ A;  3UNW A;  4KZ7 A;  3AGE A;  5HL1 A;  5FDH A;  4ZJ3 A;  3P98 A;  4S2N C;  4ID4 A;  3IH9 A;  3WRZ A;  5FAP A;  4WBG A;  3D4F A;  1O7E A;  1PZO A;  2ZC6 B;  1H8Z A;  5L2F A;  4GB7 A;  4R4R A;  4YIN A;  4GKU A;  5EPH A;  4RA7 A;  2ZC5 B;  2ZQ7 A;  1S0W A;  3BFF A;  3FKV A;  4KZ9 A;  1Z6F A;  5JYO A;  1TEM A;  3TOI A;  1FSY A;  2XGN A;  2A3U A;  3NDE A;  3EQU A;  1RGZ A;  4OQI A;  4MBK A;  5FAS A;  3NIA A;  4XXR A;  3UDI A;  2EX9 A;  1FOF A;  2CC1 A;  1RP5 A;  3GR2 A;  3WS5 A;  1ES5 A;  1XX2 A;  2WGW A;  2WYX A;  3VP1 A;  3IWQ A;  1BLH A;  4DXB A;  2C6W B;  3MZD A;  1ONG A;  4C3Q A;  5CEB A;  2QZ6 A;  4X53 A;  1YQS A;  4DXC A;  5HAQ A;  1GHP A;  3HLB A;  1PW8 A;  3E2L A;  3AGD A;  1YMS A;  3EQV A;  3PBT A;  5GHX A;  3RXX A;  5HAP A;  2WUQ A;  3GQZ A;  1PWD A;  2J8Y A;  1PI5 A;  4PM5 A;  1ESI A;  1AXB A;  1W8Y A;  3BEB A;  1YMX A;  1DJB A;  2EX2 A;  3ZVW A;  5CHU A;  4E6X A;  1GHI A;  1NXY A;  4X55 A;  5CHM A;  3VOY A;  4QJG A;  5FI6 A;  1IKG A;  4KZ8 A;  3OPR A;  3OZH A;  1CI9 A;  3BM6 A;  3G30 A;  4KZ4 A;  4FSF A;  5EVL A;  4IBR A;  5HAI A;  3UPO A;  1PWG A;  3N4I A;  5GLA A;  3NBL A;  3BFD A;  1K4E A;  3ITB A;  1HZO A;  4LCL A;  2HDS A;  1KGG A;  4Y0T A;  3G2Y A;  2XDM A;  3JYI A;  1YLT A;  1N4O A;  4Q8I A;  2Y55 A;  3ZVT A;  1W8Q A;  1GA9 A;  3UE3 A;  3PBR A;  2E8I A;  3A3F A;  3ZG7 B;  3A3J A;  2HP9 A;  4E3L A;  4JF5 A;  1KGF A;  3HUN A;  3IT9 A;  1CI8 A;  1IKI A;  2JCH A;  3W4O A;  4KQR A;  4WMC D;  1IEL A;  2V20 A;  3BFC A;  1TDG A;  3QNC A;  2XH9 A;  2Y2O A;  5E43 A;  4E6W A;  2H5S A;  3B3X A;  4R3J A;  1CEG A;  1FCM A;  3PAE A;  2DCF A;  5M18 A;  1K6R A;  5IHV A;  3M6B A;  5FI7 A;  2OLU A;  3LCE A;  1QME A;  3ISG A;  1E4D A;  1QMF A;  4JXS A;  4OLG A;  3VMA A;  4CJN A;  1FR1 A;  1W79 A;  2ZM8 A;  3FV7 A;  4JXW A;  4E3J A;  1YLJ A;  5FQI A;  4E3K A;  4OOL A;  5E2H A;  3VSL A;  1MBL A;  3OPP A;  1GA0 A;  1NYM A;  4WMC A;  1BZA A;  1WYC A;  4LCM A;  5E2G A;  3WWX A;  1PW1 A;  5JYP A;  2DNS A;  4X69 A;  3RXW A;  1XA1 A;  4IVK A;  4R23 A;  3IF6 B;  4MEZ A;  1K57 A;  1G6A A;  1BSG A;  2XF3 A;  4E3O A;  4A5R A;  4N9L A;  3OC2 A;  4E3I A;  3Q81 A;  5FI2 A;  3LEZ A;  1DY6 A;  4HBT A;  2Q9M A;  3UE1 A;  4S2L A;  5EVI B;  2R9X A;  1I2W A;  5FAQ A;  4KZ6 A;  1NZU A;  4BEN A;  3FYZ A;  1EWZ A;  4LEN A;  4S2I A;  4C6Y A;  1PYY A;  2WK0 A;  2Y4A A;  3BLS A;  2Q9N A;  5KZH A;  2Y2J A;  1LI0 A;  4JXG A;  4LV1 A;  4MBF A;  4UAA A;  5CGW A;  5FQM A;  3QHY A;  4QU3 A;  1M40 A;  1EI5 A;  4O7D A;  1JWV A;  1K4F A;  2EXB A;  5FAT A;  4OPR A;  2VGK A;  4R3B A;  3PTE A;  1MY8 A;  2EFX A;  4DDS A;  3VFH A;  4MNR A;  2WAE A;  5E2E A; 
#chains in the Genus database with same CATH topology
 1L0G A;  3C4O A;  5F1G A;  1L2S A;  4DE2 A;  4ZJ2 A;  4JBF A;  3KSI A;  2D01 A;  2LB9 A;  2K2N A;  4F3L B;  3T4S A;  3IXH A;  1U60 A;  4WN5 A;  1IOU A;  2UV0 E;  2HDQ A;  2XK1 A;  2XSS A;  5HW3 A;  4KUK A;  2W1T B;  4U0X A;  3A3I A;  3H82 A;  4N1X A;  2ZBB A;  4HEF A;  4NXE A;  2A2L A;  4EBL A;  2GJ3 A;  3TSG A;  1OPX A;  2V8C A;  2OWH A;  4G3W A;  4HJ3 A;  4MCW A;  4RX3 A;  2Y2I A;  4K0X A;  3SH8 A;  5IT5 A;  5HD5 A;  2EA9 A;  3EWK A;  4UQI S;  1PIO A;  3F1P B;  3WRT A;  2H10 A;  1ZG4 A;  1BLC A;  4D2O A;  1D1J A;  4X1L A;  1F98 A;  1JTD A;  3BW6 A;  3S7O A;  4XT2 B;  4OOM A;  1KDS A;  4PM9 A;  4EQI A;  1ZHH B;  5CRF A;  2L4R A;  5CGS A;  4CLC A;  2ZQC A;  2HPB A;  4F94 A;  1FCN A;  4BBV A;  2J9O A;  3MXQ A;  5J7E A;  4E3N A;  4KQD A;  3ZYT A;  1YLW A;  2PRF A;  2ZQ9 A;  1L0E A;  3BEC A;  1J9M A;  1TVF A;  3WS4 A;  2VV8 A;  1T18 A;  3B33 A;  3UB7 A;  3ZGA B;  4XUZ A;  1ZC2 A;  2L1M A;  1VEU B;  2IWB A;  4WLA A;  1L3L A;  3KYZ A;  4E04 A;  1YLZ A;  3M6H A;  2D02 A;  4EW7 A;  3G31 A;  4EV4 A;  5KMW A;  4UA7 A;  3UPN A;  3V5M A;  1E25 A;  1XFQ A;  3W2Z A;  4DMZ A;  1NLZ A;  2WKH A;  1ACF A;  2BG1 A;  2JN7 A;  4EEU A;  2B18 A;  3CHW P;  2P9V A;  3T4O A;  2V8F A;  4P0M A;  4BD0 A;  1KVM A;  1XJ2 A;  5DF8 A;  5DTS A;  3CMZ A;  3LUQ A;  3PYP A;  3CUE C;  1ESU A;  2Y2M A;  4BBT A;  1M6K A;  4HI4 A;  2GDN A;  3QP6 A;  4GDB A;  4KQO A;  4BLM A;  5TFQ A;  3RFB A;  1C3B A;  5FQJ A;  4HH3 A;  1NZO A;  5EVI D;  3CG5 A;  3RJU A;  3LI8 A;  4MLL A;  2OSU A;  4S2O A;  3H7W B;  3PBQ A;  4WM9 A;  1VHM A;  5DVA A;  4UA6 A;  2JE5 A;  3F1N A;  4OVD A;  1SHV A;  2I9V A;  1XGI A;  1MWS A;  3NC8 A;  1G28 A;  3BJN A;  2Z2M B;  3NOT C;  4GNU A;  4JLF A;  2G2U A;  4JGP A;  4OPY A;  3QP4 A;  5F1F A;  1J3W A;  3VE4 A;  5AQ9 A;  3T12 B;  1OTD A;  3H82 B;  2J3T D;  2VGL M;  3BLM A;  3NI9 A;  2ZD8 A;  5A8B A;  2C5W B;  1T1C A;  3R7W A;  1MWR A;  3GV9 A;  4HIA A;  3FPW A;  3UB9 A;  3ZG0 A;  2VX8 A;  5F68 A;  1DRM A;  1SDN A;  5CED A;  3QP2 A;  1ES4 A;  3A0V A;  4R38 A;  1LT0 A;  5EFW A;  3HCY A;  3O86 A;  3D3O A;  5DTT A;  2XR0 A;  2DMW A;  5FQQ A;  4FH2 A;  4KZB A;  4GJ4 A;  5TR7 A;  5EUA A;  4WUJ A;  3RH8 B;  4DJ3 A;  5HWW A;  3CPT A;  1IYQ A;  1K55 C;  1DJA A;  2FFY A;  2WGI A;  4CLC B;  3VSK A;  1UWP X;  5HFO A;  1HLU P;  4KEN B;  3K3C A;  4BWI A;  1JWZ A;  3S22 A;  4LV3 A;  3GVB A;  4OQ0 A;  4B9O A;  1ZKJ A;  5HL1 A;  3E4Q A;  3P98 A;  4S2N C;  3VOL A;  1PZO A;  4FOF A;  5L2F A;  3CUE A;  3C8C A;  5MC7 A;  4KZ9 A;  2AVX A;  5TBM B;  3A0S A;  3EQU A;  1RGZ A;  3JPU A;  5FAS A;  2EX9 A;  3GR2 A;  1AWI A;  2C6W B;  4CLC E;  3MZD A;  5CEB A;  2QZ6 A;  4X53 A;  3PBT A;  3AGD A;  3RXX A;  2WUQ A;  1PWD A;  2J8Y A;  4PM5 A;  1TS7 A;  1W8Y A;  3FC7 A;  1DJB A;  2EX2 A;  4E6X A;  2XRN A;  5CHM A;  5FI6 A;  4KZ8 A;  3BM6 A;  5HAI A;  3UPO A;  3F1O A;  3CIT A;  4LCL A;  2HDS A;  2V9A A;  4NXG A;  3G2Y A;  2M7U A;  4GHI A;  2E8I A;  3T1S A;  4L9F A;  2JKR M;  1CI8 A;  3LI9 A;  4KQR A;  3QNC A;  2OWJ A;  4E6W A;  2Y2O A;  1CEG A;  3PAE A;  5M18 A;  4EET B;  3M6B A;  2HF6 A;  1E4D A;  1QMF A;  1STZ A;  3LYX A;  1W79 A;  4E3K A;  4Q0I A;  5E2H A;  1T1A A;  1IFQ A;  1NYM A;  4IHQ A;  1WYC A;  2V1A A;  4HHD A;  5JYP A;  4X69 A;  1XA1 A;  5HDD A;  4MEZ A;  1G6A A;  4E3O A;  4A5R A;  4N9L A;  4Y2F A;  3LEZ A;  1DY6 A;  4JGQ A;  4MN6 A;  3F1N B;  3JVU A;  4KZ6 A;  2JHE A;  3FYZ A;  2WKQ A;  2Y4A A;  5KZH A;  1LI0 A;  4UAA A;  3T4J A;  4O7D A;  2Y8H A;  1JWV A;  4YOF A;  3PTE A;  3F1P A;  5FEF A;  4LRX C;  1K54 C;  1K55 A;  5EM0 A;  3BWL A;  4OQH A;  4PM7 A;  2P74 A;  5D3O A;  3FWL A;  3PR6 A;  4XT2 A;  3PXP A;  2X71 A;  4NET A;  1RGY A;  1SDE A;  5AQB A;  4S2N A;  5EOO A;  3CZD A;  3Q7Z A;  3V3S A;  1LLB A;  3DTI A;  3MXR A;  1W5D A;  2V0W A;  3UE6 A;  3IX3 A;  1G6O A;  1H0M A;  3ZG8 B;  1SCW A;  3UY6 A;  3V50 A;  3KSF A;  3KO6 A;  4Q0J A;  5A90 A;  1EW0 A;  3M2K A;  1IYO A;  5A92 A;  5TJJ A;  4OPQ A;  1FQG A;  5HD3 A;  3D9Y A;  3CPT B;  3OPL A;  2VV7 A;  1W7F A;  4OQG A;  3V3R A;  3PBN A;  1OT9 A;  3VFF A;  3LIC A;  3M2J A;  4OKP A;  4CLC D;  3MKE A;  4B93 A;  4GLQ A;  4JXV A;  3IXD A;  4DRT A;  2XQZ A;  1PZP A;  5F69 A;  4BBU A;  1PRQ A;  1NY0 A;  3ZFZ A;  4LV2 A;  2FFF B;  1YT4 A;  3IWI A;  1G68 A;  4PPR A;  3UE0 A;  2HGV A;  4WEJ A;  1PI4 A;  3GEC A;  3Q07 A;  1GSX A;  5I5L A;  4Y13 A;  4EBP A;  2M7V A;  4FTX A;  1T19 A;  2KDK A;  3ITA A;  3ULF A;  5L07 A;  1ZG6 A;  2J9P A;  3RTY A;  4WF0 A;  3UB6 A;  3S4X A;  4IBX A;  4OOY A;  1JWP A;  1G5U A;  1LSW A;  4PKY G;  3LO7 A;  4N9K A;  3D72 A;  4R6L A;  3IS2 A;  1O07 A;  4EUV A;  4P6B A;  4YWZ A;  2JKR I;  1FR6 A;  3MZF A;  3F1O B;  1FIL A;  2HV1 A;  3N8L A;  4IUK A;  2ZC7 A;  5GLD A;  1NLY A;  4S2M A;  5HSQ A;  3IH8 A;  3IWO A;  1Y54 A;  4GHI B;  4I3I A;  3S1Y A;  4MN7 A;  4EBN A;  2W3D A;  2J7V A;  1BLS A;  5AVE A;  5FAO A;  4JF4 A;  2K31 A;  5EVE A;  1IYP A;  4C75 A;  2GZA A;  2FZ0 A;  3SS5 A;  1LL5 A;  5EE8 A;  3BQA A;  3CLO A;  4EU0 A;  3N8S A;  4RVA A;  5HDS A;  2NUT C;  2JC7 A;  4L0L A;  4QHC A;  1DP6 A;  2VEA A;  5CER A;  5F82 A;  2PR6 A;  1S66 L;  1OTI A;  2RL3 A;  3MR0 A;  1PNE A;  1V9Y A;  2XA7 S;  3T1R A;  2H28 A;  4IVI A;  3V39 A;  3LY3 A;  4JF6 A;  5FSR A;  3DWK A;  5GLB A;  2QYB A;  1KGE A;  3ZHH A;  2V1Z A;  3SS3 A;  3IXB A;  4HNB A;  3ICY A;  4UHU A;  3O3V A;  4OPZ A;  2H0Y A;  4RX2 A;  2ZMV A;  5A91 A;  1I5Q A;  1VB6 A;  4H8R A;  4K0W A;  4EES A;  1CJF A;  4QB8 A;  2X01 A;  5GHY A;  2Y2P A;  1LSV A;  4ZJ1 A;  3HLC A;  1HVB A;  1XGJ A;  3T50 A;  4ZTK A;  1Q2P A;  3UN7 A;  2XEP A;  1DJC A;  3MXS A;  1JNU A;  3P7N A;  4GD8 A;  4NK3 A;  3DAV A;  4WL9 A;  1XP4 A;  1YPR A;  2IA2 A;  2Y2H A;  4S2P A;  5AQ7 A;  3Q1F A;  4JPM A;  3O88 A;  1CEF A;  2B5R A;  4O8G A;  5TGF A;  5DKL A;  1L0D A;  3LY4 A;  3C7V A;  1WYB A;  4ESP A;  3FKW A;  1N9L A;  3U2A A;  5GHZ A;  4PM8 A;  5TBM A;  1BUL A;  4FH4 A;  4DN0 A;  1MWT A;  1UWN X;  4X6T A;  3SH7 A;  1K56 A;  5HWV A;  4HJ6 A;  2XRO A;  1S6R A;  1K57 C;  2ZMA A;  5IU1 A;  3ZCZ A;  4JGR A;  4XUX A;  4R0Q A;  2VZW A;  3BFG A;  5G18 A;  2MJ6 A;  3VP2 A;  2WKP A;  3GMW A;  3ZNY A;  2EWW A;  2A24 A;  4LRZ E;  1KDW A;  4P6Z M;  1E3U D;  1GCE A;  3LIA A;  4MDZ A;  1JVJ A;  1H3Q A;  4QWO A;  3MSH A;  2EFU A;  2JKG A;  2HP6 A;  2OOL A;  4OON A;  4BL2 A;  1BLP A;  1XA7 A;  1S67 L;  2J3W A;  4ZJ3 A;  2V1B A;  4Y5F A;  3WRZ A;  3D4F A;  2ZC6 B;  5G4Y A;  4GB7 A;  1S1Y A;  2ZC5 B;  2ZQ7 A;  2O0Y A;  3BFF A;  2A3U A;  2CMN A;  3IS2 B;  2PDR A;  1RP5 A;  3WS5 A;  2K7S A;  1XX2 A;  2WGW A;  3V67 A;  4DXB A;  3LIE A;  1YQS A;  4DXC A;  5HAQ A;  1GHP A;  3EQV A;  1YMS A;  3LGO A;  1OT6 A;  3GQZ A;  4EQ1 A;  1YMX A;  3ZVW A;  4X55 A;  1IKG A;  3OPR A;  4FSF A;  2QJ5 A;  1PWG A;  3NBL A;  3BFD A;  1K4E A;  2P08 A;  1XJ3 A;  3SW1 A;  4Y0T A;  1SZV A;  1OTA A;  2XDM A;  3JYI A;  3T4Q A;  1NRJ A;  3A3F A;  3A3J A;  2HP9 A;  4E3L A;  3IX8 A;  1KGF A;  1IKI A;  5HDC A;  2XH9 A;  5E43 A;  4R3J A;  1FCM A;  2DCF A;  4R70 A;  1K6R A;  1VET A;  1NWZ A;  1DP8 A;  5FI7 A;  2OLU A;  4GCZ A;  3ISG A;  4JXS A;  4JXW A;  3FV7 A;  4E3J A;  3LR0 A;  3LIB A;  3K3D A;  4LCM A;  3WWX A;  2DNS A;  1DP9 A;  3NEC A;  4IVK A;  1K57 A;  1XJ4 A;  1BSG A;  3QP8 A;  2O9B A;  5J4E A;  3Q81 A;  2YKH A;  2R9X A;  2PD7 A;  1FIK A;  2WK0 A;  2Y2J A;  2HZ5 A;  5CGW A;  5FQM A;  1YKD A;  1M40 A;  3NOU C;  1K4F A;  2EXB A;  5FAT A;  4OPR A;  2VA0 A;  1T1B A;  2O9C A;  2EFX A;  2YKF A;  5EM1 A;  4JKT A;  2ZQ8 A;  3BQ8 A;  5E2F A;  1E3U A;  2W3H A;  4Y7P A;  3ZNT A;  3C2W A;  3S7Q A;  3ZG9 B;  2IWD A;  4ETZ A;  2VGL S;  3W8K A;  5FQK A;  3DW0 A;  4PM6 A;  2DRW A;  3Q82 A;  3DBA A;  2ZLY A;  4Y0U A;  3NCK A;  4HH2 A;  4I39 A;  4Y15 A;  2W27 A;  4Y17 A;  1SKO B;  3K2N A;  1BT5 A;  4KG5 A;  1YSP A;  2A24 B;  3UPP A;  1D7E A;  3TG9 A;  3HRE A;  3DTM A;  5HX9 A;  1YM1 A;  3MKF A;  4ZDX A;  3IF6 C;  3B47 A;  1N9B A;  3OCL A;  2V2F F;  3LIF A;  3GDI A;  1ES3 A;  3IHB A;  3IXG A;  4P87 A;  2KOI A;  5A93 A;  3UME A;  3BY8 A;  4LFU A;  2L0W A;  4GS9 A;  2ZQD A;  2OAP 1;  4Z9Q A;  4WEK A;  5EV0 A;  1GSW A;  2BTF P;  2BAS A;  3ZDJ A;  3T1Q B;  2Y2N A;  4B4X A;  2O99 A;  2OV5 A;  5KSH A;  3LR4 A;  2Y2Q A;  4CPK A;  5L8M A;  1FSW A;  2WGW B;  3MBZ A;  3KSH A;  1K0K A;  4PMA A;  5KSC A;  4HES A;  3GTC A;  2W3F A;  2EX8 A;  2HJE A;  4N1H A;  1NJ4 A;  1H8M A;  1KE3 A;  1OJ5 A;  1W63 M;  2Y91 A;  4OP8 A;  1LL9 A;  3NJA A;  3UDX A;  1YLY A;  4O01 A;  3C5A A;  1MC0 A;  3JVV A;  4GN2 A;  2PD8 A;  2VKS A;  4IED A;  2GX5 A;  2W3G A;  3DTK A;  2OLV A;  4IUH A;  4I38 A;  1ERO A;  1JTG A;  4BD1 A;  4ZAM A;  4U0T A;  4ARZ A;  1OJG A;  4R1G A;  2Y2K A;  1OTE A;  1ES2 A;  3QP1 A;  1KOU A;  1K25 A;  4KZA A;  3SS4 A;  5FL3 A;  1VET B;  3G4P A;  5HZH A;  5J8X A;  3BYD A;  2XFS A;  3HJK A;  2PHY A;  2INW A;  1LHY A;  3BY9 A;  3E4P A;  3MF0 A;  4DE0 A;  2VGJ A;  4DJ2 A;  2P7J A;  4KQQ A;  4I3A A;  5EOE A;  1F2K A;  2ZC3 B;  4FCF A;  4NEE D;  1MXO A;  3VP0 A;  4EEP A;  2R9W A;  2EWV A;  2ZQA A;  1K6S A;  5CXW A;  2R78 A;  2WKR A;  3W4P A;  2P04 A;  3HVF A;  4MN5 A;  3IF6 A;  1MWU A;  4GW9 A;  3HL9 A;  3SH9 A;  1CQA A;  1ZTU A;  1TS6 A;  1LL8 A;  5G4Z A;  4D60 A;  3OPH A;  3OBF A;  5DF7 A;  4DF6 A;  5CGX A;  4B4Z A;  3VOZ A;  3WS0 A;  4KZ3 A;  3EGX C;  1MKI A;  3A3D A;  3E0Y A;  2ZL1 A;  5GL9 A;  1H5X A;  4FUW A;  5HPF A;  1ONH A;  1ERQ A;  1K56 D;  1H8Y A;  3T1X A;  3VP3 A;  2BLS A;  1Z09 A;  2HJ9 C;  3NY4 A;  1S4S A;  4DDY A;  1HTZ A;  4X1M A;  4ETX A;  1SKF A;  1LI9 A;  5AQA A;  3U4L P;  3GSG A;  2XD5 A;  4GZB A;  1XFN A;  2QHK A;  2WZZ A;  4JGO A;  2PBD P;  1ALQ A;  2ZM0 A;  4GS9 B;  3ZG5 A;  2VLG A;  5DJT A;  4YFM A;  1K54 A;  3IQA A;  4UQI M;  1IEM A;  5CEC A;  1ERM A;  3FPV A;  2QWS A;  3HLW A;  3HLD A;  3PBS A;  3G35 A;  2HDR A;  3MS6 A;  3KYQ A;  4KZ7 A;  3AGE A;  3T4K A;  5FDH A;  2ZMF A;  5FAP A;  4WBG A;  1O7E A;  2GNX A;  4GKU A;  5EPH A;  3FKV A;  3TOI A;  2XGN A;  3NOP C;  1YAX A;  4OQI A;  4MBK A;  4L9E A;  4R3A A;  3NIA A;  2Z6C A;  2WYX A;  3VP1 A;  1TS0 A;  3IWQ A;  1BLH A;  4PKY A;  4HY8 A;  4C3Q A;  1ONG A;  3E2L A;  3L7H A;  5GHX A;  1N9N A;  2QKP A;  5HAP A;  3MQ0 A;  1PI5 A;  1ESI A;  1AXB A;  3BEB A;  3LR3 A;  1NXY A;  4NG2 A;  3VOY A;  4EER A;  4ARZ B;  4RQ9 A;  3OZH A;  2QJ7 A;  2Y79 A;  4KZ4 A;  3E4O A;  5EVL A;  3ITB A;  1P97 A;  1YLT A;  1N4O A;  4Q8I A;  2Y55 A;  1W8Q A;  1GA9 A;  3UE3 A;  2OAQ 1;  2W0N A;  3MQQ A;  5HPI A;  4JF5 A;  1WA9 A;  4LGW A;  2JCH A;  2V20 A;  1TDG A;  2H5S A;  1X0O A;  2G7U A;  2ACG A;  3A0R A;  3VMA A;  4CJN A;  2Z6D A;  1FR1 A;  3UB5 P;  2ZM8 A;  3EGD C;  5CX7 A;  1MBL A;  3OPP A;  2PT7 A;  4WMC A;  3RXW A;  3IF6 B;  1SKO A;  3VV4 A;  4I3J A;  2ZOI A;  4HBT A;  2Q9M A;  3UE1 A;  3TW8 A;  4H6J A;  1I2W A;  5FAQ A;  4BEN A;  4LEN A;  1PYY A;  3BLS A;  4LV1 A;  3QHY A;  1EI5 A;  3UB8 A;  3QP5 A;  2VGK A;  2ZL1 B;  3O5Y A;  3VFH A;  5AVF A;  5E2E A;  3MFD A;  3AGF A;  1ODV A;  1FCO A;  3Q7V A;  3LID A;  4CQH A;  2PU4 A;  2Y2L A;  4EWF A;  4GOG A;  5HAR A;  4BL3 A;  4HBU A;  1Q2Q A;  3DWZ A;  1MPL A;  3N8R A;  3NHQ A;  1PFL A;  3PAG A;  4R4S A;  4KZ5 A;  2XFT A;  4NXF A;  5IS1 A;  4N92 A;  1XPB A;  3H9W A;  2EX6 A;  2ZJ9 A;  1D06 A;  2RCX A;  5DTK A;  4X68 A;  4LLO B;  2H0T A;  3C38 A;  3B42 A;  4K91 A;  4OP5 A;  4Q0H A;  4GD6 A;  3T4L A;  3TRC A;  2HP5 A;  3E98 A;  3SZT A;  1Y4O A;  2ZM2 A;  5CTM A;  4WYY A;  5EEC A;  2ZOH A;  4P6Z S;  2QPN A;  3HLE A;  3HLG A;  1A0K A;  1Y28 A;  3G34 A;  3WS1 A;  3IF5 A;  4G3K A;  4HQA A;  1TF1 A;  3G32 A;  3FZC A;  1N9O A;  2QMI A;  5EVI C;  3LFV A;  4BMW A;  4X56 A;  1NRF A;  2M1C A;  1PWC A;  2XD1 A;  2B02 A;  2XLN A;  4U3T A;  4NKP A;  4WZ5 C;  4O0P A;  1GHM A;  3KX0 X;  1RCJ A;  3C30 A;  2WKI A;  4K08 A;  3EEH A;  3NUL A;  2JKF A;  5DJU A;  4ZBE A;  3MMH A;  1P9R A;  3UO9 A;  1S1Z A;  2HDU A;  5BOH A;  5FQ9 A;  5I94 A;  3SOI A;  3C4P A;  2PYP A;  3C7U A;  3KSG A;  1K38 A;  4B88 A;  4RYE A;  3G2Z A;  5FA7 A;  4WEL A;  1XXM A;  5L09 A;  4NXB A;  1MKM A;  2PU2 A;  5U47 A;  1BUE A;  3VE3 A;  1F9I A;  4QD4 A;  3UDF A;  2ZC4 B;  3PHY A;  2WGV A;  2Z2L B;  1P9W A;  2KLI A;  3HJI A;  2Q0O A;  3NDG A;  2J3T C;  5KIZ A;  4DKI A;  4EXO A;  4AFI A;  3L9K A;  1YLP A;  5M1A A;  2WAD A;  3TE8 A;  5GLC A;  2VJW A;  1IYS A;  4UA9 A;  4M3K A;  4MBH A;  2VV6 A;  4KG6 A;  4M4X A;  4MMN A;  3GRJ A;  5M19 A;  5DFY A;  2E8J A;  3IHA A;  5FEG A;  4P85 A;  2W3E A;  1VM1 A;  3G6O A;  5CHJ A;  3TJZ C;  2JBF A;  3N7W A;  4OH0 A;  4Y3I A;  3OCN A;  4WZ4 A;  2UWX A;  1GSV A;  5FDS A;  5C5K A;  4UEY A;  3VP4 A;  2EXA A;  3LEQ A;  4G3V A;  1KE4 A;  1TDL A;  2VK3 A;  3S7N A;  2Y2G A;  4KUO A;  2PYR A;  3W4Q A;  3HBR A;  2W1R A;  3MJQ A;  3A3E A;  1TD5 A;  4H6J B;  4II7 A;  1KE0 A;  3BRM A;  4EUZ A;  1P0Z A;  1CF0 A;  4ME4 A;  1BYW A;  3PBO A;  3CJM A;  2Y59 A;  3CI6 A;  4BQM A;  5HWT A;  3P09 A;  1KVL A;  3Q7V B;  2IWC A;  1HD8 A;  4L9G A;  3HLF A;  5EVI A;  1VQQ A;  4E3M A;  5CTN A;  1NYY A;  3QNB A;  1I2S A;  4WZ5 A;  2P9V B;  1CK3 A;  2PAV P;  4KG2 A;  2WAF A;  1WE4 A;  4QY6 A;  4YNR A;  2WKE A;  4OLD A;  1LSX A;  2O9A A;  4GDN A;  3FG8 A;  3WS2 A;  3DTE A;  5DFX A;  4BJP A;  4LV0 A;  1MZU A;  5F83 A;  2JKT M;  4F3L A;  5F6A A;  4QY5 A;  3BFE A;  2PBY A;  5F5Y A;  2I72 A;  3KYE A;  5DF9 A;  3E2K A;  4PHT A;  4Z1W A;  3N6I A;  3LR5 A;  2NUP C;  2W1T A;  3R4K A;  3HUM A;  4X25 A;  4PAU A;  3I7J A;  1V9Z A;  1XKZ A;  3IX4 A;  2FH5 A;  4DE1 A;  1L0F A;  3O87 A;  1OTB A;  2KX6 A;  3MZE A;  3OOV A;  4FD8 A;  4I5S A;  2B95 A;  4Y0O A;  4DE3 A;  3IBJ A;  5HL6 A;  2A49 A;  2WZX A;  2V0U A;  3HUO A;  4S2K A;  4HP9 A;  1YSQ A;  5AJG A;  2X02 A;  5L10 A;  2G2W A;  4S2J A;  1OME A;  1S4R A;  2PR5 A;  1BTL A;  3UNW A;  4HOI A;  4ID4 A;  3IH9 A;  1H8Z A;  4YIN A;  4R4R A;  3S7P A;  4RA7 A;  5J3W A;  1S0W A;  3IBR A;  3R7W B;  4LPZ A;  1Z6F A;  5JYO A;  3OLO A;  1TEM A;  1FSY A;  3NDE A;  4QPR A;  4XXR A;  3UDI A;  1FOF A;  2CC1 A;  4HJ4 A;  1ES5 A;  3HLB A;  1PW8 A;  4ZRR A;  3CWF A;  5CHU A;  1GHI A;  4QJG A;  5DKK A;  1CI9 A;  3G30 A;  3CAX A;  4IBR A;  1VEU A;  3N4I A;  5GLA A;  1HZO A;  3EEA A;  1KGG A;  3ZVT A;  3PBR A;  4HP4 A;  3ZG7 B;  3EOI A;  5LBR A;  3IT9 A;  3HUN A;  3W4O A;  3T4T A;  4WMC D;  1IEL A;  3BFC A;  3B3X A;  4CLC C;  5IHV A;  1W63 Q;  3LCE A;  1QME A;  4IJG A;  1XJ6 A;  4OLG A;  1F5M A;  1YLJ A;  5FQI A;  4OOL A;  3VSL A;  3UMD A;  1GA0 A;  1BZA A;  5E2G A;  2XA7 M;  1PW1 A;  4R23 A;  2LB5 A;  3MFX A;  2XF3 A;  2J80 A;  3OC2 A;  4E3I A;  5FI2 A;  1TS8 A;  4S2L A;  3P01 A;  5EVI B;  1UGU A;  1NZU A;  1EWZ A;  4S2I A;  4C6Y A;  3MQO A;  2Q9N A;  4JXG A;  4MBF A;  4QU3 A;  3ZQ5 A;  2JKT I;  3H7W A;  4R3B A;  5K5B A;  4LRY C;  1MY8 A;  4DDS A;  4MNR A;  2WAE A; 
#chains in the Genus database with same CATH homology
 1L0G A;  3C4O A;  5F1G A;  1K54 C;  1K55 A;  3MFD A;  1L2S A;  3AGF A;  4DE2 A;  4JKT A;  4ZJ2 A;  1FCO A;  4JBF A;  2ZQ8 A;  3Q7V A;  4OQH A;  5E2F A;  4PM7 A;  1E3U A;  2P74 A;  5D3O A;  2PU4 A;  3FWL A;  2Y2L A;  4EWF A;  4GOG A;  5HAR A;  4BL3 A;  4Y7P A;  3ZNT A;  4HBU A;  1Q2Q A;  3DWZ A;  1MPL A;  3N8R A;  3ZG9 B;  2X71 A;  4NET A;  2IWD A;  1RGY A;  3W8K A;  1SDE A;  3IXH A;  5AQB A;  5FQK A;  1U60 A;  4S2N A;  3DW0 A;  3CZD A;  3PAG A;  3Q7Z A;  4PM6 A;  5EOO A;  2DRW A;  3V3S A;  3Q82 A;  4R4S A;  1LLB A;  4KZ5 A;  2XFT A;  2HDQ A;  3MXR A;  1W5D A;  2XK1 A;  2ZLY A;  4N92 A;  5HW3 A;  4Y0U A;  3ZG8 B;  3NCK A;  4U0X A;  1SCW A;  1XPB A;  3A3I A;  3UY6 A;  2EX6 A;  2ZJ9 A;  3V50 A;  4N1X A;  5A90 A;  2RCX A;  3M2K A;  5DTK A;  1IYO A;  4X68 A;  2H0T A;  4K91 A;  4HEF A;  4OP5 A;  4GD6 A;  4EBL A;  1BT5 A;  3TSG A;  4KG5 A;  5A92 A;  2HP5 A;  3UPP A;  4OPQ A;  3TG9 A;  1FQG A;  3HRE A;  2ZM2 A;  3DTM A;  2Y2I A;  4RX3 A;  5CTM A;  4K0X A;  4WYY A;  5EEC A;  5HX9 A;  1YM1 A;  3MKF A;  3SH8 A;  3IF6 C;  4ZDX A;  1N9B A;  2QPN A;  3HLE A;  3HLG A;  3OCL A;  3OPL A;  3G34 A;  1W7F A;  4OQG A;  3WS1 A;  2V2F F;  3IF5 A;  3V3R A;  3PBN A;  1PIO A;  3VFF A;  1ES3 A;  3G32 A;  3WRT A;  2H10 A;  3FZC A;  1ZG4 A;  1BLC A;  3IHB A;  3IXG A;  2QMI A;  3M2J A;  4P87 A;  5EVI C;  5A93 A;  4OKP A;  4D2O A;  4X56 A;  1NRF A;  3MKE A;  1PWC A;  4JXV A;  2XD1 A;  3IXD A;  2XLN A;  4U3T A;  4DRT A;  4WZ5 C;  2XQZ A;  2ZQD A;  1JTD A;  1GHM A;  4Z9Q A;  1PZP A;  1RCJ A;  4WEK A;  2WKI A;  4OOM A;  1NY0 A;  3ZFZ A;  4LV2 A;  1KDS A;  2FFF B;  4ZBE A;  1YT4 A;  3IWI A;  1G68 A;  4PM9 A;  4PPR A;  4EQI A;  3UE0 A;  3UO9 A;  4WEJ A;  1PI4 A;  2HDU A;  4ZJ1 A;  3ZDJ A;  5BOH A;  2Y2N A;  4B4X A;  5CRF A;  5FQ9 A;  3Q07 A;  2OV5 A;  5I94 A;  5CGS A;  3SOI A;  5KSH A;  3C4P A;  2ZQC A;  3C7U A;  4EBP A;  1K38 A;  2Y2Q A;  4B88 A;  4RYE A;  4CPK A;  3ITA A;  2HPB A;  3G2Z A;  1FSW A;  2WGW B;  3MBZ A;  4WEL A;  5FA7 A;  4F94 A;  1XXM A;  1FCN A;  1ZG6 A;  2J9P A;  4PMA A;  2J9O A;  5KSC A;  4HES A;  3GTC A;  2PU2 A;  2EX8 A;  3S4X A;  4N1H A;  4E3N A;  1NJ4 A;  4IBX A;  5U47 A;  1KE3 A;  1YLW A;  4OOY A;  1JWP A;  1BUE A;  2Y91 A;  1L0E A;  2ZQ9 A;  3BEC A;  4QD4 A;  4OP8 A;  3UDF A;  1J9M A;  1TVF A;  1LL9 A;  2ZC4 B;  2WGV A;  2Z2L B;  3LO7 A;  3WS4 A;  4N9K A;  3UDX A;  1YLY A;  3NDG A;  1O07 A;  4P6B A;  3C5A A;  3ZGA B;  4DKI A;  4GN2 A;  4XUZ A;  1ZC2 A;  1FR6 A;  4IED A;  3MZF A;  2IWB A;  3N8L A;  1YLP A;  2ZC7 A;  5GLD A;  5M1A A;  4S2M A;  2WAD A;  3IH8 A;  1YLZ A;  3IWO A;  2OLV A;  3M6H A;  1Y54 A;  5GLC A;  3S1Y A;  4EBN A;  1IYS A;  3G31 A;  4EV4 A;  2J7V A;  1BLS A;  5KMW A;  4UA9 A;  1ERO A;  5FAO A;  1JTG A;  4JF4 A;  4BD1 A;  4UA7 A;  4M3K A;  3UPN A;  4ZAM A;  4U0T A;  4MBH A;  3V5M A;  1E25 A;  1IYP A;  4R1G A;  4KG6 A;  4C75 A;  2Y2K A;  1ES2 A;  2WKH A;  3GRJ A;  5M19 A;  2BG1 A;  1K25 A;  4KZA A;  3SS4 A;  3SS5 A;  1LL5 A;  3G4P A;  2P9V A;  5EE8 A;  4P0M A;  3IHA A;  4BD0 A;  1KVM A;  5J8X A;  3N8S A;  4RVA A;  5DF8 A;  3BYD A;  2JC7 A;  4L0L A;  4P85 A;  4QHC A;  1VM1 A;  5CHJ A;  2JBF A;  2XFS A;  3N7W A;  5DTS A;  5CER A;  4OH0 A;  5F82 A;  1LHY A;  3OCN A;  3CMZ A;  4WZ4 A;  2UWX A;  4DE0 A;  2RL3 A;  1ESU A;  2Y2M A;  3VP4 A;  2VGJ A;  2EXA A;  1M6K A;  4KQQ A;  1KE4 A;  1TDL A;  2Y2G A;  2GDN A;  5EOE A;  2ZC3 B;  4GDB A;  4IVI A;  4KQO A;  4FCF A;  3V39 A;  4BLM A;  3LY3 A;  5TFQ A;  3W4Q A;  1MXO A;  3HBR A;  4JF6 A;  5FSR A;  3VP0 A;  3DWK A;  3A3E A;  5GLB A;  1KGE A;  2R9W A;  1C3B A;  2ZQA A;  3ZHH A;  5FQJ A;  1NZO A;  5EVI D;  1K6S A;  5CXW A;  3CG5 A;  3RJU A;  2V1Z A;  1KE0 A;  3SS3 A;  3W4P A;  3IXB A;  4MLL A;  4UHU A;  3BRM A;  2OSU A;  3O3V A;  2H0Y A;  3HVF A;  4OPZ A;  4RX2 A;  4S2O A;  5A91 A;  3PBQ A;  3IF6 A;  1I5Q A;  4EUZ A;  4WM9 A;  3PBO A;  4H8R A;  1MWU A;  4K0W A;  3HL9 A;  3CJM A;  4QB8 A;  2Y59 A;  2X01 A;  3SH9 A;  5GHY A;  2Y2P A;  4BQM A;  5DVA A;  3P09 A;  1KVL A;  2JE5 A;  3Q7V B;  4UA6 A;  3HLC A;  1HVB A;  1HD8 A;  1XGJ A;  2IWC A;  3OPH A;  5DF7 A;  3HLF A;  4OVD A;  1SHV A;  5EVI A;  1Q2P A;  1VQQ A;  1MWS A;  1XGI A;  5CTN A;  3NC8 A;  4ZTK A;  3UN7 A;  2XEP A;  1DJC A;  3MXS A;  4DF6 A;  4E3M A;  1NYY A;  3QNB A;  2Z2M B;  5CGX A;  1I2S A;  4B4Z A;  4GD8 A;  4NK3 A;  3VOZ A;  4WZ5 A;  3WS0 A;  2P9V B;  1CK3 A;  4KZ3 A;  1MKI A;  4GNU A;  3A3D A;  4JLF A;  4KG2 A;  2WAF A;  1WE4 A;  4QY6 A;  1XP4 A;  2G2U A;  2WKE A;  5GL9 A;  4OLD A;  1H5X A;  4GDN A;  2Y2H A;  4S2P A;  4OPY A;  1ONH A;  3WS2 A;  5F1F A;  5AQ7 A;  1ERQ A;  3Q1F A;  4JPM A;  3O88 A;  1CEF A;  2B5R A;  1K56 D;  5TGF A;  1H8Y A;  5AQ9 A;  3VP3 A;  2BLS A;  3NY4 A;  4BJP A;  1L0D A;  3LY4 A;  4LV0 A;  3BLM A;  3C7V A;  3NI9 A;  5F83 A;  4DDY A;  2ZD8 A;  1HTZ A;  1WYB A;  4QY5 A;  1SKF A;  2C5W B;  1LI9 A;  3BFE A;  3FKW A;  2PBY A;  1MWR A;  2I72 A;  5AQA A;  3GV9 A;  5GHZ A;  3GSG A;  4PM8 A;  1BUL A;  5DF9 A;  2XD5 A;  4FH4 A;  1MWT A;  4X6T A;  3ZG0 A;  3SH7 A;  1K56 A;  3E2K A;  4GZB A;  3N6I A;  1S6R A;  1K57 C;  2ZMA A;  3ZCZ A;  1SDN A;  3HUM A;  5CED A;  4XUX A;  3I7J A;  4R0Q A;  1ES4 A;  2WZZ A;  3BFG A;  5G18 A;  3O86 A;  3VP2 A;  1XKZ A;  5DTT A;  4DE1 A;  3GMW A;  3ZNY A;  1ALQ A;  2XR0 A;  2ZM0 A;  5FQQ A;  4FH2 A;  4KZB A;  1KDW A;  1L0F A;  3O87 A;  3ZG5 A;  5TR7 A;  5EUA A;  3MZE A;  1E3U D;  1GCE A;  4YFM A;  1K54 A;  4FD8 A;  3IQA A;  1IEM A;  1IYQ A;  4Y0O A;  1JVJ A;  4DE3 A;  1K55 C;  5CEC A;  2A49 A;  1DJA A;  2EFU A;  2WZX A;  2FFY A;  3HUO A;  4S2K A;  2HP6 A;  2WGI A;  4OON A;  2X02 A;  4BL2 A;  1ERM A;  3VSK A;  1BLP A;  2G2W A;  5HFO A;  4S2J A;  4KEN B;  1OME A;  1XA7 A;  3HLW A;  3HLD A;  3PBS A;  1JWZ A;  3G35 A;  2HDR A;  4LV3 A;  3S22 A;  3GVB A;  4OQ0 A;  1BTL A;  1ZKJ A;  3UNW A;  4KZ7 A;  3AGE A;  5HL1 A;  5FDH A;  4ZJ3 A;  3P98 A;  4S2N C;  4ID4 A;  3IH9 A;  3WRZ A;  5FAP A;  4WBG A;  3D4F A;  1O7E A;  1PZO A;  2ZC6 B;  1H8Z A;  5L2F A;  4GB7 A;  4R4R A;  4YIN A;  4GKU A;  5EPH A;  4RA7 A;  2ZC5 B;  2ZQ7 A;  1S0W A;  3BFF A;  3FKV A;  4KZ9 A;  1Z6F A;  5JYO A;  1TEM A;  3TOI A;  1FSY A;  2XGN A;  2A3U A;  3NDE A;  3EQU A;  1RGZ A;  4OQI A;  4MBK A;  5FAS A;  3NIA A;  4XXR A;  3UDI A;  2EX9 A;  1FOF A;  2CC1 A;  1RP5 A;  3GR2 A;  3WS5 A;  1ES5 A;  1XX2 A;  2WGW A;  2WYX A;  3VP1 A;  3IWQ A;  1BLH A;  4DXB A;  2C6W B;  3MZD A;  1ONG A;  4C3Q A;  5CEB A;  2QZ6 A;  4X53 A;  1YQS A;  4DXC A;  5HAQ A;  1GHP A;  3HLB A;  1PW8 A;  3E2L A;  3AGD A;  1YMS A;  3EQV A;  3PBT A;  5GHX A;  3RXX A;  5HAP A;  2WUQ A;  3GQZ A;  1PWD A;  2J8Y A;  1PI5 A;  4PM5 A;  1ESI A;  1AXB A;  1W8Y A;  3BEB A;  1YMX A;  1DJB A;  2EX2 A;  3ZVW A;  5CHU A;  4E6X A;  1GHI A;  1NXY A;  4X55 A;  5CHM A;  3VOY A;  4QJG A;  5FI6 A;  1IKG A;  4KZ8 A;  3OPR A;  3OZH A;  1CI9 A;  3BM6 A;  3G30 A;  4KZ4 A;  4FSF A;  5EVL A;  4IBR A;  5HAI A;  3UPO A;  1PWG A;  3N4I A;  5GLA A;  3NBL A;  3BFD A;  1K4E A;  3ITB A;  1HZO A;  4LCL A;  2HDS A;  1KGG A;  4Y0T A;  3G2Y A;  2XDM A;  3JYI A;  1YLT A;  1N4O A;  4Q8I A;  2Y55 A;  3ZVT A;  1W8Q A;  1GA9 A;  3UE3 A;  3PBR A;  2E8I A;  3A3F A;  3ZG7 B;  3A3J A;  2HP9 A;  4E3L A;  4JF5 A;  1KGF A;  3HUN A;  3IT9 A;  1CI8 A;  1IKI A;  2JCH A;  3W4O A;  4KQR A;  4WMC D;  1IEL A;  2V20 A;  3BFC A;  1TDG A;  3QNC A;  2XH9 A;  2Y2O A;  5E43 A;  4E6W A;  2H5S A;  3B3X A;  4R3J A;  1CEG A;  1FCM A;  3PAE A;  2DCF A;  5M18 A;  1K6R A;  5IHV A;  3M6B A;  5FI7 A;  2OLU A;  3LCE A;  1QME A;  3ISG A;  1E4D A;  1QMF A;  4JXS A;  4OLG A;  3VMA A;  4CJN A;  1FR1 A;  1W79 A;  2ZM8 A;  3FV7 A;  4JXW A;  4E3J A;  1YLJ A;  5FQI A;  4E3K A;  4OOL A;  5E2H A;  3VSL A;  1MBL A;  3OPP A;  1GA0 A;  1NYM A;  4WMC A;  1BZA A;  1WYC A;  4LCM A;  5E2G A;  3WWX A;  1PW1 A;  5JYP A;  2DNS A;  4X69 A;  3RXW A;  1XA1 A;  4IVK A;  4R23 A;  3IF6 B;  4MEZ A;  1K57 A;  1G6A A;  1BSG A;  2XF3 A;  4E3O A;  4A5R A;  4N9L A;  3OC2 A;  4E3I A;  3Q81 A;  5FI2 A;  3LEZ A;  1DY6 A;  4HBT A;  2Q9M A;  3UE1 A;  4S2L A;  5EVI B;  2R9X A;  1I2W A;  5FAQ A;  4KZ6 A;  1NZU A;  4BEN A;  3FYZ A;  1EWZ A;  4LEN A;  4S2I A;  4C6Y A;  1PYY A;  2WK0 A;  2Y4A A;  3BLS A;  2Q9N A;  5KZH A;  2Y2J A;  1LI0 A;  4JXG A;  4LV1 A;  4MBF A;  4UAA A;  5CGW A;  5FQM A;  3QHY A;  4QU3 A;  1M40 A;  1EI5 A;  4O7D A;  1JWV A;  1K4F A;  2EXB A;  5FAT A;  4OPR A;  2VGK A;  4R3B A;  3PTE A;  1MY8 A;  2EFX A;  4DDS A;  3VFH A;  4MNR A;  2WAE A;  5E2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...