2HV1A

Haddock structure of arnt pas-b homodimer
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
CQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, protein binding
molecule keywords Aryl hydrocarbon receptor nuclear translocator
publication title Practical aspects of using paramagnetic relaxation enhancements for protein docking: Application to the ARNT PAS-B homodimer
rcsb
source organism Homo sapiens
total genus 32
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2hv1A01
3F1PA 3VE4A 1N9OA 4GHIB 3LIAA 4BBUA 5HDSA 3A0SA 1T19A 3H82B 3NOTC 2GJ3A 3E4PA 1LL8A 2QJ7A 1DP8A 2A24A 4L9EA 2ZBBA 4WF0A 4R38A 1KOUA 1LSVA 4L9FA 3RH8B 1GSVA 1D7EA 1XJ4A 2OWJA 5HSQA 2I9VA 3EWKA 3VOLA 3LIEA 1ODVA 4BBTA 2QWSA 5J4EA 5HDCA 5DJUA 4F3LB 4NXFA 4I39A 5DKKA 5I5LA 5G4ZA 5G4YA 1N9NA 1P97A 4HY8A 4NXGA 4XT2A 4HIAA 2V1BA 4H6JA 4LLOB 5TBMB 1WA9A 3IS2B 2PR5A 4HP9A 3F1PB 2VLGA 2V9AA 3OLOA 2H28A 3EEHA 4WLAA 4JGOA 5AVEA 2KX6A 3UB8A 2A24B 1LSXA 1VB6A 4I3AA 2VV7A 1EW0A 3MQOA 3BWLA 4R6LA 4LRYC 2D02A 3GECA 2WKRA 3LIDA 2KDKA 3LI9A 3UB6A 4HP4A 4JGQA 3BY8A 2EA9A 2W27A 3C8CA 1GSXA 4HH2A 4F3LA 2M1CA 4MN5A 5HWTA 3UMDA 4R70A 4KQDA 2WKQA 1V9YA 5IU1A 4XT2B 1TS6A 3NOUC 2PYPA 1MZUA 1UWPX 3G6OA 2B02A 1T18A 1X0OA 3IS2A 2HV1A 1NWZA 2V0WA 5EFWA 3VE3A 3NHQA 4LPZA 3GDIA 4NXBA 1G28A 1XFNA 4WN5A 3CLOA 2L0WA 1S66L 2CMNA 3FG8A 3LUQA 1XJ6A 1UGUA 1OTEA 4LRZE 1DRMA 2P7JA 3LYXA 4GW9A 2PDRA 3A0VA 4PKYG 2YKHA 1OT9A 1TS0A 5HD3A 4GCZA 2VV8A 4EETB 2J80A 4PKYA 1BYWA 2Z6CA 4HI4A 4I3JA 3UE6A 3H9WA 3KX0X 2OOLA 3PYPA 5F69A 3UB7A 1GSWA 4E04A 1XJ3A 4DJ2A 4GS9A 5A8BA 2PHYA 5J3WA 4EW7A 1XJ2A 4KUOA 3ICYA 4K08A 5F68A 2YKFA 2L1MA 4HNBA 4HHDA 3MR0A 3ZQ5A 4JGPA 2Z6DA 2ZOHA 3PHYA 3T50A 4M4XA 1V9ZA 1D06A 1S1ZA 2VV6A 2V0UA 2JHEA 3F1OA 3MQQA 4HJ4A 5HWWA 1S4RA 4YWZA 4KUKA 1T1AA 2QKPA 3HJIA 2PR6A 2VEAA 2ZOIA 4RQ9A 3HJKA 1T1BA 5HZHA 5DKLA 4GS9B 2PD7A 1Y28A 4JGRA 2OWHA 4I5SA 4HJ3A 4BBVA 3D72A 1OJGA 3CWFA 3LIFA 2W0NA 3F1NA 3LI8A 1LT0A 3H7WA 2INWA 3E4OA 1S67L 2PYRA 3C2WA 1DP9A 3ULFA 3NOPC 1F98A 4DJ3A 5AVFA 1LSWA 3LICA 3F1OB 3K3DA 3MXQA 1S1YA 2L4RA 3NJAA 4EEPA 4WUJA 4HH3A 3MFXA 2QJ5A 3E4QA 3MJQA 3CAXA 4B9OA 4EXOA 2BASA 2PD8A 1P0ZA 1OJ5A 1OTIA 2D01A 3P7NA 4WL9A 3BY9A 3K3CA 5DJTA 5KIZA 3UB9A 1F9IA 2WKPA 3SW1A 4EERA 5IS1A 3F1NB 5F6AA 2K7SA 3H7WB 4L9GA 1OTAA 2V1AA 1S4SA 3A0RA 4GHIA 3FC7A 1TS7A 1XFQA 3H82A 1DP6A 4LRXC 1OTBA 3LIBA 3RTYA 2R78A 5J7EA 4MN6A 1JNUA 1T1CA 5F5YA 1OTDA 4HJ6A 4I38A 1UWNX 4EQ1A 5HDDA 4EESA 2QHKA 3IBRA 4I3IA 3UMEA 5HD5A 3B33A 1OT6A 4HOIA 1TS8A 4H6JB 4EEUA 4NXEA 5HWVA 4HQAA 2JN7A 4R3AA 5TBMA 1N9LA
chains in the Genus database with same CATH superfamily
2KLIA 3NCKA 1VQQA 2A3UA 3O87A 4BBUA 1GHMA 3HLBA 1T19A 2GJ3A 1D1JA 1PWGA 4S2NC 2X02A 3LEQA 3D4FA 3LEZA 2ZBBA 4KENB 4ARZB 4ID4A 3ZG5A 1NYYA 1XX2A 3CZDA 4GD6A 1OPXA 4K0WA 1KOUA 1VEUB 4MLLA 3EEAA 1ONHA 1GSVA 1XJ4A 3GTCA 4E6XA 5HSQA 3G2YA 3EWKA 4CLCC 5EE8A 3MZEA 4FOFA 4NXFA 4OONA 3DWKA 1PI5A 5G4YA 1P97A 1J9MA 1CF0A 3Q7VB 4HY8A 4HIAA 2V1BA 2XH9A 4H6JA 5TR7A 4X6TA 4OP5A 4KG2A 2EXAA 4LLOB 5TBMB 1WYBA 3C38A 3F1PB 5KSCA 3UO9A 5TGFA 2PT7A 1SKFA 2XF3A 4P6ZS 2W3GA 4BENA 2A24B 3IH9A 5L8MA 1MWRA 2ZQ7A 1FCOA 2VV7A 3MQOA 3NIAA 3W4OA 2QZ6A 3CUEC 4S2PA 1IYQA 1Y54A 3LI9A 4BQMA 4JGQA 4BWIA 1U60A 5A91A 2ZC7A 1FOFA 1ES5A 4LENA 1ES2A 2WKHA 4KQRA 3C8CA 2XR0A 1MXOA 4OOLA 1XPBA 2XLNA 3KSIA 3G35A 3PBRA 2ZM2A 4E3OA 1K57A 1NJ4A 3BFFA 2WUQA 3QNCA 5E2HA 1TS6A 5DFXA 4GLQA 2Y2QA 2B02A 2C5WB 2B95A 2PU4A 3IXGA 3QP6A 2A2LA 3K2NA 1JTDA 2ZMFA 4QU3A 4LPZA 4NXBA 4KQQA 1G28A 5FQJA 4L0LA 4WN5A 4UEYA 4IVIA 1XXMA 2HJEA 3T1RA 2CMNA 4P85A 4C75A 3IF6B 3OBFA 3C4PA 1ESUA 3A0VA 3QNBA 3HVFA 3KYZA 3OPPA 4GD8A 2HF6A 5F82A 2XA7S 3GRJA 1SKOA 2XDMA 2ZC4B 1NZOA 2YKHA 4B93A 1TS0A 5HD3A 4WZ4A 3KSHA 2ZMVA 2VK3A 3FYZA 1S6RA 5E2EA 1Z09A 1YLPA 5FQIA 2B5RA 3T1SA 3V50A 2XD1A 3WS2A 3V3SA 3QP1A 3H9WA 4G3KA 4G3WA 2OOLA 1W63M 5F69A 3HCYA 1GSWA 4FH2A 3IH8A 4U0TA 2Q9MA 4DXCA 4UAAA 3AGEA 1PWDA 3OCLA 4DJ2A 4XUXA 5L09A 3PAGA 2ZL1A 4PM6A 1G6OA 5F68A 4OH0A 2L1MA 5L10A 5IHVA 4BMWA 1PI4A 4JGPA 3CUEA 3O3VA 2XROA 3PHYA 5EVID 3Q07A 3T1XA 1CEFA 3PR6A 1DJCA 2OV5A 1V9ZA 1YMXA 2B18A 5DTSA 4MBHA 2ZC3B 3F1OA 3MQQA 1HTZA 4BJPA 5CEDA 5HWWA 2ZLYA 4OOMA 1JWZA 1K56A 1FSYA 3MKFA 3TE8A 1T1AA 1RCJA 3HJIA 2PR6A 1G68A 2V8CA 1BLPA 1T1BA 3HREA 2J7VA 3ZHHA 4OQIA 4JGRA 3RFBA 1NRFA 2OWHA 5TJJA 4WEKA 4P0MA 2JCHA 4OQGA 3EGXC 1MWUA 3CWFA 3LIFA 4Q0IA 5KZHA 4H8RA 3EQVA 2Y2KA 3IXDA 2W0NA 2QPNA 2WZZA 2JKRM 3HLEA 1CJFA 1PRQA 2H5SA 1VETB 5GHZA 1F2KA 2BG1A 4DE2A 2EXBA 3HLDA 5CHJA 3OZHA 2P04A 4ZJ1A 2M7UA 2EX6A 1F98A 4N9LA 3LGOA 3ITBA 3CMZA 4X56A 1XA1A 2ZJ9A 3R7WB 1EWZA 4MBFA 3T12B 1S1YA 3CG5A 2FH5A 3LR3A 2DRWA 1MBLA 2W3DA 4HH3A 1ZG6A 3IX3A 5FSRA 1SCWA 5FI6A 3NULA 3O88A 5EVIC 3DWZA 3RJUA 5FI2A 2V8FA 3SS3A 3DAVA 5CHUA 3P7NA 3KYQA 3BY9A 4KZ7A 5DJTA 5KIZA 1YLWA 2WK0A 3IX4A 3TRCA 2G7UA 3GSGA 5F6AA 3A3FA 1SZVA 1HD8A 2WKIA 2XA7M 3SS4A 4L9GA 1YLJA 1GHIA 4Y15A 2V1AA 4WYYA 4BD1A 3M2KA 4ZAMA 1I5QA 3MZFA 1TS7A 1L2SA 4MN6A 3OCNA 3VP0A 4DE1A 5EPHA 1T1CA 3W2ZA 5KMWA 3VFFA 1MWTA 4CJNA 4ESPA 3O86A 5GHYA 4I38A 2QHKA 3S7QA 3IBRA 2VKSA 4I3IA 2VGKA 1PZOA 1K4EA 2ACGA 4JBFA 1PW8A 4D60A 4X68A 2FFFB 1YSQA 1LLBA 4EQIA 3CITA 2UV0E 1TS8A 1WE4A 2DNSA 2JN7A 5EOOA 2J8YA 5CGSA 1EI5A 4IUHA 3L7HA 1EROA 4OVDA 3U2AA 2P9VA 3VE4A 2EX9A 1N9OA 1FILA 3NOTC 2QJ7A 3G30A 4L9EA 4G3VA 1G6AA 5CGXA 1PWCA 4R38A 1LSVA 3IQAA 4QD4A 3G31A 4OQ0A 2Y55A 1ODVA 4BBTA 4KQOA 1TDLA 5HFOA 3A3EA 5DKKA 1K6SA 5I5LA 1N9NA 1NXYA 1ACFA 4E3IA 4XT2A 4NXGA 4AFIA 1YLZA 4CLCD 1P9WA 1IYOA 4B88A 1O7EA 2H28A 3DW0A 3EGDC 5IT5A 3CPTA 4JGOA 4P6BA 1PZPA 4I3AA 1EW0A 1STZA 4R6LA 4LRYC 2D02A 2W1TB 1ES4A 2ZQCA 2KDKA 3ZCZA 5U47A 2JBFA 2JKTM 1BULA 2EA9A 3ZG8B 4KG6A 3BQ8A 1GSXA 1XA7A 3LY3A 1XKZA 1GA9A 2M1CA 5HWTA 3UMDA 2VX8A 4KQDA 1YM1A 1TEMA 3OPHA 3NOUC 3HLGA 2PYPA 1MZUA 3IBJA 3BFGA 1JTGA 4DF6A 2X01A 3D9YA 1IKIA 1SDNA 5EOEA 1C3BA 1NWZA 4JXVA 2IWCA 3SH9A 3GDIA 4N92A 3T1QB 2G2UA 4NKPA 1XFNA 3EQUA 3N4IA 2ZM8A 1BUEA 1KDWA 2L0WA 1MKIA 3N8SA 3GMWA 2HDSA 4NK3A 4LRZE 2KOIA 1K4FA 2W1TA 3JPUA 2QMIA 3UN7A 4Z1WA 4U3TA 1LHYA 2Y2GA 1Y4OA 4GJ4A 3MF0A 2Z6CA 3HBRA 1QMEA 1ES3A 4FH4A 5BOHA 1BZAA 4IVKA 4OPQA 2Y2NA 3PYPA 1LL9A 1FCMA 5FQ9A 2LB9A 3PBQA 4GS9A 2C6WB 2PHYA 4OPYA 4EW7A 3PBNA 4KUOA 1PW1A 4CLCE 5MC7A 2HDQA 2YKFA 5A93A 4Y5FA 3MR0A 5CTMA 4JXGA 1Z6FA 2OLUA 3ZQ5A 5TFQA 5A90A 3G2ZA 2Z6DA 4UA6A 4DE0A 1MKMA 2IWBA 4Q8IA 4KZ6A 3N8LA 1NY0A 5EVEA 3HUOA 3SZTA 2H10A 3EOIA 5F1FA 1D06A 1SKOB 4DKIA 3HUNA 3B42A 4ZRRA 3FPVA 3DTIA 3JVVA 2Q9NA 2JKTI 1CI8A 1YPRA 3T4OA 3JVUA 1ZG4A 3UE3A 1WYCA 5HPIA 4OQHA 1S4RA 3FZCA 3S7NA 3E98A 4ME4A 5CERA 3WS5A 3BM6A 2WGVA 3IWQA 3PBTA 5FL3A 2ZOIA 3IHAA 4S2IA 4M3KA 2ZL1B 1W7FA 1MWSA 4I5SA 4HJ3A 3UPOA 3RXWA 5M18A 4S2NA 3IXBA 3D72A 3TW8A 3W8KA 1AXBA 3ZVTA 1SHVA 1IOUA 3D3OA 4DN0A 1KGFA 3MZDA 4JF6A 2OAQ1 1A0KA 3LFVA 4LV3A 4HBUA 4RA7A 1LT0A 2IWDA 4CLCA 5HW3A 1YMSA 2Q0OA 3NC8A 4Y0UA 2PYRA 3C2WA 4E3KA 3C7UA 2NUPC 1LI9A 4WM9A 5AQBA 1KE3A 4MN7A 3WRTA 1G5UA 3F1OB 3FKWA 4GKUA 1YQSA 3N6IA 1DY6A 3K3DA 4K0XA 4Y3IA 5EM1A 2L4RA 5FQQA 1KGGA 2QYBA 2QJ5A 3GVBA 1TDGA 3ZDJA 2WKEA 1Q2PA 3DTKA 1XGIA 1P0ZA 1OJ5A 4BL3A 5DFYA 3ZNTA 4Q0HA 3TJZC 1IELA 1FIKA 3UB9A 2PRFA 1F9IA 1LL5A 3SW1A 4EERA 2K7SA 4RX3A 1S4SA 3A0RA 4GHIA 5CHMA 1E3UD 3SOIA 3H82A 2W3EA 3C5AA 4YFMA 5EVLA 4ZTKA 1DP6A 4Y17A 1P9RA 3LIBA 3VMAA 3RTYA 2XQZA 2P08A 2XD5A 2XGNA 4YNRA 5FDHA 1W5DA 1K54C 2HP6A 4C3QA 1M40A 4EU0A 1PFLA 4HJ6A 3IXHA 4EQ1A 4DDYA 5CTNA 5HDDA 4P6ZM 2J9PA 4WELA 1TVFA 3B33A 3ZG0A 1ERMA 1PNEA 3GQZA 2J3WA 3PTEA 1E25A 2Y2IA 3ZYTA 4R3BA 3T4LA 2Z2MB 3QP5A 4NXEA 2Y2JA 3BRMA 4S2KA 3DTMA 4KZ9A 1HLUP 4N1HA 4X1MA 3C30A 1LL8A 5HX9A 3M2JA 4MMNA 2VZWA 3UB5P 2A49A 1K55C 3Q81A 3MSHA 4UA9A 4FTXA 4L9FA 5HAPA 4S2MA 4EUVA 1D7EA 2O99A 1FR1A 1K38A 5DF7A 3VOLA 3LIEA 2QWSA 5J4EA 1BT5A 1BTLA 1N4OA 5C5KA 2K2NA 3U4LP 5DJUA 4F3LB 3LR5A 4DMZA 1M6KA 1TF1A 5FQKA 4LV2A 2WAEA 1L0GA 2ZC6B 3BQAA 4R3JA 2JE5A 1YT4A 2P74A 3IWIA 3TSGA 3NI9A 3GV9A 1WA9A 3PBSA 1IFQA 4YOFA 2P9VB 4X53A 5FATA 2VA0A 4C6YA 4KZBA 5GHXA 2Y2HA 2O9CA 1GHPA 3UB8A 4HEFA 1LSXA 3HLFA 1W8QA 4D2OA 1K54A 3Q82A 4MBKA 5HL6A 3BLSA 3GECA 2WAFA 1YLYA 2WKRA 3LIDA 3QHYA 5DVAA 4EV4A 3UB6A 4HP4A 1IYSA 2W27A 5EVIB 1RP5A 4B4ZA 1SDEA 2HDUA 1FQGA 4F3LA 4R70A 5DTKA 4EUZA 1HVBA 3A3JA 4XT2B 4LV0A 4GN2A 3G34A 2HP9A 1UWPX 4Y13A 3HLWA 3Q7ZA 4Y0OA 5GLDA 5D3OA 2WGWA 2JKRI 3NY4A 1DJAA 3CPTB 4E3LA 3LR0A 4WZ5C 4OKPA 1K55A 2V20A 4OLDA 3CLOA 1JWVA 2DMWA 3BYDA 3LY4A 4A5RA 3RXXA 1S66L 4O7DA 3LUQA 1XJ6A 1OTEA 2O0YA 2E8IA 3LYXA 4GW9A 4X55A 5EV0A 3IWOA 3WS0A 4PAUA 5EVIA 4Y7PA 1GA0A 1E3UA 4EETB 2J80A 4PKYA 4LCLA 4E3JA 5EECA 4R23A 4HI4A 4PM9A 2Y2MA 4UHUA 5CXWA 3UE6A 2ZMAA 3NDGA 1NLYA 3KX0X 3CI6A 5HAIA 1KE0A 2WZXA 1XJ3A 3UNWA 4E04A 3A3IA 4BL2A 3BFCA 4QY6A 4DRTA 5J3WA 3VSLA 3ICYA 4KZ4A 4K08A 2VGJA 1PYYA 4HNBA 1ALQA 4GNUA 1W8YA 4GZBA 1O07A 2XFTA 2Y8HA 1BLCA 5LBRA 2ZQ9A 3BEBA 5M1AA 2ZOHA 1BLSA 4PPRA 3T50A 3V5MA 4M4XA 4WMCD 1I2SA 1KDSA 1S1ZA 2VV6A 4OLGA 3UDXA 3P98A 4FCFA 4QY5A 3ZFZA 4X69A 3VFHA 4JF4A 3V67A 4MEZA 5A92A 5FASA 3FV7A 4YWZA 4ZJ3A 1BSGA 2O9BA 5GLCA 2VEAA 3VOYA 3HJKA 2J9OA 5DKLA 4GS9B 5F1GA 4KZ5A 1Y28A 3FWLA 2Y91A 4KZ3A 2VGLS 3AGDA 2AVXA 3T4KA 3B3XA 4LGWA 3ZVWA 1YLTA 1OJGA 4QJGA 3BJNA 2FZ0A 3T4SA 3VP2A 5FI7A 2JC7A 1H8MA 3F1NA 5FDSA 5AQAA 3UPNA 3LI8A 3H7WA 2WGIA 3MS6A 1L3LA 4LV1A 4EBLA 3MFDA 4R1GA 4XUZA 3UDFA 4K91A 3V3RA 2XSSA 4Y0TA 1K56D 4F94A 3LICA 4PMAA 3ZGAB 4Y2FA 2VJWA 4ZDXA 4WUJA 3UY6A 1IEMA 3IHBA 3MFXA 5EM0A 2JKGA 3LCEA 3CAXA 4EXOA 5GLBA 1F5MA 4JKTA 2PD8A 5CGWA 4WEJA 3JYIA 3WS4A 2D01A 4S2OA 4WL9A 5HAQA 4PM8A 3IF5A 5I94A 3K3CA 3KYEA 3SH7A 4B4XA 2WKPA 3QP8A 5AQ9A 5IS1A 4QPRA 1CQAA 5L2FA 1XGJA 5FAPA 4DE3A 2ZQDA 4ZBEA 4CLCB 1KVLA 3FC7A 1YAXA 1FR6A 4LRXC 2EFXA 2R78A 5J7EA 4IEDA 5FQMA 2JKFA 4ARZA 3IT9A 2Y2OA 1MY8A 4GDNA 4GB7A 3S22A 1VEUA 2EFUA 2GDNA 2WADA 2XRNA 3BW6A 1L0DA 4X25A 1OTDA 3M6HA 3PBOA 3IF6C 4NEED 2FFYA 1TD5A 2V1ZA 4ETZA 3DTEA 1H0MA 3UMEA 4MCWA 2EX2A 1ERQA 4ETXA 3KO6A 3BFDA 5EUAA 3Q7VA 3HUMA 1NYMA 4HOIA 4EEUA 4HQAA 3QP4A 3MMHA 1H8YA 5TBMA 1N9LA 1S0WA 3F1PA 4CQHA 4QHCA 1MC0A 4GHIB 3LIAA 5HDSA 4ZJ2A 4RYEA 3A0SA 3H82B 3E4PA 1YSPA 2BTFP 1DP8A 2A24A 3IX8A 1JWPA 4FSFA 4BD0A 2Y59A 4WF0A 4PM7A 1HZOA 2OAP1 3VV4A 5AJGA 3RH8B 3MXSA 3LR4A 2OWJA 2VGLM 2I9VA 2H0YA 5HDCA 4WMCA 1H5XA 2RCXA 3T4JA 3WWXA 1XP4A 3B47A 3C4OA 4I39A 5G4ZA 4RX2A 2EWWA 4BLMA 3PAEA 4JXWA 4LCMA 3P09A 2Y4AA 2H0TA 3IS2B 2J3TD 2PR5A 4HP9A 4EBPA 1K0KA 2VLGA 4MNRA 5CECA 2V9AA 3OLOA 1LI0A 1ZHHB 3EEHA 1KGEA 5G18A 1MPLA 3BLMA 4WLAA 1QMFA 4N1XA 5AVEA 5GLAA 2KX6A 5K5BA 2PAVP 1VB6A 3N8RA 1RGYA 3HL9A 4IJGA 5FA7A 3BWLA 2PU2A 3E2KA 4NG2A 3IF6A 5HPFA 2BLSA 3BY8A 4KG5A 4X1LA 4OPZA 4E3MA 4HH2A 5L07A 3W4PA 2Y79A 4MN5A 3S7PA 2HZ5A 2Y2PA 3UE1A 4UQIS 3OOVA 4HBTA 4JF5A 3UE0A 5CX7A 2DCFA 2WKQA 1L0FA 1V9YA 5IU1A 1JVJA 3G4PA 3G32A 4WBGA 2XEPA 4JPMA 3G6OA 1H8ZA 1L0EA 1T18A 1CEGA 1X0OA 3CJMA 3IS2A 1YKDA 2HV1A 2G2WA 5E43A 4LFUA 2M7VA 2V0WA 5EFWA 4P87A 3VE3A 1DJBA 3NHQA 4O8GA 4R4SA 3QP2A 1KVMA 3P01A 5E2FA 3UPPA 3A3DA 4QB8A 1I2WA 5CEBA 3FG8A 1UGUA 1DRMA 2P7JA 2HP5A 2PDRA 3VOZA 2V2FF 4IBRA 3L9KA 2XK1A 3V39A 1NLZA 1N9BA 4PKYG 1VHMA 3TG9A 4JXSA 1OT9A 5FEGA 4GCZA 2J3TC 2VV8A 3NDEA 1BYWA 5GL9A 4MDZA 1IKGA 3LO7A 4I3JA 4R0QA 3PXPA 3VSKA 2IA2A 1W79A 1W63Q 3UB7A 5DTTA 4E3NA 3T4QA 5HL1A 4R4RA 3S7OA 5A8BA 4FUWA 5F83A 5KSHA 1XJ2A 2WGWB 3HLCA 2XFSA 4FD8A 3ZNYA 4HHDA 4PM5A 1VM1A 4UA7A 4KZ8A 4CPKA 4S2LA 3NBLA 2PBYA 2W3HA 3C7VA 1CI9A 4N9KA 5E2GA 1AWIA 1VETA 2ZM0A 3DBAA 2E8JA 5FAOA 3TOIA 3BECA 2OLVA 3E0YA 2V0UA 1Q2QA 2JHEA 1BLHA 4O0PA 5DF8A 4HJ4A 3R7WA 2Y2LA 4OPRA 2EWVA 3WRZA 2MJ6A 3M6BA 4KUKA 4O01A 2PBDP 2QKPA 3Q1FA 3NECA 3ISGA 1NRJA 3SH8A 4RQ9A 3BFEA 2ZC5B 5AQ7A 4YINA 4IHQA 5HZHA 2PD7A 3CHWP 2O9AA 4U0XA 1CK3A 4BBVA 2X71A 5J8XA 1K25A 3MKEA 3KSFA 4IBXA 1OMEA 2HPBA 3ZG7B 1KE4A 4OP8A 2R9XA 3S4XA 3VP4A 2GNXA 3I7JA 4QWOA 4DXBA 2ZQAA 1FCNA 2INWA 2ZD8A 4GDBA 3E4OA 4GOGA 2K31A 4Q0JA 1S67L 1DP9A 4UQIM 4OOYA 3ULFA 3MBZA 2HDRA 1ZC2A 3NOPC 4NETA 4EBNA 4DJ3A 5AVFA 4S2JA 4EWFA 1LSWA 5DF9A 2GZAA 2LB5A 3MXQA 3T4TA 3WS1A 1H3QA 5FEFA 3ITAA 3NJAA 3O5YA 3OPRA 4EEPA 3FKVA 2ZQ8A 4PHTA 3E4QA 3MJQA 2HJ9C 1RGZA 2UWXA 4B9OA 5CRFA 1K6RA 2BASA 3W4QA 1OTIA 3AGFA 4RVAA 1ZKJA 5FAQA 1ZTUA 3VP3A 3F1NB 3ZG9B 1NZUA 1E4DA 1ESIA 3H7WB 1OTAA 3VP1A 2CC1A 3MQ0A 3UDIA 3SS5A 1XFQA 4DDSA 3R4KA 1OTBA 4E6WA 2NUTC 5JYOA 4JLFA 5M19A 3E2LA 4II7A 4IUKA 2EX8A 1JNUA 4HESA 3KSGA 1IYPA 5F5YA 2I72A 2Z2LB 2GX5A 2R9WA 2WYXA 3GR2A 1GCEA 1UWNX 3OC2A 4EESA 3FPWA 2HGVA 3S1YA 4WZ5A 1ONGA 4Z9QA 1FSWA 5HD5A 2OSUA 1OT6A 2W3FA 4KZAA 1PIOA 5HARA 2RL3A 4XXRA 1J3WA 2W1RA 3MXRA 3OPLA 5JYPA 4H6JB 1K57C 5HWVA 4R3AA 3N7WA
chains in the Genus database with same CATH topology
3U2AA 2KLIA 3F1PA 3VE4A 4CQHA 1MC0A 1N9OA 4GHIB 3LIAA 4BBUA 5HDSA 3A0SA 3C30A 1T19A 3H82B 3NOTC 2GJ3A 3E4PA 1LL8A 1YSPA 2QJ7A 1DP8A 2A24A 4L9EA 4FSFA 4G3VA 2ZBBA 4MMNA 2VZWA 4ARZB 4WF0A 4R38A 1OPXA 1KOUA 1LSVA 3EEAA 2OAP1 3VV4A 4L9FA 5AJGA 3RH8B 4EUVA 1GSVA 1D7EA 1XJ4A 2O99A 3LR4A 2OWJA 5HSQA 2VGLM 2I9VA 3EWKA 3VOLA 3LIEA 4CLCC 1ODVA 4BBTA 4KQOA 2QWSA 4FOFA 5J4EA 5HDCA 5C5KA 2K2NA 5DJUA 4F3LB 3T4JA 4NXFA 3B47A 3LR5A 4DMZA 1TF1A 4I39A 5DKKA 5I5LA 5G4ZA 5G4YA 2EWWA 1N9NA 1P97A 4HY8A 4NXGA 3BQAA 4XT2A 4HIAA 2V1BA 4AFIA 4H6JA 4CLCD 4LLOB 5TBMB 1WA9A 3PBSA 1IFQA 3IS2B 4YOFA 2J3TD 2PR5A 3C38A 1P9WA 4HP9A 3F1PB 2VLGA 2V9AA 3OLOA 2H28A 2VA0A 3EGDC 1ZHHB 3EEHA 5IT5A 2PT7A 4JGOA 4WLAA 2O9CA 4P6ZS 5AVEA 2KX6A 3UB8A 2W3GA 5K5BA 2A24B 1LSXA 5L8MA 1VB6A 4I3AA 4IJGA 2VV7A 1EW0A 1STZA 3MQOA 3BWLA 4R6LA 4LRYC 5HL6A 2D02A 2W1TB 3GECA 2WKRA 3CUEC 3LIDA 5HPFA 2KDKA 3LI9A 3UB6A 4HP4A 4JGQA 4BWIA 3BY8A 2JKTM 2EA9A 2W27A 3C8CA 3BQ8A 1GSXA 4HH2A 4F3LA 4OOLA 2Y79A 3KSIA 2M1CA 4MN5A 5HWTA 3S7PA 3UMDA 3PBRA 4UQIS 3OOVA 4R70A 2VX8A 4KQDA 2WKQA 5CX7A 1V9YA 5IU1A 4XT2B 1TS6A 5DFXA 3NOUC 4GLQA 2PYPA 1MZUA 1UWPX 3G6OA 2B02A 3IBJA 1T18A 1X0OA 3IS2A 2A2LA 3K2NA 1YKDA 2HV1A 2ZMFA 2JKRI 1NWZA 2M7VA 2V0WA 5EFWA 3VE3A 3LR0A 4O8GA 3NHQA 4LPZA 3GDIA 3P01A 4NXBA 4NKPA 1G28A 1XFNA 4L0LA 4WN5A 3EQUA 4UEYA 3CLOA 2DMWA 2L0WA 2HJEA 1S66L 2CMNA 3FG8A 3LUQA 1XJ6A 1UGUA 1OTEA 2O0YA 4LRZE 1DRMA 2KOIA 2P7JA 3OBFA 3LYXA 2W1TA 4GW9A 4Z1WA 2PDRA 3A0VA 3KYZA 2HF6A 1NLZA 4PKYG 4PAUA 1VHMA 2XA7S 2YKHA 1OT9A 1TS0A 5HD3A 4B93A 4GCZA 3KSHA 2ZMVA 2J3TC 2VV8A 4EETB 4GJ4A 2J80A 4PKYA 3MF0A 1BYWA 4MDZA 2Z6CA 4HI4A 4I3JA 3PXPA 3UE6A 2IA2A 3H9WA 4G3KA 4G3WA 1NLYA 3KX0X 1W63Q 1W63M 2OOLA 3CI6A 3PYPA 5F69A 3HCYA 3UB7A 1GSWA 4E04A 1XJ3A 3T4QA 3OCLA 4DJ2A 2LB9A 3PBQA 4GS9A 3S7OA 5A8BA 2PHYA 5J3WA 5KSHA 4EW7A 1XJ2A 3PBNA 4KUOA 3ICYA 4CLCE 1G6OA 4K08A 5MC7A 5F68A 2YKFA 2L1MA 4HNBA 4HHDA 4Y5FA 3MR0A 2Y8HA 4BMWA 3ZQ5A 5LBRA 4JGPA 2W3HA 3CUEA 2Z6DA 1MKMA 2ZOHA 2XROA 3PHYA 3T50A 3PR6A 4M4XA 3EOIA 3DBAA 1V9ZA 1D06A 1S1ZA 2VV6A 3E0YA 2V0UA 4ZRRA 3B42A 2B18A 2JHEA 3FPVA 3JVVA 4O0PA 2JKTI 3T4OA 3F1OA 3JVUA 3MQQA 3UE3A 3V67A 4BJPA 4HJ4A 3R7WA 5HPIA 5HWWA 1S4RA 2EWVA 2MJ6A 4OOMA 3S7NA 3E98A 4YWZA 3TE8A 4KUKA 4ME4A 1T1AA 4O01A 2QKPA 2O9BA 3HJIA 2PR6A 3PBTA 1NRJA 5FL3A 2VEAA 2ZOIA 4RQ9A 3HJKA 1T1BA 4IHQA 5HZHA 5DKLA 4GS9B 2PD7A 1Y28A 4JGRA 3RFBA 2OWHA 2O9AA 5TJJA 4I5SA 4WEKA 4HJ3A 2VGLS 3T4KA 4BBVA 3D72A 3TW8A 1OJGA 3EGXC 3CWFA 3KSFA 1IOUA 3D3OA 3BJNA 3LIFA 4Q0IA 4DN0A 3EQVA 2FZ0A 3T4SA 2W0NA 1H8MA 2OAQ1 3F1NA 2JKRM 3LFVA 2GNXA 3LI8A 1LT0A 3H7WA 2INWA 4CLCA 3E4OA 2K31A 4Q0JA 1S67L 2P04A 2PYRA 3C2WA 1DP9A 2NUPC 4UQIM 2M7UA 3ULFA 3NOPC 1F98A 4DJ3A 5AVFA 2XSSA 1LSWA 3LICA 4MN7A 3F1OB 5DF9A 2GZAA 2LB5A 3R7WB 4Y2FA 2VJWA 3K3DA 3MXQA 3T4TA 4Y3IA 1S1YA 1H3QA 2L4RA 2FH5A 3LR3A 3NJAA 3O5YA 4EEPA 4WUJA 2W3DA 4HH3A 2QYBA 3MFXA 2QJ5A 4PHTA 3E4QA 3MJQA 2HJ9C 3CAXA 4B9OA 4EXOA 1F5MA 2BASA 2PD8A 1P0ZA 4WEJA 1OJ5A 5DFYA 1OTIA 2D01A 3P7NA 4Q0HA 3TJZC 4WL9A 3KYQA 3BY9A 3K3CA 5DJTA 5KIZA 3UB9A 1F9IA 1ZTUA 2WKPA 3SW1A 3TRCA 4EERA 2G7UA 5IS1A 3F1NB 4QPRA 5F6AA 2XA7M 2K7SA 3H7WB 4L9GA 1OTAA 2V1AA 3MQ0A 1S4SA 3A0RA 4GHIA 4CLCB 3FC7A 1YAXA 1TS7A 1XFQA 3H82A 2W3EA 3R4KA 1DP6A 4LRXC 1OTBA 1P9RA 3LIBA 2NUTC 3RTYA 2R78A 5J7EA 4MN6A 2P08A 4II7A 4IUKA 4ARZA 3OCNA 4YNRA 1JNUA 1T1CA 3W2ZA 3KSGA 2XRNA 3BW6A 5F5YA 1OTDA 2GX5A 3PBOA 4EU0A 4HJ6A 4NEED 4I38A 1UWNX 4EQ1A 1TD5A 3OC2A 5HDDA 4ETZA 4EESA 4P6ZM 2QHKA 3S7QA 3IBRA 3FPWA 2VKSA 4WELA 4I3IA 3UMEA 2HGVA 4MCWA 5HD5A 3B33A 1OT6A 2W3FA 2J3WA 4ETXA 3KO6A 2W1RA 1YSQA 3ZYTA 3CITA 4HOIA 3T4LA 1TS8A 4H6JB 4EEUA 4NXEA 5HWVA 4HQAA 2JN7A 3MMHA 4R3AA 4IUHA 5TBMA 1N9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F1P A;  3VE4 A;  1N9O A;  4GHI B;  3LIA A;  4BBU A;  5HDS A;  3A0S A;  1T19 A;  3H82 B;  3NOT C;  2GJ3 A;  3E4P A;  1LL8 A;  2QJ7 A;  1DP8 A;  2A24 A;  4L9E A;  2ZBB A;  4WF0 A;  4R38 A;  1KOU A;  1LSV A;  4L9F A;  3RH8 B;  1GSV A;  1D7E A;  1XJ4 A;  2OWJ A;  5HSQ A;  2I9V A;  3EWK A;  3VOL A;  3LIE A;  1ODV A;  4BBT A;  2QWS A;  5J4E A;  5HDC A;  5DJU A;  4F3L B;  4NXF A;  4I39 A;  5DKK A;  5I5L A;  5G4Z A;  5G4Y A;  1N9N A;  1P97 A;  4HY8 A;  4NXG A;  4XT2 A;  4HIA A;  2V1B A;  4H6J A;  4LLO B;  5TBM B;  1WA9 A;  3IS2 B;  2PR5 A;  4HP9 A;  3F1P B;  2VLG A;  2V9A A;  3OLO A;  2H28 A;  3EEH A;  4WLA A;  4JGO A;  5AVE A;  2KX6 A;  3UB8 A;  2A24 B;  1LSX A;  1VB6 A;  4I3A A;  2VV7 A;  1EW0 A;  3MQO A;  3BWL A;  4R6L A;  4LRY C;  2D02 A;  3GEC A;  2WKR A;  3LID A;  2KDK A;  3LI9 A;  3UB6 A;  4HP4 A;  4JGQ A;  3BY8 A;  2EA9 A;  2W27 A;  3C8C A;  1GSX A;  4HH2 A;  4F3L A;  2M1C A;  4MN5 A;  5HWT A;  3UMD A;  4R70 A;  4KQD A;  2WKQ A;  1V9Y A;  5IU1 A;  4XT2 B;  1TS6 A;  3NOU C;  2PYP A;  1MZU A;  1UWP X;  3G6O A;  2B02 A;  1T18 A;  1X0O A;  3IS2 A;  2HV1 A;  1NWZ A;  2V0W A;  5EFW A;  3VE3 A;  3NHQ A;  4LPZ A;  3GDI A;  4NXB A;  1G28 A;  1XFN A;  4WN5 A;  3CLO A;  2L0W A;  1S66 L;  2CMN A;  3FG8 A;  3LUQ A;  1XJ6 A;  1UGU A;  1OTE A;  4LRZ E;  1DRM A;  2P7J A;  3LYX A;  4GW9 A;  2PDR A;  3A0V A;  4PKY G;  2YKH A;  1OT9 A;  1TS0 A;  5HD3 A;  4GCZ A;  2VV8 A;  4EET B;  2J80 A;  4PKY A;  1BYW A;  2Z6C A;  4HI4 A;  4I3J A;  3UE6 A;  3H9W A;  3KX0 X;  2OOL A;  3PYP A;  5F69 A;  3UB7 A;  1GSW A;  4E04 A;  1XJ3 A;  4DJ2 A;  4GS9 A;  5A8B A;  2PHY A;  5J3W A;  4EW7 A;  1XJ2 A;  4KUO A;  3ICY A;  4K08 A;  5F68 A;  2YKF A;  2L1M A;  4HNB A;  4HHD A;  3MR0 A;  3ZQ5 A;  4JGP A;  2Z6D A;  2ZOH A;  3PHY A;  3T50 A;  4M4X A;  1V9Z A;  1D06 A;  1S1Z A;  2VV6 A;  2V0U A;  2JHE A;  3F1O A;  3MQQ A;  4HJ4 A;  5HWW A;  1S4R A;  4YWZ A;  4KUK A;  1T1A A;  2QKP A;  3HJI A;  2PR6 A;  2VEA A;  2ZOI A;  4RQ9 A;  3HJK A;  1T1B A;  5HZH A;  5DKL A;  4GS9 B;  2PD7 A;  1Y28 A;  4JGR A;  2OWH A;  4I5S A;  4HJ3 A;  4BBV A;  3D72 A;  1OJG A;  3CWF A;  3LIF A;  2W0N A;  3F1N A;  3LI8 A;  1LT0 A;  3H7W A;  2INW A;  3E4O A;  1S67 L;  2PYR A;  3C2W A;  1DP9 A;  3ULF A;  3NOP C;  1F98 A;  4DJ3 A;  5AVF A;  1LSW A;  3LIC A;  3F1O B;  3K3D A;  3MXQ A;  1S1Y A;  2L4R A;  3NJA A;  4EEP A;  4WUJ A;  4HH3 A;  3MFX A;  2QJ5 A;  3E4Q A;  3MJQ A;  3CAX A;  4B9O A;  4EXO A;  2BAS A;  2PD8 A;  1P0Z A;  1OJ5 A;  1OTI A;  2D01 A;  3P7N A;  4WL9 A;  3BY9 A;  3K3C A;  5DJT A;  5KIZ A;  3UB9 A;  1F9I A;  2WKP A;  3SW1 A;  4EER A;  5IS1 A;  3F1N B;  5F6A A;  2K7S A;  3H7W B;  4L9G A;  1OTA A;  2V1A A;  1S4S A;  3A0R A;  4GHI A;  3FC7 A;  1TS7 A;  1XFQ A;  3H82 A;  1DP6 A;  4LRX C;  1OTB A;  3LIB A;  3RTY A;  2R78 A;  5J7E A;  4MN6 A;  1JNU A;  1T1C A;  5F5Y A;  1OTD A;  4HJ6 A;  4I38 A;  1UWN X;  4EQ1 A;  5HDD A;  4EES A;  2QHK A;  3IBR A;  4I3I A;  3UME A;  5HD5 A;  3B33 A;  1OT6 A;  4HOI A;  1TS8 A;  4H6J B;  4EEU A;  4NXE A;  5HWV A;  4HQA A;  2JN7 A;  4R3A A;  5TBM A;  1N9L A; 
#chains in the Genus database with same CATH topology
 2KLI A;  3NCK A;  1VQQ A;  2A3U A;  3O87 A;  4BBU A;  1GHM A;  3HLB A;  1T19 A;  2GJ3 A;  1D1J A;  1PWG A;  4S2N C;  2X02 A;  3LEQ A;  3D4F A;  3LEZ A;  2ZBB A;  4KEN B;  4ARZ B;  4ID4 A;  3ZG5 A;  1NYY A;  1XX2 A;  3CZD A;  4GD6 A;  1OPX A;  4K0W A;  1KOU A;  1VEU B;  4MLL A;  3EEA A;  1ONH A;  1GSV A;  1XJ4 A;  3GTC A;  4E6X A;  5HSQ A;  3G2Y A;  3EWK A;  4CLC C;  5EE8 A;  3MZE A;  4FOF A;  4NXF A;  4OON A;  3DWK A;  1PI5 A;  5G4Y A;  1P97 A;  1J9M A;  1CF0 A;  3Q7V B;  4HY8 A;  4HIA A;  2V1B A;  2XH9 A;  4H6J A;  5TR7 A;  4X6T A;  4OP5 A;  4KG2 A;  2EXA A;  4LLO B;  5TBM B;  1WYB A;  3C38 A;  3F1P B;  5KSC A;  3UO9 A;  5TGF A;  2PT7 A;  1SKF A;  2XF3 A;  4P6Z S;  2W3G A;  4BEN A;  2A24 B;  3IH9 A;  5L8M A;  1MWR A;  2ZQ7 A;  1FCO A;  2VV7 A;  3MQO A;  3NIA A;  3W4O A;  2QZ6 A;  3CUE C;  4S2P A;  1IYQ A;  1Y54 A;  3LI9 A;  4BQM A;  4JGQ A;  4BWI A;  1U60 A;  5A91 A;  2ZC7 A;  1FOF A;  1ES5 A;  4LEN A;  1ES2 A;  2WKH A;  4KQR A;  3C8C A;  2XR0 A;  1MXO A;  4OOL A;  1XPB A;  2XLN A;  3KSI A;  3G35 A;  3PBR A;  2ZM2 A;  4E3O A;  1K57 A;  1NJ4 A;  3BFF A;  2WUQ A;  3QNC A;  5E2H A;  1TS6 A;  5DFX A;  4GLQ A;  2Y2Q A;  2B02 A;  2C5W B;  2B95 A;  2PU4 A;  3IXG A;  3QP6 A;  2A2L A;  3K2N A;  1JTD A;  2ZMF A;  4QU3 A;  4LPZ A;  4NXB A;  4KQQ A;  1G28 A;  5FQJ A;  4L0L A;  4WN5 A;  4UEY A;  4IVI A;  1XXM A;  2HJE A;  3T1R A;  2CMN A;  4P85 A;  4C75 A;  3IF6 B;  3OBF A;  3C4P A;  1ESU A;  3A0V A;  3QNB A;  3HVF A;  3KYZ A;  3OPP A;  4GD8 A;  2HF6 A;  5F82 A;  2XA7 S;  3GRJ A;  1SKO A;  2XDM A;  2ZC4 B;  1NZO A;  2YKH A;  4B93 A;  1TS0 A;  5HD3 A;  4WZ4 A;  3KSH A;  2ZMV A;  2VK3 A;  3FYZ A;  1S6R A;  5E2E A;  1Z09 A;  1YLP A;  5FQI A;  2B5R A;  3T1S A;  3V50 A;  2XD1 A;  3WS2 A;  3V3S A;  3QP1 A;  3H9W A;  4G3K A;  4G3W A;  2OOL A;  1W63 M;  5F69 A;  3HCY A;  1GSW A;  4FH2 A;  3IH8 A;  4U0T A;  2Q9M A;  4DXC A;  4UAA A;  3AGE A;  1PWD A;  3OCL A;  4DJ2 A;  4XUX A;  5L09 A;  3PAG A;  2ZL1 A;  4PM6 A;  1G6O A;  5F68 A;  4OH0 A;  2L1M A;  5L10 A;  5IHV A;  4BMW A;  1PI4 A;  4JGP A;  3CUE A;  3O3V A;  2XRO A;  3PHY A;  5EVI D;  3Q07 A;  3T1X A;  1CEF A;  3PR6 A;  1DJC A;  2OV5 A;  1V9Z A;  1YMX A;  2B18 A;  5DTS A;  4MBH A;  2ZC3 B;  3F1O A;  3MQQ A;  1HTZ A;  4BJP A;  5CED A;  5HWW A;  2ZLY A;  4OOM A;  1JWZ A;  1K56 A;  1FSY A;  3MKF A;  3TE8 A;  1T1A A;  1RCJ A;  3HJI A;  2PR6 A;  1G68 A;  2V8C A;  1BLP A;  1T1B A;  3HRE A;  2J7V A;  3ZHH A;  4OQI A;  4JGR A;  3RFB A;  1NRF A;  2OWH A;  5TJJ A;  4WEK A;  4P0M A;  2JCH A;  4OQG A;  3EGX C;  1MWU A;  3CWF A;  3LIF A;  4Q0I A;  5KZH A;  4H8R A;  3EQV A;  2Y2K A;  3IXD A;  2W0N A;  2QPN A;  2WZZ A;  2JKR M;  3HLE A;  1CJF A;  1PRQ A;  2H5S A;  1VET B;  5GHZ A;  1F2K A;  2BG1 A;  4DE2 A;  2EXB A;  3HLD A;  5CHJ A;  3OZH A;  2P04 A;  4ZJ1 A;  2M7U A;  2EX6 A;  1F98 A;  4N9L A;  3LGO A;  3ITB A;  3CMZ A;  4X56 A;  1XA1 A;  2ZJ9 A;  3R7W B;  1EWZ A;  4MBF A;  3T12 B;  1S1Y A;  3CG5 A;  2FH5 A;  3LR3 A;  2DRW A;  1MBL A;  2W3D A;  4HH3 A;  1ZG6 A;  3IX3 A;  5FSR A;  1SCW A;  5FI6 A;  3NUL A;  3O88 A;  5EVI C;  3DWZ A;  3RJU A;  5FI2 A;  2V8F A;  3SS3 A;  3DAV A;  5CHU A;  3P7N A;  3KYQ A;  3BY9 A;  4KZ7 A;  5DJT A;  5KIZ A;  1YLW A;  2WK0 A;  3IX4 A;  3TRC A;  2G7U A;  3GSG A;  5F6A A;  3A3F A;  1SZV A;  1HD8 A;  2WKI A;  2XA7 M;  3SS4 A;  4L9G A;  1YLJ A;  1GHI A;  4Y15 A;  2V1A A;  4WYY A;  4BD1 A;  3M2K A;  4ZAM A;  1I5Q A;  3MZF A;  1TS7 A;  1L2S A;  4MN6 A;  3OCN A;  3VP0 A;  4DE1 A;  5EPH A;  1T1C A;  3W2Z A;  5KMW A;  3VFF A;  1MWT A;  4CJN A;  4ESP A;  3O86 A;  5GHY A;  4I38 A;  2QHK A;  3S7Q A;  3IBR A;  2VKS A;  4I3I A;  2VGK A;  1PZO A;  1K4E A;  2ACG A;  4JBF A;  1PW8 A;  4D60 A;  4X68 A;  2FFF B;  1YSQ A;  1LLB A;  4EQI A;  3CIT A;  2UV0 E;  1TS8 A;  1WE4 A;  2DNS A;  2JN7 A;  5EOO A;  2J8Y A;  5CGS A;  1EI5 A;  4IUH A;  3L7H A;  1ERO A;  4OVD A;  3U2A A;  2P9V A;  3VE4 A;  2EX9 A;  1N9O A;  1FIL A;  3NOT C;  2QJ7 A;  3G30 A;  4L9E A;  4G3V A;  1G6A A;  5CGX A;  1PWC A;  4R38 A;  1LSV A;  3IQA A;  4QD4 A;  3G31 A;  4OQ0 A;  2Y55 A;  1ODV A;  4BBT A;  4KQO A;  1TDL A;  5HFO A;  3A3E A;  5DKK A;  1K6S A;  5I5L A;  1N9N A;  1NXY A;  1ACF A;  4E3I A;  4XT2 A;  4NXG A;  4AFI A;  1YLZ A;  4CLC D;  1P9W A;  1IYO A;  4B88 A;  1O7E A;  2H28 A;  3DW0 A;  3EGD C;  5IT5 A;  3CPT A;  4JGO A;  4P6B A;  1PZP A;  4I3A A;  1EW0 A;  1STZ A;  4R6L A;  4LRY C;  2D02 A;  2W1T B;  1ES4 A;  2ZQC A;  2KDK A;  3ZCZ A;  5U47 A;  2JBF A;  2JKT M;  1BUL A;  2EA9 A;  3ZG8 B;  4KG6 A;  3BQ8 A;  1GSX A;  1XA7 A;  3LY3 A;  1XKZ A;  1GA9 A;  2M1C A;  5HWT A;  3UMD A;  2VX8 A;  4KQD A;  1YM1 A;  1TEM A;  3OPH A;  3NOU C;  3HLG A;  2PYP A;  1MZU A;  3IBJ A;  3BFG A;  1JTG A;  4DF6 A;  2X01 A;  3D9Y A;  1IKI A;  1SDN A;  5EOE A;  1C3B A;  1NWZ A;  4JXV A;  2IWC A;  3SH9 A;  3GDI A;  4N92 A;  3T1Q B;  2G2U A;  4NKP A;  1XFN A;  3EQU A;  3N4I A;  2ZM8 A;  1BUE A;  1KDW A;  2L0W A;  1MKI A;  3N8S A;  3GMW A;  2HDS A;  4NK3 A;  4LRZ E;  2KOI A;  1K4F A;  2W1T A;  3JPU A;  2QMI A;  3UN7 A;  4Z1W A;  4U3T A;  1LHY A;  2Y2G A;  1Y4O A;  4GJ4 A;  3MF0 A;  2Z6C A;  3HBR A;  1QME A;  1ES3 A;  4FH4 A;  5BOH A;  1BZA A;  4IVK A;  4OPQ A;  2Y2N A;  3PYP A;  1LL9 A;  1FCM A;  5FQ9 A;  2LB9 A;  3PBQ A;  4GS9 A;  2C6W B;  2PHY A;  4OPY A;  4EW7 A;  3PBN A;  4KUO A;  1PW1 A;  4CLC E;  5MC7 A;  2HDQ A;  2YKF A;  5A93 A;  4Y5F A;  3MR0 A;  5CTM A;  4JXG A;  1Z6F A;  2OLU A;  3ZQ5 A;  5TFQ A;  5A90 A;  3G2Z A;  2Z6D A;  4UA6 A;  4DE0 A;  1MKM A;  2IWB A;  4Q8I A;  4KZ6 A;  3N8L A;  1NY0 A;  5EVE A;  3HUO A;  3SZT A;  2H10 A;  3EOI A;  5F1F A;  1D06 A;  1SKO B;  4DKI A;  3HUN A;  3B42 A;  4ZRR A;  3FPV A;  3DTI A;  3JVV A;  2Q9N A;  2JKT I;  1CI8 A;  1YPR A;  3T4O A;  3JVU A;  1ZG4 A;  3UE3 A;  1WYC A;  5HPI A;  4OQH A;  1S4R A;  3FZC A;  3S7N A;  3E98 A;  4ME4 A;  5CER A;  3WS5 A;  3BM6 A;  2WGV A;  3IWQ A;  3PBT A;  5FL3 A;  2ZOI A;  3IHA A;  4S2I A;  4M3K A;  2ZL1 B;  1W7F A;  1MWS A;  4I5S A;  4HJ3 A;  3UPO A;  3RXW A;  5M18 A;  4S2N A;  3IXB A;  3D72 A;  3TW8 A;  3W8K A;  1AXB A;  3ZVT A;  1SHV A;  1IOU A;  3D3O A;  4DN0 A;  1KGF A;  3MZD A;  4JF6 A;  2OAQ 1;  1A0K A;  3LFV A;  4LV3 A;  4HBU A;  4RA7 A;  1LT0 A;  2IWD A;  4CLC A;  5HW3 A;  1YMS A;  2Q0O A;  3NC8 A;  4Y0U A;  2PYR A;  3C2W A;  4E3K A;  3C7U A;  2NUP C;  1LI9 A;  4WM9 A;  5AQB A;  1KE3 A;  4MN7 A;  3WRT A;  1G5U A;  3F1O B;  3FKW A;  4GKU A;  1YQS A;  3N6I A;  1DY6 A;  3K3D A;  4K0X A;  4Y3I A;  5EM1 A;  2L4R A;  5FQQ A;  1KGG A;  2QYB A;  2QJ5 A;  3GVB A;  1TDG A;  3ZDJ A;  2WKE A;  1Q2P A;  3DTK A;  1XGI A;  1P0Z A;  1OJ5 A;  4BL3 A;  5DFY A;  3ZNT A;  4Q0H A;  3TJZ C;  1IEL A;  1FIK A;  3UB9 A;  2PRF A;  1F9I A;  1LL5 A;  3SW1 A;  4EER A;  2K7S A;  4RX3 A;  1S4S A;  3A0R A;  4GHI A;  5CHM A;  1E3U D;  3SOI A;  3H82 A;  2W3E A;  3C5A A;  4YFM A;  5EVL A;  4ZTK A;  1DP6 A;  4Y17 A;  1P9R A;  3LIB A;  3VMA A;  3RTY A;  2XQZ A;  2P08 A;  2XD5 A;  2XGN A;  4YNR A;  5FDH A;  1W5D A;  1K54 C;  2HP6 A;  4C3Q A;  1M40 A;  4EU0 A;  1PFL A;  4HJ6 A;  3IXH A;  4EQ1 A;  4DDY A;  5CTN A;  5HDD A;  4P6Z M;  2J9P A;  4WEL A;  1TVF A;  3B33 A;  3ZG0 A;  1ERM A;  1PNE A;  3GQZ A;  2J3W A;  3PTE A;  1E25 A;  2Y2I A;  3ZYT A;  4R3B A;  3T4L A;  2Z2M B;  3QP5 A;  4NXE A;  2Y2J A;  3BRM A;  4S2K A;  3DTM A;  4KZ9 A;  1HLU P;  4N1H A;  4X1M A;  3C30 A;  1LL8 A;  5HX9 A;  3M2J A;  4MMN A;  2VZW A;  3UB5 P;  2A49 A;  1K55 C;  3Q81 A;  3MSH A;  4UA9 A;  4FTX A;  4L9F A;  5HAP A;  4S2M A;  4EUV A;  1D7E A;  2O99 A;  1FR1 A;  1K38 A;  5DF7 A;  3VOL A;  3LIE A;  2QWS A;  5J4E A;  1BT5 A;  1BTL A;  1N4O A;  5C5K A;  2K2N A;  3U4L P;  5DJU A;  4F3L B;  3LR5 A;  4DMZ A;  1M6K A;  1TF1 A;  5FQK A;  4LV2 A;  2WAE A;  1L0G A;  2ZC6 B;  3BQA A;  4R3J A;  2JE5 A;  1YT4 A;  2P74 A;  3IWI A;  3TSG A;  3NI9 A;  3GV9 A;  1WA9 A;  3PBS A;  1IFQ A;  4YOF A;  2P9V B;  4X53 A;  5FAT A;  2VA0 A;  4C6Y A;  4KZB A;  5GHX A;  2Y2H A;  2O9C A;  1GHP A;  3UB8 A;  4HEF A;  1LSX A;  3HLF A;  1W8Q A;  4D2O A;  1K54 A;  3Q82 A;  4MBK A;  5HL6 A;  3BLS A;  3GEC A;  2WAF A;  1YLY A;  2WKR A;  3LID A;  3QHY A;  5DVA A;  4EV4 A;  3UB6 A;  4HP4 A;  1IYS A;  2W27 A;  5EVI B;  1RP5 A;  4B4Z A;  1SDE A;  2HDU A;  1FQG A;  4F3L A;  4R70 A;  5DTK A;  4EUZ A;  1HVB A;  3A3J A;  4XT2 B;  4LV0 A;  4GN2 A;  3G34 A;  2HP9 A;  1UWP X;  4Y13 A;  3HLW A;  3Q7Z A;  4Y0O A;  5GLD A;  5D3O A;  2WGW A;  2JKR I;  3NY4 A;  1DJA A;  3CPT B;  4E3L A;  3LR0 A;  4WZ5 C;  4OKP A;  1K55 A;  2V20 A;  4OLD A;  3CLO A;  1JWV A;  2DMW A;  3BYD A;  3LY4 A;  4A5R A;  3RXX A;  1S66 L;  4O7D A;  3LUQ A;  1XJ6 A;  1OTE A;  2O0Y A;  2E8I A;  3LYX A;  4GW9 A;  4X55 A;  5EV0 A;  3IWO A;  3WS0 A;  4PAU A;  5EVI A;  4Y7P A;  1GA0 A;  1E3U A;  4EET B;  2J80 A;  4PKY A;  4LCL A;  4E3J A;  5EEC A;  4R23 A;  4HI4 A;  4PM9 A;  2Y2M A;  4UHU A;  5CXW A;  3UE6 A;  2ZMA A;  3NDG A;  1NLY A;  3KX0 X;  3CI6 A;  5HAI A;  1KE0 A;  2WZX A;  1XJ3 A;  3UNW A;  4E04 A;  3A3I A;  4BL2 A;  3BFC A;  4QY6 A;  4DRT A;  5J3W A;  3VSL A;  3ICY A;  4KZ4 A;  4K08 A;  2VGJ A;  1PYY A;  4HNB A;  1ALQ A;  4GNU A;  1W8Y A;  4GZB A;  1O07 A;  2XFT A;  2Y8H A;  1BLC A;  5LBR A;  2ZQ9 A;  3BEB A;  5M1A A;  2ZOH A;  1BLS A;  4PPR A;  3T50 A;  3V5M A;  4M4X A;  4WMC D;  1I2S A;  1KDS A;  1S1Z A;  2VV6 A;  4OLG A;  3UDX A;  3P98 A;  4FCF A;  4QY5 A;  3ZFZ A;  4X69 A;  3VFH A;  4JF4 A;  3V67 A;  4MEZ A;  5A92 A;  5FAS A;  3FV7 A;  4YWZ A;  4ZJ3 A;  1BSG A;  2O9B A;  5GLC A;  2VEA A;  3VOY A;  3HJK A;  2J9O A;  5DKL A;  4GS9 B;  5F1G A;  4KZ5 A;  1Y28 A;  3FWL A;  2Y91 A;  4KZ3 A;  2VGL S;  3AGD A;  2AVX A;  3T4K A;  3B3X A;  4LGW A;  3ZVW A;  1YLT A;  1OJG A;  4QJG A;  3BJN A;  2FZ0 A;  3T4S A;  3VP2 A;  5FI7 A;  2JC7 A;  1H8M A;  3F1N A;  5FDS A;  5AQA A;  3UPN A;  3LI8 A;  3H7W A;  2WGI A;  3MS6 A;  1L3L A;  4LV1 A;  4EBL A;  3MFD A;  4R1G A;  4XUZ A;  3UDF A;  4K91 A;  3V3R A;  2XSS A;  4Y0T A;  1K56 D;  4F94 A;  3LIC A;  4PMA A;  3ZGA B;  4Y2F A;  2VJW A;  4ZDX A;  4WUJ A;  3UY6 A;  1IEM A;  3IHB A;  3MFX A;  5EM0 A;  2JKG A;  3LCE A;  3CAX A;  4EXO A;  5GLB A;  1F5M A;  4JKT A;  2PD8 A;  5CGW A;  4WEJ A;  3JYI A;  3WS4 A;  2D01 A;  4S2O A;  4WL9 A;  5HAQ A;  4PM8 A;  3IF5 A;  5I94 A;  3K3C A;  3KYE A;  3SH7 A;  4B4X A;  2WKP A;  3QP8 A;  5AQ9 A;  5IS1 A;  4QPR A;  1CQA A;  5L2F A;  1XGJ A;  5FAP A;  4DE3 A;  2ZQD A;  4ZBE A;  4CLC B;  1KVL A;  3FC7 A;  1YAX A;  1FR6 A;  4LRX C;  2EFX A;  2R78 A;  5J7E A;  4IED A;  5FQM A;  2JKF A;  4ARZ A;  3IT9 A;  2Y2O A;  1MY8 A;  4GDN A;  4GB7 A;  3S22 A;  1VEU A;  2EFU A;  2GDN A;  2WAD A;  2XRN A;  3BW6 A;  1L0D A;  4X25 A;  1OTD A;  3M6H A;  3PBO A;  3IF6 C;  4NEE D;  2FFY A;  1TD5 A;  2V1Z A;  4ETZ A;  3DTE A;  1H0M A;  3UME A;  4MCW A;  2EX2 A;  1ERQ A;  4ETX A;  3KO6 A;  3BFD A;  5EUA A;  3Q7V A;  3HUM A;  1NYM A;  4HOI A;  4EEU A;  4HQA A;  3QP4 A;  3MMH A;  1H8Y A;  5TBM A;  1N9L A;  1S0W A;  3F1P A;  4CQH A;  4QHC A;  1MC0 A;  4GHI B;  3LIA A;  5HDS A;  4ZJ2 A;  4RYE A;  3A0S A;  3H82 B;  3E4P A;  1YSP A;  2BTF P;  1DP8 A;  2A24 A;  3IX8 A;  1JWP A;  4FSF A;  4BD0 A;  2Y59 A;  4WF0 A;  4PM7 A;  1HZO A;  2OAP 1;  3VV4 A;  5AJG A;  3RH8 B;  3MXS A;  3LR4 A;  2OWJ A;  2VGL M;  2I9V A;  2H0Y A;  5HDC A;  4WMC A;  1H5X A;  2RCX A;  3T4J A;  3WWX A;  1XP4 A;  3B47 A;  3C4O A;  4I39 A;  5G4Z A;  4RX2 A;  2EWW A;  4BLM A;  3PAE A;  4JXW A;  4LCM A;  3P09 A;  2Y4A A;  2H0T A;  3IS2 B;  2J3T D;  2PR5 A;  4HP9 A;  4EBP A;  1K0K A;  2VLG A;  4MNR A;  5CEC A;  2V9A A;  3OLO A;  1LI0 A;  1ZHH B;  3EEH A;  1KGE A;  5G18 A;  1MPL A;  3BLM A;  4WLA A;  1QMF A;  4N1X A;  5AVE A;  5GLA A;  2KX6 A;  5K5B A;  2PAV P;  1VB6 A;  3N8R A;  1RGY A;  3HL9 A;  4IJG A;  5FA7 A;  3BWL A;  2PU2 A;  3E2K A;  4NG2 A;  3IF6 A;  5HPF A;  2BLS A;  3BY8 A;  4KG5 A;  4X1L A;  4OPZ A;  4E3M A;  4HH2 A;  5L07 A;  3W4P A;  2Y79 A;  4MN5 A;  3S7P A;  2HZ5 A;  2Y2P A;  3UE1 A;  4UQI S;  3OOV A;  4HBT A;  4JF5 A;  3UE0 A;  5CX7 A;  2DCF A;  2WKQ A;  1L0F A;  1V9Y A;  5IU1 A;  1JVJ A;  3G4P A;  3G32 A;  4WBG A;  2XEP A;  4JPM A;  3G6O A;  1H8Z A;  1L0E A;  1T18 A;  1CEG A;  1X0O A;  3CJM A;  3IS2 A;  1YKD A;  2HV1 A;  2G2W A;  5E43 A;  4LFU A;  2M7V A;  2V0W A;  5EFW A;  4P87 A;  3VE3 A;  1DJB A;  3NHQ A;  4O8G A;  4R4S A;  3QP2 A;  1KVM A;  3P01 A;  5E2F A;  3UPP A;  3A3D A;  4QB8 A;  1I2W A;  5CEB A;  3FG8 A;  1UGU A;  1DRM A;  2P7J A;  2HP5 A;  2PDR A;  3VOZ A;  2V2F F;  4IBR A;  3L9K A;  2XK1 A;  3V39 A;  1NLZ A;  1N9B A;  4PKY G;  1VHM A;  3TG9 A;  4JXS A;  1OT9 A;  5FEG A;  4GCZ A;  2J3T C;  2VV8 A;  3NDE A;  1BYW A;  5GL9 A;  4MDZ A;  1IKG A;  3LO7 A;  4I3J A;  4R0Q A;  3PXP A;  3VSK A;  2IA2 A;  1W79 A;  1W63 Q;  3UB7 A;  5DTT A;  4E3N A;  3T4Q A;  5HL1 A;  4R4R A;  3S7O A;  5A8B A;  4FUW A;  5F83 A;  5KSH A;  1XJ2 A;  2WGW B;  3HLC A;  2XFS A;  4FD8 A;  3ZNY A;  4HHD A;  4PM5 A;  1VM1 A;  4UA7 A;  4KZ8 A;  4CPK A;  4S2L A;  3NBL A;  2PBY A;  2W3H A;  3C7V A;  1CI9 A;  4N9K A;  5E2G A;  1AWI A;  1VET A;  2ZM0 A;  3DBA A;  2E8J A;  5FAO A;  3TOI A;  3BEC A;  2OLV A;  3E0Y A;  2V0U A;  1Q2Q A;  2JHE A;  1BLH A;  4O0P A;  5DF8 A;  4HJ4 A;  3R7W A;  2Y2L A;  4OPR A;  2EWV A;  3WRZ A;  2MJ6 A;  3M6B A;  4KUK A;  4O01 A;  2PBD P;  2QKP A;  3Q1F A;  3NEC A;  3ISG A;  1NRJ A;  3SH8 A;  4RQ9 A;  3BFE A;  2ZC5 B;  5AQ7 A;  4YIN A;  4IHQ A;  5HZH A;  2PD7 A;  3CHW P;  2O9A A;  4U0X A;  1CK3 A;  4BBV A;  2X71 A;  5J8X A;  1K25 A;  3MKE A;  3KSF A;  4IBX A;  1OME A;  2HPB A;  3ZG7 B;  1KE4 A;  4OP8 A;  2R9X A;  3S4X A;  3VP4 A;  2GNX A;  3I7J A;  4QWO A;  4DXB A;  2ZQA A;  1FCN A;  2INW A;  2ZD8 A;  4GDB A;  3E4O A;  4GOG A;  2K31 A;  4Q0J A;  1S67 L;  1DP9 A;  4UQI M;  4OOY A;  3ULF A;  3MBZ A;  2HDR A;  1ZC2 A;  3NOP C;  4NET A;  4EBN A;  4DJ3 A;  5AVF A;  4S2J A;  4EWF A;  1LSW A;  5DF9 A;  2GZA A;  2LB5 A;  3MXQ A;  3T4T A;  3WS1 A;  1H3Q A;  5FEF A;  3ITA A;  3NJA A;  3O5Y A;  3OPR A;  4EEP A;  3FKV A;  2ZQ8 A;  4PHT A;  3E4Q A;  3MJQ A;  2HJ9 C;  1RGZ A;  2UWX A;  4B9O A;  5CRF A;  1K6R A;  2BAS A;  3W4Q A;  1OTI A;  3AGF A;  4RVA A;  1ZKJ A;  5FAQ A;  1ZTU A;  3VP3 A;  3F1N B;  3ZG9 B;  1NZU A;  1E4D A;  1ESI A;  3H7W B;  1OTA A;  3VP1 A;  2CC1 A;  3MQ0 A;  3UDI A;  3SS5 A;  1XFQ A;  4DDS A;  3R4K A;  1OTB A;  4E6W A;  2NUT C;  5JYO A;  4JLF A;  5M19 A;  3E2L A;  4II7 A;  4IUK A;  2EX8 A;  1JNU A;  4HES A;  3KSG A;  1IYP A;  5F5Y A;  2I72 A;  2Z2L B;  2GX5 A;  2R9W A;  2WYX A;  3GR2 A;  1GCE A;  1UWN X;  3OC2 A;  4EES A;  3FPW A;  2HGV A;  3S1Y A;  4WZ5 A;  1ONG A;  4Z9Q A;  1FSW A;  5HD5 A;  2OSU A;  1OT6 A;  2W3F A;  4KZA A;  1PIO A;  5HAR A;  2RL3 A;  4XXR A;  1J3W A;  2W1R A;  3MXR A;  3OPL A;  5JYP A;  4H6J B;  1K57 C;  5HWV A;  4R3A A;  3N7W A; 
#chains in the Genus database with same CATH homology
 3U2A A;  2KLI A;  3F1P A;  3VE4 A;  4CQH A;  1MC0 A;  1N9O A;  4GHI B;  3LIA A;  4BBU A;  5HDS A;  3A0S A;  3C30 A;  1T19 A;  3H82 B;  3NOT C;  2GJ3 A;  3E4P A;  1LL8 A;  1YSP A;  2QJ7 A;  1DP8 A;  2A24 A;  4L9E A;  4FSF A;  4G3V A;  2ZBB A;  4MMN A;  2VZW A;  4ARZ B;  4WF0 A;  4R38 A;  1OPX A;  1KOU A;  1LSV A;  3EEA A;  2OAP 1;  3VV4 A;  4L9F A;  5AJG A;  3RH8 B;  4EUV A;  1GSV A;  1D7E A;  1XJ4 A;  2O99 A;  3LR4 A;  2OWJ A;  5HSQ A;  2VGL M;  2I9V A;  3EWK A;  3VOL A;  3LIE A;  4CLC C;  1ODV A;  4BBT A;  4KQO A;  2QWS A;  4FOF A;  5J4E A;  5HDC A;  5C5K A;  2K2N A;  5DJU A;  4F3L B;  3T4J A;  4NXF A;  3B47 A;  3LR5 A;  4DMZ A;  1TF1 A;  4I39 A;  5DKK A;  5I5L A;  5G4Z A;  5G4Y A;  2EWW A;  1N9N A;  1P97 A;  4HY8 A;  4NXG A;  3BQA A;  4XT2 A;  4HIA A;  2V1B A;  4AFI A;  4H6J A;  4CLC D;  4LLO B;  5TBM B;  1WA9 A;  3PBS A;  1IFQ A;  3IS2 B;  4YOF A;  2J3T D;  2PR5 A;  3C38 A;  1P9W A;  4HP9 A;  3F1P B;  2VLG A;  2V9A A;  3OLO A;  2H28 A;  2VA0 A;  3EGD C;  1ZHH B;  3EEH A;  5IT5 A;  2PT7 A;  4JGO A;  4WLA A;  2O9C A;  4P6Z S;  5AVE A;  2KX6 A;  3UB8 A;  2W3G A;  5K5B A;  2A24 B;  1LSX A;  5L8M A;  1VB6 A;  4I3A A;  4IJG A;  2VV7 A;  1EW0 A;  1STZ A;  3MQO A;  3BWL A;  4R6L A;  4LRY C;  5HL6 A;  2D02 A;  2W1T B;  3GEC A;  2WKR A;  3CUE C;  3LID A;  5HPF A;  2KDK A;  3LI9 A;  3UB6 A;  4HP4 A;  4JGQ A;  4BWI A;  3BY8 A;  2JKT M;  2EA9 A;  2W27 A;  3C8C A;  3BQ8 A;  1GSX A;  4HH2 A;  4F3L A;  4OOL A;  2Y79 A;  3KSI A;  2M1C A;  4MN5 A;  5HWT A;  3S7P A;  3UMD A;  3PBR A;  4UQI S;  3OOV A;  4R70 A;  2VX8 A;  4KQD A;  2WKQ A;  5CX7 A;  1V9Y A;  5IU1 A;  4XT2 B;  1TS6 A;  5DFX A;  3NOU C;  4GLQ A;  2PYP A;  1MZU A;  1UWP X;  3G6O A;  2B02 A;  3IBJ A;  1T18 A;  1X0O A;  3IS2 A;  2A2L A;  3K2N A;  1YKD A;  2HV1 A;  2ZMF A;  2JKR I;  1NWZ A;  2M7V A;  2V0W A;  5EFW A;  3VE3 A;  3LR0 A;  4O8G A;  3NHQ A;  4LPZ A;  3GDI A;  3P01 A;  4NXB A;  4NKP A;  1G28 A;  1XFN A;  4L0L A;  4WN5 A;  3EQU A;  4UEY A;  3CLO A;  2DMW A;  2L0W A;  2HJE A;  1S66 L;  2CMN A;  3FG8 A;  3LUQ A;  1XJ6 A;  1UGU A;  1OTE A;  2O0Y A;  4LRZ E;  1DRM A;  2KOI A;  2P7J A;  3OBF A;  3LYX A;  2W1T A;  4GW9 A;  4Z1W A;  2PDR A;  3A0V A;  3KYZ A;  2HF6 A;  1NLZ A;  4PKY G;  4PAU A;  1VHM A;  2XA7 S;  2YKH A;  1OT9 A;  1TS0 A;  5HD3 A;  4B93 A;  4GCZ A;  3KSH A;  2ZMV A;  2J3T C;  2VV8 A;  4EET B;  4GJ4 A;  2J80 A;  4PKY A;  3MF0 A;  1BYW A;  4MDZ A;  2Z6C A;  4HI4 A;  4I3J A;  3PXP A;  3UE6 A;  2IA2 A;  3H9W A;  4G3K A;  4G3W A;  1NLY A;  3KX0 X;  1W63 Q;  1W63 M;  2OOL A;  3CI6 A;  3PYP A;  5F69 A;  3HCY A;  3UB7 A;  1GSW A;  4E04 A;  1XJ3 A;  3T4Q A;  3OCL A;  4DJ2 A;  2LB9 A;  3PBQ A;  4GS9 A;  3S7O A;  5A8B A;  2PHY A;  5J3W A;  5KSH A;  4EW7 A;  1XJ2 A;  3PBN A;  4KUO A;  3ICY A;  4CLC E;  1G6O A;  4K08 A;  5MC7 A;  5F68 A;  2YKF A;  2L1M A;  4HNB A;  4HHD A;  4Y5F A;  3MR0 A;  2Y8H A;  4BMW A;  3ZQ5 A;  5LBR A;  4JGP A;  2W3H A;  3CUE A;  2Z6D A;  1MKM A;  2ZOH A;  2XRO A;  3PHY A;  3T50 A;  3PR6 A;  4M4X A;  3EOI A;  3DBA A;  1V9Z A;  1D06 A;  1S1Z A;  2VV6 A;  3E0Y A;  2V0U A;  4ZRR A;  3B42 A;  2B18 A;  2JHE A;  3FPV A;  3JVV A;  4O0P A;  2JKT I;  3T4O A;  3F1O A;  3JVU A;  3MQQ A;  3UE3 A;  3V67 A;  4BJP A;  4HJ4 A;  3R7W A;  5HPI A;  5HWW A;  1S4R A;  2EWV A;  2MJ6 A;  4OOM A;  3S7N A;  3E98 A;  4YWZ A;  3TE8 A;  4KUK A;  4ME4 A;  1T1A A;  4O01 A;  2QKP A;  2O9B A;  3HJI A;  2PR6 A;  3PBT A;  1NRJ A;  5FL3 A;  2VEA A;  2ZOI A;  4RQ9 A;  3HJK A;  1T1B A;  4IHQ A;  5HZH A;  5DKL A;  4GS9 B;  2PD7 A;  1Y28 A;  4JGR A;  3RFB A;  2OWH A;  2O9A A;  5TJJ A;  4I5S A;  4WEK A;  4HJ3 A;  2VGL S;  3T4K A;  4BBV A;  3D72 A;  3TW8 A;  1OJG A;  3EGX C;  3CWF A;  3KSF A;  1IOU A;  3D3O A;  3BJN A;  3LIF A;  4Q0I A;  4DN0 A;  3EQV A;  2FZ0 A;  3T4S A;  2W0N A;  1H8M A;  2OAQ 1;  3F1N A;  2JKR M;  3LFV A;  2GNX A;  3LI8 A;  1LT0 A;  3H7W A;  2INW A;  4CLC A;  3E4O A;  2K31 A;  4Q0J A;  1S67 L;  2P04 A;  2PYR A;  3C2W A;  1DP9 A;  2NUP C;  4UQI M;  2M7U A;  3ULF A;  3NOP C;  1F98 A;  4DJ3 A;  5AVF A;  2XSS A;  1LSW A;  3LIC A;  4MN7 A;  3F1O B;  5DF9 A;  2GZA A;  2LB5 A;  3R7W B;  4Y2F A;  2VJW A;  3K3D A;  3MXQ A;  3T4T A;  4Y3I A;  1S1Y A;  1H3Q A;  2L4R A;  2FH5 A;  3LR3 A;  3NJA A;  3O5Y A;  4EEP A;  4WUJ A;  2W3D A;  4HH3 A;  2QYB A;  3MFX A;  2QJ5 A;  4PHT A;  3E4Q A;  3MJQ A;  2HJ9 C;  3CAX A;  4B9O A;  4EXO A;  1F5M A;  2BAS A;  2PD8 A;  1P0Z A;  4WEJ A;  1OJ5 A;  5DFY A;  1OTI A;  2D01 A;  3P7N A;  4Q0H A;  3TJZ C;  4WL9 A;  3KYQ A;  3BY9 A;  3K3C A;  5DJT A;  5KIZ A;  3UB9 A;  1F9I A;  1ZTU A;  2WKP A;  3SW1 A;  3TRC A;  4EER A;  2G7U A;  5IS1 A;  3F1N B;  4QPR A;  5F6A A;  2XA7 M;  2K7S A;  3H7W B;  4L9G A;  1OTA A;  2V1A A;  3MQ0 A;  1S4S A;  3A0R A;  4GHI A;  4CLC B;  3FC7 A;  1YAX A;  1TS7 A;  1XFQ A;  3H82 A;  2W3E A;  3R4K A;  1DP6 A;  4LRX C;  1OTB A;  1P9R A;  3LIB A;  2NUT C;  3RTY A;  2R78 A;  5J7E A;  4MN6 A;  2P08 A;  4II7 A;  4IUK A;  4ARZ A;  3OCN A;  4YNR A;  1JNU A;  1T1C A;  3W2Z A;  3KSG A;  2XRN A;  3BW6 A;  5F5Y A;  1OTD A;  2GX5 A;  3PBO A;  4EU0 A;  4HJ6 A;  4NEE D;  4I38 A;  1UWN X;  4EQ1 A;  1TD5 A;  3OC2 A;  5HDD A;  4ETZ A;  4EES A;  4P6Z M;  2QHK A;  3S7Q A;  3IBR A;  3FPW A;  2VKS A;  4WEL A;  4I3I A;  3UME A;  2HGV A;  4MCW A;  5HD5 A;  3B33 A;  1OT6 A;  2W3F A;  2J3W A;  4ETX A;  3KO6 A;  2W1R A;  1YSQ A;  3ZYT A;  3CIT A;  4HOI A;  3T4L A;  1TS8 A;  4H6J B;  4EEU A;  4NXE A;  5HWV A;  4HQA A;  2JN7 A;  3MMH A;  4R3A A;  4IUH A;  5TBM A;  1N9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...