2HV1A

Haddock structure of arnt pas-b homodimer
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
CQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aryl hydrocarbon receptor nuclear translocator
publication title Practical aspects of using paramagnetic relaxation enhancements for protein docking: Application to the ARNT PAS-B homodimer
rcsb
source organism Homo sapiens
molecule tags Transcription, protein binding
total genus 32
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2hv1A01
1S1YA 1XJ4A 3GDIA 4BBTA 2VEAA 2WKQA 4WL9A 4HY8A 1DRMA 4LRYC 2BASA 3MFXA 3LIFA 5HWVA 3SW1A 2PD8A 1T19A 2V0UA 2A24B 3FC7A 2YKFA 3UB9A 3LYXA 4LRXC 4R70A 1LSVA 4JGRA 1N9NA 3FG8A 2CMNA 2WKRA 5A8BA 3NJAA 3NOUC 3CWFA 1T1AA 4WUJA 4EESA 4GS9A 2Z6CA 4EETB 4JGQA 3VOLA 3C2WA 5F69A 4NXGA 3RH8B 4L9FA 2GJ3A 4M4XA 1MZUA 4HQAA 4F3LA 2D02A 3E4PA 2R78A 5G4ZA 2QKPA 4GHIB 5HSQA 3UE6A 4GS9B 3F1NB 2ZOHA 2QWSA 4XT2A 1T18A 1XJ6A 4I3AA 4HH2A 3PYPA 5HD3A 1TS7A 4F3LB 1XFQA 2PR5A 3K3DA 4EERA 4RQ9A 2Z6DA 4NXBA 1LL8A 4LPZA 1G28A 1TS8A 4XT2B 2V9AA 2M1CA 4WN5A 3F1OB 3ICYA 3F1PA 4I5SA 1OJ5A 5G4YA 3MQQA 5TBMA 4HJ4A 1T1CA 2YKHA 3UB8A 2QJ5A 5F5YA 4EW7A 1LSXA 1OT9A 3LIDA 3BY9A 1BYWA 3IS2A 4EEPA 5KIZA 3F1PB 4NXFA 1D7EA 3ULFA 5TBMB 2PD7A 1OTAA 4MN6A 3OLOA 1S1ZA 1LT0A 4I39A 2H28A 2I9VA 1OT6A 1UWPX 3MXQA 4GCZA 1S67L 5HDSA 1S4SA 1KOUA 4NXEA 3IS2B 4PKYG 4HNBA 3LIBA 1TS0A 2W0NA 1XJ3A 2P7JA 1DP6A 1JNUA 4R38A 3VE4A 4BBUA 2B02A 3H82A 2KDKA 4HJ3A 3T50A 1UWNX 4HP9A 3LUQA 4JGPA 1DP9A 3E4OA 1OTIA 1T1BA 1OTBA 2OWHA 3UB7A 3MJQA 5HDCA 4WLAA 2PHYA 5HZHA 4HOIA 2PDRA 1N9OA 5EFWA 3PHYA 3H82B 3HJKA 1XFNA 4LRZE 5HWWA 3NOTC 1X0OA 1ODVA 1P0ZA 1OJGA 2VV6A 2PYPA 3MQOA 3A0RA 1GSWA 5F6AA 3CLOA 1S4RA 2OWJA 3NOPC 1DP8A 3KX0X 4EXOA 1TS6A 4YWZA 5J4EA 3LI8A 2PYRA 4H6JA 4DJ2A 5J3WA 1WA9A 3NHQA 4GW9A 2JN7A 1LSWA 2OOLA 4HP4A 5DKKA 2D01A 4HH3A 2V1AA 5AVEA 3H7WA 5HDDA 3LIEA 4WF0A 2J80A 5HD5A 3A0VA 2ZBBA 4H6JB 1Y28A 1GSVA 5HWTA 4KUOA 2INWA 5AVFA 3LIAA 3HJIA 1F98A 2L1MA 3P7NA 4K08A 3GECA 4KQDA 3ZQ5A 3UB6A 2V1BA 2L0WA 2ZOIA 3H7WB 3E4QA 2WKPA 3G6OA 1V9YA 3UMEA 4KUKA 2PR6A 2VV8A 5DKLA 1VB6A 4HIAA 4I3IA 3RTYA 5DJTA 2KX6A 4JGOA 4EEUA 1D06A 4HHDA 4L9EA 3A0SA 4GHIA 1V9ZA 3F1NA 3VE3A 3LICA 4BBVA 3IBRA 3D72A 5F68A 4MN5A 2VV7A 4I3JA 1OTDA 5DJUA 4DJ3A 4E04A 1N9LA 1GSXA 2HV1A 4L9GA 2JHEA 1UGUA 3B33A 1P97A 1OTEA 2VLGA 4EQ1A 5J7EA 3MR0A 4R6LA 4HI4A 4PKYA 3F1OA 1XJ2A 4B9OA 2QHKA 4HJ6A 5I5LA 5IU1A 2QJ7A 3BY8A 2W27A 3EWKA 3K3CA 1EW0A 3EEHA 3UMDA 1S66L 2K7SA 2V0WA 3H9WA 4R3AA 1NWZA 5IS1A 2EA9A 2L4RA 3CAXA 2A24A 1F9IA 3BWLA 4I38A 4LLOB 3C8CA 3LI9A
chains in the Genus database with same CATH superfamily
3ZG7B 1KDWA 4GJ4A 3ISGA 3IXHA 5FQ9A 1ESIA 4F94A 5AQBA 4WL9A 1QMEA 4HY8A 2C6WB 3G32A 3QP6A 3O3VA 2QYBA 5MC7A 2Y2GA 2XROA 3AGFA 1K56A 3UB9A 3QP2A 3VOZA 1G6AA 1PI5A 3C38A 2A3UA 2VGKA 2IWBA 1BTLA 1MC0A 1NXYA 4ID4A 3TRCA 1N9NA 1CEGA 5FI2A 2HPBA 5KSCA 4N9LA 3LEZA 2WKRA 5A92A 2EFUA 3T4SA 1Z6FA 1E25A 3HUNA 1JWZA 3M6BA 2Z6CA 1WYCA 4EETB 3GTCA 5F83A 1RGZA 4JGQA 1YSQA 3HLCA 2JKGA 5F69A 1W63Q 5GLAA 3WRZA 1SDNA 5E43A 2D02A 3OPRA 1SKFA 2OLUA 2QKPA 2Y2OA 5HSQA 2ZL1A 4P87A 3T1XA 3IX8A 2ZOHA 5CGXA 3ZG5A 4XT2A 4OH0A 3SZTA 2XH9A 1F5MA 1VEUB 4HH2A 4K0XA 5E2GA 4E6WA 4S2LA 1IYQA 1TS7A 5FL3A 1XFQA 3QP5A 1YLWA 1K4FA 3E2LA 3UE1A 4WEKA 3N8LA 4S2MA 1G28A 2V9AA 3OC2A 4RA7A 2QPNA 4UA9A 4IHQA 3OPLA 3F1PA 3T1RA 2J3WA 1OJ5A 2VJWA 5DFYA 1XA7A 4BLMA 1T1CA 3N8SA 1GHPA 2V20A 3N7WA 5L10A 2Y2IA 2GDNA 3WS0A 3ZHHA 2E8IA 2W1TA 4KZAA 4B93A 2V2FF 3OBFA 1KGGA 1LSXA 4CLCE 1K0KA 1OT9A 4FD8A 5KIZA 3FWLA 4NXFA 3DAVA 5TBMB 2ZM0A 3CJMA 4JF6A 1BUEA 4MN6A 1ONHA 4D60A 4CLCA 3N4IA 3OLOA 4ESPA 1RGYA 3CUEA 1CI9A 1L3LA 2I9VA 1OT6A 1UWPX 3MXQA 3UO9A 3DW0A 3GRJA 1VM1A 2PT7A 4MBKA 5HDSA 1S6RA 1KOUA 3P01A 4IUKA 5F1GA 4PKYG 4HNBA 5TJJA 4DRTA 1HD8A 1DY6A 1ZHHB 3EOIA 2W0NA 4JF5A 3V3RA 2P7JA 3MBZA 2Y2LA 3C7VA 2HP6A 1JNUA 2B02A 2H0TA 4IUHA 4HJ3A 1IKGA 3S7QA 4X55A 1STZA 1UWNX 1ZG4A 4JGPA 3HREA 4HEFA 2J8YA 4IVIA 4MMNA 3ZG9B 2OWHA 3UB7A 3MJQA 4RX3A 1M40A 5FQQA 2Z2MB 4LENA 4O0PA 4HOIA 2PDRA 1N9OA 5EFWA 3PHYA 4UQIM 3HJKA 2DNSA 3JVVA 5HWWA 3VP0A 4S2NA 1ODVA 1P0ZA 3CMZA 4X69A 1OJGA 2OAQ1 4OQHA 5J8XA 3IWIA 4PM8A 1GSWA 5F6AA 1KDSA 4KZ4A 1PWDA 4Y2FA 1YMXA 3HLDA 5JYOA 2OSUA 1PIOA 3GVBA 3CI6A 4GB7A 1SHVA 2B95A 3ZCZA 1ZG6A 2X01A 2O9CA 3Q81A 1YLYA 4XXRA 3IH8A 5FQKA 1MWTA 4KZ9A 5HL6A 3NHQA 2XDMA 3IF6A 2JN7A 3DWZA 1YAXA 5FA7A 2D01A 3KYZA 2XEPA 3ZFZA 5IT5A 2W3FA 3VV4A 5HDDA 3BECA 3IX4A 3A0VA 4FH2A 5CEDA 2BG1A 3T4QA 5KZHA 1TVFA 3UPNA 2O0YA 4IEDA 1F98A 4ZAMA 5CX7A 1KVMA 4K08A 3FZCA 3GECA 5DTTA 2EX8A 1IKIA 3GR2A 1I2WA 3NY4A 2XA7M 3FPWA 4HBUA 3WS4A 2WKPA 3SH9A 3G6OA 2XSSA 3V3SA 3HVFA 4YNRA 5TR7A 4QY6A 1VB6A 4HIAA 1ZC2A 3RTYA 1YPRA 3C4PA 2LB9A 1SKOA 4IJGA 4EEUA 4HHDA 5FEFA 1KGFA 1BSGA 3T4OA 1V9ZA 3LICA 3BFCA 4BBVA 5DTKA 3D72A 5F68A 3B47A 1LHYA 4XUXA 1OTDA 3IWOA 5CGWA 4E04A 2Y2MA 2EFXA 3DTEA 4ZJ2A 2UV0E 4L9GA 4GDNA 4LV3A 5EOEA 2M7UA 3WS2A 3Q07A 3B33A 4A5RA 4EQ1A 1XGIA 4Y15A 3MR0A 2O9AA 2IWCA 3M6HA 4Y17A 3WWXA 1XXMA 4C75A 4R23A 3UNWA 2MJ6A 3S4XA 3G2YA 4FSFA 4HJ6A 5I5LA 3T1SA 4X53A 1FCMA 3EWKA 4R0QA 4BJPA 3UN7A 4QJGA 3H9WA 4IBRA 1NWZA 2X02A 5IS1A 4B88A 3BWLA 4LLOB 4KZ7A 4PM7A 2W3GA 2HP9A 2W3HA 3NDEA 1XJ4A 4E3OA 2WKHA 1WYBA 4IBXA 4OVDA 4BBTA 2FFYA 5EPHA 3B3XA 2WKQA 3I7JA 3HL9A 2BASA 1H3QA 5HWVA 2HP5A 5EUAA 3VP1A 3SW1A 2Y2PA 4Y7PA 4JLFA 4DN0A 3A3IA 3W2ZA 4NK3A 5F1FA 3FV7A 4NG2A 5HW3A 3S7OA 3QP1A 4PM5A 4OKPA 4MCWA 2XRNA 3HCYA 3LO7A 4U0XA 1HTZA 2WGWB 3KSIA 4X25A 2ZD8A 3C4OA 4DF6A 4X1LA 3NJAA 3NOUC 1Q2PA 2IA2A 4BL3A 4CJNA 3CWFA 4S2OA 2JKTM 3KO6A 1EWZA 4RX2A 2WK0A 5EE8A 3T4JA 3VOLA 4KZ6A 4EU0A 5EM0A 4P85A 3SH8A 3DTIA 3PBTA 1MZUA 3E4PA 4QPRA 4KG5A 4CLCC 3LCEA 4S2PA 5EVEA 3Q82A 4GHIB 2G2WA 3BLMA 2QWSA 4OOLA 3U2AA 3P09A 1T18A 1K25A 4I3AA 1NYYA 1IEMA 3PYPA 2Y2NA 1ONGA 3MMHA 2M7VA 5HD3A 1PNEA 1J9MA 1JWPA 4RQ9A 4FOFA 5GHYA 2J3TD 2ZL1B 2Y8HA 1L0EA 1JVJA 3HLEA 4LPZA 3LY3A 2XA7S 4XT2B 3IHAA 3IX3A 4YFMA 3TE8A 2M1CA 2VZWA 2ZQ7A 1N4OA 4DXCA 3F1OB 1MWUA 3ICYA 5G4YA 4H8RA 3MQQA 3T1QB 2Z2LB 1WE4A 3UB8A 1SCWA 3NBLA 2EX6A 5F5YA 4EW7A 4S2NC 3SH7A 1ACFA 5HARA 4R4SA 2O99A 3LIDA 2ZMFA 3ZYTA 1KE4A 1BYWA 5FDHA 3IS2A 5EVIC 1K55A 3VP3A 3F1PB 4MDZA 4RYEA 1IYSA 5FASA 1OTAA 1MWSA 1S1ZA 1LT0A 4PM9A 3IF5A 5CXWA 1HVBA 3BW6A 3RXWA 1H8YA 4DE3A 3OCLA 1IOUA 3BFEA 2HZ5A 3MKFA 3IF6C 3HLWA 3NULA 5FDSA 3G2ZA 1H8ZA 3NI9A 5HFOA 3VE4A 3S22A 3H82A 5GL9A 3MXRA 2KDKA 5GHXA 3T50A 3BM6A 1JTGA 4R1GA 4HP9A 3LUQA 1DP9A 1OTIA 1DJBA 3ITBA 2V8CA 5F82A 4EBLA 3R4KA 4MN7A 4WLAA 3HLFA 2DCFA 1FQGA 2PBDP 2PHYA 2Y4AA 5CERA 2WZZA 5HZHA 1NYMA 1K56D 2PAVP 3O5YA 3WS1A 5KMWA 1X0OA 2WGIA 4LCLA 1K6SA 4OPZA 5M1AA 1MY8A 3MQOA 2KOIA 4YOFA 5FAPA 1PW1A 5IHVA 4P6ZM 5DTSA 3PBRA 2OWJA 5HPIA 4IVKA 3RXXA 4YWZA 4KQRA 5J4EA 4O8GA 5E2EA 4H6JA 2XLNA 3KSGA 2NUTC 4DJ2A 1TDGA 2WKEA 3LGOA 1LSWA 4QY5A 2PU4A 4E3JA 4HH3A 2HJ9C 5GLCA 3L9KA 5EV0A 1XPBA 3C30A 4WF0A 4X6TA 2Q0OA 1NRFA 3WRTA 1Y28A 1PZOA 4E3NA 3V5MA 2GX5A 5AVFA 5DVAA 5EOOA 2XF3A 3P7NA 2XGNA 3ZNYA 3D3OA 3PXPA 4N92A 1I2SA 4G3WA 2ZM8A 3S7PA 2RCXA 2GNXA 2V1ZA 2JBFA 3A3EA 3E4QA 1HZOA 4MEZA 5GLDA 4WZ4A 4PHTA 4E3LA 4X68A 4KUKA 4DDSA 4L0LA 4BENA 3W8KA 3PTEA 1XX2A 5DKLA 4N1XA 1BULA 5DJTA 2KX6A 1ESUA 3D4FA 3MZFA 3PBQA 1W8YA 3BQ8A 4ETZA 2GZAA 2Y2JA 4RVAA 4QD4A 1CI8A 3HLGA 1VQQA 3G35A 4EUZA 1VETA 2VV7A 3T4KA 2VKSA 1VEUA 3O86A 2JKRI 3CPTA 3S1YA 1SKOB 4FTXA 2CC1A 3EQUA 1GSXA 1FILA 4Y0UA 1Y4OA 3S7NA 5EVIA 4WELA 2K31A 2R9XA 1BLCA 3JVUA 2VGLM 3E2KA 1P97A 3DBAA 1OTEA 2Q9NA 4JXSA 4R6LA 2DMWA 4FCFA 1K38A 4PKYA 2K2NA 3BFDA 3M2JA 3C5AA 1XJ2A 5FAQA 5A90A 2JC7A 3T4TA 2QJ7A 1LL9A 3B42A 1EW0A 3EEHA 1L0DA 4JXGA 2K7SA 5HAPA 4BD0A 5CGSA 2V0WA 4R3AA 4GKUA 3CAXA 2A24A 5FQIA 2VX8A 5K5BA 1S1YA 5FSRA 5TFQA 3GDIA 2P74A 3FPVA 2B18A 3MSHA 3MFXA 5G18A 3FKWA 1MPLA 4MNRA 2HDUA 1T19A 1P9RA 2YKFA 3LYXA 3ZNTA 4LRXC 4GLQA 4R3JA 1LSVA 3QHYA 4PPRA 3W4PA 4C6YA 2FH5A 3LY4A 4CQHA 5CTNA 2V8FA 3PAGA 1G6OA 3UPOA 1YT4A 3RJUA 2ZQDA 3UY6A 3EGDC 4P6BA 5A8BA 5HAIA 1TD5A 4LFUA 5HX9A 1FSWA 4P6ZS 1O7EA 3N6IA 1T1AA 3EEAA 4EESA 1G5UA 3NECA 1IFQA 4GS9A 2WGVA 4DXBA 5CHMA 1K55C 2ZMVA 3RH8B 5U47A 3P98A 1D1JA 4L9FA 3IXBA 3Q7VB 4OQ0A 2EX2A 2Y2KA 2HDRA 4HQAA 1OPXA 4F3LA 5L09A 1ERMA 4Y0TA 3ZG0A 2E8JA 1L0FA 1ES3A 2WADA 3UE6A 1N9BA 2QZ6A 3LEQA 3F1NB 5HPFA 4G3KA 5CRFA 4QU3A 1RCJA 5A91A 3QP4A 4E3IA 1YLPA 1ZKJA 4Z1WA 2ZC4B 4QWOA 2XD5A 4ZBEA 3E98A 2PR5A 3BRMA 3K3DA 3O87A 1I5QA 4EERA 4U0TA 2LB5A 3IXDA 4GDBA 2Z6DA 1LL8A 4OP8A 2R9WA 1Q2QA 4BD1A 1TS8A 4X1MA 5HAQA 4Y13A 4ETXA 3A3FA 3T12B 1KGEA 5DFXA 2WYXA 2JCHA 2WKIA 1SZVA 1ZTUA 3VP2A 1PZPA 2YKHA 1Y54A 3LR5A 4AFIA 2QMIA 4EUVA 4DE1A 4WEJA 1K6RA 5CHJA 3PR6A 5GLBA 2Q9MA 4WBGA 4DE2A 2FZ0A 1TDLA 5KSHA 4KZBA 4EEPA 5AJGA 4KQOA 4ME4A 3ULFA 3GV9A 4UEYA 5EECA 2PD7A 4UQIS 4I39A 1IYPA 3JPUA 4OPRA 3BFGA 2VA0A 3TW8A 5CEBA 4JF4A 4GCZA 1S67L 4KZ3A 4BWIA 2W3DA 3DWKA 2W3EA 2HDSA 4WMCA 1G68A 1BZAA 3IS2B 4EBNA 4OOMA 3R7WA 4KZ5A 4EBPA 1DP6A 2VGLS 4R38A 4DMZA 3TJZC 2XK1A 3E4OA 3G30A 1OTBA 4GN2A 5HDCA 3V50A 5AQAA 1TF1A 2O9BA 3NC8A 2ZC3B 3H82B 4LV1A 3MKEA 4GOGA 4Q8IA 2EX9A 2AVXA 3FYZA 3QNCA 4JKTA 1FIKA 4P0MA 3E0YA 4WM9A 1GA0A 4JXVA 1GCEA 3NDGA 3A0RA 3C7UA 4JPMA 1S0WA 1NY0A 1S4RA 3SS3A 3NOPC 4EXOA 1TS6A 2Y79A 1NLYA 3LI8A 2P9VA 2VGJA 3HBRA 1WA9A 1YM1A 4M3KA 4BL2A 2Y91A 3ITAA 2OOLA 4HP4A 3AGDA 3GQZA 1BT5A 4GD8A 1RP5A 4HESA 4OQIA 2G7UA 2XFSA 1CK3A 3G31A 2EXAA 2V1AA 5AVEA 3H7WA 5BOHA 1LI9A 3KSHA 4MBFA 3LIEA 1CF0A 1JWVA 2J80A 5HD5A 5LBRA 4H6JB 1GSVA 1SDEA 1CEFA 5FI6A 4KUOA 2WGWA 2L1MA 2W1TB 4DE0A 4KQDA 3IQAA 3ZQ5A 3JYIA 3UB6A 2V1BA 3FKVA 2EWWA 5AQ9A 5D3OA 3ZVTA 3OZHA 2PR6A 1E3UD 2VV8A 1ES4A 3KYEA 3PBSA 4CLCB 3ZG8B 4I3IA 4ARZA 1JTDA 4O7DA 3IXGA 3TSGA 3W4OA 2BLSA 2UWXA 3BEBA 2Y59A 2BTFP 1IELA 4S2KA 3A0SA 4GHIA 2PRFA 1YLJA 1YLTA 1ES2A 3G34A 2FFFB 4NKPA 5DJUA 4DJ3A 1W79A 4XUZA 4PM6A 5FATA 1N9LA 3LR0A 3MZDA 3IH9A 1MKIA 3V39A 2XFTA 3V67A 2JHEA 3VOYA 2J9PA 5DF7A 1VETB 2VLGA 4QHCA 3UPPA 3BYDA 2A2LA 3RFBA 1W63M 4HI4A 5EM1A 4EQIA 2ZLYA 4G3VA 3VSLA 3F1OA 4UHUA 3G4PA 5M18A 4K91A 1FR1A 4UA7A 1MWRA 3CPTB 3VFFA 4GD6A 1H8MA 1W5DA 5EVIB 2W27A 1NZUA 2ZM2A 2DRWA 3UMDA 1S66L 2H5SA 2PU2A 1Z09A 3VMAA 2HF6A 3ZDJA 2L4RA 4NEED 4I38A 4ZJ1A 3C8CA 2HDQA 3N8RA 3O88A 1FR6A 3CITA 1PFLA 5JYPA 1U60A 4WZ5A 2VEAA 1H5XA 3CG5A 4DDYA 1DRMA 1KE3A 5L2FA 3K2NA 4LRYC 3IF6B 5CTMA 3LIFA 4Q0IA 4Q0JA 2WZXA 4ZTKA 2PD8A 1EI5A 4OPYA 2V0UA 3A3DA 4ZDXA 3BQAA 5I94A 2A24B 3FC7A 4OPQA 3GSGA 5FQJA 4R70A 1QMFA 3VSKA 1K4EA 2ZQ9A 1YLZA 4JGRA 4PMAA 4D2OA 1DJCA 2ACGA 1K54A 3FG8A 1VHMA 2CMNA 2EXBA 5CECA 1ALQA 3MFDA 1PI4A 2KLIA 4WUJA 1P9WA 1PW8A 1XP4A 1FSYA 2OAP1 3WS5A 2ZQCA 3C2WA 4NXGA 3UDIA 2Y2QA 1BLPA 1IYOA 2OLVA 2GJ3A 4M4XA 1FOFA 3ZGAB 1K57C 4CLCD 3Q7ZA 2R78A 5EVLA 5M19A 5G4ZA 3BJNA 4GS9B 1BLSA 1PRQA 4ZJ3A 5L07A 1XJ6A 4LV0A 2XR0A 2WUQA 4B4XA 1AWIA 4F3LB 1PWGA 2ZC7A 4N1HA 2IWDA 2RL3A 1LI0A 4Y5FA 4BQMA 2JKRM 2J7VA 3IWQA 1LLBA 4NXBA 2J3TC 2NUPC 3NCKA 1KVLA 5FI7A 3SS4A 3HUOA 3QNBA 4WN5A 3VFHA 3IT9A 4R3BA 4I5SA 3UE0A 1XGJA 3IHBA 2ZMAA 5TBMA 4HJ4A 4R4RA 2ZJ9A 3CZDA 4KQQA 2QJ5A 1YMSA 1O07A 3OCNA 3BY9A 3KYQA 4JXWA 5EVID 4S2JA 1D7EA 1L0GA 1TEMA 4Z9QA 1NJ4A 4KG2A 1FCNA 1HLUP 2ZQAA 2H28A 2OV5A 4MLLA 1E4DA 3Q1FA 1XKZA 1S4SA 4NXEA 2JE5A 4FH4A 3LIBA 1TS0A 3KSFA 5DF9A 1XJ3A 4LGWA 3D9YA 4OQGA 4BBUA 3BFFA 2P08A 4X56A 4WYYA 4OP5A 2WAFA 1A0KA 2JKFA 1MBLA 4DKIA 2A49A 4K0WA 2I72A 5A93A 1T1BA 1J3WA 4JBFA 3R7WB 3UE3A 5FQMA 1LL5A 3PBOA 4OONA 4MBHA 1XFNA 1ES5A 1OMEA 5FAOA 1W7FA 4LRZE 5C5KA 3NOTC 3GMWA 3U4LP 1CJFA 2P04A 3UDXA 3SOIA 2VV6A 2ZC5B 3T4LA 4E3KA 2PYPA 1EROA 2Y2HA 5HL1A 1ERQA 3CLOA 3QP8A 3OPPA 3NIAA 4EV4A 4HBTA 4LV2A 1DP8A 4Y3IA 3UB5P 3MQ0A 3KX0X 1BLHA 3MF0A 1H0MA 3BLSA 5TGFA 3EQVA 1YQSA 3A3JA 4U3TA 3OPHA 3MS6A 2PYRA 2X71A 4KG6A 2ZQ8A 5J3WA 4B4ZA 2H10A 3CHWP 4GW9A 1C3BA 5DKKA 4ZRRA 1NLZA 4NETA 3SS5A 4GZBA 1CQAA 4BMWA 4E6XA 4OLDA 2C5WB 3M2KA 2P9VB 3AGEA 2ZBBA 4C3QA 4S2IA 2Y55A 5HWTA 1YKDA 5FEGA 1K57A 2INWA 3LIAA 3HJIA 3PBNA 3L7HA 4LCMA 2XD1A 3DTKA 5DF8A 5E2FA 2L0WA 1M6KA 2ZOIA 3H7WB 4EWFA 2JKTI 3LFVA 5AQ7A 3LR4A 4II7A 1V9YA 3UMEA 1MKMA 4QB8A 1KE0A 4Q0HA 4CPKA 4UA6A 4O01A 1NZOA 2B5RA 2EWVA 1MXOA 2PBYA 2H0YA 4JGOA 2WAEA 3PAEA 3Q7VA 4GNUA 3LR3A 2HGVA 1DJAA 5E2HA 3TOIA 4WZ5C 1D06A 2G2UA 3TG9A 4L9EA 2XQZA 3EGXC 1L2SA 1FCOA 1YSPA 3F1NA 3VE3A 3HLBA 3IBRA 4Y0OA 4PAUA 4KZ8A 3HUMA 4YINA 4MN5A 4I3JA 2J9OA 4ARZB 3ZVWA 2W1RA 2HJEA 3DTMA 1GHMA 1GA9A 5CHUA 2HV1A 4KENB 1NRJA 3CUEC 4N9KA 1GHIA 1UGUA 4WMCD 1K54C 4UAAA 3MXSA 5J7EA 1XA1A 4OLGA 3UDFA 4FUWA 2ZC6B 1AXBA 1PWCA 4B9OA 3W4QA 2QHKA 5GHZA 5IU1A 2VK3A 3OOVA 3BY8A 4E3MA 1W8QA 3VP4A 3K3CA 4OOYA 1PYYA 1E3UA 2EA9A 5L8MA 3IBJA 3MZEA 1F9IA 1F2KA 3LI9A
chains in the Genus database with same CATH topology
5K5BA 1S1YA 1XJ4A 4GJ4A 3GDIA 4BBTA 3FPVA 3CITA 2VEAA 2B18A 2WKQA 4WL9A 4HY8A 1DRMA 3K2NA 4LRYC 2BASA 1H3QA 3LIFA 3MFXA 5HWVA 3SW1A 4Q0IA 4Q0JA 2PD8A 4DN0A 2QYBA 1T19A 2V0UA 3W2ZA 3BQAA 5MC7A 2XROA 1P9RA 2A24B 3FC7A 2YKFA 3S7OA 3LYXA 3UB9A 4LRXC 4GLQA 4R70A 1LSVA 4MCWA 2XRNA 3HCYA 3C38A 2FH5A 4JGRA 1MC0A 3TRCA 1N9NA 4CQHA 1G6OA 3KSIA 3FG8A 1VHMA 2CMNA 2WKRA 3EGDC 5A8BA 3NJAA 1TD5A 3T4SA 3NOUC 4P6ZS 2IA2A 3CWFA 1T1AA 2KLIA 2JKTM 3KO6A 4WUJA 3EEAA 1P9WA 4EESA 1IFQA 4GS9A 2Z6CA 4EETB 3T4JA 4JGQA 3VOLA 4EU0A 1YSQA 2OAP1 3C2WA 5F69A 4NXGA 2ZMVA 3RH8B 1W63Q 4L9FA 2GJ3A 4M4XA 3PBTA 1MZUA 4HQAA 1OPXA 4F3LA 2D02A 3E4PA 4CLCD 2R78A 4QPRA 5G4ZA 4CLCC 3BJNA 2QKPA 4GHIB 5HSQA 3UE6A 4GS9B 3F1NB 5HPFA 4G3KA 2ZOHA 2QWSA 4XT2A 4OOLA 3U2AA 1T18A 1XJ6A 1F5MA 4I3AA 4HH2A 3PYPA 4Z1WA 3MMHA 2M7VA 5HD3A 3E98A 1TS7A 5FL3A 1XFQA 4F3LB 2PR5A 3K3DA 4Y5FA 4EERA 4RQ9A 4FOFA 2JKRM 2LB5A 2J3TD 2Z6DA 4NXBA 2Y8HA 2J3TC 1LL8A 4WEKA 2NUPC 4LPZA 1G28A 1TS8A 2XA7S 4XT2B 2V9AA 3TE8A 2M1CA 3OC2A 2VZWA 4ETXA 4IHQA 4WN5A 3F1OB 5DFXA 3ICYA 3F1PA 4I5SA 2J3WA 1OJ5A 5G4YA 2VJWA 5DFYA 3MQQA 5TBMA 4HJ4A 1T1CA 1ZTUA 2YKHA 3LR5A 3UB8A 4AFIA 4EUVA 2QJ5A 5F5YA 2W1TA 4B93A 3OBFA 4EW7A 4WEJA 1LSXA 3PR6A 3OCNA 4CLCE 2O99A 1OT9A 3LIDA 2ZMFA 3BY9A 3ZYTA 3KYQA 2FZ0A 1BYWA 3IS2A 5KSHA 4EEPA 5AJGA 4KQOA 4ME4A 5KIZA 3F1PB 4NXFA 1D7EA 3ULFA 4MDZA 4UEYA 5TBMB 2PD7A 1OTAA 4MN6A 4UQIS 4CLCA 3OLOA 1S1ZA 1LT0A 4I39A 3CUEA 2H28A 2I9VA 1OT6A 2VA0A 3TW8A 1UWPX 3MXQA 4GCZA 1S67L 3BW6A 4BWIA 2W3DA 2PT7A 5HDSA 2W3EA 1S4SA 1KOUA 3OCLA 3P01A 4IUKA 1IOUA 4NXEA 3IS2B 4PKYG 4HNBA 5TJJA 3LIBA 4OOMA 3R7WA 1ZHHB 1TS0A 2W0NA 3EOIA 3KSFA 5DF9A 1XJ3A 2P7JA 1DP6A 2VGLS 1JNUA 4R38A 3VE4A 4BBUA 2B02A 4DMZA 3H82A 4IUHA 2KDKA 2P08A 4HJ3A 3S7QA 3T50A 1STZA 1UWNX 4HP9A 3LUQA 4JGPA 1DP9A 3TJZC 3E4OA 1OTIA 1T1BA 1OTBA 3R4KA 4MMNA 2OWHA 3UB7A 3MJQA 3R7WB 4MN7A 3UE3A 5HDCA 4WLAA 2PHYA 4O0PA 5HZHA 3PBOA 2PDRA 4HOIA 1N9OA 1TF1A 5EFWA 3PHYA 2O9BA 3H82B 4UQIM 3HJKA 1XFNA 3O5YA 3JVVA 4LRZE 5HWWA 5C5KA 3NOTC 1X0OA 1ODVA 1P0ZA 3E0YA 2P04A 1OJGA 2OAQ1 2VV6A 3T4LA 2PYPA 3MQOA 2KOIA 3A0RA 4YOFA 1GSWA 5F6AA 4P6ZM 3CLOA 1S4RA 4Y2FA 3PBRA 2OWJA 3NOPC 5HPIA 1DP8A 3CI6A 4Y3IA 3MQ0A 3KX0X 3MF0A 4EXOA 1TS6A 2Y79A 4YWZA 1NLYA 3EQVA 3LI8A 4O8GA 5J4EA 2O9CA 2PYRA 4H6JA 3KSGA 2NUTC 4DJ2A 5J3WA 1WA9A 5HL6A 3NHQA 4GW9A 2JN7A 1LSWA 2OOLA 4HP4A 1YAXA 5DKKA 4ZRRA 1NLZA 2G7UA 2D01A 3KYZA 4HH3A 2HJ9C 4BMWA 2V1AA 5AVEA 3H7WA 5IT5A 2W3FA 3VV4A 3KSHA 5HDDA 3C30A 3LIEA 4WF0A 2J80A 5HD5A 3A0VA 2ZBBA 5LBRA 4H6JB 3T4QA 1Y28A 1GSVA 5HWTA 2O0YA 1YKDA 2GX5A 4KUOA 2INWA 5AVFA 3LIAA 3HJIA 1F98A 3PBNA 5CX7A 2L1MA 3P7NA 2W1TB 4K08A 3GECA 3D3OA 4KQDA 3ZQ5A 3PXPA 3UB6A 2V1BA 2XA7M 4G3WA 2L0WA 3FPWA 2ZOIA 3H7WB 3S7PA 2JKTI 2EWWA 2GNXA 3LFVA 3E4QA 3LR4A 2WKPA 3G6OA 4II7A 4PHTA 1V9YA 3UMEA 2XSSA 1MKMA 4KUKA 4Q0HA 4L0LA 2PR6A 2VV8A 4O01A 4YNRA 3PBSA 4CLCB 5DKLA 2EWVA 1VB6A 4HIAA 4I3IA 3RTYA 5DJTA 2KX6A 4JGOA 4ARZA 3PBQA 3LR3A 2LB9A 2HGVA 3BQ8A 4ETZA 2GZAA 4IJGA 1D06A 4EEUA 4HHDA 4L9EA 3A0SA 4GHIA 3EGXC 1YSPA 3T4OA 1V9ZA 3F1NA 3VE3A 3LICA 4BBVA 3IBRA 4PAUA 3D72A 5F68A 4MN5A 3B47A 2VV7A 3T4KA 4I3JA 4NKPA 1OTDA 2VKSA 5DJUA 4ARZB 4DJ3A 2W1RA 2HJEA 4E04A 2JKRI 1N9LA 3LR0A 3EQUA 1GSXA 2HV1A 1NRJA 3CUEC 4L9GA 3S7NA 4WELA 2K31A 3V67A 2M7UA 2JHEA 1UGUA 3JVUA 2VGLM 3B33A 1P97A 3DBAA 1OTEA 2VLGA 4EQ1A 5J7EA 2A2LA 3MR0A 3RFBA 1W63M 2O9AA 4R6LA 2DMWA 4HI4A 4PKYA 2K2NA 4G3VA 3F1OA 1XJ2A 4B9OA 2MJ6A 2QHKA 3T4TA 4FSFA 1H8MA 4HJ6A 5I5LA 5IU1A 2QJ7A 3OOVA 3BY8A 2W27A 3EWKA 3B42A 4BJPA 3K3CA 1EW0A 3EEHA 3UMDA 1S66L 2K7SA 2V0WA 3H9WA 4R3AA 1NWZA 5IS1A 2EA9A 2HF6A 5L8MA 3IBJA 2L4RA 4NEED 3CAXA 2A24A 1F9IA 3BWLA 4I38A 4LLOB 2VX8A 2W3GA 3C8CA 2W3HA 3LI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S1Y A;  1XJ4 A;  3GDI A;  4BBT A;  2VEA A;  2WKQ A;  4WL9 A;  4HY8 A;  1DRM A;  4LRY C;  2BAS A;  3MFX A;  3LIF A;  5HWV A;  3SW1 A;  2PD8 A;  1T19 A;  2V0U A;  2A24 B;  3FC7 A;  2YKF A;  3UB9 A;  3LYX A;  4LRX C;  4R70 A;  1LSV A;  4JGR A;  1N9N A;  3FG8 A;  2CMN A;  2WKR A;  5A8B A;  3NJA A;  3NOU C;  3CWF A;  1T1A A;  4WUJ A;  4EES A;  4GS9 A;  2Z6C A;  4EET B;  4JGQ A;  3VOL A;  3C2W A;  5F69 A;  4NXG A;  3RH8 B;  4L9F A;  2GJ3 A;  4M4X A;  1MZU A;  4HQA A;  4F3L A;  2D02 A;  3E4P A;  2R78 A;  5G4Z A;  2QKP A;  4GHI B;  5HSQ A;  3UE6 A;  4GS9 B;  3F1N B;  2ZOH A;  2QWS A;  4XT2 A;  1T18 A;  1XJ6 A;  4I3A A;  4HH2 A;  3PYP A;  5HD3 A;  1TS7 A;  4F3L B;  1XFQ A;  2PR5 A;  3K3D A;  4EER A;  4RQ9 A;  2Z6D A;  4NXB A;  1LL8 A;  4LPZ A;  1G28 A;  1TS8 A;  4XT2 B;  2V9A A;  2M1C A;  4WN5 A;  3F1O B;  3ICY A;  3F1P A;  4I5S A;  1OJ5 A;  5G4Y A;  3MQQ A;  5TBM A;  4HJ4 A;  1T1C A;  2YKH A;  3UB8 A;  2QJ5 A;  5F5Y A;  4EW7 A;  1LSX A;  1OT9 A;  3LID A;  3BY9 A;  1BYW A;  3IS2 A;  4EEP A;  5KIZ A;  3F1P B;  4NXF A;  1D7E A;  3ULF A;  5TBM B;  2PD7 A;  1OTA A;  4MN6 A;  3OLO A;  1S1Z A;  1LT0 A;  4I39 A;  2H28 A;  2I9V A;  1OT6 A;  1UWP X;  3MXQ A;  4GCZ A;  1S67 L;  5HDS A;  1S4S A;  1KOU A;  4NXE A;  3IS2 B;  4PKY G;  4HNB A;  3LIB A;  1TS0 A;  2W0N A;  1XJ3 A;  2P7J A;  1DP6 A;  1JNU A;  4R38 A;  3VE4 A;  4BBU A;  2B02 A;  3H82 A;  2KDK A;  4HJ3 A;  3T50 A;  1UWN X;  4HP9 A;  3LUQ A;  4JGP A;  1DP9 A;  3E4O A;  1OTI A;  1T1B A;  1OTB A;  2OWH A;  3UB7 A;  3MJQ A;  5HDC A;  4WLA A;  2PHY A;  5HZH A;  4HOI A;  2PDR A;  1N9O A;  5EFW A;  3PHY A;  3H82 B;  3HJK A;  1XFN A;  4LRZ E;  5HWW A;  3NOT C;  1X0O A;  1ODV A;  1P0Z A;  1OJG A;  2VV6 A;  2PYP A;  3MQO A;  3A0R A;  1GSW A;  5F6A A;  3CLO A;  1S4R A;  2OWJ A;  3NOP C;  1DP8 A;  3KX0 X;  4EXO A;  1TS6 A;  4YWZ A;  5J4E A;  3LI8 A;  2PYR A;  4H6J A;  4DJ2 A;  5J3W A;  1WA9 A;  3NHQ A;  4GW9 A;  2JN7 A;  1LSW A;  2OOL A;  4HP4 A;  5DKK A;  2D01 A;  4HH3 A;  2V1A A;  5AVE A;  3H7W A;  5HDD A;  3LIE A;  4WF0 A;  2J80 A;  5HD5 A;  3A0V A;  2ZBB A;  4H6J B;  1Y28 A;  1GSV A;  5HWT A;  4KUO A;  2INW A;  5AVF A;  3LIA A;  3HJI A;  1F98 A;  2L1M A;  3P7N A;  4K08 A;  3GEC A;  4KQD A;  3ZQ5 A;  3UB6 A;  2V1B A;  2L0W A;  2ZOI A;  3H7W B;  3E4Q A;  2WKP A;  3G6O A;  1V9Y A;  3UME A;  4KUK A;  2PR6 A;  2VV8 A;  5DKL A;  1VB6 A;  4HIA A;  4I3I A;  3RTY A;  5DJT A;  2KX6 A;  4JGO A;  4EEU A;  1D06 A;  4HHD A;  4L9E A;  3A0S A;  4GHI A;  1V9Z A;  3F1N A;  3VE3 A;  3LIC A;  4BBV A;  3IBR A;  3D72 A;  5F68 A;  4MN5 A;  2VV7 A;  4I3J A;  1OTD A;  5DJU A;  4DJ3 A;  4E04 A;  1N9L A;  1GSX A;  2HV1 A;  4L9G A;  2JHE A;  1UGU A;  3B33 A;  1P97 A;  1OTE A;  2VLG A;  4EQ1 A;  5J7E A;  3MR0 A;  4R6L A;  4HI4 A;  4PKY A;  3F1O A;  1XJ2 A;  4B9O A;  2QHK A;  4HJ6 A;  5I5L A;  5IU1 A;  2QJ7 A;  3BY8 A;  2W27 A;  3EWK A;  3K3C A;  1EW0 A;  3EEH A;  3UMD A;  1S66 L;  2K7S A;  2V0W A;  3H9W A;  4R3A A;  1NWZ A;  5IS1 A;  2EA9 A;  2L4R A;  3CAX A;  2A24 A;  1F9I A;  3BWL A;  4I38 A;  4LLO B;  3C8C A;  3LI9 A; 
#chains in the Genus database with same CATH topology
 3ZG7 B;  1KDW A;  4GJ4 A;  3ISG A;  3IXH A;  5FQ9 A;  1ESI A;  4F94 A;  5AQB A;  4WL9 A;  1QME A;  4HY8 A;  2C6W B;  3G32 A;  3QP6 A;  3O3V A;  2QYB A;  5MC7 A;  2Y2G A;  2XRO A;  3AGF A;  1K56 A;  3UB9 A;  3QP2 A;  3VOZ A;  1G6A A;  1PI5 A;  3C38 A;  2A3U A;  2VGK A;  2IWB A;  1BTL A;  1MC0 A;  1NXY A;  4ID4 A;  3TRC A;  1N9N A;  1CEG A;  5FI2 A;  2HPB A;  5KSC A;  4N9L A;  3LEZ A;  2WKR A;  5A92 A;  2EFU A;  3T4S A;  1Z6F A;  1E25 A;  3HUN A;  1JWZ A;  3M6B A;  2Z6C A;  1WYC A;  4EET B;  3GTC A;  5F83 A;  1RGZ A;  4JGQ A;  1YSQ A;  3HLC A;  2JKG A;  5F69 A;  1W63 Q;  5GLA A;  3WRZ A;  1SDN A;  5E43 A;  2D02 A;  3OPR A;  1SKF A;  2OLU A;  2QKP A;  2Y2O A;  5HSQ A;  2ZL1 A;  4P87 A;  3T1X A;  3IX8 A;  2ZOH A;  5CGX A;  3ZG5 A;  4XT2 A;  4OH0 A;  3SZT A;  2XH9 A;  1F5M A;  1VEU B;  4HH2 A;  4K0X A;  5E2G A;  4E6W A;  4S2L A;  1IYQ A;  1TS7 A;  5FL3 A;  1XFQ A;  3QP5 A;  1YLW A;  1K4F A;  3E2L A;  3UE1 A;  4WEK A;  3N8L A;  4S2M A;  1G28 A;  2V9A A;  3OC2 A;  4RA7 A;  2QPN A;  4UA9 A;  4IHQ A;  3OPL A;  3F1P A;  3T1R A;  2J3W A;  1OJ5 A;  2VJW A;  5DFY A;  1XA7 A;  4BLM A;  1T1C A;  3N8S A;  1GHP A;  2V20 A;  3N7W A;  5L10 A;  2Y2I A;  2GDN A;  3WS0 A;  3ZHH A;  2E8I A;  2W1T A;  4KZA A;  4B93 A;  2V2F F;  3OBF A;  1KGG A;  1LSX A;  4CLC E;  1K0K A;  1OT9 A;  4FD8 A;  5KIZ A;  3FWL A;  4NXF A;  3DAV A;  5TBM B;  2ZM0 A;  3CJM A;  4JF6 A;  1BUE A;  4MN6 A;  1ONH A;  4D60 A;  4CLC A;  3N4I A;  3OLO A;  4ESP A;  1RGY A;  3CUE A;  1CI9 A;  1L3L A;  2I9V A;  1OT6 A;  1UWP X;  3MXQ A;  3UO9 A;  3DW0 A;  3GRJ A;  1VM1 A;  2PT7 A;  4MBK A;  5HDS A;  1S6R A;  1KOU A;  3P01 A;  4IUK A;  5F1G A;  4PKY G;  4HNB A;  5TJJ A;  4DRT A;  1HD8 A;  1DY6 A;  1ZHH B;  3EOI A;  2W0N A;  4JF5 A;  3V3R A;  2P7J A;  3MBZ A;  2Y2L A;  3C7V A;  2HP6 A;  1JNU A;  2B02 A;  2H0T A;  4IUH A;  4HJ3 A;  1IKG A;  3S7Q A;  4X55 A;  1STZ A;  1UWN X;  1ZG4 A;  4JGP A;  3HRE A;  4HEF A;  2J8Y A;  4IVI A;  4MMN A;  3ZG9 B;  2OWH A;  3UB7 A;  3MJQ A;  4RX3 A;  1M40 A;  5FQQ A;  2Z2M B;  4LEN A;  4O0P A;  4HOI A;  2PDR A;  1N9O A;  5EFW A;  3PHY A;  4UQI M;  3HJK A;  2DNS A;  3JVV A;  5HWW A;  3VP0 A;  4S2N A;  1ODV A;  1P0Z A;  3CMZ A;  4X69 A;  1OJG A;  2OAQ 1;  4OQH A;  5J8X A;  3IWI A;  4PM8 A;  1GSW A;  5F6A A;  1KDS A;  4KZ4 A;  1PWD A;  4Y2F A;  1YMX A;  3HLD A;  5JYO A;  2OSU A;  1PIO A;  3GVB A;  3CI6 A;  4GB7 A;  1SHV A;  2B95 A;  3ZCZ A;  1ZG6 A;  2X01 A;  2O9C A;  3Q81 A;  1YLY A;  4XXR A;  3IH8 A;  5FQK A;  1MWT A;  4KZ9 A;  5HL6 A;  3NHQ A;  2XDM A;  3IF6 A;  2JN7 A;  3DWZ A;  1YAX A;  5FA7 A;  2D01 A;  3KYZ A;  2XEP A;  3ZFZ A;  5IT5 A;  2W3F A;  3VV4 A;  5HDD A;  3BEC A;  3IX4 A;  3A0V A;  4FH2 A;  5CED A;  2BG1 A;  3T4Q A;  5KZH A;  1TVF A;  3UPN A;  2O0Y A;  4IED A;  1F98 A;  4ZAM A;  5CX7 A;  1KVM A;  4K08 A;  3FZC A;  3GEC A;  5DTT A;  2EX8 A;  1IKI A;  3GR2 A;  1I2W A;  3NY4 A;  2XA7 M;  3FPW A;  4HBU A;  3WS4 A;  2WKP A;  3SH9 A;  3G6O A;  2XSS A;  3V3S A;  3HVF A;  4YNR A;  5TR7 A;  4QY6 A;  1VB6 A;  4HIA A;  1ZC2 A;  3RTY A;  1YPR A;  3C4P A;  2LB9 A;  1SKO A;  4IJG A;  4EEU A;  4HHD A;  5FEF A;  1KGF A;  1BSG A;  3T4O A;  1V9Z A;  3LIC A;  3BFC A;  4BBV A;  5DTK A;  3D72 A;  5F68 A;  3B47 A;  1LHY A;  4XUX A;  1OTD A;  3IWO A;  5CGW A;  4E04 A;  2Y2M A;  2EFX A;  3DTE A;  4ZJ2 A;  2UV0 E;  4L9G A;  4GDN A;  4LV3 A;  5EOE A;  2M7U A;  3WS2 A;  3Q07 A;  3B33 A;  4A5R A;  4EQ1 A;  1XGI A;  4Y15 A;  3MR0 A;  2O9A A;  2IWC A;  3M6H A;  4Y17 A;  3WWX A;  1XXM A;  4C75 A;  4R23 A;  3UNW A;  2MJ6 A;  3S4X A;  3G2Y A;  4FSF A;  4HJ6 A;  5I5L A;  3T1S A;  4X53 A;  1FCM A;  3EWK A;  4R0Q A;  4BJP A;  3UN7 A;  4QJG A;  3H9W A;  4IBR A;  1NWZ A;  2X02 A;  5IS1 A;  4B88 A;  3BWL A;  4LLO B;  4KZ7 A;  4PM7 A;  2W3G A;  2HP9 A;  2W3H A;  3NDE A;  1XJ4 A;  4E3O A;  2WKH A;  1WYB A;  4IBX A;  4OVD A;  4BBT A;  2FFY A;  5EPH A;  3B3X A;  2WKQ A;  3I7J A;  3HL9 A;  2BAS A;  1H3Q A;  5HWV A;  2HP5 A;  5EUA A;  3VP1 A;  3SW1 A;  2Y2P A;  4Y7P A;  4JLF A;  4DN0 A;  3A3I A;  3W2Z A;  4NK3 A;  5F1F A;  3FV7 A;  4NG2 A;  5HW3 A;  3S7O A;  3QP1 A;  4PM5 A;  4OKP A;  4MCW A;  2XRN A;  3HCY A;  3LO7 A;  4U0X A;  1HTZ A;  2WGW B;  3KSI A;  4X25 A;  2ZD8 A;  3C4O A;  4DF6 A;  4X1L A;  3NJA A;  3NOU C;  1Q2P A;  2IA2 A;  4BL3 A;  4CJN A;  3CWF A;  4S2O A;  2JKT M;  3KO6 A;  1EWZ A;  4RX2 A;  2WK0 A;  5EE8 A;  3T4J A;  3VOL A;  4KZ6 A;  4EU0 A;  5EM0 A;  4P85 A;  3SH8 A;  3DTI A;  3PBT A;  1MZU A;  3E4P A;  4QPR A;  4KG5 A;  4CLC C;  3LCE A;  4S2P A;  5EVE A;  3Q82 A;  4GHI B;  2G2W A;  3BLM A;  2QWS A;  4OOL A;  3U2A A;  3P09 A;  1T18 A;  1K25 A;  4I3A A;  1NYY A;  1IEM A;  3PYP A;  2Y2N A;  1ONG A;  3MMH A;  2M7V A;  5HD3 A;  1PNE A;  1J9M A;  1JWP A;  4RQ9 A;  4FOF A;  5GHY A;  2J3T D;  2ZL1 B;  2Y8H A;  1L0E A;  1JVJ A;  3HLE A;  4LPZ A;  3LY3 A;  2XA7 S;  4XT2 B;  3IHA A;  3IX3 A;  4YFM A;  3TE8 A;  2M1C A;  2VZW A;  2ZQ7 A;  1N4O A;  4DXC A;  3F1O B;  1MWU A;  3ICY A;  5G4Y A;  4H8R A;  3MQQ A;  3T1Q B;  2Z2L B;  1WE4 A;  3UB8 A;  1SCW A;  3NBL A;  2EX6 A;  5F5Y A;  4EW7 A;  4S2N C;  3SH7 A;  1ACF A;  5HAR A;  4R4S A;  2O99 A;  3LID A;  2ZMF A;  3ZYT A;  1KE4 A;  1BYW A;  5FDH A;  3IS2 A;  5EVI C;  1K55 A;  3VP3 A;  3F1P B;  4MDZ A;  4RYE A;  1IYS A;  5FAS A;  1OTA A;  1MWS A;  1S1Z A;  1LT0 A;  4PM9 A;  3IF5 A;  5CXW A;  1HVB A;  3BW6 A;  3RXW A;  1H8Y A;  4DE3 A;  3OCL A;  1IOU A;  3BFE A;  2HZ5 A;  3MKF A;  3IF6 C;  3HLW A;  3NUL A;  5FDS A;  3G2Z A;  1H8Z A;  3NI9 A;  5HFO A;  3VE4 A;  3S22 A;  3H82 A;  5GL9 A;  3MXR A;  2KDK A;  5GHX A;  3T50 A;  3BM6 A;  1JTG A;  4R1G A;  4HP9 A;  3LUQ A;  1DP9 A;  1OTI A;  1DJB A;  3ITB A;  2V8C A;  5F82 A;  4EBL A;  3R4K A;  4MN7 A;  4WLA A;  3HLF A;  2DCF A;  1FQG A;  2PBD P;  2PHY A;  2Y4A A;  5CER A;  2WZZ A;  5HZH A;  1NYM A;  1K56 D;  2PAV P;  3O5Y A;  3WS1 A;  5KMW A;  1X0O A;  2WGI A;  4LCL A;  1K6S A;  4OPZ A;  5M1A A;  1MY8 A;  3MQO A;  2KOI A;  4YOF A;  5FAP A;  1PW1 A;  5IHV A;  4P6Z M;  5DTS A;  3PBR A;  2OWJ A;  5HPI A;  4IVK A;  3RXX A;  4YWZ A;  4KQR A;  5J4E A;  4O8G A;  5E2E A;  4H6J A;  2XLN A;  3KSG A;  2NUT C;  4DJ2 A;  1TDG A;  2WKE A;  3LGO A;  1LSW A;  4QY5 A;  2PU4 A;  4E3J A;  4HH3 A;  2HJ9 C;  5GLC A;  3L9K A;  5EV0 A;  1XPB A;  3C30 A;  4WF0 A;  4X6T A;  2Q0O A;  1NRF A;  3WRT A;  1Y28 A;  1PZO A;  4E3N A;  3V5M A;  2GX5 A;  5AVF A;  5DVA A;  5EOO A;  2XF3 A;  3P7N A;  2XGN A;  3ZNY A;  3D3O A;  3PXP A;  4N92 A;  1I2S A;  4G3W A;  2ZM8 A;  3S7P A;  2RCX A;  2GNX A;  2V1Z A;  2JBF A;  3A3E A;  3E4Q A;  1HZO A;  4MEZ A;  5GLD A;  4WZ4 A;  4PHT A;  4E3L A;  4X68 A;  4KUK A;  4DDS A;  4L0L A;  4BEN A;  3W8K A;  3PTE A;  1XX2 A;  5DKL A;  4N1X A;  1BUL A;  5DJT A;  2KX6 A;  1ESU A;  3D4F A;  3MZF A;  3PBQ A;  1W8Y A;  3BQ8 A;  4ETZ A;  2GZA A;  2Y2J A;  4RVA A;  4QD4 A;  1CI8 A;  3HLG A;  1VQQ A;  3G35 A;  4EUZ A;  1VET A;  2VV7 A;  3T4K A;  2VKS A;  1VEU A;  3O86 A;  2JKR I;  3CPT A;  3S1Y A;  1SKO B;  4FTX A;  2CC1 A;  3EQU A;  1GSX A;  1FIL A;  4Y0U A;  1Y4O A;  3S7N A;  5EVI A;  4WEL A;  2K31 A;  2R9X A;  1BLC A;  3JVU A;  2VGL M;  3E2K A;  1P97 A;  3DBA A;  1OTE A;  2Q9N A;  4JXS A;  4R6L A;  2DMW A;  4FCF A;  1K38 A;  4PKY A;  2K2N A;  3BFD A;  3M2J A;  3C5A A;  1XJ2 A;  5FAQ A;  5A90 A;  2JC7 A;  3T4T A;  2QJ7 A;  1LL9 A;  3B42 A;  1EW0 A;  3EEH A;  1L0D A;  4JXG A;  2K7S A;  5HAP A;  4BD0 A;  5CGS A;  2V0W A;  4R3A A;  4GKU A;  3CAX A;  2A24 A;  5FQI A;  2VX8 A;  5K5B A;  1S1Y A;  5FSR A;  5TFQ A;  3GDI A;  2P74 A;  3FPV A;  2B18 A;  3MSH A;  3MFX A;  5G18 A;  3FKW A;  1MPL A;  4MNR A;  2HDU A;  1T19 A;  1P9R A;  2YKF A;  3LYX A;  3ZNT A;  4LRX C;  4GLQ A;  4R3J A;  1LSV A;  3QHY A;  4PPR A;  3W4P A;  4C6Y A;  2FH5 A;  3LY4 A;  4CQH A;  5CTN A;  2V8F A;  3PAG A;  1G6O A;  3UPO A;  1YT4 A;  3RJU A;  2ZQD A;  3UY6 A;  3EGD C;  4P6B A;  5A8B A;  5HAI A;  1TD5 A;  4LFU A;  5HX9 A;  1FSW A;  4P6Z S;  1O7E A;  3N6I A;  1T1A A;  3EEA A;  4EES A;  1G5U A;  3NEC A;  1IFQ A;  4GS9 A;  2WGV A;  4DXB A;  5CHM A;  1K55 C;  2ZMV A;  3RH8 B;  5U47 A;  3P98 A;  1D1J A;  4L9F A;  3IXB A;  3Q7V B;  4OQ0 A;  2EX2 A;  2Y2K A;  2HDR A;  4HQA A;  1OPX A;  4F3L A;  5L09 A;  1ERM A;  4Y0T A;  3ZG0 A;  2E8J A;  1L0F A;  1ES3 A;  2WAD A;  3UE6 A;  1N9B A;  2QZ6 A;  3LEQ A;  3F1N B;  5HPF A;  4G3K A;  5CRF A;  4QU3 A;  1RCJ A;  5A91 A;  3QP4 A;  4E3I A;  1YLP A;  1ZKJ A;  4Z1W A;  2ZC4 B;  4QWO A;  2XD5 A;  4ZBE A;  3E98 A;  2PR5 A;  3BRM A;  3K3D A;  3O87 A;  1I5Q A;  4EER A;  4U0T A;  2LB5 A;  3IXD A;  4GDB A;  2Z6D A;  1LL8 A;  4OP8 A;  2R9W A;  1Q2Q A;  4BD1 A;  1TS8 A;  4X1M A;  5HAQ A;  4Y13 A;  4ETX A;  3A3F A;  3T12 B;  1KGE A;  5DFX A;  2WYX A;  2JCH A;  2WKI A;  1SZV A;  1ZTU A;  3VP2 A;  1PZP A;  2YKH A;  1Y54 A;  3LR5 A;  4AFI A;  2QMI A;  4EUV A;  4DE1 A;  4WEJ A;  1K6R A;  5CHJ A;  3PR6 A;  5GLB A;  2Q9M A;  4WBG A;  4DE2 A;  2FZ0 A;  1TDL A;  5KSH A;  4KZB A;  4EEP A;  5AJG A;  4KQO A;  4ME4 A;  3ULF A;  3GV9 A;  4UEY A;  5EEC A;  2PD7 A;  4UQI S;  4I39 A;  1IYP A;  3JPU A;  4OPR A;  3BFG A;  2VA0 A;  3TW8 A;  5CEB A;  4JF4 A;  4GCZ A;  1S67 L;  4KZ3 A;  4BWI A;  2W3D A;  3DWK A;  2W3E A;  2HDS A;  4WMC A;  1G68 A;  1BZA A;  3IS2 B;  4EBN A;  4OOM A;  3R7W A;  4KZ5 A;  4EBP A;  1DP6 A;  2VGL S;  4R38 A;  4DMZ A;  3TJZ C;  2XK1 A;  3E4O A;  3G30 A;  1OTB A;  4GN2 A;  5HDC A;  3V50 A;  5AQA A;  1TF1 A;  2O9B A;  3NC8 A;  2ZC3 B;  3H82 B;  4LV1 A;  3MKE A;  4GOG A;  4Q8I A;  2EX9 A;  2AVX A;  3FYZ A;  3QNC A;  4JKT A;  1FIK A;  4P0M A;  3E0Y A;  4WM9 A;  1GA0 A;  4JXV A;  1GCE A;  3NDG A;  3A0R A;  3C7U A;  4JPM A;  1S0W A;  1NY0 A;  1S4R A;  3SS3 A;  3NOP C;  4EXO A;  1TS6 A;  2Y79 A;  1NLY A;  3LI8 A;  2P9V A;  2VGJ A;  3HBR A;  1WA9 A;  1YM1 A;  4M3K A;  4BL2 A;  2Y91 A;  3ITA A;  2OOL A;  4HP4 A;  3AGD A;  3GQZ A;  1BT5 A;  4GD8 A;  1RP5 A;  4HES A;  4OQI A;  2G7U A;  2XFS A;  1CK3 A;  3G31 A;  2EXA A;  2V1A A;  5AVE A;  3H7W A;  5BOH A;  1LI9 A;  3KSH A;  4MBF A;  3LIE A;  1CF0 A;  1JWV A;  2J80 A;  5HD5 A;  5LBR A;  4H6J B;  1GSV A;  1SDE A;  1CEF A;  5FI6 A;  4KUO A;  2WGW A;  2L1M A;  2W1T B;  4DE0 A;  4KQD A;  3IQA A;  3ZQ5 A;  3JYI A;  3UB6 A;  2V1B A;  3FKV A;  2EWW A;  5AQ9 A;  5D3O A;  3ZVT A;  3OZH A;  2PR6 A;  1E3U D;  2VV8 A;  1ES4 A;  3KYE A;  3PBS A;  4CLC B;  3ZG8 B;  4I3I A;  4ARZ A;  1JTD A;  4O7D A;  3IXG A;  3TSG A;  3W4O A;  2BLS A;  2UWX A;  3BEB A;  2Y59 A;  2BTF P;  1IEL A;  4S2K A;  3A0S A;  4GHI A;  2PRF A;  1YLJ A;  1YLT A;  1ES2 A;  3G34 A;  2FFF B;  4NKP A;  5DJU A;  4DJ3 A;  1W79 A;  4XUZ A;  4PM6 A;  5FAT A;  1N9L A;  3LR0 A;  3MZD A;  3IH9 A;  1MKI A;  3V39 A;  2XFT A;  3V67 A;  2JHE A;  3VOY A;  2J9P A;  5DF7 A;  1VET B;  2VLG A;  4QHC A;  3UPP A;  3BYD A;  2A2L A;  3RFB A;  1W63 M;  4HI4 A;  5EM1 A;  4EQI A;  2ZLY A;  4G3V A;  3VSL A;  3F1O A;  4UHU A;  3G4P A;  5M18 A;  4K91 A;  1FR1 A;  4UA7 A;  1MWR A;  3CPT B;  3VFF A;  4GD6 A;  1H8M A;  1W5D A;  5EVI B;  2W27 A;  1NZU A;  2ZM2 A;  2DRW A;  3UMD A;  1S66 L;  2H5S A;  2PU2 A;  1Z09 A;  3VMA A;  2HF6 A;  3ZDJ A;  2L4R A;  4NEE D;  4I38 A;  4ZJ1 A;  3C8C A;  2HDQ A;  3N8R A;  3O88 A;  1FR6 A;  3CIT A;  1PFL A;  5JYP A;  1U60 A;  4WZ5 A;  2VEA A;  1H5X A;  3CG5 A;  4DDY A;  1DRM A;  1KE3 A;  5L2F A;  3K2N A;  4LRY C;  3IF6 B;  5CTM A;  3LIF A;  4Q0I A;  4Q0J A;  2WZX A;  4ZTK A;  2PD8 A;  1EI5 A;  4OPY A;  2V0U A;  3A3D A;  4ZDX A;  3BQA A;  5I94 A;  2A24 B;  3FC7 A;  4OPQ A;  3GSG A;  5FQJ A;  4R70 A;  1QMF A;  3VSK A;  1K4E A;  2ZQ9 A;  1YLZ A;  4JGR A;  4PMA A;  4D2O A;  1DJC A;  2ACG A;  1K54 A;  3FG8 A;  1VHM A;  2CMN A;  2EXB A;  5CEC A;  1ALQ A;  3MFD A;  1PI4 A;  2KLI A;  4WUJ A;  1P9W A;  1PW8 A;  1XP4 A;  1FSY A;  2OAP 1;  3WS5 A;  2ZQC A;  3C2W A;  4NXG A;  3UDI A;  2Y2Q A;  1BLP A;  1IYO A;  2OLV A;  2GJ3 A;  4M4X A;  1FOF A;  3ZGA B;  1K57 C;  4CLC D;  3Q7Z A;  2R78 A;  5EVL A;  5M19 A;  5G4Z A;  3BJN A;  4GS9 B;  1BLS A;  1PRQ A;  4ZJ3 A;  5L07 A;  1XJ6 A;  4LV0 A;  2XR0 A;  2WUQ A;  4B4X A;  1AWI A;  4F3L B;  1PWG A;  2ZC7 A;  4N1H A;  2IWD A;  2RL3 A;  1LI0 A;  4Y5F A;  4BQM A;  2JKR M;  2J7V A;  3IWQ A;  1LLB A;  4NXB A;  2J3T C;  2NUP C;  3NCK A;  1KVL A;  5FI7 A;  3SS4 A;  3HUO A;  3QNB A;  4WN5 A;  3VFH A;  3IT9 A;  4R3B A;  4I5S A;  3UE0 A;  1XGJ A;  3IHB A;  2ZMA A;  5TBM A;  4HJ4 A;  4R4R A;  2ZJ9 A;  3CZD A;  4KQQ A;  2QJ5 A;  1YMS A;  1O07 A;  3OCN A;  3BY9 A;  3KYQ A;  4JXW A;  5EVI D;  4S2J A;  1D7E A;  1L0G A;  1TEM A;  4Z9Q A;  1NJ4 A;  4KG2 A;  1FCN A;  1HLU P;  2ZQA A;  2H28 A;  2OV5 A;  4MLL A;  1E4D A;  3Q1F A;  1XKZ A;  1S4S A;  4NXE A;  2JE5 A;  4FH4 A;  3LIB A;  1TS0 A;  3KSF A;  5DF9 A;  1XJ3 A;  4LGW A;  3D9Y A;  4OQG A;  4BBU A;  3BFF A;  2P08 A;  4X56 A;  4WYY A;  4OP5 A;  2WAF A;  1A0K A;  2JKF A;  1MBL A;  4DKI A;  2A49 A;  4K0W A;  2I72 A;  5A93 A;  1T1B A;  1J3W A;  4JBF A;  3R7W B;  3UE3 A;  5FQM A;  1LL5 A;  3PBO A;  4OON A;  4MBH A;  1XFN A;  1ES5 A;  1OME A;  5FAO A;  1W7F A;  4LRZ E;  5C5K A;  3NOT C;  3GMW A;  3U4L P;  1CJF A;  2P04 A;  3UDX A;  3SOI A;  2VV6 A;  2ZC5 B;  3T4L A;  4E3K A;  2PYP A;  1ERO A;  2Y2H A;  5HL1 A;  1ERQ A;  3CLO A;  3QP8 A;  3OPP A;  3NIA A;  4EV4 A;  4HBT A;  4LV2 A;  1DP8 A;  4Y3I A;  3UB5 P;  3MQ0 A;  3KX0 X;  1BLH A;  3MF0 A;  1H0M A;  3BLS A;  5TGF A;  3EQV A;  1YQS A;  3A3J A;  4U3T A;  3OPH A;  3MS6 A;  2PYR A;  2X71 A;  4KG6 A;  2ZQ8 A;  5J3W A;  4B4Z A;  2H10 A;  3CHW P;  4GW9 A;  1C3B A;  5DKK A;  4ZRR A;  1NLZ A;  4NET A;  3SS5 A;  4GZB A;  1CQA A;  4BMW A;  4E6X A;  4OLD A;  2C5W B;  3M2K A;  2P9V B;  3AGE A;  2ZBB A;  4C3Q A;  4S2I A;  2Y55 A;  5HWT A;  1YKD A;  5FEG A;  1K57 A;  2INW A;  3LIA A;  3HJI A;  3PBN A;  3L7H A;  4LCM A;  2XD1 A;  3DTK A;  5DF8 A;  5E2F A;  2L0W A;  1M6K A;  2ZOI A;  3H7W B;  4EWF A;  2JKT I;  3LFV A;  5AQ7 A;  3LR4 A;  4II7 A;  1V9Y A;  3UME A;  1MKM A;  4QB8 A;  1KE0 A;  4Q0H A;  4CPK A;  4UA6 A;  4O01 A;  1NZO A;  2B5R A;  2EWV A;  1MXO A;  2PBY A;  2H0Y A;  4JGO A;  2WAE A;  3PAE A;  3Q7V A;  4GNU A;  3LR3 A;  2HGV A;  1DJA A;  5E2H A;  3TOI A;  4WZ5 C;  1D06 A;  2G2U A;  3TG9 A;  4L9E A;  2XQZ A;  3EGX C;  1L2S A;  1FCO A;  1YSP A;  3F1N A;  3VE3 A;  3HLB A;  3IBR A;  4Y0O A;  4PAU A;  4KZ8 A;  3HUM A;  4YIN A;  4MN5 A;  4I3J A;  2J9O A;  4ARZ B;  3ZVW A;  2W1R A;  2HJE A;  3DTM A;  1GHM A;  1GA9 A;  5CHU A;  2HV1 A;  4KEN B;  1NRJ A;  3CUE C;  4N9K A;  1GHI A;  1UGU A;  4WMC D;  1K54 C;  4UAA A;  3MXS A;  5J7E A;  1XA1 A;  4OLG A;  3UDF A;  4FUW A;  2ZC6 B;  1AXB A;  1PWC A;  4B9O A;  3W4Q A;  2QHK A;  5GHZ A;  5IU1 A;  2VK3 A;  3OOV A;  3BY8 A;  4E3M A;  1W8Q A;  3VP4 A;  3K3C A;  4OOY A;  1PYY A;  1E3U A;  2EA9 A;  5L8M A;  3IBJ A;  3MZE A;  1F9I A;  1F2K A;  3LI9 A; 
#chains in the Genus database with same CATH homology
 5K5B A;  1S1Y A;  1XJ4 A;  4GJ4 A;  3GDI A;  4BBT A;  3FPV A;  3CIT A;  2VEA A;  2B18 A;  2WKQ A;  4WL9 A;  4HY8 A;  1DRM A;  3K2N A;  4LRY C;  2BAS A;  1H3Q A;  3LIF A;  3MFX A;  5HWV A;  3SW1 A;  4Q0I A;  4Q0J A;  2PD8 A;  4DN0 A;  2QYB A;  1T19 A;  2V0U A;  3W2Z A;  3BQA A;  5MC7 A;  2XRO A;  1P9R A;  2A24 B;  3FC7 A;  2YKF A;  3S7O A;  3LYX A;  3UB9 A;  4LRX C;  4GLQ A;  4R70 A;  1LSV A;  4MCW A;  2XRN A;  3HCY A;  3C38 A;  2FH5 A;  4JGR A;  1MC0 A;  3TRC A;  1N9N A;  4CQH A;  1G6O A;  3KSI A;  3FG8 A;  1VHM A;  2CMN A;  2WKR A;  3EGD C;  5A8B A;  3NJA A;  1TD5 A;  3T4S A;  3NOU C;  4P6Z S;  2IA2 A;  3CWF A;  1T1A A;  2KLI A;  2JKT M;  3KO6 A;  4WUJ A;  3EEA A;  1P9W A;  4EES A;  1IFQ A;  4GS9 A;  2Z6C A;  4EET B;  3T4J A;  4JGQ A;  3VOL A;  4EU0 A;  1YSQ A;  2OAP 1;  3C2W A;  5F69 A;  4NXG A;  2ZMV A;  3RH8 B;  1W63 Q;  4L9F A;  2GJ3 A;  4M4X A;  3PBT A;  1MZU A;  4HQA A;  1OPX A;  4F3L A;  2D02 A;  3E4P A;  4CLC D;  2R78 A;  4QPR A;  5G4Z A;  4CLC C;  3BJN A;  2QKP A;  4GHI B;  5HSQ A;  3UE6 A;  4GS9 B;  3F1N B;  5HPF A;  4G3K A;  2ZOH A;  2QWS A;  4XT2 A;  4OOL A;  3U2A A;  1T18 A;  1XJ6 A;  1F5M A;  4I3A A;  4HH2 A;  3PYP A;  4Z1W A;  3MMH A;  2M7V A;  5HD3 A;  3E98 A;  1TS7 A;  5FL3 A;  1XFQ A;  4F3L B;  2PR5 A;  3K3D A;  4Y5F A;  4EER A;  4RQ9 A;  4FOF A;  2JKR M;  2LB5 A;  2J3T D;  2Z6D A;  4NXB A;  2Y8H A;  2J3T C;  1LL8 A;  4WEK A;  2NUP C;  4LPZ A;  1G28 A;  1TS8 A;  2XA7 S;  4XT2 B;  2V9A A;  3TE8 A;  2M1C A;  3OC2 A;  2VZW A;  4ETX A;  4IHQ A;  4WN5 A;  3F1O B;  5DFX A;  3ICY A;  3F1P A;  4I5S A;  2J3W A;  1OJ5 A;  5G4Y A;  2VJW A;  5DFY A;  3MQQ A;  5TBM A;  4HJ4 A;  1T1C A;  1ZTU A;  2YKH A;  3LR5 A;  3UB8 A;  4AFI A;  4EUV A;  2QJ5 A;  5F5Y A;  2W1T A;  4B93 A;  3OBF A;  4EW7 A;  4WEJ A;  1LSX A;  3PR6 A;  3OCN A;  4CLC E;  2O99 A;  1OT9 A;  3LID A;  2ZMF A;  3BY9 A;  3ZYT A;  3KYQ A;  2FZ0 A;  1BYW A;  3IS2 A;  5KSH A;  4EEP A;  5AJG A;  4KQO A;  4ME4 A;  5KIZ A;  3F1P B;  4NXF A;  1D7E A;  3ULF A;  4MDZ A;  4UEY A;  5TBM B;  2PD7 A;  1OTA A;  4MN6 A;  4UQI S;  4CLC A;  3OLO A;  1S1Z A;  1LT0 A;  4I39 A;  3CUE A;  2H28 A;  2I9V A;  1OT6 A;  2VA0 A;  3TW8 A;  1UWP X;  3MXQ A;  4GCZ A;  1S67 L;  3BW6 A;  4BWI A;  2W3D A;  2PT7 A;  5HDS A;  2W3E A;  1S4S A;  1KOU A;  3OCL A;  3P01 A;  4IUK A;  1IOU A;  4NXE A;  3IS2 B;  4PKY G;  4HNB A;  5TJJ A;  3LIB A;  4OOM A;  3R7W A;  1ZHH B;  1TS0 A;  2W0N A;  3EOI A;  3KSF A;  5DF9 A;  1XJ3 A;  2P7J A;  1DP6 A;  2VGL S;  1JNU A;  4R38 A;  3VE4 A;  4BBU A;  2B02 A;  4DMZ A;  3H82 A;  4IUH A;  2KDK A;  2P08 A;  4HJ3 A;  3S7Q A;  3T50 A;  1STZ A;  1UWN X;  4HP9 A;  3LUQ A;  4JGP A;  1DP9 A;  3TJZ C;  3E4O A;  1OTI A;  1T1B A;  1OTB A;  3R4K A;  4MMN A;  2OWH A;  3UB7 A;  3MJQ A;  3R7W B;  4MN7 A;  3UE3 A;  5HDC A;  4WLA A;  2PHY A;  4O0P A;  5HZH A;  3PBO A;  2PDR A;  4HOI A;  1N9O A;  1TF1 A;  5EFW A;  3PHY A;  2O9B A;  3H82 B;  4UQI M;  3HJK A;  1XFN A;  3O5Y A;  3JVV A;  4LRZ E;  5HWW A;  5C5K A;  3NOT C;  1X0O A;  1ODV A;  1P0Z A;  3E0Y A;  2P04 A;  1OJG A;  2OAQ 1;  2VV6 A;  3T4L A;  2PYP A;  3MQO A;  2KOI A;  3A0R A;  4YOF A;  1GSW A;  5F6A A;  4P6Z M;  3CLO A;  1S4R A;  4Y2F A;  3PBR A;  2OWJ A;  3NOP C;  5HPI A;  1DP8 A;  3CI6 A;  4Y3I A;  3MQ0 A;  3KX0 X;  3MF0 A;  4EXO A;  1TS6 A;  2Y79 A;  4YWZ A;  1NLY A;  3EQV A;  3LI8 A;  4O8G A;  5J4E A;  2O9C A;  2PYR A;  4H6J A;  3KSG A;  2NUT C;  4DJ2 A;  5J3W A;  1WA9 A;  5HL6 A;  3NHQ A;  4GW9 A;  2JN7 A;  1LSW A;  2OOL A;  4HP4 A;  1YAX A;  5DKK A;  4ZRR A;  1NLZ A;  2G7U A;  2D01 A;  3KYZ A;  4HH3 A;  2HJ9 C;  4BMW A;  2V1A A;  5AVE A;  3H7W A;  5IT5 A;  2W3F A;  3VV4 A;  3KSH A;  5HDD A;  3C30 A;  3LIE A;  4WF0 A;  2J80 A;  5HD5 A;  3A0V A;  2ZBB A;  5LBR A;  4H6J B;  3T4Q A;  1Y28 A;  1GSV A;  5HWT A;  2O0Y A;  1YKD A;  2GX5 A;  4KUO A;  2INW A;  5AVF A;  3LIA A;  3HJI A;  1F98 A;  3PBN A;  5CX7 A;  2L1M A;  3P7N A;  2W1T B;  4K08 A;  3GEC A;  3D3O A;  4KQD A;  3ZQ5 A;  3PXP A;  3UB6 A;  2V1B A;  2XA7 M;  4G3W A;  2L0W A;  3FPW A;  2ZOI A;  3H7W B;  3S7P A;  2JKT I;  2EWW A;  2GNX A;  3LFV A;  3E4Q A;  3LR4 A;  2WKP A;  3G6O A;  4II7 A;  4PHT A;  1V9Y A;  3UME A;  2XSS A;  1MKM A;  4KUK A;  4Q0H A;  4L0L A;  2PR6 A;  2VV8 A;  4O01 A;  4YNR A;  3PBS A;  4CLC B;  5DKL A;  2EWV A;  1VB6 A;  4HIA A;  4I3I A;  3RTY A;  5DJT A;  2KX6 A;  4JGO A;  4ARZ A;  3PBQ A;  3LR3 A;  2LB9 A;  2HGV A;  3BQ8 A;  4ETZ A;  2GZA A;  4IJG A;  1D06 A;  4EEU A;  4HHD A;  4L9E A;  3A0S A;  4GHI A;  3EGX C;  1YSP A;  3T4O A;  1V9Z A;  3F1N A;  3VE3 A;  3LIC A;  4BBV A;  3IBR A;  4PAU A;  3D72 A;  5F68 A;  4MN5 A;  3B47 A;  2VV7 A;  3T4K A;  4I3J A;  4NKP A;  1OTD A;  2VKS A;  5DJU A;  4ARZ B;  4DJ3 A;  2W1R A;  2HJE A;  4E04 A;  2JKR I;  1N9L A;  3LR0 A;  3EQU A;  1GSX A;  2HV1 A;  1NRJ A;  3CUE C;  4L9G A;  3S7N A;  4WEL A;  2K31 A;  3V67 A;  2M7U A;  2JHE A;  1UGU A;  3JVU A;  2VGL M;  3B33 A;  1P97 A;  3DBA A;  1OTE A;  2VLG A;  4EQ1 A;  5J7E A;  2A2L A;  3MR0 A;  3RFB A;  1W63 M;  2O9A A;  4R6L A;  2DMW A;  4HI4 A;  4PKY A;  2K2N A;  4G3V A;  3F1O A;  1XJ2 A;  4B9O A;  2MJ6 A;  2QHK A;  3T4T A;  4FSF A;  1H8M A;  4HJ6 A;  5I5L A;  5IU1 A;  2QJ7 A;  3OOV A;  3BY8 A;  2W27 A;  3EWK A;  3B42 A;  4BJP A;  3K3C A;  1EW0 A;  3EEH A;  3UMD A;  1S66 L;  2K7S A;  2V0W A;  3H9W A;  4R3A A;  1NWZ A;  5IS1 A;  2EA9 A;  2HF6 A;  5L8M A;  3IBJ A;  2L4R A;  4NEE D;  3CAX A;  2A24 A;  1F9I A;  3BWL A;  4I38 A;  4LLO B;  2VX8 A;  2W3G A;  3C8C A;  2W3H A;  3LI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...