2HV1A

Haddock structure of arnt pas-b homodimer
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
b'CQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aryl hydrocarbon receptor nuclear translocator
molecule tags Transcription, protein binding
source organism Homo sapiens
publication title Practical aspects of using paramagnetic relaxation enhancements for protein docking: Application to the ARNT PAS-B homodimer
rcsb
total genus 32
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2hv1A01
4MN6A 4B9OA 4WF0A 4LRXC 1P0ZA 3T50A 4EEPA 5J4EA 5IS1A 2QKPA 5HZHA 4HHDA 3LICA 3NOUC 2P7JA 1OTBA 4YWZA 3D72A 3VOLA 3H7WB 3UB9A 1ODVA 1S67L 3PYPA 4BBVA 3P7NA 2CMNA 1LT0A 1MZUA 3NJAA 4KQDA 3F1OA 5HD3A 5HWTA 4GHIB 1Y28A 4HQAA 4BBUA 2V9AA 3ICYA 1DP8A 1OTAA 4GW9A 5DJUA 2L4RA 3VE3A 4EW7A 3NHQA 2QJ5A 2WKQA 4WN5A 2J80A 3LI9A 3H9WA 5G4ZA 4GS9B 5F5YA 3KX0X 5A8BA 3RH8B 2OWHA 3RTYA 1XJ6A 4HY8A 4PKYA 3BWLA 4WUJA 2PDRA 4I5SA 1UWNX 5HDDA 1OTIA 3MR0A 2I9VA 5AVEA 4BBTA 2VV8A 5HWWA 2INWA 3BY8A 3E4OA 3IS2A 1NWZA 4R70A 2KX6A 1S4RA 1N9NA 1XJ3A 1DRMA 3K3CA 1T18A 4NXBA 5G4YA 3UB8A 3UMEA 3LIEA 2D01A 1TS0A 3B33A 2GJ3A 4NXGA 1S66L 2Z6DA 5HSQA 5J7EA 1N9OA 3MFXA 3MQQA 2Z6CA 4EXOA 3LUQA 4MN5A 2HV1A 3C8CA 4HJ4A 5TBMA 4L9EA 1LSWA 2VV6A 1S1ZA 1N9LA 5I5LA 1D7EA 2K7SA 3UB7A 2ZOIA 3A0RA 2ZOHA 3OLOA 4I3AA 2JHEA 3GECA 4I38A 4LPZA 4R38A 2D02A 5DKKA 4R3AA 2PD8A 3LIAA 4H6JB 4I3JA 4I39A 3HJKA 3F1OB 1GSXA 4GHIA 1XJ4A 1VB6A 3H82B 1XJ2A 5DJTA 1T1BA 2PR5A 3MQOA 2A24A 1UWPX 4PKYG 4L9GA 5HWVA 4EERA 4HNBA 2BASA 1OTDA 2KDKA 4WLAA 5J3WA 3HJIA 2V0WA 4JGOA 2QWSA 2VEAA 3UE6A 1LSXA 5F68A 4E04A 3LI8A 4HOIA 1TS6A 3G6OA 2A24B 3BY9A 3NOTC 1F98A 3IS2B 2PR6A 1D06A 1V9YA 2PYRA 3H7WA 3MXQA 4K08A 2WKRA 4DJ2A 3F1NB 2VV7A 3ULFA 4EQ1A 2H28A 1LL8A 1T1AA 3E4PA 3F1PB 3MJQA 1X0OA 3A0SA 4JGQA 2EA9A 4WL9A 3PHYA 1UGUA 1OJ5A 3K3DA 4RQ9A 2W0NA 1OTEA 1OT9A 3CLOA 3LIBA 5HDCA 3FG8A 4LRZE 3CWFA 1P97A 3UMDA 4EETB 3EEHA 4HJ3A 4EESA 2YKFA 5F6AA 1LSVA 5TBMB 4F3LA 1JNUA 4XT2A 1GSVA 2QHKA 1OT6A 1TS7A 3F1NA 3H82A 4HP9A 4XT2B 3C2WA 4H6JA 4HP4A 1G28A 1WA9A 2B02A 1XFQA 4HI4A 3UB6A 3LYXA 4HH2A 1T19A 5HDSA 2L0WA 1EW0A 5HD5A 1S4SA 4LRYC 4KUOA 5EFWA 2ZBBA 3A0VA 4I3IA 1OJGA 3SW1A 2QJ7A 2V0UA 3E4QA 2VLGA 4HJ6A 4EEUA 4JGPA 3IBRA 3LIDA 2V1BA 1DP6A 4M4XA 4NXFA 3ZQ5A 4JGRA 4L9FA 1BYWA 4KUKA 3NOPC 4GS9A 4LLOB 1XFNA 1GSWA 2M1CA 2PYPA 1T1CA 3LIFA 4HH3A 2WKPA 1V9ZA 4NXEA 5F69A 2W27A 3F1PA 3EWKA 5KIZA 1S1YA 3GDIA 5DKLA 2PD7A 4GCZA 2L1MA 2PHYA 2R78A 5IU1A 1KOUA 4R6LA 3CAXA 2JN7A 1F9IA 2YKHA 4F3LB 3FC7A 4HIAA 2V1AA 1TS8A 2OWJA 5AVFA 1DP9A 2OOLA 4DJ3A 3VE4A
chains in the Genus database with same CATH superfamily
2QKPA 1FILA 3QNCA 1OTBA 3D72A 2XR0A 1O7EA 5HWTA 1C3BA 1W63M 2BLSA 1DJAA 3SOIA 5FQJA 1W63Q 4WUJA 2J3TD 5DTKA 1FCOA 3TE8A 5TR7A 3S7PA 5HWWA 3IF5A 4GOGA 5A91A 2KX6A 4LV3A 4Q0HA 5GLBA 2PT7A 3OZHA 4GKUA 1LSWA 1XGIA 1K6SA 5FEFA 3JYIA 4IUKA 3EEAA 4KQQA 3LY4A 2PR5A 3ZVTA 3BW6A 2XA7S 4L0LA 4JF4A 2Y2QA 5FEGA 1W5DA 2H10A 3UE6A 4WBGA 3DWKA 4Z9QA 2EX6A 3Q07A 1F98A 4GDNA 1V9YA 3H7WA 1A0KA 2Q0OA 1X0OA 3PHYA 5FDSA 1DJCA 1OTEA 5CRFA 1L0EA 4X56A 5F6AA 3IBJA 1NYYA 4XT2A 3HREA 2QMIA 5CECA 1JWZA 3IHBA 2XSSA 2Y8HA 4LRYC 2ZBBA 3A0VA 4PM9A 4ARZB 1IKIA 2R9XA 3A3FA 3CPTA 4UEYA 3Q7VA 3JVVA 5KZHA 5CTMA 4GCZA 5F1FA 2ZL1B 3R4KA 4ZRRA 2Y2JA 4PPRA 3A3DA 3LR4A 5EECA 4JKTA 1TDLA 5HFOA 4CQHA 2Z2MB 3MXSA 3S7NA 2A49A 3T4JA 2Y2HA 1HD8A 4OOMA 3T1RA 4ZDXA 5G4YA 5EVEA 2X01A 2W1RA 4EUZA 5EPHA 4C3QA 4JF6A 4MN5A 3KYEA 4KZ6A 1G6AA 4OP5A 2XDMA 2P9VA 4OPZA 1CI9A 2PD8A 1IOUA 3H82B 3HVFA 1XJ2A 2MJ6A 4UQIM 5C5KA 5L8MA 4E04A 4HOIA 2Y2NA 1XXMA 1AWIA 4DJ2A 4S2IA 1LHYA 1ES3A 3FG8A 3QP2A 4EESA 2EWWA 1MPLA 4FCFA 2ZL1A 1H8ZA 3IXDA 2B02A 5EVID 4X69A 2FFFB 1ESUA 3G2YA 4KUOA 2Y2KA 3IHAA 2ZC7A 1DP6A 3LCEA 4RX3A 1BT5A 1E4DA 5EOOA 1XFNA 1V9ZA 3EWKA 1NZUA 1FSWA 3V67A 4KQOA 3ZHHA 4N9LA 3BQ8A 3WRTA 4MBHA 4CLCD 1PFLA 3IXGA 2P7JA 5FA7A 2V8CA 3H7WB 4QU3A 3VOLA 4LCLA 1MZUA 1YLTA 3F1OA 5DF7A 5DJUA 3CUEC 1I5QA 3H9WA 4OKPA 4DN0A 1UWNX 3HLBA 3MR0A 3UDFA 2VZWA 1NWZA 1XJ3A 4X55A 1S66L 4ZTKA 4DRTA 4EXOA 3MFXA 3C8CA 5DFXA 4MNRA 4DXCA 1D7EA 1YT4A 3OPPA 3UB7A 4S2MA 3MQ0A 3O87A 5DJTA 3ZFZA 3G4PA 2ZLYA 2ZQ8A 1FR6A 3N8SA 4GLQA 3BY9A 4BMWA 1VHMA 3ULFA 4EQ1A 1T1AA 3E4PA 3OC2A 1MWSA 3NDGA 3IF6C 3CWFA 4KZ4A 4C6YA 2G7UA 1FCMA 2EXAA 3GV9A 3C7VA 3H82A 4UA6A 3FV7A 1OJGA 4YINA 1FR1A 1CI8A 1H5XA 2WADA 4UA9A 2WAFA 4HEFA 2VGLS 2PYPA 4YFMA 1S1YA 3GDIA 3ZG0A 4ZJ3A 1KOUA 1F9IA 2Q9NA 4HIAA 2V1AA 2W3HA 2XH9A 4B9OA 4PM8A 3SS4A 1P9RA 1VETA 1JWPA 4JXWA 2G2UA 4Y2FA 1PNEA 5HAPA 3KYQA 3AGEA 4CLCC 1RP5A 3IH8A 3BM6A 3BY8A 3QP5A 4PM7A 1KGGA 3EGDC 2EX8A 4NXGA 5GLDA 3MQQA 1SDNA 4LV2A 1CK3A 1K55A 5L2FA 1MWTA 3ITBA 2K7SA 2JHEA 1BLHA 4ID4A 4GHIA 1VB6A 1S0WA 2XF3A 4IUHA 3D4FA 2W1TB 2KDKA 3CITA 5L10A 4WELA 4ZBEA 2WKHA 5KSHA 3NOTC 1IKGA 3UNWA 5GHYA 4Q8IA 2ACGA 1XPBA 5HSQA 5CHJA 1OT9A 3LIBA 4OQIA 5TBMB 1W8QA 1K25A 3VP3A 4DE3A 2A2LA 2WGIA 4KZ7A 3SW1A 4IVIA 2QJ7A 2O9BA 3E4QA 2GZAA 5FAOA 3ZYTA 1SHVA 3QHYA 5HL1A 4GS9A 4S2JA 3PAGA 3WS1A 5CX7A 2WZZA 3ZCZA 3P09A 4OQGA 2HDQA 2J3WA 3EGXC 3QP4A 1K57C 4CLCB 3MMHA 2JE5A 4DF6A 1ODVA 1SKFA 4BBVA 2XEPA 2VK3A 2PU4A 3ZDJA 3B3XA 2L4RA 3VE3A 2QJ5A 1NYMA 4DDYA 1EI5A 1NXYA 3UO9A 4B93A 2V8FA 5F83A 1MKMA 2D01A 5A90A 3B33A 2QPNA 5DFYA 4HJ4A 3V50A 1VEUB 4WM9A 4FOFA 4BLMA 2QYBA 1VQQA 3VP4A 5EVIC 2M7UA 5U47A 5HWVA 5EOEA 4E3JA 3NDEA 3ISGA 2V0WA 4JGOA 4RX2A 4EBNA 3MXQA 1KE4A 2EXBA 2WKRA 1Y54A 3IT9A 2VKSA 4JGQA 1N9BA 3MKEA 4EETB 1YLJA 2Y55A 3E98A 3LGOA 1LSVA 5KMWA 1LI0A 1GSVA 4HP9A 5CXWA 3EOIA 3PBQA 3UE1A 3MKFA 4HI4A 3LYXA 4E6WA 1EW0A 2IWCA 2HF6A 1YKDA 4EWFA 2Y79A 3IWIA 4M4XA 3Q81A 3W8KA 3NOPC 3Q7VB 4DE0A 2P9VB 4N1HA 4BQMA 2R78A 3WRZA 1MBLA 2NUPC 3OCNA 1TEMA 3QP1A 4LRXC 3W4OA 5CEDA 4Y0UA 5CGWA 2K31A 3P7NA 4UHUA 4KQDA 3O86A 5CHUA 1BTLA 3NHQA 4WN5A 3HBRA 2KLIA 5EE8A 2OWHA 1XJ6A 1NRJA 1LLBA 4MMNA 5FQIA 1NY0A 3AGFA 4IVKA 1S4RA 1ONGA 1T18A 3VOZA 2B18A 4OQ0A 1NZOA 5FSRA 3IF6A 2ZJ9A 1ZG4A 1S1ZA 1N9LA 4E3IA 5EVIA 3ZG7B 2QZ6A 4LPZA 4RVAA 5DKKA 4R3AA 4FTXA 4H6JB 3HJKA 3BFFA 4OLDA 3PBOA 3S22A 2JKRM 4O7DA 2X02A 4BWIA 5FATA 3CUEA 1WE4A 3VMAA 1EWZA 1E25A 3ZNTA 2JKFA 3PBNA 4WL9A 3IX8A 3VSLA 2ZMVA 4P87A 3G32A 1P97A 3BFDA 2R9WA 1K54A 4KZ5A 1ESIA 3BLSA 2Z2LB 2W3GA 5DVAA 2JKGA 3M6HA 4HJ6A 4LV0A 4KENB 3W4PA 3HUMA 3CJMA 2HDUA 3T4QA 3NCKA 5AQ9A 4R23A 2W1TA 5AVFA 5GLCA 3SZTA 3VE4A 5HAIA 4B88A 4EEPA 3Q1FA 4P6ZM 5HZHA 3E2LA 4P6ZS 3S1YA 1VEUA 1LT0A 1Y28A 3D9YA 4HESA 3ICYA 2ZM0A 1SCWA 3UDXA 5A8BA 2XFTA 4ZJ1A 1BLSA 4HY8A 3UY6A 2PRFA 4KZ9A 3G34A 4K0XA 3DAVA 3K3CA 4NXBA 2PAVP 1XA1A 1YLZA 2XFSA 3W4QA 1ERMA 1KE3A 4G3VA 2J7VA 1LL9A 4R1GA 2H0YA 1XX2A 4QPRA 2HPBA 3IWOA 1IEMA 1H8MA 3TG9A 4EBLA 2HP5A 2VEAA 3DBAA 3G35A 2XRNA 1TS6A 4JPMA 3O88A 2A24B 1CJFA 3F1NB 3C30A 3F1PB 2B5RA 1P9WA 1UGUA 3RXWA 4LRZE 5M18A 2Y2PA 3LR3A 4Y5FA 3MBZA 1PI4A 1XFQA 1RGYA 4HH2A 2L0WA 2ZC5B 4X25A 3KSGA 4JGRA 4XUXA 4E3NA 3G2ZA 4MBFA 1K6RA 4R4SA 3KSFA 4HH3A 3BLMA 3UB5P 1JWVA 4E3LA 1EROA 4N92A 4OONA 2XD1A 4UA7A 3P98A 3PR6A 1MWRA 4CJNA 3NIAA 3RXXA 4HHDA 5IS1A 5CTNA 3FZCA 2P74A 3T1SA 2G2WA 4DDSA 3O5YA 5GHZA 3OPRA 5HD3A 4BL3A 4WEKA 2K2NA 2FH5A 4MCWA 3MZEA 5FI7A 3RTYA 2PDRA 3ITAA 1TF1A 2VV8A 2WGWA 3M2JA 2JKRI 3Q82A 3SH9A 2WKIA 1K56A 3LR5A 2XA7M 3HUNA 3QP8A 4QJGA 1ZC2A 1GHPA 4MLLA 5AQAA 3TJZC 1BLPA 1KDWA 4I3AA 5IHVA 3I7JA 3LIAA 1XJ4A 3QP6A 3V3SA 4UQIS 4Q0JA 4LFUA 1OTDA 3G6OA 2WYXA 1QMFA 1AXBA 3GRJA 4QD4A 3CLOA 4QWOA 3BFEA 5EM0A 1W7FA 3C2WA 4PHTA 2RCXA 1RCJA 5HDSA 4HBTA 2X71A 1OPXA 4JGPA 1S6RA 2V1BA 3P01A 3DTKA 4OPQA 5CGSA 1M40A 2PBYA 5EM1A 3PBTA 4OOYA 1K55C 1TS8A 1DP9A 5FI6A 4KG6A 4DXBA 2PU2A 1PIOA 5HX9A 2CMNA 3PTEA 3MZFA 2ZM2A 2WKEA 3VFHA 4GW9A 4FD8A 4FSFA 2J80A 3L9KA 4GB7A 4NK3A 4OP8A 1STZA 3BEBA 4P0MA 4EUVA 3V5MA 3IS2A 3CG5A 4OPRA 1KVMA 4K0WA 5TJJA 5K5BA 3UMEA 4EQIA 3SS3A 1TS0A 4EBPA 4S2PA 5L07A 3LEQA 1PI5A 2HV1A 2Y2OA 3LUQA 3WS0A 3B47A 3G31A 1LL5A 5I5LA 3T4KA 1XKZA 5AJGA 1D1JA 3MFDA 3LO7A 3UPOA 3UE3A 1T1BA 2A24A 4H8RA 4L9GA 4HNBA 2Y2IA 2QWSA 1LSXA 3LI8A 3LY3A 2P04A 4O0PA 3N8LA 1ZTUA 1D06A 3T1XA 5FQQA 1H8YA 2VV7A 3EQUA 2VJWA 3VSKA 4GZBA 3UMDA 3S7QA 2YKFA 2WAEA 3HLDA 1HZOA 3WS4A 4OQHA 2EX9A 5HAQA 1G28A 2H0TA 3GTCA 2OLUA 2KOIA 3S4XA 5A92A 3HUOA 5DF8A 1NRFA 1MWUA 1GSWA 1IFQA 3C4OA 3VP0A 1F2KA 4MN7A 3VFFA 5DKLA 3ZNYA 3JPUA 4F3LB 1BUEA 1RGZA 4MN6A 3A3JA 3GR2A 4YWZA 3T12B 3UB9A 5FAPA 5FQMA 5GHXA 2C5WB 2V9AA 1MC0A 3T1QB 2BTFP 2WKQA 1L2SA 1QMEA 1L0GA 1I2WA 3LEZA 4I5SA 5FQ9A 1PYYA 5AVEA 4BBTA 3BJNA 2FZ0A 1GHMA 4QHCA 1DRMA 1JTGA 2JCHA 1F5MA 1L3LA 4Y13A 4DE1A 3GMWA 2EWVA 3BRMA 4FUWA 3OPHA 4MEZA 3A0RA 4U3TA 4R38A 4D2OA 3NC8A 1ALQA 1PZPA 2BASA 5FL3A 1OMEA 2VGLM 1FQGA 1KGFA 1H0MA 3HCYA 4LV1A 5HDCA 3LR0A 4OOLA 1IYSA 2HJ9C 1PRQA 4F3LA 4XT2B 1YSPA 1ZHHB 4JXSA 5GLAA 1NJ4A 1T19A 4KQRA 4ZAMA 4XUZA 4WMCD 4NXFA 4N1XA 1YPRA 3CZDA 4KUKA 4WYYA 4WZ5A 4UAAA 2DRWA 3F1PA 3FKVA 2HDSA 4R6LA 3CAXA 2YKHA 2OWJA 5CGXA 3GQZA 3WWXA 3UDIA 3NY4A 1G5UA 3KSHA 4D60A 3NOUC 4GD6A 4NETA 3HLWA 4WZ5C 4ARZA 2WK0A 3SS5A 1KDSA 1OTAA 4GN2A 4EW7A 3FPVA 5F5YA 5EVIB 3K2NA 2HP9A 3R7WA 3SH7A 1YSQA 2ZC3B 3MXRA 2Y2LA 3NULA 1YLYA 2Z6DA 2Z6CA 4E3KA 4S2LA 4GDBA 3MZDA 4LCMA 4QB8A 4DE2A 3OLOA 3N4IA 3MQOA 4PKYG 1UWPX 1YLPA 4Y7PA 3GSGA 3HJIA 5CEBA 2OLVA 3TSGA 4II7A 3T4TA 2W3FA 1KGEA 2PYRA 1LL8A 4G3WA 4DJ3A 1K56D 2EA9A 3K3DA 4HBUA 5DTTA 3RJUA 2GNXA 3MF0A 4U0XA 5DF9A 3Q7ZA 1TS7A 1I2SA 1L0DA 1WA9A 4JF5A 4KZBA 4O01A 5HD5A 4X1MA 4I3IA 2J9OA 3NI9A 4ESPA 4EEUA 3QNBA 2IWBA 3PBRA 4LGWA 4L9FA 1GCEA 4NXEA 4YOFA 1U60A 3ZGAB 1E3UD 2JN7A 4BENA 4Y15A 5J4EA 1SKOA 5F82A 3PYPA 2WZXA 4WEJA 2OAP1 3CMZA 4RA7A 2HP6A 4HQAA 4CLCE 1WYCA 2O0YA 3HLFA 1PWDA 3IX4A 2JBFA 4GS9B 1XGJA 3E2KA 1N9NA 1K4EA 1W8YA 2JKTI 4AFIA 2XQZA 2W3DA 1SKOB 1IYPA 2P08A 1XA7A 3UPNA 1VM1A 1YAXA 5TBMA 3RFBA 2VV6A 5M19A 3TW8A 4KZ8A 2ZOHA 3A3IA 4I38A 5FQKA 4OLGA 2DCFA 2WGWB 1TDGA 4BD1A 1G68A 1PZOA 1GA9A 4A5RA 2M7VA 4IBRA 5J3WA 1CF0A 4IBXA 4FH2A 5GL9A 2PR6A 3T4OA 2JC7A 1Q2PA 2VGKA 1BSGA 1K0KA 2W0NA 3OBFA 3DTMA 3PXPA 5FI2A 4B4XA 2JKTM 2H5SA 4G3KA 2QHKA 4HP4A 3UB6A 2OAQ1 2VGJA 1S4SA 1FOFA 1G6OA 4PAUA 4ETZA 2EFXA 3V3RA 3IQAA 1ACFA 2B95A 3IBRA 2J9PA 2WUQA 3ZQ5A 1JTDA 4N9KA 3SH8A 3T4SA 1YMXA 2ZC6B 5TFQA 3LIFA 2W27A 2PD7A 2ZQ7A 4BJPA 4Y0OA 4R0QA 3S7OA 2IA2A 3VV4A 4S2KA 3LICA 1PWCA 4RYEA 3IXHA 4GHIB 3DWZA 3U4LP 4BBUA 1CEFA 1PW8A 1K38A 1IYQA 1O07A 1ONHA 2A3UA 3BWLA 5FASA 4PM6A 2I9VA 2CC1A 3IH9A 2E8IA 1L0FA 5M1AA 3U2AA 4MBKA 2IWDA 4JXVA 2Y2MA 2GJ3A 3FKWA 1J9MA 1NLZA 5TGFA 5J7EA 3ZVWA 4EV4A 3UN7A 2EFUA 1BLCA 3ZG8B 5AQBA 4WZ4A 5I94A 4KG5A 3GECA 2D02A 5HW3A 3VP1A 5G18A 2BG1A 1DJBA 4GNUA 2O9AA 1ES5A 2E8JA 4MDZA 4S2NC 5E2GA 3IS2B 2HGVA 3CI6A 1SDEA 2OSUA 3VP2A 3A0SA 3C38A 2LB9A 1HTZA 2FFYA 4HJ3A 5MC7A 1Y4OA 1OT6A 4K91A 3VOYA 4FH4A 3OOVA 1IELA 2ZMAA 5EFWA 1Q2QA 5E43A 5A93A 4QY6A 1FSYA 3N7WA 3JVUA 4S2OA 3DW0A 1BYWA 4LLOB 2XGNA 4JBFA 2M1CA 5KSCA 5KIZA 3MSHA 2PHYA 2I72A 2DNSA 4X1LA 4QY5A 4R3BA 1PWGA 1HVBA 2RL3A 1YM1A 1YLWA 3R7WB 2ZQAA 3PAEA 5AQ7A 1ES2A 3KSIA 2OV5A 5HDDA 1CQAA 1M6KA 2INWA 3E4OA 3T4LA 1K4FA 1GHIA 3LIEA 3OCLA 1PW1A 2GDNA 3FWLA 1TD5A 3IF6B 3GVBA 2ZOIA 2ZC4B 1XP4A 2ZQDA 4X68A 1ES4A 1GSXA 4KG2A 4O8GA 4IHQA 4IJGA 4Q0IA 4S2NA 2Y4AA 2W3EA 2AVXA 1YQSA 3NECA 2XK1A 4PMAA 3M6BA 1WYBA 5EUAA 2O99A 3ZG9B 5HPFA 3N8RA 4GD8A 4RQ9A 2EX2A 2ZQ9A 1NLYA 4E3OA 1CEGA 3EEHA 4KZAA 1MXOA 5LBRA 2J8YA 4R4RA 2NUTC 1YMSA 4E6XA 4E3MA 2XD5A 5J8XA 4Y0TA 4OH0A 5HPIA 1BULA 1FCNA 4EU0A 4C75A 3FPWA 5E2HA 4BL2A 5EV0A 2XROA 1MY8A 1K54C 5IU1A 3C5AA 4JXGA 2OOLA 1P0ZA 3HLEA 3T50A 1ERQA 3NBLA 3O3VA 4JLFA 2HZ5A 1S67L 2LB5A 2UWXA 1DP8A 3CPTB 3L7HA 5G4ZA 4IEDA 2XLNA 4PKYA 2HJEA 1OTIA 2Y2GA 3BFCA 5E2EA 2VA0A 2ZMFA 3UPPA 3MS6A 4CPKA 3ZG5A 5D3OA 3C7UA 2Q9MA 3BFGA 3IX3A 5HARA 1TVFA 3E0YA 3HLGA 4I39A 4DKIA 3F1OB 3BECA 3FYZA 4EERA 3EQVA 4P85A 5F68A 3BQAA 3TOIA 4R3JA 1FIKA 4K08A 4CLCA 3G30A 3MJQA 3WS2A 4U0TA 2VX8A 1MKIA 2DMWA 3HL9A 4KZ3A 1JNUA 5IT5A 4OPYA 1DY6A 4H6JA 2V2FF 1Z09A 1IYOA 4P6BA 1W79A 3IXBA 2ZQCA 2UV0E 2Y91A 5CERA 4PM5A 1T1CA 3KYZA 2WKPA 2V1ZA 5F69A 3WS5A 3BYDA 1SZVA 5FDHA 1LI9A 2L1MA 1GA0A 4WF0A 3CHWP 3HLCA 4NG2A 3LFVA 3NJAA 2O9CA 5JYPA 3LI9A 3KX0X 3RH8B 5FAQA 2GX5A 2ZM8A 5BOHA 4B4ZA 1HLUP 1KVLA 4NKPA 4X6TA 2HDRA 4Y3IA 4R70A 3D3OA 3UB8A 4ZJ2A 3KO6A 1N9OA 3DTEA 4X53A 3A3EA 3AGDA 4L9EA 4YNRA 2PBDP 5JYOA 4WMCA 3V39A 3B42A 5HL6A 5L09A 4DMZA 4ETXA 4I3JA 3M2KA 1K57A 2V20A 1H3QA 4XXRA 4Z1WA 3W2ZA 2J3TC 2Y59A 4Y17A 3TRCA 3OPLA 4WLAA 5DTSA 4NEED 1JVJA 5F1GA 3PBSA 5E2FA 1BZAA 3C4PA 1VETB 2H28A 3IWQA 2C6WB 4LENA 1OJ5A 4OVDA 2WGVA 1ZKJA 2ZD8A 4M3KA 3DTIA 4GJ4A 1ZG6A 3F1NA 1KE0A 3UE0A 3N6IA 1E3UA 2V0UA 1J3WA 4BD0A 2VLGA 3LIDA 4F94A 1N4OA 1Z6FA 5EVLA 5CHMA 3FC7A 4ME4A
chains in the Genus database with same CATH topology
3S7OA 2IA2A 2J3WA 3EGXC 3VV4A 2QKPA 3LICA 1OTBA 4CLCB 3D72A 3MMHA 1ODVA 4BBVA 2CMNA 5HWTA 4GHIB 1W63M 4BBUA 4GW9A 2L4RA 3VE3A 2QJ5A 4FSFA 2J80A 1W63Q 4WUJA 2J3TD 3BWLA 1STZA 3TE8A 3S7PA 2I9VA 4EUVA 5HWWA 3IS2A 4B93A 2KX6A 3U2AA 5TJJA 1MKMA 5K5BA 3UMEA 2D01A 1TS0A 3B33A 2GJ3A 1NLZA 5J7EA 4Q0HA 5DFYA 3LUQA 2HV1A 2PT7A 4HJ4A 3B47A 4FOFA 1LSWA 5I5LA 2QYBA 3GECA 4IUKA 2M7UA 3T4KA 2D02A 3EEAA 5AJGA 3UE3A 1T1BA 2PR5A 2A24A 3BW6A 4L9GA 5HWVA 2XA7S 4HNBA 4L0LA 2V0WA 4JGOA 2QWSA 2O9AA 3UE6A 1LSXA 3LI8A 4MDZA 2P04A 4O0PA 1F98A 3IS2B 2HGVA 1D06A 1V9YA 1ZTUA 3MXQA 3CI6A 3H7WA 2WKRA 2VV7A 2VKSA 4JGQA 1X0OA 3EQUA 3A0SA 3C38A 3PHYA 2LB9A 1OTEA 2VJWA 3UMDA 4EETB 3S7QA 4HJ3A 3E98A 2YKFA 5F6AA 1LSVA 3IBJA 5MC7A 4XT2A 1GSVA 1OT6A 4HP9A 3EOIA 3PBQA 1G28A 4HI4A 3OOVA 3LYXA 1EW0A 2XSSA 2Y8HA 4LRYC 5EFWA 2HF6A 2ZBBA 3A0VA 1YKDA 2KOIA 2Y79A 3JVUA 4M4XA 4ARZB 1BYWA 4LLOB 3NOPC 1GSWA 2M1CA 4UEYA 1IFQA 3JVVA 4MN7A 5KIZA 5DKLA 4GCZA 2PHYA 2R78A 2NUPC 4F3LB 3R4KA 4ZRRA 3OCNA 4MN6A 3LR4A 4LRXC 4YWZA 3UB9A 2K31A 3P7NA 4KQDA 3R7WB 2V9AA 4CQHA 1MC0A 3NHQA 2WKQA 3KSIA 4WN5A 3S7NA 3T4JA 2KLIA 2OWHA 1XJ6A 1NRJA 4I5SA 5HDDA 4MMNA 4OOMA 5AVEA 4BBTA 3BJNA 2FZ0A 2INWA 3E4OA 3T4LA 1S4RA 1DRMA 5G4YA 1T18A 1F5MA 3LIEA 2B18A 2W1RA 3OCLA 2EWVA 4MN5A 1TD5A 1S1ZA 1N9LA 2ZOIA 3A0RA 4R38A 4LPZA 5DKKA 4R3AA 2PD8A 4H6JB 3HJKA 1IOUA 1GSXA 3H82B 4O8GA 1XJ2A 2MJ6A 4IHQA 3PBOA 4UQIM 5C5KA 2BASA 5FL3A 2JKRM 4IJGA 2VGLM 4Q0IA 4BWIA 2W3EA 5L8MA 4E04A 4HOIA 3CUEA 3HCYA 4DJ2A 2O99A 3PBNA 4WL9A 5HPFA 2ZMVA 4RQ9A 5HDCA 3LR0A 4OOLA 3FG8A 1NLYA 1P97A 2HJ9C 3EEHA 4EESA 2EWWA 4F3LA 5LBRA 4XT2B 1YSPA 2NUTC 1ZHHB 2B02A 1T19A 2W3GA 4KUOA 4HJ6A 4NXFA 1DP6A 5HPIA 3T4QA 4EU0A 4KUKA 3FPWA 1XFNA 1V9ZA 2XROA 3F1PA 3EWKA 2W1TA 5IU1A 3V67A 4R6LA 3CAXA 2YKHA 4KQOA 2OWJA 3BQ8A 5AVFA 2OOLA 3VE4A 1P0ZA 4CLCD 3KSHA 3T50A 4EEPA 4P6ZM 5HZHA 4P6ZS 3NOUC 2P7JA 3VOLA 3H7WB 1S67L 2LB5A 1LT0A 1MZUA 3F1OA 4ARZA 1Y28A 3ICYA 1DP8A 1OTAA 5DJUA 3CUEC 4EW7A 5G4ZA 3FPVA 3H9WA 5F5YA 5A8BA 4HY8A 4PKYA 4DN0A 2HJEA 3K2NA 1UWNX 3R7WA 1OTIA 3MR0A 2VZWA 1YSQA 1NWZA 2VA0A 1XJ3A 3K3CA 4NXBA 2ZMFA 1S66L 2Z6DA 4EXOA 3MFXA 2Z6CA 3C8CA 5DFXA 1D7EA 4G3VA 3UB7A 3MQ0A 3OLOA 3E0YA 4I39A 4QPRA 3F1OB 5DJTA 3MQOA 4PKYG 1UWPX 4EERA 1H8MA 3EQVA 3HJIA 4GLQA 2VEAA 3DBAA 5F68A 2XRNA 1TS6A 3BQAA 2A24B 3BY9A 4II7A 3T4TA 2W3FA 4BMWA 1VHMA 2PYRA 4K08A 4CLCA 3F1NB 3ULFA 3C30A 4EQ1A 1LL8A 1T1AA 3E4PA 3MJQA 3F1PB 3OC2A 4G3WA 4DJ3A 2EA9A 1P9WA 1UGUA 2VX8A 3K3DA 2DMWA 3CWFA 4LRZE 2GNXA 2G7UA 3LR3A 3MF0A 1JNUA 5DF9A 3H82A 5IT5A 1TS7A 4H6JA 4Y5FA 1WA9A 1XFQA 4HH2A 4O01A 2L0WA 5HD5A 4I3IA 1OJGA 4EEUA 3KSGA 3PBRA 4JGRA 4L9FA 2VGLS 2PYPA 3KSFA 1T1CA 3KYZA 4HH3A 2WKPA 4NXEA 4YOFA 5F69A 1S1YA 3GDIA 2L1MA 1KOUA 1F9IA 2JN7A 4HIAA 2V1AA 2W3HA 4B9OA 4WF0A 3PR6A 5J4EA 5IS1A 4HHDA 1P9RA 3PYPA 3O5YA 3LFVA 4WEJA 3NJAA 5HD3A 2OAP1 4HQAA 4CLCE 2O9CA 4WEKA 2O0YA 2K2NA 2FH5A 3LI9A 4MCWA 4Y2FA 4GS9B 3KX0X 3RH8B 3RTYA 2GX5A 2PDRA 3KYQA 4CLCC 1TF1A 2VV8A 4NKPA 3BY8A 4Y3IA 4R70A 1N9NA 3D3OA 3UB8A 2JKRI 3EGDC 2JKTI 4AFIA 3KO6A 3LR5A 2W3DA 4NXGA 2P08A 2XA7M 1N9OA 3MQQA 1YAXA 5TBMA 4L9EA 3RFBA 3TJZC 2VV6A 3TW8A 4YNRA 2K7SA 3B42A 5HL6A 2ZOHA 4I3AA 4DMZA 2JHEA 4I38A 4ETXA 4I3JA 3LIAA 4GHIA 1XJ4A 1VB6A 1H3QA 4Z1WA 3W2ZA 4IUHA 4UQIS 2J3TC 4Q0JA 2M7VA 2W1TB 1OTDA 2KDKA 3TRCA 3CITA 4WLAA 5J3WA 4NEED 3PBSA 4WELA 3G6OA 5KSHA 3NOTC 2PR6A 3T4OA 2H28A 5HSQA 1OJ5A 3OBFA 2W0NA 1OT9A 3CLOA 3LIBA 3PXPA 2JKTM 5TBMB 4G3KA 4GJ4A 2QHKA 3F1NA 3C2WA 4PHTA 4HP4A 2A2LA 3UB6A 2OAQ1 5HDSA 1S4SA 1G6OA 4PAUA 4ETZA 3SW1A 2QJ7A 2V0UA 2O9BA 3E4QA 2VLGA 1OPXA 2GZAA 4JGPA 3IBRA 3LIDA 2V1BA 3P01A 3ZYTA 3ZQ5A 3T4SA 4GS9A 3LIFA 2W27A 3PBTA 2PD7A 5CX7A 4BJPA 3FC7A 1TS8A 1DP9A 4ME4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MN6 A;  4B9O A;  4WF0 A;  4LRX C;  1P0Z A;  3T50 A;  4EEP A;  5J4E A;  5IS1 A;  2QKP A;  5HZH A;  4HHD A;  3LIC A;  3NOU C;  2P7J A;  1OTB A;  4YWZ A;  3D72 A;  3VOL A;  3H7W B;  3UB9 A;  1ODV A;  1S67 L;  3PYP A;  4BBV A;  3P7N A;  2CMN A;  1LT0 A;  1MZU A;  3NJA A;  4KQD A;  3F1O A;  5HD3 A;  5HWT A;  4GHI B;  1Y28 A;  4HQA A;  4BBU A;  2V9A A;  3ICY A;  1DP8 A;  1OTA A;  4GW9 A;  5DJU A;  2L4R A;  3VE3 A;  4EW7 A;  3NHQ A;  2QJ5 A;  2WKQ A;  4WN5 A;  2J80 A;  3LI9 A;  3H9W A;  5G4Z A;  4GS9 B;  5F5Y A;  3KX0 X;  5A8B A;  3RH8 B;  2OWH A;  3RTY A;  1XJ6 A;  4HY8 A;  4PKY A;  3BWL A;  4WUJ A;  2PDR A;  4I5S A;  1UWN X;  5HDD A;  1OTI A;  3MR0 A;  2I9V A;  5AVE A;  4BBT A;  2VV8 A;  5HWW A;  2INW A;  3BY8 A;  3E4O A;  3IS2 A;  1NWZ A;  4R70 A;  2KX6 A;  1S4R A;  1N9N A;  1XJ3 A;  1DRM A;  3K3C A;  1T18 A;  4NXB A;  5G4Y A;  3UB8 A;  3UME A;  3LIE A;  2D01 A;  1TS0 A;  3B33 A;  2GJ3 A;  4NXG A;  1S66 L;  2Z6D A;  5HSQ A;  5J7E A;  1N9O A;  3MFX A;  3MQQ A;  2Z6C A;  4EXO A;  3LUQ A;  4MN5 A;  2HV1 A;  3C8C A;  4HJ4 A;  5TBM A;  4L9E A;  1LSW A;  2VV6 A;  1S1Z A;  1N9L A;  5I5L A;  1D7E A;  2K7S A;  3UB7 A;  2ZOI A;  3A0R A;  2ZOH A;  3OLO A;  4I3A A;  2JHE A;  3GEC A;  4I38 A;  4LPZ A;  4R38 A;  2D02 A;  5DKK A;  4R3A A;  2PD8 A;  3LIA A;  4H6J B;  4I3J A;  4I39 A;  3HJK A;  3F1O B;  1GSX A;  4GHI A;  1XJ4 A;  1VB6 A;  3H82 B;  1XJ2 A;  5DJT A;  1T1B A;  2PR5 A;  3MQO A;  2A24 A;  1UWP X;  4PKY G;  4L9G A;  5HWV A;  4EER A;  4HNB A;  2BAS A;  1OTD A;  2KDK A;  4WLA A;  5J3W A;  3HJI A;  2V0W A;  4JGO A;  2QWS A;  2VEA A;  3UE6 A;  1LSX A;  5F68 A;  4E04 A;  3LI8 A;  4HOI A;  1TS6 A;  3G6O A;  2A24 B;  3BY9 A;  3NOT C;  1F98 A;  3IS2 B;  2PR6 A;  1D06 A;  1V9Y A;  2PYR A;  3H7W A;  3MXQ A;  4K08 A;  2WKR A;  4DJ2 A;  3F1N B;  2VV7 A;  3ULF A;  4EQ1 A;  2H28 A;  1LL8 A;  1T1A A;  3E4P A;  3F1P B;  3MJQ A;  1X0O A;  3A0S A;  4JGQ A;  2EA9 A;  4WL9 A;  3PHY A;  1UGU A;  1OJ5 A;  3K3D A;  4RQ9 A;  2W0N A;  1OTE A;  1OT9 A;  3CLO A;  3LIB A;  5HDC A;  3FG8 A;  4LRZ E;  3CWF A;  1P97 A;  3UMD A;  4EET B;  3EEH A;  4HJ3 A;  4EES A;  2YKF A;  5F6A A;  1LSV A;  5TBM B;  4F3L A;  1JNU A;  4XT2 A;  1GSV A;  2QHK A;  1OT6 A;  1TS7 A;  3F1N A;  3H82 A;  4HP9 A;  4XT2 B;  3C2W A;  4H6J A;  4HP4 A;  1G28 A;  1WA9 A;  2B02 A;  1XFQ A;  4HI4 A;  3UB6 A;  3LYX A;  4HH2 A;  1T19 A;  5HDS A;  2L0W A;  1EW0 A;  5HD5 A;  1S4S A;  4LRY C;  4KUO A;  5EFW A;  2ZBB A;  3A0V A;  4I3I A;  1OJG A;  3SW1 A;  2QJ7 A;  2V0U A;  3E4Q A;  2VLG A;  4HJ6 A;  4EEU A;  4JGP A;  3IBR A;  3LID A;  2V1B A;  1DP6 A;  4M4X A;  4NXF A;  3ZQ5 A;  4JGR A;  4L9F A;  1BYW A;  4KUK A;  3NOP C;  4GS9 A;  4LLO B;  1XFN A;  1GSW A;  2M1C A;  2PYP A;  1T1C A;  3LIF A;  4HH3 A;  2WKP A;  1V9Z A;  4NXE A;  5F69 A;  2W27 A;  3F1P A;  3EWK A;  5KIZ A;  1S1Y A;  3GDI A;  5DKL A;  2PD7 A;  4GCZ A;  2L1M A;  2PHY A;  2R78 A;  5IU1 A;  1KOU A;  4R6L A;  3CAX A;  2JN7 A;  1F9I A;  2YKH A;  4F3L B;  3FC7 A;  4HIA A;  2V1A A;  1TS8 A;  2OWJ A;  5AVF A;  1DP9 A;  2OOL A;  4DJ3 A;  3VE4 A; 
#chains in the Genus database with same CATH topology
 2QKP A;  1FIL A;  3QNC A;  1OTB A;  3D72 A;  2XR0 A;  1O7E A;  5HWT A;  1C3B A;  1W63 M;  2BLS A;  1DJA A;  3SOI A;  5FQJ A;  1W63 Q;  4WUJ A;  2J3T D;  5DTK A;  1FCO A;  3TE8 A;  5TR7 A;  3S7P A;  5HWW A;  3IF5 A;  4GOG A;  5A91 A;  2KX6 A;  4LV3 A;  4Q0H A;  5GLB A;  2PT7 A;  3OZH A;  4GKU A;  1LSW A;  1XGI A;  1K6S A;  5FEF A;  3JYI A;  4IUK A;  3EEA A;  4KQQ A;  3LY4 A;  2PR5 A;  3ZVT A;  3BW6 A;  2XA7 S;  4L0L A;  4JF4 A;  2Y2Q A;  5FEG A;  1W5D A;  2H10 A;  3UE6 A;  4WBG A;  3DWK A;  4Z9Q A;  2EX6 A;  3Q07 A;  1F98 A;  4GDN A;  1V9Y A;  3H7W A;  1A0K A;  2Q0O A;  1X0O A;  3PHY A;  5FDS A;  1DJC A;  1OTE A;  5CRF A;  1L0E A;  4X56 A;  5F6A A;  3IBJ A;  1NYY A;  4XT2 A;  3HRE A;  2QMI A;  5CEC A;  1JWZ A;  3IHB A;  2XSS A;  2Y8H A;  4LRY C;  2ZBB A;  3A0V A;  4PM9 A;  4ARZ B;  1IKI A;  2R9X A;  3A3F A;  3CPT A;  4UEY A;  3Q7V A;  3JVV A;  5KZH A;  5CTM A;  4GCZ A;  5F1F A;  2ZL1 B;  3R4K A;  4ZRR A;  2Y2J A;  4PPR A;  3A3D A;  3LR4 A;  5EEC A;  4JKT A;  1TDL A;  5HFO A;  4CQH A;  2Z2M B;  3MXS A;  3S7N A;  2A49 A;  3T4J A;  2Y2H A;  1HD8 A;  4OOM A;  3T1R A;  4ZDX A;  5G4Y A;  5EVE A;  2X01 A;  2W1R A;  4EUZ A;  5EPH A;  4C3Q A;  4JF6 A;  4MN5 A;  3KYE A;  4KZ6 A;  1G6A A;  4OP5 A;  2XDM A;  2P9V A;  4OPZ A;  1CI9 A;  2PD8 A;  1IOU A;  3H82 B;  3HVF A;  1XJ2 A;  2MJ6 A;  4UQI M;  5C5K A;  5L8M A;  4E04 A;  4HOI A;  2Y2N A;  1XXM A;  1AWI A;  4DJ2 A;  4S2I A;  1LHY A;  1ES3 A;  3FG8 A;  3QP2 A;  4EES A;  2EWW A;  1MPL A;  4FCF A;  2ZL1 A;  1H8Z A;  3IXD A;  2B02 A;  5EVI D;  4X69 A;  2FFF B;  1ESU A;  3G2Y A;  4KUO A;  2Y2K A;  3IHA A;  2ZC7 A;  1DP6 A;  3LCE A;  4RX3 A;  1BT5 A;  1E4D A;  5EOO A;  1XFN A;  1V9Z A;  3EWK A;  1NZU A;  1FSW A;  3V67 A;  4KQO A;  3ZHH A;  4N9L A;  3BQ8 A;  3WRT A;  4MBH A;  4CLC D;  1PFL A;  3IXG A;  2P7J A;  5FA7 A;  2V8C A;  3H7W B;  4QU3 A;  3VOL A;  4LCL A;  1MZU A;  1YLT A;  3F1O A;  5DF7 A;  5DJU A;  3CUE C;  1I5Q A;  3H9W A;  4OKP A;  4DN0 A;  1UWN X;  3HLB A;  3MR0 A;  3UDF A;  2VZW A;  1NWZ A;  1XJ3 A;  4X55 A;  1S66 L;  4ZTK A;  4DRT A;  4EXO A;  3MFX A;  3C8C A;  5DFX A;  4MNR A;  4DXC A;  1D7E A;  1YT4 A;  3OPP A;  3UB7 A;  4S2M A;  3MQ0 A;  3O87 A;  5DJT A;  3ZFZ A;  3G4P A;  2ZLY A;  2ZQ8 A;  1FR6 A;  3N8S A;  4GLQ A;  3BY9 A;  4BMW A;  1VHM A;  3ULF A;  4EQ1 A;  1T1A A;  3E4P A;  3OC2 A;  1MWS A;  3NDG A;  3IF6 C;  3CWF A;  4KZ4 A;  4C6Y A;  2G7U A;  1FCM A;  2EXA A;  3GV9 A;  3C7V A;  3H82 A;  4UA6 A;  3FV7 A;  1OJG A;  4YIN A;  1FR1 A;  1CI8 A;  1H5X A;  2WAD A;  4UA9 A;  2WAF A;  4HEF A;  2VGL S;  2PYP A;  4YFM A;  1S1Y A;  3GDI A;  3ZG0 A;  4ZJ3 A;  1KOU A;  1F9I A;  2Q9N A;  4HIA A;  2V1A A;  2W3H A;  2XH9 A;  4B9O A;  4PM8 A;  3SS4 A;  1P9R A;  1VET A;  1JWP A;  4JXW A;  2G2U A;  4Y2F A;  1PNE A;  5HAP A;  3KYQ A;  3AGE A;  4CLC C;  1RP5 A;  3IH8 A;  3BM6 A;  3BY8 A;  3QP5 A;  4PM7 A;  1KGG A;  3EGD C;  2EX8 A;  4NXG A;  5GLD A;  3MQQ A;  1SDN A;  4LV2 A;  1CK3 A;  1K55 A;  5L2F A;  1MWT A;  3ITB A;  2K7S A;  2JHE A;  1BLH A;  4ID4 A;  4GHI A;  1VB6 A;  1S0W A;  2XF3 A;  4IUH A;  3D4F A;  2W1T B;  2KDK A;  3CIT A;  5L10 A;  4WEL A;  4ZBE A;  2WKH A;  5KSH A;  3NOT C;  1IKG A;  3UNW A;  5GHY A;  4Q8I A;  2ACG A;  1XPB A;  5HSQ A;  5CHJ A;  1OT9 A;  3LIB A;  4OQI A;  5TBM B;  1W8Q A;  1K25 A;  3VP3 A;  4DE3 A;  2A2L A;  2WGI A;  4KZ7 A;  3SW1 A;  4IVI A;  2QJ7 A;  2O9B A;  3E4Q A;  2GZA A;  5FAO A;  3ZYT A;  1SHV A;  3QHY A;  5HL1 A;  4GS9 A;  4S2J A;  3PAG A;  3WS1 A;  5CX7 A;  2WZZ A;  3ZCZ A;  3P09 A;  4OQG A;  2HDQ A;  2J3W A;  3EGX C;  3QP4 A;  1K57 C;  4CLC B;  3MMH A;  2JE5 A;  4DF6 A;  1ODV A;  1SKF A;  4BBV A;  2XEP A;  2VK3 A;  2PU4 A;  3ZDJ A;  3B3X A;  2L4R A;  3VE3 A;  2QJ5 A;  1NYM A;  4DDY A;  1EI5 A;  1NXY A;  3UO9 A;  4B93 A;  2V8F A;  5F83 A;  1MKM A;  2D01 A;  5A90 A;  3B33 A;  2QPN A;  5DFY A;  4HJ4 A;  3V50 A;  1VEU B;  4WM9 A;  4FOF A;  4BLM A;  2QYB A;  1VQQ A;  3VP4 A;  5EVI C;  2M7U A;  5U47 A;  5HWV A;  5EOE A;  4E3J A;  3NDE A;  3ISG A;  2V0W A;  4JGO A;  4RX2 A;  4EBN A;  3MXQ A;  1KE4 A;  2EXB A;  2WKR A;  1Y54 A;  3IT9 A;  2VKS A;  4JGQ A;  1N9B A;  3MKE A;  4EET B;  1YLJ A;  2Y55 A;  3E98 A;  3LGO A;  1LSV A;  5KMW A;  1LI0 A;  1GSV A;  4HP9 A;  5CXW A;  3EOI A;  3PBQ A;  3UE1 A;  3MKF A;  4HI4 A;  3LYX A;  4E6W A;  1EW0 A;  2IWC A;  2HF6 A;  1YKD A;  4EWF A;  2Y79 A;  3IWI A;  4M4X A;  3Q81 A;  3W8K A;  3NOP C;  3Q7V B;  4DE0 A;  2P9V B;  4N1H A;  4BQM A;  2R78 A;  3WRZ A;  1MBL A;  2NUP C;  3OCN A;  1TEM A;  3QP1 A;  4LRX C;  3W4O A;  5CED A;  4Y0U A;  5CGW A;  2K31 A;  3P7N A;  4UHU A;  4KQD A;  3O86 A;  5CHU A;  1BTL A;  3NHQ A;  4WN5 A;  3HBR A;  2KLI A;  5EE8 A;  2OWH A;  1XJ6 A;  1NRJ A;  1LLB A;  4MMN A;  5FQI A;  1NY0 A;  3AGF A;  4IVK A;  1S4R A;  1ONG A;  1T18 A;  3VOZ A;  2B18 A;  4OQ0 A;  1NZO A;  5FSR A;  3IF6 A;  2ZJ9 A;  1ZG4 A;  1S1Z A;  1N9L A;  4E3I A;  5EVI A;  3ZG7 B;  2QZ6 A;  4LPZ A;  4RVA A;  5DKK A;  4R3A A;  4FTX A;  4H6J B;  3HJK A;  3BFF A;  4OLD A;  3PBO A;  3S22 A;  2JKR M;  4O7D A;  2X02 A;  4BWI A;  5FAT A;  3CUE A;  1WE4 A;  3VMA A;  1EWZ A;  1E25 A;  3ZNT A;  2JKF A;  3PBN A;  4WL9 A;  3IX8 A;  3VSL A;  2ZMV A;  4P87 A;  3G32 A;  1P97 A;  3BFD A;  2R9W A;  1K54 A;  4KZ5 A;  1ESI A;  3BLS A;  2Z2L B;  2W3G A;  5DVA A;  2JKG A;  3M6H A;  4HJ6 A;  4LV0 A;  4KEN B;  3W4P A;  3HUM A;  3CJM A;  2HDU A;  3T4Q A;  3NCK A;  5AQ9 A;  4R23 A;  2W1T A;  5AVF A;  5GLC A;  3SZT A;  3VE4 A;  5HAI A;  4B88 A;  4EEP A;  3Q1F A;  4P6Z M;  5HZH A;  3E2L A;  4P6Z S;  3S1Y A;  1VEU A;  1LT0 A;  1Y28 A;  3D9Y A;  4HES A;  3ICY A;  2ZM0 A;  1SCW A;  3UDX A;  5A8B A;  2XFT A;  4ZJ1 A;  1BLS A;  4HY8 A;  3UY6 A;  2PRF A;  4KZ9 A;  3G34 A;  4K0X A;  3DAV A;  3K3C A;  4NXB A;  2PAV P;  1XA1 A;  1YLZ A;  2XFS A;  3W4Q A;  1ERM A;  1KE3 A;  4G3V A;  2J7V A;  1LL9 A;  4R1G A;  2H0Y A;  1XX2 A;  4QPR A;  2HPB A;  3IWO A;  1IEM A;  1H8M A;  3TG9 A;  4EBL A;  2HP5 A;  2VEA A;  3DBA A;  3G35 A;  2XRN A;  1TS6 A;  4JPM A;  3O88 A;  2A24 B;  1CJF A;  3F1N B;  3C30 A;  3F1P B;  2B5R A;  1P9W A;  1UGU A;  3RXW A;  4LRZ E;  5M18 A;  2Y2P A;  3LR3 A;  4Y5F A;  3MBZ A;  1PI4 A;  1XFQ A;  1RGY A;  4HH2 A;  2L0W A;  2ZC5 B;  4X25 A;  3KSG A;  4JGR A;  4XUX A;  4E3N A;  3G2Z A;  4MBF A;  1K6R A;  4R4S A;  3KSF A;  4HH3 A;  3BLM A;  3UB5 P;  1JWV A;  4E3L A;  1ERO A;  4N92 A;  4OON A;  2XD1 A;  4UA7 A;  3P98 A;  3PR6 A;  1MWR A;  4CJN A;  3NIA A;  3RXX A;  4HHD A;  5IS1 A;  5CTN A;  3FZC A;  2P74 A;  3T1S A;  2G2W A;  4DDS A;  3O5Y A;  5GHZ A;  3OPR A;  5HD3 A;  4BL3 A;  4WEK A;  2K2N A;  2FH5 A;  4MCW A;  3MZE A;  5FI7 A;  3RTY A;  2PDR A;  3ITA A;  1TF1 A;  2VV8 A;  2WGW A;  3M2J A;  2JKR I;  3Q82 A;  3SH9 A;  2WKI A;  1K56 A;  3LR5 A;  2XA7 M;  3HUN A;  3QP8 A;  4QJG A;  1ZC2 A;  1GHP A;  4MLL A;  5AQA A;  3TJZ C;  1BLP A;  1KDW A;  4I3A A;  5IHV A;  3I7J A;  3LIA A;  1XJ4 A;  3QP6 A;  3V3S A;  4UQI S;  4Q0J A;  4LFU A;  1OTD A;  3G6O A;  2WYX A;  1QMF A;  1AXB A;  3GRJ A;  4QD4 A;  3CLO A;  4QWO A;  3BFE A;  5EM0 A;  1W7F A;  3C2W A;  4PHT A;  2RCX A;  1RCJ A;  5HDS A;  4HBT A;  2X71 A;  1OPX A;  4JGP A;  1S6R A;  2V1B A;  3P01 A;  3DTK A;  4OPQ A;  5CGS A;  1M40 A;  2PBY A;  5EM1 A;  3PBT A;  4OOY A;  1K55 C;  1TS8 A;  1DP9 A;  5FI6 A;  4KG6 A;  4DXB A;  2PU2 A;  1PIO A;  5HX9 A;  2CMN A;  3PTE A;  3MZF A;  2ZM2 A;  2WKE A;  3VFH A;  4GW9 A;  4FD8 A;  4FSF A;  2J80 A;  3L9K A;  4GB7 A;  4NK3 A;  4OP8 A;  1STZ A;  3BEB A;  4P0M A;  4EUV A;  3V5M A;  3IS2 A;  3CG5 A;  4OPR A;  1KVM A;  4K0W A;  5TJJ A;  5K5B A;  3UME A;  4EQI A;  3SS3 A;  1TS0 A;  4EBP A;  4S2P A;  5L07 A;  3LEQ A;  1PI5 A;  2HV1 A;  2Y2O A;  3LUQ A;  3WS0 A;  3B47 A;  3G31 A;  1LL5 A;  5I5L A;  3T4K A;  1XKZ A;  5AJG A;  1D1J A;  3MFD A;  3LO7 A;  3UPO A;  3UE3 A;  1T1B A;  2A24 A;  4H8R A;  4L9G A;  4HNB A;  2Y2I A;  2QWS A;  1LSX A;  3LI8 A;  3LY3 A;  2P04 A;  4O0P A;  3N8L A;  1ZTU A;  1D06 A;  3T1X A;  5FQQ A;  1H8Y A;  2VV7 A;  3EQU A;  2VJW A;  3VSK A;  4GZB A;  3UMD A;  3S7Q A;  2YKF A;  2WAE A;  3HLD A;  1HZO A;  3WS4 A;  4OQH A;  2EX9 A;  5HAQ A;  1G28 A;  2H0T A;  3GTC A;  2OLU A;  2KOI A;  3S4X A;  5A92 A;  3HUO A;  5DF8 A;  1NRF A;  1MWU A;  1GSW A;  1IFQ A;  3C4O A;  3VP0 A;  1F2K A;  4MN7 A;  3VFF A;  5DKL A;  3ZNY A;  3JPU A;  4F3L B;  1BUE A;  1RGZ A;  4MN6 A;  3A3J A;  3GR2 A;  4YWZ A;  3T12 B;  3UB9 A;  5FAP A;  5FQM A;  5GHX A;  2C5W B;  2V9A A;  1MC0 A;  3T1Q B;  2BTF P;  2WKQ A;  1L2S A;  1QME A;  1L0G A;  1I2W A;  3LEZ A;  4I5S A;  5FQ9 A;  1PYY A;  5AVE A;  4BBT A;  3BJN A;  2FZ0 A;  1GHM A;  4QHC A;  1DRM A;  1JTG A;  2JCH A;  1F5M A;  1L3L A;  4Y13 A;  4DE1 A;  3GMW A;  2EWV A;  3BRM A;  4FUW A;  3OPH A;  4MEZ A;  3A0R A;  4U3T A;  4R38 A;  4D2O A;  3NC8 A;  1ALQ A;  1PZP A;  2BAS A;  5FL3 A;  1OME A;  2VGL M;  1FQG A;  1KGF A;  1H0M A;  3HCY A;  4LV1 A;  5HDC A;  3LR0 A;  4OOL A;  1IYS A;  2HJ9 C;  1PRQ A;  4F3L A;  4XT2 B;  1YSP A;  1ZHH B;  4JXS A;  5GLA A;  1NJ4 A;  1T19 A;  4KQR A;  4ZAM A;  4XUZ A;  4WMC D;  4NXF A;  4N1X A;  1YPR A;  3CZD A;  4KUK A;  4WYY A;  4WZ5 A;  4UAA A;  2DRW A;  3F1P A;  3FKV A;  2HDS A;  4R6L A;  3CAX A;  2YKH A;  2OWJ A;  5CGX A;  3GQZ A;  3WWX A;  3UDI A;  3NY4 A;  1G5U A;  3KSH A;  4D60 A;  3NOU C;  4GD6 A;  4NET A;  3HLW A;  4WZ5 C;  4ARZ A;  2WK0 A;  3SS5 A;  1KDS A;  1OTA A;  4GN2 A;  4EW7 A;  3FPV A;  5F5Y A;  5EVI B;  3K2N A;  2HP9 A;  3R7W A;  3SH7 A;  1YSQ A;  2ZC3 B;  3MXR A;  2Y2L A;  3NUL A;  1YLY A;  2Z6D A;  2Z6C A;  4E3K A;  4S2L A;  4GDB A;  3MZD A;  4LCM A;  4QB8 A;  4DE2 A;  3OLO A;  3N4I A;  3MQO A;  4PKY G;  1UWP X;  1YLP A;  4Y7P A;  3GSG A;  3HJI A;  5CEB A;  2OLV A;  3TSG A;  4II7 A;  3T4T A;  2W3F A;  1KGE A;  2PYR A;  1LL8 A;  4G3W A;  4DJ3 A;  1K56 D;  2EA9 A;  3K3D A;  4HBU A;  5DTT A;  3RJU A;  2GNX A;  3MF0 A;  4U0X A;  5DF9 A;  3Q7Z A;  1TS7 A;  1I2S A;  1L0D A;  1WA9 A;  4JF5 A;  4KZB A;  4O01 A;  5HD5 A;  4X1M A;  4I3I A;  2J9O A;  3NI9 A;  4ESP A;  4EEU A;  3QNB A;  2IWB A;  3PBR A;  4LGW A;  4L9F A;  1GCE A;  4NXE A;  4YOF A;  1U60 A;  3ZGA B;  1E3U D;  2JN7 A;  4BEN A;  4Y15 A;  5J4E A;  1SKO A;  5F82 A;  3PYP A;  2WZX A;  4WEJ A;  2OAP 1;  3CMZ A;  4RA7 A;  2HP6 A;  4HQA A;  4CLC E;  1WYC A;  2O0Y A;  3HLF A;  1PWD A;  3IX4 A;  2JBF A;  4GS9 B;  1XGJ A;  3E2K A;  1N9N A;  1K4E A;  1W8Y A;  2JKT I;  4AFI A;  2XQZ A;  2W3D A;  1SKO B;  1IYP A;  2P08 A;  1XA7 A;  3UPN A;  1VM1 A;  1YAX A;  5TBM A;  3RFB A;  2VV6 A;  5M19 A;  3TW8 A;  4KZ8 A;  2ZOH A;  3A3I A;  4I38 A;  5FQK A;  4OLG A;  2DCF A;  2WGW B;  1TDG A;  4BD1 A;  1G68 A;  1PZO A;  1GA9 A;  4A5R A;  2M7V A;  4IBR A;  5J3W A;  1CF0 A;  4IBX A;  4FH2 A;  5GL9 A;  2PR6 A;  3T4O A;  2JC7 A;  1Q2P A;  2VGK A;  1BSG A;  1K0K A;  2W0N A;  3OBF A;  3DTM A;  3PXP A;  5FI2 A;  4B4X A;  2JKT M;  2H5S A;  4G3K A;  2QHK A;  4HP4 A;  3UB6 A;  2OAQ 1;  2VGJ A;  1S4S A;  1FOF A;  1G6O A;  4PAU A;  4ETZ A;  2EFX A;  3V3R A;  3IQA A;  1ACF A;  2B95 A;  3IBR A;  2J9P A;  2WUQ A;  3ZQ5 A;  1JTD A;  4N9K A;  3SH8 A;  3T4S A;  1YMX A;  2ZC6 B;  5TFQ A;  3LIF A;  2W27 A;  2PD7 A;  2ZQ7 A;  4BJP A;  4Y0O A;  4R0Q A;  3S7O A;  2IA2 A;  3VV4 A;  4S2K A;  3LIC A;  1PWC A;  4RYE A;  3IXH A;  4GHI B;  3DWZ A;  3U4L P;  4BBU A;  1CEF A;  1PW8 A;  1K38 A;  1IYQ A;  1O07 A;  1ONH A;  2A3U A;  3BWL A;  5FAS A;  4PM6 A;  2I9V A;  2CC1 A;  3IH9 A;  2E8I A;  1L0F A;  5M1A A;  3U2A A;  4MBK A;  2IWD A;  4JXV A;  2Y2M A;  2GJ3 A;  3FKW A;  1J9M A;  1NLZ A;  5TGF A;  5J7E A;  3ZVW A;  4EV4 A;  3UN7 A;  2EFU A;  1BLC A;  3ZG8 B;  5AQB A;  4WZ4 A;  5I94 A;  4KG5 A;  3GEC A;  2D02 A;  5HW3 A;  3VP1 A;  5G18 A;  2BG1 A;  1DJB A;  4GNU A;  2O9A A;  1ES5 A;  2E8J A;  4MDZ A;  4S2N C;  5E2G A;  3IS2 B;  2HGV A;  3CI6 A;  1SDE A;  2OSU A;  3VP2 A;  3A0S A;  3C38 A;  2LB9 A;  1HTZ A;  2FFY A;  4HJ3 A;  5MC7 A;  1Y4O A;  1OT6 A;  4K91 A;  3VOY A;  4FH4 A;  3OOV A;  1IEL A;  2ZMA A;  5EFW A;  1Q2Q A;  5E43 A;  5A93 A;  4QY6 A;  1FSY A;  3N7W A;  3JVU A;  4S2O A;  3DW0 A;  1BYW A;  4LLO B;  2XGN A;  4JBF A;  2M1C A;  5KSC A;  5KIZ A;  3MSH A;  2PHY A;  2I72 A;  2DNS A;  4X1L A;  4QY5 A;  4R3B A;  1PWG A;  1HVB A;  2RL3 A;  1YM1 A;  1YLW A;  3R7W B;  2ZQA A;  3PAE A;  5AQ7 A;  1ES2 A;  3KSI A;  2OV5 A;  5HDD A;  1CQA A;  1M6K A;  2INW A;  3E4O A;  3T4L A;  1K4F A;  1GHI A;  3LIE A;  3OCL A;  1PW1 A;  2GDN A;  3FWL A;  1TD5 A;  3IF6 B;  3GVB A;  2ZOI A;  2ZC4 B;  1XP4 A;  2ZQD A;  4X68 A;  1ES4 A;  1GSX A;  4KG2 A;  4O8G A;  4IHQ A;  4IJG A;  4Q0I A;  4S2N A;  2Y4A A;  2W3E A;  2AVX A;  1YQS A;  3NEC A;  2XK1 A;  4PMA A;  3M6B A;  1WYB A;  5EUA A;  2O99 A;  3ZG9 B;  5HPF A;  3N8R A;  4GD8 A;  4RQ9 A;  2EX2 A;  2ZQ9 A;  1NLY A;  4E3O A;  1CEG A;  3EEH A;  4KZA A;  1MXO A;  5LBR A;  2J8Y A;  4R4R A;  2NUT C;  1YMS A;  4E6X A;  4E3M A;  2XD5 A;  5J8X A;  4Y0T A;  4OH0 A;  5HPI A;  1BUL A;  1FCN A;  4EU0 A;  4C75 A;  3FPW A;  5E2H A;  4BL2 A;  5EV0 A;  2XRO A;  1MY8 A;  1K54 C;  5IU1 A;  3C5A A;  4JXG A;  2OOL A;  1P0Z A;  3HLE A;  3T50 A;  1ERQ A;  3NBL A;  3O3V A;  4JLF A;  2HZ5 A;  1S67 L;  2LB5 A;  2UWX A;  1DP8 A;  3CPT B;  3L7H A;  5G4Z A;  4IED A;  2XLN A;  4PKY A;  2HJE A;  1OTI A;  2Y2G A;  3BFC A;  5E2E A;  2VA0 A;  2ZMF A;  3UPP A;  3MS6 A;  4CPK A;  3ZG5 A;  5D3O A;  3C7U A;  2Q9M A;  3BFG A;  3IX3 A;  5HAR A;  1TVF A;  3E0Y A;  3HLG A;  4I39 A;  4DKI A;  3F1O B;  3BEC A;  3FYZ A;  4EER A;  3EQV A;  4P85 A;  5F68 A;  3BQA A;  3TOI A;  4R3J A;  1FIK A;  4K08 A;  4CLC A;  3G30 A;  3MJQ A;  3WS2 A;  4U0T A;  2VX8 A;  1MKI A;  2DMW A;  3HL9 A;  4KZ3 A;  1JNU A;  5IT5 A;  4OPY A;  1DY6 A;  4H6J A;  2V2F F;  1Z09 A;  1IYO A;  4P6B A;  1W79 A;  3IXB A;  2ZQC A;  2UV0 E;  2Y91 A;  5CER A;  4PM5 A;  1T1C A;  3KYZ A;  2WKP A;  2V1Z A;  5F69 A;  3WS5 A;  3BYD A;  1SZV A;  5FDH A;  1LI9 A;  2L1M A;  1GA0 A;  4WF0 A;  3CHW P;  3HLC A;  4NG2 A;  3LFV A;  3NJA A;  2O9C A;  5JYP A;  3LI9 A;  3KX0 X;  3RH8 B;  5FAQ A;  2GX5 A;  2ZM8 A;  5BOH A;  4B4Z A;  1HLU P;  1KVL A;  4NKP A;  4X6T A;  2HDR A;  4Y3I A;  4R70 A;  3D3O A;  3UB8 A;  4ZJ2 A;  3KO6 A;  1N9O A;  3DTE A;  4X53 A;  3A3E A;  3AGD A;  4L9E A;  4YNR A;  2PBD P;  5JYO A;  4WMC A;  3V39 A;  3B42 A;  5HL6 A;  5L09 A;  4DMZ A;  4ETX A;  4I3J A;  3M2K A;  1K57 A;  2V20 A;  1H3Q A;  4XXR A;  4Z1W A;  3W2Z A;  2J3T C;  2Y59 A;  4Y17 A;  3TRC A;  3OPL A;  4WLA A;  5DTS A;  4NEE D;  1JVJ A;  5F1G A;  3PBS A;  5E2F A;  1BZA A;  3C4P A;  1VET B;  2H28 A;  3IWQ A;  2C6W B;  4LEN A;  1OJ5 A;  4OVD A;  2WGV A;  1ZKJ A;  2ZD8 A;  4M3K A;  3DTI A;  4GJ4 A;  1ZG6 A;  3F1N A;  1KE0 A;  3UE0 A;  3N6I A;  1E3U A;  2V0U A;  1J3W A;  4BD0 A;  2VLG A;  3LID A;  4F94 A;  1N4O A;  1Z6F A;  5EVL A;  5CHM A;  3FC7 A;  4ME4 A; 
#chains in the Genus database with same CATH homology
 3S7O A;  2IA2 A;  2J3W A;  3EGX C;  3VV4 A;  2QKP A;  3LIC A;  1OTB A;  4CLC B;  3D72 A;  3MMH A;  1ODV A;  4BBV A;  2CMN A;  5HWT A;  4GHI B;  1W63 M;  4BBU A;  4GW9 A;  2L4R A;  3VE3 A;  2QJ5 A;  4FSF A;  2J80 A;  1W63 Q;  4WUJ A;  2J3T D;  3BWL A;  1STZ A;  3TE8 A;  3S7P A;  2I9V A;  4EUV A;  5HWW A;  3IS2 A;  4B93 A;  2KX6 A;  3U2A A;  5TJJ A;  1MKM A;  5K5B A;  3UME A;  2D01 A;  1TS0 A;  3B33 A;  2GJ3 A;  1NLZ A;  5J7E A;  4Q0H A;  5DFY A;  3LUQ A;  2HV1 A;  2PT7 A;  4HJ4 A;  3B47 A;  4FOF A;  1LSW A;  5I5L A;  2QYB A;  3GEC A;  4IUK A;  2M7U A;  3T4K A;  2D02 A;  3EEA A;  5AJG A;  3UE3 A;  1T1B A;  2PR5 A;  2A24 A;  3BW6 A;  4L9G A;  5HWV A;  2XA7 S;  4HNB A;  4L0L A;  2V0W A;  4JGO A;  2QWS A;  2O9A A;  3UE6 A;  1LSX A;  3LI8 A;  4MDZ A;  2P04 A;  4O0P A;  1F98 A;  3IS2 B;  2HGV A;  1D06 A;  1V9Y A;  1ZTU A;  3MXQ A;  3CI6 A;  3H7W A;  2WKR A;  2VV7 A;  2VKS A;  4JGQ A;  1X0O A;  3EQU A;  3A0S A;  3C38 A;  3PHY A;  2LB9 A;  1OTE A;  2VJW A;  3UMD A;  4EET B;  3S7Q A;  4HJ3 A;  3E98 A;  2YKF A;  5F6A A;  1LSV A;  3IBJ A;  5MC7 A;  4XT2 A;  1GSV A;  1OT6 A;  4HP9 A;  3EOI A;  3PBQ A;  1G28 A;  4HI4 A;  3OOV A;  3LYX A;  1EW0 A;  2XSS A;  2Y8H A;  4LRY C;  5EFW A;  2HF6 A;  2ZBB A;  3A0V A;  1YKD A;  2KOI A;  2Y79 A;  3JVU A;  4M4X A;  4ARZ B;  1BYW A;  4LLO B;  3NOP C;  1GSW A;  2M1C A;  4UEY A;  1IFQ A;  3JVV A;  4MN7 A;  5KIZ A;  5DKL A;  4GCZ A;  2PHY A;  2R78 A;  2NUP C;  4F3L B;  3R4K A;  4ZRR A;  3OCN A;  4MN6 A;  3LR4 A;  4LRX C;  4YWZ A;  3UB9 A;  2K31 A;  3P7N A;  4KQD A;  3R7W B;  2V9A A;  4CQH A;  1MC0 A;  3NHQ A;  2WKQ A;  3KSI A;  4WN5 A;  3S7N A;  3T4J A;  2KLI A;  2OWH A;  1XJ6 A;  1NRJ A;  4I5S A;  5HDD A;  4MMN A;  4OOM A;  5AVE A;  4BBT A;  3BJN A;  2FZ0 A;  2INW A;  3E4O A;  3T4L A;  1S4R A;  1DRM A;  5G4Y A;  1T18 A;  1F5M A;  3LIE A;  2B18 A;  2W1R A;  3OCL A;  2EWV A;  4MN5 A;  1TD5 A;  1S1Z A;  1N9L A;  2ZOI A;  3A0R A;  4R38 A;  4LPZ A;  5DKK A;  4R3A A;  2PD8 A;  4H6J B;  3HJK A;  1IOU A;  1GSX A;  3H82 B;  4O8G A;  1XJ2 A;  2MJ6 A;  4IHQ A;  3PBO A;  4UQI M;  5C5K A;  2BAS A;  5FL3 A;  2JKR M;  4IJG A;  2VGL M;  4Q0I A;  4BWI A;  2W3E A;  5L8M A;  4E04 A;  4HOI A;  3CUE A;  3HCY A;  4DJ2 A;  2O99 A;  3PBN A;  4WL9 A;  5HPF A;  2ZMV A;  4RQ9 A;  5HDC A;  3LR0 A;  4OOL A;  3FG8 A;  1NLY A;  1P97 A;  2HJ9 C;  3EEH A;  4EES A;  2EWW A;  4F3L A;  5LBR A;  4XT2 B;  1YSP A;  2NUT C;  1ZHH B;  2B02 A;  1T19 A;  2W3G A;  4KUO A;  4HJ6 A;  4NXF A;  1DP6 A;  5HPI A;  3T4Q A;  4EU0 A;  4KUK A;  3FPW A;  1XFN A;  1V9Z A;  2XRO A;  3F1P A;  3EWK A;  2W1T A;  5IU1 A;  3V67 A;  4R6L A;  3CAX A;  2YKH A;  4KQO A;  2OWJ A;  3BQ8 A;  5AVF A;  2OOL A;  3VE4 A;  1P0Z A;  4CLC D;  3KSH A;  3T50 A;  4EEP A;  4P6Z M;  5HZH A;  4P6Z S;  3NOU C;  2P7J A;  3VOL A;  3H7W B;  1S67 L;  2LB5 A;  1LT0 A;  1MZU A;  3F1O A;  4ARZ A;  1Y28 A;  3ICY A;  1DP8 A;  1OTA A;  5DJU A;  3CUE C;  4EW7 A;  5G4Z A;  3FPV A;  3H9W A;  5F5Y A;  5A8B A;  4HY8 A;  4PKY A;  4DN0 A;  2HJE A;  3K2N A;  1UWN X;  3R7W A;  1OTI A;  3MR0 A;  2VZW A;  1YSQ A;  1NWZ A;  2VA0 A;  1XJ3 A;  3K3C A;  4NXB A;  2ZMF A;  1S66 L;  2Z6D A;  4EXO A;  3MFX A;  2Z6C A;  3C8C A;  5DFX A;  1D7E A;  4G3V A;  3UB7 A;  3MQ0 A;  3OLO A;  3E0Y A;  4I39 A;  4QPR A;  3F1O B;  5DJT A;  3MQO A;  4PKY G;  1UWP X;  4EER A;  1H8M A;  3EQV A;  3HJI A;  4GLQ A;  2VEA A;  3DBA A;  5F68 A;  2XRN A;  1TS6 A;  3BQA A;  2A24 B;  3BY9 A;  4II7 A;  3T4T A;  2W3F A;  4BMW A;  1VHM A;  2PYR A;  4K08 A;  4CLC A;  3F1N B;  3ULF A;  3C30 A;  4EQ1 A;  1LL8 A;  1T1A A;  3E4P A;  3MJQ A;  3F1P B;  3OC2 A;  4G3W A;  4DJ3 A;  2EA9 A;  1P9W A;  1UGU A;  2VX8 A;  3K3D A;  2DMW A;  3CWF A;  4LRZ E;  2GNX A;  2G7U A;  3LR3 A;  3MF0 A;  1JNU A;  5DF9 A;  3H82 A;  5IT5 A;  1TS7 A;  4H6J A;  4Y5F A;  1WA9 A;  1XFQ A;  4HH2 A;  4O01 A;  2L0W A;  5HD5 A;  4I3I A;  1OJG A;  4EEU A;  3KSG A;  3PBR A;  4JGR A;  4L9F A;  2VGL S;  2PYP A;  3KSF A;  1T1C A;  3KYZ A;  4HH3 A;  2WKP A;  4NXE A;  4YOF A;  5F69 A;  1S1Y A;  3GDI A;  2L1M A;  1KOU A;  1F9I A;  2JN7 A;  4HIA A;  2V1A A;  2W3H A;  4B9O A;  4WF0 A;  3PR6 A;  5J4E A;  5IS1 A;  4HHD A;  1P9R A;  3PYP A;  3O5Y A;  3LFV A;  4WEJ A;  3NJA A;  5HD3 A;  2OAP 1;  4HQA A;  4CLC E;  2O9C A;  4WEK A;  2O0Y A;  2K2N A;  2FH5 A;  3LI9 A;  4MCW A;  4Y2F A;  4GS9 B;  3KX0 X;  3RH8 B;  3RTY A;  2GX5 A;  2PDR A;  3KYQ A;  4CLC C;  1TF1 A;  2VV8 A;  4NKP A;  3BY8 A;  4Y3I A;  4R70 A;  1N9N A;  3D3O A;  3UB8 A;  2JKR I;  3EGD C;  2JKT I;  4AFI A;  3KO6 A;  3LR5 A;  2W3D A;  4NXG A;  2P08 A;  2XA7 M;  1N9O A;  3MQQ A;  1YAX A;  5TBM A;  4L9E A;  3RFB A;  3TJZ C;  2VV6 A;  3TW8 A;  4YNR A;  2K7S A;  3B42 A;  5HL6 A;  2ZOH A;  4I3A A;  4DMZ A;  2JHE A;  4I38 A;  4ETX A;  4I3J A;  3LIA A;  4GHI A;  1XJ4 A;  1VB6 A;  1H3Q A;  4Z1W A;  3W2Z A;  4IUH A;  4UQI S;  2J3T C;  4Q0J A;  2M7V A;  2W1T B;  1OTD A;  2KDK A;  3TRC A;  3CIT A;  4WLA A;  5J3W A;  4NEE D;  3PBS A;  4WEL A;  3G6O A;  5KSH A;  3NOT C;  2PR6 A;  3T4O A;  2H28 A;  5HSQ A;  1OJ5 A;  3OBF A;  2W0N A;  1OT9 A;  3CLO A;  3LIB A;  3PXP A;  2JKT M;  5TBM B;  4G3K A;  4GJ4 A;  2QHK A;  3F1N A;  3C2W A;  4PHT A;  4HP4 A;  2A2L A;  3UB6 A;  2OAQ 1;  5HDS A;  1S4S A;  1G6O A;  4PAU A;  4ETZ A;  3SW1 A;  2QJ7 A;  2V0U A;  2O9B A;  3E4Q A;  2VLG A;  1OPX A;  2GZA A;  4JGP A;  3IBR A;  3LID A;  2V1B A;  3P01 A;  3ZYT A;  3ZQ5 A;  3T4S A;  4GS9 A;  3LIF A;  2W27 A;  3PBT A;  2PD7 A;  5CX7 A;  4BJP A;  3FC7 A;  1TS8 A;  1DP9 A;  4ME4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...