2HV1A

Haddock structure of arnt pas-b homodimer
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
b'CQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aryl hydrocarbon receptor nuclear translocator
publication title Practical aspects of using paramagnetic relaxation enhancements for protein docking: Application to the ARNT PAS-B homodimer
rcsb
source organism Homo sapiens
molecule tags Transcription, protein binding
total genus 32
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2hv1A01
2PR6A 3H7WA 1T1CA 3NHQA 5IU1A 3UB6A 4HI4A 5KIZA 2YKFA 3NJAA 2W0NA 3CAXA 5DJUA 4R3AA 3F1NA 3CLOA 3F1NB 2A24A 4RQ9A 4HIAA 2I9VA 3CWFA 1VB6A 1XFNA 4GS9A 1XJ4A 5F69A 2D01A 4L9FA 3E4OA 3RH8B 2KX6A 5F5YA 1ODVA 3BY8A 5HDSA 3VE4A 2KDKA 1OTEA 1OT9A 2PD7A 4HH3A 3VE3A 4JGQA 2PHYA 2INWA 3A0VA 4F3LA 4HJ4A 1LT0A 4NXBA 3UB9A 3MQQA 1X0OA 2P7JA 2PR5A 4BBVA 4GHIA 4EESA 4I3AA 3A0SA 3UMDA 5HDCA 1UWPX 4XT2A 5HD5A 2V1BA 4L9EA 4LLOB 3MFXA 5HWWA 3VOLA 5EFWA 2WKQA 4PKYA 3A0RA 4YWZA 4EERA 2GJ3A 2QKPA 1OTAA 3LICA 1V9ZA 2L1MA 1GSVA 3HJIA 5HD3A 4HOIA 4L9GA 1P0ZA 1TS0A 3BWLA 4I3IA 1UGUA 5AVFA 5TBMB 3OLOA 3KX0X 4EW7A 1DP8A 3C2WA 1Y28A 3EEHA 2QWSA 1F98A 1OJGA 4HP4A 3BY9A 2VLGA 3H7WB 2HV1A 1LL8A 3HJKA 3E4QA 2BASA 3B33A 1N9NA 1S1ZA 4WL9A 3K3CA 1LSXA 2CMNA 2Z6DA 5DJTA 1F9IA 1TS7A 5DKLA 2L4RA 2A24B 1XJ6A 4LRXC 3LIDA 4MN5A 1NWZA 5J3WA 5HDDA 2ZBBA 3LI8A 4KUOA 2PYRA 2ZOIA 4GS9B 3T50A 2M1CA 4H6JA 4NXFA 3FC7A 3MXQA 2J80A 3IS2A 3RTYA 1DP9A 1GSXA 3LIBA 4HJ3A 2B02A 2V0WA 1DP6A 4MN6A 4F3LB 1UWNX 5HWVA 4B9OA 2Z6CA 3LI9A 2OWJA 4GHIB 5A8BA 4XT2B 4HHDA 2R78A 4R70A 4WUJA 2PD8A 1S4RA 1OT6A 3H82A 2V9AA 3H82B 4HQAA 1S1YA 4BBUA 1T1BA 2YKHA 3IBRA 1KOUA 1OTIA 3PYPA 4PKYG 4I5SA 3F1PA 2VV8A 3UMEA 4R38A 3F1OA 2V0UA 3F1OB 3PHYA 4JGOA 4KQDA 3P7NA 3LUQA 2W27A 4I39A 1G28A 3LIEA 3MJQA 1N9LA 4WLAA 4I3JA 3UB8A 2K7SA 3MQOA 3ZQ5A 3SW1A 3C8CA 4I38A 1V9YA 1S4SA 1GSWA 4WF0A 1JNUA 2JN7A 5G4YA 3D72A 5J7EA 1D06A 5J4EA 5F6AA 3NOUC 5HSQA 2QHKA 2OWHA 2VEAA 4HH2A 2EA9A 1WA9A 3GDIA 3UE6A 3G6OA 1S67L 4GCZA 5HZHA 3EWKA 4DJ2A 4H6JB 3MR0A 4HJ6A 2VV7A 4EEPA 3IS2B 4R6LA 2QJ5A 3LIAA 3NOPC 4JGRA 2WKPA 4HY8A 1XFQA 3UB7A 4E04A 3GECA 4JGPA 2WKRA 4LRZE 3ICYA 4WN5A 5DKKA 1LSWA 1XJ2A 4LRYC 2JHEA 4EQ1A 2PYPA 1XJ3A 3K3DA 4GW9A 4HNBA 4M4XA 1EW0A 5G4ZA 2L0WA 3NOTC 1BYWA 3ULFA 4EEUA 5IS1A 2D02A 4DJ3A 3E4PA 1TS6A 1T1AA 1D7EA 1P97A 4KUKA 5F68A 1DRMA 2PDRA 4EXOA 3F1PB 1S66L 4K08A 3H9WA 1TS8A 2ZOHA 3FG8A 5I5LA 4NXEA 1LSVA 2VV6A 1OTBA 2OOLA 1OJ5A 4LPZA 1OTDA 2V1AA 1MZUA 4HP9A 1T18A 5HWTA 5TBMA 4EETB 4BBTA 2H28A 2QJ7A 3LIFA 1T19A 1N9OA 5AVEA 3LYXA 4NXGA
chains in the Genus database with same CATH superfamily
1OMEA 4BL3A 3GR2A 1XGIA 1W8YA 1YLJA 1YLWA 4WEJA 4MN7A 3UB6A 3W8KA 4B4ZA 4KQRA 1AWIA 1K56A 2JKTM 4FCFA 2M7UA 3V39A 5E2HA 4JXVA 5AQ9A 3BFCA 3LEZA 4ARZB 4IUHA 3BFDA 5HARA 5DJUA 2HGVA 2PU4A 3CUEA 4OLDA 4R3AA 3ZYTA 3CLOA 4KZ4A 1LL5A 2XDMA 2OLUA 3F1NB 4ID4A 3UB5P 2IWDA 1K4EA 4DDSA 3IF6C 3WS4A 3CG5A 2EX9A 4WM9A 4EUVA 5F69A 5A91A 1NRJA 1RGZA 2R9XA 3FWLA 2ZQ7A 4E3KA 3CZDA 2WGWB 4HH3A 1ONGA 3N8RA 1L3LA 3IXHA 5IHVA 3C7UA 3A3EA 2INWA 3NULA 2C5WB 4P87A 4NXBA 1ES3A 3CI6A 1I2SA 2P7JA 3T4TA 2Y2LA 4Q8IA 4I3AA 3A0SA 1UWPX 4B88A 3E0YA 3ISGA 1WE4A 1GHMA 3HUOA 2WKHA 5TFQA 2XK1A 2IWBA 1NXYA 4Q0JA 3EGXC 2EXAA 4IUKA 3NI9A 3QP1A 3A0RA 3IHBA 4JLFA 3UDFA 1MKMA 3PAGA 3N8SA 3NY4A 3B42A 1PI4A 2BTFP 2Z2LB 1OTAA 3LICA 1DJCA 5AJGA 4IBXA 3O3VA 3HJIA 4L9GA 1K6SA 1P0ZA 1TS0A 1EROA 4E3NA 2GZAA 5FI6A 5CTMA 1DP8A 2PRFA 2FH5A 3E2KA 1Y28A 2QWSA 4NETA 2G2WA 4IHQA 3QP8A 2R9WA 3BY9A 5F1FA 4BD1A 2PBYA 1K54C 2V2FF 4U3TA 2H5SA 2W1RA 5JYOA 5C5KA 5HAPA 1ES4A 3VP1A 4WELA 3BFFA 4GN2A 3DW0A 4FTXA 2BLSA 3EQUA 2WKEA 2JKRM 4OPYA 1TS7A 2FZ0A 2ZL1B 3LIDA 3DAVA 1GHPA 3ZCZA 5HDDA 3PR6A 3Q07A 4KUOA 4NG2A 3EEAA 2M1CA 3KYEA 3N6IA 4NXFA 3NDGA 3FC7A 4LV2A 1TF1A 5F1GA 2J80A 2ZM2A 1DP9A 4KZ7A 1TD5A 4LV3A 2EX8A 3MXSA 1BULA 1DP6A 4MN6A 4F3LB 1UWNX 2Q9NA 1CI8A 3GQZA 1MWTA 4X1MA 4UQIS 1S0WA 4X53A 4B9OA 3NCKA 4OLGA 4GHIB 1MPLA 1L0GA 5FAQA 4XT2B 5EUAA 2WYXA 1E25A 2ZQ9A 5U47A 3KSFA 2Y55A 4WZ5A 2OV5A 3OBFA 3C4PA 1SDNA 2V9AA 3H82B 4HQAA 4E6WA 5A93A 3ZDJA 1K6RA 2Y2QA 3HLFA 1MBLA 3T1QB 4PKYG 2W1TA 2V0UA 4M3KA 4E6XA 2XRNA 2WZZA 4QB8A 4UA6A 3E98A 5FEFA 3LIEA 1YPRA 2HDSA 3SS4A 3VOYA 1HZOA 4I3JA 3UB8A 2GNXA 3UNWA 3IH8A 4Y7PA 4MNRA 3QP5A 1E4DA 4N9KA 2W3GA 3O88A 1H3QA 1S4SA 3BRMA 3LR0A 1NRFA 4JXGA 2LB9A 3QNCA 1KE4A 3DWKA 3FPWA 3IH9A 5J7EA 2XA7M 4EU0A 4OPQA 5F6AA 3NOUC 3S7PA 2GDNA 3CMZA 5DF9A 1MY8A 3VFHA 1H8YA 1KVLA 2E8IA 1XPBA 3T1SA 3GDIA 1ZTUA 4ARZA 2HJEA 1LI0A 5EVEA 4X56A 5FDSA 4NEED 5M18A 4JXWA 4KQOA 2KOIA 3PXPA 1ESUA 2QMIA 1CQAA 3PBNA 4OOYA 2JBFA 4GLQA 1IEMA 3NBLA 3IS2B 1XA1A 4XUXA 2A2LA 4Y0OA 4CLCB 2EFXA 3IT9A 1XFQA 3GECA 2RCXA 1ZHHB 4YFMA 5EVIC 3R7WB 2WGWA 4WN5A 5DKKA 4DE1A 2C6WB 4LRYC 2JHEA 4EQ1A 3WS1A 4M4XA 3HBRA 5D3OA 2EXBA 4EEUA 1FCOA 5EOOA 4KZ8A 2JKGA 1NYYA 1NLZA 3NDEA 1IYQA 2VGLM 1H0MA 5F68A 4Y0TA 1DRMA 1W63Q 2PDRA 3T4JA 1KGGA 2J9PA 4E3IA 1VEUB 4KENB 3H9WA 2XLNA 3JYIA 4BD0A 2ZQ8A 3IX3A 3KSHA 1CJFA 1ACFA 1T18A 4IVIA 2O9BA 4OQHA 3VSKA 4GD6A 4EETB 1G6AA 5CGSA 1T19A 1ESIA 3L9KA 4S2LA 5AVEA 3LYXA 2PBDP 4ZAMA 3ZVTA 2PR6A 3IXDA 2ZM8A 1FSYA 1JWPA 1H5XA 1LHYA 5IU1A 1FCMA 1YAXA 5KIZA 5FATA 2ZC5B 3S4XA 3T4KA 1RP5A 4QPRA 5CHJA 1YLPA 3NECA 2ZC3B 3Q7VB 5EM1A 2G2UA 3G4PA 3IBJA 4IBRA 1VETB 2ZL1A 2HPBA 1MWRA 4RQ9A 3FPVA 2DMWA 2OSUA 3CWFA 4KZ3A 1VB6A 1XFNA 1IKGA 1FSWA 2D01A 4GZBA 1I5QA 3N8LA 3E4OA 2EX2A 2KX6A 4ZJ1A 3SH8A 3HLCA 2ZQCA 4Y5FA 1IOUA 4B93A 4KG6A 4JGQA 5EV0A 2PHYA 3UO9A 3C30A 5TR7A 2HP9A 3A0VA 4F3LA 4HEFA 3FKWA 3MQQA 1K57A 3SH9A 1S6RA 4HBTA 3PBSA 4BBVA 4GHIA 4EESA 4OVDA 2Y2HA 3T12B 5GLDA 4OP5A 3FKVA 3UMDA 5HDCA 4XT2A 3B47A 2ZMVA 2X02A 5FQKA 1W79A 4QY6A 1ERMA 4WYYA 4L9EA 4K91A 2Y2KA 1VQQA 4S2IA 3V50A 2W3FA 2W3HA 4OQIA 2WKQA 4PKYA 1YLTA 5TJJA 4U0TA 1ERQA 3G30A 1NZOA 1JTGA 4N1HA 3DWZA 2L1MA 5FL3A 1MC0A 1XGJA 1GSVA 5DTKA 5HD3A 4HOIA 2Y79A 4Y15A 3BWLA 5HL1A 4I3IA 1NZUA 5CGWA 2K2NA 1UGUA 2P9VB 4GKUA 5HX9A 3OLOA 4IEDA 4PHTA 1MKIA 5M1AA 4R23A 1XKZA 1OJGA 4MMNA 1FILA 1IELA 4D2OA 3S22A 3QP4A 3B33A 3OC2A 1S1ZA 1XX2A 3R4KA 3K3CA 3ZG8B 5KSCA 4HESA 2Y2NA 3S7QA 4ESPA 2CMNA 4Y13A 1Z6FA 4A5RA 2VK3A 3UDIA 1OPXA 5DKLA 2A24B 1XJ6A 2A49A 4MN5A 1NWZA 5J3WA 3FYZA 2ZBBA 4UAAA 4DRTA 2X71A 3LY4A 5FAOA 2PYRA 3CPTB 5J8XA 2ZOIA 4GS9B 1K4FA 3HREA 4XUZA 3MBZA 4C3QA 4P6ZM 3ZFZA 5L2FA 2ZC4B 1GHIA 4K0XA 5HW3A 3IS2A 3RTYA 3K2NA 3UE1A 5L09A 3LIBA 2B02A 4CLCA 1M40A 4X69A 4OPZA 4QJGA 4DKIA 2HDUA 5HWVA 1GA9A 3R7WA 4ZBEA 3OPPA 5GHZA 5A92A 3GV9A 3IWQA 1NJ4A 1N4OA 4R70A 3SZTA 2PT7A 2PD8A 5E2GA 1HTZA 5DFYA 4BJPA 3O87A 2WAEA 2XA7S 1QMEA 3ITBA 1P9WA 1FQGA 4II7A 3A3IA 2XFTA 4BBUA 3LO7A 3ITAA 3PBTA 2YKHA 3CUEC 2W3EA 2M7VA 1FR1A 5G18A 4I5SA 2VV8A 1VEUA 5FQIA 3F1OA 4WZ4A 3SH7A 1L0DA 4JGOA 4KQDA 1FCNA 2G7UA 2W27A 2Y91A 1PWCA 3BLMA 3BYDA 3MJQA 1ALQA 4DE0A 2X01A 1GCEA 2ZLYA 5FDHA 4CPKA 3MQOA 4P6BA 3C8CA 1V9YA 2VGKA 4KZBA 5E43A 2JN7A 3MSHA 3D72A 5CHMA 3C4OA 3UE3A 5CGXA 1N9BA 1STZA 2BG1A 1SHVA 5HSQA 3MFDA 2XR0A 4BLMA 4HH2A 4KG2A 4QY5A 2UWXA 3BJNA 5MC7A 1K38A 4ETZA 3G6OA 1S67L 1XXMA 4GCZA 1DJBA 5HZHA 3EWKA 2VGLS 3Q7VA 4DJ2A 1VETA 4S2OA 3Q1FA 4Q0IA 2KLIA 2VJWA 3MR0A 4HJ6A 1YSPA 2J7VA 1Q2PA 3WRTA 2J9OA 1BLPA 3MZDA 3LIAA 2NUPC 4Y0UA 4JGRA 4HY8A 4C75A 4YINA 4WBGA 1H8MA 3OOVA 3WS5A 3DTIA 4X1LA 1A0KA 3UPOA 4QU3A 2XD1A 1YT4A 1XJ3A 4X6TA 2ZMFA 3NOTC 1CI9A 1BSGA 3ULFA 1NY0A 4S2NC 5HPFA 1DY6A 1YKDA 1D7EA 1T1AA 2HP5A 4H8RA 1IYOA 4WMCA 1VHMA 4GNUA 1KE3A 5LBRA 4R0QA 3T1RA 3C38A 3IF6B 2EX6A 3F1PB 1KGFA 2JKFA 4ETXA 3V67A 3WS0A 1BLSA 2HP6A 5FSRA 3FG8A 5I5LA 2V20A 4R4RA 2ZJ9A 4EUZA 4DN0A 3RXXA 2ZQAA 1NLYA 1RCJA 4HP9A 2P9VA 5HWTA 2WAFA 1W63M 2H28A 3UE0A 2QZ6A 2I72A 4NXGA 3IWIA 1RGYA 1T1CA 3FV7A 3BEBA 3B3XA 2DCFA 1PFLA 2P74A 2YKFA 3WWXA 3RXWA 3NJAA 4WZ5C 2W0NA 4O7DA 1QMFA 3P01A 3TG9A 4O01A 1SKOB 3QHYA 3CAXA 4JBFA 1PWGA 4Y2FA 2B18A 5CX7A 1MWUA 5EM0A 3F1NA 2HF6A 2A24A 3LGOA 4G3WA 2XGNA 4PPRA 3P98A 3HL9A 4HBUA 4HIAA 2I9VA 1YMXA 3G34A 4PM7A 2ZC6B 4GS9A 5L10A 2WK0A 4CLCD 3SOIA 5CXWA 1PWDA 2JKTI 3RH8B 1ODVA 5HDSA 4G3KA 4ZTKA 4LV1A 1OT9A 3VE3A 2XF3A 2Y2OA 3A3FA 4AFIA 4RA7A 4HJ4A 1LT0A 4CJNA 3D9YA 2PR5A 3D3OA 1K55C 3CITA 3ZNTA 4S2MA 3HLWA 3E2LA 3RFBA 3A3JA 2DNSA 5JYPA 5HL6A 1ZC2A 3HUNA 4LLOB 3PAEA 3MFXA 3LR5A 5L07A 5L8MA 5EFWA 4MBFA 4LV0A 3BW6A 4JPMA 2HDRA 4FUWA 3G35A 3VP3A 5KZHA 3N4IA 4YWZA 5HFOA 4EERA 2O99A 4Z1WA 2J8YA 4FOFA 3LEQA 3MKFA 3BQAA 2IWCA 1J3WA 3V3RA 3S7NA 3IF5A 2VZWA 3IXBA 1ZG4A 5AVFA 4CQHA 4P6ZS 1ES2A 5TBMB 5DTTA 3ZG7B 4BL2A 3V3SA 4DE3A 5AQ7A 3H7WB 2EWWA 1SZVA 4U0XA 1I2WA 3EOIA 3HJKA 2VA0A 2H10A 5BOHA 2Q0OA 1M6KA 2BASA 3M6BA 3FZCA 4D60A 4PM9A 4N1XA 4YNRA 4MCWA 2Z6DA 4UHUA 5DJTA 1F9IA 2K31A 1BUEA 2L4RA 5HAQA 2Y59A 1IFQA 3HLBA 4JKTA 2XH9A 5E2FA 5CEBA 1L0FA 5EECA 5FQQA 4OOMA 3T50A 2XQZA 1G68A 3HVFA 1IKIA 4UA9A 3G32A 1Y4OA 3TRCA 5GL9A 1FR6A 4Z9QA 2ZMAA 4C6YA 4DF6A 1FIKA 4WEKA 4DDYA 2JKRI 3PBOA 1TVFA 4EQIA 4RVAA 4GDNA 4OQ0A 1E3UD 3ZG0A 2JE5A 2ACGA 3G2YA 2Z6CA 3LI9A 2OWJA 3L7HA 4OKPA 3HLEA 1JTDA 3EGDC 4WUJA 4RYEA 4FH2A 4WMCD 1S4RA 2CC1A 1OT6A 1YMSA 1BZAA 3H82A 3JVUA 1KDSA 5GHXA 1H8ZA 2Y2MA 2Y8HA 3CJMA 1IYPA 3GTCA 5AQBA 1T1BA 4GJ4A 3IBRA 1KOUA 3VOZA 1OTIA 3PYPA 3IF6A 3LFVA 3IHAA 3F1PA 4B4XA 3UMEA 3C5AA 4S2PA 2W1TB 3W4PA 3I7JA 5GLCA 3LUQA 1LI9A 1LLBA 2B95A 2XD5A 5EVIB 2O9CA 1N9LA 4Y3IA 1PYYA 3BQ8A 4YOFA 3OPHA 3SW1A 3OZHA 1O07A 2Q9MA 1WYCA 4XXRA 1K57C 1JNUA 5FASA 3MQ0A 1D06A 5CERA 1L0EA 2QHKA 2OWHA 1ES5A 2HJ9C 2VEAA 1MXOA 3BLSA 1GA0A 4OPRA 2EA9A 4RX2A 4MDZA 3IQAA 3VMAA 1SKOA 4FD8A 4DMZA 3QP2A 2AVXA 1EWZA 4S2KA 4E3JA 4H6JB 3IXGA 3GRJA 1YLZA 2VV7A 1K0KA 1F5MA 2MJ6A 4EV4A 3OPRA 4JF6A 5DVAA 2XSSA 4R6LA 3LR4A 2OAP1 4E3MA 2V8FA 3QNBA 2WKPA 4KZAA 2B5RA 4KG5A 2P08A 2Y2PA 5M19A 1L2SA 3ICYA 1LSWA 3O5YA 1K54A 1BT5A 2J3TD 2H0YA 2PAVP 2PYPA 1D1JA 4N92A 4GW9A 4OP8A 4HNBA 2FFYA 1EW0A 4NK3A 1BYWA 4MBHA 1XA7A 4PM8A 1BTLA 3UPPA 5GHYA 1Y54A 5IS1A 4R1GA 2D02A 2H0TA 3E4PA 1BLHA 1TS6A 4KQQA 3KSIA 5E2EA 5FQJA 4UA7A 3G2ZA 3VV4A 3MXRA 4O0PA 2EWVA 1CF0A 4KUKA 3TSGA 3NC8A 4EXOA 2ZM0A 2IA2A 4LGWA 2XROA 2WGIA 3ZG9B 3GMWA 3BM6A 2UV0E 4K08A 4BENA 4DE2A 1TS8A 2ZOHA 4KZ6A 3W4OA 3T4SA 1CK3A 1OJ5A 4LPZA 4E3LA 4K0WA 1YLYA 1OTDA 2V1AA 4PAUA 1MZUA 3OPLA 4FH4A 2RL3A 4CLCC 3KYZA 5TBMA 3VP0A 2WADA 2QJ7A 4P0MA 3MKEA 3ZG5A 1N9OA 4QD4A 3JPUA 3T4LA 4ME4A 3H7WA 4N9LA 3IWOA 3EQVA 4KZ5A 2WUQA 3NHQA 4LFUA 4QHCA 5HAIA 3CHWP 5DF8A 3N7WA 4EBNA 4HI4A 3D4FA 3WS2A 3DTKA 5FI7A 3BFGA 4KZ9A 1VM1A 4S2NA 1PW8A 4PMAA 5F83A 3M2KA 4LENA 1BLCA 4X25A 4ZJ2A 3MZFA 5I94A 2NUTC 1CEFA 1KGEA 2VGJA 1XJ4A 4L9FA 2JCHA 2EFUA 5F5YA 3BY8A 3VE4A 2KDKA 1OTEA 3MF0A 4Y17A 2PD7A 1KDWA 1G6OA 3LCEA 1YSQA 5DF7A 3A3DA 3OCLA 1E3UA 3SS3A 2FFFB 4P85A 5CTNA 3UB9A 1O7EA 1X0OA 3M2JA 1CEGA 2OAQ1 3BECA 4DXCA 3UPNA 3GSGA 3ZGAB 2ZD8A 4OOLA 1XP4A 5KMWA 5HD5A 3WRZA 2V1BA 3VP4A 2P04A 2ZQDA 2VX8A 2WKIA 3MZEA 3JVVA 5HWWA 5F82A 4MLLA 5CECA 3VOLA 3HLGA 5FQMA 1P9RA 1W5DA 3VFFA 5EE8A 3Q7ZA 2GJ3A 2QKPA 4ZRRA 1V9ZA 3VSLA 3DBAA 3PTEA 1F2KA 1PZPA 1JWVA 4BWIA 3NIAA 3KX0X 5EVIA 4EW7A 3C2WA 3TJZC 1LL9A 3EEHA 3BFEA 1WYBA 5KSHA 1F98A 4HP4A 4QWOA 1PI5A 2VLGA 2JC7A 3TOIA 2HV1A 1LL8A 3VP2A 3E4QA 1EI5A 1K56D 2O0YA 2XFSA 1N9NA 2DRWA 4EBPA 4WL9A 1K55A 1U60A 1LSXA 2V1ZA 1PNEA 3DTMA 3S7OA 3AGFA 5EVLA 1PW1A 3HLDA 1KVMA 4LRXC 4LCLA 3W4QA 4GB7A 2W3DA 2Y4AA 3LI8A 3CPTA 5GLAA 1PZOA 5FA7A 4JF4A 4H6JA 4X68A 3MXQA 4UEYA 3TW8A 2GX5A 1GSXA 4OONA 4HJ3A 5FQ9A 4G3VA 2V0WA 4EBLA 1J9MA 3QP6A 3KYQA 3HUMA 5A90A 1SCWA 1NYMA 5EPHA 5A8BA 5FEGA 4HHDA 3U2AA 2R78A 1Z09A 2XEPA 4R4SA 4S2JA 4PM6A 1W7FA 5GLBA 1S1YA 4RX3A 3SS5A 3C7VA 4LCMA 3T1XA 2ZC7A 2LB5A 5CEDA 4PM5A 2VKSA 4BQMA 5CRFA 1YQSA 1FOFA 2WGVA 4R38A 1IYSA 5IT5A 4IVKA 3F1OB 3PHYA 3P7NA 4Q0HA 3LY3A 1TEMA 4I39A 2HZ5A 3T4QA 1G28A 4O8GA 1JVJA 4JF5A 1Q2QA 5AQAA 3ZNYA 4UQIM 4WLAA 4DXBA 3T4OA 2K7SA 3ZQ5A 4I38A 1GSWA 3G31A 1HD8A 3UDXA 4WF0A 4MEZA 5G4YA 4FSFA 5TGFA 2V8CA 3IX4A 1ZG6A 3W2ZA 5J4EA 3P09A 2J3TC 3TE8A 1SDEA 1HVBA 5HPIA 3Q82A 4X55A 5EOEA 4BMWA 1WA9A 2WZXA 1AXBA 3UE6A 4OQGA 2Y2GA 4R3JA 4OH0A 4ZJ3A 1DJAA 3KSGA 4L0LA 3IX8A 1W8QA 3UY6A 4GOGA 2J3WA 5FAPA 4EEPA 2O9AA 1G5UA 3RJUA 3Q81A 4GD8A 4NKPA 2QJ5A 2Y2JA 3NOPC 2A3UA 5DFXA 2HDQA 3UB7A 4E04A 1PIOA 1K25A 4JGPA 3U4LP 4MBKA 1PRQA 2WKRA 4LRZE 3KO6A 4EWFA 3MMHA 3ZHHA 1XJ2A 3S1YA 1ZKJA 3K3DA 1TDLA 3ZVWA 3HCYA 5G4ZA 2L0WA 3AGDA 4DJ3A 5CHUA 3PBRA 1HLUP 1KE0A 3DTEA 4CLCE 3OCNA 3PBQA 3MS6A 2E8JA 1P97A 1SKFA 3O86A 5DTSA 4GDBA 4JXSA 3V5MA 1S66L 2PU2A 4E3OA 5K5BA 2Z2MB 3UN7A 4F94A 4R3BA 3AGEA 5EVID 4NXEA 2OLVA 1LSVA 2VV6A 1TDGA 1OTBA 1YM1A 2Y2IA 2OOLA 4ZDXA 2QPNA 4IJGA 5FI2A 3LR3A 2QYBA 3M6HA 1MWSA 4BBTA 3GVBA 3LIFA 1C3BA 1ONHA 1JWZA
chains in the Genus database with same CATH topology
2PR6A 4ME4A 3H7WA 3EQVA 1T1CA 3NHQA 5IU1A 4WEJA 4MN7A 3UB6A 1YAXA 4HI4A 5KIZA 2YKFA 2JKTM 3NJAA 3T4KA 2W0NA 2M7UA 3P01A 4ARZB 4O01A 4QPRA 3CAXA 4IUHA 4Y2FA 2B18A 5DJUA 2HGVA 3CUEA 5CX7A 4R3AA 3F1NA 3ZYTA 3IBJA 2HF6A 3CLOA 3F1NB 2A24A 4G3WA 4RQ9A 2NUTC 3FPVA 2DMWA 4HIAA 2I9VA 3CWFA 1VB6A 1XFNA 4GS9A 1XJ4A 4EUVA 5F69A 2D01A 4CLCD 4L9FA 1NRJA 2JKTI 3E4OA 3RH8B 2KX6A 5F5YA 1ODVA 3BY8A 5HDSA 3VE4A 4G3KA 2KDKA 1OTEA 3MF0A 4Y5FA 1OT9A 2PD7A 1G6OA 4HH3A 3VE3A 1IOUA 4B93A 1YSQA 4JGQA 2PHYA 3C30A 3OCLA 2INWA 3A0VA 4F3LA 4AFIA 4HJ4A 1LT0A 4NXBA 3UB9A 3MQQA 1X0OA 3CI6A 2OAQ1 2P7JA 3T4TA 3PBSA 2PR5A 3D3OA 4BBVA 3CITA 4GHIA 4EESA 4I3AA 3A0SA 3UMDA 5HDCA 1UWPX 4XT2A 3B47A 3E0YA 4OOLA 3RFBA 2ZMVA 5HD5A 2V1BA 2P04A 5HL6A 2VX8A 4L9EA 4LLOB 3MFXA 3LR5A 3JVVA 4Q0JA 5HWWA 3EGXC 2W3FA 4IUKA 2W3HA 5L8MA 5EFWA 3VOLA 2WKQA 4PKYA 3BW6A 5TJJA 3A0RA 1MKMA 1P9RA 4YWZA 4EERA 3B42A 2GJ3A 2QKPA 1OTAA 3LICA 1V9ZA 4ZRRA 2O99A 4Z1WA 2L1MA 5AJGA 5FL3A 4FOFA 1MC0A 3DBAA 3BQAA 1GSVA 3HJIA 5HD3A 4HOIA 2Y79A 4L9GA 3S7NA 1P0ZA 1TS0A 3BWLA 4I3IA 2VZWA 2K2NA 2GZAA 1UGUA 5AVFA 4CQHA 4P6ZS 4BWIA 5TBMB 3OLOA 3KX0X 4EW7A 1DP8A 3C2WA 4PHTA 2FH5A 1Y28A 3TJZC 3EEHA 5KSHA 2QWSA 1F98A 4IHQA 1OJGA 4HP4A 4MMNA 3BY9A 2VLGA 3H7WB 2EWWA 2HV1A 2W1RA 1LL8A 3EOIA 3HJKA 2VA0A 5C5KA 3E4QA 2BASA 3B33A 2O0YA 3OC2A 1N9NA 1S1ZA 4WELA 4WL9A 3R4KA 3K3CA 3S7QA 1LSXA 2CMNA 4YNRA 4MCWA 3EQUA 2JKRM 3S7OA 2Z6DA 1OPXA 5DJTA 1F9IA 2K31A 1TS7A 2FZ0A 5DKLA 2L4RA 2A24B 1XJ6A 4LRXC 3LIDA 1IFQA 4MN5A 1NWZA 5J3WA 5HDDA 2ZBBA 3PR6A 2W3DA 3LI8A 4KUOA 2PYRA 2ZOIA 4GS9B 3EEAA 4OOMA 2M1CA 3T50A 4H6JA 4NXFA 4P6ZM 3FC7A 3TRCA 1TF1A 3MXQA 2J80A 4UEYA 3IS2A 3TW8A 4WEKA 3RTYA 2JKRI 3K2NA 1DP9A 2GX5A 1GSXA 3LIBA 1TD5A 4HJ3A 3PBOA 2B02A 4CLCA 4G3VA 2V0WA 1DP6A 4MN6A 4F3LB 1UWNX 5HWVA 3R7WA 4UQIS 3KYQA 4B9OA 2Z6CA 3LI9A 2OWJA 4GHIB 5A8BA 4XT2B 4HHDA 3U2AA 3EGDC 2R78A 4R70A 4WUJA 2PT7A 2PD8A 3KSFA 5DFYA 1S4RA 3OBFA 4BJPA 1OT6A 3H82A 2V9AA 3JVUA 2XA7S 3H82B 4HQAA 1S1YA 2Y8HA 1P9WA 4II7A 4BBUA 3PBTA 1T1BA 2YKHA 4GJ4A 3IBRA 3CUEC 2W3EA 1KOUA 2M7VA 2LB5A 1OTIA 2VKSA 3PYPA 4PKYG 4I5SA 3LFVA 3F1PA 2VV8A 2W1TA 4R38A 3UMEA 3F1OA 2V0UA 2W1TB 5IT5A 3F1OB 3PHYA 4JGOA 4KQDA 3P7NA 4Q0HA 2G7UA 2W27A 3LUQA 4I39A 3T4QA 1G28A 2XRNA 4O8GA 3E98A 3LIEA 3MJQA 2O9CA 4UQIM 1N9LA 4Y3IA 4WLAA 4I3JA 3T4OA 3BQ8A 4YOFA 3UB8A 2GNXA 2K7SA 3MQOA 3ZQ5A 3SW1A 3C8CA 4I38A 2W3GA 1V9YA 1H3QA 1S4SA 1GSWA 3LR0A 2LB9A 4WF0A 3FPWA 1JNUA 2JN7A 3MQ0A 5G4YA 4FSFA 3D72A 5J7EA 2XA7M 4EU0A 1D06A 3W2ZA 5J4EA 2J3TC 3TE8A 5F6AA 3NOUC 3S7PA 3UE3A 1STZA 5HPIA 5HSQA 2QHKA 2OWHA 5DF9A 2HJ9C 2VEAA 4BMWA 4HH2A 2EA9A 1WA9A 3BJNA 5MC7A 4MDZA 3GDIA 1ZTUA 3UE6A 4ARZA 4ETZA 2HJEA 3G6OA 4NEED 4DMZA 1S67L 4KQOA 4GCZA 2KOIA 3KSGA 5HZHA 3EWKA 2VGLS 4DJ2A 3PXPA 4L0LA 3PBNA 4H6JB 2J3WA 4Q0IA 2KLIA 2VJWA 3MR0A 4HJ6A 2VV7A 1YSPA 4EEPA 2O9AA 4GLQA 1F5MA 3IS2B 2MJ6A 2A2LA 2XSSA 4R6LA 3LR4A 2OAP1 4NKPA 2QJ5A 2NUPC 3LIAA 4CLCB 3NOPC 4JGRA 2WKPA 4HY8A 5DFXA 1XFQA 3UB7A 4E04A 3GECA 4JGPA 2P08A 1ZHHB 2WKRA 4LRZE 3R7WB 3KO6A 1H8MA 3ICYA 4WN5A 5DKKA 1LSWA 3OOVA 3MMHA 3O5YA 1XJ2A 4LRYC 2JHEA 2J3TD 4EQ1A 2PYPA 1XJ3A 3K3DA 4GW9A 2ZMFA 4HNBA 4M4XA 1EW0A 3HCYA 5G4ZA 2L0WA 3NOTC 1BYWA 3ULFA 4EEUA 5IS1A 2D02A 4DJ3A 3PBRA 3E4PA 5HPFA 1TS6A 3KSIA 1YKDA 1T1AA 1D7EA 1NLZA 2VGLM 4CLCE 3OCNA 3VV4A 1VHMA 3PBQA 4O0PA 2EWVA 5LBRA 1P97A 4KUKA 5F68A 1DRMA 3C38A 1W63Q 2PDRA 4EXOA 3T4JA 2IA2A 3F1PB 4ETXA 2XROA 3V67A 1S66L 4K08A 3H9WA 5K5BA 1TS8A 2ZOHA 3FG8A 3T4SA 5I5LA 4NXEA 1LSVA 2VV6A 1OTBA 4DN0A 3KSHA 2OOLA 1OJ5A 4LPZA 1NLYA 1OTDA 4IJGA 3LR3A 2V1AA 2QYBA 4PAUA 1MZUA 4HP9A 4CLCC 1T18A 2O9BA 5HWTA 3KYZA 5TBMA 4EETB 1W63M 4BBTA 2H28A 2QJ7A 3LIFA 1T19A 1N9OA 5AVEA 3T4LA 3LYXA 4NXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PR6 A;  3H7W A;  1T1C A;  3NHQ A;  5IU1 A;  3UB6 A;  4HI4 A;  5KIZ A;  2YKF A;  3NJA A;  2W0N A;  3CAX A;  5DJU A;  4R3A A;  3F1N A;  3CLO A;  3F1N B;  2A24 A;  4RQ9 A;  4HIA A;  2I9V A;  3CWF A;  1VB6 A;  1XFN A;  4GS9 A;  1XJ4 A;  5F69 A;  2D01 A;  4L9F A;  3E4O A;  3RH8 B;  2KX6 A;  5F5Y A;  1ODV A;  3BY8 A;  5HDS A;  3VE4 A;  2KDK A;  1OTE A;  1OT9 A;  2PD7 A;  4HH3 A;  3VE3 A;  4JGQ A;  2PHY A;  2INW A;  3A0V A;  4F3L A;  4HJ4 A;  1LT0 A;  4NXB A;  3UB9 A;  3MQQ A;  1X0O A;  2P7J A;  2PR5 A;  4BBV A;  4GHI A;  4EES A;  4I3A A;  3A0S A;  3UMD A;  5HDC A;  1UWP X;  4XT2 A;  5HD5 A;  2V1B A;  4L9E A;  4LLO B;  3MFX A;  5HWW A;  3VOL A;  5EFW A;  2WKQ A;  4PKY A;  3A0R A;  4YWZ A;  4EER A;  2GJ3 A;  2QKP A;  1OTA A;  3LIC A;  1V9Z A;  2L1M A;  1GSV A;  3HJI A;  5HD3 A;  4HOI A;  4L9G A;  1P0Z A;  1TS0 A;  3BWL A;  4I3I A;  1UGU A;  5AVF A;  5TBM B;  3OLO A;  3KX0 X;  4EW7 A;  1DP8 A;  3C2W A;  1Y28 A;  3EEH A;  2QWS A;  1F98 A;  1OJG A;  4HP4 A;  3BY9 A;  2VLG A;  3H7W B;  2HV1 A;  1LL8 A;  3HJK A;  3E4Q A;  2BAS A;  3B33 A;  1N9N A;  1S1Z A;  4WL9 A;  3K3C A;  1LSX A;  2CMN A;  2Z6D A;  5DJT A;  1F9I A;  1TS7 A;  5DKL A;  2L4R A;  2A24 B;  1XJ6 A;  4LRX C;  3LID A;  4MN5 A;  1NWZ A;  5J3W A;  5HDD A;  2ZBB A;  3LI8 A;  4KUO A;  2PYR A;  2ZOI A;  4GS9 B;  3T50 A;  2M1C A;  4H6J A;  4NXF A;  3FC7 A;  3MXQ A;  2J80 A;  3IS2 A;  3RTY A;  1DP9 A;  1GSX A;  3LIB A;  4HJ3 A;  2B02 A;  2V0W A;  1DP6 A;  4MN6 A;  4F3L B;  1UWN X;  5HWV A;  4B9O A;  2Z6C A;  3LI9 A;  2OWJ A;  4GHI B;  5A8B A;  4XT2 B;  4HHD A;  2R78 A;  4R70 A;  4WUJ A;  2PD8 A;  1S4R A;  1OT6 A;  3H82 A;  2V9A A;  3H82 B;  4HQA A;  1S1Y A;  4BBU A;  1T1B A;  2YKH A;  3IBR A;  1KOU A;  1OTI A;  3PYP A;  4PKY G;  4I5S A;  3F1P A;  2VV8 A;  3UME A;  4R38 A;  3F1O A;  2V0U A;  3F1O B;  3PHY A;  4JGO A;  4KQD A;  3P7N A;  3LUQ A;  2W27 A;  4I39 A;  1G28 A;  3LIE A;  3MJQ A;  1N9L A;  4WLA A;  4I3J A;  3UB8 A;  2K7S A;  3MQO A;  3ZQ5 A;  3SW1 A;  3C8C A;  4I38 A;  1V9Y A;  1S4S A;  1GSW A;  4WF0 A;  1JNU A;  2JN7 A;  5G4Y A;  3D72 A;  5J7E A;  1D06 A;  5J4E A;  5F6A A;  3NOU C;  5HSQ A;  2QHK A;  2OWH A;  2VEA A;  4HH2 A;  2EA9 A;  1WA9 A;  3GDI A;  3UE6 A;  3G6O A;  1S67 L;  4GCZ A;  5HZH A;  3EWK A;  4DJ2 A;  4H6J B;  3MR0 A;  4HJ6 A;  2VV7 A;  4EEP A;  3IS2 B;  4R6L A;  2QJ5 A;  3LIA A;  3NOP C;  4JGR A;  2WKP A;  4HY8 A;  1XFQ A;  3UB7 A;  4E04 A;  3GEC A;  4JGP A;  2WKR A;  4LRZ E;  3ICY A;  4WN5 A;  5DKK A;  1LSW A;  1XJ2 A;  4LRY C;  2JHE A;  4EQ1 A;  2PYP A;  1XJ3 A;  3K3D A;  4GW9 A;  4HNB A;  4M4X A;  1EW0 A;  5G4Z A;  2L0W A;  3NOT C;  1BYW A;  3ULF A;  4EEU A;  5IS1 A;  2D02 A;  4DJ3 A;  3E4P A;  1TS6 A;  1T1A A;  1D7E A;  1P97 A;  4KUK A;  5F68 A;  1DRM A;  2PDR A;  4EXO A;  3F1P B;  1S66 L;  4K08 A;  3H9W A;  1TS8 A;  2ZOH A;  3FG8 A;  5I5L A;  4NXE A;  1LSV A;  2VV6 A;  1OTB A;  2OOL A;  1OJ5 A;  4LPZ A;  1OTD A;  2V1A A;  1MZU A;  4HP9 A;  1T18 A;  5HWT A;  5TBM A;  4EET B;  4BBT A;  2H28 A;  2QJ7 A;  3LIF A;  1T19 A;  1N9O A;  5AVE A;  3LYX A;  4NXG A; 
#chains in the Genus database with same CATH topology
 1OME A;  4BL3 A;  3GR2 A;  1XGI A;  1W8Y A;  1YLJ A;  1YLW A;  4WEJ A;  4MN7 A;  3UB6 A;  3W8K A;  4B4Z A;  4KQR A;  1AWI A;  1K56 A;  2JKT M;  4FCF A;  2M7U A;  3V39 A;  5E2H A;  4JXV A;  5AQ9 A;  3BFC A;  3LEZ A;  4ARZ B;  4IUH A;  3BFD A;  5HAR A;  5DJU A;  2HGV A;  2PU4 A;  3CUE A;  4OLD A;  4R3A A;  3ZYT A;  3CLO A;  4KZ4 A;  1LL5 A;  2XDM A;  2OLU A;  3F1N B;  4ID4 A;  3UB5 P;  2IWD A;  1K4E A;  4DDS A;  3IF6 C;  3WS4 A;  3CG5 A;  2EX9 A;  4WM9 A;  4EUV A;  5F69 A;  5A91 A;  1NRJ A;  1RGZ A;  2R9X A;  3FWL A;  2ZQ7 A;  4E3K A;  3CZD A;  2WGW B;  4HH3 A;  1ONG A;  3N8R A;  1L3L A;  3IXH A;  5IHV A;  3C7U A;  3A3E A;  2INW A;  3NUL A;  2C5W B;  4P87 A;  4NXB A;  1ES3 A;  3CI6 A;  1I2S A;  2P7J A;  3T4T A;  2Y2L A;  4Q8I A;  4I3A A;  3A0S A;  1UWP X;  4B88 A;  3E0Y A;  3ISG A;  1WE4 A;  1GHM A;  3HUO A;  2WKH A;  5TFQ A;  2XK1 A;  2IWB A;  1NXY A;  4Q0J A;  3EGX C;  2EXA A;  4IUK A;  3NI9 A;  3QP1 A;  3A0R A;  3IHB A;  4JLF A;  3UDF A;  1MKM A;  3PAG A;  3N8S A;  3NY4 A;  3B42 A;  1PI4 A;  2BTF P;  2Z2L B;  1OTA A;  3LIC A;  1DJC A;  5AJG A;  4IBX A;  3O3V A;  3HJI A;  4L9G A;  1K6S A;  1P0Z A;  1TS0 A;  1ERO A;  4E3N A;  2GZA A;  5FI6 A;  5CTM A;  1DP8 A;  2PRF A;  2FH5 A;  3E2K A;  1Y28 A;  2QWS A;  4NET A;  2G2W A;  4IHQ A;  3QP8 A;  2R9W A;  3BY9 A;  5F1F A;  4BD1 A;  2PBY A;  1K54 C;  2V2F F;  4U3T A;  2H5S A;  2W1R A;  5JYO A;  5C5K A;  5HAP A;  1ES4 A;  3VP1 A;  4WEL A;  3BFF A;  4GN2 A;  3DW0 A;  4FTX A;  2BLS A;  3EQU A;  2WKE A;  2JKR M;  4OPY A;  1TS7 A;  2FZ0 A;  2ZL1 B;  3LID A;  3DAV A;  1GHP A;  3ZCZ A;  5HDD A;  3PR6 A;  3Q07 A;  4KUO A;  4NG2 A;  3EEA A;  2M1C A;  3KYE A;  3N6I A;  4NXF A;  3NDG A;  3FC7 A;  4LV2 A;  1TF1 A;  5F1G A;  2J80 A;  2ZM2 A;  1DP9 A;  4KZ7 A;  1TD5 A;  4LV3 A;  2EX8 A;  3MXS A;  1BUL A;  1DP6 A;  4MN6 A;  4F3L B;  1UWN X;  2Q9N A;  1CI8 A;  3GQZ A;  1MWT A;  4X1M A;  4UQI S;  1S0W A;  4X53 A;  4B9O A;  3NCK A;  4OLG A;  4GHI B;  1MPL A;  1L0G A;  5FAQ A;  4XT2 B;  5EUA A;  2WYX A;  1E25 A;  2ZQ9 A;  5U47 A;  3KSF A;  2Y55 A;  4WZ5 A;  2OV5 A;  3OBF A;  3C4P A;  1SDN A;  2V9A A;  3H82 B;  4HQA A;  4E6W A;  5A93 A;  3ZDJ A;  1K6R A;  2Y2Q A;  3HLF A;  1MBL A;  3T1Q B;  4PKY G;  2W1T A;  2V0U A;  4M3K A;  4E6X A;  2XRN A;  2WZZ A;  4QB8 A;  4UA6 A;  3E98 A;  5FEF A;  3LIE A;  1YPR A;  2HDS A;  3SS4 A;  3VOY A;  1HZO A;  4I3J A;  3UB8 A;  2GNX A;  3UNW A;  3IH8 A;  4Y7P A;  4MNR A;  3QP5 A;  1E4D A;  4N9K A;  2W3G A;  3O88 A;  1H3Q A;  1S4S A;  3BRM A;  3LR0 A;  1NRF A;  4JXG A;  2LB9 A;  3QNC A;  1KE4 A;  3DWK A;  3FPW A;  3IH9 A;  5J7E A;  2XA7 M;  4EU0 A;  4OPQ A;  5F6A A;  3NOU C;  3S7P A;  2GDN A;  3CMZ A;  5DF9 A;  1MY8 A;  3VFH A;  1H8Y A;  1KVL A;  2E8I A;  1XPB A;  3T1S A;  3GDI A;  1ZTU A;  4ARZ A;  2HJE A;  1LI0 A;  5EVE A;  4X56 A;  5FDS A;  4NEE D;  5M18 A;  4JXW A;  4KQO A;  2KOI A;  3PXP A;  1ESU A;  2QMI A;  1CQA A;  3PBN A;  4OOY A;  2JBF A;  4GLQ A;  1IEM A;  3NBL A;  3IS2 B;  1XA1 A;  4XUX A;  2A2L A;  4Y0O A;  4CLC B;  2EFX A;  3IT9 A;  1XFQ A;  3GEC A;  2RCX A;  1ZHH B;  4YFM A;  5EVI C;  3R7W B;  2WGW A;  4WN5 A;  5DKK A;  4DE1 A;  2C6W B;  4LRY C;  2JHE A;  4EQ1 A;  3WS1 A;  4M4X A;  3HBR A;  5D3O A;  2EXB A;  4EEU A;  1FCO A;  5EOO A;  4KZ8 A;  2JKG A;  1NYY A;  1NLZ A;  3NDE A;  1IYQ A;  2VGL M;  1H0M A;  5F68 A;  4Y0T A;  1DRM A;  1W63 Q;  2PDR A;  3T4J A;  1KGG A;  2J9P A;  4E3I A;  1VEU B;  4KEN B;  3H9W A;  2XLN A;  3JYI A;  4BD0 A;  2ZQ8 A;  3IX3 A;  3KSH A;  1CJF A;  1ACF A;  1T18 A;  4IVI A;  2O9B A;  4OQH A;  3VSK A;  4GD6 A;  4EET B;  1G6A A;  5CGS A;  1T19 A;  1ESI A;  3L9K A;  4S2L A;  5AVE A;  3LYX A;  2PBD P;  4ZAM A;  3ZVT A;  2PR6 A;  3IXD A;  2ZM8 A;  1FSY A;  1JWP A;  1H5X A;  1LHY A;  5IU1 A;  1FCM A;  1YAX A;  5KIZ A;  5FAT A;  2ZC5 B;  3S4X A;  3T4K A;  1RP5 A;  4QPR A;  5CHJ A;  1YLP A;  3NEC A;  2ZC3 B;  3Q7V B;  5EM1 A;  2G2U A;  3G4P A;  3IBJ A;  4IBR A;  1VET B;  2ZL1 A;  2HPB A;  1MWR A;  4RQ9 A;  3FPV A;  2DMW A;  2OSU A;  3CWF A;  4KZ3 A;  1VB6 A;  1XFN A;  1IKG A;  1FSW A;  2D01 A;  4GZB A;  1I5Q A;  3N8L A;  3E4O A;  2EX2 A;  2KX6 A;  4ZJ1 A;  3SH8 A;  3HLC A;  2ZQC A;  4Y5F A;  1IOU A;  4B93 A;  4KG6 A;  4JGQ A;  5EV0 A;  2PHY A;  3UO9 A;  3C30 A;  5TR7 A;  2HP9 A;  3A0V A;  4F3L A;  4HEF A;  3FKW A;  3MQQ A;  1K57 A;  3SH9 A;  1S6R A;  4HBT A;  3PBS A;  4BBV A;  4GHI A;  4EES A;  4OVD A;  2Y2H A;  3T12 B;  5GLD A;  4OP5 A;  3FKV A;  3UMD A;  5HDC A;  4XT2 A;  3B47 A;  2ZMV A;  2X02 A;  5FQK A;  1W79 A;  4QY6 A;  1ERM A;  4WYY A;  4L9E A;  4K91 A;  2Y2K A;  1VQQ A;  4S2I A;  3V50 A;  2W3F A;  2W3H A;  4OQI A;  2WKQ A;  4PKY A;  1YLT A;  5TJJ A;  4U0T A;  1ERQ A;  3G30 A;  1NZO A;  1JTG A;  4N1H A;  3DWZ A;  2L1M A;  5FL3 A;  1MC0 A;  1XGJ A;  1GSV A;  5DTK A;  5HD3 A;  4HOI A;  2Y79 A;  4Y15 A;  3BWL A;  5HL1 A;  4I3I A;  1NZU A;  5CGW A;  2K2N A;  1UGU A;  2P9V B;  4GKU A;  5HX9 A;  3OLO A;  4IED A;  4PHT A;  1MKI A;  5M1A A;  4R23 A;  1XKZ A;  1OJG A;  4MMN A;  1FIL A;  1IEL A;  4D2O A;  3S22 A;  3QP4 A;  3B33 A;  3OC2 A;  1S1Z A;  1XX2 A;  3R4K A;  3K3C A;  3ZG8 B;  5KSC A;  4HES A;  2Y2N A;  3S7Q A;  4ESP A;  2CMN A;  4Y13 A;  1Z6F A;  4A5R A;  2VK3 A;  3UDI A;  1OPX A;  5DKL A;  2A24 B;  1XJ6 A;  2A49 A;  4MN5 A;  1NWZ A;  5J3W A;  3FYZ A;  2ZBB A;  4UAA A;  4DRT A;  2X71 A;  3LY4 A;  5FAO A;  2PYR A;  3CPT B;  5J8X A;  2ZOI A;  4GS9 B;  1K4F A;  3HRE A;  4XUZ A;  3MBZ A;  4C3Q A;  4P6Z M;  3ZFZ A;  5L2F A;  2ZC4 B;  1GHI A;  4K0X A;  5HW3 A;  3IS2 A;  3RTY A;  3K2N A;  3UE1 A;  5L09 A;  3LIB A;  2B02 A;  4CLC A;  1M40 A;  4X69 A;  4OPZ A;  4QJG A;  4DKI A;  2HDU A;  5HWV A;  1GA9 A;  3R7W A;  4ZBE A;  3OPP A;  5GHZ A;  5A92 A;  3GV9 A;  3IWQ A;  1NJ4 A;  1N4O A;  4R70 A;  3SZT A;  2PT7 A;  2PD8 A;  5E2G A;  1HTZ A;  5DFY A;  4BJP A;  3O87 A;  2WAE A;  2XA7 S;  1QME A;  3ITB A;  1P9W A;  1FQG A;  4II7 A;  3A3I A;  2XFT A;  4BBU A;  3LO7 A;  3ITA A;  3PBT A;  2YKH A;  3CUE C;  2W3E A;  2M7V A;  1FR1 A;  5G18 A;  4I5S A;  2VV8 A;  1VEU A;  5FQI A;  3F1O A;  4WZ4 A;  3SH7 A;  1L0D A;  4JGO A;  4KQD A;  1FCN A;  2G7U A;  2W27 A;  2Y91 A;  1PWC A;  3BLM A;  3BYD A;  3MJQ A;  1ALQ A;  4DE0 A;  2X01 A;  1GCE A;  2ZLY A;  5FDH A;  4CPK A;  3MQO A;  4P6B A;  3C8C A;  1V9Y A;  2VGK A;  4KZB A;  5E43 A;  2JN7 A;  3MSH A;  3D72 A;  5CHM A;  3C4O A;  3UE3 A;  5CGX A;  1N9B A;  1STZ A;  2BG1 A;  1SHV A;  5HSQ A;  3MFD A;  2XR0 A;  4BLM A;  4HH2 A;  4KG2 A;  4QY5 A;  2UWX A;  3BJN A;  5MC7 A;  1K38 A;  4ETZ A;  3G6O A;  1S67 L;  1XXM A;  4GCZ A;  1DJB A;  5HZH A;  3EWK A;  2VGL S;  3Q7V A;  4DJ2 A;  1VET A;  4S2O A;  3Q1F A;  4Q0I A;  2KLI A;  2VJW A;  3MR0 A;  4HJ6 A;  1YSP A;  2J7V A;  1Q2P A;  3WRT A;  2J9O A;  1BLP A;  3MZD A;  3LIA A;  2NUP C;  4Y0U A;  4JGR A;  4HY8 A;  4C75 A;  4YIN A;  4WBG A;  1H8M A;  3OOV A;  3WS5 A;  3DTI A;  4X1L A;  1A0K A;  3UPO A;  4QU3 A;  2XD1 A;  1YT4 A;  1XJ3 A;  4X6T A;  2ZMF A;  3NOT C;  1CI9 A;  1BSG A;  3ULF A;  1NY0 A;  4S2N C;  5HPF A;  1DY6 A;  1YKD A;  1D7E A;  1T1A A;  2HP5 A;  4H8R A;  1IYO A;  4WMC A;  1VHM A;  4GNU A;  1KE3 A;  5LBR A;  4R0Q A;  3T1R A;  3C38 A;  3IF6 B;  2EX6 A;  3F1P B;  1KGF A;  2JKF A;  4ETX A;  3V67 A;  3WS0 A;  1BLS A;  2HP6 A;  5FSR A;  3FG8 A;  5I5L A;  2V20 A;  4R4R A;  2ZJ9 A;  4EUZ A;  4DN0 A;  3RXX A;  2ZQA A;  1NLY A;  1RCJ A;  4HP9 A;  2P9V A;  5HWT A;  2WAF A;  1W63 M;  2H28 A;  3UE0 A;  2QZ6 A;  2I72 A;  4NXG A;  3IWI A;  1RGY A;  1T1C A;  3FV7 A;  3BEB A;  3B3X A;  2DCF A;  1PFL A;  2P74 A;  2YKF A;  3WWX A;  3RXW A;  3NJA A;  4WZ5 C;  2W0N A;  4O7D A;  1QMF A;  3P01 A;  3TG9 A;  4O01 A;  1SKO B;  3QHY A;  3CAX A;  4JBF A;  1PWG A;  4Y2F A;  2B18 A;  5CX7 A;  1MWU A;  5EM0 A;  3F1N A;  2HF6 A;  2A24 A;  3LGO A;  4G3W A;  2XGN A;  4PPR A;  3P98 A;  3HL9 A;  4HBU A;  4HIA A;  2I9V A;  1YMX A;  3G34 A;  4PM7 A;  2ZC6 B;  4GS9 A;  5L10 A;  2WK0 A;  4CLC D;  3SOI A;  5CXW A;  1PWD A;  2JKT I;  3RH8 B;  1ODV A;  5HDS A;  4G3K A;  4ZTK A;  4LV1 A;  1OT9 A;  3VE3 A;  2XF3 A;  2Y2O A;  3A3F A;  4AFI A;  4RA7 A;  4HJ4 A;  1LT0 A;  4CJN A;  3D9Y A;  2PR5 A;  3D3O A;  1K55 C;  3CIT A;  3ZNT A;  4S2M A;  3HLW A;  3E2L A;  3RFB A;  3A3J A;  2DNS A;  5JYP A;  5HL6 A;  1ZC2 A;  3HUN A;  4LLO B;  3PAE A;  3MFX A;  3LR5 A;  5L07 A;  5L8M A;  5EFW A;  4MBF A;  4LV0 A;  3BW6 A;  4JPM A;  2HDR A;  4FUW A;  3G35 A;  3VP3 A;  5KZH A;  3N4I A;  4YWZ A;  5HFO A;  4EER A;  2O99 A;  4Z1W A;  2J8Y A;  4FOF A;  3LEQ A;  3MKF A;  3BQA A;  2IWC A;  1J3W A;  3V3R A;  3S7N A;  3IF5 A;  2VZW A;  3IXB A;  1ZG4 A;  5AVF A;  4CQH A;  4P6Z S;  1ES2 A;  5TBM B;  5DTT A;  3ZG7 B;  4BL2 A;  3V3S A;  4DE3 A;  5AQ7 A;  3H7W B;  2EWW A;  1SZV A;  4U0X A;  1I2W A;  3EOI A;  3HJK A;  2VA0 A;  2H10 A;  5BOH A;  2Q0O A;  1M6K A;  2BAS A;  3M6B A;  3FZC A;  4D60 A;  4PM9 A;  4N1X A;  4YNR A;  4MCW A;  2Z6D A;  4UHU A;  5DJT A;  1F9I A;  2K31 A;  1BUE A;  2L4R A;  5HAQ A;  2Y59 A;  1IFQ A;  3HLB A;  4JKT A;  2XH9 A;  5E2F A;  5CEB A;  1L0F A;  5EEC A;  5FQQ A;  4OOM A;  3T50 A;  2XQZ A;  1G68 A;  3HVF A;  1IKI A;  4UA9 A;  3G32 A;  1Y4O A;  3TRC A;  5GL9 A;  1FR6 A;  4Z9Q A;  2ZMA A;  4C6Y A;  4DF6 A;  1FIK A;  4WEK A;  4DDY A;  2JKR I;  3PBO A;  1TVF A;  4EQI A;  4RVA A;  4GDN A;  4OQ0 A;  1E3U D;  3ZG0 A;  2JE5 A;  2ACG A;  3G2Y A;  2Z6C A;  3LI9 A;  2OWJ A;  3L7H A;  4OKP A;  3HLE A;  1JTD A;  3EGD C;  4WUJ A;  4RYE A;  4FH2 A;  4WMC D;  1S4R A;  2CC1 A;  1OT6 A;  1YMS A;  1BZA A;  3H82 A;  3JVU A;  1KDS A;  5GHX A;  1H8Z A;  2Y2M A;  2Y8H A;  3CJM A;  1IYP A;  3GTC A;  5AQB A;  1T1B A;  4GJ4 A;  3IBR A;  1KOU A;  3VOZ A;  1OTI A;  3PYP A;  3IF6 A;  3LFV A;  3IHA A;  3F1P A;  4B4X A;  3UME A;  3C5A A;  4S2P A;  2W1T B;  3W4P A;  3I7J A;  5GLC A;  3LUQ A;  1LI9 A;  1LLB A;  2B95 A;  2XD5 A;  5EVI B;  2O9C A;  1N9L A;  4Y3I A;  1PYY A;  3BQ8 A;  4YOF A;  3OPH A;  3SW1 A;  3OZH A;  1O07 A;  2Q9M A;  1WYC A;  4XXR A;  1K57 C;  1JNU A;  5FAS A;  3MQ0 A;  1D06 A;  5CER A;  1L0E A;  2QHK A;  2OWH A;  1ES5 A;  2HJ9 C;  2VEA A;  1MXO A;  3BLS A;  1GA0 A;  4OPR A;  2EA9 A;  4RX2 A;  4MDZ A;  3IQA A;  3VMA A;  1SKO A;  4FD8 A;  4DMZ A;  3QP2 A;  2AVX A;  1EWZ A;  4S2K A;  4E3J A;  4H6J B;  3IXG A;  3GRJ A;  1YLZ A;  2VV7 A;  1K0K A;  1F5M A;  2MJ6 A;  4EV4 A;  3OPR A;  4JF6 A;  5DVA A;  2XSS A;  4R6L A;  3LR4 A;  2OAP 1;  4E3M A;  2V8F A;  3QNB A;  2WKP A;  4KZA A;  2B5R A;  4KG5 A;  2P08 A;  2Y2P A;  5M19 A;  1L2S A;  3ICY A;  1LSW A;  3O5Y A;  1K54 A;  1BT5 A;  2J3T D;  2H0Y A;  2PAV P;  2PYP A;  1D1J A;  4N92 A;  4GW9 A;  4OP8 A;  4HNB A;  2FFY A;  1EW0 A;  4NK3 A;  1BYW A;  4MBH A;  1XA7 A;  4PM8 A;  1BTL A;  3UPP A;  5GHY A;  1Y54 A;  5IS1 A;  4R1G A;  2D02 A;  2H0T A;  3E4P A;  1BLH A;  1TS6 A;  4KQQ A;  3KSI A;  5E2E A;  5FQJ A;  4UA7 A;  3G2Z A;  3VV4 A;  3MXR A;  4O0P A;  2EWV A;  1CF0 A;  4KUK A;  3TSG A;  3NC8 A;  4EXO A;  2ZM0 A;  2IA2 A;  4LGW A;  2XRO A;  2WGI A;  3ZG9 B;  3GMW A;  3BM6 A;  2UV0 E;  4K08 A;  4BEN A;  4DE2 A;  1TS8 A;  2ZOH A;  4KZ6 A;  3W4O A;  3T4S A;  1CK3 A;  1OJ5 A;  4LPZ A;  4E3L A;  4K0W A;  1YLY A;  1OTD A;  2V1A A;  4PAU A;  1MZU A;  3OPL A;  4FH4 A;  2RL3 A;  4CLC C;  3KYZ A;  5TBM A;  3VP0 A;  2WAD A;  2QJ7 A;  4P0M A;  3MKE A;  3ZG5 A;  1N9O A;  4QD4 A;  3JPU A;  3T4L A;  4ME4 A;  3H7W A;  4N9L A;  3IWO A;  3EQV A;  4KZ5 A;  2WUQ A;  3NHQ A;  4LFU A;  4QHC A;  5HAI A;  3CHW P;  5DF8 A;  3N7W A;  4EBN A;  4HI4 A;  3D4F A;  3WS2 A;  3DTK A;  5FI7 A;  3BFG A;  4KZ9 A;  1VM1 A;  4S2N A;  1PW8 A;  4PMA A;  5F83 A;  3M2K A;  4LEN A;  1BLC A;  4X25 A;  4ZJ2 A;  3MZF A;  5I94 A;  2NUT C;  1CEF A;  1KGE A;  2VGJ A;  1XJ4 A;  4L9F A;  2JCH A;  2EFU A;  5F5Y A;  3BY8 A;  3VE4 A;  2KDK A;  1OTE A;  3MF0 A;  4Y17 A;  2PD7 A;  1KDW A;  1G6O A;  3LCE A;  1YSQ A;  5DF7 A;  3A3D A;  3OCL A;  1E3U A;  3SS3 A;  2FFF B;  4P85 A;  5CTN A;  3UB9 A;  1O7E A;  1X0O A;  3M2J A;  1CEG A;  2OAQ 1;  3BEC A;  4DXC A;  3UPN A;  3GSG A;  3ZGA B;  2ZD8 A;  4OOL A;  1XP4 A;  5KMW A;  5HD5 A;  3WRZ A;  2V1B A;  3VP4 A;  2P04 A;  2ZQD A;  2VX8 A;  2WKI A;  3MZE A;  3JVV A;  5HWW A;  5F82 A;  4MLL A;  5CEC A;  3VOL A;  3HLG A;  5FQM A;  1P9R A;  1W5D A;  3VFF A;  5EE8 A;  3Q7Z A;  2GJ3 A;  2QKP A;  4ZRR A;  1V9Z A;  3VSL A;  3DBA A;  3PTE A;  1F2K A;  1PZP A;  1JWV A;  4BWI A;  3NIA A;  3KX0 X;  5EVI A;  4EW7 A;  3C2W A;  3TJZ C;  1LL9 A;  3EEH A;  3BFE A;  1WYB A;  5KSH A;  1F98 A;  4HP4 A;  4QWO A;  1PI5 A;  2VLG A;  2JC7 A;  3TOI A;  2HV1 A;  1LL8 A;  3VP2 A;  3E4Q A;  1EI5 A;  1K56 D;  2O0Y A;  2XFS A;  1N9N A;  2DRW A;  4EBP A;  4WL9 A;  1K55 A;  1U60 A;  1LSX A;  2V1Z A;  1PNE A;  3DTM A;  3S7O A;  3AGF A;  5EVL A;  1PW1 A;  3HLD A;  1KVM A;  4LRX C;  4LCL A;  3W4Q A;  4GB7 A;  2W3D A;  2Y4A A;  3LI8 A;  3CPT A;  5GLA A;  1PZO A;  5FA7 A;  4JF4 A;  4H6J A;  4X68 A;  3MXQ A;  4UEY A;  3TW8 A;  2GX5 A;  1GSX A;  4OON A;  4HJ3 A;  5FQ9 A;  4G3V A;  2V0W A;  4EBL A;  1J9M A;  3QP6 A;  3KYQ A;  3HUM A;  5A90 A;  1SCW A;  1NYM A;  5EPH A;  5A8B A;  5FEG A;  4HHD A;  3U2A A;  2R78 A;  1Z09 A;  2XEP A;  4R4S A;  4S2J A;  4PM6 A;  1W7F A;  5GLB A;  1S1Y A;  4RX3 A;  3SS5 A;  3C7V A;  4LCM A;  3T1X A;  2ZC7 A;  2LB5 A;  5CED A;  4PM5 A;  2VKS A;  4BQM A;  5CRF A;  1YQS A;  1FOF A;  2WGV A;  4R38 A;  1IYS A;  5IT5 A;  4IVK A;  3F1O B;  3PHY A;  3P7N A;  4Q0H A;  3LY3 A;  1TEM A;  4I39 A;  2HZ5 A;  3T4Q A;  1G28 A;  4O8G A;  1JVJ A;  4JF5 A;  1Q2Q A;  5AQA A;  3ZNY A;  4UQI M;  4WLA A;  4DXB A;  3T4O A;  2K7S A;  3ZQ5 A;  4I38 A;  1GSW A;  3G31 A;  1HD8 A;  3UDX A;  4WF0 A;  4MEZ A;  5G4Y A;  4FSF A;  5TGF A;  2V8C A;  3IX4 A;  1ZG6 A;  3W2Z A;  5J4E A;  3P09 A;  2J3T C;  3TE8 A;  1SDE A;  1HVB A;  5HPI A;  3Q82 A;  4X55 A;  5EOE A;  4BMW A;  1WA9 A;  2WZX A;  1AXB A;  3UE6 A;  4OQG A;  2Y2G A;  4R3J A;  4OH0 A;  4ZJ3 A;  1DJA A;  3KSG A;  4L0L A;  3IX8 A;  1W8Q A;  3UY6 A;  4GOG A;  2J3W A;  5FAP A;  4EEP A;  2O9A A;  1G5U A;  3RJU A;  3Q81 A;  4GD8 A;  4NKP A;  2QJ5 A;  2Y2J A;  3NOP C;  2A3U A;  5DFX A;  2HDQ A;  3UB7 A;  4E04 A;  1PIO A;  1K25 A;  4JGP A;  3U4L P;  4MBK A;  1PRQ A;  2WKR A;  4LRZ E;  3KO6 A;  4EWF A;  3MMH A;  3ZHH A;  1XJ2 A;  3S1Y A;  1ZKJ A;  3K3D A;  1TDL A;  3ZVW A;  3HCY A;  5G4Z A;  2L0W A;  3AGD A;  4DJ3 A;  5CHU A;  3PBR A;  1HLU P;  1KE0 A;  3DTE A;  4CLC E;  3OCN A;  3PBQ A;  3MS6 A;  2E8J A;  1P97 A;  1SKF A;  3O86 A;  5DTS A;  4GDB A;  4JXS A;  3V5M A;  1S66 L;  2PU2 A;  4E3O A;  5K5B A;  2Z2M B;  3UN7 A;  4F94 A;  4R3B A;  3AGE A;  5EVI D;  4NXE A;  2OLV A;  1LSV A;  2VV6 A;  1TDG A;  1OTB A;  1YM1 A;  2Y2I A;  2OOL A;  4ZDX A;  2QPN A;  4IJG A;  5FI2 A;  3LR3 A;  2QYB A;  3M6H A;  1MWS A;  4BBT A;  3GVB A;  3LIF A;  1C3B A;  1ONH A;  1JWZ A; 
#chains in the Genus database with same CATH homology
 2PR6 A;  4ME4 A;  3H7W A;  3EQV A;  1T1C A;  3NHQ A;  5IU1 A;  4WEJ A;  4MN7 A;  3UB6 A;  1YAX A;  4HI4 A;  5KIZ A;  2YKF A;  2JKT M;  3NJA A;  3T4K A;  2W0N A;  2M7U A;  3P01 A;  4ARZ B;  4O01 A;  4QPR A;  3CAX A;  4IUH A;  4Y2F A;  2B18 A;  5DJU A;  2HGV A;  3CUE A;  5CX7 A;  4R3A A;  3F1N A;  3ZYT A;  3IBJ A;  2HF6 A;  3CLO A;  3F1N B;  2A24 A;  4G3W A;  4RQ9 A;  2NUT C;  3FPV A;  2DMW A;  4HIA A;  2I9V A;  3CWF A;  1VB6 A;  1XFN A;  4GS9 A;  1XJ4 A;  4EUV A;  5F69 A;  2D01 A;  4CLC D;  4L9F A;  1NRJ A;  2JKT I;  3E4O A;  3RH8 B;  2KX6 A;  5F5Y A;  1ODV A;  3BY8 A;  5HDS A;  3VE4 A;  4G3K A;  2KDK A;  1OTE A;  3MF0 A;  4Y5F A;  1OT9 A;  2PD7 A;  1G6O A;  4HH3 A;  3VE3 A;  1IOU A;  4B93 A;  1YSQ A;  4JGQ A;  2PHY A;  3C30 A;  3OCL A;  2INW A;  3A0V A;  4F3L A;  4AFI A;  4HJ4 A;  1LT0 A;  4NXB A;  3UB9 A;  3MQQ A;  1X0O A;  3CI6 A;  2OAQ 1;  2P7J A;  3T4T A;  3PBS A;  2PR5 A;  3D3O A;  4BBV A;  3CIT A;  4GHI A;  4EES A;  4I3A A;  3A0S A;  3UMD A;  5HDC A;  1UWP X;  4XT2 A;  3B47 A;  3E0Y A;  4OOL A;  3RFB A;  2ZMV A;  5HD5 A;  2V1B A;  2P04 A;  5HL6 A;  2VX8 A;  4L9E A;  4LLO B;  3MFX A;  3LR5 A;  3JVV A;  4Q0J A;  5HWW A;  3EGX C;  2W3F A;  4IUK A;  2W3H A;  5L8M A;  5EFW A;  3VOL A;  2WKQ A;  4PKY A;  3BW6 A;  5TJJ A;  3A0R A;  1MKM A;  1P9R A;  4YWZ A;  4EER A;  3B42 A;  2GJ3 A;  2QKP A;  1OTA A;  3LIC A;  1V9Z A;  4ZRR A;  2O99 A;  4Z1W A;  2L1M A;  5AJG A;  5FL3 A;  4FOF A;  1MC0 A;  3DBA A;  3BQA A;  1GSV A;  3HJI A;  5HD3 A;  4HOI A;  2Y79 A;  4L9G A;  3S7N A;  1P0Z A;  1TS0 A;  3BWL A;  4I3I A;  2VZW A;  2K2N A;  2GZA A;  1UGU A;  5AVF A;  4CQH A;  4P6Z S;  4BWI A;  5TBM B;  3OLO A;  3KX0 X;  4EW7 A;  1DP8 A;  3C2W A;  4PHT A;  2FH5 A;  1Y28 A;  3TJZ C;  3EEH A;  5KSH A;  2QWS A;  1F98 A;  4IHQ A;  1OJG A;  4HP4 A;  4MMN A;  3BY9 A;  2VLG A;  3H7W B;  2EWW A;  2HV1 A;  2W1R A;  1LL8 A;  3EOI A;  3HJK A;  2VA0 A;  5C5K A;  3E4Q A;  2BAS A;  3B33 A;  2O0Y A;  3OC2 A;  1N9N A;  1S1Z A;  4WEL A;  4WL9 A;  3R4K A;  3K3C A;  3S7Q A;  1LSX A;  2CMN A;  4YNR A;  4MCW A;  3EQU A;  2JKR M;  3S7O A;  2Z6D A;  1OPX A;  5DJT A;  1F9I A;  2K31 A;  1TS7 A;  2FZ0 A;  5DKL A;  2L4R A;  2A24 B;  1XJ6 A;  4LRX C;  3LID A;  1IFQ A;  4MN5 A;  1NWZ A;  5J3W A;  5HDD A;  2ZBB A;  3PR6 A;  2W3D A;  3LI8 A;  4KUO A;  2PYR A;  2ZOI A;  4GS9 B;  3EEA A;  4OOM A;  2M1C A;  3T50 A;  4H6J A;  4NXF A;  4P6Z M;  3FC7 A;  3TRC A;  1TF1 A;  3MXQ A;  2J80 A;  4UEY A;  3IS2 A;  3TW8 A;  4WEK A;  3RTY A;  2JKR I;  3K2N A;  1DP9 A;  2GX5 A;  1GSX A;  3LIB A;  1TD5 A;  4HJ3 A;  3PBO A;  2B02 A;  4CLC A;  4G3V A;  2V0W A;  1DP6 A;  4MN6 A;  4F3L B;  1UWN X;  5HWV A;  3R7W A;  4UQI S;  3KYQ A;  4B9O A;  2Z6C A;  3LI9 A;  2OWJ A;  4GHI B;  5A8B A;  4XT2 B;  4HHD A;  3U2A A;  3EGD C;  2R78 A;  4R70 A;  4WUJ A;  2PT7 A;  2PD8 A;  3KSF A;  5DFY A;  1S4R A;  3OBF A;  4BJP A;  1OT6 A;  3H82 A;  2V9A A;  3JVU A;  2XA7 S;  3H82 B;  4HQA A;  1S1Y A;  2Y8H A;  1P9W A;  4II7 A;  4BBU A;  3PBT A;  1T1B A;  2YKH A;  4GJ4 A;  3IBR A;  3CUE C;  2W3E A;  1KOU A;  2M7V A;  2LB5 A;  1OTI A;  2VKS A;  3PYP A;  4PKY G;  4I5S A;  3LFV A;  3F1P A;  2VV8 A;  2W1T A;  4R38 A;  3UME A;  3F1O A;  2V0U A;  2W1T B;  5IT5 A;  3F1O B;  3PHY A;  4JGO A;  4KQD A;  3P7N A;  4Q0H A;  2G7U A;  2W27 A;  3LUQ A;  4I39 A;  3T4Q A;  1G28 A;  2XRN A;  4O8G A;  3E98 A;  3LIE A;  3MJQ A;  2O9C A;  4UQI M;  1N9L A;  4Y3I A;  4WLA A;  4I3J A;  3T4O A;  3BQ8 A;  4YOF A;  3UB8 A;  2GNX A;  2K7S A;  3MQO A;  3ZQ5 A;  3SW1 A;  3C8C A;  4I38 A;  2W3G A;  1V9Y A;  1H3Q A;  1S4S A;  1GSW A;  3LR0 A;  2LB9 A;  4WF0 A;  3FPW A;  1JNU A;  2JN7 A;  3MQ0 A;  5G4Y A;  4FSF A;  3D72 A;  5J7E A;  2XA7 M;  4EU0 A;  1D06 A;  3W2Z A;  5J4E A;  2J3T C;  3TE8 A;  5F6A A;  3NOU C;  3S7P A;  3UE3 A;  1STZ A;  5HPI A;  5HSQ A;  2QHK A;  2OWH A;  5DF9 A;  2HJ9 C;  2VEA A;  4BMW A;  4HH2 A;  2EA9 A;  1WA9 A;  3BJN A;  5MC7 A;  4MDZ A;  3GDI A;  1ZTU A;  3UE6 A;  4ARZ A;  4ETZ A;  2HJE A;  3G6O A;  4NEE D;  4DMZ A;  1S67 L;  4KQO A;  4GCZ A;  2KOI A;  3KSG A;  5HZH A;  3EWK A;  2VGL S;  4DJ2 A;  3PXP A;  4L0L A;  3PBN A;  4H6J B;  2J3W A;  4Q0I A;  2KLI A;  2VJW A;  3MR0 A;  4HJ6 A;  2VV7 A;  1YSP A;  4EEP A;  2O9A A;  4GLQ A;  1F5M A;  3IS2 B;  2MJ6 A;  2A2L A;  2XSS A;  4R6L A;  3LR4 A;  2OAP 1;  4NKP A;  2QJ5 A;  2NUP C;  3LIA A;  4CLC B;  3NOP C;  4JGR A;  2WKP A;  4HY8 A;  5DFX A;  1XFQ A;  3UB7 A;  4E04 A;  3GEC A;  4JGP A;  2P08 A;  1ZHH B;  2WKR A;  4LRZ E;  3R7W B;  3KO6 A;  1H8M A;  3ICY A;  4WN5 A;  5DKK A;  1LSW A;  3OOV A;  3MMH A;  3O5Y A;  1XJ2 A;  4LRY C;  2JHE A;  2J3T D;  4EQ1 A;  2PYP A;  1XJ3 A;  3K3D A;  4GW9 A;  2ZMF A;  4HNB A;  4M4X A;  1EW0 A;  3HCY A;  5G4Z A;  2L0W A;  3NOT C;  1BYW A;  3ULF A;  4EEU A;  5IS1 A;  2D02 A;  4DJ3 A;  3PBR A;  3E4P A;  5HPF A;  1TS6 A;  3KSI A;  1YKD A;  1T1A A;  1D7E A;  1NLZ A;  2VGL M;  4CLC E;  3OCN A;  3VV4 A;  1VHM A;  3PBQ A;  4O0P A;  2EWV A;  5LBR A;  1P97 A;  4KUK A;  5F68 A;  1DRM A;  3C38 A;  1W63 Q;  2PDR A;  4EXO A;  3T4J A;  2IA2 A;  3F1P B;  4ETX A;  2XRO A;  3V67 A;  1S66 L;  4K08 A;  3H9W A;  5K5B A;  1TS8 A;  2ZOH A;  3FG8 A;  3T4S A;  5I5L A;  4NXE A;  1LSV A;  2VV6 A;  1OTB A;  4DN0 A;  3KSH A;  2OOL A;  1OJ5 A;  4LPZ A;  1NLY A;  1OTD A;  4IJG A;  3LR3 A;  2V1A A;  2QYB A;  4PAU A;  1MZU A;  4HP9 A;  4CLC C;  1T18 A;  2O9B A;  5HWT A;  3KYZ A;  5TBM A;  4EET B;  1W63 M;  4BBT A;  2H28 A;  2QJ7 A;  3LIF A;  1T19 A;  1N9O A;  5AVE A;  3T4L A;  3LYX A;  4NXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...