5HFOA

Crystal structure of oxa-232 beta-lactamase
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
243
structure length
242
Chain Sequence
EWQENKSWNAHFTEHKSQGVVVLWNENKQQGFTNNLKRANQAFLPASTFIPNSLIALDLGVVKDEHQVFKWDGQTRDIAAWNRDHDLITAMKYSVVPVYQEFARQIGEARMSKMLHAFDYGNEDISGNVDSFWLDGGIRISATQQIAFLRKLYHNKLHVSERSQRIVKQAMLTEANGDYIIRAKTGYSTSIEPKIGWWVGWVELDDNVWFFAMNMDMPTSDGLGLRQAITKEVLKQEKIIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title CRYSTAL STRUCTURE OF OXA-232 BETA-LACTAMASE at 2.21 Angstroms
rcsb
source organism Escherichia coli
total genus 85
structure length 242
sequence length 243
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5hfoA00
5HFOA 3PTEA 1ZKJA 5DF9A 1FCMA 2ZC4B 2XF3A 1XA7A 4XUXA 2EX6A 5AQBA 2Y2IA 5A92A 4WBGA 1ES2A 4FH2A 1GHIA 1DJCA 1YT4A 4HESA 1FOFA 3OCNA 1IYQA 5KMWA 2ZM0A 1LL9A 3IXDA 3UDXA 3V5MA 1KE4A 4R23A 3VP3A 3ZNYA 3AGEA 1LL5A 2HPBA 4GD6A 2G2UA 4UA9A 4KG5A 4QY6A 3IXBA 3HUOA 4EUZA 1M6KA 2Y55A 3LCEA 3ZFZA 4PM5A 3P09A 1K38A 1YMSA 1XGJA 3HLGA 3VP0A 4EQIA 2EXAA 5EVLA 3Q7ZA 1RCJA 3BECA 4OH0A 4QY5A 2X01A 1IEMA 2J8YA 2ZQ7A 3ZG7B 3UNWA 4HBTA 4N1XA 3FYZA 1XA1A 2WYXA 1XX2A 3AGFA 3PBNA 4N92A 3NI9A 5EE8A 4DKIA 3VSLA 5CHMA 1XKZA 2WAFA 3ITAA 3A3JA 3BFCA 1DJAA 1JWZA 1O7EA 1AXBA 1GHMA 1J9MA 2BG1A 3C7VA 4Z9QA 2H10A 3C7UA 4OP5A 5D3OA 3B3XA 3N6IA 4C75A 1FQGA 3SS4A 4Y0TA 3HBRA 2Y4AA 2HP6A 2HP5A 4H8RA 3BEBA 4GD8A 4B88A 1K4EA 4UHUA 3VOZA 5FAPA 5FQ9A 3UE1A 3WS5A 2EX8A 3DW0A 4QU3A 4A5RA 1MBLA 4E3MA 4OQHA 5CGWA 2WGVA 1ZG6A 2WUQA 2XH9A 1O07A 4C6YA 4KZ8A 4OONA 4LV3A 4R1GA 3OPHA 5HX9A 1PYYA 3N7WA 1RGZA 4KZ4A 4OLGA 5M19A 3N8RA 4DE1A 1EROA 1NZOA 5CRFA 4KZAA 2H0YA 2ZQCA 4JXGA 4S2KA 1PWCA 2EX2A 1K55C 1K6RA 1PI4A 4ZJ1A 3V50A 4GOGA 3E2LA 4BD0A 1DJBA 4ZBEA 1NYYA 5EVIC 1K56A 3IHAA 4BL3A 3SH9A 3UY6A 3BFEA 2A3UA 2EFXA 1WYBA 4OPRA 1LI0A 5AQ9A 3UPOA 5EUAA 5GLBA 4QD4A 4PM7A 3QNBA 3W8KA 3ZG0A 3FKWA 3PAGA 4R3JA 3HL9A 1W8YA 2Y2JA 2I72A 2P9VB 5A93A 3OPPA 1E25A 5GLAA 1YLTA 3PBSA 3MXRA 4CJNA 4S2NA 3LEZA 4JBFA 4X55A 1HZOA 2J9PA 1JTGA 3IF5A 5EOEA 4OPYA 2WZZA 1EWZA 3UDIA 3HLFA 5GHZA 3G30A 1FCNA 4KQQA 4X69A 3UE0A 1XGIA 5GL9A 1E4DA 4FH4A 3VFFA 4K0WA 4HBUA 2JC7A 3O86A 1BT5A 3G34A 4OOLA 3O3VA 3CJMA 3Q82A 2OV5A 4WZ5C 4XUZA 5DTKA 4PM8A 3NC8A 5F83A 2H0TA 2X71A 4FD8A 4UAAA 4OOYA 1N4OA 1YLJA 4E6XA 1KVMA 1SDEA 2V2FF 4PM9A 3WS4A 2ZQDA 3NDGA 4BJPA 5JYPA 4EBPA 3ZCZA 4PMAA 2DNSA 4K91A 3BLMA 4JXSA 4LV0A 4S2IA 3OPLA 1S0WA 2XK1A 2V20A 3GMWA 4YFMA 2ZLYA 3GRJA 5A91A 1I2WA 4JF6A 2R9XA 3UN7A 4EV4A 3VMAA 4IBXA 1PZOA 3W4QA 2DRWA 3QHYA 3V3RA 4WM9A 5IHVA 3GSGA 3C4OA 4S2LA 5FQMA 3S1YA 3HLWA 3GQZA 4B4XA 1K54C 1NRFA 3ZG5A 4ZAMA 1ALQA 4KENB 5EPHA 4HEFA 4JKTA 2IWBA 3VP2A 3BFDA 1L0DA 4RX2A 4PM6A 3V39A 3M6BA 3VSKA 4JF5A 1L0GA 1SCWA 1ZG4A 1TDLA 5JYOA 5CECA 4DE0A 3HLCA 1LI9A 2EFUA 2XDMA 3NIAA 4OPQA 1BUEA 1FSWA 1YQSA 1IKGA 1W8QA 1K57A 1L2SA 2Z2MB 5EVIB 4S2JA 4IVKA 4DXBA 1L0EA 4WMCD 5FI2A 1KE3A 4FSFA 3PBTA 1HVBA 1U60A 2C6WB 3WS1A 1Q2PA 5FAOA 3IHBA 4KG6A 4N9KA 3DWKA 3Q1FA 4QB8A 3SH7A 1YM1A 3PBRA 4RYEA 4GB7A 1Y54A 1BLCA 2B5RA 2HDQA 1KVLA 2JCHA 4BL2A 1VQQA 1ERMA 2ZQ9A 1ESUA 1C3BA 1H5XA 4CPKA 3Q07A 2X02A 4DE3A 2QPNA 2DCFA 3ITBA 3FWLA 2WAEA 3IXHA 1W5DA 3IWOA 1MWTA 2H5SA 3N8SA 1MKIA 3RXXA 1OMEA 1DY6A 3NCKA 2P9VA 4S2OA 3VP1A 3FKVA 4N1HA 4E3KA 5KSCA 1ZC2A 3HUNA 1HD8A 4X53A 5AQAA 3G2ZA 2Y2KA 2WGWB 3G31A 1G68A 1SKFA 2Y2MA 3DWZA 3TOIA 1CK3A 4S2PA 3WRTA 3W4PA 4S2NC 2BLSA 5FATA 1MWSA 4QHCA 4RA7A 5HARA 4JPMA 5CEBA 3IH9A 2RL3A 4LCMA 4IVIA 4NK3A 1FR1A 4X6TA 4E6WA 3ZNTA 3G2YA 1BULA 1K56D 1H8ZA 5FI7A 3V3SA 4JXVA 3S22A 3P98A 2ZM8A 3W4OA 1I2SA 2E8IA 5CEDA 1ONHA 1FR6A 2HP9A 2XD1A 2Q9NA 3QNCA 2EX9A 4KZ5A 2Y91A 2PU4A 2XLNA 3IF6C 2P74A 4OQGA 4WEKA 3BFGA 3M2JA 4WELA 2Y2PA 1I5QA 3SS5A 1SDNA 3MKFA 3UO9A 4E3NA 3CZDA 3HUMA 2ZC5B 4Y0UA 1E3UD 1KDSA 1PW1A 4BLMA 1K6SA 2Y2QA 3VOYA 1JTDA 1H8YA 2ZQ8A 3O87A 3BM6A 4R3BA 4P0MA 1KGEA 2IWDA 3CG5A 3N8LA 2EXBA 4EBNA 2ZJ9A 3OPRA 1RGYA 3G35A 2VGKA 3LY4A 4ZJ3A 5GHYA 5HAPA 5G18A 1SHVA 3UPPA 2OLUA 3NY4A 2FFYA 4KZ9A 1IKIA 1CEFA 5CERA 2A49A 1MWUA 2OSUA 3BLSA 5EOOA 4QJGA 4DXCA 3MFDA 5F1FA 1K55A 3IH8A 5FQKA 3HREA 5FI6A 2HDRA 3OZHA 5CXWA 4E3IA 3Q7VB 1MPLA 3MXSA 1JWPA 1RP5A 5EVIA 3BRMA 5CHUA 1MWRA 2WZXA 5DF7A 4LV2A 2XR0A 3UPNA 3RJUA 1HTZA 5AQ7A 3UE3A 4OQ0A 4C3QA 4MLLA 4DF6A 5A90A 1K57C 4MNRA 4U0XA 4UA7A 5M18A 4IBRA 4MEZA 5TFQA 1NJ4A 3A3IA 3N4IA 4GN2A 1BTLA 1G6AA 5CGXA 5FQJA 5FA7A 1KDWA 5GHXA 4L0LA 3I7JA 1QMFA 4YINA 3SH8A 4WYYA 4OKPA 3GR2A 1PIOA 3PAEA 3IT9A 1PWDA 5HAQA 5M1AA 4DRTA 5FQIA 2VGJA 1WYCA 1LLBA 5CTNA 2WGWA 2Y2LA 3M6HA 4P87A 2IWCA 4OLDA 2JBFA 4JXWA 4MBFA 5E43A 4F94A 1YLPA 3MZEA 3IWIA 1JVJA 5EECA 3EQUA 4ZTKA 3EQVA 2WKIA 4ZJ2A 4GZBA 3SS3A 4WZ5A 3OC2A 3NDEA 2G2WA 3C5AA 1ESIA 3FZCA 4E3OA 4UA6A 2J9OA 4KZ7A 1MY8A 2RCXA 5F1GA 4O7DA 3A3FA 1N9BA 5KSHA 1GA9A 1IYPA 5I94A 2GDNA 2ZM2A 3IF6B 4R0QA 3WRZA 1K25A 2QZ6A 2WKEA 3G4PA 3RXWA 5TR7A 3SOIA 1CI8A 4KZ3A 5E2GA 2PU2A 3ZHHA 1TVFA 4LV1A 3FV7A 4RX3A 2V1ZA 5CTMA 4LCLA 4DDYA 4OOMA 4DE2A 4WMCA 3LO7A 2R9WA 1GHPA 1KGFA 3O88A 5E2EA 1KE0A 3IXGA 4GKUA 1IYOA 1ES5A 4ID4A 3HLEA 2ZMAA 5FASA 3LY3A 5J8XA 4MBHA 1K54A 1BZAA 3Q81A 2Q9MA 4P6BA 1GA0A 5HW3A 3MKEA 2FFFB 1M40A 5DTSA 2XFTA 2Y2HA 3PBQA 4LENA 1ONGA 1FSYA 3ZG8B 3BYDA 5CGSA 4MBKA 2WGIA 5GLDA 1NXYA 4DDSA 2XEPA 3ZDJA 5E2HA 3HVFA 1NY0A 2WADA 4GNUA 5BOHA 1TDGA 5DTTA 4U0TA 5DF8A 1PWGA 1W7FA 1BLPA 3TSGA 2XFSA 5TGFA 1S6RA 4R4SA 5DVAA 4X68A 5E2FA 1K4FA 3Q7VA 5HAIA 4K0XA 2WKHA 5KZHA 5CHJA 1BSGA 2ZD8A 4BENA 4ZDXA 3GV9A 3GTCA 2XQZA 1VM1A 3PBOA 4P85A 4Y0OA 1PW8A 4WZ4A 4JLFA 1IYSA 2Y2NA 1L0FA 4GDBA 2C5WB 3D4FA 3A3EA 1ERQA 3MBZA 4S2MA 4OP8A 2Z2LB 4OVDA 4BD1A 4R4RA 3ZVTA 3IQAA 3JYIA 2JE5A 1JWVA 1EI5A 2ZC3B 1KGGA 3E2KA 4E3LA 4JF4A 3ZG9B 2QMIA 3ZVWA 1W79A 1GCEA 2XGNA 4KQOA 2WK0A 1BLHA 2Y2OA 3NBLA 4OQIA 4PPRA 4B4ZA 3HLBA 4XXRA 3UDFA 4KG2A 1CI9A 1E3UA 3BFFA 1QMEA 4EBLA 1TEMA 4E3JA 2HDSA 2J7VA 3CMZA 4U3TA 4RVAA 4X56A 4KZBA 5EVID 1IELA 2ZC6B 4M3KA 1YLYA 3WS2A 1XP4A 5L2FA 1Q2QA 2Y59A 1XPBA 3AGDA 1PZPA 3M2KA 5GLCA 4N9LA 4EWFA 1YLWA 1FCOA 3WS0A 3IWQA 4KQRA 3DTMA 3VP4A 2PBYA 3GVBA 5FSRA 3HLDA 1YLZA 2ZC7A 4GDNA 4Q8IA 3VFHA 3IF6A 1YMXA 3S4XA 1ES4A 5FAQA 2ZQAA 1NZUA 1BLSA 1NYMA 2OLVA 2XD5A 1PI5A 3MZDA 4OPZA 3C4PA 3ISGA 1LHYA 2HDUA 5FDHA 2CC1A 1MXOA 4FCFA 4WEJA 3WWXA 4IEDA 5U47A 3TG9A 4BQMA 5FQQA 1WE4A 3A3DA 3OCLA 4KZ6A 5HL1A 2Y2GA 3MZFA 5F82A 1CEGA 4D2OA 1Z6FA 3G32A 3ZGAB 2UWXA 1ES3A 4NETA 1XXMA 4Y7PA
chains in the Genus database with same CATH superfamily
1ZKJA 5AQBA 2EX6A 2Y2IA 1DJCA 4HESA 1FOFA 5KMWA 1LL9A 5HD3A 3H7WA 3VP3A 2PR6A 3DAVA 4UA9A 4GD6A 2G2UA 5DKKA 1DP8A 3HUOA 1M6KA 3LCEA 4PM5A 1K38A 3GECA 3LIAA 4EQIA 5HZHA 2J8YA 2ZQ7A 3BWLA 4N1XA 2WYXA 1XX2A 2HJ9C 1TS8A 3FPVA 1KOUA 1DJAA 4R3AA 1AXBA 1EW0A 2WKRA 3SS4A 4Y0TA 5EVEA 2HP6A 3PYPA 3A0SA 1YSQA 4UHUA 3VOZA 4L9GA 3DW0A 4OQHA 2WGVA 4HJ6A 2WUQA 2XH9A 2HF6A 1RGZA 4OLGA 3T1RA 3LGOA 3LYXA 4S2KA 1PWCA 1K6RA 1PI4A 3PXPA 4H6JB 4LGWA 4BL3A 3RTYA 3SH9A 2EFXA 1LI0A 5AQ9A 1OT6A 3W8KA 3ZG0A 4EERA 2E8JA 2ZBBA 3PAGA 5A93A 1W63M 1G6OA 1YLTA 3LICA 4JBFA 4X55A 4LLOB 4E04A 5GL9A 1E4DA 4HBUA 2J3TD 2V8FA 4P6ZS 4OOLA 3ZQ5A 2OV5A 3BW6A 1OTIA 2ZOIA 5L09A 4OOYA 1YLJA 1CQAA 4PM9A 3E4QA 4Z1WA 1STZA 2DNSA 4JXSA 4S2IA 2V20A 4YFMA 3GRJA 4JF6A 2R9XA 3VMAA 3QHYA 5F5YA 3GSGA 3C4OA 4B4XA 2QJ5A 3GQZA 3HLWA 3CITA 3ZG5A 4JKTA 2VKSA 3CUEA 5JYOA 1LI9A 3NIAA 4OPQA 1AWIA 1L2SA 2Z2MB 2V1BA 4DXBA 1L0EA 5FI2A 1HVBA 2C6WB 3H9WA 3WS1A 4QB8A 1YM1A 3B42A 1G28A 3F1NB 2W27A 2B02A 1H5XA 2QPNA 2DCFA 3IXHA 2P04A 2NUPC 2P9VA 3FKVA 5HDDA 1V9ZA 5AQAA 4X53A 1G68A 1SKFA 3DWZA 4MN6A 4HQAA 3W4PA 4GS9B 5HARA 4EETB 5CEBA 3IH9A 4IVIA 4NK3A 3QP5A 1K56D 5FI7A 4JXVA 1I2SA 2E8IA 5CEDA 2HP9A 2EX9A 4KZ5A 3BFGA 3M2JA 1I5QA 3SS5A 3L7HA 1J3WA 5G4ZA 4BLMA 2OAQ1 3NOPC 1K6SA 2Y2QA 2ZQ8A 1XFQA 3LI8A 2ZJ9A 3G35A 3LY4A 5GHYA 3UPPA 1H8MA 4KZ9A 5EOOA 4QJGA 4NG2A 5F1FA 2CMNA 2P08A 1VETB 2HDRA 3Q7VB 3CUEC 1JWPA 1RP5A 3CLOA 2VZWA 2L0WA 5EVIA 5IT5A 5CHUA 1MWRA 3QP2A 4I39A 5AQ7A 4UA7A 3PR6A 4CLCB 2VJWA 4HHDA 1G6AA 5CGXA 5FA7A 4L0LA 2BTFP 3UB7A 4YINA 3MJQA 3PAEA 3IT9A 1OTEA 2W3HA 2Q0OA 2VGJA 1WYCA 1LLBA 2IWCA 4OLDA 3EGXC 3MZEA 4ZTKA 5IU1A 3SS3A 4NKPA 2G2WA 3C5AA 1N9BA 4II7A 1GA9A 2GDNA 1BYWA 4B9OA 1K25A 3KYEA 2WKEA 5TR7A 3SOIA 1ZHHB 4XT2A 4LV1A 1NWZA 5KIZA 2V1ZA 4LCLA 4OOMA 3LEQA 4WMCA 2R9WA 1N9OA 1KE0A 4GKUA 4CQHA 1ES5A 4ID4A 3CHWP 4MBHA 1K54A 1H0MA 2NUTC 5DTSA 2Y2HA 3ZG8B 3C8CA 5CGSA 2WGIA 1L3LA 3SW1A 2XRNA 3ZDJA 3HVFA 1NY0A 4GNUA 4PHTA 3LIBA 3TSGA 3SZTA 1S6RA 4R4SA 4X68A 5E2FA 4GW9A 5KZHA 5CHJA 4LFUA 3GTCA 4Q0IA 4Y0OA 3F1PB 4JLFA 3KYZA 2W3GA 1ERQA 1DRMA 4BD1A 4R4RA 1YKDA 3IQAA 2W1TA 2JE5A 4G3KA 4LPZA 4DN0A 2PBDP 1W79A 1ZTUA 4WUJA 1BLHA 3HLBA 3D3OA 2M1CA 3R4KA 3EOIA 4YNRA 4X56A 4KZBA 3WS2A 1YLYA 2Y59A 2LB9A 3M2KA 4HIAA 4N9LA 1FCOA 3IWQA 2ZC7A 3EGDC 3DTKA 4GDNA 3IF6A 3QP1A 2ZQAA 3EEHA 1OJGA 3MZDA 2VV7A 3IS2A 1LHYA 1OJ5A 3TG9A 2VK3A 3E4PA 3A3DA 1VB6A 3IX4A 2Y2GA 3LFVA 3MZFA 1Z6FA 5DF9A 4XUXA 1ES2A 1GHIA 3QP4A 3IXDA 3UDXA 3ZNYA 4EUZA 3VP0A 1YMSA 1GSXA 2ZL1A 2EXAA 5EVLA 4QY5A 3UNWA 3MR0A 4EEUA 3FYZA 3AGFA 3VSLA 4LRYC 4DJ3A 2WAFA 3A3JA 3BFCA 4N9KA 2O99A 1D1JA 4OP5A 5D3OA 3N6IA 1FQGA 2I9VA 4EESA 3ICYA 4B88A 5FAPA 2VX8A 2EX8A 4QU3A 4A5RA 5CGWA 4GJ4A 1O07A 4C6YA 4OONA 4R1GA 3OPHA 2GX5A 3KX0X 2V1AA 2YKHA 3RFBA 3W2ZA 3HCYA 2H0YA 2ZQCA 2EX2A 1K55C 4ZJ1A 4BBUA 1DJBA 1S67L 1K56A 1XJ2A 3T4JA 1ACFA 4P6ZM 2J3TC 3H82B 3OOVA 3MQOA 4ARZB 4PM7A 3QNBA 3FKWA 3HL9A 3T4TA 5L07A 2Y2JA 3B47A 2I72A 2R78A 5GLAA 5L10A 4MN7A 1HZOA 1JTGA 2WZZA 1EWZA 3UDIA 4I3AA 3G30A 5FEGA 4KQQA 2PYPA 2QYBA 3KSIA 3VFFA 4K0WA 3G34A 5HSQA 3O3VA 2W3EA 3CJMA 2QWSA 5DTKA 5F83A 2X71A 3NDGA 4UQIS 3CI6A 2FZ0A 4LV0A 2ZLYA 4JGRA 3JVVA 5A91A 4EV4A 3W4QA 4S2LA 4HJ3A 5FQMA 3S1YA 5G4YA 4Y5FA 1L0DA 4HOIA 1SCWA 1ZG4A 1TDLA 5CECA 3HLCA 5HDSA 2JKTI 1IKGA 4WMCD 4HNBA 3SH7A 4RYEA 4GB7A 4PAUA 2HDQA 1WA9A 5IS1A 4HJ4A 4GHIB 5EM1A 3ITBA 4F3LB 4EW7A 1OMEA 3VP1A 4E3KA 3NULA 5KSCA 3CAXA 3TW8A 3HUNA 1T1BA 2JN7A 1FIKA 3G31A 3WRTA 1T19A 2XA7S 1OPXA 4WF0A 2RL3A 2VGLS 2LB5A 3MXQA 2OWHA 3V3SA 4G3WA 5DJUA 2ZM8A 3CPTA 3RH8B 2K31A 2PD8A 1VETA 1FR6A 5FL3A 2XD1A 2Q9NA 3QNCA 2Y91A 2PU4A 2XLNA 2P74A 3E4OA 2V9AA 1DP6A 4Y15A 1KDSA 1JTDA 3ZYTA 4R3BA 4P0MA 1Z09A 5HPIA 3CG5A 4ZJ3A 4L9EA 5HAPA 3A0VA 5G18A 3NY4A 3S7NA 5CERA 2A49A 1G5UA 4RQ9A 2FH5A 4R70A 5FQKA 3IH8A 5HWVA 4LV2A 4FOFA 3K3CA 4KUOA 2A24A 2JKRI 4GN2A 1BTLA 1SKOB 4HH3A 1QMFA 3SH8A 4WYYA 1LL8A 1S1YA 2HZ5A 3GR2A 2XROA 5DKLA 1PIOA 5HAQA 4DRTA 3F1OB 5CTNA 2WGWA 3M6HA 4P87A 4MBFA 5E43A 4F94A 3T1XA 4YOFA 1JVJA 3MS6A 3EQVA 4GZBA 4WZ5A 4KZ7A 5F1GA 4I5SA 2JKGA 2ZM2A 4R0QA 3NOUC 2QZ6A 3RXWA 1CI8A 5E2GA 2PU2A 3NECA 1P9RA 4RX3A 4O0PA 4DE2A 3LO7A 5E2EA 4HP9A 3F1PA 3LY3A 2P7JA 1BZAA 2JKRM 2Q9MA 4O01A 1NLYA 3MKEA 1GSVA 2XFTA 3C38A 4LENA 1ONGA 3P7NA 4EXOA 5DTTA 1LSXA 1UWNX 1PWGA 3H7WB 1W7FA 3NJAA 1VHMA 2UV0E 4DMZA 4ZDXA 3GV9A 3PBOA 2PR5A 2Y2NA 4X25A 3LUQA 4OP8A 3ZVTA 3JYIA 1JWVA 4R38A 1KGGA 4E3LA 4JF4A 3ZG9B 2Y79A 1YSPA 4I3JA 2Y2OA 4CLCE 4B4ZA 4KG2A 3BY8A 2V8CA 1E3UA 3BFFA 5TJJA 4EBLA 1TEMA 2PT7A 4U3TA 3KSGA 4RVAA 1IELA 2ZC6B 1V9YA 1XPBA 3U2AA 5L8MA 4KQRA 3VP4A 3JPUA 5AVFA 3GVBA 1YLZA 5DJTA 1BLSA 4DJ2A 1NYMA 2XD5A 4OPZA 1YAXA 3LR4A 3ZGAB 4EU0A 2UWXA 1OT9A 2O9CA 1ES3A 5EECA 5TGFA 4Y7PA 5HFOA 1YPRA 2XF3A 5K5BA 4WBGA 4FH2A 3OCNA 1IYQA 5HWTA 2ZM0A 1KE4A 4R23A 2EWVA 3AGEA 4KG5A 3FPWA 4QY6A 5MC7A 3ZFZA 5DFXA 3HLGA 1RCJA 1P97A 3ZG7B 1LSVA 4IJGA 2VLGA 4HBTA 3D9YA 3MSHA 3PBNA 4DKIA 3NI9A 2HV1A 1JWZA 1O7EA 1GHMA 3LIFA 3C7VA 2BG1A 2H10A 4C75A 3HBRA 2HP5A 1K4EA 5FQ9A 3WS5A 4E3MA 2W1RA 3BY9A 4KZ8A 5HX9A 1PYYA 4KZ4A 5M19A 4DE1A 1EROA 3TE8A 4KZAA 1N9NA 3V50A 4HP4A 2IA2A 4IHQA 2EA9A 4ZBEA 1NYYA 5EVIC 4CLCD 3T4KA 3IHAA 2A3UA 1NRJA 2J3WA 2B18A 1VEUB 5EUAA 4I3IA 3VE3A 1W8YA 1TD5A 3L9KA 2P9VB 4UQIM 3PBSA 2JKFA 5EOEA 1S4SA 5TBMA 4M4XA 1FCNA 1S4RA 1XGIA 3UE6A 3S7QA 2M7VA 1XJ4A 3O86A 1BT5A 3T4OA 4BWIA 3Q82A 4PM8A 2H0TA 4UAAA 1N4OA 2V2FF 3G6OA 3WS4A 5JYPA 4EBPA 3ZCZA 3BLMA 1I2WA 5HWWA 3UN7A 1PZOA 2DRWA 1FILA 4WM9A 5IHVA 3KYQA 5HPFA 4F3LA 1K54C 3PHYA 4ZAMA 1ALQA 4KUKA 1DP9A 3MMHA 3V39A 4HI4A 4DE0A 2EFUA 3CWFA 2QKPA 1BUEA 1FSWA 1W8QA 1T18A 4KQDA 5J7EA 2QJ7A 5EVIB 3V67A 3VE4A 3VOLA 4HH2A 1U60A 5HL6A 3DTIA 1Q2PA 5FAOA 3IHBA 3KSFA 4H6JA 3DWKA 4KG6A 4MCWA 2XA7M 1MKMA 4JGQA 2ZOHA 2VGLM 2JCHA 4BL2A 1VQQA 2ZQ9A 1ESUA 1C3BA 3Q07A 2X02A 1TF1A 3FWLA 2WAEA 3IWOA 3N8SA 1MKIA 3RXXA 2VV6A 1DY6A 3NCKA 1HD8A 1LSWA 2Y2KA 3OBFA 4NXGA 2KDKA 1CK3A 3C2WA 2AVXA 2QHKA 1MWSA 4QHCA 4RA7A 4LCMA 4X6TA 4E6WA 3QP6A 3ZNTA 3G2YA 1H8ZA 4QWOA 3S22A 3W4OA 1ONHA 3BQAA 1CJFA 4ETZA 4XT2B 3IF6C 4OQGA 4WEKA 2V0WA 4G3VA 2Y2PA 3MKFA 2PRFA 3UO9A 3HUMA 2ZC5B 4Y0UA 1E3UD 1PW1A 3VOYA 1H8YA 3O87A 3BM6A 2IWDA 4MDZA 3N8LA 4X1LA 3OPRA 1RGYA 4NXEA 1SHVA 2FFYA 1CEFA 2O0YA 3LR0A 2JHEA 4EQ1A 3MFDA 5CXWA 1H3QA 3LI9A 3MXSA 3KSHA 2OWJA 2VEAA 4GLQA 3UPNA 1LT0A 3T50A 3RJUA 2BASA 1HTZA 2VV8A 1OTAA 3UE3A 4C3QA 4MLLA 4DF6A 5A90A 4U0XA 4MNRA 5M18A 2V0UA 4IBRA 3F1NA 5TFQA 1NJ4A 2G7UA 3A3IA 3N4IA 4ESPA 5FQJA 3JVUA 3E0YA 2D02A 3I7JA 2GNXA 4OKPA 4IUHA 5CX7A 2Y2LA 2JBFA 3T4SA 4FTXA 3EQUA 2WKIA 4D60A 3K2NA 4GS9A 3OC2A 1Y28A 3FZCA 2J9OA 2RCXA 4O7DA 4BMWA 4LRXC 5LBRA 3MQ0A 2GJ3A 5EFWA 3IF6B 4PKYG 3R7WB 3WRZA 3G4PA 5F6AA 4KZ3A 3TJZC 3IS2B 2HGVA 5FEFA 5CTMA 1P9WA 4DDYA 3UB6A 1GHPA 3IBJA 5FASA 3HLEA 2ZMAA 3Q81A 4P6BA 5HW3A 4Q0HA 2O9BA 1M40A 2KX6A 1NXYA 4DDSA 5FDSA 5E2HA 5AVEA 5BOHA 2WADA 5DF8A 1JNUA 2JKTM 1BLPA 2XFSA 3Q7VA 5HAIA 4K0XA 1BSGA 4BENA 2M7UA 5DFYA 1HLUP 1S66L 2ZL1B 2XQZA 1VM1A 4Y13A 1PW8A 1IYSA 4CLCA 1L0FA 4GDBA 4MMNA 2C5WB 3D4FA 3A3EA 4S2MA 4OVDA 4IUKA 1EI5A 2EWWA 2ZC3B 3E2KA 4WN5A 3ZVWA 1GCEA 4KQOA 2WK0A 3NBLA 4OQIA 1T1CA 2O9AA 1CI9A 4EUVA 3T4LA 1ODVA 1QMEA 2GZAA 3UB9A 2HDSA 3LIEA 3IBRA 5L2FA 2PD7A 1XP4A 3AGDA 1PZPA 5GLCA 1IFQA 4EWFA 3WS0A 2ACGA 2PBYA 3HLDA 4Q8IA 3VFHA 1ES4A 5FAQA 2MJ6A 2OLVA 3C4PA 2VA0A 5FDHA 1F2KA 1MXOA 2CC1A 4WEJA 3WWXA 4Y3IA 4BQMA 1WE4A 1F98A 3OCLA 4KZ6A 2W0NA 4D2OA 3G32A 2HJEA 1XXMA 3PTEA 1FCMA 2ZC4B 1XA7A 5A92A 1YT4A 3V5MA 4ZRRA 5A8BA 1LL5A 2HPBA 3IXBA 2Y55A 3P09A 1XGJA 2X01A 3Q7ZA 3BECA 4OH0A 1IEMA 1XA1A 2YKFA 4N92A 5EE8A 1IOUA 2PAVP 5CHMA 3O5YA 1XKZA 3ITAA 1K0KA 1J9MA 1D06A 2K7SA 3C7UA 4Z9QA 3B3XA 3A0RA 2Y4AA 4Y17A 4H8RA 3BEBA 2Z6DA 1VEUA 4GD8A 4CLCC 3UE1A 1MBLA 5AJGA 1ZG6A 3S7PA 2D01A 4X1MA 4LV3A 3N7WA 4GCZA 3N8RA 1NZOA 2WKQA 3EEAA 4PKYA 2ZMVA 5CRFA 4JXGA 2WKPA 1PNEA 4GOGA 3E2LA 4BD0A 3UMEA 3UY6A 1XJ3A 3BFEA 1WYBA 4OPRA 3UPOA 5GLBA 4QD4A 4QPRA 2ZMFA 4R3JA 1N9LA 3P01A 1OTDA 3OPPA 1E25A 1MC0A 3MXRA 4CJNA 3IX8A 4HY8A 3LEZA 4S2NA 2J9PA 3IF5A 1F5MA 4OPYA 3KO6A 5F69A 3HLFA 2W3DA 5GHZA 4B93A 3LR5A 4X69A 3UE0A 4FH4A 4FUWA 2JC7A 2XSSA 4WL9A 4I38A 4WZ5C 4XUZA 3ULFA 3NC8A 1PRQA 3CPTB 4FD8A 4E6XA 1KVMA 1SDEA 2ZQDA 4BJPA 3D72A 4PMAA 3E98A 4K91A 1GSWA 3OPLA 1S0WA 2XK1A 3GMWA 1TS0A 4IBXA 5HDCA 3MQQA 3V3RA 3NOTC 1W63Q 1NRFA 2L1MA 1S1ZA 4KENB 5EPHA 3C30A 4HEFA 2IWBA 3VP2A 3BFDA 4RX2A 4PM6A 3M6BA 3VSKA 4JF5A 1L0GA 2XDMA 1YQSA 1K57A 3FG8A 4S2JA 4IVKA 3MFXA 1KE3A 4FSFA 3PBTA 3OLOA 3T4QA 5EM0A 2A24B 3Q1FA 1T1AA 3PBRA 1Y54A 1BLCA 2B5RA 1KVLA 1ERMA 4CPKA 2B95A 4DE3A 3FC7A 3H82A 4ARZA 3EWKA 1W5DA 1MWTA 2H5SA 4S2OA 3U4LP 4N1HA 3HJKA 1ZC2A 3G2ZA 2WGWB 2Y2MA 3TOIA 4BBTA 4Q0JA 4S2PA 4Y2FA 4S2NC 2BLSA 5FATA 4JPMA 2Z6CA 1UWPX 1FR1A 1NLZA 1BULA 2J80A 3P98A 4NXBA 1X0OA 4WELA 1SDNA 4E3NA 3CZDA 2INWA 4AFIA 1KGEA 3BJNA 4EBNA 2EXBA 2VGKA 2OLUA 1IKIA 1MWUA 2OSUA 3BLSA 4BBVA 4ETXA 4JGOA 4DXCA 1K55A 3HREA 5FI6A 3OZHA 4E3IA 1MPLA 3BRMA 2WZXA 5DF7A 2K2NA 2XR0A 2L4RA 3NHQA 4OQ0A 1K57C 2OAP1 4MEZA 1PFLA 3R7WA 3DBAA 4GHIA 3VV4A 1KDWA 5GHXA 3HJIA 1PWDA 5M1AA 4K08A 4JGPA 4LRZE 4YWZA 5FQIA 2A2LA 4JXWA 2OOLA 4MN5A 1YLPA 3IWIA 4ZJ2A 1Y4OA 3NDEA 1ESIA 4E3OA 4UA6A 1MY8A 1MZUA 3T1QB 3A3FA 5KSHA 1IYPA 2KLIA 5I94A 4WLAA 4EEPA 3MF0A 3S7OA 3ZHHA 1TVFA 3FV7A 3QP8A 1KGFA 3O88A 1UGUA 3IXGA 1IYOA 5J8XA 1XJ6A 2W3FA 2PDRA 1GA0A 4O8GA 2FFFB 2H28A 2KOIA 3T12B 3PBQA 3LR3A 1FSYA 3BYDA 4MBKA 5GLDA 2XEPA 1TS7A 1F9IA 4ME4A 1TDGA 1D7EA 4U0TA 3UB5P 1SZVA 3TRCA 5DVAA 1K4FA 3IX3A 4NXFA 4R6LA 2WKHA 2ZD8A 3UMDA 5HD5A 4P85A 1A0KA 1XFNA 4WZ4A 3BQ8A 3B33A 3T1SA 3MBZA 5EV0A 2Z2LB 3LIDA 2Y8HA 1SKOA 2DMWA 2QMIA 2XGNA 4PPRA 4XXRA 3UDFA 1OTBA 5I5LA 3F1OA 5F68A 1P0ZA 4E3JA 4NEED 2J7VA 3CMZA 2PHYA 5EVID 4M3KA 1Q2QA 2PYRA 1YLWA 3DTMA 4L9FA 5C5KA 5FSRA 1YMXA 3S4XA 4UEYA 2W1TB 1NZUA 3DTEA 1PI5A 3ISGA 2HDUA 4FCFA 5J4EA 4IEDA 3UB8A 5J3WA 5U47A 1TS6A 5FQQA 1CF0A 5HL1A 5F82A 1CEGA 5TBMB 3GDIA 3K3DA 4NETA
chains in the Genus database with same CATH topology
5HFOA 3PTEA 1ZKJA 5DF9A 1FCMA 2ZC4B 2XF3A 1XA7A 4XUXA 2EX6A 5AQBA 2Y2IA 5A92A 4WBGA 1ES2A 4FH2A 1GHIA 1DJCA 1YT4A 4HESA 1FOFA 3OCNA 1IYQA 5KMWA 2ZM0A 1LL9A 3IXDA 3UDXA 3V5MA 1KE4A 4R23A 3VP3A 3ZNYA 3AGEA 1LL5A 2HPBA 4GD6A 2G2UA 4UA9A 4KG5A 4QY6A 3IXBA 3HUOA 4EUZA 1M6KA 2Y55A 3LCEA 3ZFZA 4PM5A 3P09A 1K38A 1YMSA 1XGJA 3HLGA 3VP0A 4EQIA 2EXAA 5EVLA 3Q7ZA 1RCJA 3BECA 4OH0A 4QY5A 2X01A 1IEMA 2J8YA 2ZQ7A 3ZG7B 3UNWA 4HBTA 4N1XA 3FYZA 1XA1A 2WYXA 1XX2A 3AGFA 3PBNA 4N92A 3NI9A 5EE8A 4DKIA 3VSLA 5CHMA 1XKZA 2WAFA 3ITAA 3A3JA 3BFCA 1DJAA 1JWZA 1O7EA 1AXBA 1GHMA 1J9MA 2BG1A 3C7VA 4Z9QA 2H10A 3C7UA 4OP5A 5D3OA 3B3XA 3N6IA 4C75A 1FQGA 3SS4A 4Y0TA 3HBRA 2Y4AA 2HP6A 2HP5A 4H8RA 3BEBA 4GD8A 4B88A 1K4EA 4UHUA 3VOZA 5FAPA 5FQ9A 3UE1A 3WS5A 2EX8A 3DW0A 4QU3A 4A5RA 1MBLA 4E3MA 4OQHA 5CGWA 2WGVA 1ZG6A 2WUQA 2XH9A 1O07A 4C6YA 4KZ8A 4OONA 4LV3A 4R1GA 3OPHA 5HX9A 1PYYA 3N7WA 1RGZA 4KZ4A 4OLGA 5M19A 3N8RA 4DE1A 1EROA 1NZOA 5CRFA 4KZAA 2H0YA 2ZQCA 4JXGA 4S2KA 1PWCA 2EX2A 1K55C 1K6RA 1PI4A 4ZJ1A 3V50A 4GOGA 3E2LA 4BD0A 1DJBA 4ZBEA 1NYYA 5EVIC 1K56A 3IHAA 4BL3A 3SH9A 3UY6A 3BFEA 2A3UA 2EFXA 1WYBA 4OPRA 1LI0A 5AQ9A 3UPOA 5EUAA 5GLBA 4QD4A 4PM7A 3QNBA 3W8KA 3ZG0A 3FKWA 3PAGA 4R3JA 3HL9A 1W8YA 2Y2JA 2I72A 2P9VB 5A93A 3OPPA 1E25A 5GLAA 1YLTA 3PBSA 3MXRA 4CJNA 4S2NA 3LEZA 4JBFA 4X55A 1HZOA 2J9PA 1JTGA 3IF5A 5EOEA 4OPYA 2WZZA 1EWZA 3UDIA 3HLFA 5GHZA 3G30A 1FCNA 4KQQA 4X69A 3UE0A 1XGIA 5GL9A 1E4DA 4FH4A 3VFFA 4K0WA 4HBUA 2JC7A 3O86A 1BT5A 3G34A 4OOLA 3O3VA 3CJMA 3Q82A 2OV5A 4WZ5C 4XUZA 5DTKA 4PM8A 3NC8A 5F83A 2H0TA 2X71A 4FD8A 4UAAA 4OOYA 1N4OA 1YLJA 4E6XA 1KVMA 1SDEA 2V2FF 4PM9A 3WS4A 2ZQDA 3NDGA 4BJPA 5JYPA 4EBPA 3ZCZA 4PMAA 2DNSA 4K91A 3BLMA 4JXSA 4LV0A 4S2IA 3OPLA 1S0WA 2XK1A 2V20A 3GMWA 4YFMA 2ZLYA 3GRJA 5A91A 1I2WA 4JF6A 2R9XA 3UN7A 4EV4A 3VMAA 4IBXA 1PZOA 3W4QA 2DRWA 3QHYA 3V3RA 4WM9A 5IHVA 3GSGA 3C4OA 4S2LA 5FQMA 3S1YA 3HLWA 3GQZA 4B4XA 1K54C 1NRFA 3ZG5A 4ZAMA 1ALQA 4KENB 5EPHA 4HEFA 4JKTA 2IWBA 3VP2A 3BFDA 1L0DA 4RX2A 4PM6A 3V39A 3M6BA 3VSKA 4JF5A 1L0GA 1SCWA 1ZG4A 1TDLA 5JYOA 5CECA 4DE0A 3HLCA 1LI9A 2EFUA 2XDMA 3NIAA 4OPQA 1BUEA 1FSWA 1YQSA 1IKGA 1W8QA 1K57A 1L2SA 2Z2MB 5EVIB 4S2JA 4IVKA 4DXBA 1L0EA 4WMCD 5FI2A 1KE3A 4FSFA 3PBTA 1HVBA 1U60A 2C6WB 3WS1A 1Q2PA 5FAOA 3IHBA 4KG6A 4N9KA 3DWKA 3Q1FA 4QB8A 3SH7A 1YM1A 3PBRA 4RYEA 4GB7A 1Y54A 1BLCA 2B5RA 2HDQA 1KVLA 2JCHA 4BL2A 1VQQA 1ERMA 2ZQ9A 1ESUA 1C3BA 1H5XA 4CPKA 3Q07A 2X02A 4DE3A 2QPNA 2DCFA 3ITBA 3FWLA 2WAEA 3IXHA 1W5DA 3IWOA 1MWTA 2H5SA 3N8SA 1MKIA 3RXXA 1OMEA 1DY6A 3NCKA 2P9VA 4S2OA 3VP1A 3FKVA 4N1HA 4E3KA 5KSCA 1ZC2A 3HUNA 1HD8A 4X53A 5AQAA 3G2ZA 2Y2KA 2WGWB 3G31A 1G68A 1SKFA 2Y2MA 3DWZA 3TOIA 1CK3A 4S2PA 3WRTA 3W4PA 4S2NC 2BLSA 5FATA 1MWSA 4QHCA 4RA7A 5HARA 4JPMA 5CEBA 3IH9A 2RL3A 4LCMA 4IVIA 4NK3A 1FR1A 4X6TA 4E6WA 3ZNTA 3G2YA 1BULA 1K56D 1H8ZA 5FI7A 3V3SA 4JXVA 3S22A 3P98A 2ZM8A 3W4OA 1I2SA 2E8IA 5CEDA 1ONHA 1FR6A 2HP9A 2XD1A 2Q9NA 3QNCA 2EX9A 4KZ5A 2Y91A 2PU4A 2XLNA 3IF6C 2P74A 4OQGA 4WEKA 3BFGA 3M2JA 4WELA 2Y2PA 1I5QA 3SS5A 1SDNA 3MKFA 3UO9A 4E3NA 3CZDA 3HUMA 2ZC5B 4Y0UA 1E3UD 1KDSA 1PW1A 4BLMA 1K6SA 2Y2QA 3VOYA 1JTDA 1H8YA 2ZQ8A 3O87A 3BM6A 4R3BA 4P0MA 1KGEA 2IWDA 3CG5A 3N8LA 2EXBA 4EBNA 2ZJ9A 3OPRA 1RGYA 3G35A 2VGKA 3LY4A 4ZJ3A 5GHYA 5HAPA 5G18A 1SHVA 3UPPA 2OLUA 3NY4A 2FFYA 4KZ9A 1IKIA 1CEFA 5CERA 2A49A 1MWUA 2OSUA 3BLSA 5EOOA 4QJGA 4DXCA 3MFDA 5F1FA 1K55A 3IH8A 5FQKA 3HREA 5FI6A 2HDRA 3OZHA 5CXWA 4E3IA 3Q7VB 1MPLA 3MXSA 1JWPA 1RP5A 5EVIA 3BRMA 5CHUA 1MWRA 2WZXA 5DF7A 4LV2A 2XR0A 3UPNA 3RJUA 1HTZA 5AQ7A 3UE3A 4OQ0A 4C3QA 4MLLA 4DF6A 5A90A 1K57C 4MNRA 4U0XA 4UA7A 5M18A 4IBRA 4MEZA 5TFQA 1NJ4A 3A3IA 3N4IA 4GN2A 1BTLA 1G6AA 5CGXA 5FQJA 5FA7A 1KDWA 5GHXA 4L0LA 3I7JA 1QMFA 4YINA 3SH8A 4WYYA 4OKPA 3GR2A 1PIOA 3PAEA 3IT9A 1PWDA 5HAQA 5M1AA 4DRTA 5FQIA 2VGJA 1WYCA 1LLBA 5CTNA 2WGWA 2Y2LA 3M6HA 4P87A 2IWCA 4OLDA 2JBFA 4JXWA 4MBFA 5E43A 4F94A 1YLPA 3MZEA 3IWIA 1JVJA 5EECA 3EQUA 4ZTKA 3EQVA 2WKIA 4ZJ2A 4GZBA 3SS3A 4WZ5A 3OC2A 3NDEA 2G2WA 3C5AA 1ESIA 3FZCA 4E3OA 4UA6A 2J9OA 4KZ7A 1MY8A 2RCXA 5F1GA 4O7DA 3A3FA 1N9BA 5KSHA 1GA9A 1IYPA 5I94A 2GDNA 2ZM2A 3IF6B 4R0QA 3WRZA 1K25A 2QZ6A 2WKEA 3G4PA 3RXWA 5TR7A 3SOIA 1CI8A 4KZ3A 5E2GA 2PU2A 3ZHHA 1TVFA 4LV1A 3FV7A 4RX3A 2V1ZA 5CTMA 4LCLA 4DDYA 4OOMA 4DE2A 4WMCA 3LO7A 2R9WA 1GHPA 1KGFA 3O88A 5E2EA 1KE0A 3IXGA 4GKUA 1IYOA 1ES5A 4ID4A 3HLEA 2ZMAA 5FASA 3LY3A 5J8XA 4MBHA 1K54A 1BZAA 3Q81A 2Q9MA 4P6BA 1GA0A 5HW3A 3MKEA 2FFFB 1M40A 5DTSA 2XFTA 2Y2HA 3PBQA 4LENA 1ONGA 1FSYA 3ZG8B 3BYDA 5CGSA 4MBKA 2WGIA 5GLDA 1NXYA 4DDSA 2XEPA 3ZDJA 5E2HA 3HVFA 1NY0A 2WADA 4GNUA 5BOHA 1TDGA 5DTTA 4U0TA 5DF8A 1PWGA 1W7FA 1BLPA 3TSGA 2XFSA 5TGFA 1S6RA 4R4SA 5DVAA 4X68A 5E2FA 1K4FA 3Q7VA 5HAIA 4K0XA 2WKHA 5KZHA 5CHJA 1BSGA 2ZD8A 4BENA 4ZDXA 3GV9A 3GTCA 2XQZA 1VM1A 3PBOA 4P85A 4Y0OA 1PW8A 4WZ4A 4JLFA 1IYSA 2Y2NA 1L0FA 4GDBA 2C5WB 3D4FA 3A3EA 1ERQA 3MBZA 4S2MA 4OP8A 2Z2LB 4OVDA 4BD1A 4R4RA 3ZVTA 3IQAA 3JYIA 2JE5A 1JWVA 1EI5A 2ZC3B 1KGGA 3E2KA 4E3LA 4JF4A 3ZG9B 2QMIA 3ZVWA 1W79A 1GCEA 2XGNA 4KQOA 2WK0A 1BLHA 2Y2OA 3NBLA 4OQIA 4PPRA 4B4ZA 3HLBA 4XXRA 3UDFA 4KG2A 1CI9A 1E3UA 3BFFA 1QMEA 4EBLA 1TEMA 4E3JA 2HDSA 2J7VA 3CMZA 4U3TA 4RVAA 4X56A 4KZBA 5EVID 1IELA 2ZC6B 4M3KA 1YLYA 3WS2A 1XP4A 5L2FA 1Q2QA 2Y59A 1XPBA 3AGDA 1PZPA 3M2KA 5GLCA 4N9LA 4EWFA 1YLWA 1FCOA 3WS0A 3IWQA 4KQRA 3DTMA 3VP4A 2PBYA 3GVBA 5FSRA 3HLDA 1YLZA 2ZC7A 4GDNA 4Q8IA 3VFHA 3IF6A 1YMXA 3S4XA 1ES4A 5FAQA 2ZQAA 1NZUA 1BLSA 1NYMA 2OLVA 2XD5A 1PI5A 3MZDA 4OPZA 3C4PA 3ISGA 1LHYA 2HDUA 5FDHA 2CC1A 1MXOA 4FCFA 4WEJA 3WWXA 4IEDA 5U47A 3TG9A 4BQMA 5FQQA 1WE4A 3A3DA 3OCLA 4KZ6A 5HL1A 2Y2GA 3MZFA 5F82A 1CEGA 4D2OA 1Z6FA 3G32A 3ZGAB 2UWXA 1ES3A 4NETA 1XXMA 4Y7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HFO A;  3PTE A;  1ZKJ A;  5DF9 A;  1FCM A;  2ZC4 B;  2XF3 A;  1XA7 A;  4XUX A;  2EX6 A;  5AQB A;  2Y2I A;  5A92 A;  4WBG A;  1ES2 A;  4FH2 A;  1GHI A;  1DJC A;  1YT4 A;  4HES A;  1FOF A;  3OCN A;  1IYQ A;  5KMW A;  2ZM0 A;  1LL9 A;  3IXD A;  3UDX A;  3V5M A;  1KE4 A;  4R23 A;  3VP3 A;  3ZNY A;  3AGE A;  1LL5 A;  2HPB A;  4GD6 A;  2G2U A;  4UA9 A;  4KG5 A;  4QY6 A;  3IXB A;  3HUO A;  4EUZ A;  1M6K A;  2Y55 A;  3LCE A;  3ZFZ A;  4PM5 A;  3P09 A;  1K38 A;  1YMS A;  1XGJ A;  3HLG A;  3VP0 A;  4EQI A;  2EXA A;  5EVL A;  3Q7Z A;  1RCJ A;  3BEC A;  4OH0 A;  4QY5 A;  2X01 A;  1IEM A;  2J8Y A;  2ZQ7 A;  3ZG7 B;  3UNW A;  4HBT A;  4N1X A;  3FYZ A;  1XA1 A;  2WYX A;  1XX2 A;  3AGF A;  3PBN A;  4N92 A;  3NI9 A;  5EE8 A;  4DKI A;  3VSL A;  5CHM A;  1XKZ A;  2WAF A;  3ITA A;  3A3J A;  3BFC A;  1DJA A;  1JWZ A;  1O7E A;  1AXB A;  1GHM A;  1J9M A;  2BG1 A;  3C7V A;  4Z9Q A;  2H10 A;  3C7U A;  4OP5 A;  5D3O A;  3B3X A;  3N6I A;  4C75 A;  1FQG A;  3SS4 A;  4Y0T A;  3HBR A;  2Y4A A;  2HP6 A;  2HP5 A;  4H8R A;  3BEB A;  4GD8 A;  4B88 A;  1K4E A;  4UHU A;  3VOZ A;  5FAP A;  5FQ9 A;  3UE1 A;  3WS5 A;  2EX8 A;  3DW0 A;  4QU3 A;  4A5R A;  1MBL A;  4E3M A;  4OQH A;  5CGW A;  2WGV A;  1ZG6 A;  2WUQ A;  2XH9 A;  1O07 A;  4C6Y A;  4KZ8 A;  4OON A;  4LV3 A;  4R1G A;  3OPH A;  5HX9 A;  1PYY A;  3N7W A;  1RGZ A;  4KZ4 A;  4OLG A;  5M19 A;  3N8R A;  4DE1 A;  1ERO A;  1NZO A;  5CRF A;  4KZA A;  2H0Y A;  2ZQC A;  4JXG A;  4S2K A;  1PWC A;  2EX2 A;  1K55 C;  1K6R A;  1PI4 A;  4ZJ1 A;  3V50 A;  4GOG A;  3E2L A;  4BD0 A;  1DJB A;  4ZBE A;  1NYY A;  5EVI C;  1K56 A;  3IHA A;  4BL3 A;  3SH9 A;  3UY6 A;  3BFE A;  2A3U A;  2EFX A;  1WYB A;  4OPR A;  1LI0 A;  5AQ9 A;  3UPO A;  5EUA A;  5GLB A;  4QD4 A;  4PM7 A;  3QNB A;  3W8K A;  3ZG0 A;  3FKW A;  3PAG A;  4R3J A;  3HL9 A;  1W8Y A;  2Y2J A;  2I72 A;  2P9V B;  5A93 A;  3OPP A;  1E25 A;  5GLA A;  1YLT A;  3PBS A;  3MXR A;  4CJN A;  4S2N A;  3LEZ A;  4JBF A;  4X55 A;  1HZO A;  2J9P A;  1JTG A;  3IF5 A;  5EOE A;  4OPY A;  2WZZ A;  1EWZ A;  3UDI A;  3HLF A;  5GHZ A;  3G30 A;  1FCN A;  4KQQ A;  4X69 A;  3UE0 A;  1XGI A;  5GL9 A;  1E4D A;  4FH4 A;  3VFF A;  4K0W A;  4HBU A;  2JC7 A;  3O86 A;  1BT5 A;  3G34 A;  4OOL A;  3O3V A;  3CJM A;  3Q82 A;  2OV5 A;  4WZ5 C;  4XUZ A;  5DTK A;  4PM8 A;  3NC8 A;  5F83 A;  2H0T A;  2X71 A;  4FD8 A;  4UAA A;  4OOY A;  1N4O A;  1YLJ A;  4E6X A;  1KVM A;  1SDE A;  2V2F F;  4PM9 A;  3WS4 A;  2ZQD A;  3NDG A;  4BJP A;  5JYP A;  4EBP A;  3ZCZ A;  4PMA A;  2DNS A;  4K91 A;  3BLM A;  4JXS A;  4LV0 A;  4S2I A;  3OPL A;  1S0W A;  2XK1 A;  2V20 A;  3GMW A;  4YFM A;  2ZLY A;  3GRJ A;  5A91 A;  1I2W A;  4JF6 A;  2R9X A;  3UN7 A;  4EV4 A;  3VMA A;  4IBX A;  1PZO A;  3W4Q A;  2DRW A;  3QHY A;  3V3R A;  4WM9 A;  5IHV A;  3GSG A;  3C4O A;  4S2L A;  5FQM A;  3S1Y A;  3HLW A;  3GQZ A;  4B4X A;  1K54 C;  1NRF A;  3ZG5 A;  4ZAM A;  1ALQ A;  4KEN B;  5EPH A;  4HEF A;  4JKT A;  2IWB A;  3VP2 A;  3BFD A;  1L0D A;  4RX2 A;  4PM6 A;  3V39 A;  3M6B A;  3VSK A;  4JF5 A;  1L0G A;  1SCW A;  1ZG4 A;  1TDL A;  5JYO A;  5CEC A;  4DE0 A;  3HLC A;  1LI9 A;  2EFU A;  2XDM A;  3NIA A;  4OPQ A;  1BUE A;  1FSW A;  1YQS A;  1IKG A;  1W8Q A;  1K57 A;  1L2S A;  2Z2M B;  5EVI B;  4S2J A;  4IVK A;  4DXB A;  1L0E A;  4WMC D;  5FI2 A;  1KE3 A;  4FSF A;  3PBT A;  1HVB A;  1U60 A;  2C6W B;  3WS1 A;  1Q2P A;  5FAO A;  3IHB A;  4KG6 A;  4N9K A;  3DWK A;  3Q1F A;  4QB8 A;  3SH7 A;  1YM1 A;  3PBR A;  4RYE A;  4GB7 A;  1Y54 A;  1BLC A;  2B5R A;  2HDQ A;  1KVL A;  2JCH A;  4BL2 A;  1VQQ A;  1ERM A;  2ZQ9 A;  1ESU A;  1C3B A;  1H5X A;  4CPK A;  3Q07 A;  2X02 A;  4DE3 A;  2QPN A;  2DCF A;  3ITB A;  3FWL A;  2WAE A;  3IXH A;  1W5D A;  3IWO A;  1MWT A;  2H5S A;  3N8S A;  1MKI A;  3RXX A;  1OME A;  1DY6 A;  3NCK A;  2P9V A;  4S2O A;  3VP1 A;  3FKV A;  4N1H A;  4E3K A;  5KSC A;  1ZC2 A;  3HUN A;  1HD8 A;  4X53 A;  5AQA A;  3G2Z A;  2Y2K A;  2WGW B;  3G31 A;  1G68 A;  1SKF A;  2Y2M A;  3DWZ A;  3TOI A;  1CK3 A;  4S2P A;  3WRT A;  3W4P A;  4S2N C;  2BLS A;  5FAT A;  1MWS A;  4QHC A;  4RA7 A;  5HAR A;  4JPM A;  5CEB A;  3IH9 A;  2RL3 A;  4LCM A;  4IVI A;  4NK3 A;  1FR1 A;  4X6T A;  4E6W A;  3ZNT A;  3G2Y A;  1BUL A;  1K56 D;  1H8Z A;  5FI7 A;  3V3S A;  4JXV A;  3S22 A;  3P98 A;  2ZM8 A;  3W4O A;  1I2S A;  2E8I A;  5CED A;  1ONH A;  1FR6 A;  2HP9 A;  2XD1 A;  2Q9N A;  3QNC A;  2EX9 A;  4KZ5 A;  2Y91 A;  2PU4 A;  2XLN A;  3IF6 C;  2P74 A;  4OQG A;  4WEK A;  3BFG A;  3M2J A;  4WEL A;  2Y2P A;  1I5Q A;  3SS5 A;  1SDN A;  3MKF A;  3UO9 A;  4E3N A;  3CZD A;  3HUM A;  2ZC5 B;  4Y0U A;  1E3U D;  1KDS A;  1PW1 A;  4BLM A;  1K6S A;  2Y2Q A;  3VOY A;  1JTD A;  1H8Y A;  2ZQ8 A;  3O87 A;  3BM6 A;  4R3B A;  4P0M A;  1KGE A;  2IWD A;  3CG5 A;  3N8L A;  2EXB A;  4EBN A;  2ZJ9 A;  3OPR A;  1RGY A;  3G35 A;  2VGK A;  3LY4 A;  4ZJ3 A;  5GHY A;  5HAP A;  5G18 A;  1SHV A;  3UPP A;  2OLU A;  3NY4 A;  2FFY A;  4KZ9 A;  1IKI A;  1CEF A;  5CER A;  2A49 A;  1MWU A;  2OSU A;  3BLS A;  5EOO A;  4QJG A;  4DXC A;  3MFD A;  5F1F A;  1K55 A;  3IH8 A;  5FQK A;  3HRE A;  5FI6 A;  2HDR A;  3OZH A;  5CXW A;  4E3I A;  3Q7V B;  1MPL A;  3MXS A;  1JWP A;  1RP5 A;  5EVI A;  3BRM A;  5CHU A;  1MWR A;  2WZX A;  5DF7 A;  4LV2 A;  2XR0 A;  3UPN A;  3RJU A;  1HTZ A;  5AQ7 A;  3UE3 A;  4OQ0 A;  4C3Q A;  4MLL A;  4DF6 A;  5A90 A;  1K57 C;  4MNR A;  4U0X A;  4UA7 A;  5M18 A;  4IBR A;  4MEZ A;  5TFQ A;  1NJ4 A;  3A3I A;  3N4I A;  4GN2 A;  1BTL A;  1G6A A;  5CGX A;  5FQJ A;  5FA7 A;  1KDW A;  5GHX A;  4L0L A;  3I7J A;  1QMF A;  4YIN A;  3SH8 A;  4WYY A;  4OKP A;  3GR2 A;  1PIO A;  3PAE A;  3IT9 A;  1PWD A;  5HAQ A;  5M1A A;  4DRT A;  5FQI A;  2VGJ A;  1WYC A;  1LLB A;  5CTN A;  2WGW A;  2Y2L A;  3M6H A;  4P87 A;  2IWC A;  4OLD A;  2JBF A;  4JXW A;  4MBF A;  5E43 A;  4F94 A;  1YLP A;  3MZE A;  3IWI A;  1JVJ A;  5EEC A;  3EQU A;  4ZTK A;  3EQV A;  2WKI A;  4ZJ2 A;  4GZB A;  3SS3 A;  4WZ5 A;  3OC2 A;  3NDE A;  2G2W A;  3C5A A;  1ESI A;  3FZC A;  4E3O A;  4UA6 A;  2J9O A;  4KZ7 A;  1MY8 A;  2RCX A;  5F1G A;  4O7D A;  3A3F A;  1N9B A;  5KSH A;  1GA9 A;  1IYP A;  5I94 A;  2GDN A;  2ZM2 A;  3IF6 B;  4R0Q A;  3WRZ A;  1K25 A;  2QZ6 A;  2WKE A;  3G4P A;  3RXW A;  5TR7 A;  3SOI A;  1CI8 A;  4KZ3 A;  5E2G A;  2PU2 A;  3ZHH A;  1TVF A;  4LV1 A;  3FV7 A;  4RX3 A;  2V1Z A;  5CTM A;  4LCL A;  4DDY A;  4OOM A;  4DE2 A;  4WMC A;  3LO7 A;  2R9W A;  1GHP A;  1KGF A;  3O88 A;  5E2E A;  1KE0 A;  3IXG A;  4GKU A;  1IYO A;  1ES5 A;  4ID4 A;  3HLE A;  2ZMA A;  5FAS A;  3LY3 A;  5J8X A;  4MBH A;  1K54 A;  1BZA A;  3Q81 A;  2Q9M A;  4P6B A;  1GA0 A;  5HW3 A;  3MKE A;  2FFF B;  1M40 A;  5DTS A;  2XFT A;  2Y2H A;  3PBQ A;  4LEN A;  1ONG A;  1FSY A;  3ZG8 B;  3BYD A;  5CGS A;  4MBK A;  2WGI A;  5GLD A;  1NXY A;  4DDS A;  2XEP A;  3ZDJ A;  5E2H A;  3HVF A;  1NY0 A;  2WAD A;  4GNU A;  5BOH A;  1TDG A;  5DTT A;  4U0T A;  5DF8 A;  1PWG A;  1W7F A;  1BLP A;  3TSG A;  2XFS A;  5TGF A;  1S6R A;  4R4S A;  5DVA A;  4X68 A;  5E2F A;  1K4F A;  3Q7V A;  5HAI A;  4K0X A;  2WKH A;  5KZH A;  5CHJ A;  1BSG A;  2ZD8 A;  4BEN A;  4ZDX A;  3GV9 A;  3GTC A;  2XQZ A;  1VM1 A;  3PBO A;  4P85 A;  4Y0O A;  1PW8 A;  4WZ4 A;  4JLF A;  1IYS A;  2Y2N A;  1L0F A;  4GDB A;  2C5W B;  3D4F A;  3A3E A;  1ERQ A;  3MBZ A;  4S2M A;  4OP8 A;  2Z2L B;  4OVD A;  4BD1 A;  4R4R A;  3ZVT A;  3IQA A;  3JYI A;  2JE5 A;  1JWV A;  1EI5 A;  2ZC3 B;  1KGG A;  3E2K A;  4E3L A;  4JF4 A;  3ZG9 B;  2QMI A;  3ZVW A;  1W79 A;  1GCE A;  2XGN A;  4KQO A;  2WK0 A;  1BLH A;  2Y2O A;  3NBL A;  4OQI A;  4PPR A;  4B4Z A;  3HLB A;  4XXR A;  3UDF A;  4KG2 A;  1CI9 A;  1E3U A;  3BFF A;  1QME A;  4EBL A;  1TEM A;  4E3J A;  2HDS A;  2J7V A;  3CMZ A;  4U3T A;  4RVA A;  4X56 A;  4KZB A;  5EVI D;  1IEL A;  2ZC6 B;  4M3K A;  1YLY A;  3WS2 A;  1XP4 A;  5L2F A;  1Q2Q A;  2Y59 A;  1XPB A;  3AGD A;  1PZP A;  3M2K A;  5GLC A;  4N9L A;  4EWF A;  1YLW A;  1FCO A;  3WS0 A;  3IWQ A;  4KQR A;  3DTM A;  3VP4 A;  2PBY A;  3GVB A;  5FSR A;  3HLD A;  1YLZ A;  2ZC7 A;  4GDN A;  4Q8I A;  3VFH A;  3IF6 A;  1YMX A;  3S4X A;  1ES4 A;  5FAQ A;  2ZQA A;  1NZU A;  1BLS A;  1NYM A;  2OLV A;  2XD5 A;  1PI5 A;  3MZD A;  4OPZ A;  3C4P A;  3ISG A;  1LHY A;  2HDU A;  5FDH A;  2CC1 A;  1MXO A;  4FCF A;  4WEJ A;  3WWX A;  4IED A;  5U47 A;  3TG9 A;  4BQM A;  5FQQ A;  1WE4 A;  3A3D A;  3OCL A;  4KZ6 A;  5HL1 A;  2Y2G A;  3MZF A;  5F82 A;  1CEG A;  4D2O A;  1Z6F A;  3G32 A;  3ZGA B;  2UWX A;  1ES3 A;  4NET A;  1XXM A;  4Y7P A; 
#chains in the Genus database with same CATH topology
 1ZKJ A;  5AQB A;  2EX6 A;  2Y2I A;  1DJC A;  4HES A;  1FOF A;  5KMW A;  1LL9 A;  5HD3 A;  3H7W A;  3VP3 A;  2PR6 A;  3DAV A;  4UA9 A;  4GD6 A;  2G2U A;  5DKK A;  1DP8 A;  3HUO A;  1M6K A;  3LCE A;  4PM5 A;  1K38 A;  3GEC A;  3LIA A;  4EQI A;  5HZH A;  2J8Y A;  2ZQ7 A;  3BWL A;  4N1X A;  2WYX A;  1XX2 A;  2HJ9 C;  1TS8 A;  3FPV A;  1KOU A;  1DJA A;  4R3A A;  1AXB A;  1EW0 A;  2WKR A;  3SS4 A;  4Y0T A;  5EVE A;  2HP6 A;  3PYP A;  3A0S A;  1YSQ A;  4UHU A;  3VOZ A;  4L9G A;  3DW0 A;  4OQH A;  2WGV A;  4HJ6 A;  2WUQ A;  2XH9 A;  2HF6 A;  1RGZ A;  4OLG A;  3T1R A;  3LGO A;  3LYX A;  4S2K A;  1PWC A;  1K6R A;  1PI4 A;  3PXP A;  4H6J B;  4LGW A;  4BL3 A;  3RTY A;  3SH9 A;  2EFX A;  1LI0 A;  5AQ9 A;  1OT6 A;  3W8K A;  3ZG0 A;  4EER A;  2E8J A;  2ZBB A;  3PAG A;  5A93 A;  1W63 M;  1G6O A;  1YLT A;  3LIC A;  4JBF A;  4X55 A;  4LLO B;  4E04 A;  5GL9 A;  1E4D A;  4HBU A;  2J3T D;  2V8F A;  4P6Z S;  4OOL A;  3ZQ5 A;  2OV5 A;  3BW6 A;  1OTI A;  2ZOI A;  5L09 A;  4OOY A;  1YLJ A;  1CQA A;  4PM9 A;  3E4Q A;  4Z1W A;  1STZ A;  2DNS A;  4JXS A;  4S2I A;  2V20 A;  4YFM A;  3GRJ A;  4JF6 A;  2R9X A;  3VMA A;  3QHY A;  5F5Y A;  3GSG A;  3C4O A;  4B4X A;  2QJ5 A;  3GQZ A;  3HLW A;  3CIT A;  3ZG5 A;  4JKT A;  2VKS A;  3CUE A;  5JYO A;  1LI9 A;  3NIA A;  4OPQ A;  1AWI A;  1L2S A;  2Z2M B;  2V1B A;  4DXB A;  1L0E A;  5FI2 A;  1HVB A;  2C6W B;  3H9W A;  3WS1 A;  4QB8 A;  1YM1 A;  3B42 A;  1G28 A;  3F1N B;  2W27 A;  2B02 A;  1H5X A;  2QPN A;  2DCF A;  3IXH A;  2P04 A;  2NUP C;  2P9V A;  3FKV A;  5HDD A;  1V9Z A;  5AQA A;  4X53 A;  1G68 A;  1SKF A;  3DWZ A;  4MN6 A;  4HQA A;  3W4P A;  4GS9 B;  5HAR A;  4EET B;  5CEB A;  3IH9 A;  4IVI A;  4NK3 A;  3QP5 A;  1K56 D;  5FI7 A;  4JXV A;  1I2S A;  2E8I A;  5CED A;  2HP9 A;  2EX9 A;  4KZ5 A;  3BFG A;  3M2J A;  1I5Q A;  3SS5 A;  3L7H A;  1J3W A;  5G4Z A;  4BLM A;  2OAQ 1;  3NOP C;  1K6S A;  2Y2Q A;  2ZQ8 A;  1XFQ A;  3LI8 A;  2ZJ9 A;  3G35 A;  3LY4 A;  5GHY A;  3UPP A;  1H8M A;  4KZ9 A;  5EOO A;  4QJG A;  4NG2 A;  5F1F A;  2CMN A;  2P08 A;  1VET B;  2HDR A;  3Q7V B;  3CUE C;  1JWP A;  1RP5 A;  3CLO A;  2VZW A;  2L0W A;  5EVI A;  5IT5 A;  5CHU A;  1MWR A;  3QP2 A;  4I39 A;  5AQ7 A;  4UA7 A;  3PR6 A;  4CLC B;  2VJW A;  4HHD A;  1G6A A;  5CGX A;  5FA7 A;  4L0L A;  2BTF P;  3UB7 A;  4YIN A;  3MJQ A;  3PAE A;  3IT9 A;  1OTE A;  2W3H A;  2Q0O A;  2VGJ A;  1WYC A;  1LLB A;  2IWC A;  4OLD A;  3EGX C;  3MZE A;  4ZTK A;  5IU1 A;  3SS3 A;  4NKP A;  2G2W A;  3C5A A;  1N9B A;  4II7 A;  1GA9 A;  2GDN A;  1BYW A;  4B9O A;  1K25 A;  3KYE A;  2WKE A;  5TR7 A;  3SOI A;  1ZHH B;  4XT2 A;  4LV1 A;  1NWZ A;  5KIZ A;  2V1Z A;  4LCL A;  4OOM A;  3LEQ A;  4WMC A;  2R9W A;  1N9O A;  1KE0 A;  4GKU A;  4CQH A;  1ES5 A;  4ID4 A;  3CHW P;  4MBH A;  1K54 A;  1H0M A;  2NUT C;  5DTS A;  2Y2H A;  3ZG8 B;  3C8C A;  5CGS A;  2WGI A;  1L3L A;  3SW1 A;  2XRN A;  3ZDJ A;  3HVF A;  1NY0 A;  4GNU A;  4PHT A;  3LIB A;  3TSG A;  3SZT A;  1S6R A;  4R4S A;  4X68 A;  5E2F A;  4GW9 A;  5KZH A;  5CHJ A;  4LFU A;  3GTC A;  4Q0I A;  4Y0O A;  3F1P B;  4JLF A;  3KYZ A;  2W3G A;  1ERQ A;  1DRM A;  4BD1 A;  4R4R A;  1YKD A;  3IQA A;  2W1T A;  2JE5 A;  4G3K A;  4LPZ A;  4DN0 A;  2PBD P;  1W79 A;  1ZTU A;  4WUJ A;  1BLH A;  3HLB A;  3D3O A;  2M1C A;  3R4K A;  3EOI A;  4YNR A;  4X56 A;  4KZB A;  3WS2 A;  1YLY A;  2Y59 A;  2LB9 A;  3M2K A;  4HIA A;  4N9L A;  1FCO A;  3IWQ A;  2ZC7 A;  3EGD C;  3DTK A;  4GDN A;  3IF6 A;  3QP1 A;  2ZQA A;  3EEH A;  1OJG A;  3MZD A;  2VV7 A;  3IS2 A;  1LHY A;  1OJ5 A;  3TG9 A;  2VK3 A;  3E4P A;  3A3D A;  1VB6 A;  3IX4 A;  2Y2G A;  3LFV A;  3MZF A;  1Z6F A;  5DF9 A;  4XUX A;  1ES2 A;  1GHI A;  3QP4 A;  3IXD A;  3UDX A;  3ZNY A;  4EUZ A;  3VP0 A;  1YMS A;  1GSX A;  2ZL1 A;  2EXA A;  5EVL A;  4QY5 A;  3UNW A;  3MR0 A;  4EEU A;  3FYZ A;  3AGF A;  3VSL A;  4LRY C;  4DJ3 A;  2WAF A;  3A3J A;  3BFC A;  4N9K A;  2O99 A;  1D1J A;  4OP5 A;  5D3O A;  3N6I A;  1FQG A;  2I9V A;  4EES A;  3ICY A;  4B88 A;  5FAP A;  2VX8 A;  2EX8 A;  4QU3 A;  4A5R A;  5CGW A;  4GJ4 A;  1O07 A;  4C6Y A;  4OON A;  4R1G A;  3OPH A;  2GX5 A;  3KX0 X;  2V1A A;  2YKH A;  3RFB A;  3W2Z A;  3HCY A;  2H0Y A;  2ZQC A;  2EX2 A;  1K55 C;  4ZJ1 A;  4BBU A;  1DJB A;  1S67 L;  1K56 A;  1XJ2 A;  3T4J A;  1ACF A;  4P6Z M;  2J3T C;  3H82 B;  3OOV A;  3MQO A;  4ARZ B;  4PM7 A;  3QNB A;  3FKW A;  3HL9 A;  3T4T A;  5L07 A;  2Y2J A;  3B47 A;  2I72 A;  2R78 A;  5GLA A;  5L10 A;  4MN7 A;  1HZO A;  1JTG A;  2WZZ A;  1EWZ A;  3UDI A;  4I3A A;  3G30 A;  5FEG A;  4KQQ A;  2PYP A;  2QYB A;  3KSI A;  3VFF A;  4K0W A;  3G34 A;  5HSQ A;  3O3V A;  2W3E A;  3CJM A;  2QWS A;  5DTK A;  5F83 A;  2X71 A;  3NDG A;  4UQI S;  3CI6 A;  2FZ0 A;  4LV0 A;  2ZLY A;  4JGR A;  3JVV A;  5A91 A;  4EV4 A;  3W4Q A;  4S2L A;  4HJ3 A;  5FQM A;  3S1Y A;  5G4Y A;  4Y5F A;  1L0D A;  4HOI A;  1SCW A;  1ZG4 A;  1TDL A;  5CEC A;  3HLC A;  5HDS A;  2JKT I;  1IKG A;  4WMC D;  4HNB A;  3SH7 A;  4RYE A;  4GB7 A;  4PAU A;  2HDQ A;  1WA9 A;  5IS1 A;  4HJ4 A;  4GHI B;  5EM1 A;  3ITB A;  4F3L B;  4EW7 A;  1OME A;  3VP1 A;  4E3K A;  3NUL A;  5KSC A;  3CAX A;  3TW8 A;  3HUN A;  1T1B A;  2JN7 A;  1FIK A;  3G31 A;  3WRT A;  1T19 A;  2XA7 S;  1OPX A;  4WF0 A;  2RL3 A;  2VGL S;  2LB5 A;  3MXQ A;  2OWH A;  3V3S A;  4G3W A;  5DJU A;  2ZM8 A;  3CPT A;  3RH8 B;  2K31 A;  2PD8 A;  1VET A;  1FR6 A;  5FL3 A;  2XD1 A;  2Q9N A;  3QNC A;  2Y91 A;  2PU4 A;  2XLN A;  2P74 A;  3E4O A;  2V9A A;  1DP6 A;  4Y15 A;  1KDS A;  1JTD A;  3ZYT A;  4R3B A;  4P0M A;  1Z09 A;  5HPI A;  3CG5 A;  4ZJ3 A;  4L9E A;  5HAP A;  3A0V A;  5G18 A;  3NY4 A;  3S7N A;  5CER A;  2A49 A;  1G5U A;  4RQ9 A;  2FH5 A;  4R70 A;  5FQK A;  3IH8 A;  5HWV A;  4LV2 A;  4FOF A;  3K3C A;  4KUO A;  2A24 A;  2JKR I;  4GN2 A;  1BTL A;  1SKO B;  4HH3 A;  1QMF A;  3SH8 A;  4WYY A;  1LL8 A;  1S1Y A;  2HZ5 A;  3GR2 A;  2XRO A;  5DKL A;  1PIO A;  5HAQ A;  4DRT A;  3F1O B;  5CTN A;  2WGW A;  3M6H A;  4P87 A;  4MBF A;  5E43 A;  4F94 A;  3T1X A;  4YOF A;  1JVJ A;  3MS6 A;  3EQV A;  4GZB A;  4WZ5 A;  4KZ7 A;  5F1G A;  4I5S A;  2JKG A;  2ZM2 A;  4R0Q A;  3NOU C;  2QZ6 A;  3RXW A;  1CI8 A;  5E2G A;  2PU2 A;  3NEC A;  1P9R A;  4RX3 A;  4O0P A;  4DE2 A;  3LO7 A;  5E2E A;  4HP9 A;  3F1P A;  3LY3 A;  2P7J A;  1BZA A;  2JKR M;  2Q9M A;  4O01 A;  1NLY A;  3MKE A;  1GSV A;  2XFT A;  3C38 A;  4LEN A;  1ONG A;  3P7N A;  4EXO A;  5DTT A;  1LSX A;  1UWN X;  1PWG A;  3H7W B;  1W7F A;  3NJA A;  1VHM A;  2UV0 E;  4DMZ A;  4ZDX A;  3GV9 A;  3PBO A;  2PR5 A;  2Y2N A;  4X25 A;  3LUQ A;  4OP8 A;  3ZVT A;  3JYI A;  1JWV A;  4R38 A;  1KGG A;  4E3L A;  4JF4 A;  3ZG9 B;  2Y79 A;  1YSP A;  4I3J A;  2Y2O A;  4CLC E;  4B4Z A;  4KG2 A;  3BY8 A;  2V8C A;  1E3U A;  3BFF A;  5TJJ A;  4EBL A;  1TEM A;  2PT7 A;  4U3T A;  3KSG A;  4RVA A;  1IEL A;  2ZC6 B;  1V9Y A;  1XPB A;  3U2A A;  5L8M A;  4KQR A;  3VP4 A;  3JPU A;  5AVF A;  3GVB A;  1YLZ A;  5DJT A;  1BLS A;  4DJ2 A;  1NYM A;  2XD5 A;  4OPZ A;  1YAX A;  3LR4 A;  3ZGA B;  4EU0 A;  2UWX A;  1OT9 A;  2O9C A;  1ES3 A;  5EEC A;  5TGF A;  4Y7P A;  5HFO A;  1YPR A;  2XF3 A;  5K5B A;  4WBG A;  4FH2 A;  3OCN A;  1IYQ A;  5HWT A;  2ZM0 A;  1KE4 A;  4R23 A;  2EWV A;  3AGE A;  4KG5 A;  3FPW A;  4QY6 A;  5MC7 A;  3ZFZ A;  5DFX A;  3HLG A;  1RCJ A;  1P97 A;  3ZG7 B;  1LSV A;  4IJG A;  2VLG A;  4HBT A;  3D9Y A;  3MSH A;  3PBN A;  4DKI A;  3NI9 A;  2HV1 A;  1JWZ A;  1O7E A;  1GHM A;  3LIF A;  3C7V A;  2BG1 A;  2H10 A;  4C75 A;  3HBR A;  2HP5 A;  1K4E A;  5FQ9 A;  3WS5 A;  4E3M A;  2W1R A;  3BY9 A;  4KZ8 A;  5HX9 A;  1PYY A;  4KZ4 A;  5M19 A;  4DE1 A;  1ERO A;  3TE8 A;  4KZA A;  1N9N A;  3V50 A;  4HP4 A;  2IA2 A;  4IHQ A;  2EA9 A;  4ZBE A;  1NYY A;  5EVI C;  4CLC D;  3T4K A;  3IHA A;  2A3U A;  1NRJ A;  2J3W A;  2B18 A;  1VEU B;  5EUA A;  4I3I A;  3VE3 A;  1W8Y A;  1TD5 A;  3L9K A;  2P9V B;  4UQI M;  3PBS A;  2JKF A;  5EOE A;  1S4S A;  5TBM A;  4M4X A;  1FCN A;  1S4R A;  1XGI A;  3UE6 A;  3S7Q A;  2M7V A;  1XJ4 A;  3O86 A;  1BT5 A;  3T4O A;  4BWI A;  3Q82 A;  4PM8 A;  2H0T A;  4UAA A;  1N4O A;  2V2F F;  3G6O A;  3WS4 A;  5JYP A;  4EBP A;  3ZCZ A;  3BLM A;  1I2W A;  5HWW A;  3UN7 A;  1PZO A;  2DRW A;  1FIL A;  4WM9 A;  5IHV A;  3KYQ A;  5HPF A;  4F3L A;  1K54 C;  3PHY A;  4ZAM A;  1ALQ A;  4KUK A;  1DP9 A;  3MMH A;  3V39 A;  4HI4 A;  4DE0 A;  2EFU A;  3CWF A;  2QKP A;  1BUE A;  1FSW A;  1W8Q A;  1T18 A;  4KQD A;  5J7E A;  2QJ7 A;  5EVI B;  3V67 A;  3VE4 A;  3VOL A;  4HH2 A;  1U60 A;  5HL6 A;  3DTI A;  1Q2P A;  5FAO A;  3IHB A;  3KSF A;  4H6J A;  3DWK A;  4KG6 A;  4MCW A;  2XA7 M;  1MKM A;  4JGQ A;  2ZOH A;  2VGL M;  2JCH A;  4BL2 A;  1VQQ A;  2ZQ9 A;  1ESU A;  1C3B A;  3Q07 A;  2X02 A;  1TF1 A;  3FWL A;  2WAE A;  3IWO A;  3N8S A;  1MKI A;  3RXX A;  2VV6 A;  1DY6 A;  3NCK A;  1HD8 A;  1LSW A;  2Y2K A;  3OBF A;  4NXG A;  2KDK A;  1CK3 A;  3C2W A;  2AVX A;  2QHK A;  1MWS A;  4QHC A;  4RA7 A;  4LCM A;  4X6T A;  4E6W A;  3QP6 A;  3ZNT A;  3G2Y A;  1H8Z A;  4QWO A;  3S22 A;  3W4O A;  1ONH A;  3BQA A;  1CJF A;  4ETZ A;  4XT2 B;  3IF6 C;  4OQG A;  4WEK A;  2V0W A;  4G3V A;  2Y2P A;  3MKF A;  2PRF A;  3UO9 A;  3HUM A;  2ZC5 B;  4Y0U A;  1E3U D;  1PW1 A;  3VOY A;  1H8Y A;  3O87 A;  3BM6 A;  2IWD A;  4MDZ A;  3N8L A;  4X1L A;  3OPR A;  1RGY A;  4NXE A;  1SHV A;  2FFY A;  1CEF A;  2O0Y A;  3LR0 A;  2JHE A;  4EQ1 A;  3MFD A;  5CXW A;  1H3Q A;  3LI9 A;  3MXS A;  3KSH A;  2OWJ A;  2VEA A;  4GLQ A;  3UPN A;  1LT0 A;  3T50 A;  3RJU A;  2BAS A;  1HTZ A;  2VV8 A;  1OTA A;  3UE3 A;  4C3Q A;  4MLL A;  4DF6 A;  5A90 A;  4U0X A;  4MNR A;  5M18 A;  2V0U A;  4IBR A;  3F1N A;  5TFQ A;  1NJ4 A;  2G7U A;  3A3I A;  3N4I A;  4ESP A;  5FQJ A;  3JVU A;  3E0Y A;  2D02 A;  3I7J A;  2GNX A;  4OKP A;  4IUH A;  5CX7 A;  2Y2L A;  2JBF A;  3T4S A;  4FTX A;  3EQU A;  2WKI A;  4D60 A;  3K2N A;  4GS9 A;  3OC2 A;  1Y28 A;  3FZC A;  2J9O A;  2RCX A;  4O7D A;  4BMW A;  4LRX C;  5LBR A;  3MQ0 A;  2GJ3 A;  5EFW A;  3IF6 B;  4PKY G;  3R7W B;  3WRZ A;  3G4P A;  5F6A A;  4KZ3 A;  3TJZ C;  3IS2 B;  2HGV A;  5FEF A;  5CTM A;  1P9W A;  4DDY A;  3UB6 A;  1GHP A;  3IBJ A;  5FAS A;  3HLE A;  2ZMA A;  3Q81 A;  4P6B A;  5HW3 A;  4Q0H A;  2O9B A;  1M40 A;  2KX6 A;  1NXY A;  4DDS A;  5FDS A;  5E2H A;  5AVE A;  5BOH A;  2WAD A;  5DF8 A;  1JNU A;  2JKT M;  1BLP A;  2XFS A;  3Q7V A;  5HAI A;  4K0X A;  1BSG A;  4BEN A;  2M7U A;  5DFY A;  1HLU P;  1S66 L;  2ZL1 B;  2XQZ A;  1VM1 A;  4Y13 A;  1PW8 A;  1IYS A;  4CLC A;  1L0F A;  4GDB A;  4MMN A;  2C5W B;  3D4F A;  3A3E A;  4S2M A;  4OVD A;  4IUK A;  1EI5 A;  2EWW A;  2ZC3 B;  3E2K A;  4WN5 A;  3ZVW A;  1GCE A;  4KQO A;  2WK0 A;  3NBL A;  4OQI A;  1T1C A;  2O9A A;  1CI9 A;  4EUV A;  3T4L A;  1ODV A;  1QME A;  2GZA A;  3UB9 A;  2HDS A;  3LIE A;  3IBR A;  5L2F A;  2PD7 A;  1XP4 A;  3AGD A;  1PZP A;  5GLC A;  1IFQ A;  4EWF A;  3WS0 A;  2ACG A;  2PBY A;  3HLD A;  4Q8I A;  3VFH A;  1ES4 A;  5FAQ A;  2MJ6 A;  2OLV A;  3C4P A;  2VA0 A;  5FDH A;  1F2K A;  1MXO A;  2CC1 A;  4WEJ A;  3WWX A;  4Y3I A;  4BQM A;  1WE4 A;  1F98 A;  3OCL A;  4KZ6 A;  2W0N A;  4D2O A;  3G32 A;  2HJE A;  1XXM A;  3PTE A;  1FCM A;  2ZC4 B;  1XA7 A;  5A92 A;  1YT4 A;  3V5M A;  4ZRR A;  5A8B A;  1LL5 A;  2HPB A;  3IXB A;  2Y55 A;  3P09 A;  1XGJ A;  2X01 A;  3Q7Z A;  3BEC A;  4OH0 A;  1IEM A;  1XA1 A;  2YKF A;  4N92 A;  5EE8 A;  1IOU A;  2PAV P;  5CHM A;  3O5Y A;  1XKZ A;  3ITA A;  1K0K A;  1J9M A;  1D06 A;  2K7S A;  3C7U A;  4Z9Q A;  3B3X A;  3A0R A;  2Y4A A;  4Y17 A;  4H8R A;  3BEB A;  2Z6D A;  1VEU A;  4GD8 A;  4CLC C;  3UE1 A;  1MBL A;  5AJG A;  1ZG6 A;  3S7P A;  2D01 A;  4X1M A;  4LV3 A;  3N7W A;  4GCZ A;  3N8R A;  1NZO A;  2WKQ A;  3EEA A;  4PKY A;  2ZMV A;  5CRF A;  4JXG A;  2WKP A;  1PNE A;  4GOG A;  3E2L A;  4BD0 A;  3UME A;  3UY6 A;  1XJ3 A;  3BFE A;  1WYB A;  4OPR A;  3UPO A;  5GLB A;  4QD4 A;  4QPR A;  2ZMF A;  4R3J A;  1N9L A;  3P01 A;  1OTD A;  3OPP A;  1E25 A;  1MC0 A;  3MXR A;  4CJN A;  3IX8 A;  4HY8 A;  3LEZ A;  4S2N A;  2J9P A;  3IF5 A;  1F5M A;  4OPY A;  3KO6 A;  5F69 A;  3HLF A;  2W3D A;  5GHZ A;  4B93 A;  3LR5 A;  4X69 A;  3UE0 A;  4FH4 A;  4FUW A;  2JC7 A;  2XSS A;  4WL9 A;  4I38 A;  4WZ5 C;  4XUZ A;  3ULF A;  3NC8 A;  1PRQ A;  3CPT B;  4FD8 A;  4E6X A;  1KVM A;  1SDE A;  2ZQD A;  4BJP A;  3D72 A;  4PMA A;  3E98 A;  4K91 A;  1GSW A;  3OPL A;  1S0W A;  2XK1 A;  3GMW A;  1TS0 A;  4IBX A;  5HDC A;  3MQQ A;  3V3R A;  3NOT C;  1W63 Q;  1NRF A;  2L1M A;  1S1Z A;  4KEN B;  5EPH A;  3C30 A;  4HEF A;  2IWB A;  3VP2 A;  3BFD A;  4RX2 A;  4PM6 A;  3M6B A;  3VSK A;  4JF5 A;  1L0G A;  2XDM A;  1YQS A;  1K57 A;  3FG8 A;  4S2J A;  4IVK A;  3MFX A;  1KE3 A;  4FSF A;  3PBT A;  3OLO A;  3T4Q A;  5EM0 A;  2A24 B;  3Q1F A;  1T1A A;  3PBR A;  1Y54 A;  1BLC A;  2B5R A;  1KVL A;  1ERM A;  4CPK A;  2B95 A;  4DE3 A;  3FC7 A;  3H82 A;  4ARZ A;  3EWK A;  1W5D A;  1MWT A;  2H5S A;  4S2O A;  3U4L P;  4N1H A;  3HJK A;  1ZC2 A;  3G2Z A;  2WGW B;  2Y2M A;  3TOI A;  4BBT A;  4Q0J A;  4S2P A;  4Y2F A;  4S2N C;  2BLS A;  5FAT A;  4JPM A;  2Z6C A;  1UWP X;  1FR1 A;  1NLZ A;  1BUL A;  2J80 A;  3P98 A;  4NXB A;  1X0O A;  4WEL A;  1SDN A;  4E3N A;  3CZD A;  2INW A;  4AFI A;  1KGE A;  3BJN A;  4EBN A;  2EXB A;  2VGK A;  2OLU A;  1IKI A;  1MWU A;  2OSU A;  3BLS A;  4BBV A;  4ETX A;  4JGO A;  4DXC A;  1K55 A;  3HRE A;  5FI6 A;  3OZH A;  4E3I A;  1MPL A;  3BRM A;  2WZX A;  5DF7 A;  2K2N A;  2XR0 A;  2L4R A;  3NHQ A;  4OQ0 A;  1K57 C;  2OAP 1;  4MEZ A;  1PFL A;  3R7W A;  3DBA A;  4GHI A;  3VV4 A;  1KDW A;  5GHX A;  3HJI A;  1PWD A;  5M1A A;  4K08 A;  4JGP A;  4LRZ E;  4YWZ A;  5FQI A;  2A2L A;  4JXW A;  2OOL A;  4MN5 A;  1YLP A;  3IWI A;  4ZJ2 A;  1Y4O A;  3NDE A;  1ESI A;  4E3O A;  4UA6 A;  1MY8 A;  1MZU A;  3T1Q B;  3A3F A;  5KSH A;  1IYP A;  2KLI A;  5I94 A;  4WLA A;  4EEP A;  3MF0 A;  3S7O A;  3ZHH A;  1TVF A;  3FV7 A;  3QP8 A;  1KGF A;  3O88 A;  1UGU A;  3IXG A;  1IYO A;  5J8X A;  1XJ6 A;  2W3F A;  2PDR A;  1GA0 A;  4O8G A;  2FFF B;  2H28 A;  2KOI A;  3T12 B;  3PBQ A;  3LR3 A;  1FSY A;  3BYD A;  4MBK A;  5GLD A;  2XEP A;  1TS7 A;  1F9I A;  4ME4 A;  1TDG A;  1D7E A;  4U0T A;  3UB5 P;  1SZV A;  3TRC A;  5DVA A;  1K4F A;  3IX3 A;  4NXF A;  4R6L A;  2WKH A;  2ZD8 A;  3UMD A;  5HD5 A;  4P85 A;  1A0K A;  1XFN A;  4WZ4 A;  3BQ8 A;  3B33 A;  3T1S A;  3MBZ A;  5EV0 A;  2Z2L B;  3LID A;  2Y8H A;  1SKO A;  2DMW A;  2QMI A;  2XGN A;  4PPR A;  4XXR A;  3UDF A;  1OTB A;  5I5L A;  3F1O A;  5F68 A;  1P0Z A;  4E3J A;  4NEE D;  2J7V A;  3CMZ A;  2PHY A;  5EVI D;  4M3K A;  1Q2Q A;  2PYR A;  1YLW A;  3DTM A;  4L9F A;  5C5K A;  5FSR A;  1YMX A;  3S4X A;  4UEY A;  2W1T B;  1NZU A;  3DTE A;  1PI5 A;  3ISG A;  2HDU A;  4FCF A;  5J4E A;  4IED A;  3UB8 A;  5J3W A;  5U47 A;  1TS6 A;  5FQQ A;  1CF0 A;  5HL1 A;  5F82 A;  1CEG A;  5TBM B;  3GDI A;  3K3D A;  4NET A; 
#chains in the Genus database with same CATH homology
 5HFO A;  3PTE A;  1ZKJ A;  5DF9 A;  1FCM A;  2ZC4 B;  2XF3 A;  1XA7 A;  4XUX A;  2EX6 A;  5AQB A;  2Y2I A;  5A92 A;  4WBG A;  1ES2 A;  4FH2 A;  1GHI A;  1DJC A;  1YT4 A;  4HES A;  1FOF A;  3OCN A;  1IYQ A;  5KMW A;  2ZM0 A;  1LL9 A;  3IXD A;  3UDX A;  3V5M A;  1KE4 A;  4R23 A;  3VP3 A;  3ZNY A;  3AGE A;  1LL5 A;  2HPB A;  4GD6 A;  2G2U A;  4UA9 A;  4KG5 A;  4QY6 A;  3IXB A;  3HUO A;  4EUZ A;  1M6K A;  2Y55 A;  3LCE A;  3ZFZ A;  4PM5 A;  3P09 A;  1K38 A;  1YMS A;  1XGJ A;  3HLG A;  3VP0 A;  4EQI A;  2EXA A;  5EVL A;  3Q7Z A;  1RCJ A;  3BEC A;  4OH0 A;  4QY5 A;  2X01 A;  1IEM A;  2J8Y A;  2ZQ7 A;  3ZG7 B;  3UNW A;  4HBT A;  4N1X A;  3FYZ A;  1XA1 A;  2WYX A;  1XX2 A;  3AGF A;  3PBN A;  4N92 A;  3NI9 A;  5EE8 A;  4DKI A;  3VSL A;  5CHM A;  1XKZ A;  2WAF A;  3ITA A;  3A3J A;  3BFC A;  1DJA A;  1JWZ A;  1O7E A;  1AXB A;  1GHM A;  1J9M A;  2BG1 A;  3C7V A;  4Z9Q A;  2H10 A;  3C7U A;  4OP5 A;  5D3O A;  3B3X A;  3N6I A;  4C75 A;  1FQG A;  3SS4 A;  4Y0T A;  3HBR A;  2Y4A A;  2HP6 A;  2HP5 A;  4H8R A;  3BEB A;  4GD8 A;  4B88 A;  1K4E A;  4UHU A;  3VOZ A;  5FAP A;  5FQ9 A;  3UE1 A;  3WS5 A;  2EX8 A;  3DW0 A;  4QU3 A;  4A5R A;  1MBL A;  4E3M A;  4OQH A;  5CGW A;  2WGV A;  1ZG6 A;  2WUQ A;  2XH9 A;  1O07 A;  4C6Y A;  4KZ8 A;  4OON A;  4LV3 A;  4R1G A;  3OPH A;  5HX9 A;  1PYY A;  3N7W A;  1RGZ A;  4KZ4 A;  4OLG A;  5M19 A;  3N8R A;  4DE1 A;  1ERO A;  1NZO A;  5CRF A;  4KZA A;  2H0Y A;  2ZQC A;  4JXG A;  4S2K A;  1PWC A;  2EX2 A;  1K55 C;  1K6R A;  1PI4 A;  4ZJ1 A;  3V50 A;  4GOG A;  3E2L A;  4BD0 A;  1DJB A;  4ZBE A;  1NYY A;  5EVI C;  1K56 A;  3IHA A;  4BL3 A;  3SH9 A;  3UY6 A;  3BFE A;  2A3U A;  2EFX A;  1WYB A;  4OPR A;  1LI0 A;  5AQ9 A;  3UPO A;  5EUA A;  5GLB A;  4QD4 A;  4PM7 A;  3QNB A;  3W8K A;  3ZG0 A;  3FKW A;  3PAG A;  4R3J A;  3HL9 A;  1W8Y A;  2Y2J A;  2I72 A;  2P9V B;  5A93 A;  3OPP A;  1E25 A;  5GLA A;  1YLT A;  3PBS A;  3MXR A;  4CJN A;  4S2N A;  3LEZ A;  4JBF A;  4X55 A;  1HZO A;  2J9P A;  1JTG A;  3IF5 A;  5EOE A;  4OPY A;  2WZZ A;  1EWZ A;  3UDI A;  3HLF A;  5GHZ A;  3G30 A;  1FCN A;  4KQQ A;  4X69 A;  3UE0 A;  1XGI A;  5GL9 A;  1E4D A;  4FH4 A;  3VFF A;  4K0W A;  4HBU A;  2JC7 A;  3O86 A;  1BT5 A;  3G34 A;  4OOL A;  3O3V A;  3CJM A;  3Q82 A;  2OV5 A;  4WZ5 C;  4XUZ A;  5DTK A;  4PM8 A;  3NC8 A;  5F83 A;  2H0T A;  2X71 A;  4FD8 A;  4UAA A;  4OOY A;  1N4O A;  1YLJ A;  4E6X A;  1KVM A;  1SDE A;  2V2F F;  4PM9 A;  3WS4 A;  2ZQD A;  3NDG A;  4BJP A;  5JYP A;  4EBP A;  3ZCZ A;  4PMA A;  2DNS A;  4K91 A;  3BLM A;  4JXS A;  4LV0 A;  4S2I A;  3OPL A;  1S0W A;  2XK1 A;  2V20 A;  3GMW A;  4YFM A;  2ZLY A;  3GRJ A;  5A91 A;  1I2W A;  4JF6 A;  2R9X A;  3UN7 A;  4EV4 A;  3VMA A;  4IBX A;  1PZO A;  3W4Q A;  2DRW A;  3QHY A;  3V3R A;  4WM9 A;  5IHV A;  3GSG A;  3C4O A;  4S2L A;  5FQM A;  3S1Y A;  3HLW A;  3GQZ A;  4B4X A;  1K54 C;  1NRF A;  3ZG5 A;  4ZAM A;  1ALQ A;  4KEN B;  5EPH A;  4HEF A;  4JKT A;  2IWB A;  3VP2 A;  3BFD A;  1L0D A;  4RX2 A;  4PM6 A;  3V39 A;  3M6B A;  3VSK A;  4JF5 A;  1L0G A;  1SCW A;  1ZG4 A;  1TDL A;  5JYO A;  5CEC A;  4DE0 A;  3HLC A;  1LI9 A;  2EFU A;  2XDM A;  3NIA A;  4OPQ A;  1BUE A;  1FSW A;  1YQS A;  1IKG A;  1W8Q A;  1K57 A;  1L2S A;  2Z2M B;  5EVI B;  4S2J A;  4IVK A;  4DXB A;  1L0E A;  4WMC D;  5FI2 A;  1KE3 A;  4FSF A;  3PBT A;  1HVB A;  1U60 A;  2C6W B;  3WS1 A;  1Q2P A;  5FAO A;  3IHB A;  4KG6 A;  4N9K A;  3DWK A;  3Q1F A;  4QB8 A;  3SH7 A;  1YM1 A;  3PBR A;  4RYE A;  4GB7 A;  1Y54 A;  1BLC A;  2B5R A;  2HDQ A;  1KVL A;  2JCH A;  4BL2 A;  1VQQ A;  1ERM A;  2ZQ9 A;  1ESU A;  1C3B A;  1H5X A;  4CPK A;  3Q07 A;  2X02 A;  4DE3 A;  2QPN A;  2DCF A;  3ITB A;  3FWL A;  2WAE A;  3IXH A;  1W5D A;  3IWO A;  1MWT A;  2H5S A;  3N8S A;  1MKI A;  3RXX A;  1OME A;  1DY6 A;  3NCK A;  2P9V A;  4S2O A;  3VP1 A;  3FKV A;  4N1H A;  4E3K A;  5KSC A;  1ZC2 A;  3HUN A;  1HD8 A;  4X53 A;  5AQA A;  3G2Z A;  2Y2K A;  2WGW B;  3G31 A;  1G68 A;  1SKF A;  2Y2M A;  3DWZ A;  3TOI A;  1CK3 A;  4S2P A;  3WRT A;  3W4P A;  4S2N C;  2BLS A;  5FAT A;  1MWS A;  4QHC A;  4RA7 A;  5HAR A;  4JPM A;  5CEB A;  3IH9 A;  2RL3 A;  4LCM A;  4IVI A;  4NK3 A;  1FR1 A;  4X6T A;  4E6W A;  3ZNT A;  3G2Y A;  1BUL A;  1K56 D;  1H8Z A;  5FI7 A;  3V3S A;  4JXV A;  3S22 A;  3P98 A;  2ZM8 A;  3W4O A;  1I2S A;  2E8I A;  5CED A;  1ONH A;  1FR6 A;  2HP9 A;  2XD1 A;  2Q9N A;  3QNC A;  2EX9 A;  4KZ5 A;  2Y91 A;  2PU4 A;  2XLN A;  3IF6 C;  2P74 A;  4OQG A;  4WEK A;  3BFG A;  3M2J A;  4WEL A;  2Y2P A;  1I5Q A;  3SS5 A;  1SDN A;  3MKF A;  3UO9 A;  4E3N A;  3CZD A;  3HUM A;  2ZC5 B;  4Y0U A;  1E3U D;  1KDS A;  1PW1 A;  4BLM A;  1K6S A;  2Y2Q A;  3VOY A;  1JTD A;  1H8Y A;  2ZQ8 A;  3O87 A;  3BM6 A;  4R3B A;  4P0M A;  1KGE A;  2IWD A;  3CG5 A;  3N8L A;  2EXB A;  4EBN A;  2ZJ9 A;  3OPR A;  1RGY A;  3G35 A;  2VGK A;  3LY4 A;  4ZJ3 A;  5GHY A;  5HAP A;  5G18 A;  1SHV A;  3UPP A;  2OLU A;  3NY4 A;  2FFY A;  4KZ9 A;  1IKI A;  1CEF A;  5CER A;  2A49 A;  1MWU A;  2OSU A;  3BLS A;  5EOO A;  4QJG A;  4DXC A;  3MFD A;  5F1F A;  1K55 A;  3IH8 A;  5FQK A;  3HRE A;  5FI6 A;  2HDR A;  3OZH A;  5CXW A;  4E3I A;  3Q7V B;  1MPL A;  3MXS A;  1JWP A;  1RP5 A;  5EVI A;  3BRM A;  5CHU A;  1MWR A;  2WZX A;  5DF7 A;  4LV2 A;  2XR0 A;  3UPN A;  3RJU A;  1HTZ A;  5AQ7 A;  3UE3 A;  4OQ0 A;  4C3Q A;  4MLL A;  4DF6 A;  5A90 A;  1K57 C;  4MNR A;  4U0X A;  4UA7 A;  5M18 A;  4IBR A;  4MEZ A;  5TFQ A;  1NJ4 A;  3A3I A;  3N4I A;  4GN2 A;  1BTL A;  1G6A A;  5CGX A;  5FQJ A;  5FA7 A;  1KDW A;  5GHX A;  4L0L A;  3I7J A;  1QMF A;  4YIN A;  3SH8 A;  4WYY A;  4OKP A;  3GR2 A;  1PIO A;  3PAE A;  3IT9 A;  1PWD A;  5HAQ A;  5M1A A;  4DRT A;  5FQI A;  2VGJ A;  1WYC A;  1LLB A;  5CTN A;  2WGW A;  2Y2L A;  3M6H A;  4P87 A;  2IWC A;  4OLD A;  2JBF A;  4JXW A;  4MBF A;  5E43 A;  4F94 A;  1YLP A;  3MZE A;  3IWI A;  1JVJ A;  5EEC A;  3EQU A;  4ZTK A;  3EQV A;  2WKI A;  4ZJ2 A;  4GZB A;  3SS3 A;  4WZ5 A;  3OC2 A;  3NDE A;  2G2W A;  3C5A A;  1ESI A;  3FZC A;  4E3O A;  4UA6 A;  2J9O A;  4KZ7 A;  1MY8 A;  2RCX A;  5F1G A;  4O7D A;  3A3F A;  1N9B A;  5KSH A;  1GA9 A;  1IYP A;  5I94 A;  2GDN A;  2ZM2 A;  3IF6 B;  4R0Q A;  3WRZ A;  1K25 A;  2QZ6 A;  2WKE A;  3G4P A;  3RXW A;  5TR7 A;  3SOI A;  1CI8 A;  4KZ3 A;  5E2G A;  2PU2 A;  3ZHH A;  1TVF A;  4LV1 A;  3FV7 A;  4RX3 A;  2V1Z A;  5CTM A;  4LCL A;  4DDY A;  4OOM A;  4DE2 A;  4WMC A;  3LO7 A;  2R9W A;  1GHP A;  1KGF A;  3O88 A;  5E2E A;  1KE0 A;  3IXG A;  4GKU A;  1IYO A;  1ES5 A;  4ID4 A;  3HLE A;  2ZMA A;  5FAS A;  3LY3 A;  5J8X A;  4MBH A;  1K54 A;  1BZA A;  3Q81 A;  2Q9M A;  4P6B A;  1GA0 A;  5HW3 A;  3MKE A;  2FFF B;  1M40 A;  5DTS A;  2XFT A;  2Y2H A;  3PBQ A;  4LEN A;  1ONG A;  1FSY A;  3ZG8 B;  3BYD A;  5CGS A;  4MBK A;  2WGI A;  5GLD A;  1NXY A;  4DDS A;  2XEP A;  3ZDJ A;  5E2H A;  3HVF A;  1NY0 A;  2WAD A;  4GNU A;  5BOH A;  1TDG A;  5DTT A;  4U0T A;  5DF8 A;  1PWG A;  1W7F A;  1BLP A;  3TSG A;  2XFS A;  5TGF A;  1S6R A;  4R4S A;  5DVA A;  4X68 A;  5E2F A;  1K4F A;  3Q7V A;  5HAI A;  4K0X A;  2WKH A;  5KZH A;  5CHJ A;  1BSG A;  2ZD8 A;  4BEN A;  4ZDX A;  3GV9 A;  3GTC A;  2XQZ A;  1VM1 A;  3PBO A;  4P85 A;  4Y0O A;  1PW8 A;  4WZ4 A;  4JLF A;  1IYS A;  2Y2N A;  1L0F A;  4GDB A;  2C5W B;  3D4F A;  3A3E A;  1ERQ A;  3MBZ A;  4S2M A;  4OP8 A;  2Z2L B;  4OVD A;  4BD1 A;  4R4R A;  3ZVT A;  3IQA A;  3JYI A;  2JE5 A;  1JWV A;  1EI5 A;  2ZC3 B;  1KGG A;  3E2K A;  4E3L A;  4JF4 A;  3ZG9 B;  2QMI A;  3ZVW A;  1W79 A;  1GCE A;  2XGN A;  4KQO A;  2WK0 A;  1BLH A;  2Y2O A;  3NBL A;  4OQI A;  4PPR A;  4B4Z A;  3HLB A;  4XXR A;  3UDF A;  4KG2 A;  1CI9 A;  1E3U A;  3BFF A;  1QME A;  4EBL A;  1TEM A;  4E3J A;  2HDS A;  2J7V A;  3CMZ A;  4U3T A;  4RVA A;  4X56 A;  4KZB A;  5EVI D;  1IEL A;  2ZC6 B;  4M3K A;  1YLY A;  3WS2 A;  1XP4 A;  5L2F A;  1Q2Q A;  2Y59 A;  1XPB A;  3AGD A;  1PZP A;  3M2K A;  5GLC A;  4N9L A;  4EWF A;  1YLW A;  1FCO A;  3WS0 A;  3IWQ A;  4KQR A;  3DTM A;  3VP4 A;  2PBY A;  3GVB A;  5FSR A;  3HLD A;  1YLZ A;  2ZC7 A;  4GDN A;  4Q8I A;  3VFH A;  3IF6 A;  1YMX A;  3S4X A;  1ES4 A;  5FAQ A;  2ZQA A;  1NZU A;  1BLS A;  1NYM A;  2OLV A;  2XD5 A;  1PI5 A;  3MZD A;  4OPZ A;  3C4P A;  3ISG A;  1LHY A;  2HDU A;  5FDH A;  2CC1 A;  1MXO A;  4FCF A;  4WEJ A;  3WWX A;  4IED A;  5U47 A;  3TG9 A;  4BQM A;  5FQQ A;  1WE4 A;  3A3D A;  3OCL A;  4KZ6 A;  5HL1 A;  2Y2G A;  3MZF A;  5F82 A;  1CEG A;  4D2O A;  1Z6F A;  3G32 A;  3ZGA B;  2UWX A;  1ES3 A;  4NET A;  1XXM A;  4Y7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...