5KIZA

Solution structure of a repacked version of hif-2 alpha pas-b
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
114
structure length
114
Chain Sequence
GEFLDSKTFLSRFSMDMKFTYCDDRITELIGYHPEELLGRSASEFWHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQMTVIYNPRNLQPQCIMAVNYVLSEIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Endothelial PAS domain-containing protein 1
publication title Repacking of internal hydrated HIF-2 alpha cavity removes allosteric binding site
rcsb
source organism Homo sapiens
total genus 33
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2016-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5kizA00
3MFXA 4HH3A 3NOPC 2R78A 3CLOA 3RH8B 1UWNX 2QWSA 4MN5A 1LSVA 3GECA 1T18A 3F1NB 1XJ4A 1S4RA 4GHIB 3HJIA 2L1MA 1S1ZA 2VV7A 2PR5A 1N9NA 4HNBA 4E04A 2M1CA 4HP9A 4I3IA 4NXFA 4BBUA 5J4EA 1G28A 5IS1A 3KX0X 4H6JB 1BYWA 3F1PA 4HI4A 3E4QA 4BBVA 2QJ5A 5HWTA 3LI9A 2KX6A 3EWKA 4KQDA 3MJQA 3HJKA 4BBTA 5HSQA 4NXEA 3K3DA 1MZUA 5HDDA 5HD3A 2PYRA 4GS9B 2ZBBA 3H82B 2PD8A 2ZOIA 4HP4A 3LUQA 1F9IA 4F3LB 3MQQA 4R3AA 2J80A 2PD7A 1V9YA 2OWHA 1XJ3A 3BY8A 1OTAA 2I9VA 4JGPA 5DJTA 5KIZA 3E4PA 3IS2A 4HJ6A 5F69A 3C2WA 2PR6A 1DP9A 1Y28A 3CWFA 4I38A 1F98A 2INWA 4HH2A 2VV8A 3H7WA 3NJAA 2QJ7A 3UB8A 4KUOA 3G6OA 4WUJA 3FC7A 2B02A 1D06A 2D02A 4WLAA 1S1YA 2VLGA 4LPZA 1DP6A 4JGQA 1VB6A 2WKRA 3UB7A 2A24A 3K3CA 3BWLA 1T1BA 4R6LA 4GW9A 4I39A 1EW0A 4L9GA 4K08A 4KUKA 4B9OA 3ICYA 2V1AA 4L9EA 5TBMA 2CMNA 2K7SA 4EW7A 2V9AA 4LLOB 1T19A 1S67L 5F68A 1GSVA 2W27A 4WF0A 1X0OA 2PHYA 4HIAA 1N9OA 3MQOA 1LL8A 3A0RA 5HWVA 5HDSA 4HOIA 3OLOA 2BASA 5DKKA 4XT2A 2V1BA 5F5YA 2PYPA 3P7NA 2JHEA 1D7EA 2VV6A 2L0WA 3F1OA 2Z6DA 5J7EA 1XJ2A 1TS8A 3UE6A 2V0WA 3LYXA 4HJ3A 1JNUA 1ODVA 4L9FA 4LRXC 5AVFA 1OTIA 3LI8A 2D01A 4F3LA 3D72A 2EA9A 3VOLA 1KOUA 1NWZA 1LT0A 2HV1A 4LRZE 2QHKA 1LSWA 4GCZA 3F1PB 3E4OA 5J3WA 1T1CA 1OTDA 1OTEA 3A0SA 3RTYA 4PKYG 3LIFA 1XFNA 3UMDA 2L4RA 2KDKA 1TS6A 1OJGA 3H9WA 1GSWA 3LIDA 3VE4A 1TS7A 4EETB 1V9ZA 4I3JA 2OOLA 4JGOA 5I5LA 5DKLA 3GDIA 3F1NA 4RQ9A 3FG8A 1LSXA 4GHIA 3IBRA 5DJUA 4YWZA 1TS0A 1DRMA 1S4SA 3UMEA 3IS2B 4EEPA 1OJ5A 5HZHA 1T1AA 5EFWA 3VE3A 2QKPA 3T50A 3H7WB 5HD5A 4H6JA 2GJ3A 3CAXA 3LIAA 3ULFA 5IU1A 2YKHA 3NOTC 2A24B 2H28A 2JN7A 3MR0A 3LIBA 1S66L 3UB9A 3PYPA 3SW1A 4WN5A 5TBMB 4EERA 3BY9A 2WKPA 2P7JA 4GS9A 4LRYC 2Z6CA 4I3AA 4WL9A 3H82A 3ZQ5A 4NXBA 4PKYA 1XFQA 4DJ2A 3UB6A 3LICA 5G4ZA 1GSXA 5F6AA 1DP8A 4HQAA 4XT2B 1OT9A 2V0UA 2VEAA 2PDRA 1OT6A 5G4YA 4R70A 2OWJA 3LIEA 3F1OB 2W0NA 3EEHA 1UGUA 3NOUC 1XJ6A 5A8BA 1P0ZA 5AVEA 4I5SA 4R38A 4EQ1A 3NHQA 4HJ4A 4NXGA 4EXOA 5HDCA 4JGRA 1N9LA 2WKQA 3C8CA 4M4XA 4EESA 2ZOHA 4HY8A 3MXQA 4EEUA 1WA9A 3A0VA 1P97A 2YKFA 1OTBA 1UWPX 5HWWA 4MN6A 4HHDA 4DJ3A 3B33A 3PHYA
chains in the Genus database with same CATH superfamily
2LB9A 4EBLA 4HH3A 1PFLA 1Q2QA 1LHYA 3NOPC 4Y7PA 5L8MA 1TDGA 2PU2A 1IKGA 2B5RA 3RH8B 3IXGA 1LSVA 1T18A 3F1NB 1XJ4A 1YAXA 3A3IA 3NECA 4GHIB 1PW1A 2L1MA 3S22A 1J3WA 1HLUP 2VV7A 4DRTA 3O86A 3BM6A 4Y2FA 1IYQA 4QPRA 4R23A 1G28A 5IS1A 3KX0X 3E2LA 1PZOA 3RJUA 1BYWA 3LY4A 4Q0JA 5FATA 1E25A 2Y2NA 2J7VA 5M19A 2QJ5A 5DFXA 1SKOB 5GLAA 4KZ7A 3HJKA 4Y15A 3T4SA 3T4KA 4NXEA 4PMAA 1J9MA 3K3DA 1DJAA 1L0DA 5F82A 1MZUA 5FQMA 1E3UA 3N8RA 2M7VA 5HDDA 2HP5A 3S1YA 2WGVA 2QZ6A 4JXGA 3N7WA 4G3WA 4Y0OA 4QHCA 4N1HA 1XX2A 1A0KA 1F9IA 4O7DA 4QU3A 1YT4A 2JCHA 2I72A 2J80A 2W3GA 1CEGA 4P6ZM 1CF0A 1MPLA 1OTAA 4QY6A 3IXHA 3G2ZA 5KIZA 3ZHHA 3E4PA 1L0EA 2HZ5A 2XGNA 5F69A 5EM0A 2W3HA 3CUEA 1F98A 4HH2A 2PU4A 1ERQA 2QJ7A 4KUOA 4PM7A 1NJ4A 1NZOA 1K0KA 3G6OA 4WUJA 1E4DA 4KZ6A 3IWIA 5FDSA 1S1YA 1DP6A 3UB7A 4EBNA 1KGEA 2ZQ8A 1H3QA 1M6KA 2A24A 1NRFA 1T1BA 4GW9A 3V67A 1CEFA 2XROA 1EW0A 4S2OA 4Z9QA 4L9EA 2K31A 5TBMA 2Y2JA 4UA7A 1VHMA 1T19A 1W7FA 2Y79A 3OCNA 3TW8A 2EX9A 1X0OA 4FD8A 4ZTKA 3TJZC 5A91A 1IYPA 3O3VA 4N9LA 3A0RA 2Y2QA 5HWVA 4YOFA 2HP9A 3EOIA 2H0YA 4D60A 1AWIA 3WS2A 3MBZA 2PYPA 4OOLA 4QB8A 4OVDA 2VV6A 2DRWA 3Q7VA 1I5QA 5AQBA 1MWRA 5FI7A 3VOZA 1ES5A 2V1ZA 5J7EA 1XJ2A 5KZHA 1W79A 4WELA 3UE6A 1ERMA 1JNUA 2HJ9C 4L9FA 2JBFA 3DTIA 1OTIA 2HPBA 4O8GA 4BL2A 3LI8A 3CG5A 3VP1A 3HLEA 3KO6A 1YSPA 2HV1A 1NLZA 3R4KA 4UAAA 2W1TA 1LSWA 4E6XA 5GL9A 3WS1A 1IFQA 4FUWA 5J3WA 3ZYTA 2ZMVA 1OTEA 3A0SA 3OCLA 3CI6A 3HLWA 4X55A 5HAIA 3TE8A 3LIFA 2IA2A 1L0GA 3UMDA 4CLCC 3T1RA 4N9KA 4OONA 5HPIA 1SKFA 2VGLM 1Z6FA 1FQGA 3RXWA 4PAUA 4DE2A 4DN0A 5FASA 3LO7A 4S2KA 3VV4A 4CLCD 3H9WA 2JKRM 1GSWA 3VE4A 3BQAA 4IVIA 3Q7ZA 5EVIA 1JTDA 1BSGA 2Y2IA 3A3DA 3GDIA 2ZMAA 1NY0A 3LEQA 4MEZA 2ZD8A 2HDQA 3GSGA 3BRMA 3PBRA 3FG8A 4ZJ2A 4LFUA 3MQ0A 3ZG5A 5FL3A 5CGSA 1DRMA 4XXRA 5MC7A 2V8FA 4EEPA 4PM6A 1STZA 3UO9A 4JXWA 3FZCA 2ZC4B 5FEFA 2DNSA 4BWIA 4H6JA 3CAXA 5FAPA 4OPYA 1LLBA 2HDSA 1FSYA 5IU1A 5HW3A 2PBYA 2J3WA 1N4OA 3NC8A 3E0YA 2A24B 2WGWA 2H28A 4WMCD 4ARZA 3IF6A 3DTEA 5EVLA 3SH9A 1ZG4A 4UA9A 3ZDJA 2OAQ1 5TBMB 2EXAA 2HF6A 4JKTA 1H8MA 4I3AA 2XQZA 1FCOA 4MMNA 1KDSA 3HUNA 3JVUA 4IEDA 3EQVA 4JF4A 3VP4A 5AJGA 2HGVA 2ZQDA 4OPRA 3UPNA 5FDHA 3Q7VB 5G4YA 1CK3A 4R70A 2GDNA 3UY6A 3T12B 1ZG6A 3BFGA 3LGOA 4FCFA 3FWLA 2Y2KA 3HLCA 3T4LA 4R38A 4Y13A 2XA7S 3Q07A 5EOEA 4MNRA 3VP2A 1MXOA 4NKPA 1LL9A 3OZHA 2W1TB 2FH5A 4JGRA 5HX9A 4CPKA 3KSHA 5E2EA 4KG2A 4KQRA 5A93A 3P09A 4E3LA 3MXQA 1W8QA 4JPMA 1HVBA 3RXXA 4X53A 3NIAA 4RX3A 2EWVA 3PTEA 3LEZA 4ID4A 4KZBA 4S2NA 1H8YA 2VX8A 2XFSA 2JKTI 2OLVA 2BLSA 1CI8A 5EVIB 1XA7A 2FFYA 3UE1A 3V39A 3PBQA 4Q0HA 4WZ5C 3GRJA 3S7OA 4FH4A 4HBTA 4L0LA 2JE5A 1FR1A 4E3JA 1N9NA 3EEAA 3I7JA 3WRTA 4E04A 2M1CA 2X02A 4I3IA 4NXFA 4BBUA 2Y2GA 1PWDA 5J4EA 4FSFA 4WZ4A 4AFIA 2ZC7A 4H6JB 3F1PA 3HL9A 1K4FA 3ZG8B 4OPZA 2JKFA 2XR0A 3M2JA 3E4QA 3ITAA 1ZKJA 5HWTA 4UHUA 2WGWB 3C4PA 2WZXA 4ARZB 3IF6B 1ZTUA 3UNWA 4R3JA 2ZM0A 2P9VA 5FQQA 2IWCA 4N92A 4LV0A 4UEYA 3W4PA 1YLTA 2PD8A 5KSHA 4HP4A 1TEMA 4F3LB 3LR5A 1QMFA 1VETA 4X69A 2WYXA 5C5KA 4Z1WA 1YMXA 3D4FA 4WEKA 5CX7A 4QWOA 3DTMA 1GCEA 3MKEA 4FH2A 2Z2LB 3SH8A 5L2FA 1Y28A 4B4XA 4EUVA 3V50A 1MY8A 3H7WA 3UB8A 2FZ0A 3V3SA 1CQAA 3WRZA 5FI6A 3IX8A 1S6RA 3PXPA 4II7A 2WADA 3BWLA 4S2PA 2Q9MA 3QP8A 4L9GA 4K08A 4B9OA 4PM9A 2HDUA 2WKHA 3BFFA 4BD0A 3PAEA 3K2NA 5TJJA 4DDYA 2CMNA 2ZLYA 4EW7A 1LI9A 3QHYA 3VSKA 2W27A 2ZC3B 2PHYA 2VGKA 4HIAA 2VJWA 3MQOA 1PW8A 2ZC5B 4BLMA 5HDSA 3U2AA 1MC0A 3IT9A 3SS3A 4DE1A 1TDLA 2BASA 5DKKA 4Y0UA 2J3TC 2K2NA 3N8LA 2BTFP 3P7NA 4WBGA 3OPHA 2J3TD 2E8IA 2L0WA 3OC2A 3UB5P 3SOIA 3EQUA 4N1XA 4K91A 4ZJ3A 2V0WA 4PPRA 2D01A 3PR6A 3MSHA 1KOUA 2W3FA 1LT0A 3M2KA 1P9RA 5CERA 1WE4A 4LRZE 1JWVA 1ZHHB 1W5DA 5JYOA 2VGJA 3BJNA 4GCZA 5DTKA 1OPXA 4QJGA 3E2KA 3F1PB 3S7PA 1SCWA 5EECA 1OTDA 2WKIA 2OSUA 4Y5FA 2QPNA 1ESUA 1ACFA 4JBFA 1XFNA 2HJEA 3R7WA 5DVAA 1PRQA 4X56A 2EWWA 5DFYA 2KDKA 3EGXC 2ZL1A 1TS6A 3DWKA 3MZEA 3TSGA 3S7QA 5CEDA 1FIKA 4I3JA 3ZVWA 4HBUA 2JKRI 2EFUA 4ZBEA 2G7UA 4KZAA 3MFDA 1NRJA 3OOVA 1VETB 1TF1A 1H8ZA 2Z2MB 1K6RA 4RQ9A 4ETZA 4E6WA 3A3FA 1K6SA 4Y0TA 2V20A 1NLYA 3D9YA 4CLCA 1PIOA 3IBRA 3MS6A 2OLUA 4Q8IA 5IHVA 5G18A 1L0FA 3N8SA 4H8RA 3QNCA 3NDGA 5HZHA 1DJCA 1PYYA 2IWDA 2C5WB 1NXYA 2QKPA 3D3OA 3T50A 3H7WB 4S2JA 3G2YA 1ALQA 5A92A 3KSIA 2Y8HA 5M1AA 2YKHA 3B42A 5FI2A 3M6BA 4S2LA 5HPFA 5TGFA 3MMHA 3IF5A 2OAP1 4FOFA 3FPVA 5CGXA 3N4IA 4OPQA 3UB9A 2ZQAA 3PYPA 4OH0A 5CGWA 4MBHA 4IBRA 2P7JA 1U60A 4WL9A 3C5AA 1TD5A 1Y54A 4GD8A 4WMCA 3LICA 3G30A 4RYEA 2P04A 4KG6A 5G4ZA 4R3BA 4E3NA 1FSWA 5F6AA 5JYPA 4EWFA 4OLDA 3HLGA 4HQAA 1VM1A 2V0UA 4OOYA 4LGWA 3OPPA 2CC1A 4FTXA 1RCJA 3BECA 4KQQA 4K0XA 4HESA 3UN7A 2VKSA 3LIEA 4Q0IA 4A5RA 1N9BA 2XA7M 1UGUA 3NOUC 5GHXA 2XFTA 3CZDA 1XJ6A 3V3RA 3A3EA 5A8BA 5AVEA 5GLBA 4I5SA 4HJ4A 4P0MA 1D1JA 4EXOA 5FQ9A 3JVVA 4YINA 3UPPA 1N9LA 5A90A 3UDFA 5HL1A 4OLGA 4KZ9A 1K54C 5CHMA 4Y17A 2LB5A 3BFDA 5FEGA 1ES2A 1KE0A 1BZAA 4UA6A 1BLSA 4EQIA 2YKFA 4NETA 3R7WB 5J8XA 1OTBA 2A3UA 3RFBA 2XDMA 1BT5A 3QP4A 4E3KA 4DJ3A 2J9PA 4GZBA 3UDXA 3L7HA 2ZL1B 3BLSA 3MFXA 4X1LA 4B4ZA 1YLJA 2J9OA 1I2WA 3HLFA 2V8CA 3PBNA 3BLMA 2O99A 3CLOA 2EX8A 4XUXA 1UWNX 3BQ8A 2VZWA 4MN5A 5DTSA 1BTLA 3GECA 1BULA 3LCEA 2WGIA 5DTTA 5TR7A 2H10A 4CLCB 3HJIA 1GHIA 3MKFA 5HARA 1S1ZA 3C38A 2PR5A 2Y2HA 2X01A 1M40A 1PWGA 4JXVA 4HP9A 3IWOA 5K5BA 4C75A 1W8YA 3C30A 5EVEA 4LENA 4WZ5A 3CHWP 2ZJ9A 4LCLA 1P9WA 4DXBA 4BBVA 2KX6A 3EWKA 4JLFA 1K38A 3MJQA 1YMSA 1BUEA 4R0QA 3T4TA 2GX5A 4M3KA 1L3LA 1SHVA 2PYRA 2ZBBA 4ZAMA 3Q81A 1G6AA 1KGGA 3T4OA 3MQQA 4R3AA 4EUZA 4OP8A 2PD7A 3SS5A 3TRCA 2OWHA 3O5YA 3GR2A 5EVID 5DJTA 3W4OA 1LI0A 5HAPA 3AGDA 3IS2A 3ZCZA 1ES3A 4X68A 4HJ6A 5M18A 2PR6A 4OQIA 1NYMA 3CWFA 5FA7A 3ITBA 4B93A 2ZQCA 3HVFA 2MJ6A 2VV8A 1JVJA 5HFOA 3W2ZA 3MZDA 3FC7A 5I94A 5DF8A 2B02A 1D06A 1PZPA 1SDEA 3T4QA 4WLAA 3FKVA 4JGQA 4YNRA 3ZFZA 4BENA 3K3CA 5CEBA 4G3KA 4R6LA 4C3QA 4I39A 2BG1A 3IHBA 3ICYA 1KE4A 2V1AA 1BLPA 2V9AA 4LLOB 2FFFB 3W8KA 3IXBA 5F68A 1GSVA 2ZQ9A 3DW0A 3MXRA 3DTKA 1EROA 4S2IA 1N9OA 2JC7A 1GA9A 2XRNA 3ZGAB 4EBPA 3OLOA 4GLQA 5CXWA 4R4SA 1ONHA 3FV7A 4XT2A 2V1BA 5F5YA 4GB7A 1TVFA 4MBFA 5TFQA 3OBFA 4P6BA 3SZTA 5CHUA 4BQMA 3B47A 4DDSA 5EM1A 5EPHA 1IEMA 1H5XA 3OPRA 4GJ4A 1TS8A 3LYXA 4ME4A 4HJ3A 3BEBA 3PBOA 3VOLA 3PBSA 1NWZA 1NZUA 4LV3A 3LR3A 2Q9NA 4MCWA 4O01A 3GQZA 2ZMFA 1K25A 3W4QA 1KE3A 1XKZA 1T1CA 2PBDP 1YLPA 2ZC6B 4NK3A 3RTYA 3MZFA 5L07A 2B95A 2RL3A 3NDEA 3PBTA 2V2FF 1MBLA 4GD6A 1AXBA 2L4RA 2XF3A 2RCXA 4KZ8A 2H5SA 2EFXA 1OJGA 3UDIA 2XH9A 2Y55A 1YLWA 4EETB 3CMZA 1Q2PA 1IYSA 1K55A 3JYIA 2OOLA 5AQ7A 2VA0A 2WUQA 5I5LA 5DKLA 2W3EA 4GOGA 4KZ3A 3PAGA 1RP5A 3B3XA 5CTMA 1HZOA 2Y2LA 4YWZA 4OKPA 1TS0A 3UMEA 3G32A 2HP6A 1FR6A 3IS2B 3L9KA 1OJ5A 4U0XA 1T1AA 4RX2A 4F94A 5EFWA 1LL5A 3VE3A 1XGIA 4BD1A 4IVKA 3GMWA 5HD5A 2NUTC 4LV1A 4CLCE 4DKIA 3DBAA 3NCKA 1PI4A 3IX3A 3AGFA 2JN7A 5LBRA 4WM9A 2M7UA 1W63Q 4OOMA 1S66L 2O9BA 3KYQA 3SW1A 3UE3A 4EERA 2WKPA 4BMWA 4O0PA 4UQIM 4GS9A 4LRYC 2XLNA 3H82A 3ZQ5A 4NXBA 4JF5A 1K57C 2XD1A 3ZNYA 4DJ2A 3UB6A 1GSXA 4PM5A 1Z09A 3VOYA 1DP8A 3C7UA 4XT2B 3WS5A 2VEAA 2PDRA 1IELA 5CRFA 4DXCA 1K55C 1BLCA 3CITA 1ZC2A 1OT6A 2Y2OA 4XUZA 3SS4A 1IYOA 1K56D 2VK3A 3ZG9B 3CPTA 1MWTA 1C3BA 4IUHA 1F2KA 2W0NA 2EXBA 2C6WB 3EEHA 1ESIA 5CHJA 3LY3A 5F1GA 3E98A 4BJPA 2ZQ7A 3ZG0A 1JWZA 5FSRA 2WAEA 3LFVA 4K0WA 2P9VB 4EQ1A 3NHQA 2XK1A 4DE3A 4NXGA 3T1XA 2OV5A 4S2MA 5KSCA 2WKQA 4ZDXA 4M4XA 4EESA 2ZOHA 4MN7A 3NI9A 4HEFA 1WA9A 1KDWA 4CJNA 1YLZA 3A0VA 1FOFA 1WYBA 2WK0A 2WAFA 5FAOA 2O0YA 4LV2A 5HWWA 4MN6A 2KOIA 2ZM8A 3PHYA 3U4LP 2R78A 1K54A 3M6HA 3S4XA 1K4EA 2QWSA 3QP2A 1DY6A 1G6OA 2O9AA 5CTNA 4KENB 4P87A 2PAVP 3WS4A 1GHMA 3UE0A 1S4RA 3G34A 2NUPC 4GDBA 3VMAA 3VSLA 4IHQA 4HNBA 4DE0A 3G31A 2JKGA 3GTCA 4KQOA 2Y4AA 4IUKA 1MKIA 4MDZA 3KYZA 3T4JA 1YPRA 4DF6A 3NY4A 1PWCA 1GHPA 4E3IA 5GLCA 3T1SA 4C6YA 1E3UD 4HI4A 1VEUA 1CI9A 4UQIS 3LI9A 2ACGA 4KQDA 5DF9A 4BBTA 1H0MA 5AQAA 2Q0OA 3FYZA 2XD5A 2EX6A 5HSQA 4WYYA 3N6IA 4X25A 3HLDA 1I2SA 3CUEC 4KZ4A 5HD3A 3HREA 3IX4A 4EU0A 4GS9B 4R4RA 3H82B 4X6TA 1WYCA 2ZOIA 3LUQA 3EGDC 4EV4A 3Q82A 1V9YA 4JF6A 3KSFA 1XJ3A 3A3JA 4GN2A 4BL3A 2A49A 3BY8A 2I9VA 4JGPA 4ETXA 1G68A 4ZRRA 2H0TA 4D2OA 2QMIA 2E8JA 3C2WA 3V5MA 1DP9A 3CPTB 1W63M 4P6ZS 4I38A 4RVAA 4X1MA 2DMWA 2INWA 3P98A 3TG9A 2KLIA 3NJAA 3G35A 5BOHA 3HLBA 2PRFA 2D02A 3S7NA 4WEJA 3CJMA 1XXMA 2VLGA 4LPZA 3HUOA 1VB6A 2WKRA 5D3OA 4MBKA 4NEED 3GVBA 2AVXA 3QP1A 1QMEA 3IXDA 5GHYA 4KUKA 4KG5A 5L09A 2K7SA 2QYBA 1S67L 3QP6A 1YSQA 4WF0A 1GA0A 4B88A 3TOIA 5FAQA 1LL8A 1YKDA 5EV0A 3HCYA 4HOIA 2EX2A 3HBRA 5HL6A 2G2WA 1KVMA 5CECA 2JHEA 1D7EA 5KMWA 1BLHA 4PHTA 5E2HA 3QP5A 2X71A 3F1OA 2Z6DA 4OQ0A 3LR4A 5L10A 1YQSA 1ODVA 2GZAA 4LRXC 5AVFA 3DWZA 4F3LA 3D72A 2EA9A 2O9CA 1XPBA 1O7EA 3MF0A 4RA7A 3G4PA 4GDNA 5E2GA 5E43A 1FCMA 2QHKA 3NULA 1MWSA 5FQIA 3O87A 4LCMA 3E4OA 1EWZA 5EVIC 3OPLA 2IWBA 1VEUB 1G5UA 1NYYA 2PT7A 3MXSA 4OQGA 4PKYG 2XSSA 4IBXA 2P08A 3KYEA 1FILA 4OQHA 1YM1A 3KSGA 5FQJA 4U0TA 3BYDA 1XA1A 3ZNTA 4JXSA 2W3DA 2Y2MA 2Y91A 5HAQA 1ES4A 3LIDA 1TS7A 5F1FA 2P74A 1MKMA 1V9ZA 1HTZA 2VGLS 4JGOA 4DMZA 2HDRA 2A2LA 2J8YA 1HD8A 3F1NA 5U47A 2UWXA 1SZVA 1LSXA 4GHIA 5DJUA 3LR0A 1PI5A 1S4SA 3IF6C 1CJFA 4ESPA 3HUMA 3T1QB 2DCFA 1PNEA 1O07A 1RGZA 2GJ3A 5GHZA 1KGFA 5IT5A 3LIAA 1ONGA 4YFMA 3ULFA 3GV9A 3VFFA 3NOTC 2R9WA 3IHAA 4ZJ1A 1SDNA 1SKOA 3IH8A 4IJGA 1DJBA 4Y3IA 2G2UA 2Y2PA 3MR0A 3LIBA 5EOOA 3O88A 4KZ5A 1Y4OA 1YLYA 3DAVA 4WN5A 3BY9A 3WS0A 3ISGA 3JPUA 4G3VA 4R1GA 2Z6CA 2ZM2A 2UV0E 4PKYA 2Y59A 4CQHA 1XFQA 2R9XA 3BFCA 4NG2A 1XP4A 4U3TA 2GNXA 1JWPA 4QY5A 4OP5A 2W1RA 3IBJA 3C4OA 3ZG7B 1JTGA 1FCNA 3IQAA 3ZVTA 1OT9A 3BW6A 3AGEA 3P01A 2WKEA 5EUAA 1RGYA 4PM8A 1S0WA 5GLDA 1OMEA 1IKIA 2OWJA 1IOUA 3F1OB 5AQ9A 5EE8A 5E2FA 3C7VA 1K57A 3Q1FA 3VP3A 3WWXA 3FPWA 1EI5A 1P0ZA 1XGJA 1KVLA 3BFEA 3NBLA 4E3MA 2B18A 2WZZA 1K56A 4S2NC 1L2SA 5F83A 3VP0A 5HDCA 3FKWA 3IH9A 3C8CA 2XEPA 3VFHA 1VQQA 4HY8A 4GKUA 4QD4A 4EEUA 3QNBA 4E3OA 5DF7A 1P97A 1MWUA 5FQKA 3SH7A 4MLLA 1F5MA 1UWPX 3IWQA 2JKTM 4GNUA 4HHDA 3UPOA 4P85A 3B33A
chains in the Genus database with same CATH topology
3MFXA 2LB9A 4HH3A 2VX8A 2JKTI 3NOPC 5L8MA 3PBNA 2R78A 2O99A 3CLOA 3PBQA 3RH8B 4Q0HA 1UWNX 2QWSA 1G6OA 3BQ8A 2O9AA 2VZWA 1LSVA 3GECA 4MN5A 1T18A 3F1NB 1XJ4A 3S7OA 1YAXA 1S4RA 4GHIB 4CLCB 3HJIA 4L0LA 2L1MA 2NUPC 1S1ZA 2VV7A 3C38A 2PR5A 1N9NA 4IHQA 3EEAA 4HNBA 4E04A 2M1CA 4HP9A 4Y2FA 4I3IA 4QPRA 4NXFA 4KQOA 4BBUA 5J4EA 4IUKA 5K5BA 4MDZA 1G28A 3C30A 3KYZA 4FSFA 3T4JA 5IS1A 3KX0X 4AFIA 4H6JB 1BYWA 3F1PA 4Q0JA 4HI4A 1P9WA 3E4QA 4BBVA 4UQIS 2QJ5A 5DFXA 5HWTA 3LI9A 2KX6A 3EWKA 4KQDA 4ARZB 3MJQA 3HJKA 5DF9A 4BBTA 5HSQA 3T4SA 3T4KA 4NXEA 1ZTUA 3T4TA 3K3DA 2GX5A 1MZUA 3CUEC 2M7VA 5HDDA 5HD3A 4EU0A 4UEYA 2PYRA 4GS9B 4G3WA 2ZBBA 3H82B 2PD8A 2ZOIA 5KSHA 4HP4A 3LUQA 1F9IA 3T4OA 4F3LB 3LR5A 3MQQA 4R3AA 2J80A 3EGDC 2PD7A 3TRCA 1V9YA 2W3GA 2OWHA 3KSFA 4P6ZM 1XJ3A 3O5YA 3BY8A 1OTAA 2I9VA 4Z1WA 5C5KA 4JGPA 5DJTA 4WEKA 4ETXA 5CX7A 5KIZA 4ZRRA 3E4PA 3IS2A 4HJ6A 5F69A 3C2WA 2PR6A 1DP9A 2W3HA 1W63M 3CUEA 1Y28A 4P6ZS 3CWFA 4EUVA 4B93A 4I38A 2DMWA 1F98A 2INWA 4HH2A 2MJ6A 2VV8A 2KLIA 3H7WA 3NJAA 2QJ7A 4KUOA 3UB8A 3W2ZA 2FZ0A 3G6OA 4WUJA 3FC7A 2B02A 1D06A 2D02A 3S7NA 4WEJA 3T4QA 4WLAA 1S1YA 2VLGA 4LPZA 1DP6A 3PXPA 1VB6A 2WKRA 4JGQA 4YNRA 4II7A 3UB7A 1H3QA 2A24A 3K3CA 3BWLA 1T1BA 4NEED 4G3KA 4R6LA 4GW9A 3V67A 4I39A 2XROA 1EW0A 4L9GA 4K08A 4KUKA 4B9OA 3ICYA 2V1AA 4L9EA 2K31A 3K2NA 5TBMA 5TJJA 2CMNA 2K7SA 2QYBA 4EW7A 2V9AA 1VHMA 4LLOB 1T19A 2Y79A 3OCNA 3TW8A 1S67L 5F68A 1GSVA 1YSQA 2W27A 4WF0A 1X0OA 2PHYA 4HIAA 3TJZC 2VJWA 1N9OA 3MQOA 1LL8A 1YKDA 3A0RA 2XRNA 5HDSA 4YOFA 3U2AA 5HWVA 1MC0A 3HCYA 4HOIA 3EOIA 3OLOA 4GLQA 2BASA 5DKKA 2J3TC 2K2NA 4XT2A 2V1BA 5HL6A 5F5YA 2PYPA 4OOLA 3P7NA 2JHEA 3OBFA 1D7EA 2VV6A 4PHTA 2J3TD 2L0WA 3B47A 3OC2A 3F1OA 2Z6DA 3EQUA 5J7EA 1XJ2A 3LR4A 4GJ4A 1TS8A 4WELA 3UE6A 2V0WA 3LYXA 4HJ3A 4ME4A 2HJ9C 1JNUA 1ODVA 2GZAA 4L9FA 4LRXC 5AVFA 1OTIA 4O8GA 3LI8A 2D01A 3PBOA 3D72A 3PR6A 2EA9A 2O9CA 4F3LA 3VOLA 1KOUA 3PBSA 3MF0A 1NWZA 2W3FA 3KO6A 3LR3A 1LT0A 1YSPA 2HV1A 4MCWA 1P9RA 1NLZA 4LRZE 4O01A 3R4KA 1ZHHB 2QHKA 2ZMFA 2W1TA 1LSWA 3BJNA 4GCZA 1OPXA 3F1PB 1IFQA 3S7PA 3E4OA 5J3WA 3ZYTA 1T1CA 1OTDA 2ZMVA 1OTEA 2PT7A 3A0SA 3RTYA 3OCLA 4Y5FA 3CI6A 4PKYG 3TE8A 3LIFA 2IA2A 1XFNA 2XSSA 2HJEA 3UMDA 4CLCC 2P08A 5HPIA 3R7WA 3PBTA 2VGLM 4PAUA 4DN0A 2L4RA 3KSGA 2EWWA 5DFYA 3VV4A 2KDKA 3EGXC 4CLCD 2W3DA 1TS6A 1OJGA 2JKRM 1GSWA 3H9WA 3LIDA 3VE4A 3S7QA 1TS7A 4EETB 3BQAA 1MKMA 1V9ZA 4I3JA 2VGLS 2OOLA 4JGOA 4DMZA 2JKRI 2G7UA 2VA0A 5I5LA 1NRJA 3OOVA 5DKLA 2W3EA 1TF1A 3GDIA 2A2LA 3F1NA 4RQ9A 4ETZA 3PBRA 1NLYA 3FG8A 1LSXA 4GHIA 3IBRA 4CLCA 5DJUA 3LR0A 3MQ0A 5FL3A 4YWZA 1TS0A 1DRMA 1S4SA 3UMEA 5MC7A 3IS2B 4EEPA 1OJ5A 1STZA 5HZHA 1T1AA 5EFWA 3VE3A 2QKPA 3D3OA 3T50A 3H7WB 4BWIA 5HD5A 4H6JA 2GJ3A 3CAXA 2NUTC 5IT5A 3LIAA 3KSIA 4CLCE 2Y8HA 3DBAA 3ULFA 5IU1A 2YKHA 3NOTC 3B42A 2J3WA 3E0YA 2A24B 4IJGA 2H28A 5HPFA 4ARZA 2JN7A 4Y3IA 5LBRA 3MMHA 3MR0A 2OAP1 4FOFA 3FPVA 3LIBA 2M7UA 1W63Q 4OOMA 1S66L 3UB9A 2O9BA 2OAQ1 3KYQA 3PYPA 3SW1A 4WN5A 5TBMB 3UE3A 4EERA 3BY9A 2HF6A 2WKPA 4BMWA 4O0PA 1H8MA 4UQIM 2P7JA 4G3VA 4GS9A 2Z6CA 4LRYC 4I3AA 4WL9A 3H82A 3ZQ5A 1TD5A 4NXBA 4PKYA 4CQHA 1XFQA 4DJ2A 3UB6A 3LICA 4MMNA 2P04A 5G4ZA 1GSXA 2GNXA 3JVUA 5F6AA 3EQVA 2W1RA 3IBJA 1DP8A 4HQAA 4XT2B 1OT9A 3BW6A 2V0UA 2VEAA 5AJGA 2PDRA 3P01A 2HGVA 3CITA 1OT6A 5G4YA 2VKSA 4R70A 2OWJA 1IOUA 3LIEA 4Q0IA 4IUHA 3F1OB 2W0NA 2XA7M 3EEHA 1UGUA 3NOUC 1XJ6A 3E98A 3T4LA 4BJPA 3FPWA 5A8BA 1P0ZA 5AVEA 3LFVA 4I5SA 4R38A 4EQ1A 3NHQA 4HJ4A 2XA7S 2B18A 4NXGA 4EXOA 4NKPA 3JVVA 5HDCA 2W1TB 2FH5A 4JGRA 1N9LA 2WKQA 3C8CA 3KSHA 4M4XA 4EESA 2ZOHA 4HY8A 4MN7A 2LB5A 3MXQA 4EEUA 1WA9A 3A0VA 1P97A 2YKFA 3R7WB 2O0YA 1OTBA 1F5MA 1UWPX 3RFBA 5HWWA 2JKTM 4MN6A 4HHDA 2EWVA 2KOIA 4DJ3A 3B33A 3PHYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MFX A;  4HH3 A;  3NOP C;  2R78 A;  3CLO A;  3RH8 B;  1UWN X;  2QWS A;  4MN5 A;  1LSV A;  3GEC A;  1T18 A;  3F1N B;  1XJ4 A;  1S4R A;  4GHI B;  3HJI A;  2L1M A;  1S1Z A;  2VV7 A;  2PR5 A;  1N9N A;  4HNB A;  4E04 A;  2M1C A;  4HP9 A;  4I3I A;  4NXF A;  4BBU A;  5J4E A;  1G28 A;  5IS1 A;  3KX0 X;  4H6J B;  1BYW A;  3F1P A;  4HI4 A;  3E4Q A;  4BBV A;  2QJ5 A;  5HWT A;  3LI9 A;  2KX6 A;  3EWK A;  4KQD A;  3MJQ A;  3HJK A;  4BBT A;  5HSQ A;  4NXE A;  3K3D A;  1MZU A;  5HDD A;  5HD3 A;  2PYR A;  4GS9 B;  2ZBB A;  3H82 B;  2PD8 A;  2ZOI A;  4HP4 A;  3LUQ A;  1F9I A;  4F3L B;  3MQQ A;  4R3A A;  2J80 A;  2PD7 A;  1V9Y A;  2OWH A;  1XJ3 A;  3BY8 A;  1OTA A;  2I9V A;  4JGP A;  5DJT A;  5KIZ A;  3E4P A;  3IS2 A;  4HJ6 A;  5F69 A;  3C2W A;  2PR6 A;  1DP9 A;  1Y28 A;  3CWF A;  4I38 A;  1F98 A;  2INW A;  4HH2 A;  2VV8 A;  3H7W A;  3NJA A;  2QJ7 A;  3UB8 A;  4KUO A;  3G6O A;  4WUJ A;  3FC7 A;  2B02 A;  1D06 A;  2D02 A;  4WLA A;  1S1Y A;  2VLG A;  4LPZ A;  1DP6 A;  4JGQ A;  1VB6 A;  2WKR A;  3UB7 A;  2A24 A;  3K3C A;  3BWL A;  1T1B A;  4R6L A;  4GW9 A;  4I39 A;  1EW0 A;  4L9G A;  4K08 A;  4KUK A;  4B9O A;  3ICY A;  2V1A A;  4L9E A;  5TBM A;  2CMN A;  2K7S A;  4EW7 A;  2V9A A;  4LLO B;  1T19 A;  1S67 L;  5F68 A;  1GSV A;  2W27 A;  4WF0 A;  1X0O A;  2PHY A;  4HIA A;  1N9O A;  3MQO A;  1LL8 A;  3A0R A;  5HWV A;  5HDS A;  4HOI A;  3OLO A;  2BAS A;  5DKK A;  4XT2 A;  2V1B A;  5F5Y A;  2PYP A;  3P7N A;  2JHE A;  1D7E A;  2VV6 A;  2L0W A;  3F1O A;  2Z6D A;  5J7E A;  1XJ2 A;  1TS8 A;  3UE6 A;  2V0W A;  3LYX A;  4HJ3 A;  1JNU A;  1ODV A;  4L9F A;  4LRX C;  5AVF A;  1OTI A;  3LI8 A;  2D01 A;  4F3L A;  3D72 A;  2EA9 A;  3VOL A;  1KOU A;  1NWZ A;  1LT0 A;  2HV1 A;  4LRZ E;  2QHK A;  1LSW A;  4GCZ A;  3F1P B;  3E4O A;  5J3W A;  1T1C A;  1OTD A;  1OTE A;  3A0S A;  3RTY A;  4PKY G;  3LIF A;  1XFN A;  3UMD A;  2L4R A;  2KDK A;  1TS6 A;  1OJG A;  3H9W A;  1GSW A;  3LID A;  3VE4 A;  1TS7 A;  4EET B;  1V9Z A;  4I3J A;  2OOL A;  4JGO A;  5I5L A;  5DKL A;  3GDI A;  3F1N A;  4RQ9 A;  3FG8 A;  1LSX A;  4GHI A;  3IBR A;  5DJU A;  4YWZ A;  1TS0 A;  1DRM A;  1S4S A;  3UME A;  3IS2 B;  4EEP A;  1OJ5 A;  5HZH A;  1T1A A;  5EFW A;  3VE3 A;  2QKP A;  3T50 A;  3H7W B;  5HD5 A;  4H6J A;  2GJ3 A;  3CAX A;  3LIA A;  3ULF A;  5IU1 A;  2YKH A;  3NOT C;  2A24 B;  2H28 A;  2JN7 A;  3MR0 A;  3LIB A;  1S66 L;  3UB9 A;  3PYP A;  3SW1 A;  4WN5 A;  5TBM B;  4EER A;  3BY9 A;  2WKP A;  2P7J A;  4GS9 A;  4LRY C;  2Z6C A;  4I3A A;  4WL9 A;  3H82 A;  3ZQ5 A;  4NXB A;  4PKY A;  1XFQ A;  4DJ2 A;  3UB6 A;  3LIC A;  5G4Z A;  1GSX A;  5F6A A;  1DP8 A;  4HQA A;  4XT2 B;  1OT9 A;  2V0U A;  2VEA A;  2PDR A;  1OT6 A;  5G4Y A;  4R70 A;  2OWJ A;  3LIE A;  3F1O B;  2W0N A;  3EEH A;  1UGU A;  3NOU C;  1XJ6 A;  5A8B A;  1P0Z A;  5AVE A;  4I5S A;  4R38 A;  4EQ1 A;  3NHQ A;  4HJ4 A;  4NXG A;  4EXO A;  5HDC A;  4JGR A;  1N9L A;  2WKQ A;  3C8C A;  4M4X A;  4EES A;  2ZOH A;  4HY8 A;  3MXQ A;  4EEU A;  1WA9 A;  3A0V A;  1P97 A;  2YKF A;  1OTB A;  1UWP X;  5HWW A;  4MN6 A;  4HHD A;  4DJ3 A;  3B33 A;  3PHY A; 
#chains in the Genus database with same CATH topology
 2LB9 A;  4EBL A;  4HH3 A;  1PFL A;  1Q2Q A;  1LHY A;  3NOP C;  4Y7P A;  5L8M A;  1TDG A;  2PU2 A;  1IKG A;  2B5R A;  3RH8 B;  3IXG A;  1LSV A;  1T18 A;  3F1N B;  1XJ4 A;  1YAX A;  3A3I A;  3NEC A;  4GHI B;  1PW1 A;  2L1M A;  3S22 A;  1J3W A;  1HLU P;  2VV7 A;  4DRT A;  3O86 A;  3BM6 A;  4Y2F A;  1IYQ A;  4QPR A;  4R23 A;  1G28 A;  5IS1 A;  3KX0 X;  3E2L A;  1PZO A;  3RJU A;  1BYW A;  3LY4 A;  4Q0J A;  5FAT A;  1E25 A;  2Y2N A;  2J7V A;  5M19 A;  2QJ5 A;  5DFX A;  1SKO B;  5GLA A;  4KZ7 A;  3HJK A;  4Y15 A;  3T4S A;  3T4K A;  4NXE A;  4PMA A;  1J9M A;  3K3D A;  1DJA A;  1L0D A;  5F82 A;  1MZU A;  5FQM A;  1E3U A;  3N8R A;  2M7V A;  5HDD A;  2HP5 A;  3S1Y A;  2WGV A;  2QZ6 A;  4JXG A;  3N7W A;  4G3W A;  4Y0O A;  4QHC A;  4N1H A;  1XX2 A;  1A0K A;  1F9I A;  4O7D A;  4QU3 A;  1YT4 A;  2JCH A;  2I72 A;  2J80 A;  2W3G A;  1CEG A;  4P6Z M;  1CF0 A;  1MPL A;  1OTA A;  4QY6 A;  3IXH A;  3G2Z A;  5KIZ A;  3ZHH A;  3E4P A;  1L0E A;  2HZ5 A;  2XGN A;  5F69 A;  5EM0 A;  2W3H A;  3CUE A;  1F98 A;  4HH2 A;  2PU4 A;  1ERQ A;  2QJ7 A;  4KUO A;  4PM7 A;  1NJ4 A;  1NZO A;  1K0K A;  3G6O A;  4WUJ A;  1E4D A;  4KZ6 A;  3IWI A;  5FDS A;  1S1Y A;  1DP6 A;  3UB7 A;  4EBN A;  1KGE A;  2ZQ8 A;  1H3Q A;  1M6K A;  2A24 A;  1NRF A;  1T1B A;  4GW9 A;  3V67 A;  1CEF A;  2XRO A;  1EW0 A;  4S2O A;  4Z9Q A;  4L9E A;  2K31 A;  5TBM A;  2Y2J A;  4UA7 A;  1VHM A;  1T19 A;  1W7F A;  2Y79 A;  3OCN A;  3TW8 A;  2EX9 A;  1X0O A;  4FD8 A;  4ZTK A;  3TJZ C;  5A91 A;  1IYP A;  3O3V A;  4N9L A;  3A0R A;  2Y2Q A;  5HWV A;  4YOF A;  2HP9 A;  3EOI A;  2H0Y A;  4D60 A;  1AWI A;  3WS2 A;  3MBZ A;  2PYP A;  4OOL A;  4QB8 A;  4OVD A;  2VV6 A;  2DRW A;  3Q7V A;  1I5Q A;  5AQB A;  1MWR A;  5FI7 A;  3VOZ A;  1ES5 A;  2V1Z A;  5J7E A;  1XJ2 A;  5KZH A;  1W79 A;  4WEL A;  3UE6 A;  1ERM A;  1JNU A;  2HJ9 C;  4L9F A;  2JBF A;  3DTI A;  1OTI A;  2HPB A;  4O8G A;  4BL2 A;  3LI8 A;  3CG5 A;  3VP1 A;  3HLE A;  3KO6 A;  1YSP A;  2HV1 A;  1NLZ A;  3R4K A;  4UAA A;  2W1T A;  1LSW A;  4E6X A;  5GL9 A;  3WS1 A;  1IFQ A;  4FUW A;  5J3W A;  3ZYT A;  2ZMV A;  1OTE A;  3A0S A;  3OCL A;  3CI6 A;  3HLW A;  4X55 A;  5HAI A;  3TE8 A;  3LIF A;  2IA2 A;  1L0G A;  3UMD A;  4CLC C;  3T1R A;  4N9K A;  4OON A;  5HPI A;  1SKF A;  2VGL M;  1Z6F A;  1FQG A;  3RXW A;  4PAU A;  4DE2 A;  4DN0 A;  5FAS A;  3LO7 A;  4S2K A;  3VV4 A;  4CLC D;  3H9W A;  2JKR M;  1GSW A;  3VE4 A;  3BQA A;  4IVI A;  3Q7Z A;  5EVI A;  1JTD A;  1BSG A;  2Y2I A;  3A3D A;  3GDI A;  2ZMA A;  1NY0 A;  3LEQ A;  4MEZ A;  2ZD8 A;  2HDQ A;  3GSG A;  3BRM A;  3PBR A;  3FG8 A;  4ZJ2 A;  4LFU A;  3MQ0 A;  3ZG5 A;  5FL3 A;  5CGS A;  1DRM A;  4XXR A;  5MC7 A;  2V8F A;  4EEP A;  4PM6 A;  1STZ A;  3UO9 A;  4JXW A;  3FZC A;  2ZC4 B;  5FEF A;  2DNS A;  4BWI A;  4H6J A;  3CAX A;  5FAP A;  4OPY A;  1LLB A;  2HDS A;  1FSY A;  5IU1 A;  5HW3 A;  2PBY A;  2J3W A;  1N4O A;  3NC8 A;  3E0Y A;  2A24 B;  2WGW A;  2H28 A;  4WMC D;  4ARZ A;  3IF6 A;  3DTE A;  5EVL A;  3SH9 A;  1ZG4 A;  4UA9 A;  3ZDJ A;  2OAQ 1;  5TBM B;  2EXA A;  2HF6 A;  4JKT A;  1H8M A;  4I3A A;  2XQZ A;  1FCO A;  4MMN A;  1KDS A;  3HUN A;  3JVU A;  4IED A;  3EQV A;  4JF4 A;  3VP4 A;  5AJG A;  2HGV A;  2ZQD A;  4OPR A;  3UPN A;  5FDH A;  3Q7V B;  5G4Y A;  1CK3 A;  4R70 A;  2GDN A;  3UY6 A;  3T12 B;  1ZG6 A;  3BFG A;  3LGO A;  4FCF A;  3FWL A;  2Y2K A;  3HLC A;  3T4L A;  4R38 A;  4Y13 A;  2XA7 S;  3Q07 A;  5EOE A;  4MNR A;  3VP2 A;  1MXO A;  4NKP A;  1LL9 A;  3OZH A;  2W1T B;  2FH5 A;  4JGR A;  5HX9 A;  4CPK A;  3KSH A;  5E2E A;  4KG2 A;  4KQR A;  5A93 A;  3P09 A;  4E3L A;  3MXQ A;  1W8Q A;  4JPM A;  1HVB A;  3RXX A;  4X53 A;  3NIA A;  4RX3 A;  2EWV A;  3PTE A;  3LEZ A;  4ID4 A;  4KZB A;  4S2N A;  1H8Y A;  2VX8 A;  2XFS A;  2JKT I;  2OLV A;  2BLS A;  1CI8 A;  5EVI B;  1XA7 A;  2FFY A;  3UE1 A;  3V39 A;  3PBQ A;  4Q0H A;  4WZ5 C;  3GRJ A;  3S7O A;  4FH4 A;  4HBT A;  4L0L A;  2JE5 A;  1FR1 A;  4E3J A;  1N9N A;  3EEA A;  3I7J A;  3WRT A;  4E04 A;  2M1C A;  2X02 A;  4I3I A;  4NXF A;  4BBU A;  2Y2G A;  1PWD A;  5J4E A;  4FSF A;  4WZ4 A;  4AFI A;  2ZC7 A;  4H6J B;  3F1P A;  3HL9 A;  1K4F A;  3ZG8 B;  4OPZ A;  2JKF A;  2XR0 A;  3M2J A;  3E4Q A;  3ITA A;  1ZKJ A;  5HWT A;  4UHU A;  2WGW B;  3C4P A;  2WZX A;  4ARZ B;  3IF6 B;  1ZTU A;  3UNW A;  4R3J A;  2ZM0 A;  2P9V A;  5FQQ A;  2IWC A;  4N92 A;  4LV0 A;  4UEY A;  3W4P A;  1YLT A;  2PD8 A;  5KSH A;  4HP4 A;  1TEM A;  4F3L B;  3LR5 A;  1QMF A;  1VET A;  4X69 A;  2WYX A;  5C5K A;  4Z1W A;  1YMX A;  3D4F A;  4WEK A;  5CX7 A;  4QWO A;  3DTM A;  1GCE A;  3MKE A;  4FH2 A;  2Z2L B;  3SH8 A;  5L2F A;  1Y28 A;  4B4X A;  4EUV A;  3V50 A;  1MY8 A;  3H7W A;  3UB8 A;  2FZ0 A;  3V3S A;  1CQA A;  3WRZ A;  5FI6 A;  3IX8 A;  1S6R A;  3PXP A;  4II7 A;  2WAD A;  3BWL A;  4S2P A;  2Q9M A;  3QP8 A;  4L9G A;  4K08 A;  4B9O A;  4PM9 A;  2HDU A;  2WKH A;  3BFF A;  4BD0 A;  3PAE A;  3K2N A;  5TJJ A;  4DDY A;  2CMN A;  2ZLY A;  4EW7 A;  1LI9 A;  3QHY A;  3VSK A;  2W27 A;  2ZC3 B;  2PHY A;  2VGK A;  4HIA A;  2VJW A;  3MQO A;  1PW8 A;  2ZC5 B;  4BLM A;  5HDS A;  3U2A A;  1MC0 A;  3IT9 A;  3SS3 A;  4DE1 A;  1TDL A;  2BAS A;  5DKK A;  4Y0U A;  2J3T C;  2K2N A;  3N8L A;  2BTF P;  3P7N A;  4WBG A;  3OPH A;  2J3T D;  2E8I A;  2L0W A;  3OC2 A;  3UB5 P;  3SOI A;  3EQU A;  4N1X A;  4K91 A;  4ZJ3 A;  2V0W A;  4PPR A;  2D01 A;  3PR6 A;  3MSH A;  1KOU A;  2W3F A;  1LT0 A;  3M2K A;  1P9R A;  5CER A;  1WE4 A;  4LRZ E;  1JWV A;  1ZHH B;  1W5D A;  5JYO A;  2VGJ A;  3BJN A;  4GCZ A;  5DTK A;  1OPX A;  4QJG A;  3E2K A;  3F1P B;  3S7P A;  1SCW A;  5EEC A;  1OTD A;  2WKI A;  2OSU A;  4Y5F A;  2QPN A;  1ESU A;  1ACF A;  4JBF A;  1XFN A;  2HJE A;  3R7W A;  5DVA A;  1PRQ A;  4X56 A;  2EWW A;  5DFY A;  2KDK A;  3EGX C;  2ZL1 A;  1TS6 A;  3DWK A;  3MZE A;  3TSG A;  3S7Q A;  5CED A;  1FIK A;  4I3J A;  3ZVW A;  4HBU A;  2JKR I;  2EFU A;  4ZBE A;  2G7U A;  4KZA A;  3MFD A;  1NRJ A;  3OOV A;  1VET B;  1TF1 A;  1H8Z A;  2Z2M B;  1K6R A;  4RQ9 A;  4ETZ A;  4E6W A;  3A3F A;  1K6S A;  4Y0T A;  2V20 A;  1NLY A;  3D9Y A;  4CLC A;  1PIO A;  3IBR A;  3MS6 A;  2OLU A;  4Q8I A;  5IHV A;  5G18 A;  1L0F A;  3N8S A;  4H8R A;  3QNC A;  3NDG A;  5HZH A;  1DJC A;  1PYY A;  2IWD A;  2C5W B;  1NXY A;  2QKP A;  3D3O A;  3T50 A;  3H7W B;  4S2J A;  3G2Y A;  1ALQ A;  5A92 A;  3KSI A;  2Y8H A;  5M1A A;  2YKH A;  3B42 A;  5FI2 A;  3M6B A;  4S2L A;  5HPF A;  5TGF A;  3MMH A;  3IF5 A;  2OAP 1;  4FOF A;  3FPV A;  5CGX A;  3N4I A;  4OPQ A;  3UB9 A;  2ZQA A;  3PYP A;  4OH0 A;  5CGW A;  4MBH A;  4IBR A;  2P7J A;  1U60 A;  4WL9 A;  3C5A A;  1TD5 A;  1Y54 A;  4GD8 A;  4WMC A;  3LIC A;  3G30 A;  4RYE A;  2P04 A;  4KG6 A;  5G4Z A;  4R3B A;  4E3N A;  1FSW A;  5F6A A;  5JYP A;  4EWF A;  4OLD A;  3HLG A;  4HQA A;  1VM1 A;  2V0U A;  4OOY A;  4LGW A;  3OPP A;  2CC1 A;  4FTX A;  1RCJ A;  3BEC A;  4KQQ A;  4K0X A;  4HES A;  3UN7 A;  2VKS A;  3LIE A;  4Q0I A;  4A5R A;  1N9B A;  2XA7 M;  1UGU A;  3NOU C;  5GHX A;  2XFT A;  3CZD A;  1XJ6 A;  3V3R A;  3A3E A;  5A8B A;  5AVE A;  5GLB A;  4I5S A;  4HJ4 A;  4P0M A;  1D1J A;  4EXO A;  5FQ9 A;  3JVV A;  4YIN A;  3UPP A;  1N9L A;  5A90 A;  3UDF A;  5HL1 A;  4OLG A;  4KZ9 A;  1K54 C;  5CHM A;  4Y17 A;  2LB5 A;  3BFD A;  5FEG A;  1ES2 A;  1KE0 A;  1BZA A;  4UA6 A;  1BLS A;  4EQI A;  2YKF A;  4NET A;  3R7W B;  5J8X A;  1OTB A;  2A3U A;  3RFB A;  2XDM A;  1BT5 A;  3QP4 A;  4E3K A;  4DJ3 A;  2J9P A;  4GZB A;  3UDX A;  3L7H A;  2ZL1 B;  3BLS A;  3MFX A;  4X1L A;  4B4Z A;  1YLJ A;  2J9O A;  1I2W A;  3HLF A;  2V8C A;  3PBN A;  3BLM A;  2O99 A;  3CLO A;  2EX8 A;  4XUX A;  1UWN X;  3BQ8 A;  2VZW A;  4MN5 A;  5DTS A;  1BTL A;  3GEC A;  1BUL A;  3LCE A;  2WGI A;  5DTT A;  5TR7 A;  2H10 A;  4CLC B;  3HJI A;  1GHI A;  3MKF A;  5HAR A;  1S1Z A;  3C38 A;  2PR5 A;  2Y2H A;  2X01 A;  1M40 A;  1PWG A;  4JXV A;  4HP9 A;  3IWO A;  5K5B A;  4C75 A;  1W8Y A;  3C30 A;  5EVE A;  4LEN A;  4WZ5 A;  3CHW P;  2ZJ9 A;  4LCL A;  1P9W A;  4DXB A;  4BBV A;  2KX6 A;  3EWK A;  4JLF A;  1K38 A;  3MJQ A;  1YMS A;  1BUE A;  4R0Q A;  3T4T A;  2GX5 A;  4M3K A;  1L3L A;  1SHV A;  2PYR A;  2ZBB A;  4ZAM A;  3Q81 A;  1G6A A;  1KGG A;  3T4O A;  3MQQ A;  4R3A A;  4EUZ A;  4OP8 A;  2PD7 A;  3SS5 A;  3TRC A;  2OWH A;  3O5Y A;  3GR2 A;  5EVI D;  5DJT A;  3W4O A;  1LI0 A;  5HAP A;  3AGD A;  3IS2 A;  3ZCZ A;  1ES3 A;  4X68 A;  4HJ6 A;  5M18 A;  2PR6 A;  4OQI A;  1NYM A;  3CWF A;  5FA7 A;  3ITB A;  4B93 A;  2ZQC A;  3HVF A;  2MJ6 A;  2VV8 A;  1JVJ A;  5HFO A;  3W2Z A;  3MZD A;  3FC7 A;  5I94 A;  5DF8 A;  2B02 A;  1D06 A;  1PZP A;  1SDE A;  3T4Q A;  4WLA A;  3FKV A;  4JGQ A;  4YNR A;  3ZFZ A;  4BEN A;  3K3C A;  5CEB A;  4G3K A;  4R6L A;  4C3Q A;  4I39 A;  2BG1 A;  3IHB A;  3ICY A;  1KE4 A;  2V1A A;  1BLP A;  2V9A A;  4LLO B;  2FFF B;  3W8K A;  3IXB A;  5F68 A;  1GSV A;  2ZQ9 A;  3DW0 A;  3MXR A;  3DTK A;  1ERO A;  4S2I A;  1N9O A;  2JC7 A;  1GA9 A;  2XRN A;  3ZGA B;  4EBP A;  3OLO A;  4GLQ A;  5CXW A;  4R4S A;  1ONH A;  3FV7 A;  4XT2 A;  2V1B A;  5F5Y A;  4GB7 A;  1TVF A;  4MBF A;  5TFQ A;  3OBF A;  4P6B A;  3SZT A;  5CHU A;  4BQM A;  3B47 A;  4DDS A;  5EM1 A;  5EPH A;  1IEM A;  1H5X A;  3OPR A;  4GJ4 A;  1TS8 A;  3LYX A;  4ME4 A;  4HJ3 A;  3BEB A;  3PBO A;  3VOL A;  3PBS A;  1NWZ A;  1NZU A;  4LV3 A;  3LR3 A;  2Q9N A;  4MCW A;  4O01 A;  3GQZ A;  2ZMF A;  1K25 A;  3W4Q A;  1KE3 A;  1XKZ A;  1T1C A;  2PBD P;  1YLP A;  2ZC6 B;  4NK3 A;  3RTY A;  3MZF A;  5L07 A;  2B95 A;  2RL3 A;  3NDE A;  3PBT A;  2V2F F;  1MBL A;  4GD6 A;  1AXB A;  2L4R A;  2XF3 A;  2RCX A;  4KZ8 A;  2H5S A;  2EFX A;  1OJG A;  3UDI A;  2XH9 A;  2Y55 A;  1YLW A;  4EET B;  3CMZ A;  1Q2P A;  1IYS A;  1K55 A;  3JYI A;  2OOL A;  5AQ7 A;  2VA0 A;  2WUQ A;  5I5L A;  5DKL A;  2W3E A;  4GOG A;  4KZ3 A;  3PAG A;  1RP5 A;  3B3X A;  5CTM A;  1HZO A;  2Y2L A;  4YWZ A;  4OKP A;  1TS0 A;  3UME A;  3G32 A;  2HP6 A;  1FR6 A;  3IS2 B;  3L9K A;  1OJ5 A;  4U0X A;  1T1A A;  4RX2 A;  4F94 A;  5EFW A;  1LL5 A;  3VE3 A;  1XGI A;  4BD1 A;  4IVK A;  3GMW A;  5HD5 A;  2NUT C;  4LV1 A;  4CLC E;  4DKI A;  3DBA A;  3NCK A;  1PI4 A;  3IX3 A;  3AGF A;  2JN7 A;  5LBR A;  4WM9 A;  2M7U A;  1W63 Q;  4OOM A;  1S66 L;  2O9B A;  3KYQ A;  3SW1 A;  3UE3 A;  4EER A;  2WKP A;  4BMW A;  4O0P A;  4UQI M;  4GS9 A;  4LRY C;  2XLN A;  3H82 A;  3ZQ5 A;  4NXB A;  4JF5 A;  1K57 C;  2XD1 A;  3ZNY A;  4DJ2 A;  3UB6 A;  1GSX A;  4PM5 A;  1Z09 A;  3VOY A;  1DP8 A;  3C7U A;  4XT2 B;  3WS5 A;  2VEA A;  2PDR A;  1IEL A;  5CRF A;  4DXC A;  1K55 C;  1BLC A;  3CIT A;  1ZC2 A;  1OT6 A;  2Y2O A;  4XUZ A;  3SS4 A;  1IYO A;  1K56 D;  2VK3 A;  3ZG9 B;  3CPT A;  1MWT A;  1C3B A;  4IUH A;  1F2K A;  2W0N A;  2EXB A;  2C6W B;  3EEH A;  1ESI A;  5CHJ A;  3LY3 A;  5F1G A;  3E98 A;  4BJP A;  2ZQ7 A;  3ZG0 A;  1JWZ A;  5FSR A;  2WAE A;  3LFV A;  4K0W A;  2P9V B;  4EQ1 A;  3NHQ A;  2XK1 A;  4DE3 A;  4NXG A;  3T1X A;  2OV5 A;  4S2M A;  5KSC A;  2WKQ A;  4ZDX A;  4M4X A;  4EES A;  2ZOH A;  4MN7 A;  3NI9 A;  4HEF A;  1WA9 A;  1KDW A;  4CJN A;  1YLZ A;  3A0V A;  1FOF A;  1WYB A;  2WK0 A;  2WAF A;  5FAO A;  2O0Y A;  4LV2 A;  5HWW A;  4MN6 A;  2KOI A;  2ZM8 A;  3PHY A;  3U4L P;  2R78 A;  1K54 A;  3M6H A;  3S4X A;  1K4E A;  2QWS A;  3QP2 A;  1DY6 A;  1G6O A;  2O9A A;  5CTN A;  4KEN B;  4P87 A;  2PAV P;  3WS4 A;  1GHM A;  3UE0 A;  1S4R A;  3G34 A;  2NUP C;  4GDB A;  3VMA A;  3VSL A;  4IHQ A;  4HNB A;  4DE0 A;  3G31 A;  2JKG A;  3GTC A;  4KQO A;  2Y4A A;  4IUK A;  1MKI A;  4MDZ A;  3KYZ A;  3T4J A;  1YPR A;  4DF6 A;  3NY4 A;  1PWC A;  1GHP A;  4E3I A;  5GLC A;  3T1S A;  4C6Y A;  1E3U D;  4HI4 A;  1VEU A;  1CI9 A;  4UQI S;  3LI9 A;  2ACG A;  4KQD A;  5DF9 A;  4BBT A;  1H0M A;  5AQA A;  2Q0O A;  3FYZ A;  2XD5 A;  2EX6 A;  5HSQ A;  4WYY A;  3N6I A;  4X25 A;  3HLD A;  1I2S A;  3CUE C;  4KZ4 A;  5HD3 A;  3HRE A;  3IX4 A;  4EU0 A;  4GS9 B;  4R4R A;  3H82 B;  4X6T A;  1WYC A;  2ZOI A;  3LUQ A;  3EGD C;  4EV4 A;  3Q82 A;  1V9Y A;  4JF6 A;  3KSF A;  1XJ3 A;  3A3J A;  4GN2 A;  4BL3 A;  2A49 A;  3BY8 A;  2I9V A;  4JGP A;  4ETX A;  1G68 A;  4ZRR A;  2H0T A;  4D2O A;  2QMI A;  2E8J A;  3C2W A;  3V5M A;  1DP9 A;  3CPT B;  1W63 M;  4P6Z S;  4I38 A;  4RVA A;  4X1M A;  2DMW A;  2INW A;  3P98 A;  3TG9 A;  2KLI A;  3NJA A;  3G35 A;  5BOH A;  3HLB A;  2PRF A;  2D02 A;  3S7N A;  4WEJ A;  3CJM A;  1XXM A;  2VLG A;  4LPZ A;  3HUO A;  1VB6 A;  2WKR A;  5D3O A;  4MBK A;  4NEE D;  3GVB A;  2AVX A;  3QP1 A;  1QME A;  3IXD A;  5GHY A;  4KUK A;  4KG5 A;  5L09 A;  2K7S A;  2QYB A;  1S67 L;  3QP6 A;  1YSQ A;  4WF0 A;  1GA0 A;  4B88 A;  3TOI A;  5FAQ A;  1LL8 A;  1YKD A;  5EV0 A;  3HCY A;  4HOI A;  2EX2 A;  3HBR A;  5HL6 A;  2G2W A;  1KVM A;  5CEC A;  2JHE A;  1D7E A;  5KMW A;  1BLH A;  4PHT A;  5E2H A;  3QP5 A;  2X71 A;  3F1O A;  2Z6D A;  4OQ0 A;  3LR4 A;  5L10 A;  1YQS A;  1ODV A;  2GZA A;  4LRX C;  5AVF A;  3DWZ A;  4F3L A;  3D72 A;  2EA9 A;  2O9C A;  1XPB A;  1O7E A;  3MF0 A;  4RA7 A;  3G4P A;  4GDN A;  5E2G A;  5E43 A;  1FCM A;  2QHK A;  3NUL A;  1MWS A;  5FQI A;  3O87 A;  4LCM A;  3E4O A;  1EWZ A;  5EVI C;  3OPL A;  2IWB A;  1VEU B;  1G5U A;  1NYY A;  2PT7 A;  3MXS A;  4OQG A;  4PKY G;  2XSS A;  4IBX A;  2P08 A;  3KYE A;  1FIL A;  4OQH A;  1YM1 A;  3KSG A;  5FQJ A;  4U0T A;  3BYD A;  1XA1 A;  3ZNT A;  4JXS A;  2W3D A;  2Y2M A;  2Y91 A;  5HAQ A;  1ES4 A;  3LID A;  1TS7 A;  5F1F A;  2P74 A;  1MKM A;  1V9Z A;  1HTZ A;  2VGL S;  4JGO A;  4DMZ A;  2HDR A;  2A2L A;  2J8Y A;  1HD8 A;  3F1N A;  5U47 A;  2UWX A;  1SZV A;  1LSX A;  4GHI A;  5DJU A;  3LR0 A;  1PI5 A;  1S4S A;  3IF6 C;  1CJF A;  4ESP A;  3HUM A;  3T1Q B;  2DCF A;  1PNE A;  1O07 A;  1RGZ A;  2GJ3 A;  5GHZ A;  1KGF A;  5IT5 A;  3LIA A;  1ONG A;  4YFM A;  3ULF A;  3GV9 A;  3VFF A;  3NOT C;  2R9W A;  3IHA A;  4ZJ1 A;  1SDN A;  1SKO A;  3IH8 A;  4IJG A;  1DJB A;  4Y3I A;  2G2U A;  2Y2P A;  3MR0 A;  3LIB A;  5EOO A;  3O88 A;  4KZ5 A;  1Y4O A;  1YLY A;  3DAV A;  4WN5 A;  3BY9 A;  3WS0 A;  3ISG A;  3JPU A;  4G3V A;  4R1G A;  2Z6C A;  2ZM2 A;  2UV0 E;  4PKY A;  2Y59 A;  4CQH A;  1XFQ A;  2R9X A;  3BFC A;  4NG2 A;  1XP4 A;  4U3T A;  2GNX A;  1JWP A;  4QY5 A;  4OP5 A;  2W1R A;  3IBJ A;  3C4O A;  3ZG7 B;  1JTG A;  1FCN A;  3IQA A;  3ZVT A;  1OT9 A;  3BW6 A;  3AGE A;  3P01 A;  2WKE A;  5EUA A;  1RGY A;  4PM8 A;  1S0W A;  5GLD A;  1OME A;  1IKI A;  2OWJ A;  1IOU A;  3F1O B;  5AQ9 A;  5EE8 A;  5E2F A;  3C7V A;  1K57 A;  3Q1F A;  3VP3 A;  3WWX A;  3FPW A;  1EI5 A;  1P0Z A;  1XGJ A;  1KVL A;  3BFE A;  3NBL A;  4E3M A;  2B18 A;  2WZZ A;  1K56 A;  4S2N C;  1L2S A;  5F83 A;  3VP0 A;  5HDC A;  3FKW A;  3IH9 A;  3C8C A;  2XEP A;  3VFH A;  1VQQ A;  4HY8 A;  4GKU A;  4QD4 A;  4EEU A;  3QNB A;  4E3O A;  5DF7 A;  1P97 A;  1MWU A;  5FQK A;  3SH7 A;  4MLL A;  1F5M A;  1UWP X;  3IWQ A;  2JKT M;  4GNU A;  4HHD A;  3UPO A;  4P85 A;  3B33 A; 
#chains in the Genus database with same CATH homology
 3MFX A;  2LB9 A;  4HH3 A;  2VX8 A;  2JKT I;  3NOP C;  5L8M A;  3PBN A;  2R78 A;  2O99 A;  3CLO A;  3PBQ A;  3RH8 B;  4Q0H A;  1UWN X;  2QWS A;  1G6O A;  3BQ8 A;  2O9A A;  2VZW A;  1LSV A;  3GEC A;  4MN5 A;  1T18 A;  3F1N B;  1XJ4 A;  3S7O A;  1YAX A;  1S4R A;  4GHI B;  4CLC B;  3HJI A;  4L0L A;  2L1M A;  2NUP C;  1S1Z A;  2VV7 A;  3C38 A;  2PR5 A;  1N9N A;  4IHQ A;  3EEA A;  4HNB A;  4E04 A;  2M1C A;  4HP9 A;  4Y2F A;  4I3I A;  4QPR A;  4NXF A;  4KQO A;  4BBU A;  5J4E A;  4IUK A;  5K5B A;  4MDZ A;  1G28 A;  3C30 A;  3KYZ A;  4FSF A;  3T4J A;  5IS1 A;  3KX0 X;  4AFI A;  4H6J B;  1BYW A;  3F1P A;  4Q0J A;  4HI4 A;  1P9W A;  3E4Q A;  4BBV A;  4UQI S;  2QJ5 A;  5DFX A;  5HWT A;  3LI9 A;  2KX6 A;  3EWK A;  4KQD A;  4ARZ B;  3MJQ A;  3HJK A;  5DF9 A;  4BBT A;  5HSQ A;  3T4S A;  3T4K A;  4NXE A;  1ZTU A;  3T4T A;  3K3D A;  2GX5 A;  1MZU A;  3CUE C;  2M7V A;  5HDD A;  5HD3 A;  4EU0 A;  4UEY A;  2PYR A;  4GS9 B;  4G3W A;  2ZBB A;  3H82 B;  2PD8 A;  2ZOI A;  5KSH A;  4HP4 A;  3LUQ A;  1F9I A;  3T4O A;  4F3L B;  3LR5 A;  3MQQ A;  4R3A A;  2J80 A;  3EGD C;  2PD7 A;  3TRC A;  1V9Y A;  2W3G A;  2OWH A;  3KSF A;  4P6Z M;  1XJ3 A;  3O5Y A;  3BY8 A;  1OTA A;  2I9V A;  4Z1W A;  5C5K A;  4JGP A;  5DJT A;  4WEK A;  4ETX A;  5CX7 A;  5KIZ A;  4ZRR A;  3E4P A;  3IS2 A;  4HJ6 A;  5F69 A;  3C2W A;  2PR6 A;  1DP9 A;  2W3H A;  1W63 M;  3CUE A;  1Y28 A;  4P6Z S;  3CWF A;  4EUV A;  4B93 A;  4I38 A;  2DMW A;  1F98 A;  2INW A;  4HH2 A;  2MJ6 A;  2VV8 A;  2KLI A;  3H7W A;  3NJA A;  2QJ7 A;  4KUO A;  3UB8 A;  3W2Z A;  2FZ0 A;  3G6O A;  4WUJ A;  3FC7 A;  2B02 A;  1D06 A;  2D02 A;  3S7N A;  4WEJ A;  3T4Q A;  4WLA A;  1S1Y A;  2VLG A;  4LPZ A;  1DP6 A;  3PXP A;  1VB6 A;  2WKR A;  4JGQ A;  4YNR A;  4II7 A;  3UB7 A;  1H3Q A;  2A24 A;  3K3C A;  3BWL A;  1T1B A;  4NEE D;  4G3K A;  4R6L A;  4GW9 A;  3V67 A;  4I39 A;  2XRO A;  1EW0 A;  4L9G A;  4K08 A;  4KUK A;  4B9O A;  3ICY A;  2V1A A;  4L9E A;  2K31 A;  3K2N A;  5TBM A;  5TJJ A;  2CMN A;  2K7S A;  2QYB A;  4EW7 A;  2V9A A;  1VHM A;  4LLO B;  1T19 A;  2Y79 A;  3OCN A;  3TW8 A;  1S67 L;  5F68 A;  1GSV A;  1YSQ A;  2W27 A;  4WF0 A;  1X0O A;  2PHY A;  4HIA A;  3TJZ C;  2VJW A;  1N9O A;  3MQO A;  1LL8 A;  1YKD A;  3A0R A;  2XRN A;  5HDS A;  4YOF A;  3U2A A;  5HWV A;  1MC0 A;  3HCY A;  4HOI A;  3EOI A;  3OLO A;  4GLQ A;  2BAS A;  5DKK A;  2J3T C;  2K2N A;  4XT2 A;  2V1B A;  5HL6 A;  5F5Y A;  2PYP A;  4OOL A;  3P7N A;  2JHE A;  3OBF A;  1D7E A;  2VV6 A;  4PHT A;  2J3T D;  2L0W A;  3B47 A;  3OC2 A;  3F1O A;  2Z6D A;  3EQU A;  5J7E A;  1XJ2 A;  3LR4 A;  4GJ4 A;  1TS8 A;  4WEL A;  3UE6 A;  2V0W A;  3LYX A;  4HJ3 A;  4ME4 A;  2HJ9 C;  1JNU A;  1ODV A;  2GZA A;  4L9F A;  4LRX C;  5AVF A;  1OTI A;  4O8G A;  3LI8 A;  2D01 A;  3PBO A;  3D72 A;  3PR6 A;  2EA9 A;  2O9C A;  4F3L A;  3VOL A;  1KOU A;  3PBS A;  3MF0 A;  1NWZ A;  2W3F A;  3KO6 A;  3LR3 A;  1LT0 A;  1YSP A;  2HV1 A;  4MCW A;  1P9R A;  1NLZ A;  4LRZ E;  4O01 A;  3R4K A;  1ZHH B;  2QHK A;  2ZMF A;  2W1T A;  1LSW A;  3BJN A;  4GCZ A;  1OPX A;  3F1P B;  1IFQ A;  3S7P A;  3E4O A;  5J3W A;  3ZYT A;  1T1C A;  1OTD A;  2ZMV A;  1OTE A;  2PT7 A;  3A0S A;  3RTY A;  3OCL A;  4Y5F A;  3CI6 A;  4PKY G;  3TE8 A;  3LIF A;  2IA2 A;  1XFN A;  2XSS A;  2HJE A;  3UMD A;  4CLC C;  2P08 A;  5HPI A;  3R7W A;  3PBT A;  2VGL M;  4PAU A;  4DN0 A;  2L4R A;  3KSG A;  2EWW A;  5DFY A;  3VV4 A;  2KDK A;  3EGX C;  4CLC D;  2W3D A;  1TS6 A;  1OJG A;  2JKR M;  1GSW A;  3H9W A;  3LID A;  3VE4 A;  3S7Q A;  1TS7 A;  4EET B;  3BQA A;  1MKM A;  1V9Z A;  4I3J A;  2VGL S;  2OOL A;  4JGO A;  4DMZ A;  2JKR I;  2G7U A;  2VA0 A;  5I5L A;  1NRJ A;  3OOV A;  5DKL A;  2W3E A;  1TF1 A;  3GDI A;  2A2L A;  3F1N A;  4RQ9 A;  4ETZ A;  3PBR A;  1NLY A;  3FG8 A;  1LSX A;  4GHI A;  3IBR A;  4CLC A;  5DJU A;  3LR0 A;  3MQ0 A;  5FL3 A;  4YWZ A;  1TS0 A;  1DRM A;  1S4S A;  3UME A;  5MC7 A;  3IS2 B;  4EEP A;  1OJ5 A;  1STZ A;  5HZH A;  1T1A A;  5EFW A;  3VE3 A;  2QKP A;  3D3O A;  3T50 A;  3H7W B;  4BWI A;  5HD5 A;  4H6J A;  2GJ3 A;  3CAX A;  2NUT C;  5IT5 A;  3LIA A;  3KSI A;  4CLC E;  2Y8H A;  3DBA A;  3ULF A;  5IU1 A;  2YKH A;  3NOT C;  3B42 A;  2J3W A;  3E0Y A;  2A24 B;  4IJG A;  2H28 A;  5HPF A;  4ARZ A;  2JN7 A;  4Y3I A;  5LBR A;  3MMH A;  3MR0 A;  2OAP 1;  4FOF A;  3FPV A;  3LIB A;  2M7U A;  1W63 Q;  4OOM A;  1S66 L;  3UB9 A;  2O9B A;  2OAQ 1;  3KYQ A;  3PYP A;  3SW1 A;  4WN5 A;  5TBM B;  3UE3 A;  4EER A;  3BY9 A;  2HF6 A;  2WKP A;  4BMW A;  4O0P A;  1H8M A;  4UQI M;  2P7J A;  4G3V A;  4GS9 A;  2Z6C A;  4LRY C;  4I3A A;  4WL9 A;  3H82 A;  3ZQ5 A;  1TD5 A;  4NXB A;  4PKY A;  4CQH A;  1XFQ A;  4DJ2 A;  3UB6 A;  3LIC A;  4MMN A;  2P04 A;  5G4Z A;  1GSX A;  2GNX A;  3JVU A;  5F6A A;  3EQV A;  2W1R A;  3IBJ A;  1DP8 A;  4HQA A;  4XT2 B;  1OT9 A;  3BW6 A;  2V0U A;  2VEA A;  5AJG A;  2PDR A;  3P01 A;  2HGV A;  3CIT A;  1OT6 A;  5G4Y A;  2VKS A;  4R70 A;  2OWJ A;  1IOU A;  3LIE A;  4Q0I A;  4IUH A;  3F1O B;  2W0N A;  2XA7 M;  3EEH A;  1UGU A;  3NOU C;  1XJ6 A;  3E98 A;  3T4L A;  4BJP A;  3FPW A;  5A8B A;  1P0Z A;  5AVE A;  3LFV A;  4I5S A;  4R38 A;  4EQ1 A;  3NHQ A;  4HJ4 A;  2XA7 S;  2B18 A;  4NXG A;  4EXO A;  4NKP A;  3JVV A;  5HDC A;  2W1T B;  2FH5 A;  4JGR A;  1N9L A;  2WKQ A;  3C8C A;  3KSH A;  4M4X A;  4EES A;  2ZOH A;  4HY8 A;  4MN7 A;  2LB5 A;  3MXQ A;  4EEU A;  1WA9 A;  3A0V A;  1P97 A;  2YKF A;  3R7W B;  2O0Y A;  1OTB A;  1F5M A;  1UWP X;  3RFB A;  5HWW A;  2JKT M;  4MN6 A;  4HHD A;  2EWV A;  2KOI A;  4DJ3 A;  3B33 A;  3PHY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...