4N1HA

Structure of a single-domain camelid antibody fragment cab-f11n in complex with the blap beta-lactamase from bacillus licheniformis
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
258
structure length
257
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALVTSLRAFALEPGKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Probing the mechanism of aggregation of polyQ model proteins with camelid heavy-chain antibody fragments
rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase/immune system
total genus 84
structure length 257
sequence length 258
chains with identical sequence C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4n1hA00
4BLMA 4WYYA 3AGFA 4KZ4A 1TDGA 3IQAA 2X02A 2PBYA 3VP3A 5GLBA 1K6SA 2WYXA 2Y91A 5KSHA 2Z2MB 5FI6A 3M6HA 1JVJA 3IHBA 4XUXA 1Q2PA 3GV9A 2ZC5B 1EWZA 5GLAA 2B5RA 3ZG5A 2XEPA 3O86A 4PMAA 3HLGA 3MZFA 3M6BA 4DF6A 5CERA 3BM6A 3BFEA 4KG5A 1QMFA 1LLBA 4CJNA 1MY8A 3HL9A 1CEFA 5E2FA 1FOFA 4NK3A 5CHMA 3G35A 5TR7A 1M6KA 4OPRA 4C6YA 2Y2IA 3P98A 4WM9A 4EBPA 4YFMA 4ZDXA 1K56D 3HLDA 3SS3A 3UO9A 1KE3A 4GD8A 1YMSA 3VSKA 1KGEA 3VMAA 4HBUA 4P6BA 2CC1A 1K4FA 4OLGA 1DJBA 2OSUA 5CGWA 3Q82A 5F82A 3AGDA 4E3OA 1NYMA 4QD4A 1E3UD 2ZM0A 3G2YA 3QNBA 1J9MA 2I72A 1KDWA 5FAOA 3A3IA 4JXSA 3ITBA 2WGIA 3EQUA 3PBNA 1RGYA 4GOGA 3G4PA 3LEZA 1I2WA 2XFSA 3PBSA 4GKUA 4ZBEA 3O3VA 1IELA 3ZDJA 4UA6A 4DE1A 1ONGA 3MZEA 3W4QA 2WKIA 1CI8A 4BJPA 3HLEA 4R3BA 1W5DA 4P85A 2EX9A 1HZOA 2Y2LA 2QZ6A 3PAEA 4C3QA 2ZJ9A 3C5AA 4KQOA 5CXWA 1L0GA 4JBFA 5DTTA 1IEMA 4GZBA 3TSGA 4DE2A 5KSCA 2HDSA 3HVFA 2ZQ7A 1O07A 4HEFA 4KZ9A 5FATA 4OQ0A 3MKFA 2EFUA 3IXBA 4PM9A 2WAEA 1S0WA 5CRFA 1TDLA 3WS1A 2HP6A 2HDQA 3M2KA 4DDSA 1K6RA 4WMCD 4OLDA 4S2NA 3E2LA 4KZ3A 3IWQA 4N9KA 4DXCA 2EXAA 3NCKA 3TOIA 3MXSA 4N9LA 3O88A 1ES2A 3A3EA 3OCNA 5CGSA 3Q07A 2C5WB 5E2EA 1FCMA 4IVIA 4IVKA 4LV0A 5EVID 2A3UA 1FR6A 2DNSA 4UA7A 3CJMA 3E2KA 1BZAA 4JF4A 4L0LA 4KZ8A 2XD5A 3IXGA 1SCWA 4LCMA 1ONHA 3IT9A 4WELA 5CHUA 5HFOA 2QPNA 1E4DA 1VQQA 3BLSA 5E43A 1BTLA 4MBHA 2Y2HA 3IXDA 2HDUA 5A93A 1K57C 2Y2GA 1I2SA 3IXHA 1XX2A 4LV2A 4DKIA 5JYOA 3Q7VB 1LI0A 4JXVA 1RCJA 1NJ4A 1WYCA 1XPBA 2J7VA 2H10A 5AQAA 1IYSA 1GHMA 4Q8IA 3VP2A 4OP5A 1CEGA 3HBRA 4OVDA 4WZ4A 3VFHA 4Z9QA 4E3NA 1L0EA 1XGIA 2R9WA 3GTCA 1BUEA 1NRFA 1PZOA 4N1XA 3HUMA 3BYDA 3BRMA 2ZQAA 5FQ9A 3MKEA 3QHYA 3RXWA 3ZVWA 4X56A 2WGWA 3OC2A 5HL1A 3GQZA 4JF6A 1YLJA 4R4RA 1C3BA 4JXGA 1L0FA 2BLSA 1U60A 3G31A 3A3JA 3PAGA 4WZ5C 2IWDA 4FCFA 3SH9A 3SS4A 3ZNYA 1LI9A 1K55A 4K0XA 1MWUA 1ZKJA 4X68A 3MZDA 2VGJA 4F94A 3IWOA 5G18A 3HLWA 1KGFA 2OLVA 3FWLA 2V2FF 1LL9A 4E3MA 1N4OA 3NDEA 5EVIC 5FA7A 5FQKA 3SH7A 1OMEA 2Y2MA 2WGVA 1KVLA 5M1AA 4C75A 2PU2A 4GNUA 1RP5A 3UE1A 3EQVA 5FI2A 1CI9A 3SOIA 3NDGA 5DVAA 1ZG6A 3IF6A 4BD1A 2WK0A 3PBRA 4ZJ2A 1KGGA 3WS0A 5CTMA 5EVIB 3C7UA 2DRWA 4ZTKA 1FCNA 1MPLA 3CZDA 5CEDA 4E3JA 2EX8A 3C4PA 5EECA 4RVAA 3ZGAB 3BFCA 3LY3A 5EOEA 5A90A 4EBLA 5AQBA 1W79A 3OPPA 1GCEA 4LV1A 4NETA 4RA7A 1CK3A 5FASA 2ZM8A 3LO7A 4LV3A 4IBRA 4B4ZA 4QJGA 3SS5A 1BLHA 1L2SA 4S2OA 5KMWA 3B3XA 2V20A 3PBQA 3IH9A 1DY6A 3RJUA 3D4FA 2XK1A 1W8QA 4WEJA 2XD1A 1ERMA 1FSYA 1YLZA 1H8ZA 4FH2A 2ZQ9A 1PWDA 1K54C 1XXMA 2Y2KA 4M3KA 2WAFA 4S2JA 3JYIA 3OCLA 3S22A 1JTDA 5A92A 1YT4A 3TG9A 4EWFA 1QMEA 3UY6A 2ZMAA 4JF5A 2X71A 4IEDA 1BULA 1IYPA 2HPBA 4MEZA 4E3KA 4GDBA 3N4IA 5L2FA 4ID4A 2FFFB 3DWZA 2P74A 3WS5A 2Y55A 3PTEA 5CGXA 1G6AA 1ESUA 3RXXA 1Q2QA 2P9VA 2WGWB 3ZNTA 1RGZA 2DCFA 5GLDA 4Y0TA 4Y0OA 4FH4A 2JCHA 3FV7A 5AQ7A 3DW0A 2Q9MA 3VOZA 4ZAMA 1AXBA 5FQJA 3NY4A 2JC7A 2VGKA 2WKEA 4QHCA 1KVMA 1XA1A 4HESA 5CHJA 4Y0UA 4KQRA 2IWCA 3UDXA 1MXOA 5FSRA 3G32A 2EFXA 4KZ5A 5GL9A 5E2GA 1IKGA 5HX9A 1NXYA 3UN7A 2JBFA 2WUQA 2ZLYA 4ZJ3A 4XXRA 3OPHA 2ZC3B 3IF6B 5A91A 2V1ZA 1FCOA 3IWIA 4JPMA 5JYPA 5CECA 1BLPA 1XA7A 5D3OA 5FI7A 3IHAA 2GDNA 3ZHHA 1G68A 4QU3A 3VP1A 4A5RA 2XQZA 2J9PA 3VP4A 3UPPA 5HAQA 1WE4A 5U47A 1GA9A 1I5QA 4BL3A 3FZCA 4PM8A 3PBOA 5GLCA 3NI9A 5FQQA 4OOLA 2JE5A 1L0DA 2Y2QA 3ZFZA 4N92A 1M40A 1KE4A 4BQMA 4OOMA 3Q81A 2EXBA 1IYOA 4RYEA 4DXBA 1LHYA 5TFQA 5M19A 1BSGA 4E3IA 3P09A 5IHVA 3IH8A 1PYYA 1Z6FA 3GMWA 1BLSA 3LCEA 1E25A 4KG6A 4X69A 1EROA 3MBZA 1YLWA 1ES3A 2Q9NA 3FYZA 3GR2A 3IF5A 1O7EA 4P87A 5EE8A 5EPHA 3WS4A 1EI5A 4GD6A 4JXWA 5E2HA 3VOYA 2HDRA 1PZPA 4GDNA 2HP9A 1N9BA 3WS2A 2OLUA 1PI5A 2XF3A 1JWPA 4KG2A 1MKIA 4MBKA 4R4SA 1H5XA 2H5SA 2Y59A 3HLBA 3OZHA 4OPYA 4S2NC 5GHYA 4EUZA 1IYQA 5FQIA 3S4XA 3W4OA 3FKVA 4OQHA 5F1GA 5GHZA 3GRJA 3O87A 3FKWA 4JKTA 4OOYA 3V39A 2ZM2A 3Q1FA 2R9XA 1YMXA 3N8SA 2XGNA 1SKFA 4P0MA 3HLFA 4K0WA 4GB7A 1DJAA 5AQ9A 1TVFA 5DF9A 1ERQA 4PM7A 5DF7A 1Y54A 5EOOA 2E8IA 4QB8A 3N7WA 2XLNA 2ZQDA 4FD8A 3UDIA 4BL2A 3DTMA 2ZC7A 3C4OA 3G34A 5KZHA 4MNRA 4RX2A 1ES5A 2ZC4B 3W8KA 3ZCZA 4HBTA 3S1YA 2J8YA 1PW1A 4S2IA 3WRZA 1NZUA 4S2PA 4R0QA 4UA9A 1ESIA 5EUAA 3NIAA 5HW3A 2Z2LB 1ES4A 3N6IA 4BENA 2WKHA 1XP4A 1K25A 3PBTA 4WBGA 2H0TA 4QY6A 2A49A 3BEBA 3HREA 3M2JA 5DF8A 4CPKA 5F1FA 3UE3A 1K38A 1K56A 1GHIA 3UNWA 1BLCA 1H8YA 1WYBA 2XFTA 4QY5A 4OQGA 2J9OA 4S2MA 3V50A 4LENA 3OPLA 3I7JA 1NZOA 3Q7VA 3LY4A 3HUOA 5HAIA 1E3UA 2HP5A 4EV4A 1S6RA 2XDMA 1MBLA 4KZ6A 1IKIA 5BOHA 3DWKA 3CG5A 1YLPA 1YQSA 1K55C 1K57A 3VP0A 3AGEA 1PWGA 4BD0A 1ZG4A 4DRTA 5FDHA 3W4PA 3ZG9B 4GN2A 2XR0A 5FQMA 4N1HA 4U0XA 4DE0A 3ZG7B 1MWSA 3Q7ZA 1PWCA 5GHXA 4E6WA 1DJCA 4LCLA 1PIOA 2G2UA 1SDEA 5TGFA 4PM5A 1ZC2A 3BFDA 2H0YA 2WADA 4KQQA 2Y2JA 4R1GA 3UDFA 3IF6C 3WRTA 4X6TA 2WZXA 3ZG8B 2ZC6B 4D2OA 4E3LA 3NBLA 4U3TA 4WEKA 1NYYA 3BLMA 4EQIA 2EX6A 1GHPA 2ZQCA 1NY0A 1VM1A 3HUNA 3QNCA 5DTSA 2FFYA 4UAAA 4WMCA 4WZ5A 4O7DA 5CEBA 3ITAA 4IBXA 2RCXA 1KE0A 4R23A 4OPZA 4PPRA 4RX3A 1JTGA 5DTKA 3C7VA 4EBNA 4MBFA 2Y2OA 1HVBA 3G2ZA 5EVLA 1YLTA 4OONA 3GVBA 4ZJ1A 1XGJA 2IWBA 5EVIA 3ISGA 2BG1A 4B4XA 1MWRA 1GA0A 1FSWA 3ZG0A 1YM1A 4H8RA 4U0TA 2Y2NA 3VFFA 3G30A 5FAPA 2Y2PA 2XH9A 4S2LA 2RL3A 4X55A 5F83A 1W7FA 4OH0A 2G2WA 3VSLA 4PM6A 4DE3A 1XKZA 5FAQA 3V5MA 4OKPA 1LL5A 2UWXA 1FQGA 3GSGA 3N8RA 2EX2A 2WZZA 3BECA 5HARA 1SDNA 3BFGA 3SH8A 4Y7PA 1ALQA 2OV5A 4JLFA 5J8XA 2ZD8A 4R3JA 2C6WB 3WWXA 4E6XA 5CTNA 1HD8A 2PU4A 4S2KA 3CMZA 3OPRA 4OQIA 2ZQ8A 4FSFA 2QMIA 3UPOA 2Y4AA 4KZBA 5M18A 4OPQA 1JWVA 3MFDA 4XUZA 3BFFA 4K91A 4KENB 3UPNA 1K4EA 3V3SA 1BT5A 3UE0A 3N8LA 4B88A 3HLCA 1TEMA 5I94A 2X01A 3V3RA 1MWTA 2P9VB 3MXRA 4UHUA 1K54A 3NC8A 4OP8A 1HTZA 3A3DA 4KZ7A 1FR1A 4KZAA 1PI4A 1SHVA 1KDSA 3A3FA 1PW8A 1W8YA 1JWZA 3ZVTA 1YLYA 4DDYA 4MLLA 4YINA 5HAPA 4X53A
chains in the Genus database with same CATH superfamily
4WYYA 3AGFA 4KZ4A 2X02A 2PBYA 1K6SA 5KSHA 2Z2MB 3IHBA 2ZC5B 2E8JA 3ZG5A 3M6BA 3BM6A 3BFEA 3LIBA 4KG5A 1FOFA 4NK3A 3G35A 4WM9A 4LRXC 4CLCE 2GNXA 4YFMA 3VSKA 1KE3A 4GD8A 3E98A 3KYEA 2CC1A 2OAP1 5G4ZA 4KUOA 1L3LA 4GHIA 2V9AA 4R38A 4JGQA 3ITBA 3EQUA 4PKYA 1RGYA 1TS8A 5DKKA 3PBSA 3NOUC 1ACFA 2VV6A 1CI8A 4BJPA 2Y2LA 1VEUA 3C5AA 3F1NB 5DTTA 4Y17A 3TSGA 5EVEA 1N9OA 4KZ9A 2Q0OA 4OQ0A 5TBMB 2EFUA 4PM9A 5EFWA 2IA2A 2W3EA 4DDSA 5FEGA 2I9VA 2PYPA 4S2NA 3E2LA 4DXCA 4N9LA 3OCNA 5CGSA 1FCMA 4IVIA 4IVKA 5EVID 4CLCD 2A24B 2DNSA 4UA7A 3CJMA 4BWIA 2XD5A 2PRFA 3IXGA 1SCWA 3MQ0A 1ZTUA 2Y2HA 5A93A 3T4OA 1I2SA 3IXHA 4DKIA 3Q7VB 1LI0A 4JXVA 2J7VA 2PR5A 2H10A 5AQAA 1GHMA 4Q8IA 3VP2A 4OP5A 3EGXC 3VFHA 4E3NA 1L0EA 1XGIA 2R9WA 4GCZA 3QP2A 4YOFA 5FQ9A 4EEPA 4EU0A 4Y3IA 1YPRA 1D7EA 2IWDA 3SS4A 4EETB 2JN7A 1K55A 4K0XA 4MMNA 4X68A 4JGPA 1N9NA 1KGFA 3T1QB 1F2KA 3ICYA 2JKFA 1N4OA 3NDEA 2FZ0A 2Y2MA 1NRJA 2WGVA 5M1AA 3EQVA 5J7EA 1CI9A 3NDGA 1KGGA 2HV1A 5CTMA 3C7UA 4LPZA 1MPLA 2EX8A 3K2NA 4RVAA 3ZGAB 5A90A 2PT7A 4Q0IA 5AQBA 1WA9A 2XA7M 4DN0A 3HJIA 3T1SA 4YWZA 1BLHA 4L9GA 3IH9A 3D4FA 2XK1A 1ERMA 3CAXA 4FH2A 2Y2KA 2WAFA 1QMEA 2X71A 3FPVA 1VETB 3T4KA 3BJNA 1G6AA 5EV0A 1ESUA 1Q2QA 2WGWB 3ZNTA 1A0KA 2JCHA 4ZAMA 1AXBA 3E0YA 2J3TD 4KQRA 1G28A 4KZ5A 5HX9A 3UN7A 3NECA 2ZLYA 3BY8A 1LSWA 2V1ZA 3LUQA 5HDSA 4B9OA 5D3OA 2YKFA 3IHAA 5J4EA 2NUPC 1G68A 4A5RA 4CQHA 2W3DA 2J9PA 5HAQA 5L10A 1WE4A 1GA9A 4PM8A 1UGUA 5GLCA 2Y8HA 5FQQA 1L0DA 2Y2QA 1M40A 4OOMA 3Q81A 2EXBA 1MKMA 1BSGA 1KOUA 4X69A 1J3WA 2V0UA 3VE3A 4GLQA 1ES3A 3IF5A 5EPHA 4GD6A 1PZPA 3WS2A 1MKIA 1CQAA 1TS7A 3NULA 2H5SA 3HLBA 1YSPA 5HDCA 4EUZA 1IYQA 3F1PB 3FKVA 4OQHA 4GS9B 4CLCC 2FH5A 4JKTA 3V39A 3F1NA 4K08A 2R9XA 3N8SA 2LB9A 4GB7A 1DJAA 5AQ9A 5EOOA 2E8IA 1F5MA 5HDDA 4MNRA 4RX2A 4WN5A 2A2LA 1VB6A 3MS6A 1PW1A 4S2IA 1NLYA 4R0QA 4FOFA 2Z2LB 1OTDA 3N6IA 1XP4A 4NXBA 1LSVA 3BEBA 3HREA 5DF8A 5F1FA 1K56A 1GHIA 4QY5A 5C5KA 3OPLA 1NZOA 3Q7VA 3LY4A 4QPRA 1ZHHB 3OBFA 1MBLA 2KX6A 3DWKA 4AFIA 3S7QA 1PWGA 1ZG4A 3B42A 4DRTA 3DTKA 3W4PA 5DFXA 5FQMA 4U0XA 4L9EA 1DJCA 2P08A 3EGDC 3CPTB 2Y79A 2G2UA 2VA0A 3BWLA 4PM5A 3G6OA 2M7UA 2H0YA 2O0YA 2Y2JA 2NUTC 3IF6C 4R1GA 5FDSA 2VEAA 3W2ZA 4D2OA 4E3LA 4WEKA 3BLMA 4EQIA 4EQ1A 4WZ5A 1KE0A 4R23A 1NLZA 4EBNA 2Z6DA 1XGJA 3ISGA 3UB5P 2BG1A 4U0TA 2ZL1B 5FAPA 4JGRA 4XT2B 5F83A 3O5YA 5FAQA 3V5MA 4F3LB 4WUJA 1FQGA 3N8RA 5HARA 4IJGA 4MN7A 3SH8A 1ALQA 4R3JA 2HGVA 5M18A 3BFFA 3UPNA 5A8BA 3P01A 3N8LA 4B88A 3HLCA 2J3TC 1TEMA 3TE8A 1K54A 3U4LP 1VETA 3NC8A 4P6ZM 5K5BA 2O9CA 1SHVA 2WKRA 4FTXA 1W8YA 4MLLA 4MDZA 4X53A 5L8MA 1GSVA 2JKGA 1ODVA 2P04A 5GLBA 1JVJA 1Q2PA 3GV9A 1H3QA 5GLAA 3KSGA 1QMFA 1MY8A 5I5LA 3HL9A 1CEFA 5E2FA 4X1MA 2HZ5A 1CF0A 4C6YA 2Y2IA 3TRCA 4I3JA 3VMAA 3FC7A 2OSUA 5F82A 3AGDA 4E3OA 4QD4A 5CX7A 3G2YA 2I72A 3A3IA 3PBNA 1IOUA 4GOGA 3G4PA 2XFSA 3ZDJA 4UA6A 3MZEA 3L7HA 2WKIA 3LIDA 1W5DA 2EX9A 3PAEA 2ZJ9A 3T50A 3NOPC 2HDSA 4HEFA 1S66L 4RQ9A 1JNUA 1S0WA 3P7NA 4Y5FA 5CRFA 3ZQ5A 2HP6A 1K6RA 5L09A 4OLDA 2PAVP 3PXPA 2EXAA 2VV8A 3NCKA 4EERA 5G4YA 3MXSA 1S4RA 3Q07A 4EEUA 4H6JB 1BZAA 4JF4A 4KZ8A 4ESPA 1ONHA 5HFOA 3BLSA 4Y15A 1K57C 1XX2A 4I39A 1NJ4A 1IYSA 3R7WA 4OVDA 2D01A 3MQQA 1PZOA 4N1XA 3MSHA 3HUMA 2ZQAA 1GSXA 3ZVWA 4X56A 3JVUA 3OC2A 4BBUA 4JF6A 3EEHA 1YLJA 4R4RA 4JXGA 1T18A 4O0PA 4FCFA 1LI9A 1MWUA 5G18A 5KIZA 3KYQA 3H7WA 4E3MA 3T1RA 1XJ6A 3LR3A 1OMEA 4GNUA 1RP5A 3D3OA 3SOIA 4BD1A 2WK0A 3PBRA 1D1JA 3WS0A 5EVIB 4CLCB 3MMHA 1FCNA 3CZDA 3UB8A 4X1LA 3BFCA 4EW7A 4EBLA 1W79A 3LR4A 4MN6A 1DP9A 3ZYTA 3OOVA 2ZL1A 2V0WA 4B4ZA 4QJGA 3GDIA 1L2SA 4S2OA 2V8FA 5DJUA 2XD1A 1FSYA 1YKDA 3JYIA 3S22A 2WKPA 4I5SA 1IYPA 2B18A 3E4OA 4ID4A 2FFFB 3DWZA 4HNBA 2Y55A 2PD7A 1OTBA 3PTEA 1OJ5A 2YKHA 1RGZA 3GECA 5GLDA 1P9WA 2JKRM 3C38A 3NY4A 1KVMA 5CHJA 3V67A 3UDXA 5GL9A 5E2GA 1IKGA 1LL8A 4BMWA 4ZJ3A 2ZC3B 3IF6B 1F98A 2VV7A 4HJ4A 2W1TA 1BLPA 2GDNA 4QU3A 1K0KA 1Z09A 4MN5A 2UV0E 3VP4A 2V1AA 4O01A 4BL3A 1I5QA 3PBOA 3CUEA 3ZFZA 4G3VA 4N92A 3IS2B 1IYOA 4RYEA 4DXBA 1LHYA 1PRQA 1D06A 3DTIA 4HJ6A 1BLSA 3TJZC 1Y28A 3FYZA 1SKOB 3WS4A 1EI5A 5E2HA 3VOYA 2OLUA 2XF3A 4KG2A 4MBKA 4R4SA 2Y59A 3A0RA 4S2NC 4LLOB 1OT6A 5FQIA 3S4XA 1G6OA 3W4OA 1H0MA 3GRJA 3FKWA 2ZM2A 4ARZB 3UB9A 3CWFA 1ERQA 1V9ZA 5DF7A 1Y54A 2ZQDA 3QP6A 3DTMA 3C4OA 3C30A 1ES5A 3T12B 1XFNA 3ZCZA 3EEAA 2H28A 4UA9A 1CJFA 5HW3A 1HLUP 2WKHA 1K25A 2OAQ1 2A49A 5TJJA 4CPKA 3UNWA 1BLCA 1H8YA 2XFTA 3V50A 4OQGA 4LENA 2CMNA 5HAIA 2HP5A 1S6RA 2XDMA 2PYRA 4LRYC 4IUHA 1IKIA 2V1BA 5BOHA 5DFYA 1YQSA 1K55C 3AGEA 1EW0A 1OJGA 2XR0A 4HI4A 4N1HA 1MWSA 1PWCA 3VE4A 3LIAA 4LCLA 4R70A 3CLOA 2WADA 4KQQA 5HD3A 3F1OB 4X6TA 3WRTA 2ZC6B 3IBRA 4U3TA 2GZAA 2EX6A 1GHPA 2K2NA 5F6AA 1NY0A 1VM1A 3HUNA 4UAAA 2JKRI 1UWPX 3UB6A 2B02A 2PDRA 3UB7A 3G2ZA 3T1XA 3GVBA 2IWBA 5EVIA 1OTEA 3ZG0A 2Y2PA 1XJ2A 4X55A 5AVFA 4OH0A 2G2WA 4HOIA 3VSLA 4PM6A 1XKZA 3CHWP 1LL5A 3QP4A 2O9AA 3GSGA 3MJQA 2EX2A 2WZZA 3BFGA 4Y7PA 4E6XA 2PU4A 4S2KA 4OQIA 2ZQ8A 4KZBA 2VKSA 3UMEA 3V3SA 4HP4A 3UE0A 1FIKA 5I94A 3V3RA 3B33A 4HQAA 5IU1A 4OP8A 4KZ7A 1T1BA 1FR1A 4KZAA 1PI4A 3CI6A 1KDSA 4I3IA 5F5YA 5TBMA 4DDYA 5HWVA 3VP3A 1IFQA 4GJ4A 4XUXA 3EOIA 2XEPA 2A24A 1Y4OA 4DF6A 2V8CA 1LLBA 4BBVA 5CHMA 1M6KA 3MQOA 3P98A 4EBPA 2Z6CA 3UO9A 3HLDA 1YMSA 1KGEA 4HBUA 4QWOA 1K4FA 4OLGA 1DJBA 5CGWA 1E3UD 3BY9A 3IX3A 5FAOA 4JXSA 3FG8A 2WGIA 2PD8A 4GKUA 3LEZA 1I2WA 4ZBEA 3O3VA 3A0SA 1ONGA 4EXOA 2XSSA 5HWTA 1XJ4A 2PHYA 4C3QA 1P97A 5EM0A 4KQOA 5CXWA 1L0GA 1IEMA 5KSCA 1O07A 1SZVA 3MKFA 3IXBA 1S4SA 1TDLA 3T4QA 2HDQA 3M2KA 4WMCD 3D9YA 3IWQA 1ES2A 2INWA 2C5WB 4LV0A 4Q0HA 3IT9A 5CHUA 1E4DA 3IXDA 2Y2GA 5JYOA 1WYCA 1XPBA 2VLGA 2EWWA 2MJ6A 1CEGA 3HBRA 3T4LA 3IX8A 1NRFA 2GJ3A 3DAVA 3BYDA 4ZRRA 3MKEA 3QHYA 2JKTM 2WGWA 3GQZA 1C3BA 1L0FA 2BLSA 3G31A 4WZ5C 3SH9A 4F94A 3IWOA 4IUKA 1S1ZA 2OLVA 1LL9A 5FQKA 3SH7A 3C2WA 2JHEA 1KVLA 4C75A 3UE1A 5FI2A 1T19A 5CEDA 5EOEA 4NETA 5FASA 2ZM8A 2LB5A 4LV3A 2QKPA 4IBRA 1TS0A 5KMWA 3B3XA 2V20A 2VGLS 1DY6A 1W8QA 1H8ZA 2ZQ9A 1PWDA 1K54C 1OPXA 2QHKA 4HH2A 5A92A 1JTDA 4EWFA 3UY6A 4IEDA 5L2FA 4E3KA 4NXFA 4GDBA 3N4IA 3RXXA 3F1PA 1XFQA 4GS9A 4Y0TA 4Y0OA 5HPFA 5AQ7A 3VOZA 5FQJA 2WKEA 2IWCA 2KDKA 5FSRA 3G32A 1LSXA 3H82B 3PYPA 1NXYA 2JBFA 3NJAA 4M4XA 4I38A 3MF0A 3OPHA 3NOTC 4B93A 1FCOA 4NXEA 4JPMA 5CECA 4HHDA 3ZHHA 4X25A 1UWNX 3UPPA 3D72A 1H8MA 4DJ3A 1N9LA 3NI9A 2L0WA 2JE5A 3MFXA 1KE4A 2D02A 4HH3A 5TFQA 3RFBA 3IH8A 3B47A 1Z6FA 3KYZA 3E4PA 1E25A 4KG6A 1EROA 2Q9NA 2KOIA 1O7EA 3HCYA 1BYWA 2HDRA 3CPTA 4GDNA 4YNRA 3OZHA 5IS1A 5GHYA 1PFLA 5GHZA 2J3WA 1YSQA 3O87A 4OOYA 1FILA 2OWHA 1X0OA 2ACGA 3ULFA 2JKTI 4P0MA 2J80A 3LIFA 4PM7A 3IX4A 2XLNA 1P9RA 4FD8A 3UDIA 2P7JA 3KO6A 2ZC4B 3W8KA 4HBTA 3WRZA 2VJWA 1ESIA 5EUAA 1YAXA 4BENA 4XT2A 1GSWA 3PBTA 4WBGA 2ZOIA 4F3LA 3UE3A 5LBRA 1WYBA 1OTAA 2HJEA 4S2MA 2L4RA 3HUOA 4D60A 4EV4A 2ZMFA 4L9FA 2BTFP 4KZ6A 4NXGA 1YLPA 3VP0A 5FDHA 3ZG9B 3LGOA 3VOLA 3ZG7B 3FPWA 4E6WA 1PIOA 1SDEA 5F69A 5TGFA 1ZC2A 3BFDA 4I3AA 3UDFA 2WZXA 4WF0A 3ZG8B 5FEFA 3RH8B 3NBLA 1NYYA 1W63M 2ZQCA 3QNCA 5CEBA 1OT9A 2QJ7A 4PPRA 3C7VA 3S7PA 2Y2OA 4NG2A 3UE6A 4OONA 1MWRA 1FSWA 1YM1A 2Y2NA 3VFFA 2XH9A 2RL3A 1T1AA 4DE3A 4PAUA 4HJ3A 3BECA 1SDNA 3UPOA 5J8XA 2ZD8A 3JVVA 3WWXA 5CTNA 1HD8A 3SZTA 3OPRA 4Y13A 4FSFA 2QWSA 3CITA 2Y4AA 3MFDA 1DP8A 4XUZA 4K91A 2HJ9C 2O9BA 2P9VB 3MXRA 3UMDA 4EESA 4P6ZS 5HSQA 3LEQA 3QP8A 1PW8A 3H9WA 1JWZA 3ZVTA 1YLYA 4BLMA 1TDGA 3IQAA 2W27A 3SW1A 2WYXA 2Y91A 3DTEA 1S1YA 5FI6A 3M6HA 3H82A 1EWZA 2B5RA 3O86A 4PMAA 3LR5A 3HLGA 3MZFA 3KX0X 4G3KA 4KQDA 5CERA 3CUEC 4H6JA 4Z1WA 5HZHA 4CJNA 2XROA 5TR7A 3TW8A 5J3WA 4GW9A 4OPRA 3PHYA 4ZDXA 1K56D 3SS3A 1OTIA 4WLAA 4P6BA 4UQIS 3Q82A 3DBAA 1NYMA 2QJ5A 2ZM0A 3QNBA 1J9MA 1KDWA 2HF6A 3MXQA 2VGLM 1S67L 1VHMA 3VV4A 3S7OA 4NEED 1IELA 4DE1A 3W4QA 1W63Q 3HLEA 4R3BA 4P85A 1TF1A 1HZOA 2QZ6A 5HPIA 1TS6A 4JBFA 5HL6A 4GZBA 4DE2A 2WKQA 4EUVA 3HVFA 2EA9A 2ZQ7A 1G5UA 5FATA 2WAEA 3WS1A 1MZUA 2QYBA 4KZ3A 4N9KA 3K3CA 1STZA 4HY8A 3TOIA 4CLCA 3O88A 3A3EA 1V9YA 5E2EA 4UEYA 4WL9A 1P0ZA 2A3UA 1FR6A 3A0VA 2W3GA 3E2KA 4L0LA 3BW6A 3C8CA 4LCMA 4WELA 2QPNA 1VQQA 5E43A 1BTLA 4MBHA 2HDUA 4LV2A 1RCJA 2M7VA 4WZ4A 5DJTA 4Z9QA 3GTCA 2W1RA 5HWWA 1BUEA 3BRMA 3RXWA 1DRMA 5HL1A 3PAGA 1U60A 3ZNYA 3A3JA 3U2AA 1DP6A 1ZKJA 3MZDA 2VGJA 4PHTA 3BQAA 3HLWA 3FWLA 2V2FF 5EVIC 5FA7A 1LT0A 2PU2A 2PR6A 5DVAA 1ZG6A 2W3HA 3IF6A 4ZJ2A 4ZTKA 2DRWA 4E3JA 3C4PA 5EECA 3LY3A 3KSIA 3OPPA 1GCEA 4LV1A 4RA7A 3NHQA 1CK3A 3LO7A 3SS5A 4DJ2A 3IS2A 3PBQA 3RJUA 2B95A 1AWIA 4WEJA 1YLZA 1XXMA 4M3KA 4S2JA 3OCLA 3LICA 1YT4A 3R7WB 3EWKA 3TG9A 1PNEA 4HP9A 2VX8A 2EWVA 2ZMAA 4ETXA 4JF5A 1SKOA 1BULA 2HPBA 4MEZA 2P74A 3WS5A 5CGXA 4LFUA 2DMWA 2P9VA 3T4TA 2DCFA 2OWJA 4FH4A 4E04A 4ARZA 3FV7A 3DW0A 2Q9MA 4Y2FA 3E4QA 2JC7A 2VGKA 2XRNA 4QHCA 1XA1A 4HESA 4Y0UA 3H7WB 1MXOA 1TD5A 2VZWA 2EFXA 2M1CA 5F68A 2WUQA 4XXRA 2W3FA 1F9IA 5A91A 3LYXA 3IWIA 5JYPA 2AVXA 1XA7A 5FI7A 2K7SA 3OLOA 3VP1A 2XQZA 3LFVA 2BASA 1MC0A 5EM1A 5U47A 3FZCA 4LGWA 3K3DA 4IHQA 4OOLA 1NWZA 4GHIB 5FL3A 3T4SA 4BQMA 5M19A 4E3IA 4KUKA 3P09A 5IHVA 1PYYA 3GMWA 3LCEA 4FUWA 3PR6A 3MBZA 1YLWA 3LI9A 2W0NA 3LIEA 3GR2A 4P87A 5EE8A 4JXWA 1VEUB 2HP9A 1N9BA 4II7A 1PI5A 1JWPA 5L07A 1H5XA 4OPYA 4NKPA 2PBDP 5MC7A 1XJ3A 3F1OA 5F1GA 2VK3A 3Q1FA 1YMXA 2XGNA 1SKFA 3HLFA 4K0WA 1TVFA 5DF9A 2G7UA 4QB8A 3N7WA 5AVEA 4BL2A 4Q0JA 2ZC7A 3G34A 2ZMVA 5KZHA 1T1CA 3S1YA 2J8YA 2XA7S 1NZUA 4S2PA 3NIAA 2W1TB 1ES4A 2KLIA 2ZOHA 2H0TA 4QY6A 3M2JA 4PKYG 2R78A 1K38A 2J9OA 2L1MA 3I7JA 2O99A 4DMZA 4ME4A 3LR0A 1E3UA 5AJGA 4UQIM 3CG5A 1K57A 4BD0A 4G3WA 2ZBBA 4GN2A 4DE0A 3Q7ZA 5GHXA 2K31A 5HD5A 4BBTA 3IBJA 3JPUA 3QP5A 3MR0A 3BQ8A 5DKLA 4ETZA 5IT5A 3S7NA 5DTSA 2FFYA 4WMCA 4O7DA 3ITAA 4IBXA 4R6LA 2RCXA 3R4KA 4OPZA 4RX3A 1JTGA 5DTKA 3KSHA 4MBFA 4R3AA 1HVBA 5EVLA 1YLTA 4ZJ1A 4B4XA 1GA0A 4H8RA 3G30A 4S2LA 2OOLA 3L9KA 1W7FA 2GX5A 3RTYA 3T4JA 4OKPA 2UWXA 2OV5A 4JLFA 2C6WB 3CMZA 3KSFA 2QMIA 4OPQA 1JWVA 4KENB 1K4EA 1BT5A 2X01A 3HJKA 1MWTA 4HIAA 4UHUA 3QP1A 1HTZA 3A3DA 4JGOA 3LI8A 3A3FA 4LRZE 4MCWA 4YINA 4O8GA 5HAPA
chains in the Genus database with same CATH topology
4BLMA 4WYYA 3AGFA 4KZ4A 1TDGA 3IQAA 2X02A 2PBYA 3VP3A 5GLBA 1K6SA 2WYXA 2Y91A 5KSHA 2Z2MB 5FI6A 3M6HA 1JVJA 3IHBA 4XUXA 1Q2PA 3GV9A 2ZC5B 1EWZA 5GLAA 2B5RA 3ZG5A 2XEPA 3O86A 4PMAA 3HLGA 3MZFA 3M6BA 4DF6A 5CERA 3BM6A 3BFEA 4KG5A 1QMFA 1LLBA 4CJNA 1MY8A 3HL9A 1CEFA 5E2FA 1FOFA 4NK3A 5CHMA 3G35A 5TR7A 1M6KA 4OPRA 4C6YA 2Y2IA 3P98A 4WM9A 4EBPA 4YFMA 4ZDXA 1K56D 3HLDA 3SS3A 3UO9A 1KE3A 4GD8A 1YMSA 3VSKA 1KGEA 3VMAA 4HBUA 4P6BA 2CC1A 1K4FA 4OLGA 1DJBA 2OSUA 5CGWA 3Q82A 5F82A 3AGDA 4E3OA 1NYMA 4QD4A 1E3UD 2ZM0A 3G2YA 3QNBA 1J9MA 2I72A 1KDWA 5FAOA 3A3IA 4JXSA 3ITBA 2WGIA 3EQUA 3PBNA 1RGYA 4GOGA 3G4PA 3LEZA 1I2WA 2XFSA 3PBSA 4GKUA 4ZBEA 3O3VA 1IELA 3ZDJA 4UA6A 4DE1A 1ONGA 3MZEA 3W4QA 2WKIA 1CI8A 4BJPA 3HLEA 4R3BA 1W5DA 4P85A 2EX9A 1HZOA 2Y2LA 2QZ6A 3PAEA 4C3QA 2ZJ9A 3C5AA 4KQOA 5CXWA 1L0GA 4JBFA 5DTTA 1IEMA 4GZBA 3TSGA 4DE2A 5KSCA 2HDSA 3HVFA 2ZQ7A 1O07A 4HEFA 4KZ9A 5FATA 4OQ0A 3MKFA 2EFUA 3IXBA 4PM9A 2WAEA 1S0WA 5CRFA 1TDLA 3WS1A 2HP6A 2HDQA 3M2KA 4DDSA 1K6RA 4WMCD 4OLDA 4S2NA 3E2LA 4KZ3A 3IWQA 4N9KA 4DXCA 2EXAA 3NCKA 3TOIA 3MXSA 4N9LA 3O88A 1ES2A 3A3EA 3OCNA 5CGSA 3Q07A 2C5WB 5E2EA 1FCMA 4IVIA 4IVKA 4LV0A 5EVID 2A3UA 1FR6A 2DNSA 4UA7A 3CJMA 3E2KA 1BZAA 4JF4A 4L0LA 4KZ8A 2XD5A 3IXGA 1SCWA 4LCMA 1ONHA 3IT9A 4WELA 5CHUA 5HFOA 2QPNA 1E4DA 1VQQA 3BLSA 5E43A 1BTLA 4MBHA 2Y2HA 3IXDA 2HDUA 5A93A 1K57C 2Y2GA 1I2SA 3IXHA 1XX2A 4LV2A 4DKIA 5JYOA 3Q7VB 1LI0A 4JXVA 1RCJA 1NJ4A 1WYCA 1XPBA 2J7VA 2H10A 5AQAA 1IYSA 1GHMA 4Q8IA 3VP2A 4OP5A 1CEGA 3HBRA 4OVDA 4WZ4A 3VFHA 4Z9QA 4E3NA 1L0EA 1XGIA 2R9WA 3GTCA 1BUEA 1NRFA 1PZOA 4N1XA 3HUMA 3BYDA 3BRMA 2ZQAA 5FQ9A 3MKEA 3QHYA 3RXWA 3ZVWA 4X56A 2WGWA 3OC2A 5HL1A 3GQZA 4JF6A 1YLJA 4R4RA 1C3BA 4JXGA 1L0FA 2BLSA 1U60A 3G31A 3A3JA 3PAGA 4WZ5C 2IWDA 4FCFA 3SH9A 3SS4A 3ZNYA 1LI9A 1K55A 4K0XA 1MWUA 1ZKJA 4X68A 3MZDA 2VGJA 4F94A 3IWOA 5G18A 3HLWA 1KGFA 2OLVA 3FWLA 2V2FF 1LL9A 4E3MA 1N4OA 3NDEA 5EVIC 5FA7A 5FQKA 3SH7A 1OMEA 2Y2MA 2WGVA 1KVLA 5M1AA 4C75A 2PU2A 4GNUA 1RP5A 3UE1A 3EQVA 5FI2A 1CI9A 3SOIA 3NDGA 5DVAA 1ZG6A 3IF6A 4BD1A 2WK0A 3PBRA 4ZJ2A 1KGGA 3WS0A 5CTMA 5EVIB 3C7UA 2DRWA 4ZTKA 1FCNA 1MPLA 3CZDA 5CEDA 4E3JA 2EX8A 3C4PA 5EECA 4RVAA 3ZGAB 3BFCA 3LY3A 5EOEA 5A90A 4EBLA 5AQBA 1W79A 3OPPA 1GCEA 4LV1A 4NETA 4RA7A 1CK3A 5FASA 2ZM8A 3LO7A 4LV3A 4IBRA 4B4ZA 4QJGA 3SS5A 1BLHA 1L2SA 4S2OA 5KMWA 3B3XA 2V20A 3PBQA 3IH9A 1DY6A 3RJUA 3D4FA 2XK1A 1W8QA 4WEJA 2XD1A 1ERMA 1FSYA 1YLZA 1H8ZA 4FH2A 2ZQ9A 1PWDA 1K54C 1XXMA 2Y2KA 4M3KA 2WAFA 4S2JA 3JYIA 3OCLA 3S22A 1JTDA 5A92A 1YT4A 3TG9A 4EWFA 1QMEA 3UY6A 2ZMAA 4JF5A 2X71A 4IEDA 1BULA 1IYPA 2HPBA 4MEZA 4E3KA 4GDBA 3N4IA 5L2FA 4ID4A 2FFFB 3DWZA 2P74A 3WS5A 2Y55A 3PTEA 5CGXA 1G6AA 1ESUA 3RXXA 1Q2QA 2P9VA 2WGWB 3ZNTA 1RGZA 2DCFA 5GLDA 4Y0TA 4Y0OA 4FH4A 2JCHA 3FV7A 5AQ7A 3DW0A 2Q9MA 3VOZA 4ZAMA 1AXBA 5FQJA 3NY4A 2JC7A 2VGKA 2WKEA 4QHCA 1KVMA 1XA1A 4HESA 5CHJA 4Y0UA 4KQRA 2IWCA 3UDXA 1MXOA 5FSRA 3G32A 2EFXA 4KZ5A 5GL9A 5E2GA 1IKGA 5HX9A 1NXYA 3UN7A 2JBFA 2WUQA 2ZLYA 4ZJ3A 4XXRA 3OPHA 2ZC3B 3IF6B 5A91A 2V1ZA 1FCOA 3IWIA 4JPMA 5JYPA 5CECA 1BLPA 1XA7A 5D3OA 5FI7A 3IHAA 2GDNA 3ZHHA 1G68A 4QU3A 3VP1A 4A5RA 2XQZA 2J9PA 3VP4A 3UPPA 5HAQA 1WE4A 5U47A 1GA9A 1I5QA 4BL3A 3FZCA 4PM8A 3PBOA 5GLCA 3NI9A 5FQQA 4OOLA 2JE5A 1L0DA 2Y2QA 3ZFZA 4N92A 1M40A 1KE4A 4BQMA 4OOMA 3Q81A 2EXBA 1IYOA 4RYEA 4DXBA 1LHYA 5TFQA 5M19A 1BSGA 4E3IA 3P09A 5IHVA 3IH8A 1PYYA 1Z6FA 3GMWA 1BLSA 3LCEA 1E25A 4KG6A 4X69A 1EROA 3MBZA 1YLWA 1ES3A 2Q9NA 3FYZA 3GR2A 3IF5A 1O7EA 4P87A 5EE8A 5EPHA 3WS4A 1EI5A 4GD6A 4JXWA 5E2HA 3VOYA 2HDRA 1PZPA 4GDNA 2HP9A 1N9BA 3WS2A 2OLUA 1PI5A 2XF3A 1JWPA 4KG2A 1MKIA 4MBKA 4R4SA 1H5XA 2H5SA 2Y59A 3HLBA 3OZHA 4OPYA 4S2NC 5GHYA 4EUZA 1IYQA 5FQIA 3S4XA 3W4OA 3FKVA 4OQHA 5F1GA 5GHZA 3GRJA 3O87A 3FKWA 4JKTA 4OOYA 3V39A 2ZM2A 3Q1FA 2R9XA 1YMXA 3N8SA 2XGNA 1SKFA 4P0MA 3HLFA 4K0WA 4GB7A 1DJAA 5AQ9A 1TVFA 5DF9A 1ERQA 4PM7A 5DF7A 1Y54A 5EOOA 2E8IA 4QB8A 3N7WA 2XLNA 2ZQDA 4FD8A 3UDIA 4BL2A 3DTMA 2ZC7A 3C4OA 3G34A 5KZHA 4MNRA 4RX2A 1ES5A 2ZC4B 3W8KA 3ZCZA 4HBTA 3S1YA 2J8YA 1PW1A 4S2IA 3WRZA 1NZUA 4S2PA 4R0QA 4UA9A 1ESIA 5EUAA 3NIAA 5HW3A 2Z2LB 1ES4A 3N6IA 4BENA 2WKHA 1XP4A 1K25A 3PBTA 4WBGA 2H0TA 4QY6A 2A49A 3BEBA 3HREA 3M2JA 5DF8A 4CPKA 5F1FA 3UE3A 1K38A 1K56A 1GHIA 3UNWA 1BLCA 1H8YA 1WYBA 2XFTA 4QY5A 4OQGA 2J9OA 4S2MA 3V50A 4LENA 3OPLA 3I7JA 1NZOA 3Q7VA 3LY4A 3HUOA 5HAIA 1E3UA 2HP5A 4EV4A 1S6RA 2XDMA 1MBLA 4KZ6A 1IKIA 5BOHA 3DWKA 3CG5A 1YLPA 1YQSA 1K55C 1K57A 3VP0A 3AGEA 1PWGA 4BD0A 1ZG4A 4DRTA 5FDHA 3W4PA 3ZG9B 4GN2A 2XR0A 5FQMA 4N1HA 4U0XA 4DE0A 3ZG7B 1MWSA 3Q7ZA 1PWCA 5GHXA 4E6WA 1DJCA 4LCLA 1PIOA 2G2UA 1SDEA 5TGFA 4PM5A 1ZC2A 3BFDA 2H0YA 2WADA 4KQQA 2Y2JA 4R1GA 3UDFA 3IF6C 3WRTA 4X6TA 2WZXA 3ZG8B 2ZC6B 4D2OA 4E3LA 3NBLA 4U3TA 4WEKA 1NYYA 3BLMA 4EQIA 2EX6A 1GHPA 2ZQCA 1NY0A 1VM1A 3HUNA 3QNCA 5DTSA 2FFYA 4UAAA 4WMCA 4WZ5A 4O7DA 5CEBA 3ITAA 4IBXA 2RCXA 1KE0A 4R23A 4OPZA 4PPRA 4RX3A 1JTGA 5DTKA 3C7VA 4EBNA 4MBFA 2Y2OA 1HVBA 3G2ZA 5EVLA 1YLTA 4OONA 3GVBA 4ZJ1A 1XGJA 2IWBA 5EVIA 3ISGA 2BG1A 4B4XA 1MWRA 1GA0A 1FSWA 3ZG0A 1YM1A 4H8RA 4U0TA 2Y2NA 3VFFA 3G30A 5FAPA 2Y2PA 2XH9A 4S2LA 2RL3A 4X55A 5F83A 1W7FA 4OH0A 2G2WA 3VSLA 4PM6A 4DE3A 1XKZA 5FAQA 3V5MA 4OKPA 1LL5A 2UWXA 1FQGA 3GSGA 3N8RA 2EX2A 2WZZA 3BECA 5HARA 1SDNA 3BFGA 3SH8A 4Y7PA 1ALQA 2OV5A 4JLFA 5J8XA 2ZD8A 4R3JA 2C6WB 3WWXA 4E6XA 5CTNA 1HD8A 2PU4A 4S2KA 3CMZA 3OPRA 4OQIA 2ZQ8A 4FSFA 2QMIA 3UPOA 2Y4AA 4KZBA 5M18A 4OPQA 1JWVA 3MFDA 4XUZA 3BFFA 4K91A 4KENB 3UPNA 1K4EA 3V3SA 1BT5A 3UE0A 3N8LA 4B88A 3HLCA 1TEMA 5I94A 2X01A 3V3RA 1MWTA 2P9VB 3MXRA 4UHUA 1K54A 3NC8A 4OP8A 1HTZA 3A3DA 4KZ7A 1FR1A 4KZAA 1PI4A 1SHVA 1KDSA 3A3FA 1PW8A 1W8YA 1JWZA 3ZVTA 1YLYA 4DDYA 4MLLA 4YINA 5HAPA 4X53A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BLM A;  4WYY A;  3AGF A;  4KZ4 A;  1TDG A;  3IQA A;  2X02 A;  2PBY A;  3VP3 A;  5GLB A;  1K6S A;  2WYX A;  2Y91 A;  5KSH A;  2Z2M B;  5FI6 A;  3M6H A;  1JVJ A;  3IHB A;  4XUX A;  1Q2P A;  3GV9 A;  2ZC5 B;  1EWZ A;  5GLA A;  2B5R A;  3ZG5 A;  2XEP A;  3O86 A;  4PMA A;  3HLG A;  3MZF A;  3M6B A;  4DF6 A;  5CER A;  3BM6 A;  3BFE A;  4KG5 A;  1QMF A;  1LLB A;  4CJN A;  1MY8 A;  3HL9 A;  1CEF A;  5E2F A;  1FOF A;  4NK3 A;  5CHM A;  3G35 A;  5TR7 A;  1M6K A;  4OPR A;  4C6Y A;  2Y2I A;  3P98 A;  4WM9 A;  4EBP A;  4YFM A;  4ZDX A;  1K56 D;  3HLD A;  3SS3 A;  3UO9 A;  1KE3 A;  4GD8 A;  1YMS A;  3VSK A;  1KGE A;  3VMA A;  4HBU A;  4P6B A;  2CC1 A;  1K4F A;  4OLG A;  1DJB A;  2OSU A;  5CGW A;  3Q82 A;  5F82 A;  3AGD A;  4E3O A;  1NYM A;  4QD4 A;  1E3U D;  2ZM0 A;  3G2Y A;  3QNB A;  1J9M A;  2I72 A;  1KDW A;  5FAO A;  3A3I A;  4JXS A;  3ITB A;  2WGI A;  3EQU A;  3PBN A;  1RGY A;  4GOG A;  3G4P A;  3LEZ A;  1I2W A;  2XFS A;  3PBS A;  4GKU A;  4ZBE A;  3O3V A;  1IEL A;  3ZDJ A;  4UA6 A;  4DE1 A;  1ONG A;  3MZE A;  3W4Q A;  2WKI A;  1CI8 A;  4BJP A;  3HLE A;  4R3B A;  1W5D A;  4P85 A;  2EX9 A;  1HZO A;  2Y2L A;  2QZ6 A;  3PAE A;  4C3Q A;  2ZJ9 A;  3C5A A;  4KQO A;  5CXW A;  1L0G A;  4JBF A;  5DTT A;  1IEM A;  4GZB A;  3TSG A;  4DE2 A;  5KSC A;  2HDS A;  3HVF A;  2ZQ7 A;  1O07 A;  4HEF A;  4KZ9 A;  5FAT A;  4OQ0 A;  3MKF A;  2EFU A;  3IXB A;  4PM9 A;  2WAE A;  1S0W A;  5CRF A;  1TDL A;  3WS1 A;  2HP6 A;  2HDQ A;  3M2K A;  4DDS A;  1K6R A;  4WMC D;  4OLD A;  4S2N A;  3E2L A;  4KZ3 A;  3IWQ A;  4N9K A;  4DXC A;  2EXA A;  3NCK A;  3TOI A;  3MXS A;  4N9L A;  3O88 A;  1ES2 A;  3A3E A;  3OCN A;  5CGS A;  3Q07 A;  2C5W B;  5E2E A;  1FCM A;  4IVI A;  4IVK A;  4LV0 A;  5EVI D;  2A3U A;  1FR6 A;  2DNS A;  4UA7 A;  3CJM A;  3E2K A;  1BZA A;  4JF4 A;  4L0L A;  4KZ8 A;  2XD5 A;  3IXG A;  1SCW A;  4LCM A;  1ONH A;  3IT9 A;  4WEL A;  5CHU A;  5HFO A;  2QPN A;  1E4D A;  1VQQ A;  3BLS A;  5E43 A;  1BTL A;  4MBH A;  2Y2H A;  3IXD A;  2HDU A;  5A93 A;  1K57 C;  2Y2G A;  1I2S A;  3IXH A;  1XX2 A;  4LV2 A;  4DKI A;  5JYO A;  3Q7V B;  1LI0 A;  4JXV A;  1RCJ A;  1NJ4 A;  1WYC A;  1XPB A;  2J7V A;  2H10 A;  5AQA A;  1IYS A;  1GHM A;  4Q8I A;  3VP2 A;  4OP5 A;  1CEG A;  3HBR A;  4OVD A;  4WZ4 A;  3VFH A;  4Z9Q A;  4E3N A;  1L0E A;  1XGI A;  2R9W A;  3GTC A;  1BUE A;  1NRF A;  1PZO A;  4N1X A;  3HUM A;  3BYD A;  3BRM A;  2ZQA A;  5FQ9 A;  3MKE A;  3QHY A;  3RXW A;  3ZVW A;  4X56 A;  2WGW A;  3OC2 A;  5HL1 A;  3GQZ A;  4JF6 A;  1YLJ A;  4R4R A;  1C3B A;  4JXG A;  1L0F A;  2BLS A;  1U60 A;  3G31 A;  3A3J A;  3PAG A;  4WZ5 C;  2IWD A;  4FCF A;  3SH9 A;  3SS4 A;  3ZNY A;  1LI9 A;  1K55 A;  4K0X A;  1MWU A;  1ZKJ A;  4X68 A;  3MZD A;  2VGJ A;  4F94 A;  3IWO A;  5G18 A;  3HLW A;  1KGF A;  2OLV A;  3FWL A;  2V2F F;  1LL9 A;  4E3M A;  1N4O A;  3NDE A;  5EVI C;  5FA7 A;  5FQK A;  3SH7 A;  1OME A;  2Y2M A;  2WGV A;  1KVL A;  5M1A A;  4C75 A;  2PU2 A;  4GNU A;  1RP5 A;  3UE1 A;  3EQV A;  5FI2 A;  1CI9 A;  3SOI A;  3NDG A;  5DVA A;  1ZG6 A;  3IF6 A;  4BD1 A;  2WK0 A;  3PBR A;  4ZJ2 A;  1KGG A;  3WS0 A;  5CTM A;  5EVI B;  3C7U A;  2DRW A;  4ZTK A;  1FCN A;  1MPL A;  3CZD A;  5CED A;  4E3J A;  2EX8 A;  3C4P A;  5EEC A;  4RVA A;  3ZGA B;  3BFC A;  3LY3 A;  5EOE A;  5A90 A;  4EBL A;  5AQB A;  1W79 A;  3OPP A;  1GCE A;  4LV1 A;  4NET A;  4RA7 A;  1CK3 A;  5FAS A;  2ZM8 A;  3LO7 A;  4LV3 A;  4IBR A;  4B4Z A;  4QJG A;  3SS5 A;  1BLH A;  1L2S A;  4S2O A;  5KMW A;  3B3X A;  2V20 A;  3PBQ A;  3IH9 A;  1DY6 A;  3RJU A;  3D4F A;  2XK1 A;  1W8Q A;  4WEJ A;  2XD1 A;  1ERM A;  1FSY A;  1YLZ A;  1H8Z A;  4FH2 A;  2ZQ9 A;  1PWD A;  1K54 C;  1XXM A;  2Y2K A;  4M3K A;  2WAF A;  4S2J A;  3JYI A;  3OCL A;  3S22 A;  1JTD A;  5A92 A;  1YT4 A;  3TG9 A;  4EWF A;  1QME A;  3UY6 A;  2ZMA A;  4JF5 A;  2X71 A;  4IED A;  1BUL A;  1IYP A;  2HPB A;  4MEZ A;  4E3K A;  4GDB A;  3N4I A;  5L2F A;  4ID4 A;  2FFF B;  3DWZ A;  2P74 A;  3WS5 A;  2Y55 A;  3PTE A;  5CGX A;  1G6A A;  1ESU A;  3RXX A;  1Q2Q A;  2P9V A;  2WGW B;  3ZNT A;  1RGZ A;  2DCF A;  5GLD A;  4Y0T A;  4Y0O A;  4FH4 A;  2JCH A;  3FV7 A;  5AQ7 A;  3DW0 A;  2Q9M A;  3VOZ A;  4ZAM A;  1AXB A;  5FQJ A;  3NY4 A;  2JC7 A;  2VGK A;  2WKE A;  4QHC A;  1KVM A;  1XA1 A;  4HES A;  5CHJ A;  4Y0U A;  4KQR A;  2IWC A;  3UDX A;  1MXO A;  5FSR A;  3G32 A;  2EFX A;  4KZ5 A;  5GL9 A;  5E2G A;  1IKG A;  5HX9 A;  1NXY A;  3UN7 A;  2JBF A;  2WUQ A;  2ZLY A;  4ZJ3 A;  4XXR A;  3OPH A;  2ZC3 B;  3IF6 B;  5A91 A;  2V1Z A;  1FCO A;  3IWI A;  4JPM A;  5JYP A;  5CEC A;  1BLP A;  1XA7 A;  5D3O A;  5FI7 A;  3IHA A;  2GDN A;  3ZHH A;  1G68 A;  4QU3 A;  3VP1 A;  4A5R A;  2XQZ A;  2J9P A;  3VP4 A;  3UPP A;  5HAQ A;  1WE4 A;  5U47 A;  1GA9 A;  1I5Q A;  4BL3 A;  3FZC A;  4PM8 A;  3PBO A;  5GLC A;  3NI9 A;  5FQQ A;  4OOL A;  2JE5 A;  1L0D A;  2Y2Q A;  3ZFZ A;  4N92 A;  1M40 A;  1KE4 A;  4BQM A;  4OOM A;  3Q81 A;  2EXB A;  1IYO A;  4RYE A;  4DXB A;  1LHY A;  5TFQ A;  5M19 A;  1BSG A;  4E3I A;  3P09 A;  5IHV A;  3IH8 A;  1PYY A;  1Z6F A;  3GMW A;  1BLS A;  3LCE A;  1E25 A;  4KG6 A;  4X69 A;  1ERO A;  3MBZ A;  1YLW A;  1ES3 A;  2Q9N A;  3FYZ A;  3GR2 A;  3IF5 A;  1O7E A;  4P87 A;  5EE8 A;  5EPH A;  3WS4 A;  1EI5 A;  4GD6 A;  4JXW A;  5E2H A;  3VOY A;  2HDR A;  1PZP A;  4GDN A;  2HP9 A;  1N9B A;  3WS2 A;  2OLU A;  1PI5 A;  2XF3 A;  1JWP A;  4KG2 A;  1MKI A;  4MBK A;  4R4S A;  1H5X A;  2H5S A;  2Y59 A;  3HLB A;  3OZH A;  4OPY A;  4S2N C;  5GHY A;  4EUZ A;  1IYQ A;  5FQI A;  3S4X A;  3W4O A;  3FKV A;  4OQH A;  5F1G A;  5GHZ A;  3GRJ A;  3O87 A;  3FKW A;  4JKT A;  4OOY A;  3V39 A;  2ZM2 A;  3Q1F A;  2R9X A;  1YMX A;  3N8S A;  2XGN A;  1SKF A;  4P0M A;  3HLF A;  4K0W A;  4GB7 A;  1DJA A;  5AQ9 A;  1TVF A;  5DF9 A;  1ERQ A;  4PM7 A;  5DF7 A;  1Y54 A;  5EOO A;  2E8I A;  4QB8 A;  3N7W A;  2XLN A;  2ZQD A;  4FD8 A;  3UDI A;  4BL2 A;  3DTM A;  2ZC7 A;  3C4O A;  3G34 A;  5KZH A;  4MNR A;  4RX2 A;  1ES5 A;  2ZC4 B;  3W8K A;  3ZCZ A;  4HBT A;  3S1Y A;  2J8Y A;  1PW1 A;  4S2I A;  3WRZ A;  1NZU A;  4S2P A;  4R0Q A;  4UA9 A;  1ESI A;  5EUA A;  3NIA A;  5HW3 A;  2Z2L B;  1ES4 A;  3N6I A;  4BEN A;  2WKH A;  1XP4 A;  1K25 A;  3PBT A;  4WBG A;  2H0T A;  4QY6 A;  2A49 A;  3BEB A;  3HRE A;  3M2J A;  5DF8 A;  4CPK A;  5F1F A;  3UE3 A;  1K38 A;  1K56 A;  1GHI A;  3UNW A;  1BLC A;  1H8Y A;  1WYB A;  2XFT A;  4QY5 A;  4OQG A;  2J9O A;  4S2M A;  3V50 A;  4LEN A;  3OPL A;  3I7J A;  1NZO A;  3Q7V A;  3LY4 A;  3HUO A;  5HAI A;  1E3U A;  2HP5 A;  4EV4 A;  1S6R A;  2XDM A;  1MBL A;  4KZ6 A;  1IKI A;  5BOH A;  3DWK A;  3CG5 A;  1YLP A;  1YQS A;  1K55 C;  1K57 A;  3VP0 A;  3AGE A;  1PWG A;  4BD0 A;  1ZG4 A;  4DRT A;  5FDH A;  3W4P A;  3ZG9 B;  4GN2 A;  2XR0 A;  5FQM A;  4N1H A;  4U0X A;  4DE0 A;  3ZG7 B;  1MWS A;  3Q7Z A;  1PWC A;  5GHX A;  4E6W A;  1DJC A;  4LCL A;  1PIO A;  2G2U A;  1SDE A;  5TGF A;  4PM5 A;  1ZC2 A;  3BFD A;  2H0Y A;  2WAD A;  4KQQ A;  2Y2J A;  4R1G A;  3UDF A;  3IF6 C;  3WRT A;  4X6T A;  2WZX A;  3ZG8 B;  2ZC6 B;  4D2O A;  4E3L A;  3NBL A;  4U3T A;  4WEK A;  1NYY A;  3BLM A;  4EQI A;  2EX6 A;  1GHP A;  2ZQC A;  1NY0 A;  1VM1 A;  3HUN A;  3QNC A;  5DTS A;  2FFY A;  4UAA A;  4WMC A;  4WZ5 A;  4O7D A;  5CEB A;  3ITA A;  4IBX A;  2RCX A;  1KE0 A;  4R23 A;  4OPZ A;  4PPR A;  4RX3 A;  1JTG A;  5DTK A;  3C7V A;  4EBN A;  4MBF A;  2Y2O A;  1HVB A;  3G2Z A;  5EVL A;  1YLT A;  4OON A;  3GVB A;  4ZJ1 A;  1XGJ A;  2IWB A;  5EVI A;  3ISG A;  2BG1 A;  4B4X A;  1MWR A;  1GA0 A;  1FSW A;  3ZG0 A;  1YM1 A;  4H8R A;  4U0T A;  2Y2N A;  3VFF A;  3G30 A;  5FAP A;  2Y2P A;  2XH9 A;  4S2L A;  2RL3 A;  4X55 A;  5F83 A;  1W7F A;  4OH0 A;  2G2W A;  3VSL A;  4PM6 A;  4DE3 A;  1XKZ A;  5FAQ A;  3V5M A;  4OKP A;  1LL5 A;  2UWX A;  1FQG A;  3GSG A;  3N8R A;  2EX2 A;  2WZZ A;  3BEC A;  5HAR A;  1SDN A;  3BFG A;  3SH8 A;  4Y7P A;  1ALQ A;  2OV5 A;  4JLF A;  5J8X A;  2ZD8 A;  4R3J A;  2C6W B;  3WWX A;  4E6X A;  5CTN A;  1HD8 A;  2PU4 A;  4S2K A;  3CMZ A;  3OPR A;  4OQI A;  2ZQ8 A;  4FSF A;  2QMI A;  3UPO A;  2Y4A A;  4KZB A;  5M18 A;  4OPQ A;  1JWV A;  3MFD A;  4XUZ A;  3BFF A;  4K91 A;  4KEN B;  3UPN A;  1K4E A;  3V3S A;  1BT5 A;  3UE0 A;  3N8L A;  4B88 A;  3HLC A;  1TEM A;  5I94 A;  2X01 A;  3V3R A;  1MWT A;  2P9V B;  3MXR A;  4UHU A;  1K54 A;  3NC8 A;  4OP8 A;  1HTZ A;  3A3D A;  4KZ7 A;  1FR1 A;  4KZA A;  1PI4 A;  1SHV A;  1KDS A;  3A3F A;  1PW8 A;  1W8Y A;  1JWZ A;  3ZVT A;  1YLY A;  4DDY A;  4MLL A;  4YIN A;  5HAP A;  4X53 A; 
#chains in the Genus database with same CATH topology
 4WYY A;  3AGF A;  4KZ4 A;  2X02 A;  2PBY A;  1K6S A;  5KSH A;  2Z2M B;  3IHB A;  2ZC5 B;  2E8J A;  3ZG5 A;  3M6B A;  3BM6 A;  3BFE A;  3LIB A;  4KG5 A;  1FOF A;  4NK3 A;  3G35 A;  4WM9 A;  4LRX C;  4CLC E;  2GNX A;  4YFM A;  3VSK A;  1KE3 A;  4GD8 A;  3E98 A;  3KYE A;  2CC1 A;  2OAP 1;  5G4Z A;  4KUO A;  1L3L A;  4GHI A;  2V9A A;  4R38 A;  4JGQ A;  3ITB A;  3EQU A;  4PKY A;  1RGY A;  1TS8 A;  5DKK A;  3PBS A;  3NOU C;  1ACF A;  2VV6 A;  1CI8 A;  4BJP A;  2Y2L A;  1VEU A;  3C5A A;  3F1N B;  5DTT A;  4Y17 A;  3TSG A;  5EVE A;  1N9O A;  4KZ9 A;  2Q0O A;  4OQ0 A;  5TBM B;  2EFU A;  4PM9 A;  5EFW A;  2IA2 A;  2W3E A;  4DDS A;  5FEG A;  2I9V A;  2PYP A;  4S2N A;  3E2L A;  4DXC A;  4N9L A;  3OCN A;  5CGS A;  1FCM A;  4IVI A;  4IVK A;  5EVI D;  4CLC D;  2A24 B;  2DNS A;  4UA7 A;  3CJM A;  4BWI A;  2XD5 A;  2PRF A;  3IXG A;  1SCW A;  3MQ0 A;  1ZTU A;  2Y2H A;  5A93 A;  3T4O A;  1I2S A;  3IXH A;  4DKI A;  3Q7V B;  1LI0 A;  4JXV A;  2J7V A;  2PR5 A;  2H10 A;  5AQA A;  1GHM A;  4Q8I A;  3VP2 A;  4OP5 A;  3EGX C;  3VFH A;  4E3N A;  1L0E A;  1XGI A;  2R9W A;  4GCZ A;  3QP2 A;  4YOF A;  5FQ9 A;  4EEP A;  4EU0 A;  4Y3I A;  1YPR A;  1D7E A;  2IWD A;  3SS4 A;  4EET B;  2JN7 A;  1K55 A;  4K0X A;  4MMN A;  4X68 A;  4JGP A;  1N9N A;  1KGF A;  3T1Q B;  1F2K A;  3ICY A;  2JKF A;  1N4O A;  3NDE A;  2FZ0 A;  2Y2M A;  1NRJ A;  2WGV A;  5M1A A;  3EQV A;  5J7E A;  1CI9 A;  3NDG A;  1KGG A;  2HV1 A;  5CTM A;  3C7U A;  4LPZ A;  1MPL A;  2EX8 A;  3K2N A;  4RVA A;  3ZGA B;  5A90 A;  2PT7 A;  4Q0I A;  5AQB A;  1WA9 A;  2XA7 M;  4DN0 A;  3HJI A;  3T1S A;  4YWZ A;  1BLH A;  4L9G A;  3IH9 A;  3D4F A;  2XK1 A;  1ERM A;  3CAX A;  4FH2 A;  2Y2K A;  2WAF A;  1QME A;  2X71 A;  3FPV A;  1VET B;  3T4K A;  3BJN A;  1G6A A;  5EV0 A;  1ESU A;  1Q2Q A;  2WGW B;  3ZNT A;  1A0K A;  2JCH A;  4ZAM A;  1AXB A;  3E0Y A;  2J3T D;  4KQR A;  1G28 A;  4KZ5 A;  5HX9 A;  3UN7 A;  3NEC A;  2ZLY A;  3BY8 A;  1LSW A;  2V1Z A;  3LUQ A;  5HDS A;  4B9O A;  5D3O A;  2YKF A;  3IHA A;  5J4E A;  2NUP C;  1G68 A;  4A5R A;  4CQH A;  2W3D A;  2J9P A;  5HAQ A;  5L10 A;  1WE4 A;  1GA9 A;  4PM8 A;  1UGU A;  5GLC A;  2Y8H A;  5FQQ A;  1L0D A;  2Y2Q A;  1M40 A;  4OOM A;  3Q81 A;  2EXB A;  1MKM A;  1BSG A;  1KOU A;  4X69 A;  1J3W A;  2V0U A;  3VE3 A;  4GLQ A;  1ES3 A;  3IF5 A;  5EPH A;  4GD6 A;  1PZP A;  3WS2 A;  1MKI A;  1CQA A;  1TS7 A;  3NUL A;  2H5S A;  3HLB A;  1YSP A;  5HDC A;  4EUZ A;  1IYQ A;  3F1P B;  3FKV A;  4OQH A;  4GS9 B;  4CLC C;  2FH5 A;  4JKT A;  3V39 A;  3F1N A;  4K08 A;  2R9X A;  3N8S A;  2LB9 A;  4GB7 A;  1DJA A;  5AQ9 A;  5EOO A;  2E8I A;  1F5M A;  5HDD A;  4MNR A;  4RX2 A;  4WN5 A;  2A2L A;  1VB6 A;  3MS6 A;  1PW1 A;  4S2I A;  1NLY A;  4R0Q A;  4FOF A;  2Z2L B;  1OTD A;  3N6I A;  1XP4 A;  4NXB A;  1LSV A;  3BEB A;  3HRE A;  5DF8 A;  5F1F A;  1K56 A;  1GHI A;  4QY5 A;  5C5K A;  3OPL A;  1NZO A;  3Q7V A;  3LY4 A;  4QPR A;  1ZHH B;  3OBF A;  1MBL A;  2KX6 A;  3DWK A;  4AFI A;  3S7Q A;  1PWG A;  1ZG4 A;  3B42 A;  4DRT A;  3DTK A;  3W4P A;  5DFX A;  5FQM A;  4U0X A;  4L9E A;  1DJC A;  2P08 A;  3EGD C;  3CPT B;  2Y79 A;  2G2U A;  2VA0 A;  3BWL A;  4PM5 A;  3G6O A;  2M7U A;  2H0Y A;  2O0Y A;  2Y2J A;  2NUT C;  3IF6 C;  4R1G A;  5FDS A;  2VEA A;  3W2Z A;  4D2O A;  4E3L A;  4WEK A;  3BLM A;  4EQI A;  4EQ1 A;  4WZ5 A;  1KE0 A;  4R23 A;  1NLZ A;  4EBN A;  2Z6D A;  1XGJ A;  3ISG A;  3UB5 P;  2BG1 A;  4U0T A;  2ZL1 B;  5FAP A;  4JGR A;  4XT2 B;  5F83 A;  3O5Y A;  5FAQ A;  3V5M A;  4F3L B;  4WUJ A;  1FQG A;  3N8R A;  5HAR A;  4IJG A;  4MN7 A;  3SH8 A;  1ALQ A;  4R3J A;  2HGV A;  5M18 A;  3BFF A;  3UPN A;  5A8B A;  3P01 A;  3N8L A;  4B88 A;  3HLC A;  2J3T C;  1TEM A;  3TE8 A;  1K54 A;  3U4L P;  1VET A;  3NC8 A;  4P6Z M;  5K5B A;  2O9C A;  1SHV A;  2WKR A;  4FTX A;  1W8Y A;  4MLL A;  4MDZ A;  4X53 A;  5L8M A;  1GSV A;  2JKG A;  1ODV A;  2P04 A;  5GLB A;  1JVJ A;  1Q2P A;  3GV9 A;  1H3Q A;  5GLA A;  3KSG A;  1QMF A;  1MY8 A;  5I5L A;  3HL9 A;  1CEF A;  5E2F A;  4X1M A;  2HZ5 A;  1CF0 A;  4C6Y A;  2Y2I A;  3TRC A;  4I3J A;  3VMA A;  3FC7 A;  2OSU A;  5F82 A;  3AGD A;  4E3O A;  4QD4 A;  5CX7 A;  3G2Y A;  2I72 A;  3A3I A;  3PBN A;  1IOU A;  4GOG A;  3G4P A;  2XFS A;  3ZDJ A;  4UA6 A;  3MZE A;  3L7H A;  2WKI A;  3LID A;  1W5D A;  2EX9 A;  3PAE A;  2ZJ9 A;  3T50 A;  3NOP C;  2HDS A;  4HEF A;  1S66 L;  4RQ9 A;  1JNU A;  1S0W A;  3P7N A;  4Y5F A;  5CRF A;  3ZQ5 A;  2HP6 A;  1K6R A;  5L09 A;  4OLD A;  2PAV P;  3PXP A;  2EXA A;  2VV8 A;  3NCK A;  4EER A;  5G4Y A;  3MXS A;  1S4R A;  3Q07 A;  4EEU A;  4H6J B;  1BZA A;  4JF4 A;  4KZ8 A;  4ESP A;  1ONH A;  5HFO A;  3BLS A;  4Y15 A;  1K57 C;  1XX2 A;  4I39 A;  1NJ4 A;  1IYS A;  3R7W A;  4OVD A;  2D01 A;  3MQQ A;  1PZO A;  4N1X A;  3MSH A;  3HUM A;  2ZQA A;  1GSX A;  3ZVW A;  4X56 A;  3JVU A;  3OC2 A;  4BBU A;  4JF6 A;  3EEH A;  1YLJ A;  4R4R A;  4JXG A;  1T18 A;  4O0P A;  4FCF A;  1LI9 A;  1MWU A;  5G18 A;  5KIZ A;  3KYQ A;  3H7W A;  4E3M A;  3T1R A;  1XJ6 A;  3LR3 A;  1OME A;  4GNU A;  1RP5 A;  3D3O A;  3SOI A;  4BD1 A;  2WK0 A;  3PBR A;  1D1J A;  3WS0 A;  5EVI B;  4CLC B;  3MMH A;  1FCN A;  3CZD A;  3UB8 A;  4X1L A;  3BFC A;  4EW7 A;  4EBL A;  1W79 A;  3LR4 A;  4MN6 A;  1DP9 A;  3ZYT A;  3OOV A;  2ZL1 A;  2V0W A;  4B4Z A;  4QJG A;  3GDI A;  1L2S A;  4S2O A;  2V8F A;  5DJU A;  2XD1 A;  1FSY A;  1YKD A;  3JYI A;  3S22 A;  2WKP A;  4I5S A;  1IYP A;  2B18 A;  3E4O A;  4ID4 A;  2FFF B;  3DWZ A;  4HNB A;  2Y55 A;  2PD7 A;  1OTB A;  3PTE A;  1OJ5 A;  2YKH A;  1RGZ A;  3GEC A;  5GLD A;  1P9W A;  2JKR M;  3C38 A;  3NY4 A;  1KVM A;  5CHJ A;  3V67 A;  3UDX A;  5GL9 A;  5E2G A;  1IKG A;  1LL8 A;  4BMW A;  4ZJ3 A;  2ZC3 B;  3IF6 B;  1F98 A;  2VV7 A;  4HJ4 A;  2W1T A;  1BLP A;  2GDN A;  4QU3 A;  1K0K A;  1Z09 A;  4MN5 A;  2UV0 E;  3VP4 A;  2V1A A;  4O01 A;  4BL3 A;  1I5Q A;  3PBO A;  3CUE A;  3ZFZ A;  4G3V A;  4N92 A;  3IS2 B;  1IYO A;  4RYE A;  4DXB A;  1LHY A;  1PRQ A;  1D06 A;  3DTI A;  4HJ6 A;  1BLS A;  3TJZ C;  1Y28 A;  3FYZ A;  1SKO B;  3WS4 A;  1EI5 A;  5E2H A;  3VOY A;  2OLU A;  2XF3 A;  4KG2 A;  4MBK A;  4R4S A;  2Y59 A;  3A0R A;  4S2N C;  4LLO B;  1OT6 A;  5FQI A;  3S4X A;  1G6O A;  3W4O A;  1H0M A;  3GRJ A;  3FKW A;  2ZM2 A;  4ARZ B;  3UB9 A;  3CWF A;  1ERQ A;  1V9Z A;  5DF7 A;  1Y54 A;  2ZQD A;  3QP6 A;  3DTM A;  3C4O A;  3C30 A;  1ES5 A;  3T12 B;  1XFN A;  3ZCZ A;  3EEA A;  2H28 A;  4UA9 A;  1CJF A;  5HW3 A;  1HLU P;  2WKH A;  1K25 A;  2OAQ 1;  2A49 A;  5TJJ A;  4CPK A;  3UNW A;  1BLC A;  1H8Y A;  2XFT A;  3V50 A;  4OQG A;  4LEN A;  2CMN A;  5HAI A;  2HP5 A;  1S6R A;  2XDM A;  2PYR A;  4LRY C;  4IUH A;  1IKI A;  2V1B A;  5BOH A;  5DFY A;  1YQS A;  1K55 C;  3AGE A;  1EW0 A;  1OJG A;  2XR0 A;  4HI4 A;  4N1H A;  1MWS A;  1PWC A;  3VE4 A;  3LIA A;  4LCL A;  4R70 A;  3CLO A;  2WAD A;  4KQQ A;  5HD3 A;  3F1O B;  4X6T A;  3WRT A;  2ZC6 B;  3IBR A;  4U3T A;  2GZA A;  2EX6 A;  1GHP A;  2K2N A;  5F6A A;  1NY0 A;  1VM1 A;  3HUN A;  4UAA A;  2JKR I;  1UWP X;  3UB6 A;  2B02 A;  2PDR A;  3UB7 A;  3G2Z A;  3T1X A;  3GVB A;  2IWB A;  5EVI A;  1OTE A;  3ZG0 A;  2Y2P A;  1XJ2 A;  4X55 A;  5AVF A;  4OH0 A;  2G2W A;  4HOI A;  3VSL A;  4PM6 A;  1XKZ A;  3CHW P;  1LL5 A;  3QP4 A;  2O9A A;  3GSG A;  3MJQ A;  2EX2 A;  2WZZ A;  3BFG A;  4Y7P A;  4E6X A;  2PU4 A;  4S2K A;  4OQI A;  2ZQ8 A;  4KZB A;  2VKS A;  3UME A;  3V3S A;  4HP4 A;  3UE0 A;  1FIK A;  5I94 A;  3V3R A;  3B33 A;  4HQA A;  5IU1 A;  4OP8 A;  4KZ7 A;  1T1B A;  1FR1 A;  4KZA A;  1PI4 A;  3CI6 A;  1KDS A;  4I3I A;  5F5Y A;  5TBM A;  4DDY A;  5HWV A;  3VP3 A;  1IFQ A;  4GJ4 A;  4XUX A;  3EOI A;  2XEP A;  2A24 A;  1Y4O A;  4DF6 A;  2V8C A;  1LLB A;  4BBV A;  5CHM A;  1M6K A;  3MQO A;  3P98 A;  4EBP A;  2Z6C A;  3UO9 A;  3HLD A;  1YMS A;  1KGE A;  4HBU A;  4QWO A;  1K4F A;  4OLG A;  1DJB A;  5CGW A;  1E3U D;  3BY9 A;  3IX3 A;  5FAO A;  4JXS A;  3FG8 A;  2WGI A;  2PD8 A;  4GKU A;  3LEZ A;  1I2W A;  4ZBE A;  3O3V A;  3A0S A;  1ONG A;  4EXO A;  2XSS A;  5HWT A;  1XJ4 A;  2PHY A;  4C3Q A;  1P97 A;  5EM0 A;  4KQO A;  5CXW A;  1L0G A;  1IEM A;  5KSC A;  1O07 A;  1SZV A;  3MKF A;  3IXB A;  1S4S A;  1TDL A;  3T4Q A;  2HDQ A;  3M2K A;  4WMC D;  3D9Y A;  3IWQ A;  1ES2 A;  2INW A;  2C5W B;  4LV0 A;  4Q0H A;  3IT9 A;  5CHU A;  1E4D A;  3IXD A;  2Y2G A;  5JYO A;  1WYC A;  1XPB A;  2VLG A;  2EWW A;  2MJ6 A;  1CEG A;  3HBR A;  3T4L A;  3IX8 A;  1NRF A;  2GJ3 A;  3DAV A;  3BYD A;  4ZRR A;  3MKE A;  3QHY A;  2JKT M;  2WGW A;  3GQZ A;  1C3B A;  1L0F A;  2BLS A;  3G31 A;  4WZ5 C;  3SH9 A;  4F94 A;  3IWO A;  4IUK A;  1S1Z A;  2OLV A;  1LL9 A;  5FQK A;  3SH7 A;  3C2W A;  2JHE A;  1KVL A;  4C75 A;  3UE1 A;  5FI2 A;  1T19 A;  5CED A;  5EOE A;  4NET A;  5FAS A;  2ZM8 A;  2LB5 A;  4LV3 A;  2QKP A;  4IBR A;  1TS0 A;  5KMW A;  3B3X A;  2V20 A;  2VGL S;  1DY6 A;  1W8Q A;  1H8Z A;  2ZQ9 A;  1PWD A;  1K54 C;  1OPX A;  2QHK A;  4HH2 A;  5A92 A;  1JTD A;  4EWF A;  3UY6 A;  4IED A;  5L2F A;  4E3K A;  4NXF A;  4GDB A;  3N4I A;  3RXX A;  3F1P A;  1XFQ A;  4GS9 A;  4Y0T A;  4Y0O A;  5HPF A;  5AQ7 A;  3VOZ A;  5FQJ A;  2WKE A;  2IWC A;  2KDK A;  5FSR A;  3G32 A;  1LSX A;  3H82 B;  3PYP A;  1NXY A;  2JBF A;  3NJA A;  4M4X A;  4I38 A;  3MF0 A;  3OPH A;  3NOT C;  4B93 A;  1FCO A;  4NXE A;  4JPM A;  5CEC A;  4HHD A;  3ZHH A;  4X25 A;  1UWN X;  3UPP A;  3D72 A;  1H8M A;  4DJ3 A;  1N9L A;  3NI9 A;  2L0W A;  2JE5 A;  3MFX A;  1KE4 A;  2D02 A;  4HH3 A;  5TFQ A;  3RFB A;  3IH8 A;  3B47 A;  1Z6F A;  3KYZ A;  3E4P A;  1E25 A;  4KG6 A;  1ERO A;  2Q9N A;  2KOI A;  1O7E A;  3HCY A;  1BYW A;  2HDR A;  3CPT A;  4GDN A;  4YNR A;  3OZH A;  5IS1 A;  5GHY A;  1PFL A;  5GHZ A;  2J3W A;  1YSQ A;  3O87 A;  4OOY A;  1FIL A;  2OWH A;  1X0O A;  2ACG A;  3ULF A;  2JKT I;  4P0M A;  2J80 A;  3LIF A;  4PM7 A;  3IX4 A;  2XLN A;  1P9R A;  4FD8 A;  3UDI A;  2P7J A;  3KO6 A;  2ZC4 B;  3W8K A;  4HBT A;  3WRZ A;  2VJW A;  1ESI A;  5EUA A;  1YAX A;  4BEN A;  4XT2 A;  1GSW A;  3PBT A;  4WBG A;  2ZOI A;  4F3L A;  3UE3 A;  5LBR A;  1WYB A;  1OTA A;  2HJE A;  4S2M A;  2L4R A;  3HUO A;  4D60 A;  4EV4 A;  2ZMF A;  4L9F A;  2BTF P;  4KZ6 A;  4NXG A;  1YLP A;  3VP0 A;  5FDH A;  3ZG9 B;  3LGO A;  3VOL A;  3ZG7 B;  3FPW A;  4E6W A;  1PIO A;  1SDE A;  5F69 A;  5TGF A;  1ZC2 A;  3BFD A;  4I3A A;  3UDF A;  2WZX A;  4WF0 A;  3ZG8 B;  5FEF A;  3RH8 B;  3NBL A;  1NYY A;  1W63 M;  2ZQC A;  3QNC A;  5CEB A;  1OT9 A;  2QJ7 A;  4PPR A;  3C7V A;  3S7P A;  2Y2O A;  4NG2 A;  3UE6 A;  4OON A;  1MWR A;  1FSW A;  1YM1 A;  2Y2N A;  3VFF A;  2XH9 A;  2RL3 A;  1T1A A;  4DE3 A;  4PAU A;  4HJ3 A;  3BEC A;  1SDN A;  3UPO A;  5J8X A;  2ZD8 A;  3JVV A;  3WWX A;  5CTN A;  1HD8 A;  3SZT A;  3OPR A;  4Y13 A;  4FSF A;  2QWS A;  3CIT A;  2Y4A A;  3MFD A;  1DP8 A;  4XUZ A;  4K91 A;  2HJ9 C;  2O9B A;  2P9V B;  3MXR A;  3UMD A;  4EES A;  4P6Z S;  5HSQ A;  3LEQ A;  3QP8 A;  1PW8 A;  3H9W A;  1JWZ A;  3ZVT A;  1YLY A;  4BLM A;  1TDG A;  3IQA A;  2W27 A;  3SW1 A;  2WYX A;  2Y91 A;  3DTE A;  1S1Y A;  5FI6 A;  3M6H A;  3H82 A;  1EWZ A;  2B5R A;  3O86 A;  4PMA A;  3LR5 A;  3HLG A;  3MZF A;  3KX0 X;  4G3K A;  4KQD A;  5CER A;  3CUE C;  4H6J A;  4Z1W A;  5HZH A;  4CJN A;  2XRO A;  5TR7 A;  3TW8 A;  5J3W A;  4GW9 A;  4OPR A;  3PHY A;  4ZDX A;  1K56 D;  3SS3 A;  1OTI A;  4WLA A;  4P6B A;  4UQI S;  3Q82 A;  3DBA A;  1NYM A;  2QJ5 A;  2ZM0 A;  3QNB A;  1J9M A;  1KDW A;  2HF6 A;  3MXQ A;  2VGL M;  1S67 L;  1VHM A;  3VV4 A;  3S7O A;  4NEE D;  1IEL A;  4DE1 A;  3W4Q A;  1W63 Q;  3HLE A;  4R3B A;  4P85 A;  1TF1 A;  1HZO A;  2QZ6 A;  5HPI A;  1TS6 A;  4JBF A;  5HL6 A;  4GZB A;  4DE2 A;  2WKQ A;  4EUV A;  3HVF A;  2EA9 A;  2ZQ7 A;  1G5U A;  5FAT A;  2WAE A;  3WS1 A;  1MZU A;  2QYB A;  4KZ3 A;  4N9K A;  3K3C A;  1STZ A;  4HY8 A;  3TOI A;  4CLC A;  3O88 A;  3A3E A;  1V9Y A;  5E2E A;  4UEY A;  4WL9 A;  1P0Z A;  2A3U A;  1FR6 A;  3A0V A;  2W3G A;  3E2K A;  4L0L A;  3BW6 A;  3C8C A;  4LCM A;  4WEL A;  2QPN A;  1VQQ A;  5E43 A;  1BTL A;  4MBH A;  2HDU A;  4LV2 A;  1RCJ A;  2M7V A;  4WZ4 A;  5DJT A;  4Z9Q A;  3GTC A;  2W1R A;  5HWW A;  1BUE A;  3BRM A;  3RXW A;  1DRM A;  5HL1 A;  3PAG A;  1U60 A;  3ZNY A;  3A3J A;  3U2A A;  1DP6 A;  1ZKJ A;  3MZD A;  2VGJ A;  4PHT A;  3BQA A;  3HLW A;  3FWL A;  2V2F F;  5EVI C;  5FA7 A;  1LT0 A;  2PU2 A;  2PR6 A;  5DVA A;  1ZG6 A;  2W3H A;  3IF6 A;  4ZJ2 A;  4ZTK A;  2DRW A;  4E3J A;  3C4P A;  5EEC A;  3LY3 A;  3KSI A;  3OPP A;  1GCE A;  4LV1 A;  4RA7 A;  3NHQ A;  1CK3 A;  3LO7 A;  3SS5 A;  4DJ2 A;  3IS2 A;  3PBQ A;  3RJU A;  2B95 A;  1AWI A;  4WEJ A;  1YLZ A;  1XXM A;  4M3K A;  4S2J A;  3OCL A;  3LIC A;  1YT4 A;  3R7W B;  3EWK A;  3TG9 A;  1PNE A;  4HP9 A;  2VX8 A;  2EWV A;  2ZMA A;  4ETX A;  4JF5 A;  1SKO A;  1BUL A;  2HPB A;  4MEZ A;  2P74 A;  3WS5 A;  5CGX A;  4LFU A;  2DMW A;  2P9V A;  3T4T A;  2DCF A;  2OWJ A;  4FH4 A;  4E04 A;  4ARZ A;  3FV7 A;  3DW0 A;  2Q9M A;  4Y2F A;  3E4Q A;  2JC7 A;  2VGK A;  2XRN A;  4QHC A;  1XA1 A;  4HES A;  4Y0U A;  3H7W B;  1MXO A;  1TD5 A;  2VZW A;  2EFX A;  2M1C A;  5F68 A;  2WUQ A;  4XXR A;  2W3F A;  1F9I A;  5A91 A;  3LYX A;  3IWI A;  5JYP A;  2AVX A;  1XA7 A;  5FI7 A;  2K7S A;  3OLO A;  3VP1 A;  2XQZ A;  3LFV A;  2BAS A;  1MC0 A;  5EM1 A;  5U47 A;  3FZC A;  4LGW A;  3K3D A;  4IHQ A;  4OOL A;  1NWZ A;  4GHI B;  5FL3 A;  3T4S A;  4BQM A;  5M19 A;  4E3I A;  4KUK A;  3P09 A;  5IHV A;  1PYY A;  3GMW A;  3LCE A;  4FUW A;  3PR6 A;  3MBZ A;  1YLW A;  3LI9 A;  2W0N A;  3LIE A;  3GR2 A;  4P87 A;  5EE8 A;  4JXW A;  1VEU B;  2HP9 A;  1N9B A;  4II7 A;  1PI5 A;  1JWP A;  5L07 A;  1H5X A;  4OPY A;  4NKP A;  2PBD P;  5MC7 A;  1XJ3 A;  3F1O A;  5F1G A;  2VK3 A;  3Q1F A;  1YMX A;  2XGN A;  1SKF A;  3HLF A;  4K0W A;  1TVF A;  5DF9 A;  2G7U A;  4QB8 A;  3N7W A;  5AVE A;  4BL2 A;  4Q0J A;  2ZC7 A;  3G34 A;  2ZMV A;  5KZH A;  1T1C A;  3S1Y A;  2J8Y A;  2XA7 S;  1NZU A;  4S2P A;  3NIA A;  2W1T B;  1ES4 A;  2KLI A;  2ZOH A;  2H0T A;  4QY6 A;  3M2J A;  4PKY G;  2R78 A;  1K38 A;  2J9O A;  2L1M A;  3I7J A;  2O99 A;  4DMZ A;  4ME4 A;  3LR0 A;  1E3U A;  5AJG A;  4UQI M;  3CG5 A;  1K57 A;  4BD0 A;  4G3W A;  2ZBB A;  4GN2 A;  4DE0 A;  3Q7Z A;  5GHX A;  2K31 A;  5HD5 A;  4BBT A;  3IBJ A;  3JPU A;  3QP5 A;  3MR0 A;  3BQ8 A;  5DKL A;  4ETZ A;  5IT5 A;  3S7N A;  5DTS A;  2FFY A;  4WMC A;  4O7D A;  3ITA A;  4IBX A;  4R6L A;  2RCX A;  3R4K A;  4OPZ A;  4RX3 A;  1JTG A;  5DTK A;  3KSH A;  4MBF A;  4R3A A;  1HVB A;  5EVL A;  1YLT A;  4ZJ1 A;  4B4X A;  1GA0 A;  4H8R A;  3G30 A;  4S2L A;  2OOL A;  3L9K A;  1W7F A;  2GX5 A;  3RTY A;  3T4J A;  4OKP A;  2UWX A;  2OV5 A;  4JLF A;  2C6W B;  3CMZ A;  3KSF A;  2QMI A;  4OPQ A;  1JWV A;  4KEN B;  1K4E A;  1BT5 A;  2X01 A;  3HJK A;  1MWT A;  4HIA A;  4UHU A;  3QP1 A;  1HTZ A;  3A3D A;  4JGO A;  3LI8 A;  3A3F A;  4LRZ E;  4MCW A;  4YIN A;  4O8G A;  5HAP A; 
#chains in the Genus database with same CATH homology
 4BLM A;  4WYY A;  3AGF A;  4KZ4 A;  1TDG A;  3IQA A;  2X02 A;  2PBY A;  3VP3 A;  5GLB A;  1K6S A;  2WYX A;  2Y91 A;  5KSH A;  2Z2M B;  5FI6 A;  3M6H A;  1JVJ A;  3IHB A;  4XUX A;  1Q2P A;  3GV9 A;  2ZC5 B;  1EWZ A;  5GLA A;  2B5R A;  3ZG5 A;  2XEP A;  3O86 A;  4PMA A;  3HLG A;  3MZF A;  3M6B A;  4DF6 A;  5CER A;  3BM6 A;  3BFE A;  4KG5 A;  1QMF A;  1LLB A;  4CJN A;  1MY8 A;  3HL9 A;  1CEF A;  5E2F A;  1FOF A;  4NK3 A;  5CHM A;  3G35 A;  5TR7 A;  1M6K A;  4OPR A;  4C6Y A;  2Y2I A;  3P98 A;  4WM9 A;  4EBP A;  4YFM A;  4ZDX A;  1K56 D;  3HLD A;  3SS3 A;  3UO9 A;  1KE3 A;  4GD8 A;  1YMS A;  3VSK A;  1KGE A;  3VMA A;  4HBU A;  4P6B A;  2CC1 A;  1K4F A;  4OLG A;  1DJB A;  2OSU A;  5CGW A;  3Q82 A;  5F82 A;  3AGD A;  4E3O A;  1NYM A;  4QD4 A;  1E3U D;  2ZM0 A;  3G2Y A;  3QNB A;  1J9M A;  2I72 A;  1KDW A;  5FAO A;  3A3I A;  4JXS A;  3ITB A;  2WGI A;  3EQU A;  3PBN A;  1RGY A;  4GOG A;  3G4P A;  3LEZ A;  1I2W A;  2XFS A;  3PBS A;  4GKU A;  4ZBE A;  3O3V A;  1IEL A;  3ZDJ A;  4UA6 A;  4DE1 A;  1ONG A;  3MZE A;  3W4Q A;  2WKI A;  1CI8 A;  4BJP A;  3HLE A;  4R3B A;  1W5D A;  4P85 A;  2EX9 A;  1HZO A;  2Y2L A;  2QZ6 A;  3PAE A;  4C3Q A;  2ZJ9 A;  3C5A A;  4KQO A;  5CXW A;  1L0G A;  4JBF A;  5DTT A;  1IEM A;  4GZB A;  3TSG A;  4DE2 A;  5KSC A;  2HDS A;  3HVF A;  2ZQ7 A;  1O07 A;  4HEF A;  4KZ9 A;  5FAT A;  4OQ0 A;  3MKF A;  2EFU A;  3IXB A;  4PM9 A;  2WAE A;  1S0W A;  5CRF A;  1TDL A;  3WS1 A;  2HP6 A;  2HDQ A;  3M2K A;  4DDS A;  1K6R A;  4WMC D;  4OLD A;  4S2N A;  3E2L A;  4KZ3 A;  3IWQ A;  4N9K A;  4DXC A;  2EXA A;  3NCK A;  3TOI A;  3MXS A;  4N9L A;  3O88 A;  1ES2 A;  3A3E A;  3OCN A;  5CGS A;  3Q07 A;  2C5W B;  5E2E A;  1FCM A;  4IVI A;  4IVK A;  4LV0 A;  5EVI D;  2A3U A;  1FR6 A;  2DNS A;  4UA7 A;  3CJM A;  3E2K A;  1BZA A;  4JF4 A;  4L0L A;  4KZ8 A;  2XD5 A;  3IXG A;  1SCW A;  4LCM A;  1ONH A;  3IT9 A;  4WEL A;  5CHU A;  5HFO A;  2QPN A;  1E4D A;  1VQQ A;  3BLS A;  5E43 A;  1BTL A;  4MBH A;  2Y2H A;  3IXD A;  2HDU A;  5A93 A;  1K57 C;  2Y2G A;  1I2S A;  3IXH A;  1XX2 A;  4LV2 A;  4DKI A;  5JYO A;  3Q7V B;  1LI0 A;  4JXV A;  1RCJ A;  1NJ4 A;  1WYC A;  1XPB A;  2J7V A;  2H10 A;  5AQA A;  1IYS A;  1GHM A;  4Q8I A;  3VP2 A;  4OP5 A;  1CEG A;  3HBR A;  4OVD A;  4WZ4 A;  3VFH A;  4Z9Q A;  4E3N A;  1L0E A;  1XGI A;  2R9W A;  3GTC A;  1BUE A;  1NRF A;  1PZO A;  4N1X A;  3HUM A;  3BYD A;  3BRM A;  2ZQA A;  5FQ9 A;  3MKE A;  3QHY A;  3RXW A;  3ZVW A;  4X56 A;  2WGW A;  3OC2 A;  5HL1 A;  3GQZ A;  4JF6 A;  1YLJ A;  4R4R A;  1C3B A;  4JXG A;  1L0F A;  2BLS A;  1U60 A;  3G31 A;  3A3J A;  3PAG A;  4WZ5 C;  2IWD A;  4FCF A;  3SH9 A;  3SS4 A;  3ZNY A;  1LI9 A;  1K55 A;  4K0X A;  1MWU A;  1ZKJ A;  4X68 A;  3MZD A;  2VGJ A;  4F94 A;  3IWO A;  5G18 A;  3HLW A;  1KGF A;  2OLV A;  3FWL A;  2V2F F;  1LL9 A;  4E3M A;  1N4O A;  3NDE A;  5EVI C;  5FA7 A;  5FQK A;  3SH7 A;  1OME A;  2Y2M A;  2WGV A;  1KVL A;  5M1A A;  4C75 A;  2PU2 A;  4GNU A;  1RP5 A;  3UE1 A;  3EQV A;  5FI2 A;  1CI9 A;  3SOI A;  3NDG A;  5DVA A;  1ZG6 A;  3IF6 A;  4BD1 A;  2WK0 A;  3PBR A;  4ZJ2 A;  1KGG A;  3WS0 A;  5CTM A;  5EVI B;  3C7U A;  2DRW A;  4ZTK A;  1FCN A;  1MPL A;  3CZD A;  5CED A;  4E3J A;  2EX8 A;  3C4P A;  5EEC A;  4RVA A;  3ZGA B;  3BFC A;  3LY3 A;  5EOE A;  5A90 A;  4EBL A;  5AQB A;  1W79 A;  3OPP A;  1GCE A;  4LV1 A;  4NET A;  4RA7 A;  1CK3 A;  5FAS A;  2ZM8 A;  3LO7 A;  4LV3 A;  4IBR A;  4B4Z A;  4QJG A;  3SS5 A;  1BLH A;  1L2S A;  4S2O A;  5KMW A;  3B3X A;  2V20 A;  3PBQ A;  3IH9 A;  1DY6 A;  3RJU A;  3D4F A;  2XK1 A;  1W8Q A;  4WEJ A;  2XD1 A;  1ERM A;  1FSY A;  1YLZ A;  1H8Z A;  4FH2 A;  2ZQ9 A;  1PWD A;  1K54 C;  1XXM A;  2Y2K A;  4M3K A;  2WAF A;  4S2J A;  3JYI A;  3OCL A;  3S22 A;  1JTD A;  5A92 A;  1YT4 A;  3TG9 A;  4EWF A;  1QME A;  3UY6 A;  2ZMA A;  4JF5 A;  2X71 A;  4IED A;  1BUL A;  1IYP A;  2HPB A;  4MEZ A;  4E3K A;  4GDB A;  3N4I A;  5L2F A;  4ID4 A;  2FFF B;  3DWZ A;  2P74 A;  3WS5 A;  2Y55 A;  3PTE A;  5CGX A;  1G6A A;  1ESU A;  3RXX A;  1Q2Q A;  2P9V A;  2WGW B;  3ZNT A;  1RGZ A;  2DCF A;  5GLD A;  4Y0T A;  4Y0O A;  4FH4 A;  2JCH A;  3FV7 A;  5AQ7 A;  3DW0 A;  2Q9M A;  3VOZ A;  4ZAM A;  1AXB A;  5FQJ A;  3NY4 A;  2JC7 A;  2VGK A;  2WKE A;  4QHC A;  1KVM A;  1XA1 A;  4HES A;  5CHJ A;  4Y0U A;  4KQR A;  2IWC A;  3UDX A;  1MXO A;  5FSR A;  3G32 A;  2EFX A;  4KZ5 A;  5GL9 A;  5E2G A;  1IKG A;  5HX9 A;  1NXY A;  3UN7 A;  2JBF A;  2WUQ A;  2ZLY A;  4ZJ3 A;  4XXR A;  3OPH A;  2ZC3 B;  3IF6 B;  5A91 A;  2V1Z A;  1FCO A;  3IWI A;  4JPM A;  5JYP A;  5CEC A;  1BLP A;  1XA7 A;  5D3O A;  5FI7 A;  3IHA A;  2GDN A;  3ZHH A;  1G68 A;  4QU3 A;  3VP1 A;  4A5R A;  2XQZ A;  2J9P A;  3VP4 A;  3UPP A;  5HAQ A;  1WE4 A;  5U47 A;  1GA9 A;  1I5Q A;  4BL3 A;  3FZC A;  4PM8 A;  3PBO A;  5GLC A;  3NI9 A;  5FQQ A;  4OOL A;  2JE5 A;  1L0D A;  2Y2Q A;  3ZFZ A;  4N92 A;  1M40 A;  1KE4 A;  4BQM A;  4OOM A;  3Q81 A;  2EXB A;  1IYO A;  4RYE A;  4DXB A;  1LHY A;  5TFQ A;  5M19 A;  1BSG A;  4E3I A;  3P09 A;  5IHV A;  3IH8 A;  1PYY A;  1Z6F A;  3GMW A;  1BLS A;  3LCE A;  1E25 A;  4KG6 A;  4X69 A;  1ERO A;  3MBZ A;  1YLW A;  1ES3 A;  2Q9N A;  3FYZ A;  3GR2 A;  3IF5 A;  1O7E A;  4P87 A;  5EE8 A;  5EPH A;  3WS4 A;  1EI5 A;  4GD6 A;  4JXW A;  5E2H A;  3VOY A;  2HDR A;  1PZP A;  4GDN A;  2HP9 A;  1N9B A;  3WS2 A;  2OLU A;  1PI5 A;  2XF3 A;  1JWP A;  4KG2 A;  1MKI A;  4MBK A;  4R4S A;  1H5X A;  2H5S A;  2Y59 A;  3HLB A;  3OZH A;  4OPY A;  4S2N C;  5GHY A;  4EUZ A;  1IYQ A;  5FQI A;  3S4X A;  3W4O A;  3FKV A;  4OQH A;  5F1G A;  5GHZ A;  3GRJ A;  3O87 A;  3FKW A;  4JKT A;  4OOY A;  3V39 A;  2ZM2 A;  3Q1F A;  2R9X A;  1YMX A;  3N8S A;  2XGN A;  1SKF A;  4P0M A;  3HLF A;  4K0W A;  4GB7 A;  1DJA A;  5AQ9 A;  1TVF A;  5DF9 A;  1ERQ A;  4PM7 A;  5DF7 A;  1Y54 A;  5EOO A;  2E8I A;  4QB8 A;  3N7W A;  2XLN A;  2ZQD A;  4FD8 A;  3UDI A;  4BL2 A;  3DTM A;  2ZC7 A;  3C4O A;  3G34 A;  5KZH A;  4MNR A;  4RX2 A;  1ES5 A;  2ZC4 B;  3W8K A;  3ZCZ A;  4HBT A;  3S1Y A;  2J8Y A;  1PW1 A;  4S2I A;  3WRZ A;  1NZU A;  4S2P A;  4R0Q A;  4UA9 A;  1ESI A;  5EUA A;  3NIA A;  5HW3 A;  2Z2L B;  1ES4 A;  3N6I A;  4BEN A;  2WKH A;  1XP4 A;  1K25 A;  3PBT A;  4WBG A;  2H0T A;  4QY6 A;  2A49 A;  3BEB A;  3HRE A;  3M2J A;  5DF8 A;  4CPK A;  5F1F A;  3UE3 A;  1K38 A;  1K56 A;  1GHI A;  3UNW A;  1BLC A;  1H8Y A;  1WYB A;  2XFT A;  4QY5 A;  4OQG A;  2J9O A;  4S2M A;  3V50 A;  4LEN A;  3OPL A;  3I7J A;  1NZO A;  3Q7V A;  3LY4 A;  3HUO A;  5HAI A;  1E3U A;  2HP5 A;  4EV4 A;  1S6R A;  2XDM A;  1MBL A;  4KZ6 A;  1IKI A;  5BOH A;  3DWK A;  3CG5 A;  1YLP A;  1YQS A;  1K55 C;  1K57 A;  3VP0 A;  3AGE A;  1PWG A;  4BD0 A;  1ZG4 A;  4DRT A;  5FDH A;  3W4P A;  3ZG9 B;  4GN2 A;  2XR0 A;  5FQM A;  4N1H A;  4U0X A;  4DE0 A;  3ZG7 B;  1MWS A;  3Q7Z A;  1PWC A;  5GHX A;  4E6W A;  1DJC A;  4LCL A;  1PIO A;  2G2U A;  1SDE A;  5TGF A;  4PM5 A;  1ZC2 A;  3BFD A;  2H0Y A;  2WAD A;  4KQQ A;  2Y2J A;  4R1G A;  3UDF A;  3IF6 C;  3WRT A;  4X6T A;  2WZX A;  3ZG8 B;  2ZC6 B;  4D2O A;  4E3L A;  3NBL A;  4U3T A;  4WEK A;  1NYY A;  3BLM A;  4EQI A;  2EX6 A;  1GHP A;  2ZQC A;  1NY0 A;  1VM1 A;  3HUN A;  3QNC A;  5DTS A;  2FFY A;  4UAA A;  4WMC A;  4WZ5 A;  4O7D A;  5CEB A;  3ITA A;  4IBX A;  2RCX A;  1KE0 A;  4R23 A;  4OPZ A;  4PPR A;  4RX3 A;  1JTG A;  5DTK A;  3C7V A;  4EBN A;  4MBF A;  2Y2O A;  1HVB A;  3G2Z A;  5EVL A;  1YLT A;  4OON A;  3GVB A;  4ZJ1 A;  1XGJ A;  2IWB A;  5EVI A;  3ISG A;  2BG1 A;  4B4X A;  1MWR A;  1GA0 A;  1FSW A;  3ZG0 A;  1YM1 A;  4H8R A;  4U0T A;  2Y2N A;  3VFF A;  3G30 A;  5FAP A;  2Y2P A;  2XH9 A;  4S2L A;  2RL3 A;  4X55 A;  5F83 A;  1W7F A;  4OH0 A;  2G2W A;  3VSL A;  4PM6 A;  4DE3 A;  1XKZ A;  5FAQ A;  3V5M A;  4OKP A;  1LL5 A;  2UWX A;  1FQG A;  3GSG A;  3N8R A;  2EX2 A;  2WZZ A;  3BEC A;  5HAR A;  1SDN A;  3BFG A;  3SH8 A;  4Y7P A;  1ALQ A;  2OV5 A;  4JLF A;  5J8X A;  2ZD8 A;  4R3J A;  2C6W B;  3WWX A;  4E6X A;  5CTN A;  1HD8 A;  2PU4 A;  4S2K A;  3CMZ A;  3OPR A;  4OQI A;  2ZQ8 A;  4FSF A;  2QMI A;  3UPO A;  2Y4A A;  4KZB A;  5M18 A;  4OPQ A;  1JWV A;  3MFD A;  4XUZ A;  3BFF A;  4K91 A;  4KEN B;  3UPN A;  1K4E A;  3V3S A;  1BT5 A;  3UE0 A;  3N8L A;  4B88 A;  3HLC A;  1TEM A;  5I94 A;  2X01 A;  3V3R A;  1MWT A;  2P9V B;  3MXR A;  4UHU A;  1K54 A;  3NC8 A;  4OP8 A;  1HTZ A;  3A3D A;  4KZ7 A;  1FR1 A;  4KZA A;  1PI4 A;  1SHV A;  1KDS A;  3A3F A;  1PW8 A;  1W8Y A;  1JWZ A;  3ZVT A;  1YLY A;  4DDY A;  4MLL A;  4YIN A;  5HAP A;  4X53 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...