4N1HA

Structure of a single-domain camelid antibody fragment cab-f11n in complex with the blap beta-lactamase from bacillus licheniformis
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
258
structure length
257
Chain Sequence
b'DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALVTSLRAFALEPGKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
molecule tags Hydrolase/immune system
source organism Bacillus licheniformis
publication title Probing the mechanism of aggregation of polyQ model proteins with camelid heavy-chain antibody fragments
rcsb
total genus 84
structure length 257
sequence length 258
chains with identical sequence C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4n1hA00
5HL1A 1IKGA 2WGIA 1ESUA 3RXWA 2EX2A 1N4OA 2XF3A 4S2NA 5HX9A 4DRTA 4HESA 2Y2NA 4OONA 5FAQA 4E3KA 3A3JA 3HLDA 5BOHA 1K54C 1Y54A 2Y4AA 3N8SA 4OP8A 2EX9A 2EFXA 3A3IA 3S22A 3CG5A 3QHYA 4E3MA 4NK3A 5KMWA 1EI5A 4OH0A 4OOMA 3AGEA 4U0TA 3OC2A 4KZ9A 4P6BA 3G30A 3G31A 3NDEA 3RXXA 3SOIA 3SS3A 1WYCA 1BUEA 1L2SA 1BT5A 5FQIA 2PU4A 3ZG9B 4MBKA 2H0TA 1BULA 3UDXA 4ZTKA 1KGGA 1J9MA 2P9VA 1PWDA 3M6HA 4GZBA 2J9OA 4PM8A 5TFQA 1XPBA 4BJPA 1HZOA 3PBSA 2EXAA 4OKPA 3C7UA 1YLYA 4WYYA 4DDSA 5IHVA 4ZDXA 1PWCA 1BLCA 3OPPA 4Y0OA 4BD0A 4S2JA 1GA0A 5KSHA 3GMWA 2JC7A 4GD6A 5EVIC 4OPRA 3MFDA 1SKFA 3BRMA 3G2YA 3N6IA 4PPRA 1GHIA 3WRTA 2Z2LB 3GV9A 2XR0A 3IF6B 2A3UA 1K54A 2Z2MB 2UWXA 2IWDA 2X02A 1MWSA 3GRJA 1K25A 1SDNA 4E6XA 1CEFA 1FSYA 3PBTA 3DTMA 5CGWA 1NRFA 3RJUA 1LLBA 2WK0A 1LL5A 3UE3A 3BLMA 4UA6A 5GHXA 1XXMA 2WUQA 4EBNA 2Y2MA 3GR2A 4OOLA 4PM9A 1I2SA 3AGFA 5DTTA 2DRWA 1LHYA 3A3FA 4UHUA 4KZ3A 2WZZA 3PBOA 3VOYA 2WGWA 3MZFA 2ZQCA 3HLWA 3HBRA 4DE1A 4BENA 3ZG8B 2XFSA 3ITBA 3OCLA 4LV0A 4C3QA 1PW1A 4EUZA 3O87A 1RGZA 5FAOA 1FSWA 4JKTA 4LV1A 1EWZA 4RYEA 4O7DA 4EQIA 1ESIA 3FV7A 4U3TA 4X69A 5KSCA 2PU2A 1ZC2A 2JE5A 3O88A 3MBZA 3Q82A 1DY6A 5EVIA 3TG9A 3V3SA 4GB7A 3C5AA 2ZQ7A 5FI6A 2HP6A 1BZAA 5F82A 3W8KA 1K6SA 1TVFA 4R4SA 4OQ0A 2ZQAA 4ZBEA 4R23A 1YLWA 2VGKA 4KZ4A 1S0WA 1MKIA 2Y2PA 5CGSA 1LI0A 1MWRA 1E3UA 4NETA 2J8YA 1GHPA 1M40A 3EQUA 3GVBA 2HDRA 3V3RA 5CECA 1Q2QA 4X55A 1FCNA 4JPMA 3SS4A 4FSFA 1KE4A 2XFTA 3UPOA 2DNSA 1K57A 2V1ZA 3MKFA 1ZG4A 4P0MA 2DCFA 5I94A 4MNRA 5DF8A 4N9KA 3IT9A 3IXBA 1YQSA 3ZG7B 3HL9A 4XUXA 3ZG0A 1PW8A 1PIOA 3Q7ZA 2V2FF 3D4FA 5TGFA 2ZC7A 3Q7VB 3CJMA 4GKUA 3DWKA 1IEMA 1SHVA 4KZAA 4EBLA 4PM5A 3UDIA 1K55C 5FA7A 2EX8A 4X53A 4DE0A 1JWPA 3HUOA 4OVDA 1MXOA 3OCNA 4QU3A 3FKVA 3N8RA 3FYZA 1CEGA 3ZGAB 2OLUA 3ZCZA 4KG6A 3BFFA 3OPLA 5FI2A 4QB8A 3ZHHA 4BL2A 4LCLA 5FDHA 2HPBA 3PTEA 3Q7VA 4GOGA 1H8YA 3NY4A 3C4OA 5GHZA 5CTNA 1E4DA 1WYBA 5EOOA 5M18A 3WS1A 1C3BA 1IYOA 2ZMAA 3VP4A 3IH8A 3LY4A 3NDGA 3NI9A 4ZJ1A 1DJAA 4OPYA 3SH8A 5GL9A 3G35A 3VMAA 1NYYA 3ZVTA 2HP9A 3C7VA 3OZHA 3C4PA 1Q2PA 1YT4A 3HUMA 5AQBA 4JXVA 4MLLA 1E25A 4RX3A 5F1GA 4R3JA 5G18A 3IH9A 3G2ZA 4RX2A 4UA7A 4LCMA 3IWOA 1H8ZA 3HLEA 3ISGA 1ONHA 1W8YA 4OQHA 3WS2A 3WS4A 3IXHA 2GDNA 3ZNTA 4WEKA 4N1XA 4DKIA 2QPNA 2ZD8A 2ZJ9A 3FKWA 1JTGA 4GDBA 2QMIA 5EECA 4E3NA 1MPLA 3M2JA 5DF9A 4RA7A 3N4IA 3DWZA 4S2KA 4S2IA 4Z9QA 5FAPA 2VGJA 2WGWB 5F83A 4JF4A 4E3OA 5FQJA 4KQOA 1GHMA 2QZ6A 2Y2OA 4GN2A 4MBHA 4PM6A 5E2FA 5EE8A 2Q9NA 4JXGA 3UE1A 3ITAA 4KQRA 2PBYA 4B4XA 1AXBA 2G2WA 1MWUA 1W79A 3VFFA 2ZC4B 2Y2IA 3VP2A 1GCEA 2BG1A 4DE2A 1HVBA 4S2PA 1MY8A 4QY6A 1KGFA 1PI4A 4FCFA 5HAIA 2ZQDA 3G4PA 1OMEA 5GHYA 3BFGA 1EROA 4Y7PA 5L2FA 2WAEA 3W4QA 2XD5A 1L0DA 4XXRA 3O3VA 4S2OA 4FD8A 2RL3A 5GLBA 4X6TA 5U47A 2XK1A 3BM6A 1JWVA 2J9PA 2P74A 4EWFA 2WKHA 4HBUA 1DJCA 1PZOA 4IVKA 3V39A 5AQ7A 3PAGA 4YINA 1NXYA 3P98A 2Q9MA 3W4OA 5E2HA 4MBFA 3VSKA 2Y55A 2FFFB 3MZDA 5FQ9A 2C5WB 2OSUA 3IQAA 3NBLA 2J7VA 5GLDA 2IWBA 4N9LA 5FASA 4X68A 1H5XA 4QY5A 3VP1A 1JWZA 1SDEA 1QMEA 1FQGA 4GD8A 4JF5A 3BEBA 1W5DA 3HUNA 4BLMA 1PI5A 3PBQA 1IELA 1KVMA 1L0GA 5A93A 3IHBA 4R1GA 1KDSA 3GQZA 4C6YA 5FQQA 3WRZA 4E3JA 1L0FA 5EOEA 4WM9A 3UPNA 3BFDA 4WEJA 3HVFA 1G6AA 2Y2GA 3N8LA 5DVAA 5CEBA 2ZM2A 1FR1A 4BD1A 3P09A 2XQZA 5CHUA 3UE0A 3FWLA 1FR6A 3I7JA 2I72A 4KQQA 1GA9A 1HTZA 1K57C 1KE0A 1K4FA 1PZPA 4JF6A 3TOIA 2WYXA 3UY6A 2OV5A 3WS0A 3OPRA 4IBXA 4A5RA 1K56D 3V5MA 3AGDA 1FOFA 4KZ7A 3ZDJA 4MEZA 1ES4A 4E3IA 4M3KA 3A3DA 2R9XA 3UPPA 3PBRA 1NYMA 4HBTA 1K4EA 1ONGA 4JLFA 1YMXA 2EFUA 1VM1A 4IEDA 5DTSA 2XD1A 5GLCA 2C6WB 3QNBA 4KZ8A 5HARA 3ZG5A 4YFMA 3M2KA 2Y59A 3OPHA 4Y0TA 1YLZA 2EX6A 3HLBA 1ZG6A 4OP5A 1ERQA 4RVAA 5CERA 4IVIA 4L0LA 1JVJA 4ZJ3A 2Y2LA 4OPZA 4FH4A 4OQIA 3VSLA 2R9WA 1ERMA 3E2LA 4ZJ2A 4D2OA 1ALQA 1BTLA 2HDUA 1KGEA 3HREA 4N92A 4B4ZA 4R4RA 3G34A 3O86A 4OPQA 1E3UD 1XP4A 1W7FA 3IF6A 4OQGA 2P9VB 1LL9A 1RGYA 3NIAA 5KZHA 1XKZA 4JBFA 3MXRA 1BLPA 4P87A 1XA7A 5AQAA 2V20A 4H8RA 4ID4A 1K6RA 1MWTA 1KVLA 3IHAA 3BLSA 5GLAA 3NC8A 2Y2QA 2A49A 1G68A 1W8QA 4OLGA 1DJBA 4X56A 1CI8A 5CRFA 3UN7A 4KZ5A 3SS5A 1L0EA 1K38A 1XGIA 3DW0A 4K0WA 3ZNYA 3UDFA 3S1YA 3JYIA 3HLFA 4K91A 2XDMA 4KG5A 3UNWA 3TSGA 4F94A 4QJGA 3FZCA 2Y91A 2Y2JA 3ZVWA 2Y2KA 3G32A 1NJ4A 4LV3A 1VQQA 1HD8A 1TDLA 4DF6A 4PMAA 3LY3A 2X71A 5CGXA 3Q81A 5EPHA 1XA1A 2JCHA 1YMSA 2ZM8A 3A3EA 2B5RA 4QD4A 2WADA 5FATA 5M19A 3GSGA 1FCOA 1M6KA 5CHMA 1S6RA 3GTCA 4FH2A 1KE3A 3EQVA 1RCJA 2WGVA 4CJNA 3IF6C 4PM7A 5HW3A 5AQ9A 1FCMA 3VOZA 5E2EA 5A90A 1I5QA 3Q1FA 4WMCD 4HEFA 5EVID 3CZDA 2H10A 5EVIB 4Q8IA 5F1FA 1NZUA 4WZ5C 3CMZA 4BL3A 1XGJA 1K56A 5E2GA 4GNUA 4XUZA 3M6BA 5HAQA 3SH7A 2HDSA 4EV4A 5DF7A 3WWXA 5FQKA 2ZQ8A 5EVLA 4BQMA 2E8IA 4JXSA 4UA9A 4KENB 1RP5A 1PYYA 5JYPA 5A91A 1CK3A 5FQMA 4EBPA 3BFCA 3IXGA 2BLSA 3Q07A 4K0XA 3WS5A 4LENA 5E43A 4S2LA 1IYPA 1KDWA 1ES2A 2XH9A 2Y2HA 3E2KA 1SCWA 3PAEA 1YLJA 1I2WA 3LCEA 4WMCA 1Z6FA 5TR7A 5HFOA 4CPKA 3NCKA 3B3XA 3VFHA 4Y0UA 1IYQA 1BLHA 3V50A 2XGNA 4DXBA 1IKIA 2ZLYA 2ZM0A 5HAPA 5CHJA 4WELA 4DE3A 2OLVA 5JYOA 1YM1A 1N9BA 4WZ5A 2X01A 1CI9A 1NY0A 4C75A 2H0YA 4S2NC 5D3OA 2CC1A 2RCXA 1MBLA 2XLNA 2JBFA 4R3BA 3HLGA 2ZC3B 2FFYA 1O07A 4S2MA 4KZ6A 4OLDA 2HP5A 4KZBA 5A92A 3IWIA 3IXDA 2WAFA 3UO9A 3QNCA 4U0XA 4IBRA 3PBNA 5CTMA 2ZC6B 1ES5A 1QMFA 3W4PA 3MXSA 1XX2A 2H5SA 1TEMA 1BSGA 2G2UA 1NZOA 2WZXA 3LEZA 3LO7A 4JXWA 4LV2A 4N1HA 4OOYA 5FSRA 5M1AA 3BYDA 4DDYA 4R0QA 5J8XA 1TDGA 4E3LA 1LI9A 4KG2A 3BECA 1O7EA 3S4XA 1K55A 1ES3A 1JTDA 5CXWA 3MZEA 3BFEA 4ZAMA 1YLTA 2HDQA 3VP0A 3HLCA 1YLPA 3IWQA 4P85A 2EXBA 4WBGA 5FI7A 3SH9A 4B88A 2XEPA 5EUAA 4DXCA 3VP3A 4QHCA 2WKEA 1IYSA 4E6WA 4WZ4A 4GDNA 3N7WA 1U60A 3MKEA 1WE4A 4UAAA 5CEDA 2WKIA 3IF5A 5DTKA 2ZC5B 2IWCA 1PWGA 3ZFZA 1BLSA 1ZKJA 2ZQ9A
chains in the Genus database with same CATH superfamily
5HL1A 1D1JA 2EA9A 3DAVA 4Y13A 3ICYA 3K2NA 4GLQA 2EX2A 2FZ0A 2XF3A 4ARZA 4DRTA 4HESA 3LIEA 2EFXA 5HSQA 3DTIA 4FUWA 3QHYA 4E3MA 5KMWA 3G31A 3RXXA 3SOIA 3SS3A 3HCYA 5FQIA 2PU4A 3ZG9B 1VEUB 3LIAA 4ZTKA 5EM1A 3C8CA 1HZOA 1PWCA 1BLCA 4Y0OA 5HPIA 4HOIA 3E0YA 1VETB 2Y8HA 4OPRA 3BRMA 3N6IA 2JKFA 4KUKA 2UWXA 2IWDA 2V8CA 4I3JA 1K25A 1CEFA 3RJUA 1LLBA 2W1RA 3UE3A 3CLOA 4I3AA 2WUQA 3GR2A 4IUKA 3P7NA 3A3FA 2BASA 3ZG8B 3ITBA 1TS7A 4P6ZS 5TJJA 1SKOB 1FSWA 4LV1A 3T12B 1ESIA 1JNUA 5HDDA 2JE5A 1DY6A 4GB7A 5FI6A 5F82A 1BZAA 3MQQA 2ZQAA 4ZBEA 4R23A 4KZ4A 3UMDA 3K3CA 2J8YA 1GHPA 2K31A 3GVBA 3JPUA 1Q2QA 1FCNA 3JVUA 5HWVA 2V1ZA 2DCFA 3B33A 4YNRA 4N9KA 1YQSA 3HL9A 2V2FF 3D4FA 4CLCE 4M4XA 4KZAA 2VEAA 1K55C 1JWPA 4WLAA 1FILA 3IX4A 1N9NA 3ZHHA 5FDHA 1UWNX 3LIFA 1E4DA 4MDZA 4DJ3A 2G7UA 4HY8A 3NDGA 4D60A 4ZJ1A 5GL9A 3G35A 3VMAA 2BTFP 1NYYA 3C4PA 1Q2PA 4KQDA 2P04A 4JXVA 2A24A 4RX3A 3IBRA 5G18A 2QYBA 4LCMA 1ONHA 1G28A 1CQAA 1IOUA 5EV0A 4B9OA 2ZD8A 2ZJ9A 5IT5A 4RA7A 4S2KA 3F1NB 2V0WA 5F83A 1GHMA 2QZ6A 4GN2A 2Q9NA 4JXGA 3UE1A 4KQRA 2PBYA 4Z1WA 2G2WA 1H0MA 4UQIM 2OAP1 3VP2A 1HVBA 1MY8A 1KGFA 2J3WA 5HAIA 3G4PA 1GSVA 2PRFA 5L10A 3W4QA 5DJUA 2E8JA 5GLBA 2RL3A 4X6TA 3BM6A 1SZVA 1DJCA 4IVKA 3P98A 3H82A 4MBFA 5CX7A 1PRQA 3MZDA 1F98A 3BW6A 5FQ9A 3T4KA 2OSUA 3IQAA 2J7VA 2IWBA 4N9LA 3HJIA 4YWZA 4BLMA 1IELA 3IHBA 4C6YA 3GQZA 5FQQA 4E3JA 1L0FA 4HNBA 3BFDA 1G6AA 3P09A 2I72A 1GA9A 1LSXA 3MR0A 1HTZA 3O5YA 3PYPA 2WYXA 3VE3A 2O9AA 4IBXA 1K56D 3AGDA 4G3WA 4E3IA 4R38A 1S1ZA 1K4EA 1H8MA 1ONGA 3VOLA 1YMXA 2Q0OA 4IEDA 1DP8A 3QNBA 3ZG5A 4YFMA 3M2KA 3OPHA 1ZG6A 4RVAA 1ERMA 2KLIA 3EGXC 4R4RA 3G34A 3O86A 3BWLA 1E3UD 3IF6A 4EXOA 5KZHA 3MXRA 2V20A 4NXGA 1K6RA 4X1MA 5GLAA 3NC8A 1W8QA 3PHYA 1PFLA 2JKTI 3MQ0A 4HJ6A 3SS5A 3T1XA 3T4QA 3KSGA 4MN6A 3UDFA 3FPWA 1YSPA 4Q0JA 3S1YA 2XDMA 4QJGA 2Y2JA 4GCZA 1NJ4A 4LV3A 1VQQA 1HD8A 1TDLA 3H82B 3LY3A 2W0NA 4LPZA 3Q81A 3OOVA 3A3EA 5FATA 3E4OA 1LSVA 3EQVA 4CJNA 5HW3A 4LRYC 2M7UA 3Q1FA 4WMCD 5HDSA 2WKPA 5F1FA 1NZUA 4WZ5C 1XGJA 3MF0A 5FQKA 5EVLA 4BQMA 4JXSA 1XJ3A 4KENB 3IS2A 3BFCA 3IXGA 1KDWA 4LFUA 2XH9A 2Y2HA 3E2KA 1YLJA 2WKQA 3LCEA 2HF6A 2VK3A 3NCKA 3B3XA 5FDSA 4DN0A 3V50A 1BLHA 5IU1A 2XGNA 5JYOA 5HD5A 1N9BA 4WZ5A 3S7NA 5J7EA 1CI9A 4LRZE 2H0YA 4S2NC 2XLNA 2RCXA 4R3BA 1ODVA 2PHYA 2HP5A 5HZHA 3BQAA 2OAQ1 1VEUA 3ZQ5A 1QMFA 3W2ZA 3W4PA 3MXSA 3LEZA 1BSGA 4N1HA 1MC0A 3IBJA 2K7SA 3BECA 3H9WA 1K55A 5DKLA 3BFEA 2JHEA 2VA0A 4WBGA 5EUAA 4QHCA 2WKEA 4RQ9A 5L09A 1U60A 1WE4A 5DTKA 2Z6CA 4OQIA 2O99A 3RXWA 1N4OA 2W1TA 3ULFA 2Y2NA 4MMNA 1K54C 1Y54A 3N8SA 1T1BA 1YAXA 4NK3A 1EI5A 4HH3A 4OH0A 3AGEA 4U0TA 4P6BA 3ZG7B 1FIKA 3NDEA 1WYCA 5F69A 1L2SA 4ETZA 1BT5A 3R7WA 1OPXA 1SKOA 4GHIA 4PM8A 1XPBA 5DJTA 4DDSA 5IHVA 4QPRA 4JGRA 1GA0A 5KSHA 5EVIC 3MFDA 1SKFA 3GDIA 3WRTA 2Z2LB 2XR0A 2PYPA 1K54A 2Z2MB 2X02A 1MWSA 1FSYA 3PBTA 3BQ8A 2WK0A 2B02A 1XXMA 4OOLA 1I2SA 5DTTA 4O8GA 5DFXA 4KZ3A 2WZZA 3PBOA 3HLWA 3CUEA 1RGZA 5FAOA 4RYEA 2JKRM 4EQIA 4U3TA 1ZC2A 3O88A 3TG9A 5EVIA 3C5AA 1K6SA 4I38A 3U4LP 2L4RA 2PBDP 1MKIA 2D02A 5CGSA 1MWRA 3EQUA 4WL9A 3V3RA 4ETXA 4B93A 4FSFA 4I3IA 5HWWA 1KE4A 2XFTA 3S7OA 4IJGA 1ZG4A 5DF8A 3IXBA 3ZG0A 1PW8A 2A24B 4Y3IA 3Q7ZA 2OOLA 3Q7VB 3IX3A 3EEHA 4PM5A 5FA7A 1G6OA 2EX8A 4X53A 4OVDA 1MXOA 3OCNA 3F1OA 2VGLS 3OLOA 1CEGA 2OLUA 3BFFA 3OPLA 3E98A 4QB8A 3QP6A 5LBRA 3PTEA 3Q7VA 1A0KA 3C4OA 2YKHA 4MN7A 4R6LA 3WS1A 1IYOA 2ZMAA 4ARZB 3IH8A 1DJAA 3T1RA 3SH8A 3C7VA 1GSXA 3HUMA 4AFIA 4R3JA 3IH9A 4K08A 3ISGA 4ESPA 1W8YA 4OQHA 3WS2A 3IXHA 2GDNA 3ZNTA 4WEKA 4DKIA 4BWIA 4E3NA 1JTGA 1MPLA 5DF9A 1P97A 3CPTA 4S2IA 2QJ7A 3FC7A 3SW1A 2Y2OA 5EE8A 4A5RA 5IS1A 3T4SA 1MWUA 3LI9A 1W79A 3VFFA 2Y2IA 1GCEA 2BG1A 1PI4A 2ZQDA 3TW8A 5L2FA 3E4PA 2XD5A 1L0DA 3O3VA 4S2OA 1JWVA 4G3VA 2WKHA 4HBUA 1PZOA 3PAGA 3F1OB 3C30A 1TS8A 3T4TA 4Y15A 2Q9MA 2W3HA 4IUHA 2Y55A 4CLCC 4PAUA 3NBLA 5GLDA 1CF0A 3DBAA 3NULA 3VP1A 1QMEA 2PR5A 3BEBA 1PI5A 3PBQA 3MMHA 5I5LA 3R4KA 3KYEA 1S4SA 4R1GA 5L07A 3WRZA 3UPNA 4WM9A 3HVFA 3N8LA 2Y2GA 5CEBA 3UE6A 3H7WB 2XQZA 5CHUA 3I7JA 1AWIA 1K57C 5AVEA 3UY6A 3OPRA 3V5MA 4JGOA 4JGPA 1FOFA 2QKPA 4KZ7A 4LGWA 1V9ZA 1ES4A 4M3KA 4WF0A 1N9LA 4HBTA 4JLFA 2EFUA 2HGVA 2O0YA 4Y0TA 2ZOIA 2EX6A 3CI6A 5TBMB 2J3TD 3UB7A 5KIZA 4L0LA 1ACFA 1T19A 4EETB 3VSLA 4N92A 4B4ZA 5G4ZA 3RFBA 3MFXA 2P9VB 1LL9A 1RGYA 3NIAA 2PAVP 2Y2QA 2ZOHA 3T1SA 1K38A 3DW0A 3QP8A 3ZNYA 3MS6A 3JYIA 3HLFA 4KG5A 3ZVWA 2Y2KA 2QJ5A 1LSWA 4LLOB 4HHDA 3T50A 5EPHA 4NKPA 2JCHA 1YMSA 5M19A 4O0PA 1S6RA 2JKTM 2W3GA 2WGVA 4UQIS 4PM7A 5A90A 2LB9A 2H10A 3DTEA 3LEQA 5E2GA 1TS0A 2ZQ8A 4UA9A 3RH8B 5JYPA 5A91A 1EW0A 4S2LA 1XJ2A 2XROA 1I2WA 1Z6FA 4O01A 1P9WA 3VFHA 4EU0A 1VHMA 4Y0UA 1IYQA 2P7JA 1IKIA 5HAPA 2OLVA 1YM1A 5EFWA 1NY0A 2CC1A 4P6ZM 2FFYA 5F6AA 4F3LB 1O07A 4HIAA 2P08A 1MKMA 4L9GA 5HDCA 3UB5P 3PBNA 5CTMA 2ZC6B 4YOFA 3LO7A 2G2UA 3VE4A 3T1QB 3ZYTA 5J8XA 4R0QA 2R78A 1TDGA 4HJ4A 4E3LA 3S4XA 1O7EA 5CXWA 1T18A 2HDQA 3VP0A 3HLCA 1YLPA 3SH9A 3TRCA 4DXCA 1IYSA 4GDNA 1OJ5A 3B42A 2WKIA 3IF5A 3NHQA 1ZKJA 1G5UA 1IKGA 2WGIA 4EESA 4S2NA 4Q0IA 3NJAA 5FAQA 3EWKA 2Y4AA 1NLZA 4QWOA 4OP8A 4DJ2A 3F1PB 3QP2A 5AVFA 4OOMA 3OC2A 2B95A 3G30A 4NEED 3FG8A 4MBKA 1ZTUA 2Z6DA 3UDXA 2P9VA 3M6HA 1PWDA 4GZBA 5TFQA 2J9OA 4BJPA 1TF1A 2EXAA 4OKPA 4ZDXA 4BD0A 1VETA 4S2JA 1LL8A 3LIBA 1TS6A 2JC7A 4GD6A 4PPRA 3G2YA 3GV9A 1LT0A 3IF6B 4PHTA 3PXPA 5CGWA 1NRFA 2AVXA 4GS9B 1LL5A 4EBNA 4CQHA 5AJGA 3VOYA 2ZQCA 4DE1A 2XFSA 3OCLA 5DFYA 4C3QA 1PW1A 4EUZA 3EEAA 1K0KA 4JKTA 1EWZA 1UGUA 4CLCA 4O7DA 3FV7A 2OWHA 5KSCA 1S66L 3MBZA 3Q82A 2J3TC 2HP6A 1TVFA 3KYQA 4OQ0A 4EW7A 1YLWA 1S0WA 4NXEA 2Y2PA 1E3UA 1M40A 2XSSA 5CECA 4X55A 4JPMA 1T1CA 3KO6A 2DNSA 1K57A 3MKFA 3QP1A 2OWJA 4GS9A 2PD7A 1PIOA 5TGFA 2ZC7A 3CJMA 1ZHHB 3UDIA 3NOTC 4DE0A 3T4OA 1OTDA 3LIDA 2VV6A 3MJQA 3ZGAB 1OTBA 4KG6A 2PD8A 4BL2A 2KOIA 4LCLA 2HPBA 3CUEC 5GHZA 5HWTA 5CTNA 5M18A 1NRJA 3LI8A 5J3WA 3VP4A 3LY4A 2NUTC 1Y4OA 3ZVTA 2HP9A 3F1PA 5AQBA 4MLLA 4MCWA 5HL6A 1E25A 3R7WB 3G2ZA 2ZL1A 4UA7A 1OT9A 1S67L 3HLEA 3L7HA 4N1XA 1D7EA 2J80A 3FKWA 3LR4A 3M2JA 3N4IA 3CPTB 1W63Q 2VGJA 2WGWB 2W1TB 1KOUA 3E4QA 4JF4A 4KQOA 4PM6A 3ITAA 4BBUA 4E04A 4QY6A 4Q0HA 3LYXA 1OMEA 1OT6A 5GHYA 1EROA 2WAEA 4XXRA 4X1LA 4FD8A 2XK1A 2P74A 4EWFA 1S1YA 1W63M 4UEYA 1NXYA 3NECA 1F2KA 3W4OA 2QWSA 1T1AA 4F3LA 2FFFB 3NOPC 2C5WB 2B18A 3CWFA 4X68A 1H5XA 3IX8A 4QY5A 1JWZA 1SDEA 4GD8A 1FQGA 4JF5A 4PKYA 2W3DA 1W5DA 2JN7A 2ZBBA 1KVMA 5A93A 1KDSA 4EEUA 5EOEA 3G6OA 3BY9A 4WEJA 1CJFA 5DVAA 2ZM2A 1FR1A 3H7WA 1BYWA 3UE0A 3FWLA 4R3AA 2NUPC 1TD5A 1KE0A 3B47A 1PZPA 4JF6A 5G4YA 3WS0A 4MEZA 3UB9A 4Y2FA 3PBRA 1NYMA 3UPPA 4I5SA 3IS2B 2XD1A 5GLCA 2GX5A 2C6WB 4HP4A 2Y59A 1YLZA 3HLBA 4OP5A 5CERA 4IVIA 4ZJ3A 4ME4A 2Y2LA 2I9VA 3D3OA 2R9WA 3E2LA 4ZJ2A 1ALQA 2HDUA 1KGEA 3HREA 1OTAA 4OPQA 1W7FA 1F5MA 1XKZA 4P87A 4KUOA 1XA7A 5AQAA 4H8RA 4ID4A 1MWTA 3BLSA 2A49A 1G68A 5CRFA 3UN7A 1DJBA 1CI8A 1L0EA 1XGIA 4EEPA 4K91A 3TSGA 4F94A 5L8MA 4GJ4A 4DF6A 4NG2A 3LR0A 5TBMA 5CGXA 1D06A 1XA1A 2IA2A 1FCOA 1M6KA 2V8FA 2DMWA 1KE3A 1RCJA 4MN5A 2YKFA 3IF6C 3OBFA 3K3DA 5AQ9A 1FCMA 3VOZA 1I5QA 4Q8IA 1P9RA 2M1CA 5EVID 3KX0X 4BL3A 1K56A 2V9AA 4GNUA 3M6BA 5DF7A 2E8IA 1RP5A 1PYYA 2WKRA 3KYZA 1CK3A 4K0XA 3WS5A 5E43A 1ES2A 3RTYA 5F5YA 3PR6A 2UV0E 4CPKA 4X25A 1N9OA 2L1MA 4DXBA 2ZLYA 2ZM0A 5CHJA 3VV4A 2W27A 5D3OA 1MBLA 2JBFA 3HLGA 2ZC3B 4S2MA 4OLDA 4KZBA 3IXDA 5C5KA 1XJ4A 3CHWP 3TE8A 1ES5A 3SZTA 1XX2A 4DE2A 4JXWA 1NZOA 3UMEA 1YPRA 5FSRA 4GHIB 4KG2A 3LUQA 1JTDA 1HLUP 3U2AA 1YLTA 1OTIA 1S4RA 2EXBA 5FI7A 1IFQA 2XEPA 1YSQA 3VP3A 3N7WA 1YKDA 5J4EA 4UAAA 2FH5A 2IWCA 3ZFZA 1ESUA 4DMZA 5HX9A 2QHKA 4OONA 4E3KA 3A3JA 3HLDA 5BOHA 2EX9A 3A3IA 3S22A 3CG5A 4H6JB 3EOIA 4KZ9A 1BUEA 3CAXA 2H0TA 1BULA 1STZA 1P0ZA 1KGGA 1J9MA 2O9CA 4ZRRA 2W3FA 3T4JA 3KSIA 3PBSA 4HP9A 1DP9A 3C7UA 1YLYA 3BJNA 4WYYA 3OPPA 4L9FA 3GMWA 5A8BA 2VLGA 1GHIA 2A3UA 3GRJA 1SDNA 3DTKA 4E6XA 1MZUA 3P01A 5EVEA 3DTMA 3MQOA 5MC7A 3BLMA 4UA6A 5GHXA 2Y2MA 4PM9A 3AGFA 2DRWA 1LHYA 4UHUA 1OTEA 2A2LA 2WGWA 3MZFA 3HBRA 4BENA 2EWWA 4LV0A 3C2WA 4GW9A 3O87A 2HJEA 4X69A 2PU2A 3V3SA 2ZQ7A 3W8KA 1H3QA 4R4SA 2VGKA 3V67A 3LR5A 1LI0A 4XT2A 4NETA 2HDRA 3SS4A 1DP6A 3UPOA 5F68A 4P0MA 5I94A 4MNRA 3IT9A 2ZL1B 4HI4A 4XUXA 4HH2A 2VX8A 2KX6A 3JVVA 4GKUA 3DWKA 1IEMA 1SHVA 4EBLA 4HQAA 3HUOA 4PKYG 4QU3A 5DKKA 3FKVA 3N8RA 3FYZA 3ZCZA 5FI2A 4NXFA 4GOGA 1H8YA 1Z09A 1F9IA 3NY4A 1WYBA 5EOOA 3UB8A 1C3BA 3NI9A 4II7A 2VKSA 4JGQA 4OPYA 1L3LA 3OZHA 1YT4A 3LR3A 4BBVA 3LFVA 5EM0A 4XT2B 5F1GA 2VZWA 4RX2A 4Y5FA 4I39A 3IWOA 1H8ZA 2HJ9C 2V1BA 3WS4A 2GNXA 2INWA 4CLCB 2QPNA 4GDBA 5EECA 2QMIA 2KDKA 3DWZA 5K5BA 5FAPA 4Z9QA 2PT7A 2D01A 4E3OA 5FQJA 3A0VA 4MBHA 5E2FA 2O9BA 1XFQA 4B4XA 1AXBA 1DRMA 2CMNA 2ZC4B 2GZAA 3C38A 1VB6A 4S2PA 4FCFA 3A0RA 2XRNA 3HJKA 4R70A 4EQ1A 3BFGA 4Y7PA 1PNEA 2GJ3A 2XA7S 5U47A 2JKRI 2J9PA 2VJWA 3V39A 5AQ7A 4YINA 4BBTA 2H28A 5E2HA 3VSKA 1Y28A 2ACGA 2M7VA 4IHQA 2LB5A 2VV8A 5FASA 3HUNA 2EWVA 1L0GA 2JKGA 5HPFA 4HJ3A 2MJ6A 3CITA 4BD1A 1FR6A 4KQQA 5FEFA 1K4FA 3TOIA 2OV5A 2PR6A 3ZDJA 3QP4A 3A3DA 2R9XA 4EUVA 3F1NA 1VM1A 5DTSA 3MSHA 4KZ8A 5HARA 1ERQA 2V0UA 1JVJA 3T4LA 4OPZA 4FH4A 4D2OA 4FOFA 1BTLA 2V1AA 3UB6A 1XP4A 4OQGA 2PDRA 3EGDC 4JBFA 1BLPA 3MXQA 1KVLA 3IHAA 4OLGA 4X56A 4KZ5A 2ZMVA 4K0WA 1V9YA 3UNWA 3FZCA 2Y91A 3G32A 4H6JA 3KSHA 4PMAA 1OJGA 2X71A 2ZM8A 4QD4A 4WN5A 2B5RA 2WADA 3GSGA 5CHMA 3GTCA 4FH2A 1XFNA 5E2EA 4HEFA 3CZDA 5EVIB 3LICA 3CMZA 4EERA 4CLCD 4XUZA 3GECA 3KSFA 5HAQA 3A0SA 3SH7A 2HDSA 3D72A 4EV4A 3WWXA 4FTXA 2HV1A 5FQMA 4EBPA 1XJ6A 3QP5A 2BLSA 3Q07A 4LENA 1IYPA 2K2NA 2W3EA 4L9EA 1SCWA 1UWPX 3PAEA 4NXBA 4WMCA 5TR7A 5HFOA 4BMWA 4WELA 4DE3A 4Y17A 2X01A 3NOUC 4C75A 2PYRA 3S7PA 2Y79A 5FEGA 3LGOA 4KZ6A 1WA9A 2XA7M 1NLYA 5A92A 3IWIA 2WAFA 2L0WA 3UO9A 2VV7A 3QNCA 4U0XA 3L9KA 4IBRA 3TJZC 2H5SA 1TEMA 2WZXA 4LV2A 4OOYA 5HD3A 5M1AA 3BYDA 4DDYA 1LI9A 5FL3A 4WUJA 4LRXC 1ES3A 2VGLM 3MZEA 4ZAMA 3IWQA 4G3KA 1X0OA 1GSWA 4P85A 1NWZA 4B88A 3BY8A 4E6WA 3D9YA 4WZ4A 2ZMFA 3S7QA 3MKEA 5CEDA 3FPVA 2HZ5A 2ZC5B 1J3WA 1PWGA 1BLSA 2ZQ9A
chains in the Genus database with same CATH topology
5HL1A 1IKGA 2WGIA 1ESUA 3RXWA 2EX2A 1N4OA 2XF3A 4S2NA 5HX9A 4DRTA 4HESA 2Y2NA 4OONA 5FAQA 4E3KA 3A3JA 3HLDA 5BOHA 1K54C 1Y54A 2Y4AA 3N8SA 4OP8A 2EX9A 2EFXA 3A3IA 3S22A 3CG5A 3QHYA 4E3MA 4NK3A 5KMWA 1EI5A 4OH0A 4OOMA 3AGEA 4U0TA 3OC2A 4KZ9A 4P6BA 3G30A 3G31A 3NDEA 3RXXA 3SOIA 3SS3A 1WYCA 1BUEA 1L2SA 1BT5A 5FQIA 2PU4A 3ZG9B 4MBKA 2H0TA 1BULA 3UDXA 4ZTKA 1KGGA 1J9MA 2P9VA 1PWDA 3M6HA 4GZBA 2J9OA 4PM8A 5TFQA 1XPBA 4BJPA 1HZOA 3PBSA 2EXAA 4OKPA 3C7UA 1YLYA 4WYYA 4DDSA 5IHVA 4ZDXA 1PWCA 1BLCA 3OPPA 4Y0OA 4BD0A 4S2JA 1GA0A 5KSHA 3GMWA 2JC7A 4GD6A 5EVIC 4OPRA 3MFDA 1SKFA 3BRMA 3G2YA 3N6IA 4PPRA 1GHIA 3WRTA 2Z2LB 3GV9A 2XR0A 3IF6B 2A3UA 1K54A 2Z2MB 2UWXA 2IWDA 2X02A 1MWSA 3GRJA 1K25A 1SDNA 4E6XA 1CEFA 1FSYA 3PBTA 3DTMA 5CGWA 1NRFA 3RJUA 1LLBA 2WK0A 1LL5A 3UE3A 3BLMA 4UA6A 5GHXA 1XXMA 2WUQA 4EBNA 2Y2MA 3GR2A 4OOLA 4PM9A 1I2SA 3AGFA 5DTTA 2DRWA 1LHYA 3A3FA 4UHUA 4KZ3A 2WZZA 3PBOA 3VOYA 2WGWA 3MZFA 2ZQCA 3HLWA 3HBRA 4DE1A 4BENA 3ZG8B 2XFSA 3ITBA 3OCLA 4LV0A 4C3QA 1PW1A 4EUZA 3O87A 1RGZA 5FAOA 1FSWA 4JKTA 4LV1A 1EWZA 4RYEA 4O7DA 4EQIA 1ESIA 3FV7A 4U3TA 4X69A 5KSCA 2PU2A 1ZC2A 2JE5A 3O88A 3MBZA 3Q82A 1DY6A 5EVIA 3TG9A 3V3SA 4GB7A 3C5AA 2ZQ7A 5FI6A 2HP6A 1BZAA 5F82A 3W8KA 1K6SA 1TVFA 4R4SA 4OQ0A 2ZQAA 4ZBEA 4R23A 1YLWA 2VGKA 4KZ4A 1S0WA 1MKIA 2Y2PA 5CGSA 1LI0A 1MWRA 1E3UA 4NETA 2J8YA 1GHPA 1M40A 3EQUA 3GVBA 2HDRA 3V3RA 5CECA 1Q2QA 4X55A 1FCNA 4JPMA 3SS4A 4FSFA 1KE4A 2XFTA 3UPOA 2DNSA 1K57A 2V1ZA 3MKFA 1ZG4A 4P0MA 2DCFA 5I94A 4MNRA 5DF8A 4N9KA 3IT9A 3IXBA 1YQSA 3ZG7B 3HL9A 4XUXA 3ZG0A 1PW8A 1PIOA 3Q7ZA 2V2FF 3D4FA 5TGFA 2ZC7A 3Q7VB 3CJMA 4GKUA 3DWKA 1IEMA 1SHVA 4KZAA 4EBLA 4PM5A 3UDIA 1K55C 5FA7A 2EX8A 4X53A 4DE0A 1JWPA 3HUOA 4OVDA 1MXOA 3OCNA 4QU3A 3FKVA 3N8RA 3FYZA 1CEGA 3ZGAB 2OLUA 3ZCZA 4KG6A 3BFFA 3OPLA 5FI2A 4QB8A 3ZHHA 4BL2A 4LCLA 5FDHA 2HPBA 3PTEA 3Q7VA 4GOGA 1H8YA 3NY4A 3C4OA 5GHZA 5CTNA 1E4DA 1WYBA 5EOOA 5M18A 3WS1A 1C3BA 1IYOA 2ZMAA 3VP4A 3IH8A 3LY4A 3NDGA 3NI9A 4ZJ1A 1DJAA 4OPYA 3SH8A 5GL9A 3G35A 3VMAA 1NYYA 3ZVTA 2HP9A 3C7VA 3OZHA 3C4PA 1Q2PA 1YT4A 3HUMA 5AQBA 4JXVA 4MLLA 1E25A 4RX3A 5F1GA 4R3JA 5G18A 3IH9A 3G2ZA 4RX2A 4UA7A 4LCMA 3IWOA 1H8ZA 3HLEA 3ISGA 1ONHA 1W8YA 4OQHA 3WS2A 3WS4A 3IXHA 2GDNA 3ZNTA 4WEKA 4N1XA 4DKIA 2QPNA 2ZD8A 2ZJ9A 3FKWA 1JTGA 4GDBA 2QMIA 5EECA 4E3NA 1MPLA 3M2JA 5DF9A 4RA7A 3N4IA 3DWZA 4S2KA 4S2IA 4Z9QA 5FAPA 2VGJA 2WGWB 5F83A 4JF4A 4E3OA 5FQJA 4KQOA 1GHMA 2QZ6A 2Y2OA 4GN2A 4MBHA 4PM6A 5E2FA 5EE8A 2Q9NA 4JXGA 3UE1A 3ITAA 4KQRA 2PBYA 4B4XA 1AXBA 2G2WA 1MWUA 1W79A 3VFFA 2ZC4B 2Y2IA 3VP2A 1GCEA 2BG1A 4DE2A 1HVBA 4S2PA 1MY8A 4QY6A 1KGFA 1PI4A 4FCFA 5HAIA 2ZQDA 3G4PA 1OMEA 5GHYA 3BFGA 1EROA 4Y7PA 5L2FA 2WAEA 3W4QA 2XD5A 1L0DA 4XXRA 3O3VA 4S2OA 4FD8A 2RL3A 5GLBA 4X6TA 5U47A 2XK1A 3BM6A 1JWVA 2J9PA 2P74A 4EWFA 2WKHA 4HBUA 1DJCA 1PZOA 4IVKA 3V39A 5AQ7A 3PAGA 4YINA 1NXYA 3P98A 2Q9MA 3W4OA 5E2HA 4MBFA 3VSKA 2Y55A 2FFFB 3MZDA 5FQ9A 2C5WB 2OSUA 3IQAA 3NBLA 2J7VA 5GLDA 2IWBA 4N9LA 5FASA 4X68A 1H5XA 4QY5A 3VP1A 1JWZA 1SDEA 1QMEA 1FQGA 4GD8A 4JF5A 3BEBA 1W5DA 3HUNA 4BLMA 1PI5A 3PBQA 1IELA 1KVMA 1L0GA 5A93A 3IHBA 4R1GA 1KDSA 3GQZA 4C6YA 5FQQA 3WRZA 4E3JA 1L0FA 5EOEA 4WM9A 3UPNA 3BFDA 4WEJA 3HVFA 1G6AA 2Y2GA 3N8LA 5DVAA 5CEBA 2ZM2A 1FR1A 4BD1A 3P09A 2XQZA 5CHUA 3UE0A 3FWLA 1FR6A 3I7JA 2I72A 4KQQA 1GA9A 1HTZA 1K57C 1KE0A 1K4FA 1PZPA 4JF6A 3TOIA 2WYXA 3UY6A 2OV5A 3WS0A 3OPRA 4IBXA 4A5RA 1K56D 3V5MA 3AGDA 1FOFA 4KZ7A 3ZDJA 4MEZA 1ES4A 4E3IA 4M3KA 3A3DA 2R9XA 3UPPA 3PBRA 1NYMA 4HBTA 1K4EA 1ONGA 4JLFA 1YMXA 2EFUA 1VM1A 4IEDA 5DTSA 2XD1A 5GLCA 2C6WB 3QNBA 4KZ8A 5HARA 3ZG5A 4YFMA 3M2KA 2Y59A 3OPHA 4Y0TA 1YLZA 2EX6A 3HLBA 1ZG6A 4OP5A 1ERQA 4RVAA 5CERA 4IVIA 4L0LA 1JVJA 4ZJ3A 2Y2LA 4OPZA 4FH4A 4OQIA 3VSLA 2R9WA 1ERMA 3E2LA 4ZJ2A 4D2OA 1ALQA 1BTLA 2HDUA 1KGEA 3HREA 4N92A 4B4ZA 4R4RA 3G34A 3O86A 4OPQA 1E3UD 1XP4A 1W7FA 3IF6A 4OQGA 2P9VB 1LL9A 1RGYA 3NIAA 5KZHA 1XKZA 4JBFA 3MXRA 1BLPA 4P87A 1XA7A 5AQAA 2V20A 4H8RA 4ID4A 1K6RA 1MWTA 1KVLA 3IHAA 3BLSA 5GLAA 3NC8A 2Y2QA 2A49A 1G68A 1W8QA 4OLGA 1DJBA 4X56A 1CI8A 5CRFA 3UN7A 4KZ5A 3SS5A 1L0EA 1K38A 1XGIA 3DW0A 4K0WA 3ZNYA 3UDFA 3S1YA 3JYIA 3HLFA 4K91A 2XDMA 4KG5A 3UNWA 3TSGA 4F94A 4QJGA 3FZCA 2Y91A 2Y2JA 3ZVWA 2Y2KA 3G32A 1NJ4A 4LV3A 1VQQA 1HD8A 1TDLA 4DF6A 4PMAA 3LY3A 2X71A 5CGXA 3Q81A 5EPHA 1XA1A 2JCHA 1YMSA 2ZM8A 3A3EA 2B5RA 4QD4A 2WADA 5FATA 5M19A 3GSGA 1FCOA 1M6KA 5CHMA 1S6RA 3GTCA 4FH2A 1KE3A 3EQVA 1RCJA 2WGVA 4CJNA 3IF6C 4PM7A 5HW3A 5AQ9A 1FCMA 3VOZA 5E2EA 5A90A 1I5QA 3Q1FA 4WMCD 4HEFA 5EVID 3CZDA 2H10A 5EVIB 4Q8IA 5F1FA 1NZUA 4WZ5C 3CMZA 4BL3A 1XGJA 1K56A 5E2GA 4GNUA 4XUZA 3M6BA 5HAQA 3SH7A 2HDSA 4EV4A 5DF7A 3WWXA 5FQKA 2ZQ8A 5EVLA 4BQMA 2E8IA 4JXSA 4UA9A 4KENB 1RP5A 1PYYA 5JYPA 5A91A 1CK3A 5FQMA 4EBPA 3BFCA 3IXGA 2BLSA 3Q07A 4K0XA 3WS5A 4LENA 5E43A 4S2LA 1IYPA 1KDWA 1ES2A 2XH9A 2Y2HA 3E2KA 1SCWA 3PAEA 1YLJA 1I2WA 3LCEA 4WMCA 1Z6FA 5TR7A 5HFOA 4CPKA 3NCKA 3B3XA 3VFHA 4Y0UA 1IYQA 1BLHA 3V50A 2XGNA 4DXBA 1IKIA 2ZLYA 2ZM0A 5HAPA 5CHJA 4WELA 4DE3A 2OLVA 5JYOA 1YM1A 1N9BA 4WZ5A 2X01A 1CI9A 1NY0A 4C75A 2H0YA 4S2NC 5D3OA 2CC1A 2RCXA 1MBLA 2XLNA 2JBFA 4R3BA 3HLGA 2ZC3B 2FFYA 1O07A 4S2MA 4KZ6A 4OLDA 2HP5A 4KZBA 5A92A 3IWIA 3IXDA 2WAFA 3UO9A 3QNCA 4U0XA 4IBRA 3PBNA 5CTMA 2ZC6B 1ES5A 1QMFA 3W4PA 3MXSA 1XX2A 2H5SA 1TEMA 1BSGA 2G2UA 1NZOA 2WZXA 3LEZA 3LO7A 4JXWA 4LV2A 4N1HA 4OOYA 5FSRA 5M1AA 3BYDA 4DDYA 4R0QA 5J8XA 1TDGA 4E3LA 1LI9A 4KG2A 3BECA 1O7EA 3S4XA 1K55A 1ES3A 1JTDA 5CXWA 3MZEA 3BFEA 4ZAMA 1YLTA 2HDQA 3VP0A 3HLCA 1YLPA 3IWQA 4P85A 2EXBA 4WBGA 5FI7A 3SH9A 4B88A 2XEPA 5EUAA 4DXCA 3VP3A 4QHCA 2WKEA 1IYSA 4E6WA 4WZ4A 4GDNA 3N7WA 1U60A 3MKEA 1WE4A 4UAAA 5CEDA 2WKIA 3IF5A 5DTKA 2ZC5B 2IWCA 1PWGA 3ZFZA 1BLSA 1ZKJA 2ZQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HL1 A;  1IKG A;  2WGI A;  1ESU A;  3RXW A;  2EX2 A;  1N4O A;  2XF3 A;  4S2N A;  5HX9 A;  4DRT A;  4HES A;  2Y2N A;  4OON A;  5FAQ A;  4E3K A;  3A3J A;  3HLD A;  5BOH A;  1K54 C;  1Y54 A;  2Y4A A;  3N8S A;  4OP8 A;  2EX9 A;  2EFX A;  3A3I A;  3S22 A;  3CG5 A;  3QHY A;  4E3M A;  4NK3 A;  5KMW A;  1EI5 A;  4OH0 A;  4OOM A;  3AGE A;  4U0T A;  3OC2 A;  4KZ9 A;  4P6B A;  3G30 A;  3G31 A;  3NDE A;  3RXX A;  3SOI A;  3SS3 A;  1WYC A;  1BUE A;  1L2S A;  1BT5 A;  5FQI A;  2PU4 A;  3ZG9 B;  4MBK A;  2H0T A;  1BUL A;  3UDX A;  4ZTK A;  1KGG A;  1J9M A;  2P9V A;  1PWD A;  3M6H A;  4GZB A;  2J9O A;  4PM8 A;  5TFQ A;  1XPB A;  4BJP A;  1HZO A;  3PBS A;  2EXA A;  4OKP A;  3C7U A;  1YLY A;  4WYY A;  4DDS A;  5IHV A;  4ZDX A;  1PWC A;  1BLC A;  3OPP A;  4Y0O A;  4BD0 A;  4S2J A;  1GA0 A;  5KSH A;  3GMW A;  2JC7 A;  4GD6 A;  5EVI C;  4OPR A;  3MFD A;  1SKF A;  3BRM A;  3G2Y A;  3N6I A;  4PPR A;  1GHI A;  3WRT A;  2Z2L B;  3GV9 A;  2XR0 A;  3IF6 B;  2A3U A;  1K54 A;  2Z2M B;  2UWX A;  2IWD A;  2X02 A;  1MWS A;  3GRJ A;  1K25 A;  1SDN A;  4E6X A;  1CEF A;  1FSY A;  3PBT A;  3DTM A;  5CGW A;  1NRF A;  3RJU A;  1LLB A;  2WK0 A;  1LL5 A;  3UE3 A;  3BLM A;  4UA6 A;  5GHX A;  1XXM A;  2WUQ A;  4EBN A;  2Y2M A;  3GR2 A;  4OOL A;  4PM9 A;  1I2S A;  3AGF A;  5DTT A;  2DRW A;  1LHY A;  3A3F A;  4UHU A;  4KZ3 A;  2WZZ A;  3PBO A;  3VOY A;  2WGW A;  3MZF A;  2ZQC A;  3HLW A;  3HBR A;  4DE1 A;  4BEN A;  3ZG8 B;  2XFS A;  3ITB A;  3OCL A;  4LV0 A;  4C3Q A;  1PW1 A;  4EUZ A;  3O87 A;  1RGZ A;  5FAO A;  1FSW A;  4JKT A;  4LV1 A;  1EWZ A;  4RYE A;  4O7D A;  4EQI A;  1ESI A;  3FV7 A;  4U3T A;  4X69 A;  5KSC A;  2PU2 A;  1ZC2 A;  2JE5 A;  3O88 A;  3MBZ A;  3Q82 A;  1DY6 A;  5EVI A;  3TG9 A;  3V3S A;  4GB7 A;  3C5A A;  2ZQ7 A;  5FI6 A;  2HP6 A;  1BZA A;  5F82 A;  3W8K A;  1K6S A;  1TVF A;  4R4S A;  4OQ0 A;  2ZQA A;  4ZBE A;  4R23 A;  1YLW A;  2VGK A;  4KZ4 A;  1S0W A;  1MKI A;  2Y2P A;  5CGS A;  1LI0 A;  1MWR A;  1E3U A;  4NET A;  2J8Y A;  1GHP A;  1M40 A;  3EQU A;  3GVB A;  2HDR A;  3V3R A;  5CEC A;  1Q2Q A;  4X55 A;  1FCN A;  4JPM A;  3SS4 A;  4FSF A;  1KE4 A;  2XFT A;  3UPO A;  2DNS A;  1K57 A;  2V1Z A;  3MKF A;  1ZG4 A;  4P0M A;  2DCF A;  5I94 A;  4MNR A;  5DF8 A;  4N9K A;  3IT9 A;  3IXB A;  1YQS A;  3ZG7 B;  3HL9 A;  4XUX A;  3ZG0 A;  1PW8 A;  1PIO A;  3Q7Z A;  2V2F F;  3D4F A;  5TGF A;  2ZC7 A;  3Q7V B;  3CJM A;  4GKU A;  3DWK A;  1IEM A;  1SHV A;  4KZA A;  4EBL A;  4PM5 A;  3UDI A;  1K55 C;  5FA7 A;  2EX8 A;  4X53 A;  4DE0 A;  1JWP A;  3HUO A;  4OVD A;  1MXO A;  3OCN A;  4QU3 A;  3FKV A;  3N8R A;  3FYZ A;  1CEG A;  3ZGA B;  2OLU A;  3ZCZ A;  4KG6 A;  3BFF A;  3OPL A;  5FI2 A;  4QB8 A;  3ZHH A;  4BL2 A;  4LCL A;  5FDH A;  2HPB A;  3PTE A;  3Q7V A;  4GOG A;  1H8Y A;  3NY4 A;  3C4O A;  5GHZ A;  5CTN A;  1E4D A;  1WYB A;  5EOO A;  5M18 A;  3WS1 A;  1C3B A;  1IYO A;  2ZMA A;  3VP4 A;  3IH8 A;  3LY4 A;  3NDG A;  3NI9 A;  4ZJ1 A;  1DJA A;  4OPY A;  3SH8 A;  5GL9 A;  3G35 A;  3VMA A;  1NYY A;  3ZVT A;  2HP9 A;  3C7V A;  3OZH A;  3C4P A;  1Q2P A;  1YT4 A;  3HUM A;  5AQB A;  4JXV A;  4MLL A;  1E25 A;  4RX3 A;  5F1G A;  4R3J A;  5G18 A;  3IH9 A;  3G2Z A;  4RX2 A;  4UA7 A;  4LCM A;  3IWO A;  1H8Z A;  3HLE A;  3ISG A;  1ONH A;  1W8Y A;  4OQH A;  3WS2 A;  3WS4 A;  3IXH A;  2GDN A;  3ZNT A;  4WEK A;  4N1X A;  4DKI A;  2QPN A;  2ZD8 A;  2ZJ9 A;  3FKW A;  1JTG A;  4GDB A;  2QMI A;  5EEC A;  4E3N A;  1MPL A;  3M2J A;  5DF9 A;  4RA7 A;  3N4I A;  3DWZ A;  4S2K A;  4S2I A;  4Z9Q A;  5FAP A;  2VGJ A;  2WGW B;  5F83 A;  4JF4 A;  4E3O A;  5FQJ A;  4KQO A;  1GHM A;  2QZ6 A;  2Y2O A;  4GN2 A;  4MBH A;  4PM6 A;  5E2F A;  5EE8 A;  2Q9N A;  4JXG A;  3UE1 A;  3ITA A;  4KQR A;  2PBY A;  4B4X A;  1AXB A;  2G2W A;  1MWU A;  1W79 A;  3VFF A;  2ZC4 B;  2Y2I A;  3VP2 A;  1GCE A;  2BG1 A;  4DE2 A;  1HVB A;  4S2P A;  1MY8 A;  4QY6 A;  1KGF A;  1PI4 A;  4FCF A;  5HAI A;  2ZQD A;  3G4P A;  1OME A;  5GHY A;  3BFG A;  1ERO A;  4Y7P A;  5L2F A;  2WAE A;  3W4Q A;  2XD5 A;  1L0D A;  4XXR A;  3O3V A;  4S2O A;  4FD8 A;  2RL3 A;  5GLB A;  4X6T A;  5U47 A;  2XK1 A;  3BM6 A;  1JWV A;  2J9P A;  2P74 A;  4EWF A;  2WKH A;  4HBU A;  1DJC A;  1PZO A;  4IVK A;  3V39 A;  5AQ7 A;  3PAG A;  4YIN A;  1NXY A;  3P98 A;  2Q9M A;  3W4O A;  5E2H A;  4MBF A;  3VSK A;  2Y55 A;  2FFF B;  3MZD A;  5FQ9 A;  2C5W B;  2OSU A;  3IQA A;  3NBL A;  2J7V A;  5GLD A;  2IWB A;  4N9L A;  5FAS A;  4X68 A;  1H5X A;  4QY5 A;  3VP1 A;  1JWZ A;  1SDE A;  1QME A;  1FQG A;  4GD8 A;  4JF5 A;  3BEB A;  1W5D A;  3HUN A;  4BLM A;  1PI5 A;  3PBQ A;  1IEL A;  1KVM A;  1L0G A;  5A93 A;  3IHB A;  4R1G A;  1KDS A;  3GQZ A;  4C6Y A;  5FQQ A;  3WRZ A;  4E3J A;  1L0F A;  5EOE A;  4WM9 A;  3UPN A;  3BFD A;  4WEJ A;  3HVF A;  1G6A A;  2Y2G A;  3N8L A;  5DVA A;  5CEB A;  2ZM2 A;  1FR1 A;  4BD1 A;  3P09 A;  2XQZ A;  5CHU A;  3UE0 A;  3FWL A;  1FR6 A;  3I7J A;  2I72 A;  4KQQ A;  1GA9 A;  1HTZ A;  1K57 C;  1KE0 A;  1K4F A;  1PZP A;  4JF6 A;  3TOI A;  2WYX A;  3UY6 A;  2OV5 A;  3WS0 A;  3OPR A;  4IBX A;  4A5R A;  1K56 D;  3V5M A;  3AGD A;  1FOF A;  4KZ7 A;  3ZDJ A;  4MEZ A;  1ES4 A;  4E3I A;  4M3K A;  3A3D A;  2R9X A;  3UPP A;  3PBR A;  1NYM A;  4HBT A;  1K4E A;  1ONG A;  4JLF A;  1YMX A;  2EFU A;  1VM1 A;  4IED A;  5DTS A;  2XD1 A;  5GLC A;  2C6W B;  3QNB A;  4KZ8 A;  5HAR A;  3ZG5 A;  4YFM A;  3M2K A;  2Y59 A;  3OPH A;  4Y0T A;  1YLZ A;  2EX6 A;  3HLB A;  1ZG6 A;  4OP5 A;  1ERQ A;  4RVA A;  5CER A;  4IVI A;  4L0L A;  1JVJ A;  4ZJ3 A;  2Y2L A;  4OPZ A;  4FH4 A;  4OQI A;  3VSL A;  2R9W A;  1ERM A;  3E2L A;  4ZJ2 A;  4D2O A;  1ALQ A;  1BTL A;  2HDU A;  1KGE A;  3HRE A;  4N92 A;  4B4Z A;  4R4R A;  3G34 A;  3O86 A;  4OPQ A;  1E3U D;  1XP4 A;  1W7F A;  3IF6 A;  4OQG A;  2P9V B;  1LL9 A;  1RGY A;  3NIA A;  5KZH A;  1XKZ A;  4JBF A;  3MXR A;  1BLP A;  4P87 A;  1XA7 A;  5AQA A;  2V20 A;  4H8R A;  4ID4 A;  1K6R A;  1MWT A;  1KVL A;  3IHA A;  3BLS A;  5GLA A;  3NC8 A;  2Y2Q A;  2A49 A;  1G68 A;  1W8Q A;  4OLG A;  1DJB A;  4X56 A;  1CI8 A;  5CRF A;  3UN7 A;  4KZ5 A;  3SS5 A;  1L0E A;  1K38 A;  1XGI A;  3DW0 A;  4K0W A;  3ZNY A;  3UDF A;  3S1Y A;  3JYI A;  3HLF A;  4K91 A;  2XDM A;  4KG5 A;  3UNW A;  3TSG A;  4F94 A;  4QJG A;  3FZC A;  2Y91 A;  2Y2J A;  3ZVW A;  2Y2K A;  3G32 A;  1NJ4 A;  4LV3 A;  1VQQ A;  1HD8 A;  1TDL A;  4DF6 A;  4PMA A;  3LY3 A;  2X71 A;  5CGX A;  3Q81 A;  5EPH A;  1XA1 A;  2JCH A;  1YMS A;  2ZM8 A;  3A3E A;  2B5R A;  4QD4 A;  2WAD A;  5FAT A;  5M19 A;  3GSG A;  1FCO A;  1M6K A;  5CHM A;  1S6R A;  3GTC A;  4FH2 A;  1KE3 A;  3EQV A;  1RCJ A;  2WGV A;  4CJN A;  3IF6 C;  4PM7 A;  5HW3 A;  5AQ9 A;  1FCM A;  3VOZ A;  5E2E A;  5A90 A;  1I5Q A;  3Q1F A;  4WMC D;  4HEF A;  5EVI D;  3CZD A;  2H10 A;  5EVI B;  4Q8I A;  5F1F A;  1NZU A;  4WZ5 C;  3CMZ A;  4BL3 A;  1XGJ A;  1K56 A;  5E2G A;  4GNU A;  4XUZ A;  3M6B A;  5HAQ A;  3SH7 A;  2HDS A;  4EV4 A;  5DF7 A;  3WWX A;  5FQK A;  2ZQ8 A;  5EVL A;  4BQM A;  2E8I A;  4JXS A;  4UA9 A;  4KEN B;  1RP5 A;  1PYY A;  5JYP A;  5A91 A;  1CK3 A;  5FQM A;  4EBP A;  3BFC A;  3IXG A;  2BLS A;  3Q07 A;  4K0X A;  3WS5 A;  4LEN A;  5E43 A;  4S2L A;  1IYP A;  1KDW A;  1ES2 A;  2XH9 A;  2Y2H A;  3E2K A;  1SCW A;  3PAE A;  1YLJ A;  1I2W A;  3LCE A;  4WMC A;  1Z6F A;  5TR7 A;  5HFO A;  4CPK A;  3NCK A;  3B3X A;  3VFH A;  4Y0U A;  1IYQ A;  1BLH A;  3V50 A;  2XGN A;  4DXB A;  1IKI A;  2ZLY A;  2ZM0 A;  5HAP A;  5CHJ A;  4WEL A;  4DE3 A;  2OLV A;  5JYO A;  1YM1 A;  1N9B A;  4WZ5 A;  2X01 A;  1CI9 A;  1NY0 A;  4C75 A;  2H0Y A;  4S2N C;  5D3O A;  2CC1 A;  2RCX A;  1MBL A;  2XLN A;  2JBF A;  4R3B A;  3HLG A;  2ZC3 B;  2FFY A;  1O07 A;  4S2M A;  4KZ6 A;  4OLD A;  2HP5 A;  4KZB A;  5A92 A;  3IWI A;  3IXD A;  2WAF A;  3UO9 A;  3QNC A;  4U0X A;  4IBR A;  3PBN A;  5CTM A;  2ZC6 B;  1ES5 A;  1QMF A;  3W4P A;  3MXS A;  1XX2 A;  2H5S A;  1TEM A;  1BSG A;  2G2U A;  1NZO A;  2WZX A;  3LEZ A;  3LO7 A;  4JXW A;  4LV2 A;  4N1H A;  4OOY A;  5FSR A;  5M1A A;  3BYD A;  4DDY A;  4R0Q A;  5J8X A;  1TDG A;  4E3L A;  1LI9 A;  4KG2 A;  3BEC A;  1O7E A;  3S4X A;  1K55 A;  1ES3 A;  1JTD A;  5CXW A;  3MZE A;  3BFE A;  4ZAM A;  1YLT A;  2HDQ A;  3VP0 A;  3HLC A;  1YLP A;  3IWQ A;  4P85 A;  2EXB A;  4WBG A;  5FI7 A;  3SH9 A;  4B88 A;  2XEP A;  5EUA A;  4DXC A;  3VP3 A;  4QHC A;  2WKE A;  1IYS A;  4E6W A;  4WZ4 A;  4GDN A;  3N7W A;  1U60 A;  3MKE A;  1WE4 A;  4UAA A;  5CED A;  2WKI A;  3IF5 A;  5DTK A;  2ZC5 B;  2IWC A;  1PWG A;  3ZFZ A;  1BLS A;  1ZKJ A;  2ZQ9 A; 
#chains in the Genus database with same CATH topology
 5HL1 A;  1D1J A;  2EA9 A;  3DAV A;  4Y13 A;  3ICY A;  3K2N A;  4GLQ A;  2EX2 A;  2FZ0 A;  2XF3 A;  4ARZ A;  4DRT A;  4HES A;  3LIE A;  2EFX A;  5HSQ A;  3DTI A;  4FUW A;  3QHY A;  4E3M A;  5KMW A;  3G31 A;  3RXX A;  3SOI A;  3SS3 A;  3HCY A;  5FQI A;  2PU4 A;  3ZG9 B;  1VEU B;  3LIA A;  4ZTK A;  5EM1 A;  3C8C A;  1HZO A;  1PWC A;  1BLC A;  4Y0O A;  5HPI A;  4HOI A;  3E0Y A;  1VET B;  2Y8H A;  4OPR A;  3BRM A;  3N6I A;  2JKF A;  4KUK A;  2UWX A;  2IWD A;  2V8C A;  4I3J A;  1K25 A;  1CEF A;  3RJU A;  1LLB A;  2W1R A;  3UE3 A;  3CLO A;  4I3A A;  2WUQ A;  3GR2 A;  4IUK A;  3P7N A;  3A3F A;  2BAS A;  3ZG8 B;  3ITB A;  1TS7 A;  4P6Z S;  5TJJ A;  1SKO B;  1FSW A;  4LV1 A;  3T12 B;  1ESI A;  1JNU A;  5HDD A;  2JE5 A;  1DY6 A;  4GB7 A;  5FI6 A;  5F82 A;  1BZA A;  3MQQ A;  2ZQA A;  4ZBE A;  4R23 A;  4KZ4 A;  3UMD A;  3K3C A;  2J8Y A;  1GHP A;  2K31 A;  3GVB A;  3JPU A;  1Q2Q A;  1FCN A;  3JVU A;  5HWV A;  2V1Z A;  2DCF A;  3B33 A;  4YNR A;  4N9K A;  1YQS A;  3HL9 A;  2V2F F;  3D4F A;  4CLC E;  4M4X A;  4KZA A;  2VEA A;  1K55 C;  1JWP A;  4WLA A;  1FIL A;  3IX4 A;  1N9N A;  3ZHH A;  5FDH A;  1UWN X;  3LIF A;  1E4D A;  4MDZ A;  4DJ3 A;  2G7U A;  4HY8 A;  3NDG A;  4D60 A;  4ZJ1 A;  5GL9 A;  3G35 A;  3VMA A;  2BTF P;  1NYY A;  3C4P A;  1Q2P A;  4KQD A;  2P04 A;  4JXV A;  2A24 A;  4RX3 A;  3IBR A;  5G18 A;  2QYB A;  4LCM A;  1ONH A;  1G28 A;  1CQA A;  1IOU A;  5EV0 A;  4B9O A;  2ZD8 A;  2ZJ9 A;  5IT5 A;  4RA7 A;  4S2K A;  3F1N B;  2V0W A;  5F83 A;  1GHM A;  2QZ6 A;  4GN2 A;  2Q9N A;  4JXG A;  3UE1 A;  4KQR A;  2PBY A;  4Z1W A;  2G2W A;  1H0M A;  4UQI M;  2OAP 1;  3VP2 A;  1HVB A;  1MY8 A;  1KGF A;  2J3W A;  5HAI A;  3G4P A;  1GSV A;  2PRF A;  5L10 A;  3W4Q A;  5DJU A;  2E8J A;  5GLB A;  2RL3 A;  4X6T A;  3BM6 A;  1SZV A;  1DJC A;  4IVK A;  3P98 A;  3H82 A;  4MBF A;  5CX7 A;  1PRQ A;  3MZD A;  1F98 A;  3BW6 A;  5FQ9 A;  3T4K A;  2OSU A;  3IQA A;  2J7V A;  2IWB A;  4N9L A;  3HJI A;  4YWZ A;  4BLM A;  1IEL A;  3IHB A;  4C6Y A;  3GQZ A;  5FQQ A;  4E3J A;  1L0F A;  4HNB A;  3BFD A;  1G6A A;  3P09 A;  2I72 A;  1GA9 A;  1LSX A;  3MR0 A;  1HTZ A;  3O5Y A;  3PYP A;  2WYX A;  3VE3 A;  2O9A A;  4IBX A;  1K56 D;  3AGD A;  4G3W A;  4E3I A;  4R38 A;  1S1Z A;  1K4E A;  1H8M A;  1ONG A;  3VOL A;  1YMX A;  2Q0O A;  4IED A;  1DP8 A;  3QNB A;  3ZG5 A;  4YFM A;  3M2K A;  3OPH A;  1ZG6 A;  4RVA A;  1ERM A;  2KLI A;  3EGX C;  4R4R A;  3G34 A;  3O86 A;  3BWL A;  1E3U D;  3IF6 A;  4EXO A;  5KZH A;  3MXR A;  2V20 A;  4NXG A;  1K6R A;  4X1M A;  5GLA A;  3NC8 A;  1W8Q A;  3PHY A;  1PFL A;  2JKT I;  3MQ0 A;  4HJ6 A;  3SS5 A;  3T1X A;  3T4Q A;  3KSG A;  4MN6 A;  3UDF A;  3FPW A;  1YSP A;  4Q0J A;  3S1Y A;  2XDM A;  4QJG A;  2Y2J A;  4GCZ A;  1NJ4 A;  4LV3 A;  1VQQ A;  1HD8 A;  1TDL A;  3H82 B;  3LY3 A;  2W0N A;  4LPZ A;  3Q81 A;  3OOV A;  3A3E A;  5FAT A;  3E4O A;  1LSV A;  3EQV A;  4CJN A;  5HW3 A;  4LRY C;  2M7U A;  3Q1F A;  4WMC D;  5HDS A;  2WKP A;  5F1F A;  1NZU A;  4WZ5 C;  1XGJ A;  3MF0 A;  5FQK A;  5EVL A;  4BQM A;  4JXS A;  1XJ3 A;  4KEN B;  3IS2 A;  3BFC A;  3IXG A;  1KDW A;  4LFU A;  2XH9 A;  2Y2H A;  3E2K A;  1YLJ A;  2WKQ A;  3LCE A;  2HF6 A;  2VK3 A;  3NCK A;  3B3X A;  5FDS A;  4DN0 A;  3V50 A;  1BLH A;  5IU1 A;  2XGN A;  5JYO A;  5HD5 A;  1N9B A;  4WZ5 A;  3S7N A;  5J7E A;  1CI9 A;  4LRZ E;  2H0Y A;  4S2N C;  2XLN A;  2RCX A;  4R3B A;  1ODV A;  2PHY A;  2HP5 A;  5HZH A;  3BQA A;  2OAQ 1;  1VEU A;  3ZQ5 A;  1QMF A;  3W2Z A;  3W4P A;  3MXS A;  3LEZ A;  1BSG A;  4N1H A;  1MC0 A;  3IBJ A;  2K7S A;  3BEC A;  3H9W A;  1K55 A;  5DKL A;  3BFE A;  2JHE A;  2VA0 A;  4WBG A;  5EUA A;  4QHC A;  2WKE A;  4RQ9 A;  5L09 A;  1U60 A;  1WE4 A;  5DTK A;  2Z6C A;  4OQI A;  2O99 A;  3RXW A;  1N4O A;  2W1T A;  3ULF A;  2Y2N A;  4MMN A;  1K54 C;  1Y54 A;  3N8S A;  1T1B A;  1YAX A;  4NK3 A;  1EI5 A;  4HH3 A;  4OH0 A;  3AGE A;  4U0T A;  4P6B A;  3ZG7 B;  1FIK A;  3NDE A;  1WYC A;  5F69 A;  1L2S A;  4ETZ A;  1BT5 A;  3R7W A;  1OPX A;  1SKO A;  4GHI A;  4PM8 A;  1XPB A;  5DJT A;  4DDS A;  5IHV A;  4QPR A;  4JGR A;  1GA0 A;  5KSH A;  5EVI C;  3MFD A;  1SKF A;  3GDI A;  3WRT A;  2Z2L B;  2XR0 A;  2PYP A;  1K54 A;  2Z2M B;  2X02 A;  1MWS A;  1FSY A;  3PBT A;  3BQ8 A;  2WK0 A;  2B02 A;  1XXM A;  4OOL A;  1I2S A;  5DTT A;  4O8G A;  5DFX A;  4KZ3 A;  2WZZ A;  3PBO A;  3HLW A;  3CUE A;  1RGZ A;  5FAO A;  4RYE A;  2JKR M;  4EQI A;  4U3T A;  1ZC2 A;  3O88 A;  3TG9 A;  5EVI A;  3C5A A;  1K6S A;  4I38 A;  3U4L P;  2L4R A;  2PBD P;  1MKI A;  2D02 A;  5CGS A;  1MWR A;  3EQU A;  4WL9 A;  3V3R A;  4ETX A;  4B93 A;  4FSF A;  4I3I A;  5HWW A;  1KE4 A;  2XFT A;  3S7O A;  4IJG A;  1ZG4 A;  5DF8 A;  3IXB A;  3ZG0 A;  1PW8 A;  2A24 B;  4Y3I A;  3Q7Z A;  2OOL A;  3Q7V B;  3IX3 A;  3EEH A;  4PM5 A;  5FA7 A;  1G6O A;  2EX8 A;  4X53 A;  4OVD A;  1MXO A;  3OCN A;  3F1O A;  2VGL S;  3OLO A;  1CEG A;  2OLU A;  3BFF A;  3OPL A;  3E98 A;  4QB8 A;  3QP6 A;  5LBR A;  3PTE A;  3Q7V A;  1A0K A;  3C4O A;  2YKH A;  4MN7 A;  4R6L A;  3WS1 A;  1IYO A;  2ZMA A;  4ARZ B;  3IH8 A;  1DJA A;  3T1R A;  3SH8 A;  3C7V A;  1GSX A;  3HUM A;  4AFI A;  4R3J A;  3IH9 A;  4K08 A;  3ISG A;  4ESP A;  1W8Y A;  4OQH A;  3WS2 A;  3IXH A;  2GDN A;  3ZNT A;  4WEK A;  4DKI A;  4BWI A;  4E3N A;  1JTG A;  1MPL A;  5DF9 A;  1P97 A;  3CPT A;  4S2I A;  2QJ7 A;  3FC7 A;  3SW1 A;  2Y2O A;  5EE8 A;  4A5R A;  5IS1 A;  3T4S A;  1MWU A;  3LI9 A;  1W79 A;  3VFF A;  2Y2I A;  1GCE A;  2BG1 A;  1PI4 A;  2ZQD A;  3TW8 A;  5L2F A;  3E4P A;  2XD5 A;  1L0D A;  3O3V A;  4S2O A;  1JWV A;  4G3V A;  2WKH A;  4HBU A;  1PZO A;  3PAG A;  3F1O B;  3C30 A;  1TS8 A;  3T4T A;  4Y15 A;  2Q9M A;  2W3H A;  4IUH A;  2Y55 A;  4CLC C;  4PAU A;  3NBL A;  5GLD A;  1CF0 A;  3DBA A;  3NUL A;  3VP1 A;  1QME A;  2PR5 A;  3BEB A;  1PI5 A;  3PBQ A;  3MMH A;  5I5L A;  3R4K A;  3KYE A;  1S4S A;  4R1G A;  5L07 A;  3WRZ A;  3UPN A;  4WM9 A;  3HVF A;  3N8L A;  2Y2G A;  5CEB A;  3UE6 A;  3H7W B;  2XQZ A;  5CHU A;  3I7J A;  1AWI A;  1K57 C;  5AVE A;  3UY6 A;  3OPR A;  3V5M A;  4JGO A;  4JGP A;  1FOF A;  2QKP A;  4KZ7 A;  4LGW A;  1V9Z A;  1ES4 A;  4M3K A;  4WF0 A;  1N9L A;  4HBT A;  4JLF A;  2EFU A;  2HGV A;  2O0Y A;  4Y0T A;  2ZOI A;  2EX6 A;  3CI6 A;  5TBM B;  2J3T D;  3UB7 A;  5KIZ A;  4L0L A;  1ACF A;  1T19 A;  4EET B;  3VSL A;  4N92 A;  4B4Z A;  5G4Z A;  3RFB A;  3MFX A;  2P9V B;  1LL9 A;  1RGY A;  3NIA A;  2PAV P;  2Y2Q A;  2ZOH A;  3T1S A;  1K38 A;  3DW0 A;  3QP8 A;  3ZNY A;  3MS6 A;  3JYI A;  3HLF A;  4KG5 A;  3ZVW A;  2Y2K A;  2QJ5 A;  1LSW A;  4LLO B;  4HHD A;  3T50 A;  5EPH A;  4NKP A;  2JCH A;  1YMS A;  5M19 A;  4O0P A;  1S6R A;  2JKT M;  2W3G A;  2WGV A;  4UQI S;  4PM7 A;  5A90 A;  2LB9 A;  2H10 A;  3DTE A;  3LEQ A;  5E2G A;  1TS0 A;  2ZQ8 A;  4UA9 A;  3RH8 B;  5JYP A;  5A91 A;  1EW0 A;  4S2L A;  1XJ2 A;  2XRO A;  1I2W A;  1Z6F A;  4O01 A;  1P9W A;  3VFH A;  4EU0 A;  1VHM A;  4Y0U A;  1IYQ A;  2P7J A;  1IKI A;  5HAP A;  2OLV A;  1YM1 A;  5EFW A;  1NY0 A;  2CC1 A;  4P6Z M;  2FFY A;  5F6A A;  4F3L B;  1O07 A;  4HIA A;  2P08 A;  1MKM A;  4L9G A;  5HDC A;  3UB5 P;  3PBN A;  5CTM A;  2ZC6 B;  4YOF A;  3LO7 A;  2G2U A;  3VE4 A;  3T1Q B;  3ZYT A;  5J8X A;  4R0Q A;  2R78 A;  1TDG A;  4HJ4 A;  4E3L A;  3S4X A;  1O7E A;  5CXW A;  1T18 A;  2HDQ A;  3VP0 A;  3HLC A;  1YLP A;  3SH9 A;  3TRC A;  4DXC A;  1IYS A;  4GDN A;  1OJ5 A;  3B42 A;  2WKI A;  3IF5 A;  3NHQ A;  1ZKJ A;  1G5U A;  1IKG A;  2WGI A;  4EES A;  4S2N A;  4Q0I A;  3NJA A;  5FAQ A;  3EWK A;  2Y4A A;  1NLZ A;  4QWO A;  4OP8 A;  4DJ2 A;  3F1P B;  3QP2 A;  5AVF A;  4OOM A;  3OC2 A;  2B95 A;  3G30 A;  4NEE D;  3FG8 A;  4MBK A;  1ZTU A;  2Z6D A;  3UDX A;  2P9V A;  3M6H A;  1PWD A;  4GZB A;  5TFQ A;  2J9O A;  4BJP A;  1TF1 A;  2EXA A;  4OKP A;  4ZDX A;  4BD0 A;  1VET A;  4S2J A;  1LL8 A;  3LIB A;  1TS6 A;  2JC7 A;  4GD6 A;  4PPR A;  3G2Y A;  3GV9 A;  1LT0 A;  3IF6 B;  4PHT A;  3PXP A;  5CGW A;  1NRF A;  2AVX A;  4GS9 B;  1LL5 A;  4EBN A;  4CQH A;  5AJG A;  3VOY A;  2ZQC A;  4DE1 A;  2XFS A;  3OCL A;  5DFY A;  4C3Q A;  1PW1 A;  4EUZ A;  3EEA A;  1K0K A;  4JKT A;  1EWZ A;  1UGU A;  4CLC A;  4O7D A;  3FV7 A;  2OWH A;  5KSC A;  1S66 L;  3MBZ A;  3Q82 A;  2J3T C;  2HP6 A;  1TVF A;  3KYQ A;  4OQ0 A;  4EW7 A;  1YLW A;  1S0W A;  4NXE A;  2Y2P A;  1E3U A;  1M40 A;  2XSS A;  5CEC A;  4X55 A;  4JPM A;  1T1C A;  3KO6 A;  2DNS A;  1K57 A;  3MKF A;  3QP1 A;  2OWJ A;  4GS9 A;  2PD7 A;  1PIO A;  5TGF A;  2ZC7 A;  3CJM A;  1ZHH B;  3UDI A;  3NOT C;  4DE0 A;  3T4O A;  1OTD A;  3LID A;  2VV6 A;  3MJQ A;  3ZGA B;  1OTB A;  4KG6 A;  2PD8 A;  4BL2 A;  2KOI A;  4LCL A;  2HPB A;  3CUE C;  5GHZ A;  5HWT A;  5CTN A;  5M18 A;  1NRJ A;  3LI8 A;  5J3W A;  3VP4 A;  3LY4 A;  2NUT C;  1Y4O A;  3ZVT A;  2HP9 A;  3F1P A;  5AQB A;  4MLL A;  4MCW A;  5HL6 A;  1E25 A;  3R7W B;  3G2Z A;  2ZL1 A;  4UA7 A;  1OT9 A;  1S67 L;  3HLE A;  3L7H A;  4N1X A;  1D7E A;  2J80 A;  3FKW A;  3LR4 A;  3M2J A;  3N4I A;  3CPT B;  1W63 Q;  2VGJ A;  2WGW B;  2W1T B;  1KOU A;  3E4Q A;  4JF4 A;  4KQO A;  4PM6 A;  3ITA A;  4BBU A;  4E04 A;  4QY6 A;  4Q0H A;  3LYX A;  1OME A;  1OT6 A;  5GHY A;  1ERO A;  2WAE A;  4XXR A;  4X1L A;  4FD8 A;  2XK1 A;  2P74 A;  4EWF A;  1S1Y A;  1W63 M;  4UEY A;  1NXY A;  3NEC A;  1F2K A;  3W4O A;  2QWS A;  1T1A A;  4F3L A;  2FFF B;  3NOP C;  2C5W B;  2B18 A;  3CWF A;  4X68 A;  1H5X A;  3IX8 A;  4QY5 A;  1JWZ A;  1SDE A;  4GD8 A;  1FQG A;  4JF5 A;  4PKY A;  2W3D A;  1W5D A;  2JN7 A;  2ZBB A;  1KVM A;  5A93 A;  1KDS A;  4EEU A;  5EOE A;  3G6O A;  3BY9 A;  4WEJ A;  1CJF A;  5DVA A;  2ZM2 A;  1FR1 A;  3H7W A;  1BYW A;  3UE0 A;  3FWL A;  4R3A A;  2NUP C;  1TD5 A;  1KE0 A;  3B47 A;  1PZP A;  4JF6 A;  5G4Y A;  3WS0 A;  4MEZ A;  3UB9 A;  4Y2F A;  3PBR A;  1NYM A;  3UPP A;  4I5S A;  3IS2 B;  2XD1 A;  5GLC A;  2GX5 A;  2C6W B;  4HP4 A;  2Y59 A;  1YLZ A;  3HLB A;  4OP5 A;  5CER A;  4IVI A;  4ZJ3 A;  4ME4 A;  2Y2L A;  2I9V A;  3D3O A;  2R9W A;  3E2L A;  4ZJ2 A;  1ALQ A;  2HDU A;  1KGE A;  3HRE A;  1OTA A;  4OPQ A;  1W7F A;  1F5M A;  1XKZ A;  4P87 A;  4KUO A;  1XA7 A;  5AQA A;  4H8R A;  4ID4 A;  1MWT A;  3BLS A;  2A49 A;  1G68 A;  5CRF A;  3UN7 A;  1DJB A;  1CI8 A;  1L0E A;  1XGI A;  4EEP A;  4K91 A;  3TSG A;  4F94 A;  5L8M A;  4GJ4 A;  4DF6 A;  4NG2 A;  3LR0 A;  5TBM A;  5CGX A;  1D06 A;  1XA1 A;  2IA2 A;  1FCO A;  1M6K A;  2V8F A;  2DMW A;  1KE3 A;  1RCJ A;  4MN5 A;  2YKF A;  3IF6 C;  3OBF A;  3K3D A;  5AQ9 A;  1FCM A;  3VOZ A;  1I5Q A;  4Q8I A;  1P9R A;  2M1C A;  5EVI D;  3KX0 X;  4BL3 A;  1K56 A;  2V9A A;  4GNU A;  3M6B A;  5DF7 A;  2E8I A;  1RP5 A;  1PYY A;  2WKR A;  3KYZ A;  1CK3 A;  4K0X A;  3WS5 A;  5E43 A;  1ES2 A;  3RTY A;  5F5Y A;  3PR6 A;  2UV0 E;  4CPK A;  4X25 A;  1N9O A;  2L1M A;  4DXB A;  2ZLY A;  2ZM0 A;  5CHJ A;  3VV4 A;  2W27 A;  5D3O A;  1MBL A;  2JBF A;  3HLG A;  2ZC3 B;  4S2M A;  4OLD A;  4KZB A;  3IXD A;  5C5K A;  1XJ4 A;  3CHW P;  3TE8 A;  1ES5 A;  3SZT A;  1XX2 A;  4DE2 A;  4JXW A;  1NZO A;  3UME A;  1YPR A;  5FSR A;  4GHI B;  4KG2 A;  3LUQ A;  1JTD A;  1HLU P;  3U2A A;  1YLT A;  1OTI A;  1S4R A;  2EXB A;  5FI7 A;  1IFQ A;  2XEP A;  1YSQ A;  3VP3 A;  3N7W A;  1YKD A;  5J4E A;  4UAA A;  2FH5 A;  2IWC A;  3ZFZ A;  1ESU A;  4DMZ A;  5HX9 A;  2QHK A;  4OON A;  4E3K A;  3A3J A;  3HLD A;  5BOH A;  2EX9 A;  3A3I A;  3S22 A;  3CG5 A;  4H6J B;  3EOI A;  4KZ9 A;  1BUE A;  3CAX A;  2H0T A;  1BUL A;  1STZ A;  1P0Z A;  1KGG A;  1J9M A;  2O9C A;  4ZRR A;  2W3F A;  3T4J A;  3KSI A;  3PBS A;  4HP9 A;  1DP9 A;  3C7U A;  1YLY A;  3BJN A;  4WYY A;  3OPP A;  4L9F A;  3GMW A;  5A8B A;  2VLG A;  1GHI A;  2A3U A;  3GRJ A;  1SDN A;  3DTK A;  4E6X A;  1MZU A;  3P01 A;  5EVE A;  3DTM A;  3MQO A;  5MC7 A;  3BLM A;  4UA6 A;  5GHX A;  2Y2M A;  4PM9 A;  3AGF A;  2DRW A;  1LHY A;  4UHU A;  1OTE A;  2A2L A;  2WGW A;  3MZF A;  3HBR A;  4BEN A;  2EWW A;  4LV0 A;  3C2W A;  4GW9 A;  3O87 A;  2HJE A;  4X69 A;  2PU2 A;  3V3S A;  2ZQ7 A;  3W8K A;  1H3Q A;  4R4S A;  2VGK A;  3V67 A;  3LR5 A;  1LI0 A;  4XT2 A;  4NET A;  2HDR A;  3SS4 A;  1DP6 A;  3UPO A;  5F68 A;  4P0M A;  5I94 A;  4MNR A;  3IT9 A;  2ZL1 B;  4HI4 A;  4XUX A;  4HH2 A;  2VX8 A;  2KX6 A;  3JVV A;  4GKU A;  3DWK A;  1IEM A;  1SHV A;  4EBL A;  4HQA A;  3HUO A;  4PKY G;  4QU3 A;  5DKK A;  3FKV A;  3N8R A;  3FYZ A;  3ZCZ A;  5FI2 A;  4NXF A;  4GOG A;  1H8Y A;  1Z09 A;  1F9I A;  3NY4 A;  1WYB A;  5EOO A;  3UB8 A;  1C3B A;  3NI9 A;  4II7 A;  2VKS A;  4JGQ A;  4OPY A;  1L3L A;  3OZH A;  1YT4 A;  3LR3 A;  4BBV A;  3LFV A;  5EM0 A;  4XT2 B;  5F1G A;  2VZW A;  4RX2 A;  4Y5F A;  4I39 A;  3IWO A;  1H8Z A;  2HJ9 C;  2V1B A;  3WS4 A;  2GNX A;  2INW A;  4CLC B;  2QPN A;  4GDB A;  5EEC A;  2QMI A;  2KDK A;  3DWZ A;  5K5B A;  5FAP A;  4Z9Q A;  2PT7 A;  2D01 A;  4E3O A;  5FQJ A;  3A0V A;  4MBH A;  5E2F A;  2O9B A;  1XFQ A;  4B4X A;  1AXB A;  1DRM A;  2CMN A;  2ZC4 B;  2GZA A;  3C38 A;  1VB6 A;  4S2P A;  4FCF A;  3A0R A;  2XRN A;  3HJK A;  4R70 A;  4EQ1 A;  3BFG A;  4Y7P A;  1PNE A;  2GJ3 A;  2XA7 S;  5U47 A;  2JKR I;  2J9P A;  2VJW A;  3V39 A;  5AQ7 A;  4YIN A;  4BBT A;  2H28 A;  5E2H A;  3VSK A;  1Y28 A;  2ACG A;  2M7V A;  4IHQ A;  2LB5 A;  2VV8 A;  5FAS A;  3HUN A;  2EWV A;  1L0G A;  2JKG A;  5HPF A;  4HJ3 A;  2MJ6 A;  3CIT A;  4BD1 A;  1FR6 A;  4KQQ A;  5FEF A;  1K4F A;  3TOI A;  2OV5 A;  2PR6 A;  3ZDJ A;  3QP4 A;  3A3D A;  2R9X A;  4EUV A;  3F1N A;  1VM1 A;  5DTS A;  3MSH A;  4KZ8 A;  5HAR A;  1ERQ A;  2V0U A;  1JVJ A;  3T4L A;  4OPZ A;  4FH4 A;  4D2O A;  4FOF A;  1BTL A;  2V1A A;  3UB6 A;  1XP4 A;  4OQG A;  2PDR A;  3EGD C;  4JBF A;  1BLP A;  3MXQ A;  1KVL A;  3IHA A;  4OLG A;  4X56 A;  4KZ5 A;  2ZMV A;  4K0W A;  1V9Y A;  3UNW A;  3FZC A;  2Y91 A;  3G32 A;  4H6J A;  3KSH A;  4PMA A;  1OJG A;  2X71 A;  2ZM8 A;  4QD4 A;  4WN5 A;  2B5R A;  2WAD A;  3GSG A;  5CHM A;  3GTC A;  4FH2 A;  1XFN A;  5E2E A;  4HEF A;  3CZD A;  5EVI B;  3LIC A;  3CMZ A;  4EER A;  4CLC D;  4XUZ A;  3GEC A;  3KSF A;  5HAQ A;  3A0S A;  3SH7 A;  2HDS A;  3D72 A;  4EV4 A;  3WWX A;  4FTX A;  2HV1 A;  5FQM A;  4EBP A;  1XJ6 A;  3QP5 A;  2BLS A;  3Q07 A;  4LEN A;  1IYP A;  2K2N A;  2W3E A;  4L9E A;  1SCW A;  1UWP X;  3PAE A;  4NXB A;  4WMC A;  5TR7 A;  5HFO A;  4BMW A;  4WEL A;  4DE3 A;  4Y17 A;  2X01 A;  3NOU C;  4C75 A;  2PYR A;  3S7P A;  2Y79 A;  5FEG A;  3LGO A;  4KZ6 A;  1WA9 A;  2XA7 M;  1NLY A;  5A92 A;  3IWI A;  2WAF A;  2L0W A;  3UO9 A;  2VV7 A;  3QNC A;  4U0X A;  3L9K A;  4IBR A;  3TJZ C;  2H5S A;  1TEM A;  2WZX A;  4LV2 A;  4OOY A;  5HD3 A;  5M1A A;  3BYD A;  4DDY A;  1LI9 A;  5FL3 A;  4WUJ A;  4LRX C;  1ES3 A;  2VGL M;  3MZE A;  4ZAM A;  3IWQ A;  4G3K A;  1X0O A;  1GSW A;  4P85 A;  1NWZ A;  4B88 A;  3BY8 A;  4E6W A;  3D9Y A;  4WZ4 A;  2ZMF A;  3S7Q A;  3MKE A;  5CED A;  3FPV A;  2HZ5 A;  2ZC5 B;  1J3W A;  1PWG A;  1BLS A;  2ZQ9 A; 
#chains in the Genus database with same CATH homology
 5HL1 A;  1IKG A;  2WGI A;  1ESU A;  3RXW A;  2EX2 A;  1N4O A;  2XF3 A;  4S2N A;  5HX9 A;  4DRT A;  4HES A;  2Y2N A;  4OON A;  5FAQ A;  4E3K A;  3A3J A;  3HLD A;  5BOH A;  1K54 C;  1Y54 A;  2Y4A A;  3N8S A;  4OP8 A;  2EX9 A;  2EFX A;  3A3I A;  3S22 A;  3CG5 A;  3QHY A;  4E3M A;  4NK3 A;  5KMW A;  1EI5 A;  4OH0 A;  4OOM A;  3AGE A;  4U0T A;  3OC2 A;  4KZ9 A;  4P6B A;  3G30 A;  3G31 A;  3NDE A;  3RXX A;  3SOI A;  3SS3 A;  1WYC A;  1BUE A;  1L2S A;  1BT5 A;  5FQI A;  2PU4 A;  3ZG9 B;  4MBK A;  2H0T A;  1BUL A;  3UDX A;  4ZTK A;  1KGG A;  1J9M A;  2P9V A;  1PWD A;  3M6H A;  4GZB A;  2J9O A;  4PM8 A;  5TFQ A;  1XPB A;  4BJP A;  1HZO A;  3PBS A;  2EXA A;  4OKP A;  3C7U A;  1YLY A;  4WYY A;  4DDS A;  5IHV A;  4ZDX A;  1PWC A;  1BLC A;  3OPP A;  4Y0O A;  4BD0 A;  4S2J A;  1GA0 A;  5KSH A;  3GMW A;  2JC7 A;  4GD6 A;  5EVI C;  4OPR A;  3MFD A;  1SKF A;  3BRM A;  3G2Y A;  3N6I A;  4PPR A;  1GHI A;  3WRT A;  2Z2L B;  3GV9 A;  2XR0 A;  3IF6 B;  2A3U A;  1K54 A;  2Z2M B;  2UWX A;  2IWD A;  2X02 A;  1MWS A;  3GRJ A;  1K25 A;  1SDN A;  4E6X A;  1CEF A;  1FSY A;  3PBT A;  3DTM A;  5CGW A;  1NRF A;  3RJU A;  1LLB A;  2WK0 A;  1LL5 A;  3UE3 A;  3BLM A;  4UA6 A;  5GHX A;  1XXM A;  2WUQ A;  4EBN A;  2Y2M A;  3GR2 A;  4OOL A;  4PM9 A;  1I2S A;  3AGF A;  5DTT A;  2DRW A;  1LHY A;  3A3F A;  4UHU A;  4KZ3 A;  2WZZ A;  3PBO A;  3VOY A;  2WGW A;  3MZF A;  2ZQC A;  3HLW A;  3HBR A;  4DE1 A;  4BEN A;  3ZG8 B;  2XFS A;  3ITB A;  3OCL A;  4LV0 A;  4C3Q A;  1PW1 A;  4EUZ A;  3O87 A;  1RGZ A;  5FAO A;  1FSW A;  4JKT A;  4LV1 A;  1EWZ A;  4RYE A;  4O7D A;  4EQI A;  1ESI A;  3FV7 A;  4U3T A;  4X69 A;  5KSC A;  2PU2 A;  1ZC2 A;  2JE5 A;  3O88 A;  3MBZ A;  3Q82 A;  1DY6 A;  5EVI A;  3TG9 A;  3V3S A;  4GB7 A;  3C5A A;  2ZQ7 A;  5FI6 A;  2HP6 A;  1BZA A;  5F82 A;  3W8K A;  1K6S A;  1TVF A;  4R4S A;  4OQ0 A;  2ZQA A;  4ZBE A;  4R23 A;  1YLW A;  2VGK A;  4KZ4 A;  1S0W A;  1MKI A;  2Y2P A;  5CGS A;  1LI0 A;  1MWR A;  1E3U A;  4NET A;  2J8Y A;  1GHP A;  1M40 A;  3EQU A;  3GVB A;  2HDR A;  3V3R A;  5CEC A;  1Q2Q A;  4X55 A;  1FCN A;  4JPM A;  3SS4 A;  4FSF A;  1KE4 A;  2XFT A;  3UPO A;  2DNS A;  1K57 A;  2V1Z A;  3MKF A;  1ZG4 A;  4P0M A;  2DCF A;  5I94 A;  4MNR A;  5DF8 A;  4N9K A;  3IT9 A;  3IXB A;  1YQS A;  3ZG7 B;  3HL9 A;  4XUX A;  3ZG0 A;  1PW8 A;  1PIO A;  3Q7Z A;  2V2F F;  3D4F A;  5TGF A;  2ZC7 A;  3Q7V B;  3CJM A;  4GKU A;  3DWK A;  1IEM A;  1SHV A;  4KZA A;  4EBL A;  4PM5 A;  3UDI A;  1K55 C;  5FA7 A;  2EX8 A;  4X53 A;  4DE0 A;  1JWP A;  3HUO A;  4OVD A;  1MXO A;  3OCN A;  4QU3 A;  3FKV A;  3N8R A;  3FYZ A;  1CEG A;  3ZGA B;  2OLU A;  3ZCZ A;  4KG6 A;  3BFF A;  3OPL A;  5FI2 A;  4QB8 A;  3ZHH A;  4BL2 A;  4LCL A;  5FDH A;  2HPB A;  3PTE A;  3Q7V A;  4GOG A;  1H8Y A;  3NY4 A;  3C4O A;  5GHZ A;  5CTN A;  1E4D A;  1WYB A;  5EOO A;  5M18 A;  3WS1 A;  1C3B A;  1IYO A;  2ZMA A;  3VP4 A;  3IH8 A;  3LY4 A;  3NDG A;  3NI9 A;  4ZJ1 A;  1DJA A;  4OPY A;  3SH8 A;  5GL9 A;  3G35 A;  3VMA A;  1NYY A;  3ZVT A;  2HP9 A;  3C7V A;  3OZH A;  3C4P A;  1Q2P A;  1YT4 A;  3HUM A;  5AQB A;  4JXV A;  4MLL A;  1E25 A;  4RX3 A;  5F1G A;  4R3J A;  5G18 A;  3IH9 A;  3G2Z A;  4RX2 A;  4UA7 A;  4LCM A;  3IWO A;  1H8Z A;  3HLE A;  3ISG A;  1ONH A;  1W8Y A;  4OQH A;  3WS2 A;  3WS4 A;  3IXH A;  2GDN A;  3ZNT A;  4WEK A;  4N1X A;  4DKI A;  2QPN A;  2ZD8 A;  2ZJ9 A;  3FKW A;  1JTG A;  4GDB A;  2QMI A;  5EEC A;  4E3N A;  1MPL A;  3M2J A;  5DF9 A;  4RA7 A;  3N4I A;  3DWZ A;  4S2K A;  4S2I A;  4Z9Q A;  5FAP A;  2VGJ A;  2WGW B;  5F83 A;  4JF4 A;  4E3O A;  5FQJ A;  4KQO A;  1GHM A;  2QZ6 A;  2Y2O A;  4GN2 A;  4MBH A;  4PM6 A;  5E2F A;  5EE8 A;  2Q9N A;  4JXG A;  3UE1 A;  3ITA A;  4KQR A;  2PBY A;  4B4X A;  1AXB A;  2G2W A;  1MWU A;  1W79 A;  3VFF A;  2ZC4 B;  2Y2I A;  3VP2 A;  1GCE A;  2BG1 A;  4DE2 A;  1HVB A;  4S2P A;  1MY8 A;  4QY6 A;  1KGF A;  1PI4 A;  4FCF A;  5HAI A;  2ZQD A;  3G4P A;  1OME A;  5GHY A;  3BFG A;  1ERO A;  4Y7P A;  5L2F A;  2WAE A;  3W4Q A;  2XD5 A;  1L0D A;  4XXR A;  3O3V A;  4S2O A;  4FD8 A;  2RL3 A;  5GLB A;  4X6T A;  5U47 A;  2XK1 A;  3BM6 A;  1JWV A;  2J9P A;  2P74 A;  4EWF A;  2WKH A;  4HBU A;  1DJC A;  1PZO A;  4IVK A;  3V39 A;  5AQ7 A;  3PAG A;  4YIN A;  1NXY A;  3P98 A;  2Q9M A;  3W4O A;  5E2H A;  4MBF A;  3VSK A;  2Y55 A;  2FFF B;  3MZD A;  5FQ9 A;  2C5W B;  2OSU A;  3IQA A;  3NBL A;  2J7V A;  5GLD A;  2IWB A;  4N9L A;  5FAS A;  4X68 A;  1H5X A;  4QY5 A;  3VP1 A;  1JWZ A;  1SDE A;  1QME A;  1FQG A;  4GD8 A;  4JF5 A;  3BEB A;  1W5D A;  3HUN A;  4BLM A;  1PI5 A;  3PBQ A;  1IEL A;  1KVM A;  1L0G A;  5A93 A;  3IHB A;  4R1G A;  1KDS A;  3GQZ A;  4C6Y A;  5FQQ A;  3WRZ A;  4E3J A;  1L0F A;  5EOE A;  4WM9 A;  3UPN A;  3BFD A;  4WEJ A;  3HVF A;  1G6A A;  2Y2G A;  3N8L A;  5DVA A;  5CEB A;  2ZM2 A;  1FR1 A;  4BD1 A;  3P09 A;  2XQZ A;  5CHU A;  3UE0 A;  3FWL A;  1FR6 A;  3I7J A;  2I72 A;  4KQQ A;  1GA9 A;  1HTZ A;  1K57 C;  1KE0 A;  1K4F A;  1PZP A;  4JF6 A;  3TOI A;  2WYX A;  3UY6 A;  2OV5 A;  3WS0 A;  3OPR A;  4IBX A;  4A5R A;  1K56 D;  3V5M A;  3AGD A;  1FOF A;  4KZ7 A;  3ZDJ A;  4MEZ A;  1ES4 A;  4E3I A;  4M3K A;  3A3D A;  2R9X A;  3UPP A;  3PBR A;  1NYM A;  4HBT A;  1K4E A;  1ONG A;  4JLF A;  1YMX A;  2EFU A;  1VM1 A;  4IED A;  5DTS A;  2XD1 A;  5GLC A;  2C6W B;  3QNB A;  4KZ8 A;  5HAR A;  3ZG5 A;  4YFM A;  3M2K A;  2Y59 A;  3OPH A;  4Y0T A;  1YLZ A;  2EX6 A;  3HLB A;  1ZG6 A;  4OP5 A;  1ERQ A;  4RVA A;  5CER A;  4IVI A;  4L0L A;  1JVJ A;  4ZJ3 A;  2Y2L A;  4OPZ A;  4FH4 A;  4OQI A;  3VSL A;  2R9W A;  1ERM A;  3E2L A;  4ZJ2 A;  4D2O A;  1ALQ A;  1BTL A;  2HDU A;  1KGE A;  3HRE A;  4N92 A;  4B4Z A;  4R4R A;  3G34 A;  3O86 A;  4OPQ A;  1E3U D;  1XP4 A;  1W7F A;  3IF6 A;  4OQG A;  2P9V B;  1LL9 A;  1RGY A;  3NIA A;  5KZH A;  1XKZ A;  4JBF A;  3MXR A;  1BLP A;  4P87 A;  1XA7 A;  5AQA A;  2V20 A;  4H8R A;  4ID4 A;  1K6R A;  1MWT A;  1KVL A;  3IHA A;  3BLS A;  5GLA A;  3NC8 A;  2Y2Q A;  2A49 A;  1G68 A;  1W8Q A;  4OLG A;  1DJB A;  4X56 A;  1CI8 A;  5CRF A;  3UN7 A;  4KZ5 A;  3SS5 A;  1L0E A;  1K38 A;  1XGI A;  3DW0 A;  4K0W A;  3ZNY A;  3UDF A;  3S1Y A;  3JYI A;  3HLF A;  4K91 A;  2XDM A;  4KG5 A;  3UNW A;  3TSG A;  4F94 A;  4QJG A;  3FZC A;  2Y91 A;  2Y2J A;  3ZVW A;  2Y2K A;  3G32 A;  1NJ4 A;  4LV3 A;  1VQQ A;  1HD8 A;  1TDL A;  4DF6 A;  4PMA A;  3LY3 A;  2X71 A;  5CGX A;  3Q81 A;  5EPH A;  1XA1 A;  2JCH A;  1YMS A;  2ZM8 A;  3A3E A;  2B5R A;  4QD4 A;  2WAD A;  5FAT A;  5M19 A;  3GSG A;  1FCO A;  1M6K A;  5CHM A;  1S6R A;  3GTC A;  4FH2 A;  1KE3 A;  3EQV A;  1RCJ A;  2WGV A;  4CJN A;  3IF6 C;  4PM7 A;  5HW3 A;  5AQ9 A;  1FCM A;  3VOZ A;  5E2E A;  5A90 A;  1I5Q A;  3Q1F A;  4WMC D;  4HEF A;  5EVI D;  3CZD A;  2H10 A;  5EVI B;  4Q8I A;  5F1F A;  1NZU A;  4WZ5 C;  3CMZ A;  4BL3 A;  1XGJ A;  1K56 A;  5E2G A;  4GNU A;  4XUZ A;  3M6B A;  5HAQ A;  3SH7 A;  2HDS A;  4EV4 A;  5DF7 A;  3WWX A;  5FQK A;  2ZQ8 A;  5EVL A;  4BQM A;  2E8I A;  4JXS A;  4UA9 A;  4KEN B;  1RP5 A;  1PYY A;  5JYP A;  5A91 A;  1CK3 A;  5FQM A;  4EBP A;  3BFC A;  3IXG A;  2BLS A;  3Q07 A;  4K0X A;  3WS5 A;  4LEN A;  5E43 A;  4S2L A;  1IYP A;  1KDW A;  1ES2 A;  2XH9 A;  2Y2H A;  3E2K A;  1SCW A;  3PAE A;  1YLJ A;  1I2W A;  3LCE A;  4WMC A;  1Z6F A;  5TR7 A;  5HFO A;  4CPK A;  3NCK A;  3B3X A;  3VFH A;  4Y0U A;  1IYQ A;  1BLH A;  3V50 A;  2XGN A;  4DXB A;  1IKI A;  2ZLY A;  2ZM0 A;  5HAP A;  5CHJ A;  4WEL A;  4DE3 A;  2OLV A;  5JYO A;  1YM1 A;  1N9B A;  4WZ5 A;  2X01 A;  1CI9 A;  1NY0 A;  4C75 A;  2H0Y A;  4S2N C;  5D3O A;  2CC1 A;  2RCX A;  1MBL A;  2XLN A;  2JBF A;  4R3B A;  3HLG A;  2ZC3 B;  2FFY A;  1O07 A;  4S2M A;  4KZ6 A;  4OLD A;  2HP5 A;  4KZB A;  5A92 A;  3IWI A;  3IXD A;  2WAF A;  3UO9 A;  3QNC A;  4U0X A;  4IBR A;  3PBN A;  5CTM A;  2ZC6 B;  1ES5 A;  1QMF A;  3W4P A;  3MXS A;  1XX2 A;  2H5S A;  1TEM A;  1BSG A;  2G2U A;  1NZO A;  2WZX A;  3LEZ A;  3LO7 A;  4JXW A;  4LV2 A;  4N1H A;  4OOY A;  5FSR A;  5M1A A;  3BYD A;  4DDY A;  4R0Q A;  5J8X A;  1TDG A;  4E3L A;  1LI9 A;  4KG2 A;  3BEC A;  1O7E A;  3S4X A;  1K55 A;  1ES3 A;  1JTD A;  5CXW A;  3MZE A;  3BFE A;  4ZAM A;  1YLT A;  2HDQ A;  3VP0 A;  3HLC A;  1YLP A;  3IWQ A;  4P85 A;  2EXB A;  4WBG A;  5FI7 A;  3SH9 A;  4B88 A;  2XEP A;  5EUA A;  4DXC A;  3VP3 A;  4QHC A;  2WKE A;  1IYS A;  4E6W A;  4WZ4 A;  4GDN A;  3N7W A;  1U60 A;  3MKE A;  1WE4 A;  4UAA A;  5CED A;  2WKI A;  3IF5 A;  5DTK A;  2ZC5 B;  2IWC A;  1PWG A;  3ZFZ A;  1BLS A;  1ZKJ A;  2ZQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...