4N1HA

Structure of a single-domain camelid antibody fragment cab-f11n in complex with the blap beta-lactamase from bacillus licheniformis
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
258
structure length
257
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALVTSLRAFALEPGKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords Beta-lactamase
publication title Probing the mechanism of aggregation of polyQ model proteins with camelid heavy-chain antibody fragments
rcsb
source organism Bacillus licheniformis
total genus 84
structure length 257
sequence length 258
chains with identical sequence C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4n1hA00
2BLSA 4OPRA 3NI9A 2VGJA 3VP2A 1HD8A 3HLBA 3DWKA 3RXWA 2A3UA 4DE1A 3VFFA 1N9BA 1IYSA 2IWCA 1ESUA 2XFTA 2ZQAA 3G30A 4FSFA 4GN2A 3M2KA 3S4XA 4DE3A 4LV1A 4BJPA 3HUMA 1K55C 1YLJA 4KZBA 2Y91A 4Q8IA 1FOFA 4X6TA 5CGXA 3ZHHA 4E3OA 1ERQA 3VP3A 4EWFA 3EQVA 2ZC6B 3MXSA 1VQQA 4WM9A 2WGWA 1NXYA 2H0YA 4KZ5A 1L0EA 2Y2PA 3CJMA 4GD8A 3UPPA 2C5WB 1W79A 5CRFA 4RA7A 1K56A 4IVKA 2XF3A 4N9KA 3SS4A 3Q81A 3UN7A 3BYDA 3VSLA 1LL5A 3AGEA 3Q1FA 5GLCA 3ZDJA 3N8RA 4OOMA 4UAAA 2ZLYA 4WYYA 1K38A 3CZDA 1W5DA 5D3OA 1CEFA 3BEBA 3ITBA 4R23A 2XK1A 3BLMA 2X02A 3OPPA 2V2FF 2ZD8A 1TEMA 5DF9A 4HBTA 4IBRA 3HVFA 5A90A 3Q07A 1I5QA 4MBHA 3LO7A 2H10A 4N1HA 4IBXA 5EPHA 3IHAA 1BZAA 1ES2A 3ZG7B 3OPLA 4CJNA 3QNCA 5CTNA 5GHYA 5A92A 2XEPA 2V1ZA 3MKFA 1Y54A 4RYEA 5FATA 4HEFA 3LCEA 1NYMA 2WADA 4KZ4A 4WEKA 1YMSA 5CXWA 1Q2QA 3EQUA 3G2ZA 1YMXA 2EX9A 2WGIA 5FQ9A 4JF4A 1FCOA 4QB8A 1I2SA 2WZZA 5F1FA 1EI5A 4S2LA 3O3VA 2E8IA 1KE3A 5CHMA 3IWIA 3PBQA 4S2NC 3TOIA 4WZ5A 3M6HA 2J7VA 4EV4A 5FQJA 3C4OA 4GDBA 4S2JA 2JC7A 1XGJA 2G2WA 3ZG5A 4BL2A 3G2YA 4QJGA 4MBFA 4BL3A 4BENA 3GRJA 2VGKA 1PIOA 3CMZA 3ZNTA 4M3KA 3GR2A 1XXMA 3FZCA 3C4PA 4UHUA 5KSCA 1K4EA 4KQQA 3PBRA 5AQAA 3IHBA 3LEZA 5F1GA 4GZBA 2I72A 2HDRA 2OLUA 4JXSA 1YLPA 1TDLA 1JTGA 4UA7A 1ZKJA 4EQIA 2PU2A 1IYQA 1PW8A 1S0WA 3IH8A 5EVIB 5HL1A 4OQGA 5FSRA 3HUNA 4ZBEA 2HP5A 3FV7A 3NDGA 1DJCA 1NY0A 3UY6A 3IWQA 3C5AA 3IT9A 3BLSA 4U0XA 2R9XA 1RGZA 4S2KA 4E3KA 1NJ4A 4PPRA 1WYCA 2X01A 2ZM0A 2Y2QA 4DF6A 3ITAA 3IXDA 4R1GA 4MEZA 1YLYA 1G68A 4R4SA 3WWXA 5GLDA 4FH2A 1IKIA 1MPLA 4OLDA 3M2JA 4P0MA 3MZFA 1LI9A 1BT5A 2HDQA 3N4IA 3W4PA 3PTEA 1KGGA 4GNUA 2Z2MB 4DKIA 3IXBA 3BM6A 4KZAA 5FI6A 1MBLA 5BOHA 2CC1A 3UE0A 1MY8A 2HDSA 1BLCA 3O86A 3VOYA 2ZMAA 3ZGAB 4C6YA 3ZNYA 3FWLA 3MFDA 4S2OA 4S2PA 5GLBA 1K54C 1KE0A 2WZXA 3A3IA 3MZDA 4KG5A 3WRZA 4N9LA 1DJBA 2OSUA 3HL9A 3SOIA 1GCEA 4RX2A 5E43A 4JXGA 5HX9A 3NIAA 5FDHA 5CGWA 2ZM2A 3AGDA 3FYZA 3HBRA 4OOYA 4B4XA 2Y4AA 3G32A 3C7VA 3O88A 4KG6A 3WRTA 5FASA 3DWZA 4DXCA 5HAPA 1IEMA 3WS1A 3UPNA 5E2HA 2X71A 1ERMA 2HP6A 5TGFA 4GB7A 1W8YA 3UE1A 3A3DA 4BD1A 3PBNA 3ZVTA 3V39A 1CK3A 5M1AA 2R9WA 3CG5A 5FI2A 3AGFA 1O7EA 3ZFZA 2ZM8A 3V3RA 5EVID 2G2UA 3OCNA 2IWBA 3ZVWA 2XQZA 4QD4A 1LLBA 1RP5A 3SH7A 1JTDA 2XD1A 1ONGA 2H0TA 3A3FA 2WGVA 3TG9A 3VP1A 1LHYA 4WZ4A 2B5RA 4GD6A 1BULA 5HAIA 4R3JA 1J9MA 1MKIA 2P74A 3A3JA 3SH8A 3WS2A 1K57C 3GVBA 1MXOA 4N92A 3ZG8B 1JVJA 2JE5A 5EOEA 5DTKA 2A49A 4KENB 3WS4A 5JYPA 1PYYA 4QHCA 1KGEA 4U3TA 2WAEA 1DY6A 4R3BA 4E3LA 4OPQA 4S2MA 5FQMA 1I2WA 3QNBA 3OC2A 1ES5A 4K0WA 3HUOA 1K6SA 2WGWB 3M6BA 2EX6A 3OPHA 4BQMA 1E25A 1YLTA 5DTSA 1PWGA 1GHIA 3GQZA 1XA1A 3A3EA 4DDSA 3BECA 2EFUA 3B3XA 2Y2NA 3JYIA 3IWOA 4LV3A 1WYBA 1IKGA 3NCKA 1PZOA 4QY5A 3C7UA 3P98A 5EOOA 3BFDA 1BTLA 4FCFA 5GHZA 2EXBA 4OP8A 1XPBA 4S2IA 4JKTA 4KG2A 1H8YA 4A5RA 2ZQ7A 3IF6A 1QMFA 3N8LA 5FAOA 3TSGA 1FR6A 5JYOA 1ZG4A 5EVLA 2WK0A 1CI8A 4DE2A 3NBLA 4KZ6A 1K25A 1K6RA 1L0FA 4OOLA 3HLFA 2BG1A 5TFQA 4E6XA 1XKZA 4ZJ3A 4KQOA 4EBNA 3IXHA 5FQKA 4OPYA 3IXGA 5E2EA 3G4PA 4LCLA 3ZG9B 1RCJA 4H8RA 4NK3A 4X53A 3UE3A 4KZ9A 1KVLA 2OV5A 4C3QA 4KZ7A 3S1YA 2J8YA 4D2OA 1BSGA 1PWCA 3IH9A 5EVIA 1FQGA 1M6KA 3UDXA 3BFEA 5FQIA 1MWTA 2PU4A 2ZC4B 5CHJA 5GLAA 2WKEA 2IWDA 2Y2HA 1KDWA 2P9VB 4JPMA 1DJAA 4BLMA 4EBLA 4NETA 5DVAA 3MBZA 5M19A 5DF8A 5G18A 2Q9MA 4Y7PA 4ZJ1A 4E6WA 2ZQCA 4QU3A 4RVAA 1M40A 4JBFA 4JF6A 3VMAA 3UNWA 4PM9A 4DDYA 1E4DA 2Y2LA 1K55A 3HLCA 5E2GA 4OPZA 2XH9A 4Y0OA 2RCXA 2ZQ9A 3SS3A 2EX8A 1FSYA 3UPOA 4FH4A 3WS5A 1GHPA 4Y0TA 1ES4A 3NC8A 5KSHA 1N4OA 3MZEA 1YLWA 1SDEA 1HZOA 2XDMA 3UDFA 4KZ8A 4L0LA 5AQ7A 4JF5A 1PI5A 3FKWA 5TR7A 5CERA 4C75A 4E3IA 2JCHA 5GL9A 1IYOA 5GHXA 1ESIA 3UO9A 2FFFB 2Y2IA 5FAPA 4KZ3A 1E3UD 3E2LA 4IVIA 4N1XA 4UA6A 4MNRA 1ALQA 2OLVA 4PM6A 3Q82A 4WBGA 2ZC3B 1HTZA 4YFMA 4E3JA 3BFCA 1H5XA 1YLZA 1W7FA 4GKUA 4PM8A 4DRTA 4P87A 3BFGA 4GDNA 1ZG6A 5L2FA 4XUZA 4ZJ2A 4K91A 5EE8A 3Q7VB 3VP4A 2H5SA 3ZG0A 3HLGA 3V5MA 2ZQDA 1CI9A 4R4RA 2HP9A 2Y2MA 1ZC2A 4Z9QA 2EXAA 2Y59A 3QHYA 1RGYA 4OVDA 1S6RA 4E3MA 2Y2GA 4YINA 2WUQA 4EUZA 3Q7ZA 1K4FA 3GMWA 2WAFA 2Y2OA 1FSWA 1Q2PA 2XGNA 3VSKA 1FR1A 1JWZA 2JBFA 1YM1A 4X69A 3OPRA 3PBOA 4LV0A 4OONA 3OCLA 1BLPA 4O7DA 2DRWA 4S2NA 3G34A 5M18A 2DNSA 1SDNA 5FA7A 1OMEA 5A91A 4ID4A 4EBPA 4DXBA 1NRFA 1PW1A 3V50A 3PBSA 4WMCD 1KE4A 5FI7A 3MKEA 4XXRA 2GDNA 1LL9A 5CECA 5FAQA 2QMIA 1L0GA 3E2KA 4X55A 1TVFA 4B88A 1MWUA 1KGFA 2WYXA 1GHMA 1PI4A 1XP4A 1H8ZA 5HFOA 3MXRA 1XA7A 5AQ9A 1EWZA 3O87A 4HBUA 2QPNA 4ZTKA 1MWRA 2XR0A 5IHVA 2ZJ9A 4JXVA 4JLFA 1KDSA 3PBTA 2V20A 1HVBA 5EECA 1E3UA 3VP0A 2Y2JA 4PM5A 1AXBA 1BLSA 3W8KA 1G6AA 4E3NA 3LY4A 4OQIA 2HPBA 4Y0UA 3SH9A 4OH0A 4WELA 4PMAA 2ZC7A 2XD5A 4OLGA 1IELA 3ZCZA 2FFYA 1SCWA 5E2FA 3OZHA 5KZHA 3BFFA 1YQSA 2J9OA 1JWVA 1SHVA 5CGSA 4F94A 2C6WB 2Q9NA 3D4FA 5CEBA 2HDUA 3GSGA 4BD0A 3RJUA 1ONHA 5CHUA 3HLDA 1W8QA 2RL3A 5A93A 1L0DA 4FD8A 4PM7A 2P9VA 3GTCA 2ZC5B 2ZQ8A 2PBYA 3FKVA 3PAGA 1GA0A 2UWXA 3WS0A 1ES3A 3HREA 1PZPA 1NZUA 2EX2A 4K0XA 1VM1A 3HLEA 3IF6B 4CPKA 1K54A 3N7WA 3NY4A 4OP5A 4LCMA 1BLHA 3N6IA 4ZAMA 3SS5A 1TDGA 3BRMA 1KVMA 2WKIA 1YT4A 4U0TA 3P09A 4X68A 1O07A 2Y2KA 1QMEA 3G31A 2Y55A 5HARA 4ZDXA 1MWSA 3DTMA 1IYPA 4WMCA 1PWDA 4R0QA 1BUEA 4P6BA 4JXWA 4DE0A 5HAQA 4WEJA 1LI0A 5KMWA 3IF5A 4MBKA 4XUXA 1SKFA 1C3BA 3I7JA 1K56D 4LENA 3RXXA 1JWPA 1XGIA 3IQAA 1GA9A 3GV9A 2J9PA 4B4ZA 5DF7A 4IEDA 3IF6C 3DW0A 2DCFA 3V3SA 1XX2A 3LY3A 4UA9A 4X56A 5DTTA 5U47A 1L2SA 2EFXA 4WZ5C 1CEGA 3VFHA 5AQBA 3VOZA 5F83A 3ISGA 3UDIA 1NYYA 2WKHA 2XFSA 1Z6FA 1U60A 5FQQA 1K57A 4KQRA 2Z2LB 3W4QA 1FCMA 3NDEA 4QY6A 1WE4A 5EUAA 5HW3A 4MLLA 4OQ0A 5CEDA 1EROA 3HLWA 3Q7VA 4LV2A 2XLNA 5CTMA 4HESA 5EVIC 5J8XA 3PAEA 4P85A 1NZOA 1FCNA 5F82A 4OQHA 3W4OA 2QZ6A 3G35A 4RX3A 4GOGA 5I94A 3N8SA 4OKPA 3S22A
chains in the Genus database with same CATH superfamily
2BLSA 3VE3A 1IFQA 2PAVP 3HLBA 3DWKA 1N9BA 1IYSA 1ESUA 2VV6A 4CLCE 3HUMA 2VJWA 1MZUA 1UWPX 4Q8IA 3ZHHA 4IUHA 4JGOA 3QP6A 1ERQA 4EEPA 3MXSA 2WGWA 3CJMA 4GD8A 2BTFP 1X0OA 2C5WB 3EGDC 4IVKA 3Q81A 4EW7A 5GLCA 3N8RA 4OOMA 4B93A 1W5DA 3F1PB 2XK1A 2P04A 5DF9A 4IBRA 3HVFA 3JPUA 4MBHA 5HPIA 2PRFA 1BZAA 1ES2A 3MR0A 5CTNA 5A92A 3DTKA 1Y54A 4KZ4A 4WEKA 4ESPA 5CXWA 1EW0A 3EQUA 3F1OB 3G2ZA 1YMXA 4QB8A 2OWHA 2WZZA 4S2LA 2ACGA 4S2NC 3TOIA 4WZ5A 5I5LA 2J7VA 5FQJA 3U4LP 4GDBA 4X1LA 2JC7A 2G2WA 2VX8A 3ZG5A 4QJGA 3G2YA 1OT9A 2OAQ1 1PFLA 1TS8A 4M3KA 4M4XA 2W3GA 5AQAA 2QHKA 4YWZA 2I72A 4JXSA 2OLUA 3CLOA 5HL1A 5EVIB 3MQOA 5FSRA 2HP5A 3C5AA 1NJ4A 2X01A 3RFBA 4D60A 2Y2QA 4MEZA 3CAXA 1MPLA 1OJ5A 4P0MA 3MZFA 4HI4A 3N4IA 4GNUA 2Z2MB 3BM6A 5FI6A 2ZL1B 2CC1A 3O86A 3VOYA 5IS1A 3PR6A 4ARZB 5AVEA 4S2OA 4S2PA 1K54C 2OSUA 2JKGA 5FDHA 2PT7A 3FYZA 1XJ2A 4OOYA 5HL6A 2Y4AA 3WRTA 1TS6A 3RTYA 1ERMA 4QPRA 1DP9A 4R6LA 2J3TD 3NOUC 2M7VA 3CG5A 5FI2A 3AGFA 3ZFZA 5EVID 2PHYA 5F5YA 4HQAA 2P7JA 2H0TA 2WGVA 4WZ4A 5HAIA 4R3JA 1J9MA 1K57C 3F1NA 1MXOA 4N92A 1PRQA 2JE5A 4I39A 4XT2A 1VB6A 1KGEA 4U3TA 2WAEA 4E3LA 4S2MA 2JKRM 3HUOA 3M6BA 4BQMA 2XSSA 4GJ4A 1GHIA 1YSQA 3GQZA 1GSWA 1YKDA 2EFUA 2K2NA 2Y2NA 4QY5A 2ZOIA 3P98A 3BFDA 4PKYG 5GHZA 4OP8A 4CJNA 4JKTA 1H8YA 5FAOA 3LFVA 3HLFA 1W63M 1XJ6A 4E6XA 4KQOA 4EBNA 3IXGA 3ZG9B 1RCJA 4Y3IA 4H8RA 4X53A 1LSVA 4C3QA 1BSGA 3UDXA 5FQIA 4LGWA 5CHJA 3KSHA 2Y2HA 2P9VB 2CMNA 1DJAA 2A24B 4NETA 1S1ZA 5DF8A 1Y4OA 3MF0A 4NKPA 2ZQCA 1SKOA 4RVAA 4JBFA 1LL8A 2RCXA 3SS3A 2EX8A 2V1BA 3UPOA 1GHPA 5KSHA 1SDEA 2XDMA 4KZ8A 5AQ7A 5TR7A 4E3IA 4C75A 2JCHA 1IOUA 4CLCB 4IVIA 5DJTA 2K7SA 4PM6A 4WF0A 4WBGA 5LBRA 1YLZA 3UMDA 3BFGA 3QP8A 1ZG6A 1CJFA 4B9OA 4KUOA 4I3JA 2PYRA 3MMHA 3VP4A 2H5SA 2OAP1 3V5MA 1Y28A 2ZQDA 1CI9A 1RGYA 4E3MA 2Y2GA 3GMWA 3TRCA 1Q2PA 2XA7M 1FR1A 1OTEA 2ZMFA 3F1PA 3C38A 4HOIA 4LV0A 3T4SA 3UE6A 4O7DA 5M18A 3S7NA 4EBPA 3B47A 2AVXA 5CX7A 1NRFA 2VV8A 2GDNA 4GCZA 1S4RA 1KGFA 1GHMA 1H8ZA 5AQ9A 1EWZA 3O87A 4ZTKA 2QPNA 1MWRA 2XR0A 4CLCD 1V9YA 2B95A 5EECA 2R78A 1BLSA 2HPBA 4Y0UA 3UB6A 4UEYA 4OH0A 4WELA 2ZC7A 1SCWA 3BFFA 2VKSA 1JWVA 1UGUA 5CGSA 3T1QB 3D4FA 1LSXA 3ZYTA 1OT6A 2Q0OA 1W8QA 2ZQ8A 2PBYA 3FKVA 4F3LB 3PAGA 3WS0A 4ME4A 3KSGA 1VM1A 1YPRA 3T4QA 1VHMA 1TDGA 4L9GA 1O07A 2KOIA 4WMCA 3FPVA 3VOLA 3KSIA 5KMWA 3IF5A 2ZL1A 2QYBA 3I7JA 5IT5A 1P9RA 3GV9A 4B4ZA 3DW0A 4UA9A 5DTTA 2PR5A 5U47A 3VFHA 1CEGA 5F83A 2WKHA 1Z6FA 2Z2LB 3W4QA 4QY6A 5HW3A 2YKHA 2PD8A 5CEDA 3H7WB 4MMNA 4Y2FA 2QJ7A 3UB5P 4P85A 4AFIA 3G35A 3R4KA 3N8SA 3S22A 4OPRA 3NI9A 2J80A 2A3UA 3VFFA 4BMWA 3M2KA 3CITA 4LV1A 4Y17A 1NXYA 3JVVA 4BWIA 2Y2PA 3T50A 2PD7A 3UPPA 2JKTI 3K3CA 2XF3A 3SS4A 3HJKA 4HJ4A 1LL5A 3AGEA 3Q1FA 2B02A 1K38A 4IJGA 2QWSA 1ODVA 5EV0A 1XJ4A 3F1NB 3OPPA 2V2FF 1TEMA 4XT2B 5A90A 2XROA 4N1HA 5EPHA 4ZRRA 3OPLA 5GHYA 2PDRA 3MKFA 2VV7A 2KLIA 3S1YA 3T4JA 2EX9A 1D06A 1P0ZA 1FCOA 1I2SA 5F1FA 1EI5A 1NRJA 1OTIA 1KE3A 3PBQA 4S2JA 4BL2A 2JKRI 2NUPC 3GRJA 1T1AA 3CMZA 3LIFA 3ZNTA 1XXMA 3C4PA 1K4EA 5F68A 5F1GA 3MSHA 1ZKJA 4Q0IA 2W3EA 3OOVA 2H28A 3HUNA 3CUEC 4I3AA 3NDGA 1DJCA 3UY6A 3IWQA 3BLSA 4U0XA 4CLCA 3UMEA 4S2KA 4E3KA 1WYCA 4DF6A 4R1GA 4HJ3A 1FIKA 1YSPA 3HCYA 1IKIA 4OLDA 3NHQA 1TS0A 1LI9A 5G4YA 2HDQA 3W4PA 2J3TC 4KZAA 2OWJA 2EWVA 4NXEA 3R7WA 3UE0A 2M1CA 1BLCA 3MQ0A 3FWLA 3MFDA 3MZDA 3HL9A 4JXGA 2I9VA 5CGWA 3HBRA 4B4XA 2LB5A 1DRMA 4KG6A 3LICA 3DWZA 4DXCA 3WS1A 3UPNA 5E2HA 3C2WA 3UE1A 3A3DA 4BD1A 3T4LA 4HH3A 3ZVTA 4DN0A 2KDKA 1XJ3A 2G2UA 3OCNA 3LIBA 3ZVWA 2XQZA 4QD4A 1JTDA 2XD1A 1ONGA 4NXGA 5KIZA 3VP1A 1LHYA 3A3JA 3GVBA 3ZG8B 3DBAA 4KENB 5JYPA 5HZHA 1STZA 3QNBA 5L09A 1K6SA 2W27A 2EX6A 5DTSA 3PYPA 5HD3A 4DDSA 3BECA 3CPTB 3B3XA 1NLYA 3IX8A 1WYBA 3NCKA 4F3LA 1BTLA 4KG2A 2ZQ7A 1FR6A 3IS2B 2WK0A 4DE2A 3NBLA 2JHEA 4KZ6A 3LUQA 1K6RA 1L0FA 3D3OA 1H8MA 3IBRA 3C8CA 5FQKA 5E2EA 3G4PA 1H0MA 4D2OA 4Z1WA 1M6KA 3BFEA 2VZWA 2ZC4B 2PU4A 3O5YA 2D01A 2EWWA 4EBLA 5DVAA 1XFNA 4LFUA 5G18A 3V67A 4Y7PA 4E6WA 1M40A 3VMAA 1NLZA 1E4DA 3ULFA 2XH9A 2ZQ9A 3H7WA 4EU0A 4Y0TA 3U2AA 4R3AA 1T1CA 1N4OA 3MZEA 1DP8A 3C30A 3UDFA 4L0LA 3FKWA 4NXFA 5GL9A 1IYOA 2JKTM 2XA7S 3UO9A 2FFFB 2Y2IA 3SZTA 3Q82A 2HZ5A 4MCWA 3LR4A 1HTZA 2B18A 4YFMA 1VETB 1W7FA 4PM8A 5DJUA 4P87A 3CI6A 4GDNA 4ZJ2A 4I38A 5EE8A 3ZG0A 4LLOB 4R4RA 2HP9A 1UWNX 2W3DA 1YAXA 3EEAA 4EUZA 4CLCC 3KSFA 2Y2OA 1FSWA 3FG8A 1JWZA 2JBFA 3E4OA 3OPRA 3OCLA 2DRWA 3G34A 3T1XA 4HNBA 2DNSA 3B33A 1OMEA 4ID4A 4DXBA 4YOFA 3V50A 2HV1A 4WMCD 4XXRA 5CECA 5FAQA 3T12B 3E2KA 1TVFA 1PI4A 1XP4A 1P97A 4HBUA 2V8FA 2Y79A 1HVBA 4BBVA 1AXBA 4WUJA 3LR0A 4OQIA 3G6OA 4PMAA 3UB9A 4OLGA 2P08A 2FFYA 4GHIB 5E2FA 1AWIA 3OZHA 1YQSA 2J9OA 3LR3A 5FL3A 5IU1A 4EESA 2RL3A 4HY8A 2J3WA 1L0DA 5FEFA 3GDIA 4FD8A 3GTCA 3PXPA 4WLAA 2ZC5B 2UV0E 1F2KA 1GA0A 2UWXA 3HREA 3IF6B 3NY4A 1G28A 1KVMA 4X68A 2Y2KA 1QMEA 1MWSA 4BBTA 3DTMA 1N9LA 1N9NA 1TF1A 2V9AA 4Y5FA 4JXWA 4XUXA 5EVEA 1C3BA 4II7A 1JWPA 3V3SA 1NWZA 3LY3A 4X56A 5TJJA 2EFXA 4WZ5C 2K31A 2XFSA 5FQQA 4KQRA 5K5BA 3OBFA 3NDEA 1WE4A 4MLLA 3H9WA 1L3LA 1F98A 2ZMVA 3Q7VA 4LV2A 4EERA 2HJ9C 2YKFA 2O9CA 4GOGA 3KO6A 3R7WB 5I94A 4OKPA 3RXWA 4DE1A 2V0WA 2IWCA 2O0YA 2XFTA 2ZQAA 4GN2A 4DE3A 2PR6A 4I5SA 4BJPA 1YLJA 4KZBA 4HHDA 4X6TA 4E3OA 2O99A 2W1RA 3EQVA 1VQQA 4KZ5A 5AJGA 4R70A 4RA7A 3CPTA 3JVUA 3UB8A 2QKPA 2V0UA 2ZLYA 4WYYA 3CZDA 1ACFA 2JN7A 3PHYA 3IS2A 3EGXC 5FDSA 3S7QA 3Q07A 1I5QA 5HSQA 4IBXA 3NECA 3IHAA 1V9ZA 2G7UA 4ETXA 4Y15A 2XEPA 4PAUA 5FATA 1NYMA 4ZJ1A 2WGIA 5FQ9A 1F9IA 5AVFA 1N9OA 3C4OA 1XGJA 1XFQA 4MBFA 1PIOA 3GR2A 4UHUA 4KQQA 3PBRA 3IHBA 4YNRA 4GZBA 4JGRA 2HDRA 5DFXA 1TDLA 3K2NA 2PU2A 1IYQA 1S0WA 3IBJA 1NY0A 1MC0A 3IT9A 2R9XA 3ITAA 1G68A 5HPFA 1VETA 2HGVA 3M2JA 1BT5A 5J3WA 5J4EA 3PTEA 1KGGA 1F5MA 1MBLA 2W1TA 5BOHA 2VGLS 2HDSA 3ZNYA 1KE0A 4KG5A 1DJBA 3SOIA 1GCEA 4RX2A 5HDDA 5HX9A 3H82A 2ZM2A 5FASA 3D9YA 1IEMA 2HP6A 4GB7A 1W8YA 3PBNA 3QP5A 1FILA 3K3DA 1O7EA 2ZM8A 2FZ0A 3LI8A 3TG9A 2M7UA 4GD6A 2P74A 3SH8A 3T4TA 3WS2A 2GX5A 2VLGA 1JVJA 5DTKA 2A49A 1PYYA 4QHCA 2QJ5A 1DY6A 4R3BA 4GHIA 1I2WA 5FQMA 1ES5A 2ZBBA 3QP1A 3SW1A 1XA1A 4KQDA 3IWOA 4LV3A 1IKGA 1PZOA 1VEUA 3EEHA 3NJAA 2OOLA 4L9EA 5EOOA 1T18A 4FCFA 4A5RA 3UB7A 3IF6A 3N8LA 5JYOA 3P01A 1ZG4A 4Q0HA 4G3VA 3TW8A 1CI8A 2JKFA 3T4OA 4OOLA 2BG1A 1XKZA 1J3WA 3IXHA 4OPYA 4LCLA 2VEAA 1KOUA 4KZ9A 1KVLA 2OV5A 2J8YA 2KX6A 5A8BA 3IH9A 4PHTA 1FQGA 1MWTA 5HWVA 5GLAA 2WKEA 2IWDA 4JPMA 2D02A 2Q9MA 4QU3A 3QP2A 3UNWA 1G6OA 4DDYA 2Y2LA 3LI9A 1K55A 5E2GA 5HWTA 4OPZA 4PKYA 1ZTUA 4Y0OA 5L07A 2W0NA 1FSYA 1ES4A 3NC8A 4JF5A 5EFWA 5DKLA 3ZQ5A 4EEUA 5FAPA 4KZ3A 1P9WA 4N1XA 3NOTC 3MXQA 3E98A 3BFCA 4GKUA 4DRTA 3DAVA 5L2FA 2O9BA 3Q7VB 1WA9A 1LSWA 3LGOA 3HLGA 3W2ZA 2EXAA 3QHYA 4OVDA 2WKQA 1S6RA 2VGLM 4O8GA 4YINA 2WUQA 3Q7ZA 4NEED 3LIEA 5G4ZA 1OTBA 5FA7A 5A91A 3A0SA 1TS7A 1PW1A 3PBSA 1KE4A 3MKEA 2QMIA 1L0GA 4B88A 2WYXA 3A0RA 3MXRA 3LR5A 5IHVA 4EETB 2ZJ9A 4JXVA 1KDSA 3PBTA 2WKRA 2V20A 4Q0JA 4RQ9A 1E3UA 3OLOA 1T19A 3VP0A 2Y2JA 4PM5A 1G6AA 1BYWA 3SH9A 3TJZC 4HH2A 3ZCZA 1IELA 3B42A 4Y13A 4LRXC 1SHVA 4DMZA 4F94A 4HIAA 2C6WB 2Q9NA 3GSGA 4BD0A 3RJUA 4P6ZS 5CHUA 1OTDA 3HLDA 4UQIS 3FC7A 5A93A 4PM7A 4EQ1A 1PZPA 2EX2A 4K0XA 4CPKA 3N7WA 2NUTC 1BLHA 3N6IA 3BRMA 2WKIA 4U0TA 1YT4A 3G31A 4DJ2A 2Y55A 1TD5A 4R0QA 4P6BA 4DE0A 5HAQA 4WEJA 3BJNA 4MBKA 1SKFA 4FOFA 2VA0A 4LENA 3LEQA 1XGIA 1GA9A 2LB9A 3KYQA 3IF6C 1XX2A 1L2SA 3MQQA 3UDIA 1U60A 4X25A 1FCMA 3BW6A 5EUAA 4OQ0A 1EROA 3BQAA 4HESA 2GNXA 3PAEA 3KYEA 2FH5A 1S4SA 5F82A 4OQHA 3W4OA 2QZ6A 2W1TB 4H6JB 3TE8A 3UN7A 2VK3A 3VP2A 2VGJA 1HD8A 3S4XA 4FSFA 3G30A 1K55C 2W3HA 5EM0A 2Y91A 1FOFA 5CGXA 3H82B 3VP3A 4EWFA 3A0VA 3IX4A 2ZC6B 4WM9A 4CQHA 2H0YA 1L0EA 3S7PA 1S66L 1W79A 5CRFA 1K56A 4N9KA 5DKKA 4DJ3A 3BYDA 3VSLA 3ZDJA 3QP4A 3LIDA 4UAAA 5D3OA 1CEFA 3BEBA 3ITBA 4R23A 3BLMA 2X02A 2ZD8A 4HBTA 1S1YA 4GW9A 3LO7A 2H10A 3ZG7B 3EWKA 3E4QA 3QNCA 4JGQA 2V1ZA 4RYEA 4HEFA 3LCEA 2WADA 5C5KA 1YMSA 4LRZE 1Q2QA 4JF4A 1VEUB 3O3VA 2E8IA 1OPXA 4BBUA 5CHMA 3IWIA 3KX0X 2L1MA 2IA2A 4EV4A 3M6HA 1ZHHB 1GSVA 4BL3A 4BENA 2VGKA 4NXBA 3FZCA 5KSCA 3T1SA 3LEZA 1YLPA 1JTGA 4UA7A 4EQIA 2GJ3A 4GS9B 3VV4A 3IH8A 1PW8A 4P6ZM 4UQIM 4OQGA 4R38A 4ZBEA 3FV7A 4GLQA 1H3QA 3MFXA 3GECA 1RGZA 4PPRA 2ZM0A 3IXDA 1YLYA 4R4SA 3WWXA 5GLDA 4FH2A 2PBDP 3T4KA 4DKIA 3IXBA 5FEGA 1MY8A 5TBMA 2ZMAA 3ZGAB 4C6YA 4ETZA 1S67L 5GLBA 2WZXA 3A3IA 3CHWP 3WRZA 4LPZA 4N9LA 3MS6A 5E43A 3NIAA 4K08A 3AGDA 3G32A 3O88A 3C7VA 5HAPA 3ICYA 2X71A 2V1AA 5TGFA 3P7NA 3V39A 1CK3A 5M1AA 2R9WA 4KUKA 3V3RA 2IWBA 1LLBA 1K0KA 1RP5A 3SH7A 3A3FA 3DTIA 2B5RA 1BULA 4NG2A 4HP9A 1MKIA 5EOEA 3WS4A 4OPQA 4EXOA 1OTAA 3OC2A 4K0WA 3OPHA 2WGWB 1E25A 1YLTA 2DMWA 1PWGA 3MJQA 2O9AA 3HJIA 3A3EA 2WKPA 3JYIA 3F1OA 3CUEA 3C7UA 1W63Q 2EXBA 4HP4A 1XPBA 4S2IA 1QMFA 3TSGA 5EVLA 4HJ6A 1K25A 5HDCA 5TFQA 2INWA 4ZJ3A 2EA9A 5HWWA 4NK3A 3UE3A 2Y8HA 3BY9A 4KZ7A 1PWCA 5EVIA 3BY8A 3L9KA 2BASA 1KDWA 4MDZA 4MN5A 4BLMA 5M19A 3MBZA 5EM1A 1GSXA 3DTEA 5F69A 2PYPA 5DFYA 4JF6A 5HD5A 2ZOHA 5L10A 4PM9A 5L8MA 3HLCA 3VE4A 3E4PA 4FH4A 3WS5A 4E04A 1JNUA 1YLWA 3T1RA 4ARZA 1HZOA 1T1BA 4H6JA 1PI5A 3E0YA 2XRNA 5CERA 1OJGA 3LYXA 3NULA 5GHXA 1ESIA 2V8CA 3BWLA 1E3UD 3E2LA 4UA6A 4MNRA 1ALQA 2HJEA 2OLVA 4I3IA 2HF6A 2ZC3B 2W3FA 4X1MA 4E3JA 1H5XA 2A2LA 4XUZA 4K91A 2Z6CA 4QWOA 4JGPA 2E8JA 5F6AA 1A0KA 1ZC2A 2Y2MA 4Z9QA 2Y59A 1K4FA 2WAFA 1G5UA 2XGNA 1Z09A 3VSKA 1YM1A 4X69A 3PBOA 4S2NA 4OONA 1BLPA 4MN6A 1SDNA 4L9FA 5FI7A 5HDSA 1LL9A 4X55A 1MWUA 3D72A 5HFOA 1XA7A 3EOIA 4FTXA 4JLFA 3CWFA 3W8KA 4E3NA 2L0WA 3LY4A 4O01A 2MJ6A 3IX3A 3LIAA 2XD5A 1D1JA 4IHQA 4LRYC 5KZHA 4IUKA 5CEBA 2HDUA 1D7EA 1ONHA 3RH8B 1PNEA 4GS9A 2P9VA 1LT0A 2A24A 1ES3A 4EUVA 1NZUA 3HLEA 1K54A 4OP5A 1CQAA 4LCMA 4G3KA 1DP6A 4ZAMA 3SS5A 2GZAA 3P09A 2L4RA 4ZDXA 5HARA 3KYZA 3NOPC 1IYPA 4O0PA 1CF0A 1PWDA 1BUEA 3BQ8A 1LI0A 3S7OA 1K56D 3RXXA 1MKMA 3IQAA 2Z6DA 2J9PA 5DF7A 4IEDA 2DCFA 5J7EA 3FPWA 3VOZA 5AQBA 1SKOB 3ISGA 1NYYA 1K57A 4FUWA 1SZVA 3L7HA 1HLUP 4WL9A 4WN5A 3HLWA 5CTMA 2XLNA 5EVIC 5J8XA 1NZOA 1FCNA 5MC7A 4G3WA 4RX3A 4MN7A 5TBMB
chains in the Genus database with same CATH topology
2BLSA 4OPRA 3NI9A 2VGJA 3VP2A 1HD8A 3HLBA 3DWKA 3RXWA 2A3UA 4DE1A 3VFFA 1N9BA 1IYSA 2IWCA 1ESUA 2XFTA 2ZQAA 3G30A 4FSFA 4GN2A 3M2KA 3S4XA 4DE3A 4LV1A 4BJPA 3HUMA 1K55C 1YLJA 4KZBA 2Y91A 4Q8IA 1FOFA 4X6TA 5CGXA 3ZHHA 4E3OA 1ERQA 3VP3A 4EWFA 3EQVA 2ZC6B 3MXSA 1VQQA 4WM9A 2WGWA 1NXYA 2H0YA 4KZ5A 1L0EA 2Y2PA 3CJMA 4GD8A 3UPPA 2C5WB 1W79A 5CRFA 4RA7A 1K56A 4IVKA 2XF3A 4N9KA 3SS4A 3Q81A 3UN7A 3BYDA 3VSLA 1LL5A 3AGEA 3Q1FA 5GLCA 3ZDJA 3N8RA 4OOMA 4UAAA 2ZLYA 4WYYA 1K38A 3CZDA 1W5DA 5D3OA 1CEFA 3BEBA 3ITBA 4R23A 2XK1A 3BLMA 2X02A 3OPPA 2V2FF 2ZD8A 1TEMA 5DF9A 4HBTA 4IBRA 3HVFA 5A90A 3Q07A 1I5QA 4MBHA 3LO7A 2H10A 4N1HA 4IBXA 5EPHA 3IHAA 1BZAA 1ES2A 3ZG7B 3OPLA 4CJNA 3QNCA 5CTNA 5GHYA 5A92A 2XEPA 2V1ZA 3MKFA 1Y54A 4RYEA 5FATA 4HEFA 3LCEA 1NYMA 2WADA 4KZ4A 4WEKA 1YMSA 5CXWA 1Q2QA 3EQUA 3G2ZA 1YMXA 2EX9A 2WGIA 5FQ9A 4JF4A 1FCOA 4QB8A 1I2SA 2WZZA 5F1FA 1EI5A 4S2LA 3O3VA 2E8IA 1KE3A 5CHMA 3IWIA 3PBQA 4S2NC 3TOIA 4WZ5A 3M6HA 2J7VA 4EV4A 5FQJA 3C4OA 4GDBA 4S2JA 2JC7A 1XGJA 2G2WA 3ZG5A 4BL2A 3G2YA 4QJGA 4MBFA 4BL3A 4BENA 3GRJA 2VGKA 1PIOA 3CMZA 3ZNTA 4M3KA 3GR2A 1XXMA 3FZCA 3C4PA 4UHUA 5KSCA 1K4EA 4KQQA 3PBRA 5AQAA 3IHBA 3LEZA 5F1GA 4GZBA 2I72A 2HDRA 2OLUA 4JXSA 1YLPA 1TDLA 1JTGA 4UA7A 1ZKJA 4EQIA 2PU2A 1IYQA 1PW8A 1S0WA 3IH8A 5EVIB 5HL1A 4OQGA 5FSRA 3HUNA 4ZBEA 2HP5A 3FV7A 3NDGA 1DJCA 1NY0A 3UY6A 3IWQA 3C5AA 3IT9A 3BLSA 4U0XA 2R9XA 1RGZA 4S2KA 4E3KA 1NJ4A 4PPRA 1WYCA 2X01A 2ZM0A 2Y2QA 4DF6A 3ITAA 3IXDA 4R1GA 4MEZA 1YLYA 1G68A 4R4SA 3WWXA 5GLDA 4FH2A 1IKIA 1MPLA 4OLDA 3M2JA 4P0MA 3MZFA 1LI9A 1BT5A 2HDQA 3N4IA 3W4PA 3PTEA 1KGGA 4GNUA 2Z2MB 4DKIA 3IXBA 3BM6A 4KZAA 5FI6A 1MBLA 5BOHA 2CC1A 3UE0A 1MY8A 2HDSA 1BLCA 3O86A 3VOYA 2ZMAA 3ZGAB 4C6YA 3ZNYA 3FWLA 3MFDA 4S2OA 4S2PA 5GLBA 1K54C 1KE0A 2WZXA 3A3IA 3MZDA 4KG5A 3WRZA 4N9LA 1DJBA 2OSUA 3HL9A 3SOIA 1GCEA 4RX2A 5E43A 4JXGA 5HX9A 3NIAA 5FDHA 5CGWA 2ZM2A 3AGDA 3FYZA 3HBRA 4OOYA 4B4XA 2Y4AA 3G32A 3C7VA 3O88A 4KG6A 3WRTA 5FASA 3DWZA 4DXCA 5HAPA 1IEMA 3WS1A 3UPNA 5E2HA 2X71A 1ERMA 2HP6A 5TGFA 4GB7A 1W8YA 3UE1A 3A3DA 4BD1A 3PBNA 3ZVTA 3V39A 1CK3A 5M1AA 2R9WA 3CG5A 5FI2A 3AGFA 1O7EA 3ZFZA 2ZM8A 3V3RA 5EVID 2G2UA 3OCNA 2IWBA 3ZVWA 2XQZA 4QD4A 1LLBA 1RP5A 3SH7A 1JTDA 2XD1A 1ONGA 2H0TA 3A3FA 2WGVA 3TG9A 3VP1A 1LHYA 4WZ4A 2B5RA 4GD6A 1BULA 5HAIA 4R3JA 1J9MA 1MKIA 2P74A 3A3JA 3SH8A 3WS2A 1K57C 3GVBA 1MXOA 4N92A 3ZG8B 1JVJA 2JE5A 5EOEA 5DTKA 2A49A 4KENB 3WS4A 5JYPA 1PYYA 4QHCA 1KGEA 4U3TA 2WAEA 1DY6A 4R3BA 4E3LA 4OPQA 4S2MA 5FQMA 1I2WA 3QNBA 3OC2A 1ES5A 4K0WA 3HUOA 1K6SA 2WGWB 3M6BA 2EX6A 3OPHA 4BQMA 1E25A 1YLTA 5DTSA 1PWGA 1GHIA 3GQZA 1XA1A 3A3EA 4DDSA 3BECA 2EFUA 3B3XA 2Y2NA 3JYIA 3IWOA 4LV3A 1WYBA 1IKGA 3NCKA 1PZOA 4QY5A 3C7UA 3P98A 5EOOA 3BFDA 1BTLA 4FCFA 5GHZA 2EXBA 4OP8A 1XPBA 4S2IA 4JKTA 4KG2A 1H8YA 4A5RA 2ZQ7A 3IF6A 1QMFA 3N8LA 5FAOA 3TSGA 1FR6A 5JYOA 1ZG4A 5EVLA 2WK0A 1CI8A 4DE2A 3NBLA 4KZ6A 1K25A 1K6RA 1L0FA 4OOLA 3HLFA 2BG1A 5TFQA 4E6XA 1XKZA 4ZJ3A 4KQOA 4EBNA 3IXHA 5FQKA 4OPYA 3IXGA 5E2EA 3G4PA 4LCLA 3ZG9B 1RCJA 4H8RA 4NK3A 4X53A 3UE3A 4KZ9A 1KVLA 2OV5A 4C3QA 4KZ7A 3S1YA 2J8YA 4D2OA 1BSGA 1PWCA 3IH9A 5EVIA 1FQGA 1M6KA 3UDXA 3BFEA 5FQIA 1MWTA 2PU4A 2ZC4B 5CHJA 5GLAA 2WKEA 2IWDA 2Y2HA 1KDWA 2P9VB 4JPMA 1DJAA 4BLMA 4EBLA 4NETA 5DVAA 3MBZA 5M19A 5DF8A 5G18A 2Q9MA 4Y7PA 4ZJ1A 4E6WA 2ZQCA 4QU3A 4RVAA 1M40A 4JBFA 4JF6A 3VMAA 3UNWA 4PM9A 4DDYA 1E4DA 2Y2LA 1K55A 3HLCA 5E2GA 4OPZA 2XH9A 4Y0OA 2RCXA 2ZQ9A 3SS3A 2EX8A 1FSYA 3UPOA 4FH4A 3WS5A 1GHPA 4Y0TA 1ES4A 3NC8A 5KSHA 1N4OA 3MZEA 1YLWA 1SDEA 1HZOA 2XDMA 3UDFA 4KZ8A 4L0LA 5AQ7A 4JF5A 1PI5A 3FKWA 5TR7A 5CERA 4C75A 4E3IA 2JCHA 5GL9A 1IYOA 5GHXA 1ESIA 3UO9A 2FFFB 2Y2IA 5FAPA 4KZ3A 1E3UD 3E2LA 4IVIA 4N1XA 4UA6A 4MNRA 1ALQA 2OLVA 4PM6A 3Q82A 4WBGA 2ZC3B 1HTZA 4YFMA 4E3JA 3BFCA 1H5XA 1YLZA 1W7FA 4GKUA 4PM8A 4DRTA 4P87A 3BFGA 4GDNA 1ZG6A 5L2FA 4XUZA 4ZJ2A 4K91A 5EE8A 3Q7VB 3VP4A 2H5SA 3ZG0A 3HLGA 3V5MA 2ZQDA 1CI9A 4R4RA 2HP9A 2Y2MA 1ZC2A 4Z9QA 2EXAA 2Y59A 3QHYA 1RGYA 4OVDA 1S6RA 4E3MA 2Y2GA 4YINA 2WUQA 4EUZA 3Q7ZA 1K4FA 3GMWA 2WAFA 2Y2OA 1FSWA 1Q2PA 2XGNA 3VSKA 1FR1A 1JWZA 2JBFA 1YM1A 4X69A 3OPRA 3PBOA 4LV0A 4OONA 3OCLA 1BLPA 4O7DA 2DRWA 4S2NA 3G34A 5M18A 2DNSA 1SDNA 5FA7A 1OMEA 5A91A 4ID4A 4EBPA 4DXBA 1NRFA 1PW1A 3V50A 3PBSA 4WMCD 1KE4A 5FI7A 3MKEA 4XXRA 2GDNA 1LL9A 5CECA 5FAQA 2QMIA 1L0GA 3E2KA 4X55A 1TVFA 4B88A 1MWUA 1KGFA 2WYXA 1GHMA 1PI4A 1XP4A 1H8ZA 5HFOA 3MXRA 1XA7A 5AQ9A 1EWZA 3O87A 4HBUA 2QPNA 4ZTKA 1MWRA 2XR0A 5IHVA 2ZJ9A 4JXVA 4JLFA 1KDSA 3PBTA 2V20A 1HVBA 5EECA 1E3UA 3VP0A 2Y2JA 4PM5A 1AXBA 1BLSA 3W8KA 1G6AA 4E3NA 3LY4A 4OQIA 2HPBA 4Y0UA 3SH9A 4OH0A 4WELA 4PMAA 2ZC7A 2XD5A 4OLGA 1IELA 3ZCZA 2FFYA 1SCWA 5E2FA 3OZHA 5KZHA 3BFFA 1YQSA 2J9OA 1JWVA 1SHVA 5CGSA 4F94A 2C6WB 2Q9NA 3D4FA 5CEBA 2HDUA 3GSGA 4BD0A 3RJUA 1ONHA 5CHUA 3HLDA 1W8QA 2RL3A 5A93A 1L0DA 4FD8A 4PM7A 2P9VA 3GTCA 2ZC5B 2ZQ8A 2PBYA 3FKVA 3PAGA 1GA0A 2UWXA 3WS0A 1ES3A 3HREA 1PZPA 1NZUA 2EX2A 4K0XA 1VM1A 3HLEA 3IF6B 4CPKA 1K54A 3N7WA 3NY4A 4OP5A 4LCMA 1BLHA 3N6IA 4ZAMA 3SS5A 1TDGA 3BRMA 1KVMA 2WKIA 1YT4A 4U0TA 3P09A 4X68A 1O07A 2Y2KA 1QMEA 3G31A 2Y55A 5HARA 4ZDXA 1MWSA 3DTMA 1IYPA 4WMCA 1PWDA 4R0QA 1BUEA 4P6BA 4JXWA 4DE0A 5HAQA 4WEJA 1LI0A 5KMWA 3IF5A 4MBKA 4XUXA 1SKFA 1C3BA 3I7JA 1K56D 4LENA 3RXXA 1JWPA 1XGIA 3IQAA 1GA9A 3GV9A 2J9PA 4B4ZA 5DF7A 4IEDA 3IF6C 3DW0A 2DCFA 3V3SA 1XX2A 3LY3A 4UA9A 4X56A 5DTTA 5U47A 1L2SA 2EFXA 4WZ5C 1CEGA 3VFHA 5AQBA 3VOZA 5F83A 3ISGA 3UDIA 1NYYA 2WKHA 2XFSA 1Z6FA 1U60A 5FQQA 1K57A 4KQRA 2Z2LB 3W4QA 1FCMA 3NDEA 4QY6A 1WE4A 5EUAA 5HW3A 4MLLA 4OQ0A 5CEDA 1EROA 3HLWA 3Q7VA 4LV2A 2XLNA 5CTMA 4HESA 5EVIC 5J8XA 3PAEA 4P85A 1NZOA 1FCNA 5F82A 4OQHA 3W4OA 2QZ6A 3G35A 4RX3A 4GOGA 5I94A 3N8SA 4OKPA 3S22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BLS A;  4OPR A;  3NI9 A;  2VGJ A;  3VP2 A;  1HD8 A;  3HLB A;  3DWK A;  3RXW A;  2A3U A;  4DE1 A;  3VFF A;  1N9B A;  1IYS A;  2IWC A;  1ESU A;  2XFT A;  2ZQA A;  3G30 A;  4FSF A;  4GN2 A;  3M2K A;  3S4X A;  4DE3 A;  4LV1 A;  4BJP A;  3HUM A;  1K55 C;  1YLJ A;  4KZB A;  2Y91 A;  4Q8I A;  1FOF A;  4X6T A;  5CGX A;  3ZHH A;  4E3O A;  1ERQ A;  3VP3 A;  4EWF A;  3EQV A;  2ZC6 B;  3MXS A;  1VQQ A;  4WM9 A;  2WGW A;  1NXY A;  2H0Y A;  4KZ5 A;  1L0E A;  2Y2P A;  3CJM A;  4GD8 A;  3UPP A;  2C5W B;  1W79 A;  5CRF A;  4RA7 A;  1K56 A;  4IVK A;  2XF3 A;  4N9K A;  3SS4 A;  3Q81 A;  3UN7 A;  3BYD A;  3VSL A;  1LL5 A;  3AGE A;  3Q1F A;  5GLC A;  3ZDJ A;  3N8R A;  4OOM A;  4UAA A;  2ZLY A;  4WYY A;  1K38 A;  3CZD A;  1W5D A;  5D3O A;  1CEF A;  3BEB A;  3ITB A;  4R23 A;  2XK1 A;  3BLM A;  2X02 A;  3OPP A;  2V2F F;  2ZD8 A;  1TEM A;  5DF9 A;  4HBT A;  4IBR A;  3HVF A;  5A90 A;  3Q07 A;  1I5Q A;  4MBH A;  3LO7 A;  2H10 A;  4N1H A;  4IBX A;  5EPH A;  3IHA A;  1BZA A;  1ES2 A;  3ZG7 B;  3OPL A;  4CJN A;  3QNC A;  5CTN A;  5GHY A;  5A92 A;  2XEP A;  2V1Z A;  3MKF A;  1Y54 A;  4RYE A;  5FAT A;  4HEF A;  3LCE A;  1NYM A;  2WAD A;  4KZ4 A;  4WEK A;  1YMS A;  5CXW A;  1Q2Q A;  3EQU A;  3G2Z A;  1YMX A;  2EX9 A;  2WGI A;  5FQ9 A;  4JF4 A;  1FCO A;  4QB8 A;  1I2S A;  2WZZ A;  5F1F A;  1EI5 A;  4S2L A;  3O3V A;  2E8I A;  1KE3 A;  5CHM A;  3IWI A;  3PBQ A;  4S2N C;  3TOI A;  4WZ5 A;  3M6H A;  2J7V A;  4EV4 A;  5FQJ A;  3C4O A;  4GDB A;  4S2J A;  2JC7 A;  1XGJ A;  2G2W A;  3ZG5 A;  4BL2 A;  3G2Y A;  4QJG A;  4MBF A;  4BL3 A;  4BEN A;  3GRJ A;  2VGK A;  1PIO A;  3CMZ A;  3ZNT A;  4M3K A;  3GR2 A;  1XXM A;  3FZC A;  3C4P A;  4UHU A;  5KSC A;  1K4E A;  4KQQ A;  3PBR A;  5AQA A;  3IHB A;  3LEZ A;  5F1G A;  4GZB A;  2I72 A;  2HDR A;  2OLU A;  4JXS A;  1YLP A;  1TDL A;  1JTG A;  4UA7 A;  1ZKJ A;  4EQI A;  2PU2 A;  1IYQ A;  1PW8 A;  1S0W A;  3IH8 A;  5EVI B;  5HL1 A;  4OQG A;  5FSR A;  3HUN A;  4ZBE A;  2HP5 A;  3FV7 A;  3NDG A;  1DJC A;  1NY0 A;  3UY6 A;  3IWQ A;  3C5A A;  3IT9 A;  3BLS A;  4U0X A;  2R9X A;  1RGZ A;  4S2K A;  4E3K A;  1NJ4 A;  4PPR A;  1WYC A;  2X01 A;  2ZM0 A;  2Y2Q A;  4DF6 A;  3ITA A;  3IXD A;  4R1G A;  4MEZ A;  1YLY A;  1G68 A;  4R4S A;  3WWX A;  5GLD A;  4FH2 A;  1IKI A;  1MPL A;  4OLD A;  3M2J A;  4P0M A;  3MZF A;  1LI9 A;  1BT5 A;  2HDQ A;  3N4I A;  3W4P A;  3PTE A;  1KGG A;  4GNU A;  2Z2M B;  4DKI A;  3IXB A;  3BM6 A;  4KZA A;  5FI6 A;  1MBL A;  5BOH A;  2CC1 A;  3UE0 A;  1MY8 A;  2HDS A;  1BLC A;  3O86 A;  3VOY A;  2ZMA A;  3ZGA B;  4C6Y A;  3ZNY A;  3FWL A;  3MFD A;  4S2O A;  4S2P A;  5GLB A;  1K54 C;  1KE0 A;  2WZX A;  3A3I A;  3MZD A;  4KG5 A;  3WRZ A;  4N9L A;  1DJB A;  2OSU A;  3HL9 A;  3SOI A;  1GCE A;  4RX2 A;  5E43 A;  4JXG A;  5HX9 A;  3NIA A;  5FDH A;  5CGW A;  2ZM2 A;  3AGD A;  3FYZ A;  3HBR A;  4OOY A;  4B4X A;  2Y4A A;  3G32 A;  3C7V A;  3O88 A;  4KG6 A;  3WRT A;  5FAS A;  3DWZ A;  4DXC A;  5HAP A;  1IEM A;  3WS1 A;  3UPN A;  5E2H A;  2X71 A;  1ERM A;  2HP6 A;  5TGF A;  4GB7 A;  1W8Y A;  3UE1 A;  3A3D A;  4BD1 A;  3PBN A;  3ZVT A;  3V39 A;  1CK3 A;  5M1A A;  2R9W A;  3CG5 A;  5FI2 A;  3AGF A;  1O7E A;  3ZFZ A;  2ZM8 A;  3V3R A;  5EVI D;  2G2U A;  3OCN A;  2IWB A;  3ZVW A;  2XQZ A;  4QD4 A;  1LLB A;  1RP5 A;  3SH7 A;  1JTD A;  2XD1 A;  1ONG A;  2H0T A;  3A3F A;  2WGV A;  3TG9 A;  3VP1 A;  1LHY A;  4WZ4 A;  2B5R A;  4GD6 A;  1BUL A;  5HAI A;  4R3J A;  1J9M A;  1MKI A;  2P74 A;  3A3J A;  3SH8 A;  3WS2 A;  1K57 C;  3GVB A;  1MXO A;  4N92 A;  3ZG8 B;  1JVJ A;  2JE5 A;  5EOE A;  5DTK A;  2A49 A;  4KEN B;  3WS4 A;  5JYP A;  1PYY A;  4QHC A;  1KGE A;  4U3T A;  2WAE A;  1DY6 A;  4R3B A;  4E3L A;  4OPQ A;  4S2M A;  5FQM A;  1I2W A;  3QNB A;  3OC2 A;  1ES5 A;  4K0W A;  3HUO A;  1K6S A;  2WGW B;  3M6B A;  2EX6 A;  3OPH A;  4BQM A;  1E25 A;  1YLT A;  5DTS A;  1PWG A;  1GHI A;  3GQZ A;  1XA1 A;  3A3E A;  4DDS A;  3BEC A;  2EFU A;  3B3X A;  2Y2N A;  3JYI A;  3IWO A;  4LV3 A;  1WYB A;  1IKG A;  3NCK A;  1PZO A;  4QY5 A;  3C7U A;  3P98 A;  5EOO A;  3BFD A;  1BTL A;  4FCF A;  5GHZ A;  2EXB A;  4OP8 A;  1XPB A;  4S2I A;  4JKT A;  4KG2 A;  1H8Y A;  4A5R A;  2ZQ7 A;  3IF6 A;  1QMF A;  3N8L A;  5FAO A;  3TSG A;  1FR6 A;  5JYO A;  1ZG4 A;  5EVL A;  2WK0 A;  1CI8 A;  4DE2 A;  3NBL A;  4KZ6 A;  1K25 A;  1K6R A;  1L0F A;  4OOL A;  3HLF A;  2BG1 A;  5TFQ A;  4E6X A;  1XKZ A;  4ZJ3 A;  4KQO A;  4EBN A;  3IXH A;  5FQK A;  4OPY A;  3IXG A;  5E2E A;  3G4P A;  4LCL A;  3ZG9 B;  1RCJ A;  4H8R A;  4NK3 A;  4X53 A;  3UE3 A;  4KZ9 A;  1KVL A;  2OV5 A;  4C3Q A;  4KZ7 A;  3S1Y A;  2J8Y A;  4D2O A;  1BSG A;  1PWC A;  3IH9 A;  5EVI A;  1FQG A;  1M6K A;  3UDX A;  3BFE A;  5FQI A;  1MWT A;  2PU4 A;  2ZC4 B;  5CHJ A;  5GLA A;  2WKE A;  2IWD A;  2Y2H A;  1KDW A;  2P9V B;  4JPM A;  1DJA A;  4BLM A;  4EBL A;  4NET A;  5DVA A;  3MBZ A;  5M19 A;  5DF8 A;  5G18 A;  2Q9M A;  4Y7P A;  4ZJ1 A;  4E6W A;  2ZQC A;  4QU3 A;  4RVA A;  1M40 A;  4JBF A;  4JF6 A;  3VMA A;  3UNW A;  4PM9 A;  4DDY A;  1E4D A;  2Y2L A;  1K55 A;  3HLC A;  5E2G A;  4OPZ A;  2XH9 A;  4Y0O A;  2RCX A;  2ZQ9 A;  3SS3 A;  2EX8 A;  1FSY A;  3UPO A;  4FH4 A;  3WS5 A;  1GHP A;  4Y0T A;  1ES4 A;  3NC8 A;  5KSH A;  1N4O A;  3MZE A;  1YLW A;  1SDE A;  1HZO A;  2XDM A;  3UDF A;  4KZ8 A;  4L0L A;  5AQ7 A;  4JF5 A;  1PI5 A;  3FKW A;  5TR7 A;  5CER A;  4C75 A;  4E3I A;  2JCH A;  5GL9 A;  1IYO A;  5GHX A;  1ESI A;  3UO9 A;  2FFF B;  2Y2I A;  5FAP A;  4KZ3 A;  1E3U D;  3E2L A;  4IVI A;  4N1X A;  4UA6 A;  4MNR A;  1ALQ A;  2OLV A;  4PM6 A;  3Q82 A;  4WBG A;  2ZC3 B;  1HTZ A;  4YFM A;  4E3J A;  3BFC A;  1H5X A;  1YLZ A;  1W7F A;  4GKU A;  4PM8 A;  4DRT A;  4P87 A;  3BFG A;  4GDN A;  1ZG6 A;  5L2F A;  4XUZ A;  4ZJ2 A;  4K91 A;  5EE8 A;  3Q7V B;  3VP4 A;  2H5S A;  3ZG0 A;  3HLG A;  3V5M A;  2ZQD A;  1CI9 A;  4R4R A;  2HP9 A;  2Y2M A;  1ZC2 A;  4Z9Q A;  2EXA A;  2Y59 A;  3QHY A;  1RGY A;  4OVD A;  1S6R A;  4E3M A;  2Y2G A;  4YIN A;  2WUQ A;  4EUZ A;  3Q7Z A;  1K4F A;  3GMW A;  2WAF A;  2Y2O A;  1FSW A;  1Q2P A;  2XGN A;  3VSK A;  1FR1 A;  1JWZ A;  2JBF A;  1YM1 A;  4X69 A;  3OPR A;  3PBO A;  4LV0 A;  4OON A;  3OCL A;  1BLP A;  4O7D A;  2DRW A;  4S2N A;  3G34 A;  5M18 A;  2DNS A;  1SDN A;  5FA7 A;  1OME A;  5A91 A;  4ID4 A;  4EBP A;  4DXB A;  1NRF A;  1PW1 A;  3V50 A;  3PBS A;  4WMC D;  1KE4 A;  5FI7 A;  3MKE A;  4XXR A;  2GDN A;  1LL9 A;  5CEC A;  5FAQ A;  2QMI A;  1L0G A;  3E2K A;  4X55 A;  1TVF A;  4B88 A;  1MWU A;  1KGF A;  2WYX A;  1GHM A;  1PI4 A;  1XP4 A;  1H8Z A;  5HFO A;  3MXR A;  1XA7 A;  5AQ9 A;  1EWZ A;  3O87 A;  4HBU A;  2QPN A;  4ZTK A;  1MWR A;  2XR0 A;  5IHV A;  2ZJ9 A;  4JXV A;  4JLF A;  1KDS A;  3PBT A;  2V20 A;  1HVB A;  5EEC A;  1E3U A;  3VP0 A;  2Y2J A;  4PM5 A;  1AXB A;  1BLS A;  3W8K A;  1G6A A;  4E3N A;  3LY4 A;  4OQI A;  2HPB A;  4Y0U A;  3SH9 A;  4OH0 A;  4WEL A;  4PMA A;  2ZC7 A;  2XD5 A;  4OLG A;  1IEL A;  3ZCZ A;  2FFY A;  1SCW A;  5E2F A;  3OZH A;  5KZH A;  3BFF A;  1YQS A;  2J9O A;  1JWV A;  1SHV A;  5CGS A;  4F94 A;  2C6W B;  2Q9N A;  3D4F A;  5CEB A;  2HDU A;  3GSG A;  4BD0 A;  3RJU A;  1ONH A;  5CHU A;  3HLD A;  1W8Q A;  2RL3 A;  5A93 A;  1L0D A;  4FD8 A;  4PM7 A;  2P9V A;  3GTC A;  2ZC5 B;  2ZQ8 A;  2PBY A;  3FKV A;  3PAG A;  1GA0 A;  2UWX A;  3WS0 A;  1ES3 A;  3HRE A;  1PZP A;  1NZU A;  2EX2 A;  4K0X A;  1VM1 A;  3HLE A;  3IF6 B;  4CPK A;  1K54 A;  3N7W A;  3NY4 A;  4OP5 A;  4LCM A;  1BLH A;  3N6I A;  4ZAM A;  3SS5 A;  1TDG A;  3BRM A;  1KVM A;  2WKI A;  1YT4 A;  4U0T A;  3P09 A;  4X68 A;  1O07 A;  2Y2K A;  1QME A;  3G31 A;  2Y55 A;  5HAR A;  4ZDX A;  1MWS A;  3DTM A;  1IYP A;  4WMC A;  1PWD A;  4R0Q A;  1BUE A;  4P6B A;  4JXW A;  4DE0 A;  5HAQ A;  4WEJ A;  1LI0 A;  5KMW A;  3IF5 A;  4MBK A;  4XUX A;  1SKF A;  1C3B A;  3I7J A;  1K56 D;  4LEN A;  3RXX A;  1JWP A;  1XGI A;  3IQA A;  1GA9 A;  3GV9 A;  2J9P A;  4B4Z A;  5DF7 A;  4IED A;  3IF6 C;  3DW0 A;  2DCF A;  3V3S A;  1XX2 A;  3LY3 A;  4UA9 A;  4X56 A;  5DTT A;  5U47 A;  1L2S A;  2EFX A;  4WZ5 C;  1CEG A;  3VFH A;  5AQB A;  3VOZ A;  5F83 A;  3ISG A;  3UDI A;  1NYY A;  2WKH A;  2XFS A;  1Z6F A;  1U60 A;  5FQQ A;  1K57 A;  4KQR A;  2Z2L B;  3W4Q A;  1FCM A;  3NDE A;  4QY6 A;  1WE4 A;  5EUA A;  5HW3 A;  4MLL A;  4OQ0 A;  5CED A;  1ERO A;  3HLW A;  3Q7V A;  4LV2 A;  2XLN A;  5CTM A;  4HES A;  5EVI C;  5J8X A;  3PAE A;  4P85 A;  1NZO A;  1FCN A;  5F82 A;  4OQH A;  3W4O A;  2QZ6 A;  3G35 A;  4RX3 A;  4GOG A;  5I94 A;  3N8S A;  4OKP A;  3S22 A; 
#chains in the Genus database with same CATH topology
 2BLS A;  3VE3 A;  1IFQ A;  2PAV P;  3HLB A;  3DWK A;  1N9B A;  1IYS A;  1ESU A;  2VV6 A;  4CLC E;  3HUM A;  2VJW A;  1MZU A;  1UWP X;  4Q8I A;  3ZHH A;  4IUH A;  4JGO A;  3QP6 A;  1ERQ A;  4EEP A;  3MXS A;  2WGW A;  3CJM A;  4GD8 A;  2BTF P;  1X0O A;  2C5W B;  3EGD C;  4IVK A;  3Q81 A;  4EW7 A;  5GLC A;  3N8R A;  4OOM A;  4B93 A;  1W5D A;  3F1P B;  2XK1 A;  2P04 A;  5DF9 A;  4IBR A;  3HVF A;  3JPU A;  4MBH A;  5HPI A;  2PRF A;  1BZA A;  1ES2 A;  3MR0 A;  5CTN A;  5A92 A;  3DTK A;  1Y54 A;  4KZ4 A;  4WEK A;  4ESP A;  5CXW A;  1EW0 A;  3EQU A;  3F1O B;  3G2Z A;  1YMX A;  4QB8 A;  2OWH A;  2WZZ A;  4S2L A;  2ACG A;  4S2N C;  3TOI A;  4WZ5 A;  5I5L A;  2J7V A;  5FQJ A;  3U4L P;  4GDB A;  4X1L A;  2JC7 A;  2G2W A;  2VX8 A;  3ZG5 A;  4QJG A;  3G2Y A;  1OT9 A;  2OAQ 1;  1PFL A;  1TS8 A;  4M3K A;  4M4X A;  2W3G A;  5AQA A;  2QHK A;  4YWZ A;  2I72 A;  4JXS A;  2OLU A;  3CLO A;  5HL1 A;  5EVI B;  3MQO A;  5FSR A;  2HP5 A;  3C5A A;  1NJ4 A;  2X01 A;  3RFB A;  4D60 A;  2Y2Q A;  4MEZ A;  3CAX A;  1MPL A;  1OJ5 A;  4P0M A;  3MZF A;  4HI4 A;  3N4I A;  4GNU A;  2Z2M B;  3BM6 A;  5FI6 A;  2ZL1 B;  2CC1 A;  3O86 A;  3VOY A;  5IS1 A;  3PR6 A;  4ARZ B;  5AVE A;  4S2O A;  4S2P A;  1K54 C;  2OSU A;  2JKG A;  5FDH A;  2PT7 A;  3FYZ A;  1XJ2 A;  4OOY A;  5HL6 A;  2Y4A A;  3WRT A;  1TS6 A;  3RTY A;  1ERM A;  4QPR A;  1DP9 A;  4R6L A;  2J3T D;  3NOU C;  2M7V A;  3CG5 A;  5FI2 A;  3AGF A;  3ZFZ A;  5EVI D;  2PHY A;  5F5Y A;  4HQA A;  2P7J A;  2H0T A;  2WGV A;  4WZ4 A;  5HAI A;  4R3J A;  1J9M A;  1K57 C;  3F1N A;  1MXO A;  4N92 A;  1PRQ A;  2JE5 A;  4I39 A;  4XT2 A;  1VB6 A;  1KGE A;  4U3T A;  2WAE A;  4E3L A;  4S2M A;  2JKR M;  3HUO A;  3M6B A;  4BQM A;  2XSS A;  4GJ4 A;  1GHI A;  1YSQ A;  3GQZ A;  1GSW A;  1YKD A;  2EFU A;  2K2N A;  2Y2N A;  4QY5 A;  2ZOI A;  3P98 A;  3BFD A;  4PKY G;  5GHZ A;  4OP8 A;  4CJN A;  4JKT A;  1H8Y A;  5FAO A;  3LFV A;  3HLF A;  1W63 M;  1XJ6 A;  4E6X A;  4KQO A;  4EBN A;  3IXG A;  3ZG9 B;  1RCJ A;  4Y3I A;  4H8R A;  4X53 A;  1LSV A;  4C3Q A;  1BSG A;  3UDX A;  5FQI A;  4LGW A;  5CHJ A;  3KSH A;  2Y2H A;  2P9V B;  2CMN A;  1DJA A;  2A24 B;  4NET A;  1S1Z A;  5DF8 A;  1Y4O A;  3MF0 A;  4NKP A;  2ZQC A;  1SKO A;  4RVA A;  4JBF A;  1LL8 A;  2RCX A;  3SS3 A;  2EX8 A;  2V1B A;  3UPO A;  1GHP A;  5KSH A;  1SDE A;  2XDM A;  4KZ8 A;  5AQ7 A;  5TR7 A;  4E3I A;  4C75 A;  2JCH A;  1IOU A;  4CLC B;  4IVI A;  5DJT A;  2K7S A;  4PM6 A;  4WF0 A;  4WBG A;  5LBR A;  1YLZ A;  3UMD A;  3BFG A;  3QP8 A;  1ZG6 A;  1CJF A;  4B9O A;  4KUO A;  4I3J A;  2PYR A;  3MMH A;  3VP4 A;  2H5S A;  2OAP 1;  3V5M A;  1Y28 A;  2ZQD A;  1CI9 A;  1RGY A;  4E3M A;  2Y2G A;  3GMW A;  3TRC A;  1Q2P A;  2XA7 M;  1FR1 A;  1OTE A;  2ZMF A;  3F1P A;  3C38 A;  4HOI A;  4LV0 A;  3T4S A;  3UE6 A;  4O7D A;  5M18 A;  3S7N A;  4EBP A;  3B47 A;  2AVX A;  5CX7 A;  1NRF A;  2VV8 A;  2GDN A;  4GCZ A;  1S4R A;  1KGF A;  1GHM A;  1H8Z A;  5AQ9 A;  1EWZ A;  3O87 A;  4ZTK A;  2QPN A;  1MWR A;  2XR0 A;  4CLC D;  1V9Y A;  2B95 A;  5EEC A;  2R78 A;  1BLS A;  2HPB A;  4Y0U A;  3UB6 A;  4UEY A;  4OH0 A;  4WEL A;  2ZC7 A;  1SCW A;  3BFF A;  2VKS A;  1JWV A;  1UGU A;  5CGS A;  3T1Q B;  3D4F A;  1LSX A;  3ZYT A;  1OT6 A;  2Q0O A;  1W8Q A;  2ZQ8 A;  2PBY A;  3FKV A;  4F3L B;  3PAG A;  3WS0 A;  4ME4 A;  3KSG A;  1VM1 A;  1YPR A;  3T4Q A;  1VHM A;  1TDG A;  4L9G A;  1O07 A;  2KOI A;  4WMC A;  3FPV A;  3VOL A;  3KSI A;  5KMW A;  3IF5 A;  2ZL1 A;  2QYB A;  3I7J A;  5IT5 A;  1P9R A;  3GV9 A;  4B4Z A;  3DW0 A;  4UA9 A;  5DTT A;  2PR5 A;  5U47 A;  3VFH A;  1CEG A;  5F83 A;  2WKH A;  1Z6F A;  2Z2L B;  3W4Q A;  4QY6 A;  5HW3 A;  2YKH A;  2PD8 A;  5CED A;  3H7W B;  4MMN A;  4Y2F A;  2QJ7 A;  3UB5 P;  4P85 A;  4AFI A;  3G35 A;  3R4K A;  3N8S A;  3S22 A;  4OPR A;  3NI9 A;  2J80 A;  2A3U A;  3VFF A;  4BMW A;  3M2K A;  3CIT A;  4LV1 A;  4Y17 A;  1NXY A;  3JVV A;  4BWI A;  2Y2P A;  3T50 A;  2PD7 A;  3UPP A;  2JKT I;  3K3C A;  2XF3 A;  3SS4 A;  3HJK A;  4HJ4 A;  1LL5 A;  3AGE A;  3Q1F A;  2B02 A;  1K38 A;  4IJG A;  2QWS A;  1ODV A;  5EV0 A;  1XJ4 A;  3F1N B;  3OPP A;  2V2F F;  1TEM A;  4XT2 B;  5A90 A;  2XRO A;  4N1H A;  5EPH A;  4ZRR A;  3OPL A;  5GHY A;  2PDR A;  3MKF A;  2VV7 A;  2KLI A;  3S1Y A;  3T4J A;  2EX9 A;  1D06 A;  1P0Z A;  1FCO A;  1I2S A;  5F1F A;  1EI5 A;  1NRJ A;  1OTI A;  1KE3 A;  3PBQ A;  4S2J A;  4BL2 A;  2JKR I;  2NUP C;  3GRJ A;  1T1A A;  3CMZ A;  3LIF A;  3ZNT A;  1XXM A;  3C4P A;  1K4E A;  5F68 A;  5F1G A;  3MSH A;  1ZKJ A;  4Q0I A;  2W3E A;  3OOV A;  2H28 A;  3HUN A;  3CUE C;  4I3A A;  3NDG A;  1DJC A;  3UY6 A;  3IWQ A;  3BLS A;  4U0X A;  4CLC A;  3UME A;  4S2K A;  4E3K A;  1WYC A;  4DF6 A;  4R1G A;  4HJ3 A;  1FIK A;  1YSP A;  3HCY A;  1IKI A;  4OLD A;  3NHQ A;  1TS0 A;  1LI9 A;  5G4Y A;  2HDQ A;  3W4P A;  2J3T C;  4KZA A;  2OWJ A;  2EWV A;  4NXE A;  3R7W A;  3UE0 A;  2M1C A;  1BLC A;  3MQ0 A;  3FWL A;  3MFD A;  3MZD A;  3HL9 A;  4JXG A;  2I9V A;  5CGW A;  3HBR A;  4B4X A;  2LB5 A;  1DRM A;  4KG6 A;  3LIC A;  3DWZ A;  4DXC A;  3WS1 A;  3UPN A;  5E2H A;  3C2W A;  3UE1 A;  3A3D A;  4BD1 A;  3T4L A;  4HH3 A;  3ZVT A;  4DN0 A;  2KDK A;  1XJ3 A;  2G2U A;  3OCN A;  3LIB A;  3ZVW A;  2XQZ A;  4QD4 A;  1JTD A;  2XD1 A;  1ONG A;  4NXG A;  5KIZ A;  3VP1 A;  1LHY A;  3A3J A;  3GVB A;  3ZG8 B;  3DBA A;  4KEN B;  5JYP A;  5HZH A;  1STZ A;  3QNB A;  5L09 A;  1K6S A;  2W27 A;  2EX6 A;  5DTS A;  3PYP A;  5HD3 A;  4DDS A;  3BEC A;  3CPT B;  3B3X A;  1NLY A;  3IX8 A;  1WYB A;  3NCK A;  4F3L A;  1BTL A;  4KG2 A;  2ZQ7 A;  1FR6 A;  3IS2 B;  2WK0 A;  4DE2 A;  3NBL A;  2JHE A;  4KZ6 A;  3LUQ A;  1K6R A;  1L0F A;  3D3O A;  1H8M A;  3IBR A;  3C8C A;  5FQK A;  5E2E A;  3G4P A;  1H0M A;  4D2O A;  4Z1W A;  1M6K A;  3BFE A;  2VZW A;  2ZC4 B;  2PU4 A;  3O5Y A;  2D01 A;  2EWW A;  4EBL A;  5DVA A;  1XFN A;  4LFU A;  5G18 A;  3V67 A;  4Y7P A;  4E6W A;  1M40 A;  3VMA A;  1NLZ A;  1E4D A;  3ULF A;  2XH9 A;  2ZQ9 A;  3H7W A;  4EU0 A;  4Y0T A;  3U2A A;  4R3A A;  1T1C A;  1N4O A;  3MZE A;  1DP8 A;  3C30 A;  3UDF A;  4L0L A;  3FKW A;  4NXF A;  5GL9 A;  1IYO A;  2JKT M;  2XA7 S;  3UO9 A;  2FFF B;  2Y2I A;  3SZT A;  3Q82 A;  2HZ5 A;  4MCW A;  3LR4 A;  1HTZ A;  2B18 A;  4YFM A;  1VET B;  1W7F A;  4PM8 A;  5DJU A;  4P87 A;  3CI6 A;  4GDN A;  4ZJ2 A;  4I38 A;  5EE8 A;  3ZG0 A;  4LLO B;  4R4R A;  2HP9 A;  1UWN X;  2W3D A;  1YAX A;  3EEA A;  4EUZ A;  4CLC C;  3KSF A;  2Y2O A;  1FSW A;  3FG8 A;  1JWZ A;  2JBF A;  3E4O A;  3OPR A;  3OCL A;  2DRW A;  3G34 A;  3T1X A;  4HNB A;  2DNS A;  3B33 A;  1OME A;  4ID4 A;  4DXB A;  4YOF A;  3V50 A;  2HV1 A;  4WMC D;  4XXR A;  5CEC A;  5FAQ A;  3T12 B;  3E2K A;  1TVF A;  1PI4 A;  1XP4 A;  1P97 A;  4HBU A;  2V8F A;  2Y79 A;  1HVB A;  4BBV A;  1AXB A;  4WUJ A;  3LR0 A;  4OQI A;  3G6O A;  4PMA A;  3UB9 A;  4OLG A;  2P08 A;  2FFY A;  4GHI B;  5E2F A;  1AWI A;  3OZH A;  1YQS A;  2J9O A;  3LR3 A;  5FL3 A;  5IU1 A;  4EES A;  2RL3 A;  4HY8 A;  2J3W A;  1L0D A;  5FEF A;  3GDI A;  4FD8 A;  3GTC A;  3PXP A;  4WLA A;  2ZC5 B;  2UV0 E;  1F2K A;  1GA0 A;  2UWX A;  3HRE A;  3IF6 B;  3NY4 A;  1G28 A;  1KVM A;  4X68 A;  2Y2K A;  1QME A;  1MWS A;  4BBT A;  3DTM A;  1N9L A;  1N9N A;  1TF1 A;  2V9A A;  4Y5F A;  4JXW A;  4XUX A;  5EVE A;  1C3B A;  4II7 A;  1JWP A;  3V3S A;  1NWZ A;  3LY3 A;  4X56 A;  5TJJ A;  2EFX A;  4WZ5 C;  2K31 A;  2XFS A;  5FQQ A;  4KQR A;  5K5B A;  3OBF A;  3NDE A;  1WE4 A;  4MLL A;  3H9W A;  1L3L A;  1F98 A;  2ZMV A;  3Q7V A;  4LV2 A;  4EER A;  2HJ9 C;  2YKF A;  2O9C A;  4GOG A;  3KO6 A;  3R7W B;  5I94 A;  4OKP A;  3RXW A;  4DE1 A;  2V0W A;  2IWC A;  2O0Y A;  2XFT A;  2ZQA A;  4GN2 A;  4DE3 A;  2PR6 A;  4I5S A;  4BJP A;  1YLJ A;  4KZB A;  4HHD A;  4X6T A;  4E3O A;  2O99 A;  2W1R A;  3EQV A;  1VQQ A;  4KZ5 A;  5AJG A;  4R70 A;  4RA7 A;  3CPT A;  3JVU A;  3UB8 A;  2QKP A;  2V0U A;  2ZLY A;  4WYY A;  3CZD A;  1ACF A;  2JN7 A;  3PHY A;  3IS2 A;  3EGX C;  5FDS A;  3S7Q A;  3Q07 A;  1I5Q A;  5HSQ A;  4IBX A;  3NEC A;  3IHA A;  1V9Z A;  2G7U A;  4ETX A;  4Y15 A;  2XEP A;  4PAU A;  5FAT A;  1NYM A;  4ZJ1 A;  2WGI A;  5FQ9 A;  1F9I A;  5AVF A;  1N9O A;  3C4O A;  1XGJ A;  1XFQ A;  4MBF A;  1PIO A;  3GR2 A;  4UHU A;  4KQQ A;  3PBR A;  3IHB A;  4YNR A;  4GZB A;  4JGR A;  2HDR A;  5DFX A;  1TDL A;  3K2N A;  2PU2 A;  1IYQ A;  1S0W A;  3IBJ A;  1NY0 A;  1MC0 A;  3IT9 A;  2R9X A;  3ITA A;  1G68 A;  5HPF A;  1VET A;  2HGV A;  3M2J A;  1BT5 A;  5J3W A;  5J4E A;  3PTE A;  1KGG A;  1F5M A;  1MBL A;  2W1T A;  5BOH A;  2VGL S;  2HDS A;  3ZNY A;  1KE0 A;  4KG5 A;  1DJB A;  3SOI A;  1GCE A;  4RX2 A;  5HDD A;  5HX9 A;  3H82 A;  2ZM2 A;  5FAS A;  3D9Y A;  1IEM A;  2HP6 A;  4GB7 A;  1W8Y A;  3PBN A;  3QP5 A;  1FIL A;  3K3D A;  1O7E A;  2ZM8 A;  2FZ0 A;  3LI8 A;  3TG9 A;  2M7U A;  4GD6 A;  2P74 A;  3SH8 A;  3T4T A;  3WS2 A;  2GX5 A;  2VLG A;  1JVJ A;  5DTK A;  2A49 A;  1PYY A;  4QHC A;  2QJ5 A;  1DY6 A;  4R3B A;  4GHI A;  1I2W A;  5FQM A;  1ES5 A;  2ZBB A;  3QP1 A;  3SW1 A;  1XA1 A;  4KQD A;  3IWO A;  4LV3 A;  1IKG A;  1PZO A;  1VEU A;  3EEH A;  3NJA A;  2OOL A;  4L9E A;  5EOO A;  1T18 A;  4FCF A;  4A5R A;  3UB7 A;  3IF6 A;  3N8L A;  5JYO A;  3P01 A;  1ZG4 A;  4Q0H A;  4G3V A;  3TW8 A;  1CI8 A;  2JKF A;  3T4O A;  4OOL A;  2BG1 A;  1XKZ A;  1J3W A;  3IXH A;  4OPY A;  4LCL A;  2VEA A;  1KOU A;  4KZ9 A;  1KVL A;  2OV5 A;  2J8Y A;  2KX6 A;  5A8B A;  3IH9 A;  4PHT A;  1FQG A;  1MWT A;  5HWV A;  5GLA A;  2WKE A;  2IWD A;  4JPM A;  2D02 A;  2Q9M A;  4QU3 A;  3QP2 A;  3UNW A;  1G6O A;  4DDY A;  2Y2L A;  3LI9 A;  1K55 A;  5E2G A;  5HWT A;  4OPZ A;  4PKY A;  1ZTU A;  4Y0O A;  5L07 A;  2W0N A;  1FSY A;  1ES4 A;  3NC8 A;  4JF5 A;  5EFW A;  5DKL A;  3ZQ5 A;  4EEU A;  5FAP A;  4KZ3 A;  1P9W A;  4N1X A;  3NOT C;  3MXQ A;  3E98 A;  3BFC A;  4GKU A;  4DRT A;  3DAV A;  5L2F A;  2O9B A;  3Q7V B;  1WA9 A;  1LSW A;  3LGO A;  3HLG A;  3W2Z A;  2EXA A;  3QHY A;  4OVD A;  2WKQ A;  1S6R A;  2VGL M;  4O8G A;  4YIN A;  2WUQ A;  3Q7Z A;  4NEE D;  3LIE A;  5G4Z A;  1OTB A;  5FA7 A;  5A91 A;  3A0S A;  1TS7 A;  1PW1 A;  3PBS A;  1KE4 A;  3MKE A;  2QMI A;  1L0G A;  4B88 A;  2WYX A;  3A0R A;  3MXR A;  3LR5 A;  5IHV A;  4EET B;  2ZJ9 A;  4JXV A;  1KDS A;  3PBT A;  2WKR A;  2V20 A;  4Q0J A;  4RQ9 A;  1E3U A;  3OLO A;  1T19 A;  3VP0 A;  2Y2J A;  4PM5 A;  1G6A A;  1BYW A;  3SH9 A;  3TJZ C;  4HH2 A;  3ZCZ A;  1IEL A;  3B42 A;  4Y13 A;  4LRX C;  1SHV A;  4DMZ A;  4F94 A;  4HIA A;  2C6W B;  2Q9N A;  3GSG A;  4BD0 A;  3RJU A;  4P6Z S;  5CHU A;  1OTD A;  3HLD A;  4UQI S;  3FC7 A;  5A93 A;  4PM7 A;  4EQ1 A;  1PZP A;  2EX2 A;  4K0X A;  4CPK A;  3N7W A;  2NUT C;  1BLH A;  3N6I A;  3BRM A;  2WKI A;  4U0T A;  1YT4 A;  3G31 A;  4DJ2 A;  2Y55 A;  1TD5 A;  4R0Q A;  4P6B A;  4DE0 A;  5HAQ A;  4WEJ A;  3BJN A;  4MBK A;  1SKF A;  4FOF A;  2VA0 A;  4LEN A;  3LEQ A;  1XGI A;  1GA9 A;  2LB9 A;  3KYQ A;  3IF6 C;  1XX2 A;  1L2S A;  3MQQ A;  3UDI A;  1U60 A;  4X25 A;  1FCM A;  3BW6 A;  5EUA A;  4OQ0 A;  1ERO A;  3BQA A;  4HES A;  2GNX A;  3PAE A;  3KYE A;  2FH5 A;  1S4S A;  5F82 A;  4OQH A;  3W4O A;  2QZ6 A;  2W1T B;  4H6J B;  3TE8 A;  3UN7 A;  2VK3 A;  3VP2 A;  2VGJ A;  1HD8 A;  3S4X A;  4FSF A;  3G30 A;  1K55 C;  2W3H A;  5EM0 A;  2Y91 A;  1FOF A;  5CGX A;  3H82 B;  3VP3 A;  4EWF A;  3A0V A;  3IX4 A;  2ZC6 B;  4WM9 A;  4CQH A;  2H0Y A;  1L0E A;  3S7P A;  1S66 L;  1W79 A;  5CRF A;  1K56 A;  4N9K A;  5DKK A;  4DJ3 A;  3BYD A;  3VSL A;  3ZDJ A;  3QP4 A;  3LID A;  4UAA A;  5D3O A;  1CEF A;  3BEB A;  3ITB A;  4R23 A;  3BLM A;  2X02 A;  2ZD8 A;  4HBT A;  1S1Y A;  4GW9 A;  3LO7 A;  2H10 A;  3ZG7 B;  3EWK A;  3E4Q A;  3QNC A;  4JGQ A;  2V1Z A;  4RYE A;  4HEF A;  3LCE A;  2WAD A;  5C5K A;  1YMS A;  4LRZ E;  1Q2Q A;  4JF4 A;  1VEU B;  3O3V A;  2E8I A;  1OPX A;  4BBU A;  5CHM A;  3IWI A;  3KX0 X;  2L1M A;  2IA2 A;  4EV4 A;  3M6H A;  1ZHH B;  1GSV A;  4BL3 A;  4BEN A;  2VGK A;  4NXB A;  3FZC A;  5KSC A;  3T1S A;  3LEZ A;  1YLP A;  1JTG A;  4UA7 A;  4EQI A;  2GJ3 A;  4GS9 B;  3VV4 A;  3IH8 A;  1PW8 A;  4P6Z M;  4UQI M;  4OQG A;  4R38 A;  4ZBE A;  3FV7 A;  4GLQ A;  1H3Q A;  3MFX A;  3GEC A;  1RGZ A;  4PPR A;  2ZM0 A;  3IXD A;  1YLY A;  4R4S A;  3WWX A;  5GLD A;  4FH2 A;  2PBD P;  3T4K A;  4DKI A;  3IXB A;  5FEG A;  1MY8 A;  5TBM A;  2ZMA A;  3ZGA B;  4C6Y A;  4ETZ A;  1S67 L;  5GLB A;  2WZX A;  3A3I A;  3CHW P;  3WRZ A;  4LPZ A;  4N9L A;  3MS6 A;  5E43 A;  3NIA A;  4K08 A;  3AGD A;  3G32 A;  3O88 A;  3C7V A;  5HAP A;  3ICY A;  2X71 A;  2V1A A;  5TGF A;  3P7N A;  3V39 A;  1CK3 A;  5M1A A;  2R9W A;  4KUK A;  3V3R A;  2IWB A;  1LLB A;  1K0K A;  1RP5 A;  3SH7 A;  3A3F A;  3DTI A;  2B5R A;  1BUL A;  4NG2 A;  4HP9 A;  1MKI A;  5EOE A;  3WS4 A;  4OPQ A;  4EXO A;  1OTA A;  3OC2 A;  4K0W A;  3OPH A;  2WGW B;  1E25 A;  1YLT A;  2DMW A;  1PWG A;  3MJQ A;  2O9A A;  3HJI A;  3A3E A;  2WKP A;  3JYI A;  3F1O A;  3CUE A;  3C7U A;  1W63 Q;  2EXB A;  4HP4 A;  1XPB A;  4S2I A;  1QMF A;  3TSG A;  5EVL A;  4HJ6 A;  1K25 A;  5HDC A;  5TFQ A;  2INW A;  4ZJ3 A;  2EA9 A;  5HWW A;  4NK3 A;  3UE3 A;  2Y8H A;  3BY9 A;  4KZ7 A;  1PWC A;  5EVI A;  3BY8 A;  3L9K A;  2BAS A;  1KDW A;  4MDZ A;  4MN5 A;  4BLM A;  5M19 A;  3MBZ A;  5EM1 A;  1GSX A;  3DTE A;  5F69 A;  2PYP A;  5DFY A;  4JF6 A;  5HD5 A;  2ZOH A;  5L10 A;  4PM9 A;  5L8M A;  3HLC A;  3VE4 A;  3E4P A;  4FH4 A;  3WS5 A;  4E04 A;  1JNU A;  1YLW A;  3T1R A;  4ARZ A;  1HZO A;  1T1B A;  4H6J A;  1PI5 A;  3E0Y A;  2XRN A;  5CER A;  1OJG A;  3LYX A;  3NUL A;  5GHX A;  1ESI A;  2V8C A;  3BWL A;  1E3U D;  3E2L A;  4UA6 A;  4MNR A;  1ALQ A;  2HJE A;  2OLV A;  4I3I A;  2HF6 A;  2ZC3 B;  2W3F A;  4X1M A;  4E3J A;  1H5X A;  2A2L A;  4XUZ A;  4K91 A;  2Z6C A;  4QWO A;  4JGP A;  2E8J A;  5F6A A;  1A0K A;  1ZC2 A;  2Y2M A;  4Z9Q A;  2Y59 A;  1K4F A;  2WAF A;  1G5U A;  2XGN A;  1Z09 A;  3VSK A;  1YM1 A;  4X69 A;  3PBO A;  4S2N A;  4OON A;  1BLP A;  4MN6 A;  1SDN A;  4L9F A;  5FI7 A;  5HDS A;  1LL9 A;  4X55 A;  1MWU A;  3D72 A;  5HFO A;  1XA7 A;  3EOI A;  4FTX A;  4JLF A;  3CWF A;  3W8K A;  4E3N A;  2L0W A;  3LY4 A;  4O01 A;  2MJ6 A;  3IX3 A;  3LIA A;  2XD5 A;  1D1J A;  4IHQ A;  4LRY C;  5KZH A;  4IUK A;  5CEB A;  2HDU A;  1D7E A;  1ONH A;  3RH8 B;  1PNE A;  4GS9 A;  2P9V A;  1LT0 A;  2A24 A;  1ES3 A;  4EUV A;  1NZU A;  3HLE A;  1K54 A;  4OP5 A;  1CQA A;  4LCM A;  4G3K A;  1DP6 A;  4ZAM A;  3SS5 A;  2GZA A;  3P09 A;  2L4R A;  4ZDX A;  5HAR A;  3KYZ A;  3NOP C;  1IYP A;  4O0P A;  1CF0 A;  1PWD A;  1BUE A;  3BQ8 A;  1LI0 A;  3S7O A;  1K56 D;  3RXX A;  1MKM A;  3IQA A;  2Z6D A;  2J9P A;  5DF7 A;  4IED A;  2DCF A;  5J7E A;  3FPW A;  3VOZ A;  5AQB A;  1SKO B;  3ISG A;  1NYY A;  1K57 A;  4FUW A;  1SZV A;  3L7H A;  1HLU P;  4WL9 A;  4WN5 A;  3HLW A;  5CTM A;  2XLN A;  5EVI C;  5J8X A;  1NZO A;  1FCN A;  5MC7 A;  4G3W A;  4RX3 A;  4MN7 A;  5TBM B; 
#chains in the Genus database with same CATH homology
 2BLS A;  4OPR A;  3NI9 A;  2VGJ A;  3VP2 A;  1HD8 A;  3HLB A;  3DWK A;  3RXW A;  2A3U A;  4DE1 A;  3VFF A;  1N9B A;  1IYS A;  2IWC A;  1ESU A;  2XFT A;  2ZQA A;  3G30 A;  4FSF A;  4GN2 A;  3M2K A;  3S4X A;  4DE3 A;  4LV1 A;  4BJP A;  3HUM A;  1K55 C;  1YLJ A;  4KZB A;  2Y91 A;  4Q8I A;  1FOF A;  4X6T A;  5CGX A;  3ZHH A;  4E3O A;  1ERQ A;  3VP3 A;  4EWF A;  3EQV A;  2ZC6 B;  3MXS A;  1VQQ A;  4WM9 A;  2WGW A;  1NXY A;  2H0Y A;  4KZ5 A;  1L0E A;  2Y2P A;  3CJM A;  4GD8 A;  3UPP A;  2C5W B;  1W79 A;  5CRF A;  4RA7 A;  1K56 A;  4IVK A;  2XF3 A;  4N9K A;  3SS4 A;  3Q81 A;  3UN7 A;  3BYD A;  3VSL A;  1LL5 A;  3AGE A;  3Q1F A;  5GLC A;  3ZDJ A;  3N8R A;  4OOM A;  4UAA A;  2ZLY A;  4WYY A;  1K38 A;  3CZD A;  1W5D A;  5D3O A;  1CEF A;  3BEB A;  3ITB A;  4R23 A;  2XK1 A;  3BLM A;  2X02 A;  3OPP A;  2V2F F;  2ZD8 A;  1TEM A;  5DF9 A;  4HBT A;  4IBR A;  3HVF A;  5A90 A;  3Q07 A;  1I5Q A;  4MBH A;  3LO7 A;  2H10 A;  4N1H A;  4IBX A;  5EPH A;  3IHA A;  1BZA A;  1ES2 A;  3ZG7 B;  3OPL A;  4CJN A;  3QNC A;  5CTN A;  5GHY A;  5A92 A;  2XEP A;  2V1Z A;  3MKF A;  1Y54 A;  4RYE A;  5FAT A;  4HEF A;  3LCE A;  1NYM A;  2WAD A;  4KZ4 A;  4WEK A;  1YMS A;  5CXW A;  1Q2Q A;  3EQU A;  3G2Z A;  1YMX A;  2EX9 A;  2WGI A;  5FQ9 A;  4JF4 A;  1FCO A;  4QB8 A;  1I2S A;  2WZZ A;  5F1F A;  1EI5 A;  4S2L A;  3O3V A;  2E8I A;  1KE3 A;  5CHM A;  3IWI A;  3PBQ A;  4S2N C;  3TOI A;  4WZ5 A;  3M6H A;  2J7V A;  4EV4 A;  5FQJ A;  3C4O A;  4GDB A;  4S2J A;  2JC7 A;  1XGJ A;  2G2W A;  3ZG5 A;  4BL2 A;  3G2Y A;  4QJG A;  4MBF A;  4BL3 A;  4BEN A;  3GRJ A;  2VGK A;  1PIO A;  3CMZ A;  3ZNT A;  4M3K A;  3GR2 A;  1XXM A;  3FZC A;  3C4P A;  4UHU A;  5KSC A;  1K4E A;  4KQQ A;  3PBR A;  5AQA A;  3IHB A;  3LEZ A;  5F1G A;  4GZB A;  2I72 A;  2HDR A;  2OLU A;  4JXS A;  1YLP A;  1TDL A;  1JTG A;  4UA7 A;  1ZKJ A;  4EQI A;  2PU2 A;  1IYQ A;  1PW8 A;  1S0W A;  3IH8 A;  5EVI B;  5HL1 A;  4OQG A;  5FSR A;  3HUN A;  4ZBE A;  2HP5 A;  3FV7 A;  3NDG A;  1DJC A;  1NY0 A;  3UY6 A;  3IWQ A;  3C5A A;  3IT9 A;  3BLS A;  4U0X A;  2R9X A;  1RGZ A;  4S2K A;  4E3K A;  1NJ4 A;  4PPR A;  1WYC A;  2X01 A;  2ZM0 A;  2Y2Q A;  4DF6 A;  3ITA A;  3IXD A;  4R1G A;  4MEZ A;  1YLY A;  1G68 A;  4R4S A;  3WWX A;  5GLD A;  4FH2 A;  1IKI A;  1MPL A;  4OLD A;  3M2J A;  4P0M A;  3MZF A;  1LI9 A;  1BT5 A;  2HDQ A;  3N4I A;  3W4P A;  3PTE A;  1KGG A;  4GNU A;  2Z2M B;  4DKI A;  3IXB A;  3BM6 A;  4KZA A;  5FI6 A;  1MBL A;  5BOH A;  2CC1 A;  3UE0 A;  1MY8 A;  2HDS A;  1BLC A;  3O86 A;  3VOY A;  2ZMA A;  3ZGA B;  4C6Y A;  3ZNY A;  3FWL A;  3MFD A;  4S2O A;  4S2P A;  5GLB A;  1K54 C;  1KE0 A;  2WZX A;  3A3I A;  3MZD A;  4KG5 A;  3WRZ A;  4N9L A;  1DJB A;  2OSU A;  3HL9 A;  3SOI A;  1GCE A;  4RX2 A;  5E43 A;  4JXG A;  5HX9 A;  3NIA A;  5FDH A;  5CGW A;  2ZM2 A;  3AGD A;  3FYZ A;  3HBR A;  4OOY A;  4B4X A;  2Y4A A;  3G32 A;  3C7V A;  3O88 A;  4KG6 A;  3WRT A;  5FAS A;  3DWZ A;  4DXC A;  5HAP A;  1IEM A;  3WS1 A;  3UPN A;  5E2H A;  2X71 A;  1ERM A;  2HP6 A;  5TGF A;  4GB7 A;  1W8Y A;  3UE1 A;  3A3D A;  4BD1 A;  3PBN A;  3ZVT A;  3V39 A;  1CK3 A;  5M1A A;  2R9W A;  3CG5 A;  5FI2 A;  3AGF A;  1O7E A;  3ZFZ A;  2ZM8 A;  3V3R A;  5EVI D;  2G2U A;  3OCN A;  2IWB A;  3ZVW A;  2XQZ A;  4QD4 A;  1LLB A;  1RP5 A;  3SH7 A;  1JTD A;  2XD1 A;  1ONG A;  2H0T A;  3A3F A;  2WGV A;  3TG9 A;  3VP1 A;  1LHY A;  4WZ4 A;  2B5R A;  4GD6 A;  1BUL A;  5HAI A;  4R3J A;  1J9M A;  1MKI A;  2P74 A;  3A3J A;  3SH8 A;  3WS2 A;  1K57 C;  3GVB A;  1MXO A;  4N92 A;  3ZG8 B;  1JVJ A;  2JE5 A;  5EOE A;  5DTK A;  2A49 A;  4KEN B;  3WS4 A;  5JYP A;  1PYY A;  4QHC A;  1KGE A;  4U3T A;  2WAE A;  1DY6 A;  4R3B A;  4E3L A;  4OPQ A;  4S2M A;  5FQM A;  1I2W A;  3QNB A;  3OC2 A;  1ES5 A;  4K0W A;  3HUO A;  1K6S A;  2WGW B;  3M6B A;  2EX6 A;  3OPH A;  4BQM A;  1E25 A;  1YLT A;  5DTS A;  1PWG A;  1GHI A;  3GQZ A;  1XA1 A;  3A3E A;  4DDS A;  3BEC A;  2EFU A;  3B3X A;  2Y2N A;  3JYI A;  3IWO A;  4LV3 A;  1WYB A;  1IKG A;  3NCK A;  1PZO A;  4QY5 A;  3C7U A;  3P98 A;  5EOO A;  3BFD A;  1BTL A;  4FCF A;  5GHZ A;  2EXB A;  4OP8 A;  1XPB A;  4S2I A;  4JKT A;  4KG2 A;  1H8Y A;  4A5R A;  2ZQ7 A;  3IF6 A;  1QMF A;  3N8L A;  5FAO A;  3TSG A;  1FR6 A;  5JYO A;  1ZG4 A;  5EVL A;  2WK0 A;  1CI8 A;  4DE2 A;  3NBL A;  4KZ6 A;  1K25 A;  1K6R A;  1L0F A;  4OOL A;  3HLF A;  2BG1 A;  5TFQ A;  4E6X A;  1XKZ A;  4ZJ3 A;  4KQO A;  4EBN A;  3IXH A;  5FQK A;  4OPY A;  3IXG A;  5E2E A;  3G4P A;  4LCL A;  3ZG9 B;  1RCJ A;  4H8R A;  4NK3 A;  4X53 A;  3UE3 A;  4KZ9 A;  1KVL A;  2OV5 A;  4C3Q A;  4KZ7 A;  3S1Y A;  2J8Y A;  4D2O A;  1BSG A;  1PWC A;  3IH9 A;  5EVI A;  1FQG A;  1M6K A;  3UDX A;  3BFE A;  5FQI A;  1MWT A;  2PU4 A;  2ZC4 B;  5CHJ A;  5GLA A;  2WKE A;  2IWD A;  2Y2H A;  1KDW A;  2P9V B;  4JPM A;  1DJA A;  4BLM A;  4EBL A;  4NET A;  5DVA A;  3MBZ A;  5M19 A;  5DF8 A;  5G18 A;  2Q9M A;  4Y7P A;  4ZJ1 A;  4E6W A;  2ZQC A;  4QU3 A;  4RVA A;  1M40 A;  4JBF A;  4JF6 A;  3VMA A;  3UNW A;  4PM9 A;  4DDY A;  1E4D A;  2Y2L A;  1K55 A;  3HLC A;  5E2G A;  4OPZ A;  2XH9 A;  4Y0O A;  2RCX A;  2ZQ9 A;  3SS3 A;  2EX8 A;  1FSY A;  3UPO A;  4FH4 A;  3WS5 A;  1GHP A;  4Y0T A;  1ES4 A;  3NC8 A;  5KSH A;  1N4O A;  3MZE A;  1YLW A;  1SDE A;  1HZO A;  2XDM A;  3UDF A;  4KZ8 A;  4L0L A;  5AQ7 A;  4JF5 A;  1PI5 A;  3FKW A;  5TR7 A;  5CER A;  4C75 A;  4E3I A;  2JCH A;  5GL9 A;  1IYO A;  5GHX A;  1ESI A;  3UO9 A;  2FFF B;  2Y2I A;  5FAP A;  4KZ3 A;  1E3U D;  3E2L A;  4IVI A;  4N1X A;  4UA6 A;  4MNR A;  1ALQ A;  2OLV A;  4PM6 A;  3Q82 A;  4WBG A;  2ZC3 B;  1HTZ A;  4YFM A;  4E3J A;  3BFC A;  1H5X A;  1YLZ A;  1W7F A;  4GKU A;  4PM8 A;  4DRT A;  4P87 A;  3BFG A;  4GDN A;  1ZG6 A;  5L2F A;  4XUZ A;  4ZJ2 A;  4K91 A;  5EE8 A;  3Q7V B;  3VP4 A;  2H5S A;  3ZG0 A;  3HLG A;  3V5M A;  2ZQD A;  1CI9 A;  4R4R A;  2HP9 A;  2Y2M A;  1ZC2 A;  4Z9Q A;  2EXA A;  2Y59 A;  3QHY A;  1RGY A;  4OVD A;  1S6R A;  4E3M A;  2Y2G A;  4YIN A;  2WUQ A;  4EUZ A;  3Q7Z A;  1K4F A;  3GMW A;  2WAF A;  2Y2O A;  1FSW A;  1Q2P A;  2XGN A;  3VSK A;  1FR1 A;  1JWZ A;  2JBF A;  1YM1 A;  4X69 A;  3OPR A;  3PBO A;  4LV0 A;  4OON A;  3OCL A;  1BLP A;  4O7D A;  2DRW A;  4S2N A;  3G34 A;  5M18 A;  2DNS A;  1SDN A;  5FA7 A;  1OME A;  5A91 A;  4ID4 A;  4EBP A;  4DXB A;  1NRF A;  1PW1 A;  3V50 A;  3PBS A;  4WMC D;  1KE4 A;  5FI7 A;  3MKE A;  4XXR A;  2GDN A;  1LL9 A;  5CEC A;  5FAQ A;  2QMI A;  1L0G A;  3E2K A;  4X55 A;  1TVF A;  4B88 A;  1MWU A;  1KGF A;  2WYX A;  1GHM A;  1PI4 A;  1XP4 A;  1H8Z A;  5HFO A;  3MXR A;  1XA7 A;  5AQ9 A;  1EWZ A;  3O87 A;  4HBU A;  2QPN A;  4ZTK A;  1MWR A;  2XR0 A;  5IHV A;  2ZJ9 A;  4JXV A;  4JLF A;  1KDS A;  3PBT A;  2V20 A;  1HVB A;  5EEC A;  1E3U A;  3VP0 A;  2Y2J A;  4PM5 A;  1AXB A;  1BLS A;  3W8K A;  1G6A A;  4E3N A;  3LY4 A;  4OQI A;  2HPB A;  4Y0U A;  3SH9 A;  4OH0 A;  4WEL A;  4PMA A;  2ZC7 A;  2XD5 A;  4OLG A;  1IEL A;  3ZCZ A;  2FFY A;  1SCW A;  5E2F A;  3OZH A;  5KZH A;  3BFF A;  1YQS A;  2J9O A;  1JWV A;  1SHV A;  5CGS A;  4F94 A;  2C6W B;  2Q9N A;  3D4F A;  5CEB A;  2HDU A;  3GSG A;  4BD0 A;  3RJU A;  1ONH A;  5CHU A;  3HLD A;  1W8Q A;  2RL3 A;  5A93 A;  1L0D A;  4FD8 A;  4PM7 A;  2P9V A;  3GTC A;  2ZC5 B;  2ZQ8 A;  2PBY A;  3FKV A;  3PAG A;  1GA0 A;  2UWX A;  3WS0 A;  1ES3 A;  3HRE A;  1PZP A;  1NZU A;  2EX2 A;  4K0X A;  1VM1 A;  3HLE A;  3IF6 B;  4CPK A;  1K54 A;  3N7W A;  3NY4 A;  4OP5 A;  4LCM A;  1BLH A;  3N6I A;  4ZAM A;  3SS5 A;  1TDG A;  3BRM A;  1KVM A;  2WKI A;  1YT4 A;  4U0T A;  3P09 A;  4X68 A;  1O07 A;  2Y2K A;  1QME A;  3G31 A;  2Y55 A;  5HAR A;  4ZDX A;  1MWS A;  3DTM A;  1IYP A;  4WMC A;  1PWD A;  4R0Q A;  1BUE A;  4P6B A;  4JXW A;  4DE0 A;  5HAQ A;  4WEJ A;  1LI0 A;  5KMW A;  3IF5 A;  4MBK A;  4XUX A;  1SKF A;  1C3B A;  3I7J A;  1K56 D;  4LEN A;  3RXX A;  1JWP A;  1XGI A;  3IQA A;  1GA9 A;  3GV9 A;  2J9P A;  4B4Z A;  5DF7 A;  4IED A;  3IF6 C;  3DW0 A;  2DCF A;  3V3S A;  1XX2 A;  3LY3 A;  4UA9 A;  4X56 A;  5DTT A;  5U47 A;  1L2S A;  2EFX A;  4WZ5 C;  1CEG A;  3VFH A;  5AQB A;  3VOZ A;  5F83 A;  3ISG A;  3UDI A;  1NYY A;  2WKH A;  2XFS A;  1Z6F A;  1U60 A;  5FQQ A;  1K57 A;  4KQR A;  2Z2L B;  3W4Q A;  1FCM A;  3NDE A;  4QY6 A;  1WE4 A;  5EUA A;  5HW3 A;  4MLL A;  4OQ0 A;  5CED A;  1ERO A;  3HLW A;  3Q7V A;  4LV2 A;  2XLN A;  5CTM A;  4HES A;  5EVI C;  5J8X A;  3PAE A;  4P85 A;  1NZO A;  1FCN A;  5F82 A;  4OQH A;  3W4O A;  2QZ6 A;  3G35 A;  4RX3 A;  4GOG A;  5I94 A;  3N8S A;  4OKP A;  3S22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...