2NUPC

Crystal structure of the human sec23a/24a heterodimer, complexed with the snare protein sec22b
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
157
structure length
137
Chain Sequence
MVLLTMIARVADGLPLAASMQEDDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARIMVANIEEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Transport Signal on Sec22 for Packaging into COPII-Coated Vesicles is a Conformational Epitope
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Protein transport protein Sec23A
total genus 38
structure length 137
sequence length 157
ec nomenclature
pdb deposition date 2006-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2nupC00
2NUTC 1IFQA 4AFIA 3BW6A 1H8MA 4B93A 3KYQA 2DMWA 3EGDC 1IOUA 2NUPC 3EGXC 2VX8A
chains in the Genus database with same CATH superfamily
1LL8A 1ZC2A 1HLUP 4HOIA 3JVUA 3T1SA 3IWOA 5FQ9A 2EX2A 5L8MA 1TS0A 4DE3A 3IXDA 3LCEA 3WS0A 4OOMA 4GN2A 3LIFA 1Z6FA 2HDQA 3ZHHA 1BLSA 3OBFA 3IWIA 4Y3IA 3V3RA 4MEZA 2DRWA 1S4RA 2PU4A 3DTIA 4OOLA 2GX5A 3F1OB 4Z1WA 4NXGA 2ZM8A 2O9BA 4IVIA 3PXPA 4G3VA 3E4PA 3F1NA 3NIAA 5F1FA 5CECA 5CHUA 3DWKA 3PBSA 2Z6DA 2DNSA 3LR0A 4QWOA 1OJGA 1JNUA 5FQMA 2H0TA 4HHDA 3KO6A 2EFXA 1W63Q 1V9ZA 3I7JA 2L0WA 3HLGA 5E2HA 1NXYA 5FQKA 2V8CA 1AWIA 2VZWA 3T1XA 1IKGA 5DTKA 5F82A 5AVEA 4LPZA 3FV7A 5EVEA 3FPVA 2YKFA 1SKOA 1NRJA 2OAQ1 3G6OA 5J4EA 2G2WA 1KGFA 1L0EA 3CJMA 3N8RA 4ZAMA 5FI2A 1EROA 2BASA 1K57C 2JKTI 2OLVA 4P87A 1KOUA 2PR5A 4BL3A 1BUEA 4E6WA 2XA7M 3BY8A 1LSVA 3KSFA 3NBLA 1MZUA 4LRXC 1NJ4A 3GVBA 3MQ0A 1K55C 4UA7A 1G28A 3OPHA 5L09A 1PZOA 3H9WA 2V20A 1P97A 1DJAA 3H7WA 2ZD8A 4JLFA 1ZG6A 3ZVTA 3C7VA 1OTAA 1XFQA 1S67L 1MWUA 3QNBA 4H6JB 4X6TA 5EVLA 4DE0A 5HDCA 2EFUA 4XT2A 4ETXA 1YLPA 1TVFA 4JXWA 1ESUA 1H5XA 3IHBA 4OQ0A 3T12B 3RFBA 2J9OA 5FI7A 1WYBA 3KYQA 3WS2A 3KX0X 4PM8A 3T4SA 2XLNA 1MKMA 2A24B 3HUMA 1H3QA 5CXWA 2ZQDA 1TS6A 2W3GA 3FWLA 4MCWA 1HVBA 4RX3A 4UQIS 4K0XA 4YINA 4WEJA 3LI8A 1NYYA 1CQAA 2ZC4B 1HTZA 3HJIA 5HAIA 3K3DA 3O5YA 1KE3A 3CG5A 2M7VA 3TOIA 5FQIA 2R78A 1GHPA 3O88A 3LI9A 3HLFA 4KG5A 4UA6A 1FILA 1DP6A 2I9VA 3VOYA 1LL9A 3K3CA 4ME4A 3BQ8A 1K0KA 3TRCA 4K91A 2FZ0A 3BLMA 4X1LA 3UB7A 5EUAA 5K5BA 2HV1A 3ZGAB 3VP1A 1IYQA 4HJ3A 2JBFA 1MWSA 2Q0OA 3C8CA 4Y7PA 1BULA 1H8YA 3ZQ5A 3NC8A 4NXEA 3D3OA 4HJ4A 4UHUA 4E3OA 2W1TB 2OV5A 3P01A 1KGEA 1F9IA 2XGNA 3NCKA 5FQJA 4XUXA 4E3MA 4EQIA 3F1PA 4MLLA 1CI9A 1XJ6A 5FATA 2Y2PA 4EETB 2HP6A 2Y4AA 5HL6A 1ZKJA 3CI6A 4X68A 4S2NA 2HF6A 2Y2IA 4ZJ3A 1OPXA 2JC7A 2EXAA 3C38A 4QHCA 5GL9A 2WAFA 3T1QB 3K2NA 3W4QA 4BJPA 3QP6A 5L10A 2D01A 3GMWA 3H82B 3VP4A 3M6BA 4C75A 4FD8A 3A3JA 3UPPA 2W27A 5C5KA 2ZC5B 4ZBEA 5GLDA 2JKGA 3AGFA 3VOZA 3MF0A 1S4SA 5HD3A 5DFYA 1C3BA 5A92A 4O8GA 3BRMA 1EW0A 4MBHA 4I39A 2ZMAA 4MN6A 3FKWA 3N7WA 3G30A 3BFFA 3L7HA 4WUJA 2PDRA 5GLBA 4NXFA 1N9NA 1K6SA 3MQOA 3BFGA 5M18A 4KENB 4Y5FA 4EERA 4BBVA 4YFMA 5DKKA 3WS5A 3F1NB 4IHQA 4CPKA 4JF6A 3T4OA 3B3XA 3BFDA 5F1GA 5AQ7A 3TW8A 3DW0A 2P08A 1ES5A 5E43A 3WS1A 3BQAA 1OT6A 3LIEA 2P9VA 3HREA 1K38A 3MJQA 1N4OA 1XA1A 2JE5A 4N92A 1IEMA 2ZOIA 5A91A 3Q82A 4NG2A 5HWVA 2OLUA 2V9AA 1I2SA 2Y79A 2PYRA 2VJWA 3P7NA 1XP4A 5TBMA 1K56A 4OQHA 2WKQA 5EECA 1ERMA 2FFFB 4ESPA 1VHMA 4KQRA 1FIKA 3ZNTA 5M19A 4S2MA 4PKYG 3QP4A 4EBNA 4HQAA 1K4FA 4KUKA 5L2FA 1CJFA 4RQ9A 2W3HA 3NHQA 4OONA 1QMEA 1KGGA 1LSWA 4KZ9A 5AQAA 1P0ZA 4E3LA 3LEQA 2JCHA 3UN7A 2VK3A 4NXBA 4HP9A 5G4ZA 1W63M 2R9WA 4HH2A 5CERA 2ZQ8A 1CK3A 3O86A 1JTDA 1ES4A 4D2OA 1L0FA 4EUZA 2ZJ9A 5EM1A 2HP9A 2QWSA 1MPLA 2XFSA 3VP0A 1AXBA 2Y2JA 5CEDA 3EGDC 4RYEA 4EBLA 4EEUA 3BY9A 4OP8A 1GA9A 1IYOA 2V1BA 1M6KA 1WYCA 3B33A 1YLYA 2WKPA 2QMIA 3PAEA 4EEPA 3LFVA 4KG2A 2H10A 1FCMA 2K7SA 2QPNA 3NY4A 3ZYTA 2RCXA 4S2IA 2ZOHA 1IOUA 4YOFA 5EVIA 3FC7A 3S1YA 3VFHA 3IF6C 4BMWA 4JGRA 4FTXA 5AVFA 5EOOA 3A0VA 3IX4A 4WMCD 3BECA 2ZQAA 2NUPC 3IX8A 3VSKA 1ZTUA 3V67A 4HH3A 3WRTA 1T1BA 2R9XA 4FSFA 4WBGA 3G2ZA 3NECA 5FDSA 4Q0JA 5FDHA 1GSXA 3FYZA 1GHMA 1YLWA 3F1OA 3G34A 3IS2B 3EWKA 3V50A 2V1AA 4Y0UA 1NLZA 2K31A 3HLDA 3BW6A 1UWPX 3GR2A 2WGIA 1ONHA 3EEHA 4UAAA 1OMEA 1DRMA 5EFWA 2JHEA 4XT2B 4E04A 2HPBA 1W8QA 1TDLA 4Y13A 3MKEA 1RGYA 1KVMA 4EBPA 3GTCA 5FEGA 4KZ8A 3BFCA 3NULA 4WYYA 4GLQA 5G18A 1N9OA 1GSWA 4WZ5C 1L0GA 2OSUA 3U4LP 5KIZA 3CUEC 1IYPA 2DCFA 3LIBA 3CPTB 2KDKA 2W0NA 3ZFZA 3WS4A 2Z6CA 4Q0IA 4GW9A 3UE0A 5HW3A 1F5MA 2PT7A 1NYMA 5BOHA 1TS8A 2INWA 3KYZA 4RX2A 3CHWP 1BLCA 5FQQA 3VE4A 2ZQ9A 4BL2A 1XKZA 2XH9A 3VV4A 3KSGA 1MC0A 4LV1A 2M7UA 1XGJA 4JF5A 3IXBA 1PRQA 4KZ7A 2J3TD 2BG1A 1YLTA 4LRZE 2ZC7A 1LLBA 3A3FA 4PMAA 1T1CA 4GDBA 3UMDA 4FUWA 1YAXA 5HPFA 2ZM2A 4KZ5A 3C4PA 1S0WA 4X69A 3MFDA 4IUKA 4R6LA 2PYPA 5TBMB 3S7OA 4DE1A 4PM6A 5HWTA 1PWCA 3BJNA 4WEKA 3LO7A 3D4FA 1N9LA 3H82A 1MWTA 3SS4A 1PW1A 2ACGA 2VGLM 4YWZA 4JGQA 2P9VB 3KSIA 2ZL1A 4WZ4A 5KSHA 1MY8A 3C2WA 1XXMA 5IT5A 3IF5A 3LUQA 4LCLA 1ZHHB 4N9LA 4MBFA 3N4IA 3P98A 4U3TA 4KUOA 1XPBA 2EX6A 3CPTA 2XQZA 1XFNA 2JKTM 4R3JA 1FR6A 2G2UA 3BLSA 1F2KA 1IYSA 4I5SA 2XF3A 3QP1A 4KQQA 4S2PA 1K55A 2VA0A 1S1ZA 4IVKA 1OTBA 4OP5A 3UO9A 2O0YA 1OTIA 1G68A 1M40A 4ARZB 2Y2MA 4EESA 1SDEA 5FEFA 1VETA 2PRFA 4NK3A 1K57A 3T4TA 4LV3A 2D02A 1TS7A 5FA7A 2Y91A 1IKIA 2Y8HA 2PD7A 3MZFA 3W2ZA 3NJAA 2PBDP 1TF1A 1LT0A 4MBKA 3NOTC 3NOPC 5EE8A 3VP3A 4R1GA 1E25A 1H8MA 4FOFA 3OPRA 1JWVA 4G3KA 3VOLA 3S7NA 1LSXA 5D3OA 3UB9A 4X53A 3PAGA 2QJ7A 4B88A 1BT5A 4UQIM 4GOGA 5KMWA 2VV6A 5EVIB 3UB8A 3G31A 5HX9A 3FPWA 4KQDA 2OWHA 1YSPA 1K56D 1UGUA 2L1MA 4OLGA 1VEUB 3E98A 3DTMA 4OVDA 3V5MA 5HZHA 4I3IA 1PYYA 1N9BA 4S2JA 3RXXA 4JXGA 4R38A 4BBUA 3ZG9B 2Y2QA 2EXBA 2XSSA 3UB5P 4CLCA 4OPQA 4U0XA 2V8FA 2B5RA 4OQGA 2MJ6A 5LBRA 4QPRA 4DF6A 1DJBA 3C7UA 3NOUC 3GQZA 2WKRA 2WKHA 3PBTA 1GSVA 2X01A 4R0QA 4BD0A 2W3FA 3QP5A 2J8YA 2Y2LA 5A90A 1XX2A 1STZA 2PHYA 2XA7S 3PBNA 4GHIA 4MNRA 4CLCE 2H0YA 3S7QA 3E0YA 1XGIA 1D1JA 1QMFA 4PM5A 5CRFA 5AJGA 1EI5A 3T1RA 2HZ5A 4YNRA 4MMNA 2WK0A 4XXRA 3RH8B 1V9YA 3RJUA 4DKIA 2WKIA 5FSRA 3OPLA 3E4OA 4WL9A 3MXRA 1DP9A 5HSQA 2PAVP 5HAPA 5HL1A 2J3WA 3ZNYA 4FH2A 4LCMA 2BTFP 3W4OA 3QP8A 4A5RA 3R7WB 1YKDA 4FCFA 3A3EA 2H28A 1PNEA 5DJUA 2WGWA 5DTSA 2EA9A 1GHIA 4X56A 5FI6A 5DF7A 4P0MA 3IT9A 3SS3A 5GLAA 3E2LA 3BEBA 2PU2A 1ONGA 5DTTA 4ID4A 4JF4A 4L9GA 4HBUA 2JN7A 5CGXA 3MQQA 5DF9A 3LGOA 5HARA 4B9OA 4BWIA 5JYOA 1LI9A 2VX8A 1L2SA 4K0WA 4OPYA 4IEDA 3IXGA 1W79A 4S2NC 3FKVA 3EQUA 4D60A 3GECA 3CWFA 2C5WB 3IBRA 1F98A 5CTNA 3HUNA 4X25A 4NKPA 3VP2A 2GNXA 3BWLA 5TFQA 4WELA 1GA0A 2V2FF 4XUZA 5DVAA 4M3KA 2XDMA 3CLOA 4ETZA 2WZXA 2YKHA 3W8KA 5E2EA 1Y54A 3HJKA 3VSLA 3IXHA 4P6ZS 1OT9A 5EVID 4DJ3A 1VM1A 3M2JA 3SW1A 2VLGA 3Q07A 4LLOB 4PM7A 4WF0A 1LL5A 5HD5A 1ZG4A 3GSGA 1NZUA 2IA2A 5DJTA 5DFXA 4EWFA 4KZBA 4E3KA 1NZOA 4HJ6A 4WLAA 5E2GA 2H5SA 1XJ3A 4R4RA 4DJ2A 3TG9A 1TEMA 1WA9A 2LB5A 3HUOA 4JBFA 2XROA 4BD1A 5MC7A 1YLJA 3IF6A 3ISGA 4E3IA 4B93A 2VGKA 4P6BA 3SS5A 2ZBBA 4E3JA 4Z9QA 4QU3A 4DXBA 3O87A 4OKPA 3EEAA 1SDNA 4CLCC 2WGWB 2E8JA 4LRYC 2EWVA 4UEYA 5U47A 2HDSA 1SHVA 3N8SA 2HGVA 2QZ6A 3HLEA 4IUHA 5CHJA 3G2YA 3FZCA 3VMAA 5HDSA 3FG8A 2BLSA 3EOIA 1FCOA 5FL3A 4JXSA 1OTDA 1DJCA 3HLCA 2XK1A 3LY3A 3R4KA 3A3DA 2UV0E 3LYXA 2Q9NA 2FFYA 3PR6A 3LR4A 1CF0A 2XR0A 3UE1A 3MMHA 4ZDXA 4I3AA 4LGWA 3IH9A 2W1RA 4PAUA 5FAQA 1A0KA 1HZOA 3E2KA 1TD5A 3NDEA 4EW7A 3DTKA 3OOVA 4U0TA 1T19A 2NUTC 4F94A 3SH8A 1UWNX 2VV8A 1NWZA 3PBRA 5TR7A 2J9PA 2ZQCA 4FH4A 1VEUA 1JWPA 2V0WA 4WN5A 2IWBA 4Y2FA 1PI5A 1PZPA 4KG6A 1ES2A 4OH0A 4Y17A 4L9FA 4JXVA 1YLZA 1FOFA 1I2WA 2LB9A 3DAVA 3CZDA 4QB8A 4X55A 5F5YA 3N8LA 2HDRA 3T4JA 5CHMA 1XJ2A 4ZTKA 4R4SA 4RVAA 4ZRRA 5A93A 4GJ4A 3QP2A 1H8ZA 3MBZA 4GHIB 1I5QA 1PWGA 4GS9A 1W8YA 4LV2A 3WWXA 5HWWA 2XFTA 3OC2A 3OZHA 5F83A 3TJZC 3ZDJA 3WRZA 2RL3A 4OLDA 1FSWA 4QJGA 5EV0A 2V1ZA 3O3VA 1CEGA 1D06A 2M1CA 5HFOA 3IBJA 4Q0HA 4DDYA 1J3WA 5F6AA 2Y2KA 4JPMA 3S4XA 3P09A 3B47A 4LFUA 3UPNA 5CX7A 4MN7A 4H6JA 2XRNA 3LEZA 3U2AA 4IBXA 1DY6A 4UA9A 3Q7VA 1YT4A 5J7EA 3CUEA 3BM6A 3LICA 3CITA 1FCNA 3S7PA 5GHZA 3MZDA 2ZMVA 3NI9A 1Q2QA 4R70A 3A3IA 2P74A 2A3UA 3DTEA 4Q8IA 2X71A 5EPHA 3G35A 3OPPA 1KE4A 5FAOA 1FSYA 3GV9A 3L9KA 2J80A 5J8XA 3UNWA 2OWJA 5J3WA 2WGVA 4N9KA 3OCNA 4BLMA 3MSHA 2ZLYA 3PYPA 4G3WA 1ACFA 1BSGA 2OOLA 2W1TA 3UDXA 2Y59A 1H0MA 2WADA 3PTEA 1MXOA 3LIDA 4QY6A 1Z09A 1SKOB 3Q1FA 3KSHA 4O0PA 1CI8A 3UDFA 3ZG5A 3Q7ZA 3VFFA 4KQOA 4K08A 4NEED 1VETB 2WKEA 3IH8A 4RA7A 3ZCZA 1MWRA 4GKUA 3ITBA 3UPOA 5KSCA 4OQIA 1PIOA 5DF8A 4M4XA 1SKFA 4F3LB 1JVJA 1K54A 4HI4A 2EX9A 5G4YA 5CTMA 2ZQ7A 1KDWA 2KX6A 2GZAA 2CMNA 5GHXA 2O99A 4JGOA 4PPRA 4KZ6A 4EUVA 4HNBA 1YMSA 1PFLA 2W3DA 5GHYA 1NY0A 1D7EA 4L9EA 5E2FA 3QNCA 3D9YA 1IELA 1OTEA 2C6WB 4PKYA 3IQAA 5FAPA 3JVVA 3GRJA 3G4PA 5EM0A 1VQQA 1EWZA 3SOIA 1FR1A 3IHAA 1K25A 4QY5A 4JGPA 3Q7VB 4N1XA 4B4ZA 1S1YA 2FH5A 3AGEA 4EQ1A 2P04A 3SH9A 5TJJA 4KZ4A 2K2NA 2UWXA 2Q9MA 3W4PA 2VGLS 5I5LA 1K54C 3PHYA 3V3SA 5HPIA 3T50A 1S6RA 4BENA 4DE2A 2QYBA 5GLCA 5IS1A 3MXQA 4Y15A 1YSQA 1E3UA 3NDGA 4R23A 1W5DA 4GNUA 3SZTA 1K6RA 3HCYA 4L0LA 1G6OA 2G7UA 3TE8A 1G5UA 2P7JA 4OOYA 2JKFA 4PM9A 2Y2HA 4O7DA 4EU0A 1BLPA 1BYWA 3IWQA 2WUQA 2J3TC 1K4EA 1PI4A 2B95A 3LR5A 4CJNA 1Y4OA 2W3EA 4MDZA 3PBOA 3A0RA 3BFEA 2HDUA 5EVIC 4C3QA 4IJGA 4GS9B 5CGSA 3GDIA 3C5AA 5CEBA 1U60A 2Z2LB 3ZG7B 2QHKA 5TGFA 3MZEA 2ZL1B 4R3BA 3T4LA 3T4KA 1DP8A 1ES3A 2IWDA 5DKLA 1ALQA 1KE0A 5F69A 1BTLA 1GCEA 4C6YA 4IBRA 3Q81A 1LI0A 4GD8A 3DWZA 4HP4A 4QD4A 2IWCA 1IFQA 3LY4A 3A0SA 2WAEA 2HJ9C 4HIAA 1SZVA 5FASA 1Q2PA 4CLCD 5AQ9A 3C4OA 1JWZA 3PBQA 2JKRM 3TSGA 2L4RA 4DDSA 2PR6A 5KZHA 1RGZA 1HD8A 3D72A 4HESA 1NRFA 3MKFA 3EGXC 2DMWA 4I38A 5HDDA 2VGJA 3JPUA 3B42A 4F3LA 1ERQA 1Y28A 2HP5A 1P9RA 3OLOA 4JKTA 3HBRA 3BYDA 5M1AA 4GCZA 2B18A 2KOIA 5AQBA 4DXCA 2EX8A 3MR0A 4MN5A 2Y55A 2I72A 3DBAA 3LIAA 3AGDA 3E4QA 3ZVWA 4N1HA 2QKPA 4S2LA 1XA7A 2ZM0A 3RTYA 1J9MA 1W7FA 2Y2NA 1P9WA 5F68A 4OPZA 4KZAA 2Y2GA 3EQVA 1JTGA 1RP5A 4R3AA 2VEAA 3H7WB 1ESIA 1WE4A 5EOEA 3QHYA 2X02A 4WZ5A 4DMZA 2AVXA 5HAQA 1VB6A 4CLCB 2WYXA 1FQGA 4II7A 1E3UD 1NLYA 1BLHA 2Y2OA 1KVLA 5L07A 3HL9A 1MKIA 3ICYA 4X1MA 1T18A 1YQSA 4ZJ2A 2ZC6B 3T4QA 4Y0OA 2HJEA 3UB6A 3R7WA 2JKRI 1YMXA 3OCLA 3UMEA 2XD1A 1L3LA 1TDGA 3CMZA 2XEPA 2O9CA 2QJ5A 1OJ5A 3M2KA 4H8RA 4KZ3A 1PW8A 2GDNA 1E4DA 2J7VA 5IU1A 4AFIA 3JYIA 2A49A 3SH7A 3RXWA 1S66L 4I3JA 4S2KA 4O01A 4HY8A 2A24A 1KDSA 3ZG0A 4B4XA 4P85A 1X0OA 2A2LA 4OPRA 2B02A 1LHYA 1ODVA 4ARZA 2O9AA 2WZZA 4Y0TA 4EXOA 4BQMA 4ZJ1A 5A8BA 3UY6A 3N6IA 3MXSA 3G32A 3KYEA 4S2OA 4E6XA 3CAXA 2EWWA 1SCWA 4GB7A 5I94A 3ULFA 2KLIA 4LENA 4EV4A 1YPRA 3MFXA 1BZAA 4PHTA 2PBYA 3M6HA 4DRTA 2OAP1 3HLWA 4BBTA 4DN0A 5JYPA 1YM1A 4GDNA 3UE3A 1T1AA 3IF6B 5CGWA 3HVFA 3HLBA 2Z2MB 1O7EA 3LR3A 2CC1A 3MS6A 3V39A 3UDIA 5IHVA 2PD8A 4WMCA 1XJ4A 1MBLA 4WM9A 4CQHA 1RCJA 2ZC3B 1O07A 1L0DA 4LV0A 1CEFA 1PWDA 1G6AA 4GZBA 2VKSA 3IS2A 4NETA 4E3NA 3VE3A 3ZG8B 2XD5A 2E8IA 4HBTA 3C30A 3ITAA 4HEFA 4P6ZM 3UE6A 3S22A 3IX3A 2GJ3A 4GD6A 2VV7A 2ZMFA 2V0UA 3F1PB
chains in the Genus database with same CATH topology
2KX6A 1LL8A 3RH8B 2GZAA 2CMNA 1V9YA 4NXBA 2O99A 4HP9A 4HOIA 3JVUA 1W63M 5G4ZA 4JGOA 5L8MA 4EUVA 1TS0A 4HNBA 3E4OA 4WL9A 4HH2A 2W3DA 1DP9A 5HSQA 1D7EA 4OOMA 4L9EA 3LIFA 2J3WA 4PKYA 1OTEA 2QWSA 3OBFA 3JVVA 3EGDC 4Y3IA 3R7WB 1YKDA 4EEUA 3BY9A 2H28A 4JGPA 1S4RA 5DJUA 2EA9A 2V1BA 3B33A 1S1YA 2FH5A 2WKPA 4EQ1A 4OOLA 2GX5A 2P04A 4EEPA 3F1OB 5TJJA 2K2NA 4Z1WA 4NXGA 3LFVA 2VGLS 5I5LA 3PHYA 5HPIA 2O9BA 3T50A 3PXPA 4G3VA 2K7SA 4L9GA 2JN7A 3E4PA 3F1NA 3ZYTA 2QYBA 3MQQA 2ZOHA 5DF9A 1IOUA 5IS1A 4YOFA 3MXQA 3FC7A 1YSQA 3PBSA 2Z6DA 4BMWA 3LR0A 4JGRA 1OJGA 4B9OA 1JNUA 4BWIA 3HCYA 5AVFA 4L0LA 1G6OA 2G7UA 3A0VA 4HHDA 3TE8A 2VX8A 3KO6A 2P7JA 1W63Q 1V9ZA 2L0WA 2NUPC 1ZTUA 3V67A 4EU0A 3EQUA 1BYWA 3GECA 4HH3A 3CWFA 3IBRA 2VZWA 1F98A 1T1BA 2J3TC 4NKPA 2GNXA 3BWLA 4WELA 5AVEA 4FSFA 3LR5A 4LPZA 3FPVA 3CLOA 2YKFA 4Q0JA 2W3EA 4ETZA 1NRJA 2OAQ1 3PBOA 3A0RA 2YKHA 4MDZA 3G6OA 1GSXA 5J4EA 3F1OA 3HJKA 3IS2B 4P6ZS 1OT9A 3EWKA 2V1AA 1NLZA 4IJGA 2BASA 4GS9B 4DJ3A 2K31A 3GDIA 3BW6A 2JKTI 3SW1A 2VLGA 1KOUA 2PR5A 1UWPX 4LLOB 4WF0A 5HD5A 2XA7M 3BY8A 3EEHA 1LSVA 3KSFA 1MZUA 1DRMA 2IA2A 2QHKA 5DFXA 5DJTA 5EFWA 4LRXC 2JHEA 4XT2B 4E04A 4HJ6A 3MQ0A 4WLAA 1XJ3A 4DJ2A 3T4LA 3T4KA 1DP8A 1G28A 3H9WA 5DKLA 1WA9A 1P97A 2LB5A 5F69A 2XROA 4GLQA 5MC7A 1N9OA 1GSWA 4HP4A 3H7WA 1IFQA 3A0SA 1OTAA 4B93A 1XFQA 2HJ9C 4HIAA 1S67L 5KIZA 2ZBBA 3CUEC 4H6JB 3LIBA 2KDKA 2W0NA 5HDCA 2Z6CA 4XT2A 4ETXA 4CLCD 3EEAA 4CLCC 4Q0IA 4GW9A 4LRYC 2EWVA 1F5MA 3PBQA 4UEYA 2JKRM 2PT7A 2L4RA 3RFBA 2HGVA 4IUHA 2PR6A 3KYQA 1TS8A 3KX0X 2INWA 3KYZA 3D72A 3T4SA 3VE4A 1MKMA 2A24B 5HDSA 3EGXC 2DMWA 4I38A 3VV4A 1H3QA 5HDDA 3KSGA 1MC0A 3FG8A 1TS6A 2W3GA 3B42A 4MCWA 3EOIA 4F3LA 5FL3A 4UQIS 1Y28A 2M7UA 1OTDA 4WEJA 1P9RA 2J3TD 3LI8A 3OLOA 3R4KA 4LRZE 3LYXA 3HJIA 3K3DA 3O5YA 3PR6A 4GCZA 1T1CA 3LR4A 2M7VA 3UMDA 2B18A 1YAXA 2KOIA 5HPFA 3MMHA 2R78A 4I3AA 3LI9A 3MR0A 4MN5A 4IUKA 2W1RA 4PAUA 4R6LA 2PYPA 5TBMB 3S7OA 1DP6A 3DBAA 3LIAA 2I9VA 5HWTA 1TD5A 3E4QA 3BJNA 3K3CA 4ME4A 3BQ8A 4WEKA 4EW7A 2QKPA 3TRCA 1N9LA 3OOVA 3RTYA 3H82A 1T19A 2NUTC 2FZ0A 1UWNX 1P9WA 2VV8A 1NWZA 3PBRA 5F68A 2VGLM 4YWZA 3UB7A 3EQVA 5K5BA 4JGQA 2HV1A 3KSIA 5KSHA 4HJ3A 3C2WA 2V0WA 4WN5A 3C8CA 4Y2FA 5IT5A 3LUQA 4R3AA 3ZQ5A 2VEAA 1ZHHB 3H7WB 4NXEA 4L9FA 3D3OA 4HJ4A 4KUOA 2W1TB 3P01A 1XFNA 2JKTM 2LB9A 4DMZA 4I5SA 1VB6A 1F9IA 4CLCB 4II7A 5F5YA 1NLYA 3F1PA 1XJ6A 2VA0A 4EETB 1S1ZA 3T4JA 1OTBA 2O0YA 3ICYA 1OTIA 5HL6A 1T18A 1XJ2A 4ARZB 4EESA 3CI6A 4ZRRA 2HF6A 1OPXA 4GJ4A 3T4QA 3C38A 4GHIB 2HJEA 4GS9A 3T4TA 3UB6A 2D02A 3K2NA 1TS7A 3R7WA 5HWWA 4BJPA 2Y8HA 2D01A 3OC2A 2JKRI 3H82B 3TJZC 2PD7A 3W2ZA 2W27A 5C5KA 3NJAA 1TF1A 3OCLA 3UMEA 1LT0A 3MF0A 1S4SA 5HD3A 5DFYA 1D06A 2M1CA 3NOTC 3IBJA 2O9CA 2QJ5A 3NOPC 1OJ5A 4Q0HA 4O8GA 5F6AA 1H8MA 4FOFA 1EW0A 4G3KA 3VOLA 5IU1A 3S7NA 1LSXA 4AFIA 4I39A 1S66L 4I3JA 3UB9A 4O01A 3B47A 4HY8A 2A24A 4MN6A 5CX7A 2QJ7A 4MN7A 4H6JA 4WUJA 4UQIM 2PDRA 2XRNA 2VV6A 3U2AA 3UB8A 1X0OA 4NXFA 2A2LA 2B02A 3FPWA 4KQDA 5J7EA 2OWHA 1YSPA 1UGUA 1ODVA 2L1MA 3CUEA 2O9AA 4ARZA 1N9NA 3LICA 3CITA 3MQOA 3S7PA 4EXOA 4Y5FA 4EERA 2ZMVA 4BBVA 3E98A 4R70A 5DKKA 5A8BA 5HZHA 3F1NB 4IHQA 3CAXA 3T4OA 2EWWA 4I3IA 3TW8A 3ULFA 2KLIA 2P08A 4R38A 4BBUA 3MFXA 3BQAA 1OT6A 3LIEA 4PHTA 2J80A 2XSSA 4CLCA 3MJQA 2OAP1 4BBTA 4DN0A 3UE3A 1T1AA 2OWJA 5J3WA 2ZOIA 2MJ6A 5HWVA 3OCNA 5LBRA 4QPRA 3PYPA 2V9AA 4G3WA 3NOUC 2Y79A 2PYRA 2WKRA 2OOLA 2W1TA 3LR3A 2VJWA 3P7NA 5TBMA 2WKQA 3PBTA 1GSVA 1VHMA 2PD8A 1XJ4A 2W3FA 3LIDA 4CQHA 1STZA 3KSHA 4O0PA 2PHYA 2XA7S 4PKYG 3PBNA 4KQOA 4K08A 4NEED 4HQAA 4GHIA 2VKSA 3IS2A 4KUKA 4CLCE 3S7QA 4RQ9A 2W3HA 3E0YA 3VE3A 3C30A 3NHQA 4P6ZM 5AJGA 3UE6A 4M4XA 1LSWA 4F3LB 2GJ3A 1P0ZA 4YNRA 4HI4A 4MMNA 5G4YA 2VV7A 2ZMFA 2V0UA 3F1PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUT C;  1IFQ A;  4AFI A;  3BW6 A;  1H8M A;  4B93 A;  3KYQ A;  2DMW A;  3EGD C;  1IOU A;  2NUP C;  3EGX C;  2VX8 A; 
#chains in the Genus database with same CATH topology
 1LL8 A;  1ZC2 A;  1HLU P;  4HOI A;  3JVU A;  3T1S A;  3IWO A;  5FQ9 A;  2EX2 A;  5L8M A;  1TS0 A;  4DE3 A;  3IXD A;  3LCE A;  3WS0 A;  4OOM A;  4GN2 A;  3LIF A;  1Z6F A;  2HDQ A;  3ZHH A;  1BLS A;  3OBF A;  3IWI A;  4Y3I A;  3V3R A;  4MEZ A;  2DRW A;  1S4R A;  2PU4 A;  3DTI A;  4OOL A;  2GX5 A;  3F1O B;  4Z1W A;  4NXG A;  2ZM8 A;  2O9B A;  4IVI A;  3PXP A;  4G3V A;  3E4P A;  3F1N A;  3NIA A;  5F1F A;  5CEC A;  5CHU A;  3DWK A;  3PBS A;  2Z6D A;  2DNS A;  3LR0 A;  4QWO A;  1OJG A;  1JNU A;  5FQM A;  2H0T A;  4HHD A;  3KO6 A;  2EFX A;  1W63 Q;  1V9Z A;  3I7J A;  2L0W A;  3HLG A;  5E2H A;  1NXY A;  5FQK A;  2V8C A;  1AWI A;  2VZW A;  3T1X A;  1IKG A;  5DTK A;  5F82 A;  5AVE A;  4LPZ A;  3FV7 A;  5EVE A;  3FPV A;  2YKF A;  1SKO A;  1NRJ A;  2OAQ 1;  3G6O A;  5J4E A;  2G2W A;  1KGF A;  1L0E A;  3CJM A;  3N8R A;  4ZAM A;  5FI2 A;  1ERO A;  2BAS A;  1K57 C;  2JKT I;  2OLV A;  4P87 A;  1KOU A;  2PR5 A;  4BL3 A;  1BUE A;  4E6W A;  2XA7 M;  3BY8 A;  1LSV A;  3KSF A;  3NBL A;  1MZU A;  4LRX C;  1NJ4 A;  3GVB A;  3MQ0 A;  1K55 C;  4UA7 A;  1G28 A;  3OPH A;  5L09 A;  1PZO A;  3H9W A;  2V20 A;  1P97 A;  1DJA A;  3H7W A;  2ZD8 A;  4JLF A;  1ZG6 A;  3ZVT A;  3C7V A;  1OTA A;  1XFQ A;  1S67 L;  1MWU A;  3QNB A;  4H6J B;  4X6T A;  5EVL A;  4DE0 A;  5HDC A;  2EFU A;  4XT2 A;  4ETX A;  1YLP A;  1TVF A;  4JXW A;  1ESU A;  1H5X A;  3IHB A;  4OQ0 A;  3T12 B;  3RFB A;  2J9O A;  5FI7 A;  1WYB A;  3KYQ A;  3WS2 A;  3KX0 X;  4PM8 A;  3T4S A;  2XLN A;  1MKM A;  2A24 B;  3HUM A;  1H3Q A;  5CXW A;  2ZQD A;  1TS6 A;  2W3G A;  3FWL A;  4MCW A;  1HVB A;  4RX3 A;  4UQI S;  4K0X A;  4YIN A;  4WEJ A;  3LI8 A;  1NYY A;  1CQA A;  2ZC4 B;  1HTZ A;  3HJI A;  5HAI A;  3K3D A;  3O5Y A;  1KE3 A;  3CG5 A;  2M7V A;  3TOI A;  5FQI A;  2R78 A;  1GHP A;  3O88 A;  3LI9 A;  3HLF A;  4KG5 A;  4UA6 A;  1FIL A;  1DP6 A;  2I9V A;  3VOY A;  1LL9 A;  3K3C A;  4ME4 A;  3BQ8 A;  1K0K A;  3TRC A;  4K91 A;  2FZ0 A;  3BLM A;  4X1L A;  3UB7 A;  5EUA A;  5K5B A;  2HV1 A;  3ZGA B;  3VP1 A;  1IYQ A;  4HJ3 A;  2JBF A;  1MWS A;  2Q0O A;  3C8C A;  4Y7P A;  1BUL A;  1H8Y A;  3ZQ5 A;  3NC8 A;  4NXE A;  3D3O A;  4HJ4 A;  4UHU A;  4E3O A;  2W1T B;  2OV5 A;  3P01 A;  1KGE A;  1F9I A;  2XGN A;  3NCK A;  5FQJ A;  4XUX A;  4E3M A;  4EQI A;  3F1P A;  4MLL A;  1CI9 A;  1XJ6 A;  5FAT A;  2Y2P A;  4EET B;  2HP6 A;  2Y4A A;  5HL6 A;  1ZKJ A;  3CI6 A;  4X68 A;  4S2N A;  2HF6 A;  2Y2I A;  4ZJ3 A;  1OPX A;  2JC7 A;  2EXA A;  3C38 A;  4QHC A;  5GL9 A;  2WAF A;  3T1Q B;  3K2N A;  3W4Q A;  4BJP A;  3QP6 A;  5L10 A;  2D01 A;  3GMW A;  3H82 B;  3VP4 A;  3M6B A;  4C75 A;  4FD8 A;  3A3J A;  3UPP A;  2W27 A;  5C5K A;  2ZC5 B;  4ZBE A;  5GLD A;  2JKG A;  3AGF A;  3VOZ A;  3MF0 A;  1S4S A;  5HD3 A;  5DFY A;  1C3B A;  5A92 A;  4O8G A;  3BRM A;  1EW0 A;  4MBH A;  4I39 A;  2ZMA A;  4MN6 A;  3FKW A;  3N7W A;  3G30 A;  3BFF A;  3L7H A;  4WUJ A;  2PDR A;  5GLB A;  4NXF A;  1N9N A;  1K6S A;  3MQO A;  3BFG A;  5M18 A;  4KEN B;  4Y5F A;  4EER A;  4BBV A;  4YFM A;  5DKK A;  3WS5 A;  3F1N B;  4IHQ A;  4CPK A;  4JF6 A;  3T4O A;  3B3X A;  3BFD A;  5F1G A;  5AQ7 A;  3TW8 A;  3DW0 A;  2P08 A;  1ES5 A;  5E43 A;  3WS1 A;  3BQA A;  1OT6 A;  3LIE A;  2P9V A;  3HRE A;  1K38 A;  3MJQ A;  1N4O A;  1XA1 A;  2JE5 A;  4N92 A;  1IEM A;  2ZOI A;  5A91 A;  3Q82 A;  4NG2 A;  5HWV A;  2OLU A;  2V9A A;  1I2S A;  2Y79 A;  2PYR A;  2VJW A;  3P7N A;  1XP4 A;  5TBM A;  1K56 A;  4OQH A;  2WKQ A;  5EEC A;  1ERM A;  2FFF B;  4ESP A;  1VHM A;  4KQR A;  1FIK A;  3ZNT A;  5M19 A;  4S2M A;  4PKY G;  3QP4 A;  4EBN A;  4HQA A;  1K4F A;  4KUK A;  5L2F A;  1CJF A;  4RQ9 A;  2W3H A;  3NHQ A;  4OON A;  1QME A;  1KGG A;  1LSW A;  4KZ9 A;  5AQA A;  1P0Z A;  4E3L A;  3LEQ A;  2JCH A;  3UN7 A;  2VK3 A;  4NXB A;  4HP9 A;  5G4Z A;  1W63 M;  2R9W A;  4HH2 A;  5CER A;  2ZQ8 A;  1CK3 A;  3O86 A;  1JTD A;  1ES4 A;  4D2O A;  1L0F A;  4EUZ A;  2ZJ9 A;  5EM1 A;  2HP9 A;  2QWS A;  1MPL A;  2XFS A;  3VP0 A;  1AXB A;  2Y2J A;  5CED A;  3EGD C;  4RYE A;  4EBL A;  4EEU A;  3BY9 A;  4OP8 A;  1GA9 A;  1IYO A;  2V1B A;  1M6K A;  1WYC A;  3B33 A;  1YLY A;  2WKP A;  2QMI A;  3PAE A;  4EEP A;  3LFV A;  4KG2 A;  2H10 A;  1FCM A;  2K7S A;  2QPN A;  3NY4 A;  3ZYT A;  2RCX A;  4S2I A;  2ZOH A;  1IOU A;  4YOF A;  5EVI A;  3FC7 A;  3S1Y A;  3VFH A;  3IF6 C;  4BMW A;  4JGR A;  4FTX A;  5AVF A;  5EOO A;  3A0V A;  3IX4 A;  4WMC D;  3BEC A;  2ZQA A;  2NUP C;  3IX8 A;  3VSK A;  1ZTU A;  3V67 A;  4HH3 A;  3WRT A;  1T1B A;  2R9X A;  4FSF A;  4WBG A;  3G2Z A;  3NEC A;  5FDS A;  4Q0J A;  5FDH A;  1GSX A;  3FYZ A;  1GHM A;  1YLW A;  3F1O A;  3G34 A;  3IS2 B;  3EWK A;  3V50 A;  2V1A A;  4Y0U A;  1NLZ A;  2K31 A;  3HLD A;  3BW6 A;  1UWP X;  3GR2 A;  2WGI A;  1ONH A;  3EEH A;  4UAA A;  1OME A;  1DRM A;  5EFW A;  2JHE A;  4XT2 B;  4E04 A;  2HPB A;  1W8Q A;  1TDL A;  4Y13 A;  3MKE A;  1RGY A;  1KVM A;  4EBP A;  3GTC A;  5FEG A;  4KZ8 A;  3BFC A;  3NUL A;  4WYY A;  4GLQ A;  5G18 A;  1N9O A;  1GSW A;  4WZ5 C;  1L0G A;  2OSU A;  3U4L P;  5KIZ A;  3CUE C;  1IYP A;  2DCF A;  3LIB A;  3CPT B;  2KDK A;  2W0N A;  3ZFZ A;  3WS4 A;  2Z6C A;  4Q0I A;  4GW9 A;  3UE0 A;  5HW3 A;  1F5M A;  2PT7 A;  1NYM A;  5BOH A;  1TS8 A;  2INW A;  3KYZ A;  4RX2 A;  3CHW P;  1BLC A;  5FQQ A;  3VE4 A;  2ZQ9 A;  4BL2 A;  1XKZ A;  2XH9 A;  3VV4 A;  3KSG A;  1MC0 A;  4LV1 A;  2M7U A;  1XGJ A;  4JF5 A;  3IXB A;  1PRQ A;  4KZ7 A;  2J3T D;  2BG1 A;  1YLT A;  4LRZ E;  2ZC7 A;  1LLB A;  3A3F A;  4PMA A;  1T1C A;  4GDB A;  3UMD A;  4FUW A;  1YAX A;  5HPF A;  2ZM2 A;  4KZ5 A;  3C4P A;  1S0W A;  4X69 A;  3MFD A;  4IUK A;  4R6L A;  2PYP A;  5TBM B;  3S7O A;  4DE1 A;  4PM6 A;  5HWT A;  1PWC A;  3BJN A;  4WEK A;  3LO7 A;  3D4F A;  1N9L A;  3H82 A;  1MWT A;  3SS4 A;  1PW1 A;  2ACG A;  2VGL M;  4YWZ A;  4JGQ A;  2P9V B;  3KSI A;  2ZL1 A;  4WZ4 A;  5KSH A;  1MY8 A;  3C2W A;  1XXM A;  5IT5 A;  3IF5 A;  3LUQ A;  4LCL A;  1ZHH B;  4N9L A;  4MBF A;  3N4I A;  3P98 A;  4U3T A;  4KUO A;  1XPB A;  2EX6 A;  3CPT A;  2XQZ A;  1XFN A;  2JKT M;  4R3J A;  1FR6 A;  2G2U A;  3BLS A;  1F2K A;  1IYS A;  4I5S A;  2XF3 A;  3QP1 A;  4KQQ A;  4S2P A;  1K55 A;  2VA0 A;  1S1Z A;  4IVK A;  1OTB A;  4OP5 A;  3UO9 A;  2O0Y A;  1OTI A;  1G68 A;  1M40 A;  4ARZ B;  2Y2M A;  4EES A;  1SDE A;  5FEF A;  1VET A;  2PRF A;  4NK3 A;  1K57 A;  3T4T A;  4LV3 A;  2D02 A;  1TS7 A;  5FA7 A;  2Y91 A;  1IKI A;  2Y8H A;  2PD7 A;  3MZF A;  3W2Z A;  3NJA A;  2PBD P;  1TF1 A;  1LT0 A;  4MBK A;  3NOT C;  3NOP C;  5EE8 A;  3VP3 A;  4R1G A;  1E25 A;  1H8M A;  4FOF A;  3OPR A;  1JWV A;  4G3K A;  3VOL A;  3S7N A;  1LSX A;  5D3O A;  3UB9 A;  4X53 A;  3PAG A;  2QJ7 A;  4B88 A;  1BT5 A;  4UQI M;  4GOG A;  5KMW A;  2VV6 A;  5EVI B;  3UB8 A;  3G31 A;  5HX9 A;  3FPW A;  4KQD A;  2OWH A;  1YSP A;  1K56 D;  1UGU A;  2L1M A;  4OLG A;  1VEU B;  3E98 A;  3DTM A;  4OVD A;  3V5M A;  5HZH A;  4I3I A;  1PYY A;  1N9B A;  4S2J A;  3RXX A;  4JXG A;  4R38 A;  4BBU A;  3ZG9 B;  2Y2Q A;  2EXB A;  2XSS A;  3UB5 P;  4CLC A;  4OPQ A;  4U0X A;  2V8F A;  2B5R A;  4OQG A;  2MJ6 A;  5LBR A;  4QPR A;  4DF6 A;  1DJB A;  3C7U A;  3NOU C;  3GQZ A;  2WKR A;  2WKH A;  3PBT A;  1GSV A;  2X01 A;  4R0Q A;  4BD0 A;  2W3F A;  3QP5 A;  2J8Y A;  2Y2L A;  5A90 A;  1XX2 A;  1STZ A;  2PHY A;  2XA7 S;  3PBN A;  4GHI A;  4MNR A;  4CLC E;  2H0Y A;  3S7Q A;  3E0Y A;  1XGI A;  1D1J A;  1QMF A;  4PM5 A;  5CRF A;  5AJG A;  1EI5 A;  3T1R A;  2HZ5 A;  4YNR A;  4MMN A;  2WK0 A;  4XXR A;  3RH8 B;  1V9Y A;  3RJU A;  4DKI A;  2WKI A;  5FSR A;  3OPL A;  3E4O A;  4WL9 A;  3MXR A;  1DP9 A;  5HSQ A;  2PAV P;  5HAP A;  5HL1 A;  2J3W A;  3ZNY A;  4FH2 A;  4LCM A;  2BTF P;  3W4O A;  3QP8 A;  4A5R A;  3R7W B;  1YKD A;  4FCF A;  3A3E A;  2H28 A;  1PNE A;  5DJU A;  2WGW A;  5DTS A;  2EA9 A;  1GHI A;  4X56 A;  5FI6 A;  5DF7 A;  4P0M A;  3IT9 A;  3SS3 A;  5GLA A;  3E2L A;  3BEB A;  2PU2 A;  1ONG A;  5DTT A;  4ID4 A;  4JF4 A;  4L9G A;  4HBU A;  2JN7 A;  5CGX A;  3MQQ A;  5DF9 A;  3LGO A;  5HAR A;  4B9O A;  4BWI A;  5JYO A;  1LI9 A;  2VX8 A;  1L2S A;  4K0W A;  4OPY A;  4IED A;  3IXG A;  1W79 A;  4S2N C;  3FKV A;  3EQU A;  4D60 A;  3GEC A;  3CWF A;  2C5W B;  3IBR A;  1F98 A;  5CTN A;  3HUN A;  4X25 A;  4NKP A;  3VP2 A;  2GNX A;  3BWL A;  5TFQ A;  4WEL A;  1GA0 A;  2V2F F;  4XUZ A;  5DVA A;  4M3K A;  2XDM A;  3CLO A;  4ETZ A;  2WZX A;  2YKH A;  3W8K A;  5E2E A;  1Y54 A;  3HJK A;  3VSL A;  3IXH A;  4P6Z S;  1OT9 A;  5EVI D;  4DJ3 A;  1VM1 A;  3M2J A;  3SW1 A;  2VLG A;  3Q07 A;  4LLO B;  4PM7 A;  4WF0 A;  1LL5 A;  5HD5 A;  1ZG4 A;  3GSG A;  1NZU A;  2IA2 A;  5DJT A;  5DFX A;  4EWF A;  4KZB A;  4E3K A;  1NZO A;  4HJ6 A;  4WLA A;  5E2G A;  2H5S A;  1XJ3 A;  4R4R A;  4DJ2 A;  3TG9 A;  1TEM A;  1WA9 A;  2LB5 A;  3HUO A;  4JBF A;  2XRO A;  4BD1 A;  5MC7 A;  1YLJ A;  3IF6 A;  3ISG A;  4E3I A;  4B93 A;  2VGK A;  4P6B A;  3SS5 A;  2ZBB A;  4E3J A;  4Z9Q A;  4QU3 A;  4DXB A;  3O87 A;  4OKP A;  3EEA A;  1SDN A;  4CLC C;  2WGW B;  2E8J A;  4LRY C;  2EWV A;  4UEY A;  5U47 A;  2HDS A;  1SHV A;  3N8S A;  2HGV A;  2QZ6 A;  3HLE A;  4IUH A;  5CHJ A;  3G2Y A;  3FZC A;  3VMA A;  5HDS A;  3FG8 A;  2BLS A;  3EOI A;  1FCO A;  5FL3 A;  4JXS A;  1OTD A;  1DJC A;  3HLC A;  2XK1 A;  3LY3 A;  3R4K A;  3A3D A;  2UV0 E;  3LYX A;  2Q9N A;  2FFY A;  3PR6 A;  3LR4 A;  1CF0 A;  2XR0 A;  3UE1 A;  3MMH A;  4ZDX A;  4I3A A;  4LGW A;  3IH9 A;  2W1R A;  4PAU A;  5FAQ A;  1A0K A;  1HZO A;  3E2K A;  1TD5 A;  3NDE A;  4EW7 A;  3DTK A;  3OOV A;  4U0T A;  1T19 A;  2NUT C;  4F94 A;  3SH8 A;  1UWN X;  2VV8 A;  1NWZ A;  3PBR A;  5TR7 A;  2J9P A;  2ZQC A;  4FH4 A;  1VEU A;  1JWP A;  2V0W A;  4WN5 A;  2IWB A;  4Y2F A;  1PI5 A;  1PZP A;  4KG6 A;  1ES2 A;  4OH0 A;  4Y17 A;  4L9F A;  4JXV A;  1YLZ A;  1FOF A;  1I2W A;  2LB9 A;  3DAV A;  3CZD A;  4QB8 A;  4X55 A;  5F5Y A;  3N8L A;  2HDR A;  3T4J A;  5CHM A;  1XJ2 A;  4ZTK A;  4R4S A;  4RVA A;  4ZRR A;  5A93 A;  4GJ4 A;  3QP2 A;  1H8Z A;  3MBZ A;  4GHI B;  1I5Q A;  1PWG A;  4GS9 A;  1W8Y A;  4LV2 A;  3WWX A;  5HWW A;  2XFT A;  3OC2 A;  3OZH A;  5F83 A;  3TJZ C;  3ZDJ A;  3WRZ A;  2RL3 A;  4OLD A;  1FSW A;  4QJG A;  5EV0 A;  2V1Z A;  3O3V A;  1CEG A;  1D06 A;  2M1C A;  5HFO A;  3IBJ A;  4Q0H A;  4DDY A;  1J3W A;  5F6A A;  2Y2K A;  4JPM A;  3S4X A;  3P09 A;  3B47 A;  4LFU A;  3UPN A;  5CX7 A;  4MN7 A;  4H6J A;  2XRN A;  3LEZ A;  3U2A A;  4IBX A;  1DY6 A;  4UA9 A;  3Q7V A;  1YT4 A;  5J7E A;  3CUE A;  3BM6 A;  3LIC A;  3CIT A;  1FCN A;  3S7P A;  5GHZ A;  3MZD A;  2ZMV A;  3NI9 A;  1Q2Q A;  4R70 A;  3A3I A;  2P74 A;  2A3U A;  3DTE A;  4Q8I A;  2X71 A;  5EPH A;  3G35 A;  3OPP A;  1KE4 A;  5FAO A;  1FSY A;  3GV9 A;  3L9K A;  2J80 A;  5J8X A;  3UNW A;  2OWJ A;  5J3W A;  2WGV A;  4N9K A;  3OCN A;  4BLM A;  3MSH A;  2ZLY A;  3PYP A;  4G3W A;  1ACF A;  1BSG A;  2OOL A;  2W1T A;  3UDX A;  2Y59 A;  1H0M A;  2WAD A;  3PTE A;  1MXO A;  3LID A;  4QY6 A;  1Z09 A;  1SKO B;  3Q1F A;  3KSH A;  4O0P A;  1CI8 A;  3UDF A;  3ZG5 A;  3Q7Z A;  3VFF A;  4KQO A;  4K08 A;  4NEE D;  1VET B;  2WKE A;  3IH8 A;  4RA7 A;  3ZCZ A;  1MWR A;  4GKU A;  3ITB A;  3UPO A;  5KSC A;  4OQI A;  1PIO A;  5DF8 A;  4M4X A;  1SKF A;  4F3L B;  1JVJ A;  1K54 A;  4HI4 A;  2EX9 A;  5G4Y A;  5CTM A;  2ZQ7 A;  1KDW A;  2KX6 A;  2GZA A;  2CMN A;  5GHX A;  2O99 A;  4JGO A;  4PPR A;  4KZ6 A;  4EUV A;  4HNB A;  1YMS A;  1PFL A;  2W3D A;  5GHY A;  1NY0 A;  1D7E A;  4L9E A;  5E2F A;  3QNC A;  3D9Y A;  1IEL A;  1OTE A;  2C6W B;  4PKY A;  3IQA A;  5FAP A;  3JVV A;  3GRJ A;  3G4P A;  5EM0 A;  1VQQ A;  1EWZ A;  3SOI A;  1FR1 A;  3IHA A;  1K25 A;  4QY5 A;  4JGP A;  3Q7V B;  4N1X A;  4B4Z A;  1S1Y A;  2FH5 A;  3AGE A;  4EQ1 A;  2P04 A;  3SH9 A;  5TJJ A;  4KZ4 A;  2K2N A;  2UWX A;  2Q9M A;  3W4P A;  2VGL S;  5I5L A;  1K54 C;  3PHY A;  3V3S A;  5HPI A;  3T50 A;  1S6R A;  4BEN A;  4DE2 A;  2QYB A;  5GLC A;  5IS1 A;  3MXQ A;  4Y15 A;  1YSQ A;  1E3U A;  3NDG A;  4R23 A;  1W5D A;  4GNU A;  3SZT A;  1K6R A;  3HCY A;  4L0L A;  1G6O A;  2G7U A;  3TE8 A;  1G5U A;  2P7J A;  4OOY A;  2JKF A;  4PM9 A;  2Y2H A;  4O7D A;  4EU0 A;  1BLP A;  1BYW A;  3IWQ A;  2WUQ A;  2J3T C;  1K4E A;  1PI4 A;  2B95 A;  3LR5 A;  4CJN A;  1Y4O A;  2W3E A;  4MDZ A;  3PBO A;  3A0R A;  3BFE A;  2HDU A;  5EVI C;  4C3Q A;  4IJG A;  4GS9 B;  5CGS A;  3GDI A;  3C5A A;  5CEB A;  1U60 A;  2Z2L B;  3ZG7 B;  2QHK A;  5TGF A;  3MZE A;  2ZL1 B;  4R3B A;  3T4L A;  3T4K A;  1DP8 A;  1ES3 A;  2IWD A;  5DKL A;  1ALQ A;  1KE0 A;  5F69 A;  1BTL A;  1GCE A;  4C6Y A;  4IBR A;  3Q81 A;  1LI0 A;  4GD8 A;  3DWZ A;  4HP4 A;  4QD4 A;  2IWC A;  1IFQ A;  3LY4 A;  3A0S A;  2WAE A;  2HJ9 C;  4HIA A;  1SZV A;  5FAS A;  1Q2P A;  4CLC D;  5AQ9 A;  3C4O A;  1JWZ A;  3PBQ A;  2JKR M;  3TSG A;  2L4R A;  4DDS A;  2PR6 A;  5KZH A;  1RGZ A;  1HD8 A;  3D72 A;  4HES A;  1NRF A;  3MKF A;  3EGX C;  2DMW A;  4I38 A;  5HDD A;  2VGJ A;  3JPU A;  3B42 A;  4F3L A;  1ERQ A;  1Y28 A;  2HP5 A;  1P9R A;  3OLO A;  4JKT A;  3HBR A;  3BYD A;  5M1A A;  4GCZ A;  2B18 A;  2KOI A;  5AQB A;  4DXC A;  2EX8 A;  3MR0 A;  4MN5 A;  2Y55 A;  2I72 A;  3DBA A;  3LIA A;  3AGD A;  3E4Q A;  3ZVW A;  4N1H A;  2QKP A;  4S2L A;  1XA7 A;  2ZM0 A;  3RTY A;  1J9M A;  1W7F A;  2Y2N A;  1P9W A;  5F68 A;  4OPZ A;  4KZA A;  2Y2G A;  3EQV A;  1JTG A;  1RP5 A;  4R3A A;  2VEA A;  3H7W B;  1ESI A;  1WE4 A;  5EOE A;  3QHY A;  2X02 A;  4WZ5 A;  4DMZ A;  2AVX A;  5HAQ A;  1VB6 A;  4CLC B;  2WYX A;  1FQG A;  4II7 A;  1E3U D;  1NLY A;  1BLH A;  2Y2O A;  1KVL A;  5L07 A;  3HL9 A;  1MKI A;  3ICY A;  4X1M A;  1T18 A;  1YQS A;  4ZJ2 A;  2ZC6 B;  3T4Q A;  4Y0O A;  2HJE A;  3UB6 A;  3R7W A;  2JKR I;  1YMX A;  3OCL A;  3UME A;  2XD1 A;  1L3L A;  1TDG A;  3CMZ A;  2XEP A;  2O9C A;  2QJ5 A;  1OJ5 A;  3M2K A;  4H8R A;  4KZ3 A;  1PW8 A;  2GDN A;  1E4D A;  2J7V A;  5IU1 A;  4AFI A;  3JYI A;  2A49 A;  3SH7 A;  3RXW A;  1S66 L;  4I3J A;  4S2K A;  4O01 A;  4HY8 A;  2A24 A;  1KDS A;  3ZG0 A;  4B4X A;  4P85 A;  1X0O A;  2A2L A;  4OPR A;  2B02 A;  1LHY A;  1ODV A;  4ARZ A;  2O9A A;  2WZZ A;  4Y0T A;  4EXO A;  4BQM A;  4ZJ1 A;  5A8B A;  3UY6 A;  3N6I A;  3MXS A;  3G32 A;  3KYE A;  4S2O A;  4E6X A;  3CAX A;  2EWW A;  1SCW A;  4GB7 A;  5I94 A;  3ULF A;  2KLI A;  4LEN A;  4EV4 A;  1YPR A;  3MFX A;  1BZA A;  4PHT A;  2PBY A;  3M6H A;  4DRT A;  2OAP 1;  3HLW A;  4BBT A;  4DN0 A;  5JYP A;  1YM1 A;  4GDN A;  3UE3 A;  1T1A A;  3IF6 B;  5CGW A;  3HVF A;  3HLB A;  2Z2M B;  1O7E A;  3LR3 A;  2CC1 A;  3MS6 A;  3V39 A;  3UDI A;  5IHV A;  2PD8 A;  4WMC A;  1XJ4 A;  1MBL A;  4WM9 A;  4CQH A;  1RCJ A;  2ZC3 B;  1O07 A;  1L0D A;  4LV0 A;  1CEF A;  1PWD A;  1G6A A;  4GZB A;  2VKS A;  3IS2 A;  4NET A;  4E3N A;  3VE3 A;  3ZG8 B;  2XD5 A;  2E8I A;  4HBT A;  3C30 A;  3ITA A;  4HEF A;  4P6Z M;  3UE6 A;  3S22 A;  3IX3 A;  2GJ3 A;  4GD6 A;  2VV7 A;  2ZMF A;  2V0U A;  3F1P B; 
#chains in the Genus database with same CATH homology
 2KX6 A;  1LL8 A;  3RH8 B;  2GZA A;  2CMN A;  1V9Y A;  4NXB A;  2O99 A;  4HP9 A;  4HOI A;  3JVU A;  1W63 M;  5G4Z A;  4JGO A;  5L8M A;  4EUV A;  1TS0 A;  4HNB A;  3E4O A;  4WL9 A;  4HH2 A;  2W3D A;  1DP9 A;  5HSQ A;  1D7E A;  4OOM A;  4L9E A;  3LIF A;  2J3W A;  4PKY A;  1OTE A;  2QWS A;  3OBF A;  3JVV A;  3EGD C;  4Y3I A;  3R7W B;  1YKD A;  4EEU A;  3BY9 A;  2H28 A;  4JGP A;  1S4R A;  5DJU A;  2EA9 A;  2V1B A;  3B33 A;  1S1Y A;  2FH5 A;  2WKP A;  4EQ1 A;  4OOL A;  2GX5 A;  2P04 A;  4EEP A;  3F1O B;  5TJJ A;  2K2N A;  4Z1W A;  4NXG A;  3LFV A;  2VGL S;  5I5L A;  3PHY A;  5HPI A;  2O9B A;  3T50 A;  3PXP A;  4G3V A;  2K7S A;  4L9G A;  2JN7 A;  3E4P A;  3F1N A;  3ZYT A;  2QYB A;  3MQQ A;  2ZOH A;  5DF9 A;  1IOU A;  5IS1 A;  4YOF A;  3MXQ A;  3FC7 A;  1YSQ A;  3PBS A;  2Z6D A;  4BMW A;  3LR0 A;  4JGR A;  1OJG A;  4B9O A;  1JNU A;  4BWI A;  3HCY A;  5AVF A;  4L0L A;  1G6O A;  2G7U A;  3A0V A;  4HHD A;  3TE8 A;  2VX8 A;  3KO6 A;  2P7J A;  1W63 Q;  1V9Z A;  2L0W A;  2NUP C;  1ZTU A;  3V67 A;  4EU0 A;  3EQU A;  1BYW A;  3GEC A;  4HH3 A;  3CWF A;  3IBR A;  2VZW A;  1F98 A;  1T1B A;  2J3T C;  4NKP A;  2GNX A;  3BWL A;  4WEL A;  5AVE A;  4FSF A;  3LR5 A;  4LPZ A;  3FPV A;  3CLO A;  2YKF A;  4Q0J A;  2W3E A;  4ETZ A;  1NRJ A;  2OAQ 1;  3PBO A;  3A0R A;  2YKH A;  4MDZ A;  3G6O A;  1GSX A;  5J4E A;  3F1O A;  3HJK A;  3IS2 B;  4P6Z S;  1OT9 A;  3EWK A;  2V1A A;  1NLZ A;  4IJG A;  2BAS A;  4GS9 B;  4DJ3 A;  2K31 A;  3GDI A;  3BW6 A;  2JKT I;  3SW1 A;  2VLG A;  1KOU A;  2PR5 A;  1UWP X;  4LLO B;  4WF0 A;  5HD5 A;  2XA7 M;  3BY8 A;  3EEH A;  1LSV A;  3KSF A;  1MZU A;  1DRM A;  2IA2 A;  2QHK A;  5DFX A;  5DJT A;  5EFW A;  4LRX C;  2JHE A;  4XT2 B;  4E04 A;  4HJ6 A;  3MQ0 A;  4WLA A;  1XJ3 A;  4DJ2 A;  3T4L A;  3T4K A;  1DP8 A;  1G28 A;  3H9W A;  5DKL A;  1WA9 A;  1P97 A;  2LB5 A;  5F69 A;  2XRO A;  4GLQ A;  5MC7 A;  1N9O A;  1GSW A;  4HP4 A;  3H7W A;  1IFQ A;  3A0S A;  1OTA A;  4B93 A;  1XFQ A;  2HJ9 C;  4HIA A;  1S67 L;  5KIZ A;  2ZBB A;  3CUE C;  4H6J B;  3LIB A;  2KDK A;  2W0N A;  5HDC A;  2Z6C A;  4XT2 A;  4ETX A;  4CLC D;  3EEA A;  4CLC C;  4Q0I A;  4GW9 A;  4LRY C;  2EWV A;  1F5M A;  3PBQ A;  4UEY A;  2JKR M;  2PT7 A;  2L4R A;  3RFB A;  2HGV A;  4IUH A;  2PR6 A;  3KYQ A;  1TS8 A;  3KX0 X;  2INW A;  3KYZ A;  3D72 A;  3T4S A;  3VE4 A;  1MKM A;  2A24 B;  5HDS A;  3EGX C;  2DMW A;  4I38 A;  3VV4 A;  1H3Q A;  5HDD A;  3KSG A;  1MC0 A;  3FG8 A;  1TS6 A;  2W3G A;  3B42 A;  4MCW A;  3EOI A;  4F3L A;  5FL3 A;  4UQI S;  1Y28 A;  2M7U A;  1OTD A;  4WEJ A;  1P9R A;  2J3T D;  3LI8 A;  3OLO A;  3R4K A;  4LRZ E;  3LYX A;  3HJI A;  3K3D A;  3O5Y A;  3PR6 A;  4GCZ A;  1T1C A;  3LR4 A;  2M7V A;  3UMD A;  2B18 A;  1YAX A;  2KOI A;  5HPF A;  3MMH A;  2R78 A;  4I3A A;  3LI9 A;  3MR0 A;  4MN5 A;  4IUK A;  2W1R A;  4PAU A;  4R6L A;  2PYP A;  5TBM B;  3S7O A;  1DP6 A;  3DBA A;  3LIA A;  2I9V A;  5HWT A;  1TD5 A;  3E4Q A;  3BJN A;  3K3C A;  4ME4 A;  3BQ8 A;  4WEK A;  4EW7 A;  2QKP A;  3TRC A;  1N9L A;  3OOV A;  3RTY A;  3H82 A;  1T19 A;  2NUT C;  2FZ0 A;  1UWN X;  1P9W A;  2VV8 A;  1NWZ A;  3PBR A;  5F68 A;  2VGL M;  4YWZ A;  3UB7 A;  3EQV A;  5K5B A;  4JGQ A;  2HV1 A;  3KSI A;  5KSH A;  4HJ3 A;  3C2W A;  2V0W A;  4WN5 A;  3C8C A;  4Y2F A;  5IT5 A;  3LUQ A;  4R3A A;  3ZQ5 A;  2VEA A;  1ZHH B;  3H7W B;  4NXE A;  4L9F A;  3D3O A;  4HJ4 A;  4KUO A;  2W1T B;  3P01 A;  1XFN A;  2JKT M;  2LB9 A;  4DMZ A;  4I5S A;  1VB6 A;  1F9I A;  4CLC B;  4II7 A;  5F5Y A;  1NLY A;  3F1P A;  1XJ6 A;  2VA0 A;  4EET B;  1S1Z A;  3T4J A;  1OTB A;  2O0Y A;  3ICY A;  1OTI A;  5HL6 A;  1T18 A;  1XJ2 A;  4ARZ B;  4EES A;  3CI6 A;  4ZRR A;  2HF6 A;  1OPX A;  4GJ4 A;  3T4Q A;  3C38 A;  4GHI B;  2HJE A;  4GS9 A;  3T4T A;  3UB6 A;  2D02 A;  3K2N A;  1TS7 A;  3R7W A;  5HWW A;  4BJP A;  2Y8H A;  2D01 A;  3OC2 A;  2JKR I;  3H82 B;  3TJZ C;  2PD7 A;  3W2Z A;  2W27 A;  5C5K A;  3NJA A;  1TF1 A;  3OCL A;  3UME A;  1LT0 A;  3MF0 A;  1S4S A;  5HD3 A;  5DFY A;  1D06 A;  2M1C A;  3NOT C;  3IBJ A;  2O9C A;  2QJ5 A;  3NOP C;  1OJ5 A;  4Q0H A;  4O8G A;  5F6A A;  1H8M A;  4FOF A;  1EW0 A;  4G3K A;  3VOL A;  5IU1 A;  3S7N A;  1LSX A;  4AFI A;  4I39 A;  1S66 L;  4I3J A;  3UB9 A;  4O01 A;  3B47 A;  4HY8 A;  2A24 A;  4MN6 A;  5CX7 A;  2QJ7 A;  4MN7 A;  4H6J A;  4WUJ A;  4UQI M;  2PDR A;  2XRN A;  2VV6 A;  3U2A A;  3UB8 A;  1X0O A;  4NXF A;  2A2L A;  2B02 A;  3FPW A;  4KQD A;  5J7E A;  2OWH A;  1YSP A;  1UGU A;  1ODV A;  2L1M A;  3CUE A;  2O9A A;  4ARZ A;  1N9N A;  3LIC A;  3CIT A;  3MQO A;  3S7P A;  4EXO A;  4Y5F A;  4EER A;  2ZMV A;  4BBV A;  3E98 A;  4R70 A;  5DKK A;  5A8B A;  5HZH A;  3F1N B;  4IHQ A;  3CAX A;  3T4O A;  2EWW A;  4I3I A;  3TW8 A;  3ULF A;  2KLI A;  2P08 A;  4R38 A;  4BBU A;  3MFX A;  3BQA A;  1OT6 A;  3LIE A;  4PHT A;  2J80 A;  2XSS A;  4CLC A;  3MJQ A;  2OAP 1;  4BBT A;  4DN0 A;  3UE3 A;  1T1A A;  2OWJ A;  5J3W A;  2ZOI A;  2MJ6 A;  5HWV A;  3OCN A;  5LBR A;  4QPR A;  3PYP A;  2V9A A;  4G3W A;  3NOU C;  2Y79 A;  2PYR A;  2WKR A;  2OOL A;  2W1T A;  3LR3 A;  2VJW A;  3P7N A;  5TBM A;  2WKQ A;  3PBT A;  1GSV A;  1VHM A;  2PD8 A;  1XJ4 A;  2W3F A;  3LID A;  4CQH A;  1STZ A;  3KSH A;  4O0P A;  2PHY A;  2XA7 S;  4PKY G;  3PBN A;  4KQO A;  4K08 A;  4NEE D;  4HQA A;  4GHI A;  2VKS A;  3IS2 A;  4KUK A;  4CLC E;  3S7Q A;  4RQ9 A;  2W3H A;  3E0Y A;  3VE3 A;  3C30 A;  3NHQ A;  4P6Z M;  5AJG A;  3UE6 A;  4M4X A;  1LSW A;  4F3L B;  2GJ3 A;  1P0Z A;  4YNR A;  4HI4 A;  4MMN A;  5G4Y A;  2VV7 A;  2ZMF A;  2V0U A;  3F1P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...