2NUPC

Crystal structure of the human sec23a/24a heterodimer, complexed with the snare protein sec22b
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
157
structure length
137
Chain Sequence
MVLLTMIARVADGLPLAASMQEDDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARIMVANIEEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Protein transport protein Sec23A
publication title The Transport Signal on Sec22 for Packaging into COPII-Coated Vesicles is a Conformational Epitope
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 137
sequence length 157
ec nomenclature
pdb deposition date 2006-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2nupC00
2VX8A 2NUTC 3EGXC 1IFQA 3KYQA 3BW6A 2NUPC 3EGDC 2DMWA 1H8MA 4AFIA 4B93A 1IOUA
chains in the Genus database with same CATH superfamily
3NECA 1C3BA 4QB8A 2Y8HA 4PM9A 1MWTA 3E98A 2H0YA 3HLWA 4BBVA 5FQJA 3T50A 2Y2MA 1IEMA 4EU0A 3TJZC 3T4JA 3GTCA 5JYOA 3NULA 3UPNA 1RCJA 1M6KA 3N7WA 3G6OA 3QP6A 4DXBA 3EGXC 4F3LB 2O9CA 1DY6A 2EWWA 5HAQA 1PW8A 5F82A 3M2JA 4Y0UA 4IVIA 1L0GA 4S2JA 2ZLYA 1FQGA 2V20A 5FI7A 1ACFA 4X53A 3I7JA 2A24B 5EPHA 4NXBA 1RP5A 4HI4A 1SKOA 3HCYA 2W1TB 4UA9A 4U0XA 5EM0A 2XF3A 4Y0TA 1Y54A 4L0LA 2ZC7A 1S4SA 2E8JA 2PD8A 4DXCA 1ODVA 3UO9A 2ZM2A 3KSGA 4E04A 3SH8A 4X55A 1GCEA 1VEUB 3NDEA 1ES3A 2DRWA 4L9GA 3BJNA 2GX5A 1FOFA 1KDWA 5E43A 5FQKA 3QP4A 1FSYA 3HLGA 1PWDA 4BBUA 4OOYA 4DMZA 1Z6FA 5HPIA 3FPWA 4F3LA 4G3VA 2Y59A 1YQSA 5DFXA 1K6SA 2WAEA 1J3WA 3KSIA 3NY4A 4U0TA 3PBQA 3N8LA 4WBGA 4P6ZS 1MKIA 2WKPA 4KZ9A 2EFXA 2Y2NA 2A24A 3UDFA 5TJJA 3MQQA 3HJIA 3VSLA 1XA1A 1Q2PA 1TS8A 1ALQA 4GD6A 1NRFA 2AVXA 4OPYA 3N6IA 4YWZA 2NUTC 1KGEA 5G4ZA 4ZBEA 3WS4A 1I2SA 4BD1A 4LRXC 2ZBBA 1XJ6A 3ZFZA 3BFFA 1MBLA 2VV8A 1BLHA 3B42A 1W8QA 1F9IA 3FWLA 1HLUP 4ESPA 1G6OA 4D2OA 2J7VA 3GVBA 5FA7A 4ME4A 3HL9A 2ZQ8A 2ZJ9A 4WMCA 1LL8A 5FQMA 2W0NA 4E6XA 5KIZA 4JGPA 4S2PA 4Q0IA 4HJ3A 4ID4A 2G2UA 5HDSA 4OP8A 3UPPA 3OPPA 3G2YA 1UGUA 3JYIA 3S1YA 3T1XA 2P74A 4BD0A 4Z9QA 2Y2QA 4QHCA 3F1OB 1XJ2A 3G2ZA 4JF6A 3W4OA 3E4PA 3NIAA 4KQRA 5AJGA 4X1MA 1O07A 2R9XA 3UE1A 1D06A 1VETB 4WZ5C 4PPRA 1K55C 3LIDA 4B4ZA 3PBOA 1GSXA 1LI9A 4EERA 1NZOA 2P04A 3UMEA 2GJ3A 4FD8A 4CLCD 3SS4A 3R7WB 5FAQA 2G2WA 1PI5A 3LFVA 3T4OA 3A3EA 3VP3A 2PYRA 1HD8A 3FKWA 2VKSA 3EWKA 2OLVA 4C75A 4HP9A 3WWXA 1IYPA 4HIAA 5J7EA 2JKRI 4DE2A 5KZHA 1DJCA 4BQMA 3QNBA 1ES5A 3WRTA 2HDQA 2Z6DA 2EXAA 4MBFA 1KOUA 3V67A 1OMEA 5DTKA 4DF6A 1OTEA 1IOUA 3UDIA 1E25A 4LV1A 3MF0A 5DF8A 2WGVA 4BENA 3R4KA 3JPUA 1P9WA 3C5AA 1S0WA 5JYPA 1XJ3A 4E3JA 3F1OA 5HW3A 4JLFA 3DTIA 1IKGA 3CWFA 3WS2A 3UE3A 3U4LP 5CEBA 2PBDP 4EEPA 5M18A 4N9LA 3IXHA 3CLOA 1HVBA 1QMFA 4MLLA 1JVJA 3ZGAB 4GZBA 1GHPA 1W79A 3U2AA 4EQIA 3VOYA 3R7WA 4R6LA 1JWZA 5CGSA 3LR5A 3HJKA 2XROA 1YLYA 1V9YA 2HDSA 4UA7A 5L09A 3IHAA 1YLWA 5HDDA 3HREA 2KX6A 1N9LA 3UE0A 1PW1A 5FI6A 1CK3A 3W2ZA 4QY6A 4MN7A 3HLBA 2ACGA 2B02A 3IWIA 3TW8A 2XK1A 1TS0A 4KZ6A 1ES2A 3IT9A 3PAGA 1E3UD 1LI0A 3VP4A 4RX3A 3GSGA 1ZC2A 4GJ4A 4AFIA 3QP8A 1MPLA 1ZKJA 3W4QA 3LY3A 2LB5A 2H28A 4JXSA 2XA7S 1EWZA 3L9KA 4K0XA 3T1RA 5TR7A 3LY4A 1NY0A 3IXBA 3P98A 1WYBA 1SZVA 3HLEA 5DJTA 1T1AA 1NYMA 3SOIA 1KGFA 3PBTA 1S6RA 4KENB 2Y2JA 2XEPA 4IBRA 5F83A 5CERA 4I3AA 2W1RA 5HFOA 5A8BA 1PI4A 1X0OA 3GRJA 3VFHA 3A3IA 2INWA 4X68A 5EOOA 1CEFA 4IUHA 5HAPA 1PIOA 4K0WA 5GHXA 3BYDA 3N8RA 4MMNA 1YPRA 4XT2A 1N4OA 4GS9B 1TF1A 4UQIS 2ZL1B 4LENA 2PYPA 4DKIA 1KE0A 4GB7A 3JVUA 5GHYA 3ZG0A 3Q7VA 3Q7ZA 1H0MA 4B93A 4ZRRA 4N92A 4WMCD 2V0UA 4QPRA 4S2NA 1CI9A 3ZHHA 2X71A 2QZ6A 1T18A 3OZHA 4E3IA 5HDCA 2X01A 2P9VA 4UEYA 2JHEA 1K4FA 1W5DA 3OLOA 4I5SA 4OKPA 5HX9A 3O87A 3IWOA 1J9MA 5HWWA 3MZDA 4ZAMA 4E3OA 1IYQA 3C4PA 2ZQ7A 4LV3A 2JBFA 4N1XA 2J3WA 3PXPA 1L0FA 3F1PB 5DTTA 4ETZA 4GDBA 1EW0A 1OTIA 3G4PA 1SKFA 3CG5A 2XSSA 4GHIA 2Q9MA 3HLFA 2KLIA 5CX7A 1SCWA 5CRFA 2WK0A 1GHMA 5HWTA 4LCMA 1QMEA 1XFNA 1N9BA 1XXMA 5CECA 3DBAA 5TBMB 4NEED 3KYZA 1PRQA 3SH9A 3KYEA 5GLBA 2RCXA 3PBRA 2ZL1A 4HH2A 5LBRA 1TEMA 4P85A 1TS7A 1LLBA 2OWJA 5A92A 4YFMA 3W8KA 3ZVWA 3DW0A 1MY8A 5EVID 1BYWA 4GCZA 5L10A 4BL2A 1OT9A 5IHVA 4KQOA 1Z09A 5DKKA 3IBJA 1TD5A 4JGRA 2FFFB 3NI9A 5HZHA 1M40A 3M2KA 4OONA 1P97A 1SDNA 3EGDC 5GLDA 4QU3A 5DJUA 3CMZA 3SZTA 3HLCA 2BLSA 4XUZA 2FZ0A 2DMWA 4DE3A 1D1JA 1XPBA 4EETB 4NXFA 2EX9A 3O88A 4RVAA 4B4XA 3CAXA 2K2NA 2VV6A 3F1PA 1WYCA 3V5MA 2JKGA 5HSQA 1OT6A 5EECA 2JKTI 2X02A 1JTDA 3V39A 1LSVA 5M19A 2V0WA 4R3JA 2WGWB 2ZC4B 3ZG8B 3OC2A 4ARZB 1K4EA 4KZ4A 2RL3A 3QHYA 2QKPA 4KZ5A 2UWXA 4RX2A 4EBPA 2V8CA 2Y4AA 3EQVA 1ONGA 2Y2HA 4E3LA 3MQOA 4U3TA 1P0ZA 2P08A 2Q0OA 3Q81A 2HV1A 3T4LA 2JC7A 3M6BA 1FCOA 1ERQA 4DRTA 5DVAA 2M7VA 1WA9A 2HDUA 2B95A 1EI5A 4LPZA 1LL9A 3IX3A 2XFTA 5FEFA 4DDSA 4IVKA 4WZ4A 2R78A 1LL5A 4LCLA 2EX8A 4X69A 3T4QA 3BLMA 5HAIA 2ZC3B 3DWZA 3C30A 3FPVA 3G35A 4B9OA 5CHMA 4LFUA 1DP6A 1IELA 4ARZA 3UB9A 1XX2A 3ZDJA 3OCLA 3TG9A 2W1TA 5F1FA 2W3GA 3BWLA 3IXGA 3LIFA 1G68A 1O7EA 1P9RA 1FCMA 2DNSA 1MWSA 3E4OA 3MZFA 4B88A 3LEQA 3WS1A 2V8FA 4JF5A 3OBFA 1G5UA 4Q0HA 4UAAA 2K7SA 4PKYG 4Y3IA 2I9VA 3V50A 3RXWA 3CJMA 4D60A 3DTKA 2PD7A 5HARA 3A0RA 5I94A 3IXDA 2J8YA 4H6JB 3OPHA 1VEUA 2WYXA 3K2NA 4MDZA 4OPRA 4KZ8A 2V1BA 4KZAA 1OJ5A 1YMXA 3FZCA 5GLCA 1BZAA 1PWCA 5CTMA 3O5YA 1NLZA 2G7UA 3ULFA 2QHKA 2M7UA 1NLYA 3BEBA 3UMDA 1L0DA 4GD8A 5CXWA 4HJ4A 2FH5A 5AQ7A 3BRMA 2D02A 3T4SA 5F69A 3VFFA 1NYYA 2W3HA 3D9YA 2K31A 3ZNYA 1L0EA 5L07A 3W4PA 4KG5A 2BTFP 3MXQA 3CI6A 5KSHA 2VGLM 5G18A 4YOFA 1OJGA 3IF6B 3D72A 4BLMA 1CJFA 2HP6A 4JXVA 2WADA 4OQ0A 1SHVA 2Y2OA 3M6HA 2ZOHA 3BFEA 2ZC6B 4GKUA 1V9ZA 3A3FA 2D01A 5J3WA 4GDNA 1K6RA 3ZCZA 5TGFA 1OTDA 3UB6A 3FYZA 4H6JA 2PT7A 4LRYC 3RFBA 3A0VA 1S67L 4S2LA 3VP2A 3S7NA 3BM6A 2O99A 4Y2FA 4H8RA 1DP8A 3IF6C 3ITAA 2QMIA 4C6YA 4R0QA 4IBXA 4HHDA 1XA7A 5MC7A 4JKTA 2HP9A 4Y13A 4WZ5A 3BQ8A 1ERMA 1K55A 4DN0A 4HBUA 1KVLA 5FATA 4OVDA 5F6AA 3MKFA 1N9NA 1WE4A 4OLDA 4PMAA 1OTBA 2HJ9C 1BLSA 2QYBA 2QPNA 2PR6A 4CLCE 3C8CA 1LT0A 5BOHA 1TS6A 1TDGA 2XGNA 2XRNA 3MBZA 3V3RA 4BL3A 3IF6A 5IS1A 1YSPA 2VA0A 2A3UA 2Y2PA 1VETA 2XLNA 4MN6A 2PU2A 1KVMA 2PAVP 3P09A 2XD5A 4EXOA 5EM1A 3Q82A 3N4IA 3RJUA 2WUQA 5AVEA 4HP4A 4O7DA 1H3QA 1LSWA 2OAQ1 4OP5A 4PM8A 1K57C 4KUKA 1K38A 3H9WA 2CMNA 5FAPA 3BFDA 3NHQA 2WZZA 4GN2A 4CQHA 5CGXA 3NBLA 1MWUA 1A0KA 3IX8A 3FC7A 2BG1A 1YLJA 2ZQAA 2PRFA 4NXGA 3LR0A 2EX2A 3LGOA 3BW6A 4JXWA 5J8XA 3KO6A 3T4TA 1MZUA 3VE4A 2Y55A 4IHQA 3NC8A 1TDLA 1TVFA 5DTSA 3S7OA 3PYPA 3PBSA 1JTGA 3BY9A 3UN7A 3VSKA 3CHWP 2Z2MB 4EUVA 4KQQA 3S22A 4WUJA 2H5SA 2VGJA 3UE6A 3EOIA 1I2WA 2I72A 2HF6A 2OOLA 4R3AA 5A90A 1NWZA 4EBLA 1STZA 2HP5A 1ZG4A 2VX8A 1FIKA 3MMHA 1XGIA 3IHBA 5FEGA 5L2FA 1GSWA 5IT5A 4BJPA 2O9AA 2V2FF 4R70A 1K56A 5AQBA 1NRJA 2ZM0A 4Y5FA 4II7A 5FDHA 1UWPX 1NZUA 4S2MA 1YLZA 5K5BA 3LYXA 2HJEA 1Y4OA 2PDRA 3PHYA 1S1ZA 3SS5A 4O0PA 1VM1A 4Y15A 5A93A 3CITA 1JWPA 3ITBA 4CLCB 2EWVA 5HD5A 3ZNTA 4PM7A 1L2SA 4S2OA 2KOIA 1F2KA 3JVVA 2H0TA 4GNUA 4FH4A 1K0KA 4WM9A 3NOUC 1BSGA 3V3SA 3PTEA 4C3QA 2L0WA 4OPQA 1GHIA 1GA9A 3S7PA 1LSXA 3D4FA 4CLCC 2YKFA 1FR6A 1JNUA 2J9OA 4YINA 5E2HA 4Y0OA 2B18A 3AGFA 4I3IA 2A2LA 3LICA 4R3BA 2W3FA 2PU4A 2EX6A 2O9BA 3LO7A 5FQIA 1CQAA 3S7QA 2ZD8A 5E2EA 4DDYA 1YLTA 5DF7A 3ZQ5A 3EEHA 2QWSA 4ZJ1A 3CPTB 5L8MA 2EA9A 3LCEA 4HBTA 4GS9A 1L3LA 2W3DA 2VJWA 4EQ1A 2JCHA 1U60A 5E2FA 3GQZA 1AWIA 1CEGA 4KQDA 5HPFA 3O86A 3E4QA 2IWBA 5M1AA 3FKVA 1E4DA 4NK3A 4LRZE 1Y28A 2VGKA 1T19A 1G28A 4I38A 4WEKA 3G34A 2HGVA 3GDIA 1PWGA 5GLAA 2V1ZA 3ZG7B 3CZDA 1BUEA 5FASA 4OOMA 2B5RA 5GL9A 3KSHA 1G6AA 5EFWA 2C6WB 1FILA 1HZOA 2E8IA 3IH8A 4PHTA 1ESIA 2DCFA 4LGWA 3UY6A 2UV0E 4FH2A 2WKEA 3KYQA 1SDEA 1ESUA 4HJ6A 2KDKA 2W3EA 3CPTA 3LEZA 1XP4A 5TBMA 1OPXA 3NCKA 2WZXA 3HUMA 3K3DA 3VOZA 3DTEA 4S2IA 2ZOIA 1H5XA 3UPOA 2GNXA 1K54C 2NUPC 4WN5A 1CI8A 4N9KA 4BBTA 2XH9A 2XQZA 2EXBA 1FR1A 1AXBA 2Y91A 4RA7A 2ZQCA 1DRMA 2OLUA 1ZTUA 3NJAA 4K91A 3MS6A 5HD3A 4FUWA 4X1LA 3MR0A 3EEAA 4EESA 4LV2A 4BMWA 3A3JA 4KZBA 3NOTC 1MC0A 3T1QB 2Z2LB 4EUZA 4JPMA 3PAEA 1MXOA 2P7JA 1E3UA 3GV9A 4FOFA 4R4RA 1XFQA 4NKPA 1K54A 3MKEA 3O3VA 3WRZA 1BT5A 5AQAA 3BQAA 4PAUA 4I39A 1H8ZA 1RGZA 5FI2A 4F94A 4OPZA 3IWQA 2ZC5B 2WKRA 2IWDA 1FCNA 1YAXA 3LR4A 2WGWA 3BLSA 3Q1FA 3B47A 3VOLA 4MN5A 4MBKA 2WGIA 4E3MA 4HESA 4N1HA 4P87A 4WEJA 1W8YA 4JGQA 4KG6A 5EUAA 3IF5A 5U47A 3GR2A 1DJAA 3G31A 4O01A 1K56D 3A3DA 3MFXA 2Y79A 4OQHA 1BULA 1CF0A 1IFQA 2VLGA 4X6TA 2C5WB 1Q2QA 1VB6A 1D7EA 3TE8A 4YNRA 2YKHA 3HLDA 2V9AA 2J80A 4GW9A 4EEUA 3UDXA 5FSRA 4OH0A 3LUQA 1IYSA 2XA7M 4LLOB 2Z6CA 3H7WB 1N9OA 2J3TD 2WKIA 3HUNA 1S4RA 1W7FA 4R23A 4NETA 4JBFA 3DAVA 2XDMA 2L1MA 4NXEA 4Q8IA 4XXRA 3LIEA 2QJ7A 2QJ5A 1FSWA 1BLPA 4L9FA 2WKQA 2JKRM 5EVIB 3C7VA 3SH7A 5FAOA 3B33A 2JE5A 4JF4A 4E3KA 2XD1A 5IU1A 3ZG9B 5EVEA 2J9PA 5FQ9A 3ICYA 3QP1A 3IQAA 3QNCA 3VMAA 2O0YA 3DWKA 1MWRA 4FTXA 2HPBA 4DJ2A 3EQUA 4UA6A 5F68A 3WS0A 1T1BA 4Y7PA 4UQIM 4XUXA 1YMSA 4KZ3A 4P0MA 5I5LA 2PBYA 3VE3A 5EVIC 2Q9NA 4ETXA 2OSUA 3CUEC 5FDSA 3H7WA 1MKMA 5TFQA 4G3KA 5KMWA 5HL1A 3E2LA 3VP0A 3S4XA 4PM6A 4Y17A 3TRCA 3FG8A 5DF9A 3DTMA 5AQ9A 4MNRA 5CTNA 4RYEA 3G30A 4GLQA 2Y2LA 3ZVTA 1UWNX 5G4YA 3LIBA 4L9EA 4BWIA 2HDRA 1PNEA 4HEFA 5EVIA 3QP2A 4GOGA 1PYYA 3CUEA 3A0SA 1XGJA 1K25A 3PR6A 2JKFA 2XR0A 2VEAA 1GA0A 3K3CA 5EE8A 2WAFA 3KX0X 3IX4A 3E2KA 3C4OA 4PKYA 1YLPA 1YT4A 2H10A 3NDGA 1GSVA 3PBNA 1KDSA 1PZPA 4PM5A 5CHJA 1W63M 3BECA 4KZ7A 2A49A 4RQ9A 3BY8A 4DE1A 3F1NB 4A5RA 4EW7A 4G3WA 4HY8A 5FQQA 2HZ5A 2ZMVA 1DP9A 3LIAA 3KSFA 3IS2B 4OQIA 4EWFA 5C5KA 2WKHA 4MEZA 4R4SA 2ZM8A 3MXRA 4WYYA 5EVLA 2Y2IA 4CJNA 1BTLA 4FCFA 3TOIA 2ZMAA 5HL6A 5F1GA 4KUOA 1YKDA 5GHZA 3WS5A 2BASA 2R9WA 4WF0A 3TSGA 4NG2A 3RH8B 3N8SA 3IH9A 5HWVA 1K57A 4X56A 1VHMA 5CGWA 4DE0A 3SW1A 4ZJ3A 4QY5A 4X25A 3SS3A 1I5QA 2CC1A 3RXXA 4IEDA 4XT2B 1KGGA 4JXGA 2GDNA 4IUKA 4M4XA 2OAP1 5CEDA 1KE4A 3UNWA 1S66L 4MBHA 4EV4A 2Y2GA 1S1YA 1NJ4A 3E0YA 3Q7VB 3F1NA 3NOPC 4JGOA 5F5YA 3UB8A 1ZG6A 4ZTKA 1VQQA 2VK3A 2IA2A 3IS2A 2PR5A 5D3OA 4KG2A 5A91A 1YM1A 2L4RA 5DFYA 2P9VB 3C38A 2ZMFA 4QJGA 1XKZA 3HBRA 3ISGA 3OOVA 2EFUA 2J3TC 3VP1A 3AGDA 2JN7A 3HVFA 5DKLA 3BFGA 2MJ6A 3Q07A 3AGEA 4OLGA 3H82B 1T1CA 3OPRA 1YSQA 1H8MA 3P7NA 4S2NC 3IBRA 1KE3A 4OQGA 3VV4A 4HQAA 3ZYTA 4HH3A 3C2WA 2VGLS 4GHIB 2VV7A 3FV7A 4Z1WA 1JWVA 5AVFA 3T4KA 4ZDXA 4P6ZM 4E3NA 4WELA 1NXYA 5FL3A 1OTAA 3MSHA 1F98A 5E2GA 3D3OA 4S2KA 5J4EA 3OCNA 3OPLA 3MXSA 4QWOA 4E6WA 1LHYA 3L7HA 3LR3A 4UHUA 5EOEA 1EROA 4O8GA 4K08A 3MZEA 4Q0JA 2M1CA 4WLAA 4HNBA 2ZQ9A 1ONHA 3LI8A 3QP5A 4FSFA 4LV0A 2V1AA 3H82A 2ZQDA 4EBNA 3UB5P 3GECA 3C7UA 4R38A 2FFYA 3G32A 4HOIA 3GMWA 5EV0A 1XJ4A 5CHUA 2OV5A 3MFDA 2LB9A 2JKTM 3ZG5A 1PZOA 3BFCA 4QD4A 3MJQA 4M3KA 4CLCA 4R1GA 1IKIA 4I3JA 4MCWA 2OWHA 4DJ3A 3LI9A 3HUOA 4CPKA 4IJGA 1F5MA 3T1SA 1PFLA 2GZAA 5KSCA 1IYOA 2PHYA 2XFSA 4P6BA 1SKOB 1DJBA 4ZJ2A 1HTZA 3P01A 2Y2KA 2VZWA 3B3XA 2W27A 3UB7A 4WL9A 1ZHHB 1BLCA 3RTYA 3MQ0A 1ES4A 2IWCA 4OOLA 3T12B 1W63Q 1H8YA 1RGYA
chains in the Genus database with same CATH topology
1D7EA 3TE8A 4YNRA 2YKHA 2XRNA 1X0OA 2V9AA 2Y8HA 2J80A 4GW9A 4EEUA 3E98A 4BBVA 3LUQA 2INWA 5IS1A 1YSPA 2XA7M 4LLOB 3T50A 2Z6CA 2VA0A 4IUHA 3H7WB 4EU0A 3TJZC 4MN6A 1N9OA 3T4JA 2J3TD 4MMNA 4XT2A 4GS9B 4EXOA 1S4RA 3G6OA 5AVEA 3EGXC 1TF1A 4F3LB 4UQIS 2O9CA 4HP4A 2EWWA 2PYPA 2L1MA 4NXEA 1H3QA 3JVUA 3LIEA 2QJ7A 1LSWA 2OAQ1 4B93A 4KUKA 4ZRRA 2QJ5A 2V0UA 3H9WA 4QPRA 2CMNA 4L9FA 2WKQA 1T18A 3NHQA 2JKRM 5HDCA 4CQHA 2A24B 4UEYA 2JHEA 4NXBA 3B33A 3OLOA 4HI4A 4I5SA 3HCYA 2W1TB 3FC7A 5HWWA 5IU1A 4L0LA 3ICYA 4NXGA 2O0YA 1S4SA 3LR0A 3BW6A 2PD8A 2J3WA 3KO6A 1ODVA 4DJ2A 3T4TA 3PXPA 3EQUA 1MZUA 3F1PB 5F68A 4ETZA 1T1BA 3VE4A 4UQIM 4IHQA 3KSGA 1EW0A 1OTIA 5I5LA 4E04A 3VE3A 2XSSA 4GHIA 3S7OA 4ETXA 2KLIA 3CUEC 5CX7A 3PYPA 3H7WA 1MKMA 4G3KA 3PBSA 4L9GA 3BJNA 2GX5A 5HWTA 3BY9A 1XFNA 4BBUA 3TRCA 3DBAA 5TBMB 3FG8A 5DF9A 4NEED 4DMZA 4EUVA 3KYZA 4WUJA 5HPIA 3FPWA 4F3LA 3PBRA 4G3VA 4HH2A 5LBRA 3UE6A 3EOIA 1TS7A 4GLQA 5DFXA 2OWJA 2HF6A 3KSIA 1UWNX 2OOLA 4R3AA 3PBQA 1NWZA 1STZA 5G4YA 2VX8A 4P6ZS 1BYWA 3MMHA 4GCZA 1GSWA 3LIBA 2WKPA 4L9EA 4BWIA 5IT5A 4BJPA 1OT9A 2O9AA 4KQOA 2A24A 4R70A 5DKKA 5TJJA 3IBJA 3MQQA 1TD5A 3CUEA 3HJIA 1NRJA 4JGRA 3A0SA 5HZHA 4Y5FA 4II7A 1P97A 3EGDC 1UWPX 3PR6A 5DJUA 1TS8A 2VEAA 2FZ0A 5K5BA 2DMWA 4YWZA 3K3CA 3LYXA 2NUTC 3KX0X 4EETB 2HJEA 4NXFA 5G4ZA 2PDRA 3PHYA 1S1ZA 3CAXA 2K2NA 4PKYA 4O0PA 2VV6A 3F1PA 4LRXC 2ZBBA 5HSQA 1XJ6A 1OT6A 1GSVA 2VV8A 3PBNA 2JKTI 3CITA 3B42A 4CLCB 1W63M 2EWVA 1F9IA 4RQ9A 5HD5A 3BY8A 3F1NB 4EW7A 4G3WA 4HY8A 1G6OA 1LSVA 2ZMVA 2V0WA 1DP9A 2KOIA 3LIAA 3JVVA 4ME4A 3KSFA 3IS2B 3OC2A 5C5KA 1LL8A 4ARZB 2W0NA 5KIZA 4JGPA 3NOUC 2QKPA 4Q0IA 4HJ3A 5HDSA 2L0WA 3S7PA 5HL6A 1LSXA 1YKDA 1UGUA 4KUOA 2BASA 4WF0A 4CLCC 3EQVA 2YKFA 1JNUA 3RH8B 2B18A 3MQOA 4I3IA 2A2LA 1P0ZA 3F1OB 2P08A 3LICA 1XJ2A 2W3FA 5HWVA 2O9BA 3E4PA 1VHMA 2HV1A 3T4LA 3S7QA 5AJGA 3SW1A 1D06A 3ZQ5A 3LIDA 3EEHA 2M7VA 3PBOA 1WA9A 1GSXA 2QWSA 4EERA 4XT2B 5L8MA 3UMEA 2EA9A 2P04A 2GJ3A 4LPZA 4GS9A 4IUKA 4CLCD 4M4XA 2W3DA 2OAP1 2VJWA 4EQ1A 3R7WB 2R78A 1S66L 3LFVA 3T4OA 1S1YA 4KQDA 3E0YA 2PYRA 3F1NA 3NOPC 4JGOA 5HPFA 2VKSA 3EWKA 5F5YA 3T4QA 4B9OA 3E4QA 3C30A 3FPVA 4HP9A 3UB8A 4HIAA 5J7EA 4LRZE 1DP6A 1Y28A 2IA2A 3IS2A 2PR5A 2JKRI 1T19A 1G28A 4ARZA 4I38A 4WEKA 2L4RA 2HGVA 3GDIA 5DFYA 3UB9A 3C38A 3OCLA 2ZMFA 2W1TA 2W3GA 3BWLA 3LIFA 2Z6DA 3V67A 1KOUA 1P9RA 3OOVA 2J3TC 1OTEA 4OOMA 1IOUA 3E4OA 2JN7A 5DKLA 2MJ6A 3MF0A 3H82B 3OBFA 1T1CA 3R4KA 4Q0HA 1P9WA 2K7SA 4PKYG 1YSQA 4Y3IA 1XJ3A 3KSHA 1H8MA 3F1OA 2I9VA 3P7NA 5EFWA 3IBRA 2PD7A 3VV4A 3A0RA 3CWFA 4HQAA 3ZYTA 3UE3A 4HH3A 3C2WA 2VGLS 4GHIB 2VV7A 4H6JB 4Z1WA 4PHTA 5AVFA 3T4KA 3K2NA 4EEPA 4P6ZM 4MDZA 4WELA 2V1BA 3KYQA 1OJ5A 3CLOA 5FL3A 2W3EA 2KDKA 4HJ6A 1OTAA 1F98A 3O5YA 5TBMA 1NLZA 3D3OA 2G7UA 1OPXA 3U2AA 3ULFA 5J4EA 3OCNA 2QHKA 2M7UA 3R7WA 1NLYA 3K3DA 4R6LA 3UMDA 3LR5A 2ZOIA 3HJKA 2GNXA 2XROA 1V9YA 2NUPC 4HJ4A 4WN5A 2FH5A 4BBTA 5HDDA 3LR3A 2KX6A 1N9LA 2D02A 3T4SA 5F69A 2W3HA 3W2ZA 2K31A 4MN7A 4O8GA 1DRMA 4K08A 1ZTUA 3NJAA 5HD3A 5KSHA 2B02A 3CI6A 3MXQA 4Q0JA 3TW8A 1TS0A 2M1CA 4WLAA 2VGLM 3MR0A 4HNBA 3EEAA 4EESA 4YOFA 1OJGA 4BMWA 3D72A 3NOTC 3LI8A 1MC0A 4FSFA 2V1AA 4GJ4A 2P7JA 3H82A 2ZOHA 4AFIA 3GECA 4FOFA 1XFQA 4R38A 4NKPA 4HOIA 1V9ZA 2D01A 5J3WA 1XJ4A 2LB9A 2JKTM 1OTDA 3BQAA 3UB6A 4PAUA 2LB5A 3MJQA 4I39A 4CLCA 2H28A 4H6JA 2PT7A 4LRYC 3RFBA 3A0VA 4I3JA 1S67L 2XA7S 3S7NA 4MCWA 2OWHA 2O99A 4Y2FA 2WKRA 1DP8A 4DJ3A 3LI9A 1YAXA 3LR4A 4IJGA 1F5MA 3B47A 3VOLA 4MN5A 4HHDA 2GZAA 5MC7A 2PHYA 4WEJA 5DJTA 1T1AA 3BQ8A 4JGQA 4DN0A 3PBTA 5F6AA 3P01A 1N9NA 2VZWA 4O01A 2W27A 1OTBA 3MFXA 3UB7A 4WL9A 1ZHHB 2HJ9C 4I3AA 2QYBA 2Y79A 2W1RA 3RTYA 2PR6A 1IFQA 2VLGA 3MQ0A 5A8BA 4CLCE 3C8CA 4OOLA 1W63Q 1LT0A 1VB6A 1TS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VX8 A;  2NUT C;  3EGX C;  1IFQ A;  3KYQ A;  3BW6 A;  2NUP C;  3EGD C;  2DMW A;  1H8M A;  4AFI A;  4B93 A;  1IOU A; 
#chains in the Genus database with same CATH topology
 3NEC A;  1C3B A;  4QB8 A;  2Y8H A;  4PM9 A;  1MWT A;  3E98 A;  2H0Y A;  3HLW A;  4BBV A;  5FQJ A;  3T50 A;  2Y2M A;  1IEM A;  4EU0 A;  3TJZ C;  3T4J A;  3GTC A;  5JYO A;  3NUL A;  3UPN A;  1RCJ A;  1M6K A;  3N7W A;  3G6O A;  3QP6 A;  4DXB A;  3EGX C;  4F3L B;  2O9C A;  1DY6 A;  2EWW A;  5HAQ A;  1PW8 A;  5F82 A;  3M2J A;  4Y0U A;  4IVI A;  1L0G A;  4S2J A;  2ZLY A;  1FQG A;  2V20 A;  5FI7 A;  1ACF A;  4X53 A;  3I7J A;  2A24 B;  5EPH A;  4NXB A;  1RP5 A;  4HI4 A;  1SKO A;  3HCY A;  2W1T B;  4UA9 A;  4U0X A;  5EM0 A;  2XF3 A;  4Y0T A;  1Y54 A;  4L0L A;  2ZC7 A;  1S4S A;  2E8J A;  2PD8 A;  4DXC A;  1ODV A;  3UO9 A;  2ZM2 A;  3KSG A;  4E04 A;  3SH8 A;  4X55 A;  1GCE A;  1VEU B;  3NDE A;  1ES3 A;  2DRW A;  4L9G A;  3BJN A;  2GX5 A;  1FOF A;  1KDW A;  5E43 A;  5FQK A;  3QP4 A;  1FSY A;  3HLG A;  1PWD A;  4BBU A;  4OOY A;  4DMZ A;  1Z6F A;  5HPI A;  3FPW A;  4F3L A;  4G3V A;  2Y59 A;  1YQS A;  5DFX A;  1K6S A;  2WAE A;  1J3W A;  3KSI A;  3NY4 A;  4U0T A;  3PBQ A;  3N8L A;  4WBG A;  4P6Z S;  1MKI A;  2WKP A;  4KZ9 A;  2EFX A;  2Y2N A;  2A24 A;  3UDF A;  5TJJ A;  3MQQ A;  3HJI A;  3VSL A;  1XA1 A;  1Q2P A;  1TS8 A;  1ALQ A;  4GD6 A;  1NRF A;  2AVX A;  4OPY A;  3N6I A;  4YWZ A;  2NUT C;  1KGE A;  5G4Z A;  4ZBE A;  3WS4 A;  1I2S A;  4BD1 A;  4LRX C;  2ZBB A;  1XJ6 A;  3ZFZ A;  3BFF A;  1MBL A;  2VV8 A;  1BLH A;  3B42 A;  1W8Q A;  1F9I A;  3FWL A;  1HLU P;  4ESP A;  1G6O A;  4D2O A;  2J7V A;  3GVB A;  5FA7 A;  4ME4 A;  3HL9 A;  2ZQ8 A;  2ZJ9 A;  4WMC A;  1LL8 A;  5FQM A;  2W0N A;  4E6X A;  5KIZ A;  4JGP A;  4S2P A;  4Q0I A;  4HJ3 A;  4ID4 A;  2G2U A;  5HDS A;  4OP8 A;  3UPP A;  3OPP A;  3G2Y A;  1UGU A;  3JYI A;  3S1Y A;  3T1X A;  2P74 A;  4BD0 A;  4Z9Q A;  2Y2Q A;  4QHC A;  3F1O B;  1XJ2 A;  3G2Z A;  4JF6 A;  3W4O A;  3E4P A;  3NIA A;  4KQR A;  5AJG A;  4X1M A;  1O07 A;  2R9X A;  3UE1 A;  1D06 A;  1VET B;  4WZ5 C;  4PPR A;  1K55 C;  3LID A;  4B4Z A;  3PBO A;  1GSX A;  1LI9 A;  4EER A;  1NZO A;  2P04 A;  3UME A;  2GJ3 A;  4FD8 A;  4CLC D;  3SS4 A;  3R7W B;  5FAQ A;  2G2W A;  1PI5 A;  3LFV A;  3T4O A;  3A3E A;  3VP3 A;  2PYR A;  1HD8 A;  3FKW A;  2VKS A;  3EWK A;  2OLV A;  4C75 A;  4HP9 A;  3WWX A;  1IYP A;  4HIA A;  5J7E A;  2JKR I;  4DE2 A;  5KZH A;  1DJC A;  4BQM A;  3QNB A;  1ES5 A;  3WRT A;  2HDQ A;  2Z6D A;  2EXA A;  4MBF A;  1KOU A;  3V67 A;  1OME A;  5DTK A;  4DF6 A;  1OTE A;  1IOU A;  3UDI A;  1E25 A;  4LV1 A;  3MF0 A;  5DF8 A;  2WGV A;  4BEN A;  3R4K A;  3JPU A;  1P9W A;  3C5A A;  1S0W A;  5JYP A;  1XJ3 A;  4E3J A;  3F1O A;  5HW3 A;  4JLF A;  3DTI A;  1IKG A;  3CWF A;  3WS2 A;  3UE3 A;  3U4L P;  5CEB A;  2PBD P;  4EEP A;  5M18 A;  4N9L A;  3IXH A;  3CLO A;  1HVB A;  1QMF A;  4MLL A;  1JVJ A;  3ZGA B;  4GZB A;  1GHP A;  1W79 A;  3U2A A;  4EQI A;  3VOY A;  3R7W A;  4R6L A;  1JWZ A;  5CGS A;  3LR5 A;  3HJK A;  2XRO A;  1YLY A;  1V9Y A;  2HDS A;  4UA7 A;  5L09 A;  3IHA A;  1YLW A;  5HDD A;  3HRE A;  2KX6 A;  1N9L A;  3UE0 A;  1PW1 A;  5FI6 A;  1CK3 A;  3W2Z A;  4QY6 A;  4MN7 A;  3HLB A;  2ACG A;  2B02 A;  3IWI A;  3TW8 A;  2XK1 A;  1TS0 A;  4KZ6 A;  1ES2 A;  3IT9 A;  3PAG A;  1E3U D;  1LI0 A;  3VP4 A;  4RX3 A;  3GSG A;  1ZC2 A;  4GJ4 A;  4AFI A;  3QP8 A;  1MPL A;  1ZKJ A;  3W4Q A;  3LY3 A;  2LB5 A;  2H28 A;  4JXS A;  2XA7 S;  1EWZ A;  3L9K A;  4K0X A;  3T1R A;  5TR7 A;  3LY4 A;  1NY0 A;  3IXB A;  3P98 A;  1WYB A;  1SZV A;  3HLE A;  5DJT A;  1T1A A;  1NYM A;  3SOI A;  1KGF A;  3PBT A;  1S6R A;  4KEN B;  2Y2J A;  2XEP A;  4IBR A;  5F83 A;  5CER A;  4I3A A;  2W1R A;  5HFO A;  5A8B A;  1PI4 A;  1X0O A;  3GRJ A;  3VFH A;  3A3I A;  2INW A;  4X68 A;  5EOO A;  1CEF A;  4IUH A;  5HAP A;  1PIO A;  4K0W A;  5GHX A;  3BYD A;  3N8R A;  4MMN A;  1YPR A;  4XT2 A;  1N4O A;  4GS9 B;  1TF1 A;  4UQI S;  2ZL1 B;  4LEN A;  2PYP A;  4DKI A;  1KE0 A;  4GB7 A;  3JVU A;  5GHY A;  3ZG0 A;  3Q7V A;  3Q7Z A;  1H0M A;  4B93 A;  4ZRR A;  4N92 A;  4WMC D;  2V0U A;  4QPR A;  4S2N A;  1CI9 A;  3ZHH A;  2X71 A;  2QZ6 A;  1T18 A;  3OZH A;  4E3I A;  5HDC A;  2X01 A;  2P9V A;  4UEY A;  2JHE A;  1K4F A;  1W5D A;  3OLO A;  4I5S A;  4OKP A;  5HX9 A;  3O87 A;  3IWO A;  1J9M A;  5HWW A;  3MZD A;  4ZAM A;  4E3O A;  1IYQ A;  3C4P A;  2ZQ7 A;  4LV3 A;  2JBF A;  4N1X A;  2J3W A;  3PXP A;  1L0F A;  3F1P B;  5DTT A;  4ETZ A;  4GDB A;  1EW0 A;  1OTI A;  3G4P A;  1SKF A;  3CG5 A;  2XSS A;  4GHI A;  2Q9M A;  3HLF A;  2KLI A;  5CX7 A;  1SCW A;  5CRF A;  2WK0 A;  1GHM A;  5HWT A;  4LCM A;  1QME A;  1XFN A;  1N9B A;  1XXM A;  5CEC A;  3DBA A;  5TBM B;  4NEE D;  3KYZ A;  1PRQ A;  3SH9 A;  3KYE A;  5GLB A;  2RCX A;  3PBR A;  2ZL1 A;  4HH2 A;  5LBR A;  1TEM A;  4P85 A;  1TS7 A;  1LLB A;  2OWJ A;  5A92 A;  4YFM A;  3W8K A;  3ZVW A;  3DW0 A;  1MY8 A;  5EVI D;  1BYW A;  4GCZ A;  5L10 A;  4BL2 A;  1OT9 A;  5IHV A;  4KQO A;  1Z09 A;  5DKK A;  3IBJ A;  1TD5 A;  4JGR A;  2FFF B;  3NI9 A;  5HZH A;  1M40 A;  3M2K A;  4OON A;  1P97 A;  1SDN A;  3EGD C;  5GLD A;  4QU3 A;  5DJU A;  3CMZ A;  3SZT A;  3HLC A;  2BLS A;  4XUZ A;  2FZ0 A;  2DMW A;  4DE3 A;  1D1J A;  1XPB A;  4EET B;  4NXF A;  2EX9 A;  3O88 A;  4RVA A;  4B4X A;  3CAX A;  2K2N A;  2VV6 A;  3F1P A;  1WYC A;  3V5M A;  2JKG A;  5HSQ A;  1OT6 A;  5EEC A;  2JKT I;  2X02 A;  1JTD A;  3V39 A;  1LSV A;  5M19 A;  2V0W A;  4R3J A;  2WGW B;  2ZC4 B;  3ZG8 B;  3OC2 A;  4ARZ B;  1K4E A;  4KZ4 A;  2RL3 A;  3QHY A;  2QKP A;  4KZ5 A;  2UWX A;  4RX2 A;  4EBP A;  2V8C A;  2Y4A A;  3EQV A;  1ONG A;  2Y2H A;  4E3L A;  3MQO A;  4U3T A;  1P0Z A;  2P08 A;  2Q0O A;  3Q81 A;  2HV1 A;  3T4L A;  2JC7 A;  3M6B A;  1FCO A;  1ERQ A;  4DRT A;  5DVA A;  2M7V A;  1WA9 A;  2HDU A;  2B95 A;  1EI5 A;  4LPZ A;  1LL9 A;  3IX3 A;  2XFT A;  5FEF A;  4DDS A;  4IVK A;  4WZ4 A;  2R78 A;  1LL5 A;  4LCL A;  2EX8 A;  4X69 A;  3T4Q A;  3BLM A;  5HAI A;  2ZC3 B;  3DWZ A;  3C30 A;  3FPV A;  3G35 A;  4B9O A;  5CHM A;  4LFU A;  1DP6 A;  1IEL A;  4ARZ A;  3UB9 A;  1XX2 A;  3ZDJ A;  3OCL A;  3TG9 A;  2W1T A;  5F1F A;  2W3G A;  3BWL A;  3IXG A;  3LIF A;  1G68 A;  1O7E A;  1P9R A;  1FCM A;  2DNS A;  1MWS A;  3E4O A;  3MZF A;  4B88 A;  3LEQ A;  3WS1 A;  2V8F A;  4JF5 A;  3OBF A;  1G5U A;  4Q0H A;  4UAA A;  2K7S A;  4PKY G;  4Y3I A;  2I9V A;  3V50 A;  3RXW A;  3CJM A;  4D60 A;  3DTK A;  2PD7 A;  5HAR A;  3A0R A;  5I94 A;  3IXD A;  2J8Y A;  4H6J B;  3OPH A;  1VEU A;  2WYX A;  3K2N A;  4MDZ A;  4OPR A;  4KZ8 A;  2V1B A;  4KZA A;  1OJ5 A;  1YMX A;  3FZC A;  5GLC A;  1BZA A;  1PWC A;  5CTM A;  3O5Y A;  1NLZ A;  2G7U A;  3ULF A;  2QHK A;  2M7U A;  1NLY A;  3BEB A;  3UMD A;  1L0D A;  4GD8 A;  5CXW A;  4HJ4 A;  2FH5 A;  5AQ7 A;  3BRM A;  2D02 A;  3T4S A;  5F69 A;  3VFF A;  1NYY A;  2W3H A;  3D9Y A;  2K31 A;  3ZNY A;  1L0E A;  5L07 A;  3W4P A;  4KG5 A;  2BTF P;  3MXQ A;  3CI6 A;  5KSH A;  2VGL M;  5G18 A;  4YOF A;  1OJG A;  3IF6 B;  3D72 A;  4BLM A;  1CJF A;  2HP6 A;  4JXV A;  2WAD A;  4OQ0 A;  1SHV A;  2Y2O A;  3M6H A;  2ZOH A;  3BFE A;  2ZC6 B;  4GKU A;  1V9Z A;  3A3F A;  2D01 A;  5J3W A;  4GDN A;  1K6R A;  3ZCZ A;  5TGF A;  1OTD A;  3UB6 A;  3FYZ A;  4H6J A;  2PT7 A;  4LRY C;  3RFB A;  3A0V A;  1S67 L;  4S2L A;  3VP2 A;  3S7N A;  3BM6 A;  2O99 A;  4Y2F A;  4H8R A;  1DP8 A;  3IF6 C;  3ITA A;  2QMI A;  4C6Y A;  4R0Q A;  4IBX A;  4HHD A;  1XA7 A;  5MC7 A;  4JKT A;  2HP9 A;  4Y13 A;  4WZ5 A;  3BQ8 A;  1ERM A;  1K55 A;  4DN0 A;  4HBU A;  1KVL A;  5FAT A;  4OVD A;  5F6A A;  3MKF A;  1N9N A;  1WE4 A;  4OLD A;  4PMA A;  1OTB A;  2HJ9 C;  1BLS A;  2QYB A;  2QPN A;  2PR6 A;  4CLC E;  3C8C A;  1LT0 A;  5BOH A;  1TS6 A;  1TDG A;  2XGN A;  2XRN A;  3MBZ A;  3V3R A;  4BL3 A;  3IF6 A;  5IS1 A;  1YSP A;  2VA0 A;  2A3U A;  2Y2P A;  1VET A;  2XLN A;  4MN6 A;  2PU2 A;  1KVM A;  2PAV P;  3P09 A;  2XD5 A;  4EXO A;  5EM1 A;  3Q82 A;  3N4I A;  3RJU A;  2WUQ A;  5AVE A;  4HP4 A;  4O7D A;  1H3Q A;  1LSW A;  2OAQ 1;  4OP5 A;  4PM8 A;  1K57 C;  4KUK A;  1K38 A;  3H9W A;  2CMN A;  5FAP A;  3BFD A;  3NHQ A;  2WZZ A;  4GN2 A;  4CQH A;  5CGX A;  3NBL A;  1MWU A;  1A0K A;  3IX8 A;  3FC7 A;  2BG1 A;  1YLJ A;  2ZQA A;  2PRF A;  4NXG A;  3LR0 A;  2EX2 A;  3LGO A;  3BW6 A;  4JXW A;  5J8X A;  3KO6 A;  3T4T A;  1MZU A;  3VE4 A;  2Y55 A;  4IHQ A;  3NC8 A;  1TDL A;  1TVF A;  5DTS A;  3S7O A;  3PYP A;  3PBS A;  1JTG A;  3BY9 A;  3UN7 A;  3VSK A;  3CHW P;  2Z2M B;  4EUV A;  4KQQ A;  3S22 A;  4WUJ A;  2H5S A;  2VGJ A;  3UE6 A;  3EOI A;  1I2W A;  2I72 A;  2HF6 A;  2OOL A;  4R3A A;  5A90 A;  1NWZ A;  4EBL A;  1STZ A;  2HP5 A;  1ZG4 A;  2VX8 A;  1FIK A;  3MMH A;  1XGI A;  3IHB A;  5FEG A;  5L2F A;  1GSW A;  5IT5 A;  4BJP A;  2O9A A;  2V2F F;  4R70 A;  1K56 A;  5AQB A;  1NRJ A;  2ZM0 A;  4Y5F A;  4II7 A;  5FDH A;  1UWP X;  1NZU A;  4S2M A;  1YLZ A;  5K5B A;  3LYX A;  2HJE A;  1Y4O A;  2PDR A;  3PHY A;  1S1Z A;  3SS5 A;  4O0P A;  1VM1 A;  4Y15 A;  5A93 A;  3CIT A;  1JWP A;  3ITB A;  4CLC B;  2EWV A;  5HD5 A;  3ZNT A;  4PM7 A;  1L2S A;  4S2O A;  2KOI A;  1F2K A;  3JVV A;  2H0T A;  4GNU A;  4FH4 A;  1K0K A;  4WM9 A;  3NOU C;  1BSG A;  3V3S A;  3PTE A;  4C3Q A;  2L0W A;  4OPQ A;  1GHI A;  1GA9 A;  3S7P A;  1LSX A;  3D4F A;  4CLC C;  2YKF A;  1FR6 A;  1JNU A;  2J9O A;  4YIN A;  5E2H A;  4Y0O A;  2B18 A;  3AGF A;  4I3I A;  2A2L A;  3LIC A;  4R3B A;  2W3F A;  2PU4 A;  2EX6 A;  2O9B A;  3LO7 A;  5FQI A;  1CQA A;  3S7Q A;  2ZD8 A;  5E2E A;  4DDY A;  1YLT A;  5DF7 A;  3ZQ5 A;  3EEH A;  2QWS A;  4ZJ1 A;  3CPT B;  5L8M A;  2EA9 A;  3LCE A;  4HBT A;  4GS9 A;  1L3L A;  2W3D A;  2VJW A;  4EQ1 A;  2JCH A;  1U60 A;  5E2F A;  3GQZ A;  1AWI A;  1CEG A;  4KQD A;  5HPF A;  3O86 A;  3E4Q A;  2IWB A;  5M1A A;  3FKV A;  1E4D A;  4NK3 A;  4LRZ E;  1Y28 A;  2VGK A;  1T19 A;  1G28 A;  4I38 A;  4WEK A;  3G34 A;  2HGV A;  3GDI A;  1PWG A;  5GLA A;  2V1Z A;  3ZG7 B;  3CZD A;  1BUE A;  5FAS A;  4OOM A;  2B5R A;  5GL9 A;  3KSH A;  1G6A A;  5EFW A;  2C6W B;  1FIL A;  1HZO A;  2E8I A;  3IH8 A;  4PHT A;  1ESI A;  2DCF A;  4LGW A;  3UY6 A;  2UV0 E;  4FH2 A;  2WKE A;  3KYQ A;  1SDE A;  1ESU A;  4HJ6 A;  2KDK A;  2W3E A;  3CPT A;  3LEZ A;  1XP4 A;  5TBM A;  1OPX A;  3NCK A;  2WZX A;  3HUM A;  3K3D A;  3VOZ A;  3DTE A;  4S2I A;  2ZOI A;  1H5X A;  3UPO A;  2GNX A;  1K54 C;  2NUP C;  4WN5 A;  1CI8 A;  4N9K A;  4BBT A;  2XH9 A;  2XQZ A;  2EXB A;  1FR1 A;  1AXB A;  2Y91 A;  4RA7 A;  2ZQC A;  1DRM A;  2OLU A;  1ZTU A;  3NJA A;  4K91 A;  3MS6 A;  5HD3 A;  4FUW A;  4X1L A;  3MR0 A;  3EEA A;  4EES A;  4LV2 A;  4BMW A;  3A3J A;  4KZB A;  3NOT C;  1MC0 A;  3T1Q B;  2Z2L B;  4EUZ A;  4JPM A;  3PAE A;  1MXO A;  2P7J A;  1E3U A;  3GV9 A;  4FOF A;  4R4R A;  1XFQ A;  4NKP A;  1K54 A;  3MKE A;  3O3V A;  3WRZ A;  1BT5 A;  5AQA A;  3BQA A;  4PAU A;  4I39 A;  1H8Z A;  1RGZ A;  5FI2 A;  4F94 A;  4OPZ A;  3IWQ A;  2ZC5 B;  2WKR A;  2IWD A;  1FCN A;  1YAX A;  3LR4 A;  2WGW A;  3BLS A;  3Q1F A;  3B47 A;  3VOL A;  4MN5 A;  4MBK A;  2WGI A;  4E3M A;  4HES A;  4N1H A;  4P87 A;  4WEJ A;  1W8Y A;  4JGQ A;  4KG6 A;  5EUA A;  3IF5 A;  5U47 A;  3GR2 A;  1DJA A;  3G31 A;  4O01 A;  1K56 D;  3A3D A;  3MFX A;  2Y79 A;  4OQH A;  1BUL A;  1CF0 A;  1IFQ A;  2VLG A;  4X6T A;  2C5W B;  1Q2Q A;  1VB6 A;  1D7E A;  3TE8 A;  4YNR A;  2YKH A;  3HLD A;  2V9A A;  2J80 A;  4GW9 A;  4EEU A;  3UDX A;  5FSR A;  4OH0 A;  3LUQ A;  1IYS A;  2XA7 M;  4LLO B;  2Z6C A;  3H7W B;  1N9O A;  2J3T D;  2WKI A;  3HUN A;  1S4R A;  1W7F A;  4R23 A;  4NET A;  4JBF A;  3DAV A;  2XDM A;  2L1M A;  4NXE A;  4Q8I A;  4XXR A;  3LIE A;  2QJ7 A;  2QJ5 A;  1FSW A;  1BLP A;  4L9F A;  2WKQ A;  2JKR M;  5EVI B;  3C7V A;  3SH7 A;  5FAO A;  3B33 A;  2JE5 A;  4JF4 A;  4E3K A;  2XD1 A;  5IU1 A;  3ZG9 B;  5EVE A;  2J9P A;  5FQ9 A;  3ICY A;  3QP1 A;  3IQA A;  3QNC A;  3VMA A;  2O0Y A;  3DWK A;  1MWR A;  4FTX A;  2HPB A;  4DJ2 A;  3EQU A;  4UA6 A;  5F68 A;  3WS0 A;  1T1B A;  4Y7P A;  4UQI M;  4XUX A;  1YMS A;  4KZ3 A;  4P0M A;  5I5L A;  2PBY A;  3VE3 A;  5EVI C;  2Q9N A;  4ETX A;  2OSU A;  3CUE C;  5FDS A;  3H7W A;  1MKM A;  5TFQ A;  4G3K A;  5KMW A;  5HL1 A;  3E2L A;  3VP0 A;  3S4X A;  4PM6 A;  4Y17 A;  3TRC A;  3FG8 A;  5DF9 A;  3DTM A;  5AQ9 A;  4MNR A;  5CTN A;  4RYE A;  3G30 A;  4GLQ A;  2Y2L A;  3ZVT A;  1UWN X;  5G4Y A;  3LIB A;  4L9E A;  4BWI A;  2HDR A;  1PNE A;  4HEF A;  5EVI A;  3QP2 A;  4GOG A;  1PYY A;  3CUE A;  3A0S A;  1XGJ A;  1K25 A;  3PR6 A;  2JKF A;  2XR0 A;  2VEA A;  1GA0 A;  3K3C A;  5EE8 A;  2WAF A;  3KX0 X;  3IX4 A;  3E2K A;  3C4O A;  4PKY A;  1YLP A;  1YT4 A;  2H10 A;  3NDG A;  1GSV A;  3PBN A;  1KDS A;  1PZP A;  4PM5 A;  5CHJ A;  1W63 M;  3BEC A;  4KZ7 A;  2A49 A;  4RQ9 A;  3BY8 A;  4DE1 A;  3F1N B;  4A5R A;  4EW7 A;  4G3W A;  4HY8 A;  5FQQ A;  2HZ5 A;  2ZMV A;  1DP9 A;  3LIA A;  3KSF A;  3IS2 B;  4OQI A;  4EWF A;  5C5K A;  2WKH A;  4MEZ A;  4R4S A;  2ZM8 A;  3MXR A;  4WYY A;  5EVL A;  2Y2I A;  4CJN A;  1BTL A;  4FCF A;  3TOI A;  2ZMA A;  5HL6 A;  5F1G A;  4KUO A;  1YKD A;  5GHZ A;  3WS5 A;  2BAS A;  2R9W A;  4WF0 A;  3TSG A;  4NG2 A;  3RH8 B;  3N8S A;  3IH9 A;  5HWV A;  1K57 A;  4X56 A;  1VHM A;  5CGW A;  4DE0 A;  3SW1 A;  4ZJ3 A;  4QY5 A;  4X25 A;  3SS3 A;  1I5Q A;  2CC1 A;  3RXX A;  4IED A;  4XT2 B;  1KGG A;  4JXG A;  2GDN A;  4IUK A;  4M4X A;  2OAP 1;  5CED A;  1KE4 A;  3UNW A;  1S66 L;  4MBH A;  4EV4 A;  2Y2G A;  1S1Y A;  1NJ4 A;  3E0Y A;  3Q7V B;  3F1N A;  3NOP C;  4JGO A;  5F5Y A;  3UB8 A;  1ZG6 A;  4ZTK A;  1VQQ A;  2VK3 A;  2IA2 A;  3IS2 A;  2PR5 A;  5D3O A;  4KG2 A;  5A91 A;  1YM1 A;  2L4R A;  5DFY A;  2P9V B;  3C38 A;  2ZMF A;  4QJG A;  1XKZ A;  3HBR A;  3ISG A;  3OOV A;  2EFU A;  2J3T C;  3VP1 A;  3AGD A;  2JN7 A;  3HVF A;  5DKL A;  3BFG A;  2MJ6 A;  3Q07 A;  3AGE A;  4OLG A;  3H82 B;  1T1C A;  3OPR A;  1YSQ A;  1H8M A;  3P7N A;  4S2N C;  3IBR A;  1KE3 A;  4OQG A;  3VV4 A;  4HQA A;  3ZYT A;  4HH3 A;  3C2W A;  2VGL S;  4GHI B;  2VV7 A;  3FV7 A;  4Z1W A;  1JWV A;  5AVF A;  3T4K A;  4ZDX A;  4P6Z M;  4E3N A;  4WEL A;  1NXY A;  5FL3 A;  1OTA A;  3MSH A;  1F98 A;  5E2G A;  3D3O A;  4S2K A;  5J4E A;  3OCN A;  3OPL A;  3MXS A;  4QWO A;  4E6W A;  1LHY A;  3L7H A;  3LR3 A;  4UHU A;  5EOE A;  1ERO A;  4O8G A;  4K08 A;  3MZE A;  4Q0J A;  2M1C A;  4WLA A;  4HNB A;  2ZQ9 A;  1ONH A;  3LI8 A;  3QP5 A;  4FSF A;  4LV0 A;  2V1A A;  3H82 A;  2ZQD A;  4EBN A;  3UB5 P;  3GEC A;  3C7U A;  4R38 A;  2FFY A;  3G32 A;  4HOI A;  3GMW A;  5EV0 A;  1XJ4 A;  5CHU A;  2OV5 A;  3MFD A;  2LB9 A;  2JKT M;  3ZG5 A;  1PZO A;  3BFC A;  4QD4 A;  3MJQ A;  4M3K A;  4CLC A;  4R1G A;  1IKI A;  4I3J A;  4MCW A;  2OWH A;  4DJ3 A;  3LI9 A;  3HUO A;  4CPK A;  4IJG A;  1F5M A;  3T1S A;  1PFL A;  2GZA A;  5KSC A;  1IYO A;  2PHY A;  2XFS A;  4P6B A;  1SKO B;  1DJB A;  4ZJ2 A;  1HTZ A;  3P01 A;  2Y2K A;  2VZW A;  3B3X A;  2W27 A;  3UB7 A;  4WL9 A;  1ZHH B;  1BLC A;  3RTY A;  3MQ0 A;  1ES4 A;  2IWC A;  4OOL A;  3T12 B;  1W63 Q;  1H8Y A;  1RGY A; 
#chains in the Genus database with same CATH homology
 1D7E A;  3TE8 A;  4YNR A;  2YKH A;  2XRN A;  1X0O A;  2V9A A;  2Y8H A;  2J80 A;  4GW9 A;  4EEU A;  3E98 A;  4BBV A;  3LUQ A;  2INW A;  5IS1 A;  1YSP A;  2XA7 M;  4LLO B;  3T50 A;  2Z6C A;  2VA0 A;  4IUH A;  3H7W B;  4EU0 A;  3TJZ C;  4MN6 A;  1N9O A;  3T4J A;  2J3T D;  4MMN A;  4XT2 A;  4GS9 B;  4EXO A;  1S4R A;  3G6O A;  5AVE A;  3EGX C;  1TF1 A;  4F3L B;  4UQI S;  2O9C A;  4HP4 A;  2EWW A;  2PYP A;  2L1M A;  4NXE A;  1H3Q A;  3JVU A;  3LIE A;  2QJ7 A;  1LSW A;  2OAQ 1;  4B93 A;  4KUK A;  4ZRR A;  2QJ5 A;  2V0U A;  3H9W A;  4QPR A;  2CMN A;  4L9F A;  2WKQ A;  1T18 A;  3NHQ A;  2JKR M;  5HDC A;  4CQH A;  2A24 B;  4UEY A;  2JHE A;  4NXB A;  3B33 A;  3OLO A;  4HI4 A;  4I5S A;  3HCY A;  2W1T B;  3FC7 A;  5HWW A;  5IU1 A;  4L0L A;  3ICY A;  4NXG A;  2O0Y A;  1S4S A;  3LR0 A;  3BW6 A;  2PD8 A;  2J3W A;  3KO6 A;  1ODV A;  4DJ2 A;  3T4T A;  3PXP A;  3EQU A;  1MZU A;  3F1P B;  5F68 A;  4ETZ A;  1T1B A;  3VE4 A;  4UQI M;  4IHQ A;  3KSG A;  1EW0 A;  1OTI A;  5I5L A;  4E04 A;  3VE3 A;  2XSS A;  4GHI A;  3S7O A;  4ETX A;  2KLI A;  3CUE C;  5CX7 A;  3PYP A;  3H7W A;  1MKM A;  4G3K A;  3PBS A;  4L9G A;  3BJN A;  2GX5 A;  5HWT A;  3BY9 A;  1XFN A;  4BBU A;  3TRC A;  3DBA A;  5TBM B;  3FG8 A;  5DF9 A;  4NEE D;  4DMZ A;  4EUV A;  3KYZ A;  4WUJ A;  5HPI A;  3FPW A;  4F3L A;  3PBR A;  4G3V A;  4HH2 A;  5LBR A;  3UE6 A;  3EOI A;  1TS7 A;  4GLQ A;  5DFX A;  2OWJ A;  2HF6 A;  3KSI A;  1UWN X;  2OOL A;  4R3A A;  3PBQ A;  1NWZ A;  1STZ A;  5G4Y A;  2VX8 A;  4P6Z S;  1BYW A;  3MMH A;  4GCZ A;  1GSW A;  3LIB A;  2WKP A;  4L9E A;  4BWI A;  5IT5 A;  4BJP A;  1OT9 A;  2O9A A;  4KQO A;  2A24 A;  4R70 A;  5DKK A;  5TJJ A;  3IBJ A;  3MQQ A;  1TD5 A;  3CUE A;  3HJI A;  1NRJ A;  4JGR A;  3A0S A;  5HZH A;  4Y5F A;  4II7 A;  1P97 A;  3EGD C;  1UWP X;  3PR6 A;  5DJU A;  1TS8 A;  2VEA A;  2FZ0 A;  5K5B A;  2DMW A;  4YWZ A;  3K3C A;  3LYX A;  2NUT C;  3KX0 X;  4EET B;  2HJE A;  4NXF A;  5G4Z A;  2PDR A;  3PHY A;  1S1Z A;  3CAX A;  2K2N A;  4PKY A;  4O0P A;  2VV6 A;  3F1P A;  4LRX C;  2ZBB A;  5HSQ A;  1XJ6 A;  1OT6 A;  1GSV A;  2VV8 A;  3PBN A;  2JKT I;  3CIT A;  3B42 A;  4CLC B;  1W63 M;  2EWV A;  1F9I A;  4RQ9 A;  5HD5 A;  3BY8 A;  3F1N B;  4EW7 A;  4G3W A;  4HY8 A;  1G6O A;  1LSV A;  2ZMV A;  2V0W A;  1DP9 A;  2KOI A;  3LIA A;  3JVV A;  4ME4 A;  3KSF A;  3IS2 B;  3OC2 A;  5C5K A;  1LL8 A;  4ARZ B;  2W0N A;  5KIZ A;  4JGP A;  3NOU C;  2QKP A;  4Q0I A;  4HJ3 A;  5HDS A;  2L0W A;  3S7P A;  5HL6 A;  1LSX A;  1YKD A;  1UGU A;  4KUO A;  2BAS A;  4WF0 A;  4CLC C;  3EQV A;  2YKF A;  1JNU A;  3RH8 B;  2B18 A;  3MQO A;  4I3I A;  2A2L A;  1P0Z A;  3F1O B;  2P08 A;  3LIC A;  1XJ2 A;  2W3F A;  5HWV A;  2O9B A;  3E4P A;  1VHM A;  2HV1 A;  3T4L A;  3S7Q A;  5AJG A;  3SW1 A;  1D06 A;  3ZQ5 A;  3LID A;  3EEH A;  2M7V A;  3PBO A;  1WA9 A;  1GSX A;  2QWS A;  4EER A;  4XT2 B;  5L8M A;  3UME A;  2EA9 A;  2P04 A;  2GJ3 A;  4LPZ A;  4GS9 A;  4IUK A;  4CLC D;  4M4X A;  2W3D A;  2OAP 1;  2VJW A;  4EQ1 A;  3R7W B;  2R78 A;  1S66 L;  3LFV A;  3T4O A;  1S1Y A;  4KQD A;  3E0Y A;  2PYR A;  3F1N A;  3NOP C;  4JGO A;  5HPF A;  2VKS A;  3EWK A;  5F5Y A;  3T4Q A;  4B9O A;  3E4Q A;  3C30 A;  3FPV A;  4HP9 A;  3UB8 A;  4HIA A;  5J7E A;  4LRZ E;  1DP6 A;  1Y28 A;  2IA2 A;  3IS2 A;  2PR5 A;  2JKR I;  1T19 A;  1G28 A;  4ARZ A;  4I38 A;  4WEK A;  2L4R A;  2HGV A;  3GDI A;  5DFY A;  3UB9 A;  3C38 A;  3OCL A;  2ZMF A;  2W1T A;  2W3G A;  3BWL A;  3LIF A;  2Z6D A;  3V67 A;  1KOU A;  1P9R A;  3OOV A;  2J3T C;  1OTE A;  4OOM A;  1IOU A;  3E4O A;  2JN7 A;  5DKL A;  2MJ6 A;  3MF0 A;  3H82 B;  3OBF A;  1T1C A;  3R4K A;  4Q0H A;  1P9W A;  2K7S A;  4PKY G;  1YSQ A;  4Y3I A;  1XJ3 A;  3KSH A;  1H8M A;  3F1O A;  2I9V A;  3P7N A;  5EFW A;  3IBR A;  2PD7 A;  3VV4 A;  3A0R A;  3CWF A;  4HQA A;  3ZYT A;  3UE3 A;  4HH3 A;  3C2W A;  2VGL S;  4GHI B;  2VV7 A;  4H6J B;  4Z1W A;  4PHT A;  5AVF A;  3T4K A;  3K2N A;  4EEP A;  4P6Z M;  4MDZ A;  4WEL A;  2V1B A;  3KYQ A;  1OJ5 A;  3CLO A;  5FL3 A;  2W3E A;  2KDK A;  4HJ6 A;  1OTA A;  1F98 A;  3O5Y A;  5TBM A;  1NLZ A;  3D3O A;  2G7U A;  1OPX A;  3U2A A;  3ULF A;  5J4E A;  3OCN A;  2QHK A;  2M7U A;  3R7W A;  1NLY A;  3K3D A;  4R6L A;  3UMD A;  3LR5 A;  2ZOI A;  3HJK A;  2GNX A;  2XRO A;  1V9Y A;  2NUP C;  4HJ4 A;  4WN5 A;  2FH5 A;  4BBT A;  5HDD A;  3LR3 A;  2KX6 A;  1N9L A;  2D02 A;  3T4S A;  5F69 A;  2W3H A;  3W2Z A;  2K31 A;  4MN7 A;  4O8G A;  1DRM A;  4K08 A;  1ZTU A;  3NJA A;  5HD3 A;  5KSH A;  2B02 A;  3CI6 A;  3MXQ A;  4Q0J A;  3TW8 A;  1TS0 A;  2M1C A;  4WLA A;  2VGL M;  3MR0 A;  4HNB A;  3EEA A;  4EES A;  4YOF A;  1OJG A;  4BMW A;  3D72 A;  3NOT C;  3LI8 A;  1MC0 A;  4FSF A;  2V1A A;  4GJ4 A;  2P7J A;  3H82 A;  2ZOH A;  4AFI A;  3GEC A;  4FOF A;  1XFQ A;  4R38 A;  4NKP A;  4HOI A;  1V9Z A;  2D01 A;  5J3W A;  1XJ4 A;  2LB9 A;  2JKT M;  1OTD A;  3BQA A;  3UB6 A;  4PAU A;  2LB5 A;  3MJQ A;  4I39 A;  4CLC A;  2H28 A;  4H6J A;  2PT7 A;  4LRY C;  3RFB A;  3A0V A;  4I3J A;  1S67 L;  2XA7 S;  3S7N A;  4MCW A;  2OWH A;  2O99 A;  4Y2F A;  2WKR A;  1DP8 A;  4DJ3 A;  3LI9 A;  1YAX A;  3LR4 A;  4IJG A;  1F5M A;  3B47 A;  3VOL A;  4MN5 A;  4HHD A;  2GZA A;  5MC7 A;  2PHY A;  4WEJ A;  5DJT A;  1T1A A;  3BQ8 A;  4JGQ A;  4DN0 A;  3PBT A;  5F6A A;  3P01 A;  1N9N A;  2VZW A;  4O01 A;  2W27 A;  1OTB A;  3MFX A;  3UB7 A;  4WL9 A;  1ZHH B;  2HJ9 C;  4I3A A;  2QYB A;  2Y79 A;  2W1R A;  3RTY A;  2PR6 A;  1IFQ A;  2VLG A;  3MQ0 A;  5A8B A;  4CLC E;  3C8C A;  4OOL A;  1W63 Q;  1LT0 A;  1VB6 A;  1TS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...