2NUPC

Crystal structure of the human sec23a/24a heterodimer, complexed with the snare protein sec22b
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
157
structure length
137
Chain Sequence
MVLLTMIARVADGLPLAASMQEDDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARIMVANIEEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein transport protein Sec23A
publication title The Transport Signal on Sec22 for Packaging into COPII-Coated Vesicles is a Conformational Epitope
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 38
structure length 137
sequence length 157
ec nomenclature
pdb deposition date 2006-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2nupC00
2NUTC 3KYQA 4AFIA 1IFQA 4B93A 3EGXC 3EGDC 2DMWA 1H8MA 1IOUA 2NUPC 2VX8A 3BW6A
chains in the Genus database with same CATH superfamily
4R4RA 2I9VA 4WLAA 4FH4A 4I5SA 4WMCD 3MBZA 3IX3A 4Z1WA 1ERQA 1MZUA 3B3XA 1MWSA 2JN7A 1ES2A 4OPZA 2W3DA 5CERA 3GMWA 1JWZA 3H7WB 1FR1A 3LR5A 3Q07A 3LYXA 3TG9A 2K31A 4NG2A 3QP5A 3FPWA 5L2FA 4GW9A 4HJ6A 2P74A 3HLGA 1KGGA 3M2JA 1CF0A 2JKTM 5EECA 4FCFA 5EOEA 5F1FA 2E8IA 1RP5A 1NLZA 2HDSA 4R1GA 3VMAA 4HI4A 2Y79A 3AGFA 3HJKA 4DF6A 3IXHA 3D4FA 5E2HA 3UE6A 4BBVA 2J80A 4NK3A 1FOFA 2W27A 4DKIA 2Q9NA 3IWQA 5E2GA 4ZDXA 4WM9A 4G3VA 5TBMB 4Y3IA 1S6RA 5GLAA 3WS4A 3NDGA 2Y2MA 3A3JA 1J3WA 2OAQ1 1IEMA 1ES4A 1O07A 4YOFA 1F2KA 4KZ6A 5CEBA 3TJZC 4OP8A 3P09A 4U0XA 1LL8A 3E4OA 4OPYA 3LIFA 3OPHA 4GZBA 1PRQA 4RX3A 5F69A 4OPQA 3IHAA 4OOLA 3G30A 4Y2FA 4DDSA 2EX9A 5EVEA 2IWDA 1MWUA 3PBOA 5DJTA 2J3WA 2WUQA 3G4PA 3BFCA 5EVIC 2WKQA 2RL3A 3GSGA 5CX7A 1GSXA 4O0PA 3CITA 4K08A 3WS0A 3G6OA 3K3DA 2WYXA 2HZ5A 3IH8A 2W3EA 4NXEA 2W1TB 1PWGA 1ACFA 1CI9A 2A3UA 1FIKA 5EVID 3W4QA 2ZD8A 1XKZA 4HOIA 5L07A 4DE1A 2G2UA 2Y55A 3Q1FA 2GJ3A 2XK1A 2ACGA 3MMHA 1MWRA 1DJCA 2XFSA 4I39A 1K56A 2QHKA 3IQAA 1DRMA 2L0WA 5GLBA 4BQMA 3F1OB 4R38A 4MN7A 5E43A 2M7VA 3GV9A 1U60A 3F1PB 3WS1A 3VE4A 3HJIA 5HDSA 2O9AA 2IWCA 3LCEA 4HESA 4JXSA 3PBNA 5AQ7A 4ZJ3A 1IYPA 3BM6A 5JYOA 4I3IA 2ZOIA 3G32A 3UDIA 5GHXA 1KDSA 1D1JA 2XA7M 3BECA 4KUKA 1O7EA 4BD1A 4GS9B 5DKLA 1H8MA 1NRFA 5A8BA 4ZJ1A 1PI4A 4NKPA 3HLDA 1KDWA 5J8XA 5HD3A 3PBTA 3H82A 4GHIA 3NECA 2P04A 2ZMAA 3HLEA 3O3VA 2PD8A 3N4IA 1K57C 3G31A 4X1LA 5I94A 3HL9A 4L9EA 5AJGA 5HDDA 2XD5A 2Z6CA 3NBLA 4PM5A 3VSKA 1PWCA 4PKYG 2Y2NA 2XSSA 5HARA 2C6WB 1OTEA 4YNRA 3LICA 5GL9A 1K4EA 1W8QA 4PMAA 2PT7A 4K0WA 1YM1A 4KZAA 2WZXA 2X71A 5TGFA 2UV0E 1SDNA 2V1AA 1GHMA 5F6AA 5DF9A 2EX8A 1TS0A 2JKTI 4HHDA 4P85A 3BFDA 1XP4A 2W3FA 3L9KA 4OP5A 2ZM0A 1H8YA 2A24A 2CC1A 1DP6A 1LI9A 2WKPA 3AGEA 4JF4A 4F3LA 2H28A 4ARZA 2KLIA 2M1CA 5J4EA 1YSPA 4UA9A 1MC0A 3IHBA 4GB7A 5M18A 4QY6A 3BJNA 2VK3A 3LY3A 3UY6A 4E3OA 4MBHA 4EBPA 1DY6A 3ZCZA 4CLCA 1KVMA 1W63M 2WGVA 3ZHHA 3FPVA 1K6SA 5AQ9A 3A0RA 4OH0A 4O01A 2ZLYA 5CGSA 4E3IA 3A3IA 3QP1A 4S2OA 4H6JA 4QHCA 3C30A 4IHQA 3M6BA 4ID4A 1UGUA 4O7DA 4P87A 1NYMA 2QWSA 1YKDA 1JTGA 1XJ6A 1OMEA 4PAUA 3B47A 5FSRA 2Y2QA 2Y2GA 2WGWB 1WYBA 1IFQA 2Z6DA 2VGLS 2Y91A 3A0VA 3O86A 3W2ZA 2KOIA 3LY4A 1L3LA 4XUXA 1CQAA 3PAEA 3MXQA 3VSLA 3P98A 5J7EA 3LEQA 3WRTA 5TFQA 4C75A 4EU0A 4Z9QA 1KGFA 5G4ZA 4Y15A 2ZM8A 1KE0A 2JKRM 2ZQAA 3FZCA 3G34A 1JWVA 3CG5A 4P6ZS 2WK0A 4GNUA 3MZEA 3TRCA 3WS2A 1S4SA 2Y59A 3ZNYA 3WRZA 4E6WA 2V8FA 2XH9A 3IF6B 4BJPA 3UB8A 1PZPA 3OZHA 2Y2HA 1ZG6A 1EWZA 3VP3A 2QZ6A 5GHZA 3VP2A 3BY9A 1TS6A 1HLUP 4EUVA 1N9BA 2LB9A 3RFBA 3UO9A 2XDMA 4WN5A 2PD7A 3FKVA 3EGXC 3H7WA 1MBLA 4JGQA 4KZ7A 1Q2PA 1YLYA 3FYZA 3T4TA 2GZAA 3GECA 3T12B 5HAQA 3EEAA 4OLGA 4KZ8A 4KG6A 1L0GA 2KX6A 3HLFA 2M7UA 5KIZA 3S7OA 5DFXA 5FQKA 4A5RA 2VV7A 3W8KA 1Y4OA 4S2NC 3T4OA 3MS6A 4KQQA 2QJ7A 3HUNA 1PW8A 3A3DA 4DDYA 5HFOA 1N4OA 1NZUA 1KE4A 4R3AA 1VHMA 2PDRA 3N6IA 2ZQCA 3ISGA 3LIAA 2Q0OA 2ZM2A 3T4QA 5TBMA 3F1NB 4L9GA 3EOIA 3G2ZA 5HL6A 4B4XA 4HEFA 3S7PA 4MMNA 1PWDA 1PYYA 4WBGA 1QMEA 5CECA 1DP8A 3V39A 1UWPX 4YWZA 3ZYTA 4Y0UA 3RXWA 5FEGA 1GCEA 5AQAA 3BY8A 5E2EA 4OONA 5HWWA 4II7A 1WYCA 2PYRA 3N8SA 4QU3A 2EX6A 1BLPA 1VEUA 4OQGA 2OLUA 4DE0A 5F83A 2QMIA 1HVBA 2J3TC 4JLFA 1W7FA 3VV4A 1K0KA 3ZG5A 3VP4A 3IWOA 2XLNA 1DP9A 1J9MA 3MQ0A 1ONHA 4Y5FA 1Y54A 4NXGA 1JNUA 3G2YA 3QNCA 2B5RA 2FH5A 1CEFA 1PFLA 5EVIB 5HD5A 1C3BA 4S2PA 2DNSA 1BLHA 3S22A 1IOUA 3PXPA 3S1YA 4LGWA 3S7QA 5IU1A 5EOOA 3T4SA 5AVEA 4Y17A 5FQQA 4WZ5C 5HSQA 1G6AA 3F1PA 3T1QB 1LL5A 3UB7A 4D2OA 1K38A 1NYYA 2XRNA 2J8YA 4BBUA 3U2AA 1E3UD 2FFYA 2WZZA 4BL3A 2XA7S 1BSGA 1VETB 1P9RA 2HP5A 4BL2A 4RYEA 3BLSA 3ZQ5A 2VJWA 3ZGAB 4JGPA 5CRFA 1CK3A 5GLCA 3NHQA 5FEFA 4I3JA 1ERMA 4RVAA 3DBAA 1WA9A 1I2WA 5F82A 1FILA 4E3NA 5DKKA 3IXDA 3LIBA 3ICYA 2XQZA 2ZQ8A 2K2NA 3M6HA 4KZBA 4OLDA 4LFUA 3UMDA 4E3MA 4L0LA 2O99A 1YSQA 4U0TA 5F68A 2XFTA 3MQQA 2R9XA 1OTDA 5CEDA 4PPRA 1Z09A 3CPTA 3E98A 4YFMA 3Q7VB 2HDUA 3T4JA 4HBUA 4R23A 1L0DA 4S2IA 1E4DA 4MBKA 4CJNA 3D72A 1ZHHB 3FV7A 2CMNA 2HPBA 2XD1A 1M40A 2GDNA 5EV0A 3UE0A 1K55A 3LI9A 3VOZA 5FAPA 4KZ9A 4DE2A 1BULA 2EFUA 3OLOA 5FQMA 1IKIA 1YPRA 5KSHA 1XFQA 4MEZA 1RGYA 3CUEC 2VLGA 1XJ4A 1VQQA 4IVKA 4WF0A 1FSWA 1W79A 5KSCA 4HH3A 3VP0A 4K91A 4GCZA 4K0XA 3ZG9B 4BLMA 3IXGA 3FC7A 4UQIM 3HLCA 1ES5A 2HDRA 2JCHA 3MXRA 5LBRA 2NUPC 3BQAA 2A49A 3UDFA 1LT0A 2P9VB 2EFXA 1ZG4A 1MPLA 3O87A 1IELA 4P0MA 3HBRA 3BFGA 4LPZA 3BRMA 5CHMA 5EPHA 5C5KA 1FSYA 3S7NA 2HP9A 2WADA 1S66L 3IS2A 3M2KA 2Y2LA 3PR6A 2EWWA 4E3JA 3MZDA 5FQJA 4UA6A 4IJGA 5U47A 3OCLA 3JVVA 1P97A 2NUTC 4D60A 1MWTA 1ESIA 3N8LA 2ZC4B 4QWOA 4KQDA 4RQ9A 1NJ4A 2EX2A 4R3BA 3FG8A 2V9AA 3E2KA 4YINA 3OC2A 2Y2KA 1K25A 3KYQA 4I38A 5HL1A 1XPBA 1TF1A 1S1YA 3SH8A 3VOYA 1CEGA 1YLTA 2BG1A 3DW0A 4X68A 2INWA 1OJ5A 3RXXA 3DWZA 1TDGA 2FFFB 3MXSA 3KYZA 3MFDA 5FI7A 4JKTA 3CHWP 2YKHA 3UB9A 1OTBA 4BWIA 2V1BA 1GHPA 3HLWA 1IYQA 1G5UA 3D3OA 1XGIA 4M3KA 2OV5A 4KZ3A 5D3OA 3T4LA 4HJ3A 4JXWA 4JXGA 3IF6A 4XT2B 4S2MA 4Q0HA 4FTXA 3OPPA 3NY4A 1XA1A 4HQAA 2VZWA 5HZHA 3MQOA 1SKOA 1TS7A 3UN7A 4MDZA 4GKUA 2V0WA 4WMCA 3BWLA 1W63Q 4S2JA 5HWTA 1D7EA 4E6XA 4JF6A 2PRFA 2PAVP 4KENB 4IUHA 3OOVA 2QYBA 1YLZA 3KSHA 4KG5A 3C2WA 4HBTA 3SH9A 3HUOA 4DJ2A 2WKEA 4FD8A 1XXMA 3OPLA 4O8GA 4MN5A 4RA7A 4LV0A 1LLBA 1YMSA 3IXBA 4NXBA 2G7UA 4HH2A 3V3RA 3PTEA 3EQUA 3S4XA 4X6TA 5HAPA 5L09A 2J9OA 4LRXC 4H8RA 3NOUC 3GDIA 2WKIA 3IF5A 2L4RA 3C8CA 2XR0A 2P08A 4I3AA 3E4PA 1VM1A 4U3TA 4LLOB 4NXFA 1RGZA 3R7WB 3DTIA 1XFNA 1IYSA 1KGEA 1ZKJA 3ZG0A 1BZAA 4JF5A 4KQOA 1ES3A 4PKYA 4ZAMA 1P9WA 3ZG7B 3FKWA 4GN2A 3VFFA 1T18A 3O88A 4EBNA 4F94A 3V5MA 2PHYA 1OT9A 1P0ZA 3GR2A 2XROA 2Y2OA 5CGWA 1XGJA 4UEYA 5G4YA 2OWHA 1TEMA 1LHYA 3H82B 4UAAA 3KSIA 4EESA 3Q7ZA 3SS4A 5DJUA 1GHIA 3CAXA 3NULA 3RH8B 1F9IA 5DFYA 4X1MA 4OPRA 2ZQ7A 4EXOA 4S2LA 1ZC2A 1JTDA 4EW7A 3UE3A 2QKPA 1YAXA 2VEAA 1K4FA 1XA7A 1OTAA 1T1AA 3UMEA 2JKFA 1G68A 1JWPA 2VA0A 2JE5A 3CI6A 4N1XA 3BFFA 4P6BA 3BYDA 3IWIA 4JPMA 4EQIA 3B33A 5FI2A 2W0NA 3BFEA 1TDLA 5EVIA 1H0MA 3GRJA 3LIDA 1V9YA 3HCYA 2AVXA 1SCWA 3UE1A 1ZTUA 1MKIA 4EEUA 1Q2QA 2L1MA 2HP6A 4R6LA 3PHYA 2B02A 3C38A 3JPUA 2A24B 2ZC7A 4LV3A 4EERA 1FQGA 4IBRA 2DRWA 4AFIA 5K5BA 4DRTA 1VETA 2WAFA 1K56D 3HUMA 4PM7A 2IWBA 4MCWA 1BT5A 1T1BA 1EI5A 1NY0A 4GLQA 4NETA 1GSWA 2B18A 3K2NA 4OQHA 4Y7PA 4G3WA 4KQRA 1NRJA 3NCKA 3NI9A 4N92A 4LENA 4Q0IA 5HX9A 4JGOA 2WKHA 4ZBEA 3W4PA 2ZOHA 1IYOA 3V50A 1LSXA 3LO7A 1NXYA 4GD8A 2J9PA 2P7JA 3NOPC 2H0YA 5J3WA 4IVIA 2ZC6B 3UNWA 3Q7VA 3MF0A 3MKFA 3QNBA 1PNEA 2GX5A 1F98A 1EROA 2JHEA 1K57A 4QJGA 3P01A 3PAGA 1PW1A 4KZ4A 3HREA 3LI8A 4HP9A 1XJ2A 3CLOA 3LR3A 3GVBA 3I7JA 4DJ3A 4X55A 1F5MA 2W1TA 4MBFA 3DTEA 4N9KA 1TD5A 1BLSA 3WWXA 3VE3A 2WKRA 2ZL1B 1YLPA 1N9OA 4R0QA 1NLYA 3ZVWA 5A92A 2FZ0A 3CJMA 2J3TD 2XGNA 4OOYA 1SHVA 3BEBA 2XF3A 2JC7A 3TE8A 2PR5A 4ZJ2A 2EA9A 5F1GA 5CTMA 3F1OA 5EM0A 2DCFA 4HIAA 4CLCC 4IBXA 4FUWA 2PBYA 2Y4AA 1SZVA 3UPOA 3IBRA 5EM1A 1DJAA 4GJ4A 3P7NA 3VFHA 3T1SA 3GTCA 5L8MA 2O9CA 4GS9A 2Z2LB 4BENA 2JKRI 3NIAA 4CLCD 1JVJA 3GQZA 3KYEA 3IX8A 1FCNA 3SS5A 1OTIA 4PHTA 5EVLA 3OPRA 1YLWA 1WE4A 2X02A 5KZHA 3N7WA 3LUQA 1HZOA 3UB5P 4JBFA 2PBDP 4QD4A 4DXCA 4WUJA 3NDEA 5HWVA 5TJJA 2Q9MA 2D02A 2O9BA 3DAVA 3DTKA 3VP1A 1HD8A 3U4LP 4Y0TA 2ZC3B 5FATA 2HF6A 2BASA 3PBRA 5CTNA 5HW3A 3MSHA 3EQVA 3N8RA 1T19A 1GA0A 3ZVTA 2D01A 1A0KA 1BLCA 2ZQ9A 3ZFZA 1G28A 1OT6A 3LIEA 4EBLA 3JYIA 4WZ4A 5JYPA 5FDHA 3HVFA 2ZMFA 4RX2A 4LV1A 3QP2A 4XT2A 3ULFA 1X0OA 2V0UA 2LB5A 3JVUA 1YQSA 5EUAA 1UWNX 5M1AA 3T1XA 4OKPA 3SZTA 2EXBA 1ALQA 4EV4A 2UWXA 1XJ3A 2PU4A 1VEUB 3LEZA 2HJEA 1FCMA 5FAQA 4X25A 1K54A 4WL9A 1LSVA 3BLMA 4ESPA 4CQHA 4B4ZA 4R3JA 3E2LA 4OQIA 2VKSA 5A93A 4Y13A 3A3EA 4JGRA 3ZG8B 5DF7A 2QJ5A 3SH7A 1BTLA 1MXOA 4EWFA 1PZOA 3PYPA 1FR6A 1YLJA 4GD6A 4M4XA 1SKFA 3UDXA 2OLVA 1S4RA 1N9LA 5CHUA 1S0WA 1IKGA 2O0YA 3MR0A 3EWKA 3T50A 3OCNA 4IUKA 4ETXA 5HPIA 2VX8A 5GHYA 1W5DA 1Z6FA 4PM8A 4EEPA 2GNXA 3R7WA 5A90A 5AQBA 2HDQA 3V3SA 4LRZE 3K3CA 3H9WA 5DTTA 2WGWA 2QPNA 2VV8A 1D06A 4S2NA 1RCJA 5DVAA 2G2WA 1ODVA 2PYPA 4HY8A 2C5WB 3AGDA 2ZC5B 5E2FA 3MZFA 1LI0A 2X01A 1DJBA 3SW1A 3G35A 3EEHA 4PM9A 3NOTC 3V67A 3Q81A 4FH2A 1V9ZA 3UPPA 4X56A 2EWVA 3EGDC 4KG2A 3KX0X 4UHUA 2R9WA 5L10A 1BYWA 1LL9A 4G3KA 4KZ5A 4OVDA 4DE3A 2BTFP 2K7SA 2Y2JA 1YT4A 2B95A 4N1HA 4E3KA 3CPTB 4DXBA 3SOIA 3LR4A 4QB8A 2BLSA 4WELA 4R4SA 4L9FA 3C4PA 4HP4A 5DTKA 4FOFA 4S2KA 5AVFA 5IHVA 3QP6A 3CMZA 5FQ9A 3CWFA 5MC7A 1FCOA 5FI6A 3FWLA 1MKMA 3KSFA 4ZRRA 1EW0A 4EQ1A 3ITAA 2OAP1 2ZQDA 3DWKA 1CI8A 1L0FA 2IA2A 4C3QA 4Y0OA 3ZNTA 3TW8A 2R78A 3C4OA 5GLDA 1G6OA 2I72A 2V8CA 1KE3A 1SDEA 4MLLA 5IT5A 1STZA 3E0YA 4IEDA 4Q0JA 5BOHA 3MKEA 2E8JA 1TS8A 1S1ZA 1E3UA 1ONGA 1NZOA 4E04A 4N9LA 3A3FA 3W4OA 4B9OA 4BD0A 2V20A 4WZ5A 2XEPA 3F1NA 1OPXA 3QHYA 2DMWA 1OJGA 3IS2B 4LCLA 2H0TA 3C7VA 1GSVA 3L7HA 5F5YA 3ITBA 4LRYC 3NC8A 1ESUA 5KMWA 2A2LA 1MY8A 5FQIA 5IS1A 2WAEA 2HV1A 4BBTA 2KDKA 2OSUA 5G18A 3O5YA 3R4KA 3UB6A 1LSWA 2Y2PA 3D9YA 2W1RA 4GHIB 1XX2A 5EFWA 1L2SA 1E25A 1H5XA 5CHJA 1K55C 3C5AA 3WS5A 4MNRA 3MJQA 5I5LA 1H3QA 4HJ4A 2W3GA 3IT9A 4KUOA 2H5SA 4ZTKA 3OBFA 2VV6A 5HAIA 4R70A 1PIOA 1AXBA 3LGOA 4EUZA 2WGIA 4LCMA 3VOLA 4OQ0A 1PI5A 3PBQA 2ZL1A 2VGJA 4E3LA 2ZBBA 4XXRA 1K54C 5FL3A 4FSFA 4WEJA 4QY5A 1CJFA 2EXAA 1N9NA 3E4QA 3IX4A 3SS3A 4ETZA 4GDBA 4ME4A 3UPNA 4X53A 1T1CA 2J7VA 3A0SA 2V2FF 3LFVA 2RCXA 4EETB 3CUEA 5FDSA 2Z2MB 4JXVA 1SKOB 1YMXA 1Y28A 3RTYA 3RJUA 4HNBA 1KOUA 4LV2A 3IH9A 4F3LB 4OOMA 3LR0A 3ZDJA 2HJ9C 4ARZB 4XUZA 3TSGA 2Y8HA 3KSGA 4MN6A 3Q82A 5CXWA 3TOIA 2HGVA 3BQ8A 4CLCB 2VGKA 2PR6A 4Q8IA 4B88A 1W8YA 3DTMA 5FAOA 4GOGA 3NJAA 3T4KA 3MFXA 4UA7A 4DN0A 3CZDA 1L0EA 2ZJ9A 4H6JB 3T1RA 1I2SA 5CGXA 3KO6A 1M6KA 3BW6A 4C6YA 2ZMVA 4X69A 2JKGA 4DMZA 5FASA 3C7UA 3IBJA 4NEED 5A91A 4BMWA 2Y2IA 4QPRA 1BUEA 5DF8A 2JBFA 5HPFA 1GA9A 4CPKA 3PBSA 1K6RA 2OWJA 4WEKA 4WYYA 2PU2A 2VGLM 5EE8A 1H8ZA 1NWZA 2V1ZA 4PM6A 3QP4A 3IF6C 1VB6A 1QMFA 1AWIA 2W3HA 2H10A 5TR7A 5M19A 5DTSA 1I5QA 4UQIS 3QP8A 1S67L 3HLBA 4P6ZM 5FA7A 5HDCA 1KVLA 1TVFA 4GDNA 2MJ6A 4B93A 3B42A 2OOLA 2P9VA 2YKFA 4CLCE 1HTZA
chains in the Genus database with same CATH topology
4JGRA 2I9VA 4WLAA 4EUVA 2LB9A 4I5SA 3RFBA 4IUHA 4WN5A 2QJ5A 3OOVA 4Z1WA 1MZUA 2QYBA 2PD7A 3KSHA 3EGXC 3H7WA 2JN7A 3PYPA 3C2WA 4JGQA 2W3DA 4DJ2A 4M4XA 4O8GA 4MN5A 3H7WB 3T4TA 2GZAA 1S4RA 1N9LA 3LR5A 4NXBA 3GECA 2G7UA 2O0YA 3LYXA 4HH2A 3EEAA 2K31A 3FPWA 3EWKA 3MR0A 4GW9A 3T50A 4HJ6A 3EQUA 2KX6A 3OCNA 4IUKA 2M7UA 4ETXA 5KIZA 3S7OA 5HPIA 2VX8A 4LRXC 4EEPA 3NOUC 5DFXA 3GDIA 2JKTM 2VV7A 2GNXA 2L4RA 3C8CA 3T4OA 3R7WA 1NLZA 2P08A 4I3AA 3E4PA 4HI4A 2QJ7A 4LRZE 3K3CA 3H9WA 4LLOB 2Y79A 3HJKA 4NXFA 3R7WB 4R3AA 1VHMA 2PDRA 1XFNA 3LIAA 2VV8A 3UE6A 4BBVA 1D06A 3T4QA 5TBMA 4KQOA 1ODVA 3F1NB 2PYPA 2J80A 4L9GA 3EOIA 4HY8A 2W27A 4PKYA 5HL6A 1P9WA 3S7PA 4G3VA 4MMNA 1T18A 5TBMB 4Y3IA 2PHYA 1OT9A 3SW1A 1P0ZA 3EEHA 2XROA 1DP8A 3NOTC 3V67A 2OAQ1 1V9ZA 4YOFA 1UWPX 4UEYA 4YWZA 5G4YA 3TJZC 2OWHA 2EWVA 3H82B 1LL8A 3ZYTA 3EGDC 3KSIA 4EESA 3E4OA 3KX0X 3LIFA 1BYWA 5DJUA 4G3KA 3CAXA 3RH8B 5F69A 2K7SA 1F9IA 3BY8A 5DFYA 5HWWA 4EXOA 4II7A 4OOLA 4Y2FA 2PYRA 4EW7A 3UE3A 2QKPA 3PBOA 1YAXA 2VEAA 3LR4A 1OTAA 1T1AA 5DJTA 4WELA 3UMEA 2J3WA 4L9FA 4HP4A 2J3TC 4FOFA 3VV4A 2VA0A 2WKQA 5AVFA 3CI6A 5CX7A 1GSXA 4O0PA 3CWFA 3CITA 4K08A 5MC7A 3G6OA 1DP9A 3MQ0A 3KSFA 1MKMA 3K3DA 3B33A 4ZRRA 4Y5FA 1EW0A 4EQ1A 2W0NA 4NXGA 2W3EA 4NXEA 2W1TB 1JNUA 3LIDA 1V9YA 3HCYA 2OAP1 2FH5A 2IA2A 1ZTUA 4EEUA 3TW8A 2L1MA 2R78A 5HD5A 4R6LA 1G6OA 4HOIA 3PHYA 2B02A 3C38A 1IOUA 2GJ3A 3PXPA 5IT5A 1STZA 3E0YA 4Q0JA 2A24B 3S7QA 3MMHA 5IU1A 1TS8A 1S1ZA 3T4SA 5AVEA 4I39A 2QHKA 4EERA 5HSQA 1DRMA 2L0WA 3F1PA 3UB7A 4AFIA 5K5BA 3F1OB 2XRNA 4R38A 4MN7A 4E04A 2M7VA 4BBUA 3U2AA 3F1PB 4MCWA 3VE4A 2XA7S 3HJIA 4B9OA 1T1BA 5HDSA 1P9RA 2O9AA 4GLQA 1GSWA 3F1NA 2B18A 1OPXA 3ZQ5A 3PBNA 2DMWA 2VJWA 1OJGA 3IS2B 3K2NA 4JGPA 4I3IA 2ZOIA 1GSVA 5F5YA 2XA7M 3NHQA 4G3WA 4KUKA 4I3JA 4GS9B 5DKLA 3DBAA 1H8MA 1NRJA 1WA9A 4LRYC 5A8BA 5DKKA 3LIBA 2A2LA 4NKPA 4Q0IA 3ICYA 5IS1A 5HD3A 4JGOA 2HV1A 4BBTA 2KDKA 2K2NA 3PBTA 2ZOHA 3H82A 3O5YA 3R4KA 3UB6A 3UMDA 4GHIA 1LSWA 1LSXA 4L0LA 2O99A 1YSQA 2P04A 2W1RA 5F68A 2PD8A 4GHIB 2P7JA 3MQQA 3NOPC 5EFWA 5J3WA 1OTDA 4L9EA 5AJGA 3MF0A 5HDDA 2Z6CA 2GX5A 1F98A 2JHEA 3E98A 3MJQA 3T4JA 4PKYG 5I5LA 1H3QA 4HJ4A 2XSSA 2W3GA 1OTEA 3P01A 4KUOA 3OBFA 4YNRA 2VV6A 3D72A 3LICA 1ZHHB 4R70A 2CMNA 3LI8A 4HP9A 1XJ2A 3CLOA 3LI9A 3LR3A 3VOLA 2PT7A 4DJ3A 1F5MA 3OLOA 3PBQA 5KSHA 1XFQA 2W1TA 2ZBBA 1TD5A 2V1AA 5F6AA 5FL3A 4FSFA 4WEJA 3CUEC 3VE3A 2WKRA 5DF9A 1N9NA 3E4QA 2VLGA 1TS0A 2JKTI 4ETZA 1XJ4A 1N9OA 4WF0A 4HHDA 1NLYA 4ME4A 4HH3A 1T1CA 4GCZA 2FZ0A 3LFVA 3A0SA 2J3TD 2W3FA 3FC7A 4EETB 4UQIM 5LBRA 2A24A 3CUEA 2NUPC 3BQAA 1DP6A 1Y28A 2WKPA 3RTYA 4F3LA 4HNBA 1LT0A 3TE8A 2PR5A 1KOUA 2EA9A 2H28A 4ARZA 2KLIA 2M1CA 3F1OA 5J4EA 4HIAA 4CLCC 4F3LB 4OOMA 4LPZA 1YSPA 1MC0A 3LR0A 4ARZB 2HJ9C 5C5KA 3S7NA 2Y8HA 3BJNA 3IBRA 3KSGA 4MN6A 1S66L 3IS2A 4GJ4A 3P7NA 3PR6A 4CLCA 1W63M 2EWWA 3FPVA 2HGVA 3BQ8A 4IJGA 5L8MA 3A0RA 3OCLA 2O9CA 4GS9A 3JVVA 1P97A 4O01A 4CLCB 2JKRI 2NUTC 2PR6A 4CLCD 4H6JA 3NJAA 1OTIA 4PHTA 3T4KA 3MFXA 3C30A 4KQDA 4IHQA 4RQ9A 4DN0A 1UGUA 4H6JB 3FG8A 2QWSA 1YKDA 2V9AA 3LUQA 1XJ6A 3KO6A 3OC2A 3B47A 3BW6A 4PAUA 4WUJA 3KYQA 4I38A 2ZMVA 5HWVA 4DMZA 5TJJA 3IBJA 4NEED 1TF1A 4BMWA 1S1YA 1IFQA 2D02A 2Z6DA 2O9BA 2VGLS 4QPRA 3A0VA 3W2ZA 2KOIA 2INWA 2HF6A 1OJ5A 2BASA 3PBRA 5HPFA 3MXQA 3EQVA 1T19A 3KYZA 3PBSA 5J7EA 2OWJA 4WEKA 2D01A 2VGLM 4EU0A 1NWZA 5G4ZA 2YKHA 3UB9A 1OTBA 4BWIA 1G28A 2JKRM 1OT6A 3LIEA 1VB6A 2V1BA 2ZMFA 3D3OA 2W3HA 4P6ZS 3T4LA 4XT2A 3TRCA 4HJ3A 3ULFA 1X0OA 2V0UA 2LB5A 3JVUA 1S4SA 1UWNX 4UQIS 4XT2B 4Q0HA 1S67L 4P6ZM 5HDCA 4BJPA 3UB8A 1XJ3A 4HQAA 2VZWA 2MJ6A 4B93A 2HJEA 5HZHA 3B42A 3MQOA 1TS7A 4MDZA 2OOLA 2YKFA 3BY9A 2V0WA 4WL9A 3BWLA 1TS6A 1LSVA 4CLCE 4CQHA 1W63Q 5HWTA 2VKSA 1D7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUT C;  3KYQ A;  4AFI A;  1IFQ A;  4B93 A;  3EGX C;  3EGD C;  2DMW A;  1H8M A;  1IOU A;  2NUP C;  2VX8 A;  3BW6 A; 
#chains in the Genus database with same CATH topology
 4R4R A;  2I9V A;  4WLA A;  4FH4 A;  4I5S A;  4WMC D;  3MBZ A;  3IX3 A;  4Z1W A;  1ERQ A;  1MZU A;  3B3X A;  1MWS A;  2JN7 A;  1ES2 A;  4OPZ A;  2W3D A;  5CER A;  3GMW A;  1JWZ A;  3H7W B;  1FR1 A;  3LR5 A;  3Q07 A;  3LYX A;  3TG9 A;  2K31 A;  4NG2 A;  3QP5 A;  3FPW A;  5L2F A;  4GW9 A;  4HJ6 A;  2P74 A;  3HLG A;  1KGG A;  3M2J A;  1CF0 A;  2JKT M;  5EEC A;  4FCF A;  5EOE A;  5F1F A;  2E8I A;  1RP5 A;  1NLZ A;  2HDS A;  4R1G A;  3VMA A;  4HI4 A;  2Y79 A;  3AGF A;  3HJK A;  4DF6 A;  3IXH A;  3D4F A;  5E2H A;  3UE6 A;  4BBV A;  2J80 A;  4NK3 A;  1FOF A;  2W27 A;  4DKI A;  2Q9N A;  3IWQ A;  5E2G A;  4ZDX A;  4WM9 A;  4G3V A;  5TBM B;  4Y3I A;  1S6R A;  5GLA A;  3WS4 A;  3NDG A;  2Y2M A;  3A3J A;  1J3W A;  2OAQ 1;  1IEM A;  1ES4 A;  1O07 A;  4YOF A;  1F2K A;  4KZ6 A;  5CEB A;  3TJZ C;  4OP8 A;  3P09 A;  4U0X A;  1LL8 A;  3E4O A;  4OPY A;  3LIF A;  3OPH A;  4GZB A;  1PRQ A;  4RX3 A;  5F69 A;  4OPQ A;  3IHA A;  4OOL A;  3G30 A;  4Y2F A;  4DDS A;  2EX9 A;  5EVE A;  2IWD A;  1MWU A;  3PBO A;  5DJT A;  2J3W A;  2WUQ A;  3G4P A;  3BFC A;  5EVI C;  2WKQ A;  2RL3 A;  3GSG A;  5CX7 A;  1GSX A;  4O0P A;  3CIT A;  4K08 A;  3WS0 A;  3G6O A;  3K3D A;  2WYX A;  2HZ5 A;  3IH8 A;  2W3E A;  4NXE A;  2W1T B;  1PWG A;  1ACF A;  1CI9 A;  2A3U A;  1FIK A;  5EVI D;  3W4Q A;  2ZD8 A;  1XKZ A;  4HOI A;  5L07 A;  4DE1 A;  2G2U A;  2Y55 A;  3Q1F A;  2GJ3 A;  2XK1 A;  2ACG A;  3MMH A;  1MWR A;  1DJC A;  2XFS A;  4I39 A;  1K56 A;  2QHK A;  3IQA A;  1DRM A;  2L0W A;  5GLB A;  4BQM A;  3F1O B;  4R38 A;  4MN7 A;  5E43 A;  2M7V A;  3GV9 A;  1U60 A;  3F1P B;  3WS1 A;  3VE4 A;  3HJI A;  5HDS A;  2O9A A;  2IWC A;  3LCE A;  4HES A;  4JXS A;  3PBN A;  5AQ7 A;  4ZJ3 A;  1IYP A;  3BM6 A;  5JYO A;  4I3I A;  2ZOI A;  3G32 A;  3UDI A;  5GHX A;  1KDS A;  1D1J A;  2XA7 M;  3BEC A;  4KUK A;  1O7E A;  4BD1 A;  4GS9 B;  5DKL A;  1H8M A;  1NRF A;  5A8B A;  4ZJ1 A;  1PI4 A;  4NKP A;  3HLD A;  1KDW A;  5J8X A;  5HD3 A;  3PBT A;  3H82 A;  4GHI A;  3NEC A;  2P04 A;  2ZMA A;  3HLE A;  3O3V A;  2PD8 A;  3N4I A;  1K57 C;  3G31 A;  4X1L A;  5I94 A;  3HL9 A;  4L9E A;  5AJG A;  5HDD A;  2XD5 A;  2Z6C A;  3NBL A;  4PM5 A;  3VSK A;  1PWC A;  4PKY G;  2Y2N A;  2XSS A;  5HAR A;  2C6W B;  1OTE A;  4YNR A;  3LIC A;  5GL9 A;  1K4E A;  1W8Q A;  4PMA A;  2PT7 A;  4K0W A;  1YM1 A;  4KZA A;  2WZX A;  2X71 A;  5TGF A;  2UV0 E;  1SDN A;  2V1A A;  1GHM A;  5F6A A;  5DF9 A;  2EX8 A;  1TS0 A;  2JKT I;  4HHD A;  4P85 A;  3BFD A;  1XP4 A;  2W3F A;  3L9K A;  4OP5 A;  2ZM0 A;  1H8Y A;  2A24 A;  2CC1 A;  1DP6 A;  1LI9 A;  2WKP A;  3AGE A;  4JF4 A;  4F3L A;  2H28 A;  4ARZ A;  2KLI A;  2M1C A;  5J4E A;  1YSP A;  4UA9 A;  1MC0 A;  3IHB A;  4GB7 A;  5M18 A;  4QY6 A;  3BJN A;  2VK3 A;  3LY3 A;  3UY6 A;  4E3O A;  4MBH A;  4EBP A;  1DY6 A;  3ZCZ A;  4CLC A;  1KVM A;  1W63 M;  2WGV A;  3ZHH A;  3FPV A;  1K6S A;  5AQ9 A;  3A0R A;  4OH0 A;  4O01 A;  2ZLY A;  5CGS A;  4E3I A;  3A3I A;  3QP1 A;  4S2O A;  4H6J A;  4QHC A;  3C30 A;  4IHQ A;  3M6B A;  4ID4 A;  1UGU A;  4O7D A;  4P87 A;  1NYM A;  2QWS A;  1YKD A;  1JTG A;  1XJ6 A;  1OME A;  4PAU A;  3B47 A;  5FSR A;  2Y2Q A;  2Y2G A;  2WGW B;  1WYB A;  1IFQ A;  2Z6D A;  2VGL S;  2Y91 A;  3A0V A;  3O86 A;  3W2Z A;  2KOI A;  3LY4 A;  1L3L A;  4XUX A;  1CQA A;  3PAE A;  3MXQ A;  3VSL A;  3P98 A;  5J7E A;  3LEQ A;  3WRT A;  5TFQ A;  4C75 A;  4EU0 A;  4Z9Q A;  1KGF A;  5G4Z A;  4Y15 A;  2ZM8 A;  1KE0 A;  2JKR M;  2ZQA A;  3FZC A;  3G34 A;  1JWV A;  3CG5 A;  4P6Z S;  2WK0 A;  4GNU A;  3MZE A;  3TRC A;  3WS2 A;  1S4S A;  2Y59 A;  3ZNY A;  3WRZ A;  4E6W A;  2V8F A;  2XH9 A;  3IF6 B;  4BJP A;  3UB8 A;  1PZP A;  3OZH A;  2Y2H A;  1ZG6 A;  1EWZ A;  3VP3 A;  2QZ6 A;  5GHZ A;  3VP2 A;  3BY9 A;  1TS6 A;  1HLU P;  4EUV A;  1N9B A;  2LB9 A;  3RFB A;  3UO9 A;  2XDM A;  4WN5 A;  2PD7 A;  3FKV A;  3EGX C;  3H7W A;  1MBL A;  4JGQ A;  4KZ7 A;  1Q2P A;  1YLY A;  3FYZ A;  3T4T A;  2GZA A;  3GEC A;  3T12 B;  5HAQ A;  3EEA A;  4OLG A;  4KZ8 A;  4KG6 A;  1L0G A;  2KX6 A;  3HLF A;  2M7U A;  5KIZ A;  3S7O A;  5DFX A;  5FQK A;  4A5R A;  2VV7 A;  3W8K A;  1Y4O A;  4S2N C;  3T4O A;  3MS6 A;  4KQQ A;  2QJ7 A;  3HUN A;  1PW8 A;  3A3D A;  4DDY A;  5HFO A;  1N4O A;  1NZU A;  1KE4 A;  4R3A A;  1VHM A;  2PDR A;  3N6I A;  2ZQC A;  3ISG A;  3LIA A;  2Q0O A;  2ZM2 A;  3T4Q A;  5TBM A;  3F1N B;  4L9G A;  3EOI A;  3G2Z A;  5HL6 A;  4B4X A;  4HEF A;  3S7P A;  4MMN A;  1PWD A;  1PYY A;  4WBG A;  1QME A;  5CEC A;  1DP8 A;  3V39 A;  1UWP X;  4YWZ A;  3ZYT A;  4Y0U A;  3RXW A;  5FEG A;  1GCE A;  5AQA A;  3BY8 A;  5E2E A;  4OON A;  5HWW A;  4II7 A;  1WYC A;  2PYR A;  3N8S A;  4QU3 A;  2EX6 A;  1BLP A;  1VEU A;  4OQG A;  2OLU A;  4DE0 A;  5F83 A;  2QMI A;  1HVB A;  2J3T C;  4JLF A;  1W7F A;  3VV4 A;  1K0K A;  3ZG5 A;  3VP4 A;  3IWO A;  2XLN A;  1DP9 A;  1J9M A;  3MQ0 A;  1ONH A;  4Y5F A;  1Y54 A;  4NXG A;  1JNU A;  3G2Y A;  3QNC A;  2B5R A;  2FH5 A;  1CEF A;  1PFL A;  5EVI B;  5HD5 A;  1C3B A;  4S2P A;  2DNS A;  1BLH A;  3S22 A;  1IOU A;  3PXP A;  3S1Y A;  4LGW A;  3S7Q A;  5IU1 A;  5EOO A;  3T4S A;  5AVE A;  4Y17 A;  5FQQ A;  4WZ5 C;  5HSQ A;  1G6A A;  3F1P A;  3T1Q B;  1LL5 A;  3UB7 A;  4D2O A;  1K38 A;  1NYY A;  2XRN A;  2J8Y A;  4BBU A;  3U2A A;  1E3U D;  2FFY A;  2WZZ A;  4BL3 A;  2XA7 S;  1BSG A;  1VET B;  1P9R A;  2HP5 A;  4BL2 A;  4RYE A;  3BLS A;  3ZQ5 A;  2VJW A;  3ZGA B;  4JGP A;  5CRF A;  1CK3 A;  5GLC A;  3NHQ A;  5FEF A;  4I3J A;  1ERM A;  4RVA A;  3DBA A;  1WA9 A;  1I2W A;  5F82 A;  1FIL A;  4E3N A;  5DKK A;  3IXD A;  3LIB A;  3ICY A;  2XQZ A;  2ZQ8 A;  2K2N A;  3M6H A;  4KZB A;  4OLD A;  4LFU A;  3UMD A;  4E3M A;  4L0L A;  2O99 A;  1YSQ A;  4U0T A;  5F68 A;  2XFT A;  3MQQ A;  2R9X A;  1OTD A;  5CED A;  4PPR A;  1Z09 A;  3CPT A;  3E98 A;  4YFM A;  3Q7V B;  2HDU A;  3T4J A;  4HBU A;  4R23 A;  1L0D A;  4S2I A;  1E4D A;  4MBK A;  4CJN A;  3D72 A;  1ZHH B;  3FV7 A;  2CMN A;  2HPB A;  2XD1 A;  1M40 A;  2GDN A;  5EV0 A;  3UE0 A;  1K55 A;  3LI9 A;  3VOZ A;  5FAP A;  4KZ9 A;  4DE2 A;  1BUL A;  2EFU A;  3OLO A;  5FQM A;  1IKI A;  1YPR A;  5KSH A;  1XFQ A;  4MEZ A;  1RGY A;  3CUE C;  2VLG A;  1XJ4 A;  1VQQ A;  4IVK A;  4WF0 A;  1FSW A;  1W79 A;  5KSC A;  4HH3 A;  3VP0 A;  4K91 A;  4GCZ A;  4K0X A;  3ZG9 B;  4BLM A;  3IXG A;  3FC7 A;  4UQI M;  3HLC A;  1ES5 A;  2HDR A;  2JCH A;  3MXR A;  5LBR A;  2NUP C;  3BQA A;  2A49 A;  3UDF A;  1LT0 A;  2P9V B;  2EFX A;  1ZG4 A;  1MPL A;  3O87 A;  1IEL A;  4P0M A;  3HBR A;  3BFG A;  4LPZ A;  3BRM A;  5CHM A;  5EPH A;  5C5K A;  1FSY A;  3S7N A;  2HP9 A;  2WAD A;  1S66 L;  3IS2 A;  3M2K A;  2Y2L A;  3PR6 A;  2EWW A;  4E3J A;  3MZD A;  5FQJ A;  4UA6 A;  4IJG A;  5U47 A;  3OCL A;  3JVV A;  1P97 A;  2NUT C;  4D60 A;  1MWT A;  1ESI A;  3N8L A;  2ZC4 B;  4QWO A;  4KQD A;  4RQ9 A;  1NJ4 A;  2EX2 A;  4R3B A;  3FG8 A;  2V9A A;  3E2K A;  4YIN A;  3OC2 A;  2Y2K A;  1K25 A;  3KYQ A;  4I38 A;  5HL1 A;  1XPB A;  1TF1 A;  1S1Y A;  3SH8 A;  3VOY A;  1CEG A;  1YLT A;  2BG1 A;  3DW0 A;  4X68 A;  2INW A;  1OJ5 A;  3RXX A;  3DWZ A;  1TDG A;  2FFF B;  3MXS A;  3KYZ A;  3MFD A;  5FI7 A;  4JKT A;  3CHW P;  2YKH A;  3UB9 A;  1OTB A;  4BWI A;  2V1B A;  1GHP A;  3HLW A;  1IYQ A;  1G5U A;  3D3O A;  1XGI A;  4M3K A;  2OV5 A;  4KZ3 A;  5D3O A;  3T4L A;  4HJ3 A;  4JXW A;  4JXG A;  3IF6 A;  4XT2 B;  4S2M A;  4Q0H A;  4FTX A;  3OPP A;  3NY4 A;  1XA1 A;  4HQA A;  2VZW A;  5HZH A;  3MQO A;  1SKO A;  1TS7 A;  3UN7 A;  4MDZ A;  4GKU A;  2V0W A;  4WMC A;  3BWL A;  1W63 Q;  4S2J A;  5HWT A;  1D7E A;  4E6X A;  4JF6 A;  2PRF A;  2PAV P;  4KEN B;  4IUH A;  3OOV A;  2QYB A;  1YLZ A;  3KSH A;  4KG5 A;  3C2W A;  4HBT A;  3SH9 A;  3HUO A;  4DJ2 A;  2WKE A;  4FD8 A;  1XXM A;  3OPL A;  4O8G A;  4MN5 A;  4RA7 A;  4LV0 A;  1LLB A;  1YMS A;  3IXB A;  4NXB A;  2G7U A;  4HH2 A;  3V3R A;  3PTE A;  3EQU A;  3S4X A;  4X6T A;  5HAP A;  5L09 A;  2J9O A;  4LRX C;  4H8R A;  3NOU C;  3GDI A;  2WKI A;  3IF5 A;  2L4R A;  3C8C A;  2XR0 A;  2P08 A;  4I3A A;  3E4P A;  1VM1 A;  4U3T A;  4LLO B;  4NXF A;  1RGZ A;  3R7W B;  3DTI A;  1XFN A;  1IYS A;  1KGE A;  1ZKJ A;  3ZG0 A;  1BZA A;  4JF5 A;  4KQO A;  1ES3 A;  4PKY A;  4ZAM A;  1P9W A;  3ZG7 B;  3FKW A;  4GN2 A;  3VFF A;  1T18 A;  3O88 A;  4EBN A;  4F94 A;  3V5M A;  2PHY A;  1OT9 A;  1P0Z A;  3GR2 A;  2XRO A;  2Y2O A;  5CGW A;  1XGJ A;  4UEY A;  5G4Y A;  2OWH A;  1TEM A;  1LHY A;  3H82 B;  4UAA A;  3KSI A;  4EES A;  3Q7Z A;  3SS4 A;  5DJU A;  1GHI A;  3CAX A;  3NUL A;  3RH8 B;  1F9I A;  5DFY A;  4X1M A;  4OPR A;  2ZQ7 A;  4EXO A;  4S2L A;  1ZC2 A;  1JTD A;  4EW7 A;  3UE3 A;  2QKP A;  1YAX A;  2VEA A;  1K4F A;  1XA7 A;  1OTA A;  1T1A A;  3UME A;  2JKF A;  1G68 A;  1JWP A;  2VA0 A;  2JE5 A;  3CI6 A;  4N1X A;  3BFF A;  4P6B A;  3BYD A;  3IWI A;  4JPM A;  4EQI A;  3B33 A;  5FI2 A;  2W0N A;  3BFE A;  1TDL A;  5EVI A;  1H0M A;  3GRJ A;  3LID A;  1V9Y A;  3HCY A;  2AVX A;  1SCW A;  3UE1 A;  1ZTU A;  1MKI A;  4EEU A;  1Q2Q A;  2L1M A;  2HP6 A;  4R6L A;  3PHY A;  2B02 A;  3C38 A;  3JPU A;  2A24 B;  2ZC7 A;  4LV3 A;  4EER A;  1FQG A;  4IBR A;  2DRW A;  4AFI A;  5K5B A;  4DRT A;  1VET A;  2WAF A;  1K56 D;  3HUM A;  4PM7 A;  2IWB A;  4MCW A;  1BT5 A;  1T1B A;  1EI5 A;  1NY0 A;  4GLQ A;  4NET A;  1GSW A;  2B18 A;  3K2N A;  4OQH A;  4Y7P A;  4G3W A;  4KQR A;  1NRJ A;  3NCK A;  3NI9 A;  4N92 A;  4LEN A;  4Q0I A;  5HX9 A;  4JGO A;  2WKH A;  4ZBE A;  3W4P A;  2ZOH A;  1IYO A;  3V50 A;  1LSX A;  3LO7 A;  1NXY A;  4GD8 A;  2J9P A;  2P7J A;  3NOP C;  2H0Y A;  5J3W A;  4IVI A;  2ZC6 B;  3UNW A;  3Q7V A;  3MF0 A;  3MKF A;  3QNB A;  1PNE A;  2GX5 A;  1F98 A;  1ERO A;  2JHE A;  1K57 A;  4QJG A;  3P01 A;  3PAG A;  1PW1 A;  4KZ4 A;  3HRE A;  3LI8 A;  4HP9 A;  1XJ2 A;  3CLO A;  3LR3 A;  3GVB A;  3I7J A;  4DJ3 A;  4X55 A;  1F5M A;  2W1T A;  4MBF A;  3DTE A;  4N9K A;  1TD5 A;  1BLS A;  3WWX A;  3VE3 A;  2WKR A;  2ZL1 B;  1YLP A;  1N9O A;  4R0Q A;  1NLY A;  3ZVW A;  5A92 A;  2FZ0 A;  3CJM A;  2J3T D;  2XGN A;  4OOY A;  1SHV A;  3BEB A;  2XF3 A;  2JC7 A;  3TE8 A;  2PR5 A;  4ZJ2 A;  2EA9 A;  5F1G A;  5CTM A;  3F1O A;  5EM0 A;  2DCF A;  4HIA A;  4CLC C;  4IBX A;  4FUW A;  2PBY A;  2Y4A A;  1SZV A;  3UPO A;  3IBR A;  5EM1 A;  1DJA A;  4GJ4 A;  3P7N A;  3VFH A;  3T1S A;  3GTC A;  5L8M A;  2O9C A;  4GS9 A;  2Z2L B;  4BEN A;  2JKR I;  3NIA A;  4CLC D;  1JVJ A;  3GQZ A;  3KYE A;  3IX8 A;  1FCN A;  3SS5 A;  1OTI A;  4PHT A;  5EVL A;  3OPR A;  1YLW A;  1WE4 A;  2X02 A;  5KZH A;  3N7W A;  3LUQ A;  1HZO A;  3UB5 P;  4JBF A;  2PBD P;  4QD4 A;  4DXC A;  4WUJ A;  3NDE A;  5HWV A;  5TJJ A;  2Q9M A;  2D02 A;  2O9B A;  3DAV A;  3DTK A;  3VP1 A;  1HD8 A;  3U4L P;  4Y0T A;  2ZC3 B;  5FAT A;  2HF6 A;  2BAS A;  3PBR A;  5CTN A;  5HW3 A;  3MSH A;  3EQV A;  3N8R A;  1T19 A;  1GA0 A;  3ZVT A;  2D01 A;  1A0K A;  1BLC A;  2ZQ9 A;  3ZFZ A;  1G28 A;  1OT6 A;  3LIE A;  4EBL A;  3JYI A;  4WZ4 A;  5JYP A;  5FDH A;  3HVF A;  2ZMF A;  4RX2 A;  4LV1 A;  3QP2 A;  4XT2 A;  3ULF A;  1X0O A;  2V0U A;  2LB5 A;  3JVU A;  1YQS A;  5EUA A;  1UWN X;  5M1A A;  3T1X A;  4OKP A;  3SZT A;  2EXB A;  1ALQ A;  4EV4 A;  2UWX A;  1XJ3 A;  2PU4 A;  1VEU B;  3LEZ A;  2HJE A;  1FCM A;  5FAQ A;  4X25 A;  1K54 A;  4WL9 A;  1LSV A;  3BLM A;  4ESP A;  4CQH A;  4B4Z A;  4R3J A;  3E2L A;  4OQI A;  2VKS A;  5A93 A;  4Y13 A;  3A3E A;  4JGR A;  3ZG8 B;  5DF7 A;  2QJ5 A;  3SH7 A;  1BTL A;  1MXO A;  4EWF A;  1PZO A;  3PYP A;  1FR6 A;  1YLJ A;  4GD6 A;  4M4X A;  1SKF A;  3UDX A;  2OLV A;  1S4R A;  1N9L A;  5CHU A;  1S0W A;  1IKG A;  2O0Y A;  3MR0 A;  3EWK A;  3T50 A;  3OCN A;  4IUK A;  4ETX A;  5HPI A;  2VX8 A;  5GHY A;  1W5D A;  1Z6F A;  4PM8 A;  4EEP A;  2GNX A;  3R7W A;  5A90 A;  5AQB A;  2HDQ A;  3V3S A;  4LRZ E;  3K3C A;  3H9W A;  5DTT A;  2WGW A;  2QPN A;  2VV8 A;  1D06 A;  4S2N A;  1RCJ A;  5DVA A;  2G2W A;  1ODV A;  2PYP A;  4HY8 A;  2C5W B;  3AGD A;  2ZC5 B;  5E2F A;  3MZF A;  1LI0 A;  2X01 A;  1DJB A;  3SW1 A;  3G35 A;  3EEH A;  4PM9 A;  3NOT C;  3V67 A;  3Q81 A;  4FH2 A;  1V9Z A;  3UPP A;  4X56 A;  2EWV A;  3EGD C;  4KG2 A;  3KX0 X;  4UHU A;  2R9W A;  5L10 A;  1BYW A;  1LL9 A;  4G3K A;  4KZ5 A;  4OVD A;  4DE3 A;  2BTF P;  2K7S A;  2Y2J A;  1YT4 A;  2B95 A;  4N1H A;  4E3K A;  3CPT B;  4DXB A;  3SOI A;  3LR4 A;  4QB8 A;  2BLS A;  4WEL A;  4R4S A;  4L9F A;  3C4P A;  4HP4 A;  5DTK A;  4FOF A;  4S2K A;  5AVF A;  5IHV A;  3QP6 A;  3CMZ A;  5FQ9 A;  3CWF A;  5MC7 A;  1FCO A;  5FI6 A;  3FWL A;  1MKM A;  3KSF A;  4ZRR A;  1EW0 A;  4EQ1 A;  3ITA A;  2OAP 1;  2ZQD A;  3DWK A;  1CI8 A;  1L0F A;  2IA2 A;  4C3Q A;  4Y0O A;  3ZNT A;  3TW8 A;  2R78 A;  3C4O A;  5GLD A;  1G6O A;  2I72 A;  2V8C A;  1KE3 A;  1SDE A;  4MLL A;  5IT5 A;  1STZ A;  3E0Y A;  4IED A;  4Q0J A;  5BOH A;  3MKE A;  2E8J A;  1TS8 A;  1S1Z A;  1E3U A;  1ONG A;  1NZO A;  4E04 A;  4N9L A;  3A3F A;  3W4O A;  4B9O A;  4BD0 A;  2V20 A;  4WZ5 A;  2XEP A;  3F1N A;  1OPX A;  3QHY A;  2DMW A;  1OJG A;  3IS2 B;  4LCL A;  2H0T A;  3C7V A;  1GSV A;  3L7H A;  5F5Y A;  3ITB A;  4LRY C;  3NC8 A;  1ESU A;  5KMW A;  2A2L A;  1MY8 A;  5FQI A;  5IS1 A;  2WAE A;  2HV1 A;  4BBT A;  2KDK A;  2OSU A;  5G18 A;  3O5Y A;  3R4K A;  3UB6 A;  1LSW A;  2Y2P A;  3D9Y A;  2W1R A;  4GHI B;  1XX2 A;  5EFW A;  1L2S A;  1E25 A;  1H5X A;  5CHJ A;  1K55 C;  3C5A A;  3WS5 A;  4MNR A;  3MJQ A;  5I5L A;  1H3Q A;  4HJ4 A;  2W3G A;  3IT9 A;  4KUO A;  2H5S A;  4ZTK A;  3OBF A;  2VV6 A;  5HAI A;  4R70 A;  1PIO A;  1AXB A;  3LGO A;  4EUZ A;  2WGI A;  4LCM A;  3VOL A;  4OQ0 A;  1PI5 A;  3PBQ A;  2ZL1 A;  2VGJ A;  4E3L A;  2ZBB A;  4XXR A;  1K54 C;  5FL3 A;  4FSF A;  4WEJ A;  4QY5 A;  1CJF A;  2EXA A;  1N9N A;  3E4Q A;  3IX4 A;  3SS3 A;  4ETZ A;  4GDB A;  4ME4 A;  3UPN A;  4X53 A;  1T1C A;  2J7V A;  3A0S A;  2V2F F;  3LFV A;  2RCX A;  4EET B;  3CUE A;  5FDS A;  2Z2M B;  4JXV A;  1SKO B;  1YMX A;  1Y28 A;  3RTY A;  3RJU A;  4HNB A;  1KOU A;  4LV2 A;  3IH9 A;  4F3L B;  4OOM A;  3LR0 A;  3ZDJ A;  2HJ9 C;  4ARZ B;  4XUZ A;  3TSG A;  2Y8H A;  3KSG A;  4MN6 A;  3Q82 A;  5CXW A;  3TOI A;  2HGV A;  3BQ8 A;  4CLC B;  2VGK A;  2PR6 A;  4Q8I A;  4B88 A;  1W8Y A;  3DTM A;  5FAO A;  4GOG A;  3NJA A;  3T4K A;  3MFX A;  4UA7 A;  4DN0 A;  3CZD A;  1L0E A;  2ZJ9 A;  4H6J B;  3T1R A;  1I2S A;  5CGX A;  3KO6 A;  1M6K A;  3BW6 A;  4C6Y A;  2ZMV A;  4X69 A;  2JKG A;  4DMZ A;  5FAS A;  3C7U A;  3IBJ A;  4NEE D;  5A91 A;  4BMW A;  2Y2I A;  4QPR A;  1BUE A;  5DF8 A;  2JBF A;  5HPF A;  1GA9 A;  4CPK A;  3PBS A;  1K6R A;  2OWJ A;  4WEK A;  4WYY A;  2PU2 A;  2VGL M;  5EE8 A;  1H8Z A;  1NWZ A;  2V1Z A;  4PM6 A;  3QP4 A;  3IF6 C;  1VB6 A;  1QMF A;  1AWI A;  2W3H A;  2H10 A;  5TR7 A;  5M19 A;  5DTS A;  1I5Q A;  4UQI S;  3QP8 A;  1S67 L;  3HLB A;  4P6Z M;  5FA7 A;  5HDC A;  1KVL A;  1TVF A;  4GDN A;  2MJ6 A;  4B93 A;  3B42 A;  2OOL A;  2P9V A;  2YKF A;  4CLC E;  1HTZ A; 
#chains in the Genus database with same CATH homology
 4JGR A;  2I9V A;  4WLA A;  4EUV A;  2LB9 A;  4I5S A;  3RFB A;  4IUH A;  4WN5 A;  2QJ5 A;  3OOV A;  4Z1W A;  1MZU A;  2QYB A;  2PD7 A;  3KSH A;  3EGX C;  3H7W A;  2JN7 A;  3PYP A;  3C2W A;  4JGQ A;  2W3D A;  4DJ2 A;  4M4X A;  4O8G A;  4MN5 A;  3H7W B;  3T4T A;  2GZA A;  1S4R A;  1N9L A;  3LR5 A;  4NXB A;  3GEC A;  2G7U A;  2O0Y A;  3LYX A;  4HH2 A;  3EEA A;  2K31 A;  3FPW A;  3EWK A;  3MR0 A;  4GW9 A;  3T50 A;  4HJ6 A;  3EQU A;  2KX6 A;  3OCN A;  4IUK A;  2M7U A;  4ETX A;  5KIZ A;  3S7O A;  5HPI A;  2VX8 A;  4LRX C;  4EEP A;  3NOU C;  5DFX A;  3GDI A;  2JKT M;  2VV7 A;  2GNX A;  2L4R A;  3C8C A;  3T4O A;  3R7W A;  1NLZ A;  2P08 A;  4I3A A;  3E4P A;  4HI4 A;  2QJ7 A;  4LRZ E;  3K3C A;  3H9W A;  4LLO B;  2Y79 A;  3HJK A;  4NXF A;  3R7W B;  4R3A A;  1VHM A;  2PDR A;  1XFN A;  3LIA A;  2VV8 A;  3UE6 A;  4BBV A;  1D06 A;  3T4Q A;  5TBM A;  4KQO A;  1ODV A;  3F1N B;  2PYP A;  2J80 A;  4L9G A;  3EOI A;  4HY8 A;  2W27 A;  4PKY A;  5HL6 A;  1P9W A;  3S7P A;  4G3V A;  4MMN A;  1T18 A;  5TBM B;  4Y3I A;  2PHY A;  1OT9 A;  3SW1 A;  1P0Z A;  3EEH A;  2XRO A;  1DP8 A;  3NOT C;  3V67 A;  2OAQ 1;  1V9Z A;  4YOF A;  1UWP X;  4UEY A;  4YWZ A;  5G4Y A;  3TJZ C;  2OWH A;  2EWV A;  3H82 B;  1LL8 A;  3ZYT A;  3EGD C;  3KSI A;  4EES A;  3E4O A;  3KX0 X;  3LIF A;  1BYW A;  5DJU A;  4G3K A;  3CAX A;  3RH8 B;  5F69 A;  2K7S A;  1F9I A;  3BY8 A;  5DFY A;  5HWW A;  4EXO A;  4II7 A;  4OOL A;  4Y2F A;  2PYR A;  4EW7 A;  3UE3 A;  2QKP A;  3PBO A;  1YAX A;  2VEA A;  3LR4 A;  1OTA A;  1T1A A;  5DJT A;  4WEL A;  3UME A;  2J3W A;  4L9F A;  4HP4 A;  2J3T C;  4FOF A;  3VV4 A;  2VA0 A;  2WKQ A;  5AVF A;  3CI6 A;  5CX7 A;  1GSX A;  4O0P A;  3CWF A;  3CIT A;  4K08 A;  5MC7 A;  3G6O A;  1DP9 A;  3MQ0 A;  3KSF A;  1MKM A;  3K3D A;  3B33 A;  4ZRR A;  4Y5F A;  1EW0 A;  4EQ1 A;  2W0N A;  4NXG A;  2W3E A;  4NXE A;  2W1T B;  1JNU A;  3LID A;  1V9Y A;  3HCY A;  2OAP 1;  2FH5 A;  2IA2 A;  1ZTU A;  4EEU A;  3TW8 A;  2L1M A;  2R78 A;  5HD5 A;  4R6L A;  1G6O A;  4HOI A;  3PHY A;  2B02 A;  3C38 A;  1IOU A;  2GJ3 A;  3PXP A;  5IT5 A;  1STZ A;  3E0Y A;  4Q0J A;  2A24 B;  3S7Q A;  3MMH A;  5IU1 A;  1TS8 A;  1S1Z A;  3T4S A;  5AVE A;  4I39 A;  2QHK A;  4EER A;  5HSQ A;  1DRM A;  2L0W A;  3F1P A;  3UB7 A;  4AFI A;  5K5B A;  3F1O B;  2XRN A;  4R38 A;  4MN7 A;  4E04 A;  2M7V A;  4BBU A;  3U2A A;  3F1P B;  4MCW A;  3VE4 A;  2XA7 S;  3HJI A;  4B9O A;  1T1B A;  5HDS A;  1P9R A;  2O9A A;  4GLQ A;  1GSW A;  3F1N A;  2B18 A;  1OPX A;  3ZQ5 A;  3PBN A;  2DMW A;  2VJW A;  1OJG A;  3IS2 B;  3K2N A;  4JGP A;  4I3I A;  2ZOI A;  1GSV A;  5F5Y A;  2XA7 M;  3NHQ A;  4G3W A;  4KUK A;  4I3J A;  4GS9 B;  5DKL A;  3DBA A;  1H8M A;  1NRJ A;  1WA9 A;  4LRY C;  5A8B A;  5DKK A;  3LIB A;  2A2L A;  4NKP A;  4Q0I A;  3ICY A;  5IS1 A;  5HD3 A;  4JGO A;  2HV1 A;  4BBT A;  2KDK A;  2K2N A;  3PBT A;  2ZOH A;  3H82 A;  3O5Y A;  3R4K A;  3UB6 A;  3UMD A;  4GHI A;  1LSW A;  1LSX A;  4L0L A;  2O99 A;  1YSQ A;  2P04 A;  2W1R A;  5F68 A;  2PD8 A;  4GHI B;  2P7J A;  3MQQ A;  3NOP C;  5EFW A;  5J3W A;  1OTD A;  4L9E A;  5AJG A;  3MF0 A;  5HDD A;  2Z6C A;  2GX5 A;  1F98 A;  2JHE A;  3E98 A;  3MJQ A;  3T4J A;  4PKY G;  5I5L A;  1H3Q A;  4HJ4 A;  2XSS A;  2W3G A;  1OTE A;  3P01 A;  4KUO A;  3OBF A;  4YNR A;  2VV6 A;  3D72 A;  3LIC A;  1ZHH B;  4R70 A;  2CMN A;  3LI8 A;  4HP9 A;  1XJ2 A;  3CLO A;  3LI9 A;  3LR3 A;  3VOL A;  2PT7 A;  4DJ3 A;  1F5M A;  3OLO A;  3PBQ A;  5KSH A;  1XFQ A;  2W1T A;  2ZBB A;  1TD5 A;  2V1A A;  5F6A A;  5FL3 A;  4FSF A;  4WEJ A;  3CUE C;  3VE3 A;  2WKR A;  5DF9 A;  1N9N A;  3E4Q A;  2VLG A;  1TS0 A;  2JKT I;  4ETZ A;  1XJ4 A;  1N9O A;  4WF0 A;  4HHD A;  1NLY A;  4ME4 A;  4HH3 A;  1T1C A;  4GCZ A;  2FZ0 A;  3LFV A;  3A0S A;  2J3T D;  2W3F A;  3FC7 A;  4EET B;  4UQI M;  5LBR A;  2A24 A;  3CUE A;  2NUP C;  3BQA A;  1DP6 A;  1Y28 A;  2WKP A;  3RTY A;  4F3L A;  4HNB A;  1LT0 A;  3TE8 A;  2PR5 A;  1KOU A;  2EA9 A;  2H28 A;  4ARZ A;  2KLI A;  2M1C A;  3F1O A;  5J4E A;  4HIA A;  4CLC C;  4F3L B;  4OOM A;  4LPZ A;  1YSP A;  1MC0 A;  3LR0 A;  4ARZ B;  2HJ9 C;  5C5K A;  3S7N A;  2Y8H A;  3BJN A;  3IBR A;  3KSG A;  4MN6 A;  1S66 L;  3IS2 A;  4GJ4 A;  3P7N A;  3PR6 A;  4CLC A;  1W63 M;  2EWW A;  3FPV A;  2HGV A;  3BQ8 A;  4IJG A;  5L8M A;  3A0R A;  3OCL A;  2O9C A;  4GS9 A;  3JVV A;  1P97 A;  4O01 A;  4CLC B;  2JKR I;  2NUT C;  2PR6 A;  4CLC D;  4H6J A;  3NJA A;  1OTI A;  4PHT A;  3T4K A;  3MFX A;  3C30 A;  4KQD A;  4IHQ A;  4RQ9 A;  4DN0 A;  1UGU A;  4H6J B;  3FG8 A;  2QWS A;  1YKD A;  2V9A A;  3LUQ A;  1XJ6 A;  3KO6 A;  3OC2 A;  3B47 A;  3BW6 A;  4PAU A;  4WUJ A;  3KYQ A;  4I38 A;  2ZMV A;  5HWV A;  4DMZ A;  5TJJ A;  3IBJ A;  4NEE D;  1TF1 A;  4BMW A;  1S1Y A;  1IFQ A;  2D02 A;  2Z6D A;  2O9B A;  2VGL S;  4QPR A;  3A0V A;  3W2Z A;  2KOI A;  2INW A;  2HF6 A;  1OJ5 A;  2BAS A;  3PBR A;  5HPF A;  3MXQ A;  3EQV A;  1T19 A;  3KYZ A;  3PBS A;  5J7E A;  2OWJ A;  4WEK A;  2D01 A;  2VGL M;  4EU0 A;  1NWZ A;  5G4Z A;  2YKH A;  3UB9 A;  1OTB A;  4BWI A;  1G28 A;  2JKR M;  1OT6 A;  3LIE A;  1VB6 A;  2V1B A;  2ZMF A;  3D3O A;  2W3H A;  4P6Z S;  3T4L A;  4XT2 A;  3TRC A;  4HJ3 A;  3ULF A;  1X0O A;  2V0U A;  2LB5 A;  3JVU A;  1S4S A;  1UWN X;  4UQI S;  4XT2 B;  4Q0H A;  1S67 L;  4P6Z M;  5HDC A;  4BJP A;  3UB8 A;  1XJ3 A;  4HQA A;  2VZW A;  2MJ6 A;  4B93 A;  2HJE A;  5HZH A;  3B42 A;  3MQO A;  1TS7 A;  4MDZ A;  2OOL A;  2YKF A;  3BY9 A;  2V0W A;  4WL9 A;  3BWL A;  1TS6 A;  1LSV A;  4CLC E;  4CQH A;  1W63 Q;  5HWT A;  2VKS A;  1D7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...