2NUPC

Crystal structure of the human sec23a/24a heterodimer, complexed with the snare protein sec22b
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
157
structure length
137
Chain Sequence
b'MVLLTMIARVADGLPLAASMQEDDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARIMVANIEEVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein transport protein Sec23A
publication title The Transport Signal on Sec22 for Packaging into COPII-Coated Vesicles is a Conformational Epitope
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 38
structure length 137
sequence length 157
ec nomenclature
pdb deposition date 2006-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2nupC00
3EGDC 1IOUA 3KYQA 4B93A 3BW6A 1IFQA 4AFIA 2NUTC 1H8MA 3EGXC 2DMWA 2NUPC 2VX8A
chains in the Genus database with same CATH superfamily
1S0WA 5F69A 4BLMA 2ZBBA 1ESUA 3U4LP 3LIAA 1SCWA 4S2PA 2VV6A 4I3JA 4WM9A 3A0RA 5LBRA 1K54C 1CF0A 4KZAA 1T1AA 5C5KA 1S4SA 3CLOA 3BFGA 3P98A 1W8YA 4HESA 4PM6A 3FYZA 4O01A 5DTSA 3UPPA 3ZQ5A 5DFXA 4QPRA 4G3VA 1PWGA 2HF6A 3PBQA 4NK3A 2A24B 5FASA 2LB5A 2EFUA 3UE6A 2QJ5A 3A3DA 4GW9A 5EVEA 2ZL1B 4CLCC 3VP1A 2Y55A 3HVFA 1K54A 1HD8A 4S2LA 1IEMA 3V67A 4RX2A 1MBLA 1VB6A 5AVEA 3KSIA 4YNRA 3R7WA 3IXGA 1DRMA 1EWZA 2Y2IA 1CQAA 2XH9A 3ITAA 3V50A 4G3KA 3VSLA 4I38A 1GHPA 1LSXA 5F5YA 5DTKA 3MFDA 1H8ZA 2QWSA 2VKSA 2XSSA 4CLCA 1TS8A 1NYYA 3VP2A 5A92A 3W4PA 2ZQ8A 3HJKA 5D3OA 1VETB 3QP2A 4CLCE 1U60A 3KX0X 2VZWA 4FOFA 5FQIA 5I94A 3RTYA 2UV0E 4UEYA 2INWA 3HLGA 3VP4A 1N4OA 5EVIA 4JGRA 1BTLA 2CC1A 4DDSA 3T12B 4UAAA 5HAPA 3PR6A 4K08A 3BQ8A 1P9WA 5EOOA 1ACFA 4WEJA 1Q2QA 2XRNA 4NXBA 2VV8A 2WKQA 1ERMA 5FI7A 1FQGA 4X6TA 1E3UD 1H0MA 1FIKA 1RGZA 3M2KA 3RH8B 3P01A 4DMZA 2XFTA 5CECA 2O99A 3OLOA 3N7WA 2ZM0A 5DFYA 2JKGA 5CRFA 1JWZA 4WN5A 3EQVA 5TR7A 4XXRA 2XGNA 3IF6C 4H6JB 4EBNA 1TF1A 4QB8A 5EVLA 2K2NA 3NIAA 5HD3A 3LUQA 4EQIA 1MXOA 1VEUA 3WWXA 3ITBA 1O7EA 3UB7A 1T1CA 1K6RA 2WKIA 1N9OA 4KZ4A 3G35A 4MN5A 5FAPA 3S22A 2P9VA 4HJ3A 4DF6A 3NI9A 2O9BA 3TSGA 1K25A 2FFFB 4U0XA 5AQBA 1T19A 3ZNYA 2Q9NA 2HDRA 2B02A 4HEFA 5FQMA 3NHQA 3S7NA 1KDWA 5A93A 1KE0A 1G6OA 2WAFA 4HBUA 1CK3A 3ZVTA 4R23A 4DDYA 1ESIA 3IF6A 3ZVWA 2B5RA 5KSCA 1SZVA 2PYPA 4GOGA 5GL9A 4BQMA 3V3RA 3BECA 5TBMA 2WYXA 4CPKA 2Y2HA 5CERA 3ZDJA 3VP0A 5FEGA 2W3FA 3SH7A 3T1SA 3MQQA 2WZZA 4JGPA 4EETB 3DTIA 3GVBA 3ICYA 4BL2A 2XA7S 3N6IA 2HP5A 4BBTA 1BSGA 4WL9A 1BLHA 3C38A 4L9EA 3IHBA 4MCWA 5M18A 3UE3A 2VGLS 5F1GA 1SKOA 5L07A 4OQIA 4YFMA 3E4PA 1YMSA 1JTGA 4EEPA 3IQAA 2J3TC 1X0OA 2A49A 1STZA 3UN7A 1LL9A 4H8RA 4MN7A 2ZL1A 4EQ1A 5HL6A 3ZNTA 1DY6A 4E3JA 3SS4A 5DKKA 1ZG6A 4OVDA 4IVKA 2VLGA 5DVAA 2VV7A 1I5QA 4ETXA 5U47A 4CLCD 1K55A 5CTNA 3W4OA 2L4RA 3PTEA 5CGXA 4XUZA 4Q8IA 3WS5A 4OPQA 5HSQA 3HJIA 2V0UA 3LIEA 2EA9A 4P6BA 1ZTUA 3UO9A 1LL5A 3CG5A 2JE5A 1IELA 1K57C 4WZ4A 2XFSA 1JVJA 3C2WA 4EXOA 4CQHA 1XJ2A 4MN6A 4BBUA 5L10A 4X53A 1OPXA 5EVID 3E98A 1YLPA 3LR0A 3D4FA 3QHYA 2Z2MB 3NOTC 3PBOA 4R1GA 2PHYA 1H8MA 4Z9QA 3UDFA 4E3OA 2WKEA 4PM8A 2IWDA 1MPLA 1MWSA 4EEUA 1WYCA 4IUKA 1PYYA 3NECA 1GHIA 2NUTC 1W79A 4I3IA 5HWTA 2XR0A 2C6WB 4C6YA 5F68A 3TG9A 2W3HA 1K57A 4UA6A 1M6KA 5FAQA 5EOEA 5HWWA 1ERQA 3EOIA 3KSHA 3OZHA 4Y2FA 1ES2A 3UB9A 5FSRA 4NEED 1RCJA 5GLAA 3UMDA 3T4TA 2OV5A 5GLBA 1XFNA 2ZD8A 4PKYG 3BFEA 4HI4A 5FDSA 4X68A 3BQAA 3V3SA 5TJJA 3MXSA 1PI4A 2BLSA 1ES3A 5F83A 1PFLA 3Q7VB 1CEFA 1PWDA 3T1XA 3KYQA 4IVIA 3JVVA 4CLCB 4KZ8A 4P6ZS 4GD8A 1PI5A 3Q7ZA 3FC7A 4Y17A 5L09A 2NUPC 2X01A 1KDSA 3HLBA 4H6JA 2G7UA 3ZG9B 3K3CA 5DJUA 3G30A 4IEDA 2H10A 3SS5A 4LV3A 2JC7A 2VA0A 1PZOA 2V1ZA 3MKEA 3VSKA 1DP6A 5L8MA 3E2LA 3CMZA 3WRTA 2JKRM 3IX8A 1KGEA 3HLCA 3UPNA 1H5XA 4BMWA 3V39A 5AQ9A 3JVUA 3CITA 3ZG5A 2QKPA 1MKMA 3UPOA 4I39A 3NC8A 2PBDP 2L0WA 3G4PA 3HL9A 3E4QA 3K3DA 2ZC5B 4Y13A 1K38A 4HNBA 5FA7A 2ZM2A 1XJ6A 1W63M 4LGWA 1F9IA 1RP5A 1VQQA 1A0KA 4IBXA 2XDMA 3T4KA 1LLBA 3IWIA 5G4YA 4L0LA 1PWCA 4UQIS 3OOVA 5EECA 4QJGA 3HREA 1FSYA 3PAGA 4JGQA 5E2EA 3UE1A 4E3IA 2R9WA 2M7VA 4OOMA 2K31A 3EQUA 1VEUB 2GZAA 2Q0OA 1NXYA 5FQQA 4LFUA 3PBTA 2P9VB 3HUNA 5FEFA 3B42A 4BWIA 3BLMA 5TGFA 5EM1A 5DTTA 3IF6B 5GLDA 1ODVA 1VHMA 3KYEA 1S6RA 1EI5A 2WGWA 4GZBA 2W1TA 1IFQA 4ZRRA 2B18A 5TBMB 1MWTA 2I72A 3UDXA 1DP8A 4RVAA 4LCMA 2QPNA 2WK0A 3Q82A 5FQJA 3LEQA 3LIBA 3DWKA 4IHQA 3H9WA 3CUEC 4HQAA 4KQQA 3CPTA 4Y15A 1YM1A 4OONA 2PU4A 4EU0A 3DAVA 3TJZC 4OPZA 4IUHA 4R3JA 3CHWP 3W8KA 1XKZA 1UWPX 5AQ7A 1SKOB 1Z09A 3NDGA 4NXEA 4HOIA 5CHJA 3P09A 1OTDA 3GRJA 3LYXA 3Q81A 5IS1A 1BLPA 4S2IA 1CI9A 3GMWA 4EWFA 5FI2A 1IKGA 1YLZA 1N9NA 2O9AA 3O5YA 1S1YA 4KQOA 2X02A 1K56A 1LHYA 5KMWA 3CUEA 3IH8A 3A3IA 3IX4A 4RA7A 4IJGA 1J9MA 1TEMA 1XJ3A 4PM5A 5GHYA 2W1RA 3PXPA 4MLLA 1XFQA 4MEZA 1Y54A 2XA7M 2Z6DA 4C3QA 3Q7VA 1I2WA 4WMCD 1OJGA 3DW0A 2KLIA 3QP8A 2O0YA 2GNXA 1YLTA 3PBNA 2JKFA 2PR6A 1KOUA 4DXBA 1V9ZA 2V8CA 4MBKA 1V9YA 3R4KA 2W3DA 5E2HA 3SZTA 4WLAA 5GLCA 5FATA 3A3JA 2ZQ9A 2FH5A 4UHUA 2H0TA 4WZ5C 5FL3A 4F94A 3HLFA 3LO7A 2IA2A 4NETA 4K91A 3IT9A 1DJBA 1BUEA 3S4XA 1OJ5A 5KSHA 5HD5A 3W4QA 1LL8A 4YOFA 4JLFA 3G34A 4R3AA 4BENA 1SHVA 2JKRI 1TS6A 1ZC2A 3RXXA 1K4FA 2EWWA 5DF7A 4B93A 1L0FA 1MWUA 2B95A 3PHYA 4DE0A 2OLUA 2WGIA 4P85A 5EFWA 3BEBA 4LRYC 2PYRA 4R0QA 4WZ5A 4WYYA 3MZFA 5F1FA 1W63Q 2ZC6B 3C4OA 3C7VA 1F2KA 3NJAA 2JHEA 3LEZA 1ZHHB 2J8YA 4HY8A 2I9VA 5CGWA 2XQZA 2J9OA 2ZMFA 3TOIA 3OCNA 4ZJ1A 1XP4A 2FFYA 4JXSA 2IWBA 4FD8A 3S7OA 3E4OA 1WA9A 4Y3IA 3S1YA 3S7QA 4QY6A 1UGUA 2ZM8A 2EFXA 4BJPA 3MS6A 3JYIA 3IXHA 4PM7A 5HWVA 3GECA 4Q0HA 2UWXA 4Y0OA 1KGGA 2O9CA 4ZBEA 3VP3A 1NLYA 3HUOA 1W5DA 3IBRA 4X55A 1Y4OA 5HFOA 3KSGA 3EEHA 5DJTA 2W3GA 2BTFP 4ESPA 4CJNA 1JNUA 5HDDA 5DF9A 2KX6A 1ZG4A 1K56D 5CHUA 3MBZA 3MQOA 1ALQA 1PW8A 3VFFA 3B3XA 3T50A 3DTEA 5M1AA 4LRZE 1N9BA 3N8LA 5HARA 2VJWA 4Y0TA 4U0TA 1BT5A 5MC7A 4S2OA 1BLSA 3BY9A 5EV0A 2QYBA 2LB9A 1BYWA 2H28A 4BBVA 2PBYA 4NXGA 5HAIA 4A5RA 1GA9A 4P0MA 1FR1A 4JXVA 2HGVA 3EEAA 1VM1A 4MMNA 1YSQA 2WGWB 2W1TB 4M4XA 4EUVA 1KVMA 1P0ZA 5FI6A 2M1CA 3H82A 4PHTA 4Y7PA 4UQIM 1D1JA 3C5AA 4KG2A 2V0WA 4GHIB 4GN2A 3DTMA 2Y2NA 1FILA 3CPTB 3D3OA 4JF6A 3WRZA 3E2KA 2P04A 5K5BA 4KENB 3SW1A 3U2AA 1BULA 2WKHA 3MSHA 1ONHA 5FDHA 1S67L 5FAOA 2HDQA 4FH2A 5EE8A 3KSFA 4E6XA 3Q1FA 3BFFA 3QP5A 1LI9A 5G4ZA 3PAEA 3RFBA 3A3EA 3O3VA 1NJ4A 3M6BA 3TW8A 5HX9A 3FPWA 3CWFA 3M6HA 3MJQA 1CJFA 4JXWA 2XD1A 1M40A 2R78A 4DKIA 2D02A 3ZGAB 1GCEA 4KUKA 2ZOIA 1NY0A 1IYSA 4YINA 2M7UA 4MBFA 4E3NA 3T4SA 2DRWA 2ZC3B 2CMNA 3GQZA 2XK1A 4N1HA 4GLQA 5EPHA 3IS2B 2W27A 2HJEA 3PBSA 4F3LB 5AJGA 3QP6A 2PR5A 5JYOA 1JTDA 2DMWA 3FV7A 4DJ3A 1CI8A 3VFHA 1Q2PA 2ZC7A 3D9YA 1NWZA 4PKYA 4S2JA 2JN7A 2W0NA 4E3MA 1K0KA 1NRFA 4LV2A 4MNRA 3K2NA 3BYDA 3LCEA 4ETZA 3CAXA 3DWZA 1GSWA 1GSVA 1P9RA 2H5SA 1L2SA 4ZJ2A 4C75A 4Z1WA 4RQ9A 3DBAA 3MFXA 3SOIA 2WGVA 4LPZA 4KUOA 4XT2A 4ZAMA 3OBFA 1E25A 1PNEA 2Y2PA 3G6OA 3CZDA 3OPRA 4D2OA 1WYBA 1ES5A 3F1OB 2Y2JA 1FSWA 4N9KA 3UDIA 2WAEA 4JXGA 3V5MA 1E4DA 1RGYA 3LI9A 2QHKA 2ZMAA 4WF0A 1DP9A 4PAUA 4WBGA 2Z2LB 3T4OA 5FQ9A 3NULA 4ZDXA 2EWVA 3LR4A 1K4EA 1LI0A 1NLZA 3BM6A 2VEAA 5HPIA 3T1RA 2PDRA 2OAQ1 4JBFA 4OOYA 1TD5A 4S2MA 4DN0A 1FR6A 5CEBA 5IHVA 3M2JA 1IYOA 2J80A 3Q07A 3T1QB 4HH2A 3MXQA 1D7EA 4IBRA 4R3BA 1W8QA 5TFQA 1E3UA 2DNSA 3F1PB 4NKPA 3GR2A 3VOZA 4B4ZA 3I7JA 5HL1A 3FWLA 2XLNA 5E2GA 3HUMA 4HBTA 4JPMA 3N4IA 2J3TD 3IX3A 2PAVP 3ISGA 2HPBA 3BJNA 3A0SA 5KIZA 4KZ6A 1T1BA 4O0PA 1F98A 2V1BA 1NZOA 2WZXA 2VGKA 4ME4A 4OKPA 3UB6A 3PYPA 1OTBA 3HBRA 4PMAA 4QHCA 3ZG0A 1PRQA 3P7NA 1EW0A 2PRFA 4HP4A 3WS0A 3G31A 2J3WA 3T4JA 4GHIA 2BASA 4OQ0A 2ZQCA 3O88A 4DE1A 3QNBA 4KZ9A 5EM0A 3UB8A 4KQRA 5GHZA 5L2FA 4KZ5A 1S1ZA 4QU3A 4PPRA 2YKHA 4O7DA 3ZHHA 4OQGA 1IYQA 1DJAA 5IU1A 4BD1A 3MXRA 2ZJ9A 1BZAA 2W3EA 1HVBA 3FKWA 2XROA 4WUJA 3AGDA 3O86A 4R4RA 5HW3A 5EUAA 2Y91A 4X56A 2PD7A 4OLGA 4AFIA 2Y59A 3OPLA 4E3LA 2FZ0A 3GDIA 3IF5A 1F5MA 2VGJA 5IT5A 3DTKA 2HV1A 1KE3A 2WKRA 5CTMA 3A0VA 3NOUC 2RL3A 1HZOA 3BFCA 1OT6A 1ONGA 4R38A 1TDGA 3IS2A 1XXMA 1MC0A 3LGOA 2E8IA 4F3LA 3EGXC 1FCOA 3ZCZA 3H82B 3H7WB 3RXWA 3L9KA 3RJUA 4E6WA 3EWKA 4FUWA 5EVIC 3WS2A 4S2KA 2Q9MA 4N92A 3MF0A 3FZCA 3QP4A 3CJMA 3GSGA 5DF8A 2VGLM 5G18A 3VV4A 4ZJ3A 1OT9A 1JWPA 3VOLA 3VMAA 4Q0JA 4ZTKA 4DE2A 4OQHA 2Y2GA 4MBHA 2XF3A 2Y2QA 5J4EA 3BLSA 3ZG8B 5HAQA 4I5SA 3NCKA 1P97A 4EERA 2L1MA 4QWOA 4K0WA 4Q0IA 2QZ6A 1XPBA 1OTEA 4M3KA 2Y4AA 3TRCA 3N8SA 1IYPA 3VE3A 2V1AA 4OH0A 4X1MA 2ZQDA 1XJ4A 3BWLA 3ULFA 2A3UA 2OAP1 4B88A 3T4QA 2JKTM 2V9AA 1YMXA 3F1OA 5BOHA 1SDEA 1TS7A 3EGDC 4HHDA 4BD0A 3IWQA 3BRMA 1YAXA 3KO6A 1SDNA 2RCXA 3WS1A 4LCLA 3NY4A 1LT0A 5CX7A 2HP9A 2JBFA 1L0GA 4ARZA 1I2SA 4R4SA 4B9OA 1XA7A 4GS9A 3UNWA 4ID4A 4DE3A 2E8JA 1AXBA 1LSVA 3QNCA 4X1LA 1GHMA 1OTAA 1OMEA 4MDZA 3BW6A 3IXDA 1Y28A 4N1XA 4BL3A 4WEKA 4L9GA 2WADA 3F1PA 5M19A 4K0XA 2HDSA 4QD4A 1DJCA 4EUZA 2P74A 4JKTA 4HH3A 2ZQ7A 4XT2B 4NXFA 1FCMA 2VX8A 3AGEA 3D72A 3G32A 2MJ6A 3OC2A 2QJ7A 5HPFA 4HP9A 2J7VA 3OPPA 3UY6A 3KYZA 4DRTA 4Y0UA 1XGJA 5F6AA 4I3AA 1QMEA 4G3WA 4OPRA 2Y2MA 2OSUA 4FH4A 5GHXA 2J9PA 3F1NA 2HZ5A 4P6ZM 4LENA 4EV4A 4XUXA 3IWOA 4LRXC 4E04A 1H8YA 2KDKA 2DCFA 3LY4A 4LLOB 1YSPA 2GX5A 3LY3A 2V8FA 3UB5P 2D01A 2AVXA 1O07A 3MMHA 5A91A 4P87A 2A2LA 4HJ4A 1K55C 3G2YA 3IHAA 2OOLA 3O87A 1GA0A 2QMIA 3VE4A 1OTIA 4PM9A 4EBPA 2HP6A 5AQAA 3B47A 1AWIA 3IBJA 4KG5A 4GDBA 1L3LA 3IXBA 2Y79A 1JWVA 2K7SA 3SH8A 1CEGA 4GD6A 4FSFA 3LIFA 4RX3A 2A24A 3MZEA 4EW7A 1NZUA 4GJ4A 2HDUA 3IH9A 2ZQAA 1PZPA 3G2ZA 5A90A 2G2WA 1IKIA 3H7WA 1BLCA 3HLEA 2G2UA 1QMFA 3L7HA 5J8XA 5F82A 4RYEA 3HCYA 2VK3A 3CI6A 1XA1A 3FKVA 4LV1A 3UMEA 2Y2OA 3NBLA 4DXCA 1PIOA 1G68A 3FPVA 4KZ3A 4KG6A 3UE0A 2GJ3A 4R6LA 4HJ6A 4UA9A 1L0DA 5HZHA 2KOIA 2GDNA 2X71A 3C8CA 4NG2A 1MKIA 1YT4A 3B33A 2H0YA 1VETA 5DKLA 4O8GA 4II7A 1ES4A 4OLDA 3GV9A 3JPUA 1TVFA 4JF4A 4E3KA 1IOUA 1MY8A 2HJ9C 2ZOHA 2P08A 4KZ7A 2PD8A 3SS3A 3C30A 4X69A 2OWHA 2V20A 4GKUA 4U3TA 3ZFZA 3LICA 5CEDA 3R7WB 2EXBA 5J7EA 1L0EA 1G5UA 3LR3A 3VOYA 2PU2A 4WELA 4B4XA 1FCNA 3NDEA 5E43A 5JYPA 1WE4A 3QP1A 2IWCA 4GNUA 4X25A 4D60A 5KZHA 2JKTI 3A3FA 5E2FA 2Y8HA 1LSWA 1KGFA 4JGOA 4FTXA 1HTZA 1PW1A 1J3WA 1W7FA 4FCFA 4GDNA 3ZG7B 2R9XA 3T4LA 1Z6FA 3HLDA 4UA7A 1HLUP 3W2ZA 2V2FF 4S2NC 1KVLA 5CHMA 4QY5A 3HLWA 5I5LA 2ZC4B 1YLWA 3MR0A 5HDCA 4HIAA 2WUQA 4Y5FA 4GB7A 1TDLA 4R70A 3S7PA 4JF5A 1GSXA 4EESA 1S66L 1MZUA 5HDSA 3BFDA 3C7UA 5EVIB 1S4RA 1T18A 3GTCA 1YPRA 4WMCA 1YLJA 3N8RA 2EX2A 4N9LA 2YKFA 1SKFA 2XEPA 2XD5A 4GCZA 4KQDA 1NYMA 3TE8A 3C4PA 4EBLA 2ACGA 1TS0A 1MWRA 2EXAA 1YLYA 4LV0A 3FG8A 3LFVA 1G6AA 1YKDA 4S2NA 5A8BA 3LR5A 5AVFA 1NRJA 2ZMVA 4KZBA 5J3WA 3WS4A 4ARZB 1G28A 3NOPC 2EX9A 2EX6A 4OOLA 3MKFA 4GS9B 5CXWA 2C5WB 1ZKJA 1EROA 2Z6CA 3PBRA 4L9FA 3OCLA 1FOFA 1UWNX 1K6SA 3AGFA 2BG1A 3MZDA 3E0YA 3LI8A 2WKPA 4YWZA 3BY8A 1XGIA 1KE4A 2JCHA 4OP8A 2P7JA 2EX8A 4DJ2A 2ZLYA 2Y2KA 3MQ0A 1D06A 4OPYA 2OWJA 2OLVA 1H3QA 5FQKA 3LIDA 5CGSA 3SH9A 1N9LA 3F1NB 3ZYTA 2Y2LA 1XX2A 1YQSA 1C3BA 3OPHA 4OP5A 2PT7A
chains in the Genus database with same CATH topology
3KYQA 1XJ4A 3BWLA 3JVVA 5F69A 4CLCB 3ULFA 4LRZE 2ZBBA 2OAP1 4P6ZS 3T4QA 3LIAA 3FC7A 2JKTM 2NUPC 2V9AA 2VV6A 2VJWA 4H6JA 4I3JA 3F1OA 2G7UA 5MC7A 3A0RA 5LBRA 3K3CA 1TS7A 3EGDC 5DJUA 4HHDA 3BY9A 2QYBA 2VA0A 2LB9A 1BYWA 2H28A 4BBVA 1YAXA 3KO6A 4NXGA 1DP6A 1T1AA 5L8MA 5C5KA 1S4SA 3CLOA 1LT0A 5CX7A 2HGVA 3EEAA 2JKRM 4MMNA 1YSQA 2W1TB 4ARZA 4M4XA 4EUVA 1P0ZA 4BMWA 4B9OA 4O01A 2M1CA 4GS9A 3H82A 4PHTA 3ZQ5A 3JVUA 3CITA 4UQIM 5DFXA 4QPRA 2QKPA 1LSVA 4G3VA 1MKMA 2V0WA 2HF6A 3PBQA 4GHIB 1OTAA 2A24B 4MDZA 2LB5A 4I39A 3BW6A 3UE6A 2QJ5A 4GW9A 3D3OA 1Y28A 4CLCC 4WEKA 2L0WA 4L9GA 3E4QA 3F1PA 2P04A 3K3DA 5K5BA 3SW1A 3U2AA 3V67A 4HNBA 4HH3A 1XJ6A 4XT2B 1VB6A 4NXFA 5AVEA 1W63M 1F9IA 2VX8A 1S67L 3KSIA 3D72A 4YNRA 3R7WA 2MJ6A 3T4KA 3OC2A 2QJ7A 3KSFA 5HPFA 4HP9A 1DRMA 5G4ZA 3RFBA 5G4YA 4L0LA 3KYZA 4UQIS 3OOVA 3TW8A 3FPWA 4JGQA 3CWFA 4G3KA 4I3AA 5F6AA 4G3WA 4I38A 1LSXA 3MJQA 5F5YA 2R78A 3F1NA 2D02A 4KUKA 4P6ZM 2M7VA 4OOMA 2K31A 2QWSA 3EQUA 2VKSA 2ZOIA 2GZAA 2XSSA 4CLCA 1TS8A 2M7UA 4LRXC 3PBTA 3T4SA 4E04A 2KDKA 2CMNA 3HJKA 4GLQA 3IS2B 3B42A 2W27A 4CLCE 2HJEA 4LLOB 1YSPA 3PBSA 4F3LB 3KX0X 2VZWA 2GX5A 5AJGA 2PR5A 2D01A 4FOFA 4BWIA 3RTYA 4UEYA 3MMHA 2INWA 2DMWA 4DJ3A 2A2LA 4HJ4A 4JGRA 1ODVA 2OOLA 1VHMA 2W1TA 1IFQA 1NWZA 4PKYA 4ZRRA 3PR6A 4K08A 2B18A 5TBMB 3VE4A 1OTIA 2JN7A 2W0NA 3BQ8A 1P9WA 3B47A 3IBJA 1DP8A 2Y79A 2K7SA 4WEJA 3LIBA 4FSFA 2XRNA 4NXBA 3LIFA 4IHQA 2VV8A 3H9WA 2A24A 2WKQA 3K2NA 4ETZA 3CUEC 4HQAA 4EW7A 3CAXA 4GJ4A 1GSWA 1GSVA 1P9RA 4Z1WA 4RQ9A 3DBAA 3MFXA 4EU0A 3TJZC 3RH8B 3P01A 4IUHA 4DMZA 4LPZA 2O99A 4KUOA 4XT2A 3OLOA 3OBFA 5DFYA 1UWPX 3H7WA 4WN5A 3EQVA 4NXEA 3G6OA 4HOIA 3HCYA 1OTDA 3CI6A 4H6JB 3LYXA 3F1OB 3UMEA 5IS1A 1TF1A 1N9NA 2O9AA 2K2NA 3O5YA 1S1YA 4KQOA 3LI9A 3FPVA 5HD3A 2GJ3A 3LUQA 2QHKA 4WF0A 4R6LA 1DP9A 3CUEA 4HJ6A 4PAUA 3T4OA 2EWVA 3LR4A 5HZHA 3UB7A 1T1CA 2KOIA 1N9OA 4IJGA 1NLZA 3C8CA 4MN5A 2VEAA 1XJ3A 5HPIA 3B33A 2PDRA 2OAQ1 1TD5A 4HJ3A 2W1RA 4DN0A 5DKLA 4O8GA 2O9BA 3PXPA 1T19A 1XFQA 4II7A 2B02A 2XA7M 3NHQA 2Z6DA 3S7NA 2J80A 1G6OA 1IOUA 4HH2A 2HJ9C 3MXQA 1D7EA 2PYPA 2ZOHA 2P08A 1OJGA 2PD8A 3F1PB 4NKPA 3C30A 5TBMA 2KLIA 2OWHA 2O0YA 2GNXA 3LICA 2W3FA 3R7WB 3PBNA 2J3TD 2PR6A 3MQQA 5J7EA 1KOUA 1V9ZA 3LR3A 4JGPA 3BJNA 1V9YA 3R4KA 4EETB 3A0SA 2W3DA 3ICYA 5KIZA 4WELA 2XA7S 1T1BA 4O0PA 4WLAA 1F98A 2V1BA 4BBTA 4WL9A 4ME4A 3C38A 3UB6A 4L9EA 3PYPA 2FH5A 2JKTI 1OTBA 4MCWA 2Y8HA 3P7NA 1EW0A 1LSWA 2VGLS 4HP4A 5FL3A 3UE3A 2J3WA 3E4PA 3T4JA 4JGOA 4GHIA 4EEPA 2BASA 2J3TC 1X0OA 1STZA 2IA2A 3T4LA 4MN7A 3W2ZA 4EQ1A 1OJ5A 5KSHA 5HL6A 5HD5A 5I5LA 3UB8A 1LL8A 4YOFA 4R3AA 3MR0A 5HDCA 4HIAA 5DKKA 4Y5FA 2JKRI 1S1ZA 1TS6A 4R70A 3S7PA 2VLGA 2YKHA 1GSXA 2VV7A 4EESA 4ETXA 1S66L 4CLCD 1MZUA 5IU1A 2EWWA 5HDSA 2L4RA 1S4RA 1T18A 5HSQA 3HJIA 4B93A 2V0UA 2W3EA 3LIEA 2EA9A 3PHYA 1ZTUA 2YKFA 5EFWA 4LRYC 2PYRA 4GCZA 4KQDA 3TE8A 2XROA 4WUJA 3C2WA 4EXOA 4CQHA 1W63Q 1TS0A 1XJ2A 2PD7A 4AFIA 4MN6A 2FZ0A 3FG8A 3GDIA 4BBUA 3NJAA 2JHEA 1F5MA 1OPXA 1ZHHB 3LFVA 1YKDA 3E98A 5IT5A 5A8BA 2HV1A 3LR0A 3LR5A 2I9VA 4HY8A 5AVFA 2WKRA 1NRJA 3A0VA 3NOUC 2ZMVA 2ZMFA 3NOTC 3OCNA 3PBOA 1OT6A 2PHYA 5J3WA 1H8MA 4R38A 4ARZB 1G28A 3IS2A 1MC0A 3NOPC 4F3LA 3S7OA 3E4OA 3EGXC 4GS9B 4OOLA 1WA9A 3H82B 4EEUA 3H7WB 4Y3IA 4IUKA 3S7QA 2Z6CA 1UGUA 3PBRA 4L9FA 3OCLA 1UWNX 4BJPA 3EWKA 2NUTC 4I3IA 5HWTA 3E0YA 3MF0A 5F68A 5HWVA 3GECA 2VGLM 3VV4A 2W3HA 1OT9A 3VOLA 4Q0HA 3LI8A 2WKPA 5HWWA 4YWZA 3BY8A 4Q0JA 3EOIA 3KSHA 4Y2FA 2O9CA 3UB9A 1NLYA 2P7JA 3IBRA 4NEED 3UMDA 4DJ2A 5J4EA 3T4TA 4I5SA 3KSGA 3EEHA 5DJTA 1P97A 1XFNA 4EERA 2W3GA 3MQ0A 2L1MA 1D06A 4Q0IA 4PKYG 2OWJA 4HI4A 1OTEA 3BQAA 1H3QA 1JNUA 5HDDA 5DF9A 5TJJA 3TRCA 3LIDA 2KX6A 1N9LA 3F1NB 3ZYTA 3VE3A 2V1AA 3MQOA 3T50A 2PT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EGD C;  1IOU A;  3KYQ A;  4B93 A;  3BW6 A;  1IFQ A;  4AFI A;  2NUT C;  1H8M A;  3EGX C;  2DMW A;  2NUP C;  2VX8 A; 
#chains in the Genus database with same CATH topology
 1S0W A;  5F69 A;  4BLM A;  2ZBB A;  1ESU A;  3U4L P;  3LIA A;  1SCW A;  4S2P A;  2VV6 A;  4I3J A;  4WM9 A;  3A0R A;  5LBR A;  1K54 C;  1CF0 A;  4KZA A;  1T1A A;  5C5K A;  1S4S A;  3CLO A;  3BFG A;  3P98 A;  1W8Y A;  4HES A;  4PM6 A;  3FYZ A;  4O01 A;  5DTS A;  3UPP A;  3ZQ5 A;  5DFX A;  4QPR A;  4G3V A;  1PWG A;  2HF6 A;  3PBQ A;  4NK3 A;  2A24 B;  5FAS A;  2LB5 A;  2EFU A;  3UE6 A;  2QJ5 A;  3A3D A;  4GW9 A;  5EVE A;  2ZL1 B;  4CLC C;  3VP1 A;  2Y55 A;  3HVF A;  1K54 A;  1HD8 A;  4S2L A;  1IEM A;  3V67 A;  4RX2 A;  1MBL A;  1VB6 A;  5AVE A;  3KSI A;  4YNR A;  3R7W A;  3IXG A;  1DRM A;  1EWZ A;  2Y2I A;  1CQA A;  2XH9 A;  3ITA A;  3V50 A;  4G3K A;  3VSL A;  4I38 A;  1GHP A;  1LSX A;  5F5Y A;  5DTK A;  3MFD A;  1H8Z A;  2QWS A;  2VKS A;  2XSS A;  4CLC A;  1TS8 A;  1NYY A;  3VP2 A;  5A92 A;  3W4P A;  2ZQ8 A;  3HJK A;  5D3O A;  1VET B;  3QP2 A;  4CLC E;  1U60 A;  3KX0 X;  2VZW A;  4FOF A;  5FQI A;  5I94 A;  3RTY A;  2UV0 E;  4UEY A;  2INW A;  3HLG A;  3VP4 A;  1N4O A;  5EVI A;  4JGR A;  1BTL A;  2CC1 A;  4DDS A;  3T12 B;  4UAA A;  5HAP A;  3PR6 A;  4K08 A;  3BQ8 A;  1P9W A;  5EOO A;  1ACF A;  4WEJ A;  1Q2Q A;  2XRN A;  4NXB A;  2VV8 A;  2WKQ A;  1ERM A;  5FI7 A;  1FQG A;  4X6T A;  1E3U D;  1H0M A;  1FIK A;  1RGZ A;  3M2K A;  3RH8 B;  3P01 A;  4DMZ A;  2XFT A;  5CEC A;  2O99 A;  3OLO A;  3N7W A;  2ZM0 A;  5DFY A;  2JKG A;  5CRF A;  1JWZ A;  4WN5 A;  3EQV A;  5TR7 A;  4XXR A;  2XGN A;  3IF6 C;  4H6J B;  4EBN A;  1TF1 A;  4QB8 A;  5EVL A;  2K2N A;  3NIA A;  5HD3 A;  3LUQ A;  4EQI A;  1MXO A;  1VEU A;  3WWX A;  3ITB A;  1O7E A;  3UB7 A;  1T1C A;  1K6R A;  2WKI A;  1N9O A;  4KZ4 A;  3G35 A;  4MN5 A;  5FAP A;  3S22 A;  2P9V A;  4HJ3 A;  4DF6 A;  3NI9 A;  2O9B A;  3TSG A;  1K25 A;  2FFF B;  4U0X A;  5AQB A;  1T19 A;  3ZNY A;  2Q9N A;  2HDR A;  2B02 A;  4HEF A;  5FQM A;  3NHQ A;  3S7N A;  1KDW A;  5A93 A;  1KE0 A;  1G6O A;  2WAF A;  4HBU A;  1CK3 A;  3ZVT A;  4R23 A;  4DDY A;  1ESI A;  3IF6 A;  3ZVW A;  2B5R A;  5KSC A;  1SZV A;  2PYP A;  4GOG A;  5GL9 A;  4BQM A;  3V3R A;  3BEC A;  5TBM A;  2WYX A;  4CPK A;  2Y2H A;  5CER A;  3ZDJ A;  3VP0 A;  5FEG A;  2W3F A;  3SH7 A;  3T1S A;  3MQQ A;  2WZZ A;  4JGP A;  4EET B;  3DTI A;  3GVB A;  3ICY A;  4BL2 A;  2XA7 S;  3N6I A;  2HP5 A;  4BBT A;  1BSG A;  4WL9 A;  1BLH A;  3C38 A;  4L9E A;  3IHB A;  4MCW A;  5M18 A;  3UE3 A;  2VGL S;  5F1G A;  1SKO A;  5L07 A;  4OQI A;  4YFM A;  3E4P A;  1YMS A;  1JTG A;  4EEP A;  3IQA A;  2J3T C;  1X0O A;  2A49 A;  1STZ A;  3UN7 A;  1LL9 A;  4H8R A;  4MN7 A;  2ZL1 A;  4EQ1 A;  5HL6 A;  3ZNT A;  1DY6 A;  4E3J A;  3SS4 A;  5DKK A;  1ZG6 A;  4OVD A;  4IVK A;  2VLG A;  5DVA A;  2VV7 A;  1I5Q A;  4ETX A;  5U47 A;  4CLC D;  1K55 A;  5CTN A;  3W4O A;  2L4R A;  3PTE A;  5CGX A;  4XUZ A;  4Q8I A;  3WS5 A;  4OPQ A;  5HSQ A;  3HJI A;  2V0U A;  3LIE A;  2EA9 A;  4P6B A;  1ZTU A;  3UO9 A;  1LL5 A;  3CG5 A;  2JE5 A;  1IEL A;  1K57 C;  4WZ4 A;  2XFS A;  1JVJ A;  3C2W A;  4EXO A;  4CQH A;  1XJ2 A;  4MN6 A;  4BBU A;  5L10 A;  4X53 A;  1OPX A;  5EVI D;  3E98 A;  1YLP A;  3LR0 A;  3D4F A;  3QHY A;  2Z2M B;  3NOT C;  3PBO A;  4R1G A;  2PHY A;  1H8M A;  4Z9Q A;  3UDF A;  4E3O A;  2WKE A;  4PM8 A;  2IWD A;  1MPL A;  1MWS A;  4EEU A;  1WYC A;  4IUK A;  1PYY A;  3NEC A;  1GHI A;  2NUT C;  1W79 A;  4I3I A;  5HWT A;  2XR0 A;  2C6W B;  4C6Y A;  5F68 A;  3TG9 A;  2W3H A;  1K57 A;  4UA6 A;  1M6K A;  5FAQ A;  5EOE A;  5HWW A;  1ERQ A;  3EOI A;  3KSH A;  3OZH A;  4Y2F A;  1ES2 A;  3UB9 A;  5FSR A;  4NEE D;  1RCJ A;  5GLA A;  3UMD A;  3T4T A;  2OV5 A;  5GLB A;  1XFN A;  2ZD8 A;  4PKY G;  3BFE A;  4HI4 A;  5FDS A;  4X68 A;  3BQA A;  3V3S A;  5TJJ A;  3MXS A;  1PI4 A;  2BLS A;  1ES3 A;  5F83 A;  1PFL A;  3Q7V B;  1CEF A;  1PWD A;  3T1X A;  3KYQ A;  4IVI A;  3JVV A;  4CLC B;  4KZ8 A;  4P6Z S;  4GD8 A;  1PI5 A;  3Q7Z A;  3FC7 A;  4Y17 A;  5L09 A;  2NUP C;  2X01 A;  1KDS A;  3HLB A;  4H6J A;  2G7U A;  3ZG9 B;  3K3C A;  5DJU A;  3G30 A;  4IED A;  2H10 A;  3SS5 A;  4LV3 A;  2JC7 A;  2VA0 A;  1PZO A;  2V1Z A;  3MKE A;  3VSK A;  1DP6 A;  5L8M A;  3E2L A;  3CMZ A;  3WRT A;  2JKR M;  3IX8 A;  1KGE A;  3HLC A;  3UPN A;  1H5X A;  4BMW A;  3V39 A;  5AQ9 A;  3JVU A;  3CIT A;  3ZG5 A;  2QKP A;  1MKM A;  3UPO A;  4I39 A;  3NC8 A;  2PBD P;  2L0W A;  3G4P A;  3HL9 A;  3E4Q A;  3K3D A;  2ZC5 B;  4Y13 A;  1K38 A;  4HNB A;  5FA7 A;  2ZM2 A;  1XJ6 A;  1W63 M;  4LGW A;  1F9I A;  1RP5 A;  1VQQ A;  1A0K A;  4IBX A;  2XDM A;  3T4K A;  1LLB A;  3IWI A;  5G4Y A;  4L0L A;  1PWC A;  4UQI S;  3OOV A;  5EEC A;  4QJG A;  3HRE A;  1FSY A;  3PAG A;  4JGQ A;  5E2E A;  3UE1 A;  4E3I A;  2R9W A;  2M7V A;  4OOM A;  2K31 A;  3EQU A;  1VEU B;  2GZA A;  2Q0O A;  1NXY A;  5FQQ A;  4LFU A;  3PBT A;  2P9V B;  3HUN A;  5FEF A;  3B42 A;  4BWI A;  3BLM A;  5TGF A;  5EM1 A;  5DTT A;  3IF6 B;  5GLD A;  1ODV A;  1VHM A;  3KYE A;  1S6R A;  1EI5 A;  2WGW A;  4GZB A;  2W1T A;  1IFQ A;  4ZRR A;  2B18 A;  5TBM B;  1MWT A;  2I72 A;  3UDX A;  1DP8 A;  4RVA A;  4LCM A;  2QPN A;  2WK0 A;  3Q82 A;  5FQJ A;  3LEQ A;  3LIB A;  3DWK A;  4IHQ A;  3H9W A;  3CUE C;  4HQA A;  4KQQ A;  3CPT A;  4Y15 A;  1YM1 A;  4OON A;  2PU4 A;  4EU0 A;  3DAV A;  3TJZ C;  4OPZ A;  4IUH A;  4R3J A;  3CHW P;  3W8K A;  1XKZ A;  1UWP X;  5AQ7 A;  1SKO B;  1Z09 A;  3NDG A;  4NXE A;  4HOI A;  5CHJ A;  3P09 A;  1OTD A;  3GRJ A;  3LYX A;  3Q81 A;  5IS1 A;  1BLP A;  4S2I A;  1CI9 A;  3GMW A;  4EWF A;  5FI2 A;  1IKG A;  1YLZ A;  1N9N A;  2O9A A;  3O5Y A;  1S1Y A;  4KQO A;  2X02 A;  1K56 A;  1LHY A;  5KMW A;  3CUE A;  3IH8 A;  3A3I A;  3IX4 A;  4RA7 A;  4IJG A;  1J9M A;  1TEM A;  1XJ3 A;  4PM5 A;  5GHY A;  2W1R A;  3PXP A;  4MLL A;  1XFQ A;  4MEZ A;  1Y54 A;  2XA7 M;  2Z6D A;  4C3Q A;  3Q7V A;  1I2W A;  4WMC D;  1OJG A;  3DW0 A;  2KLI A;  3QP8 A;  2O0Y A;  2GNX A;  1YLT A;  3PBN A;  2JKF A;  2PR6 A;  1KOU A;  4DXB A;  1V9Z A;  2V8C A;  4MBK A;  1V9Y A;  3R4K A;  2W3D A;  5E2H A;  3SZT A;  4WLA A;  5GLC A;  5FAT A;  3A3J A;  2ZQ9 A;  2FH5 A;  4UHU A;  2H0T A;  4WZ5 C;  5FL3 A;  4F94 A;  3HLF A;  3LO7 A;  2IA2 A;  4NET A;  4K91 A;  3IT9 A;  1DJB A;  1BUE A;  3S4X A;  1OJ5 A;  5KSH A;  5HD5 A;  3W4Q A;  1LL8 A;  4YOF A;  4JLF A;  3G34 A;  4R3A A;  4BEN A;  1SHV A;  2JKR I;  1TS6 A;  1ZC2 A;  3RXX A;  1K4F A;  2EWW A;  5DF7 A;  4B93 A;  1L0F A;  1MWU A;  2B95 A;  3PHY A;  4DE0 A;  2OLU A;  2WGI A;  4P85 A;  5EFW A;  3BEB A;  4LRY C;  2PYR A;  4R0Q A;  4WZ5 A;  4WYY A;  3MZF A;  5F1F A;  1W63 Q;  2ZC6 B;  3C4O A;  3C7V A;  1F2K A;  3NJA A;  2JHE A;  3LEZ A;  1ZHH B;  2J8Y A;  4HY8 A;  2I9V A;  5CGW A;  2XQZ A;  2J9O A;  2ZMF A;  3TOI A;  3OCN A;  4ZJ1 A;  1XP4 A;  2FFY A;  4JXS A;  2IWB A;  4FD8 A;  3S7O A;  3E4O A;  1WA9 A;  4Y3I A;  3S1Y A;  3S7Q A;  4QY6 A;  1UGU A;  2ZM8 A;  2EFX A;  4BJP A;  3MS6 A;  3JYI A;  3IXH A;  4PM7 A;  5HWV A;  3GEC A;  4Q0H A;  2UWX A;  4Y0O A;  1KGG A;  2O9C A;  4ZBE A;  3VP3 A;  1NLY A;  3HUO A;  1W5D A;  3IBR A;  4X55 A;  1Y4O A;  5HFO A;  3KSG A;  3EEH A;  5DJT A;  2W3G A;  2BTF P;  4ESP A;  4CJN A;  1JNU A;  5HDD A;  5DF9 A;  2KX6 A;  1ZG4 A;  1K56 D;  5CHU A;  3MBZ A;  3MQO A;  1ALQ A;  1PW8 A;  3VFF A;  3B3X A;  3T50 A;  3DTE A;  5M1A A;  4LRZ E;  1N9B A;  3N8L A;  5HAR A;  2VJW A;  4Y0T A;  4U0T A;  1BT5 A;  5MC7 A;  4S2O A;  1BLS A;  3BY9 A;  5EV0 A;  2QYB A;  2LB9 A;  1BYW A;  2H28 A;  4BBV A;  2PBY A;  4NXG A;  5HAI A;  4A5R A;  1GA9 A;  4P0M A;  1FR1 A;  4JXV A;  2HGV A;  3EEA A;  1VM1 A;  4MMN A;  1YSQ A;  2WGW B;  2W1T B;  4M4X A;  4EUV A;  1KVM A;  1P0Z A;  5FI6 A;  2M1C A;  3H82 A;  4PHT A;  4Y7P A;  4UQI M;  1D1J A;  3C5A A;  4KG2 A;  2V0W A;  4GHI B;  4GN2 A;  3DTM A;  2Y2N A;  1FIL A;  3CPT B;  3D3O A;  4JF6 A;  3WRZ A;  3E2K A;  2P04 A;  5K5B A;  4KEN B;  3SW1 A;  3U2A A;  1BUL A;  2WKH A;  3MSH A;  1ONH A;  5FDH A;  1S67 L;  5FAO A;  2HDQ A;  4FH2 A;  5EE8 A;  3KSF A;  4E6X A;  3Q1F A;  3BFF A;  3QP5 A;  1LI9 A;  5G4Z A;  3PAE A;  3RFB A;  3A3E A;  3O3V A;  1NJ4 A;  3M6B A;  3TW8 A;  5HX9 A;  3FPW A;  3CWF A;  3M6H A;  3MJQ A;  1CJF A;  4JXW A;  2XD1 A;  1M40 A;  2R78 A;  4DKI A;  2D02 A;  3ZGA B;  1GCE A;  4KUK A;  2ZOI A;  1NY0 A;  1IYS A;  4YIN A;  2M7U A;  4MBF A;  4E3N A;  3T4S A;  2DRW A;  2ZC3 B;  2CMN A;  3GQZ A;  2XK1 A;  4N1H A;  4GLQ A;  5EPH A;  3IS2 B;  2W27 A;  2HJE A;  3PBS A;  4F3L B;  5AJG A;  3QP6 A;  2PR5 A;  5JYO A;  1JTD A;  2DMW A;  3FV7 A;  4DJ3 A;  1CI8 A;  3VFH A;  1Q2P A;  2ZC7 A;  3D9Y A;  1NWZ A;  4PKY A;  4S2J A;  2JN7 A;  2W0N A;  4E3M A;  1K0K A;  1NRF A;  4LV2 A;  4MNR A;  3K2N A;  3BYD A;  3LCE A;  4ETZ A;  3CAX A;  3DWZ A;  1GSW A;  1GSV A;  1P9R A;  2H5S A;  1L2S A;  4ZJ2 A;  4C75 A;  4Z1W A;  4RQ9 A;  3DBA A;  3MFX A;  3SOI A;  2WGV A;  4LPZ A;  4KUO A;  4XT2 A;  4ZAM A;  3OBF A;  1E25 A;  1PNE A;  2Y2P A;  3G6O A;  3CZD A;  3OPR A;  4D2O A;  1WYB A;  1ES5 A;  3F1O B;  2Y2J A;  1FSW A;  4N9K A;  3UDI A;  2WAE A;  4JXG A;  3V5M A;  1E4D A;  1RGY A;  3LI9 A;  2QHK A;  2ZMA A;  4WF0 A;  1DP9 A;  4PAU A;  4WBG A;  2Z2L B;  3T4O A;  5FQ9 A;  3NUL A;  4ZDX A;  2EWV A;  3LR4 A;  1K4E A;  1LI0 A;  1NLZ A;  3BM6 A;  2VEA A;  5HPI A;  3T1R A;  2PDR A;  2OAQ 1;  4JBF A;  4OOY A;  1TD5 A;  4S2M A;  4DN0 A;  1FR6 A;  5CEB A;  5IHV A;  3M2J A;  1IYO A;  2J80 A;  3Q07 A;  3T1Q B;  4HH2 A;  3MXQ A;  1D7E A;  4IBR A;  4R3B A;  1W8Q A;  5TFQ A;  1E3U A;  2DNS A;  3F1P B;  4NKP A;  3GR2 A;  3VOZ A;  4B4Z A;  3I7J A;  5HL1 A;  3FWL A;  2XLN A;  5E2G A;  3HUM A;  4HBT A;  4JPM A;  3N4I A;  2J3T D;  3IX3 A;  2PAV P;  3ISG A;  2HPB A;  3BJN A;  3A0S A;  5KIZ A;  4KZ6 A;  1T1B A;  4O0P A;  1F98 A;  2V1B A;  1NZO A;  2WZX A;  2VGK A;  4ME4 A;  4OKP A;  3UB6 A;  3PYP A;  1OTB A;  3HBR A;  4PMA A;  4QHC A;  3ZG0 A;  1PRQ A;  3P7N A;  1EW0 A;  2PRF A;  4HP4 A;  3WS0 A;  3G31 A;  2J3W A;  3T4J A;  4GHI A;  2BAS A;  4OQ0 A;  2ZQC A;  3O88 A;  4DE1 A;  3QNB A;  4KZ9 A;  5EM0 A;  3UB8 A;  4KQR A;  5GHZ A;  5L2F A;  4KZ5 A;  1S1Z A;  4QU3 A;  4PPR A;  2YKH A;  4O7D A;  3ZHH A;  4OQG A;  1IYQ A;  1DJA A;  5IU1 A;  4BD1 A;  3MXR A;  2ZJ9 A;  1BZA A;  2W3E A;  1HVB A;  3FKW A;  2XRO A;  4WUJ A;  3AGD A;  3O86 A;  4R4R A;  5HW3 A;  5EUA A;  2Y91 A;  4X56 A;  2PD7 A;  4OLG A;  4AFI A;  2Y59 A;  3OPL A;  4E3L A;  2FZ0 A;  3GDI A;  3IF5 A;  1F5M A;  2VGJ A;  5IT5 A;  3DTK A;  2HV1 A;  1KE3 A;  2WKR A;  5CTM A;  3A0V A;  3NOU C;  2RL3 A;  1HZO A;  3BFC A;  1OT6 A;  1ONG A;  4R38 A;  1TDG A;  3IS2 A;  1XXM A;  1MC0 A;  3LGO A;  2E8I A;  4F3L A;  3EGX C;  1FCO A;  3ZCZ A;  3H82 B;  3H7W B;  3RXW A;  3L9K A;  3RJU A;  4E6W A;  3EWK A;  4FUW A;  5EVI C;  3WS2 A;  4S2K A;  2Q9M A;  4N92 A;  3MF0 A;  3FZC A;  3QP4 A;  3CJM A;  3GSG A;  5DF8 A;  2VGL M;  5G18 A;  3VV4 A;  4ZJ3 A;  1OT9 A;  1JWP A;  3VOL A;  3VMA A;  4Q0J A;  4ZTK A;  4DE2 A;  4OQH A;  2Y2G A;  4MBH A;  2XF3 A;  2Y2Q A;  5J4E A;  3BLS A;  3ZG8 B;  5HAQ A;  4I5S A;  3NCK A;  1P97 A;  4EER A;  2L1M A;  4QWO A;  4K0W A;  4Q0I A;  2QZ6 A;  1XPB A;  1OTE A;  4M3K A;  2Y4A A;  3TRC A;  3N8S A;  1IYP A;  3VE3 A;  2V1A A;  4OH0 A;  4X1M A;  2ZQD A;  1XJ4 A;  3BWL A;  3ULF A;  2A3U A;  2OAP 1;  4B88 A;  3T4Q A;  2JKT M;  2V9A A;  1YMX A;  3F1O A;  5BOH A;  1SDE A;  1TS7 A;  3EGD C;  4HHD A;  4BD0 A;  3IWQ A;  3BRM A;  1YAX A;  3KO6 A;  1SDN A;  2RCX A;  3WS1 A;  4LCL A;  3NY4 A;  1LT0 A;  5CX7 A;  2HP9 A;  2JBF A;  1L0G A;  4ARZ A;  1I2S A;  4R4S A;  4B9O A;  1XA7 A;  4GS9 A;  3UNW A;  4ID4 A;  4DE3 A;  2E8J A;  1AXB A;  1LSV A;  3QNC A;  4X1L A;  1GHM A;  1OTA A;  1OME A;  4MDZ A;  3BW6 A;  3IXD A;  1Y28 A;  4N1X A;  4BL3 A;  4WEK A;  4L9G A;  2WAD A;  3F1P A;  5M19 A;  4K0X A;  2HDS A;  4QD4 A;  1DJC A;  4EUZ A;  2P74 A;  4JKT A;  4HH3 A;  2ZQ7 A;  4XT2 B;  4NXF A;  1FCM A;  2VX8 A;  3AGE A;  3D72 A;  3G32 A;  2MJ6 A;  3OC2 A;  2QJ7 A;  5HPF A;  4HP9 A;  2J7V A;  3OPP A;  3UY6 A;  3KYZ A;  4DRT A;  4Y0U A;  1XGJ A;  5F6A A;  4I3A A;  1QME A;  4G3W A;  4OPR A;  2Y2M A;  2OSU A;  4FH4 A;  5GHX A;  2J9P A;  3F1N A;  2HZ5 A;  4P6Z M;  4LEN A;  4EV4 A;  4XUX A;  3IWO A;  4LRX C;  4E04 A;  1H8Y A;  2KDK A;  2DCF A;  3LY4 A;  4LLO B;  1YSP A;  2GX5 A;  3LY3 A;  2V8F A;  3UB5 P;  2D01 A;  2AVX A;  1O07 A;  3MMH A;  5A91 A;  4P87 A;  2A2L A;  4HJ4 A;  1K55 C;  3G2Y A;  3IHA A;  2OOL A;  3O87 A;  1GA0 A;  2QMI A;  3VE4 A;  1OTI A;  4PM9 A;  4EBP A;  2HP6 A;  5AQA A;  3B47 A;  1AWI A;  3IBJ A;  4KG5 A;  4GDB A;  1L3L A;  3IXB A;  2Y79 A;  1JWV A;  2K7S A;  3SH8 A;  1CEG A;  4GD6 A;  4FSF A;  3LIF A;  4RX3 A;  2A24 A;  3MZE A;  4EW7 A;  1NZU A;  4GJ4 A;  2HDU A;  3IH9 A;  2ZQA A;  1PZP A;  3G2Z A;  5A90 A;  2G2W A;  1IKI A;  3H7W A;  1BLC A;  3HLE A;  2G2U A;  1QMF A;  3L7H A;  5J8X A;  5F82 A;  4RYE A;  3HCY A;  2VK3 A;  3CI6 A;  1XA1 A;  3FKV A;  4LV1 A;  3UME A;  2Y2O A;  3NBL A;  4DXC A;  1PIO A;  1G68 A;  3FPV A;  4KZ3 A;  4KG6 A;  3UE0 A;  2GJ3 A;  4R6L A;  4HJ6 A;  4UA9 A;  1L0D A;  5HZH A;  2KOI A;  2GDN A;  2X71 A;  3C8C A;  4NG2 A;  1MKI A;  1YT4 A;  3B33 A;  2H0Y A;  1VET A;  5DKL A;  4O8G A;  4II7 A;  1ES4 A;  4OLD A;  3GV9 A;  3JPU A;  1TVF A;  4JF4 A;  4E3K A;  1IOU A;  1MY8 A;  2HJ9 C;  2ZOH A;  2P08 A;  4KZ7 A;  2PD8 A;  3SS3 A;  3C30 A;  4X69 A;  2OWH A;  2V20 A;  4GKU A;  4U3T A;  3ZFZ A;  3LIC A;  5CED A;  3R7W B;  2EXB A;  5J7E A;  1L0E A;  1G5U A;  3LR3 A;  3VOY A;  2PU2 A;  4WEL A;  4B4X A;  1FCN A;  3NDE A;  5E43 A;  5JYP A;  1WE4 A;  3QP1 A;  2IWC A;  4GNU A;  4X25 A;  4D60 A;  5KZH A;  2JKT I;  3A3F A;  5E2F A;  2Y8H A;  1LSW A;  1KGF A;  4JGO A;  4FTX A;  1HTZ A;  1PW1 A;  1J3W A;  1W7F A;  4FCF A;  4GDN A;  3ZG7 B;  2R9X A;  3T4L A;  1Z6F A;  3HLD A;  4UA7 A;  1HLU P;  3W2Z A;  2V2F F;  4S2N C;  1KVL A;  5CHM A;  4QY5 A;  3HLW A;  5I5L A;  2ZC4 B;  1YLW A;  3MR0 A;  5HDC A;  4HIA A;  2WUQ A;  4Y5F A;  4GB7 A;  1TDL A;  4R70 A;  3S7P A;  4JF5 A;  1GSX A;  4EES A;  1S66 L;  1MZU A;  5HDS A;  3BFD A;  3C7U A;  5EVI B;  1S4R A;  1T18 A;  3GTC A;  1YPR A;  4WMC A;  1YLJ A;  3N8R A;  2EX2 A;  4N9L A;  2YKF A;  1SKF A;  2XEP A;  2XD5 A;  4GCZ A;  4KQD A;  1NYM A;  3TE8 A;  3C4P A;  4EBL A;  2ACG A;  1TS0 A;  1MWR A;  2EXA A;  1YLY A;  4LV0 A;  3FG8 A;  3LFV A;  1G6A A;  1YKD A;  4S2N A;  5A8B A;  3LR5 A;  5AVF A;  1NRJ A;  2ZMV A;  4KZB A;  5J3W A;  3WS4 A;  4ARZ B;  1G28 A;  3NOP C;  2EX9 A;  2EX6 A;  4OOL A;  3MKF A;  4GS9 B;  5CXW A;  2C5W B;  1ZKJ A;  1ERO A;  2Z6C A;  3PBR A;  4L9F A;  3OCL A;  1FOF A;  1UWN X;  1K6S A;  3AGF A;  2BG1 A;  3MZD A;  3E0Y A;  3LI8 A;  2WKP A;  4YWZ A;  3BY8 A;  1XGI A;  1KE4 A;  2JCH A;  4OP8 A;  2P7J A;  2EX8 A;  4DJ2 A;  2ZLY A;  2Y2K A;  3MQ0 A;  1D06 A;  4OPY A;  2OWJ A;  2OLV A;  1H3Q A;  5FQK A;  3LID A;  5CGS A;  3SH9 A;  1N9L A;  3F1N B;  3ZYT A;  2Y2L A;  1XX2 A;  1YQS A;  1C3B A;  3OPH A;  4OP5 A;  2PT7 A; 
#chains in the Genus database with same CATH homology
 3KYQ A;  1XJ4 A;  3BWL A;  3JVV A;  5F69 A;  4CLC B;  3ULF A;  4LRZ E;  2ZBB A;  2OAP 1;  4P6Z S;  3T4Q A;  3LIA A;  3FC7 A;  2JKT M;  2NUP C;  2V9A A;  2VV6 A;  2VJW A;  4H6J A;  4I3J A;  3F1O A;  2G7U A;  5MC7 A;  3A0R A;  5LBR A;  3K3C A;  1TS7 A;  3EGD C;  5DJU A;  4HHD A;  3BY9 A;  2QYB A;  2VA0 A;  2LB9 A;  1BYW A;  2H28 A;  4BBV A;  1YAX A;  3KO6 A;  4NXG A;  1DP6 A;  1T1A A;  5L8M A;  5C5K A;  1S4S A;  3CLO A;  1LT0 A;  5CX7 A;  2HGV A;  3EEA A;  2JKR M;  4MMN A;  1YSQ A;  2W1T B;  4ARZ A;  4M4X A;  4EUV A;  1P0Z A;  4BMW A;  4B9O A;  4O01 A;  2M1C A;  4GS9 A;  3H82 A;  4PHT A;  3ZQ5 A;  3JVU A;  3CIT A;  4UQI M;  5DFX A;  4QPR A;  2QKP A;  1LSV A;  4G3V A;  1MKM A;  2V0W A;  2HF6 A;  3PBQ A;  4GHI B;  1OTA A;  2A24 B;  4MDZ A;  2LB5 A;  4I39 A;  3BW6 A;  3UE6 A;  2QJ5 A;  4GW9 A;  3D3O A;  1Y28 A;  4CLC C;  4WEK A;  2L0W A;  4L9G A;  3E4Q A;  3F1P A;  2P04 A;  3K3D A;  5K5B A;  3SW1 A;  3U2A A;  3V67 A;  4HNB A;  4HH3 A;  1XJ6 A;  4XT2 B;  1VB6 A;  4NXF A;  5AVE A;  1W63 M;  1F9I A;  2VX8 A;  1S67 L;  3KSI A;  3D72 A;  4YNR A;  3R7W A;  2MJ6 A;  3T4K A;  3OC2 A;  2QJ7 A;  3KSF A;  5HPF A;  4HP9 A;  1DRM A;  5G4Z A;  3RFB A;  5G4Y A;  4L0L A;  3KYZ A;  4UQI S;  3OOV A;  3TW8 A;  3FPW A;  4JGQ A;  3CWF A;  4G3K A;  4I3A A;  5F6A A;  4G3W A;  4I38 A;  1LSX A;  3MJQ A;  5F5Y A;  2R78 A;  3F1N A;  2D02 A;  4KUK A;  4P6Z M;  2M7V A;  4OOM A;  2K31 A;  2QWS A;  3EQU A;  2VKS A;  2ZOI A;  2GZA A;  2XSS A;  4CLC A;  1TS8 A;  2M7U A;  4LRX C;  3PBT A;  3T4S A;  4E04 A;  2KDK A;  2CMN A;  3HJK A;  4GLQ A;  3IS2 B;  3B42 A;  2W27 A;  4CLC E;  2HJE A;  4LLO B;  1YSP A;  3PBS A;  4F3L B;  3KX0 X;  2VZW A;  2GX5 A;  5AJG A;  2PR5 A;  2D01 A;  4FOF A;  4BWI A;  3RTY A;  4UEY A;  3MMH A;  2INW A;  2DMW A;  4DJ3 A;  2A2L A;  4HJ4 A;  4JGR A;  1ODV A;  2OOL A;  1VHM A;  2W1T A;  1IFQ A;  1NWZ A;  4PKY A;  4ZRR A;  3PR6 A;  4K08 A;  2B18 A;  5TBM B;  3VE4 A;  1OTI A;  2JN7 A;  2W0N A;  3BQ8 A;  1P9W A;  3B47 A;  3IBJ A;  1DP8 A;  2Y79 A;  2K7S A;  4WEJ A;  3LIB A;  4FSF A;  2XRN A;  4NXB A;  3LIF A;  4IHQ A;  2VV8 A;  3H9W A;  2A24 A;  2WKQ A;  3K2N A;  4ETZ A;  3CUE C;  4HQA A;  4EW7 A;  3CAX A;  4GJ4 A;  1GSW A;  1GSV A;  1P9R A;  4Z1W A;  4RQ9 A;  3DBA A;  3MFX A;  4EU0 A;  3TJZ C;  3RH8 B;  3P01 A;  4IUH A;  4DMZ A;  4LPZ A;  2O99 A;  4KUO A;  4XT2 A;  3OLO A;  3OBF A;  5DFY A;  1UWP X;  3H7W A;  4WN5 A;  3EQV A;  4NXE A;  3G6O A;  4HOI A;  3HCY A;  1OTD A;  3CI6 A;  4H6J B;  3LYX A;  3F1O B;  3UME A;  5IS1 A;  1TF1 A;  1N9N A;  2O9A A;  2K2N A;  3O5Y A;  1S1Y A;  4KQO A;  3LI9 A;  3FPV A;  5HD3 A;  2GJ3 A;  3LUQ A;  2QHK A;  4WF0 A;  4R6L A;  1DP9 A;  3CUE A;  4HJ6 A;  4PAU A;  3T4O A;  2EWV A;  3LR4 A;  5HZH A;  3UB7 A;  1T1C A;  2KOI A;  1N9O A;  4IJG A;  1NLZ A;  3C8C A;  4MN5 A;  2VEA A;  1XJ3 A;  5HPI A;  3B33 A;  2PDR A;  2OAQ 1;  1TD5 A;  4HJ3 A;  2W1R A;  4DN0 A;  5DKL A;  4O8G A;  2O9B A;  3PXP A;  1T19 A;  1XFQ A;  4II7 A;  2B02 A;  2XA7 M;  3NHQ A;  2Z6D A;  3S7N A;  2J80 A;  1G6O A;  1IOU A;  4HH2 A;  2HJ9 C;  3MXQ A;  1D7E A;  2PYP A;  2ZOH A;  2P08 A;  1OJG A;  2PD8 A;  3F1P B;  4NKP A;  3C30 A;  5TBM A;  2KLI A;  2OWH A;  2O0Y A;  2GNX A;  3LIC A;  2W3F A;  3R7W B;  3PBN A;  2J3T D;  2PR6 A;  3MQQ A;  5J7E A;  1KOU A;  1V9Z A;  3LR3 A;  4JGP A;  3BJN A;  1V9Y A;  3R4K A;  4EET B;  3A0S A;  2W3D A;  3ICY A;  5KIZ A;  4WEL A;  2XA7 S;  1T1B A;  4O0P A;  4WLA A;  1F98 A;  2V1B A;  4BBT A;  4WL9 A;  4ME4 A;  3C38 A;  3UB6 A;  4L9E A;  3PYP A;  2FH5 A;  2JKT I;  1OTB A;  4MCW A;  2Y8H A;  3P7N A;  1EW0 A;  1LSW A;  2VGL S;  4HP4 A;  5FL3 A;  3UE3 A;  2J3W A;  3E4P A;  3T4J A;  4JGO A;  4GHI A;  4EEP A;  2BAS A;  2J3T C;  1X0O A;  1STZ A;  2IA2 A;  3T4L A;  4MN7 A;  3W2Z A;  4EQ1 A;  1OJ5 A;  5KSH A;  5HL6 A;  5HD5 A;  5I5L A;  3UB8 A;  1LL8 A;  4YOF A;  4R3A A;  3MR0 A;  5HDC A;  4HIA A;  5DKK A;  4Y5F A;  2JKR I;  1S1Z A;  1TS6 A;  4R70 A;  3S7P A;  2VLG A;  2YKH A;  1GSX A;  2VV7 A;  4EES A;  4ETX A;  1S66 L;  4CLC D;  1MZU A;  5IU1 A;  2EWW A;  5HDS A;  2L4R A;  1S4R A;  1T18 A;  5HSQ A;  3HJI A;  4B93 A;  2V0U A;  2W3E A;  3LIE A;  2EA9 A;  3PHY A;  1ZTU A;  2YKF A;  5EFW A;  4LRY C;  2PYR A;  4GCZ A;  4KQD A;  3TE8 A;  2XRO A;  4WUJ A;  3C2W A;  4EXO A;  4CQH A;  1W63 Q;  1TS0 A;  1XJ2 A;  2PD7 A;  4AFI A;  4MN6 A;  2FZ0 A;  3FG8 A;  3GDI A;  4BBU A;  3NJA A;  2JHE A;  1F5M A;  1OPX A;  1ZHH B;  3LFV A;  1YKD A;  3E98 A;  5IT5 A;  5A8B A;  2HV1 A;  3LR0 A;  3LR5 A;  2I9V A;  4HY8 A;  5AVF A;  2WKR A;  1NRJ A;  3A0V A;  3NOU C;  2ZMV A;  2ZMF A;  3NOT C;  3OCN A;  3PBO A;  1OT6 A;  2PHY A;  5J3W A;  1H8M A;  4R38 A;  4ARZ B;  1G28 A;  3IS2 A;  1MC0 A;  3NOP C;  4F3L A;  3S7O A;  3E4O A;  3EGX C;  4GS9 B;  4OOL A;  1WA9 A;  3H82 B;  4EEU A;  3H7W B;  4Y3I A;  4IUK A;  3S7Q A;  2Z6C A;  1UGU A;  3PBR A;  4L9F A;  3OCL A;  1UWN X;  4BJP A;  3EWK A;  2NUT C;  4I3I A;  5HWT A;  3E0Y A;  3MF0 A;  5F68 A;  5HWV A;  3GEC A;  2VGL M;  3VV4 A;  2W3H A;  1OT9 A;  3VOL A;  4Q0H A;  3LI8 A;  2WKP A;  5HWW A;  4YWZ A;  3BY8 A;  4Q0J A;  3EOI A;  3KSH A;  4Y2F A;  2O9C A;  3UB9 A;  1NLY A;  2P7J A;  3IBR A;  4NEE D;  3UMD A;  4DJ2 A;  5J4E A;  3T4T A;  4I5S A;  3KSG A;  3EEH A;  5DJT A;  1P97 A;  1XFN A;  4EER A;  2W3G A;  3MQ0 A;  2L1M A;  1D06 A;  4Q0I A;  4PKY G;  2OWJ A;  4HI4 A;  1OTE A;  3BQA A;  1H3Q A;  1JNU A;  5HDD A;  5DF9 A;  5TJJ A;  3TRC A;  3LID A;  2KX6 A;  1N9L A;  3F1N B;  3ZYT A;  3VE3 A;  2V1A A;  3MQO A;  3T50 A;  2PT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...