3S22A

Amp-c beta-lactamase (pseudomonas aeruginosa) in complex with an inhibitor
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
361
structure length
361
Chain Sequence
APADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Side chain SAR of bicyclic Beta-lactamase inhibitors (BLIs). 2. N-Alkylated and open chain analogs of MK-8712
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase/hydrolase inhibitor
total genus 122
structure length 361
sequence length 361
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3s22A00
1XKZA 3GQZA 4WZ4A 3VFHA 4WEJA 1DY6A 5I94A 3IWQA 1S6RA 1Y54A 2DNSA 1TDGA 3IWOA 4WMCD 3MZEA 3G35A 2XK1A 3IF5A 2H5SA 4DDYA 4E3NA 1VM1A 2XGNA 4RA7A 5CHMA 3QHYA 3PBRA 3C7VA 3DTMA 4ZAMA 3PBTA 3WS1A 5DTKA 4OPYA 3ZDJA 4DF6A 3GRJA 4MNRA 4KZ8A 5EVIA 5GHYA 4M3KA 1KE4A 2JC7A 3HLWA 2Y2NA 2P9VA 1RCJA 3NI9A 1YLTA 3G4PA 1XA7A 3MBZA 5EOEA 5M18A 4KQQA 4X6TA 5KSCA 4E3MA 3GSGA 1CI8A 1JWZA 2BG1A 5A91A 5AQ7A 3BLMA 4ZBEA 4EUZA 2HP9A 4X69A 1K55A 2A3UA 3A3DA 4FCFA 3IT9A 5EE8A 5FDHA 4OOMA 4B88A 2ZC3B 4CPKA 4GOGA 5HAIA 3CMZA 3S22A 4XUZA 3G2YA 4KG6A 1MPLA 4JPMA 1BUEA 2Y2QA 4OQHA 5TFQA 4N92A 1HD8A 3OPPA 3WS0A 3A3IA 1DJBA 4KZ6A 2G2UA 1L0FA 4N1XA 4LV0A 3HUNA 3ZNTA 3TSGA 2DRWA 4S2NA 2XEPA 2Y2LA 1YMSA 3O88A 4R4RA 3MFDA 2OSUA 1MWRA 4E3OA 1O07A 1SHVA 1S0WA 1Z6FA 4H8RA 2WAFA 2X71A 2Z2MB 5CTMA 3MXRA 1Q2QA 2Y4AA 2ZM2A 3FZCA 1K56A 2HDQA 1KVLA 5EUAA 5A90A 2GDNA 4KENB 1K4FA 5HAQA 2G2WA 1N9BA 3HLFA 5CGXA 1XX2A 4MLLA 1MWUA 3G32A 3N8LA 3IH8A 4IBXA 5EVIB 2XFTA 3VFFA 1KE3A 2P9VB 5KZHA 3IF6C 3N8RA 4LENA 3P98A 3NBLA 5GL9A 3IQAA 2PU2A 3MKEA 4OLDA 1VQQA 1NZOA 1IELA 1W8QA 3N4IA 5U47A 3IXHA 4BL3A 3PBSA 1LL5A 1FQGA 1PW8A 3I7JA 4BLMA 5HARA 1RGZA 2XD5A 5F83A 5FQKA 2RCXA 3BEBA 1L2SA 1SDNA 3LY3A 4QY6A 5FAQA 3G2ZA 3NY4A 4FH4A 1ES2A 3UPPA 5DTTA 1K6SA 4OVDA 5J8XA 1KDSA 1K6RA 2HDRA 2Z2LB 3M2JA 4E3LA 5L2FA 2OLVA 2EX9A 5TR7A 2ZC5B 1PI4A 1EI5A 1SCWA 4DKIA 3W4PA 4BENA 1G68A 1GHPA 2J9PA 4JF4A 3P09A 5F1GA 1GCEA 4HESA 1K25A 4RVAA 1MWTA 3VOZA 4S2PA 3VP1A 3O86A 4JBFA 1K54A 3UDXA 1PZOA 3HREA 5DF8A 3LEZA 1YT4A 3MXSA 4OH0A 1L0EA 4OPZA 4KG5A 2HPBA 3C7UA 4FSFA 2ZQAA 1ONGA 3A3JA 5DVAA 3ZFZA 1BTLA 5BOHA 5AQAA 3JYIA 1LI9A 4NK3A 2J8YA 4YINA 5M1AA 2OLUA 1NXYA 1FOFA 3V5MA 1L0GA 2C6WB 4R4SA 3UY6A 3ISGA 3NDGA 3MKFA 2HDSA 3E2LA 5CGSA 1H8ZA 3MZFA 4X56A 3V39A 2XFSA 2QZ6A 2WK0A 1K57C 3SH9A 4KZ5A 5CGWA 4N1HA 2WADA 2ZC4B 4DE3A 3BFGA 2QMIA 5GLBA 4ZTKA 5GHXA 3AGEA 3O87A 1LHYA 1XGIA 3GV9A 4BD1A 4C75A 1ESIA 2Y2MA 3W4QA 1J9MA 5EVLA 2Y2OA 4C3QA 4GB7A 2V2FF 1GHMA 1W5DA 5FI2A 4A5RA 4GZBA 4R0QA 4KZBA 4UHUA 2BLSA 3BFEA 3IXDA 5FQ9A 1JVJA 3OPHA 4E6XA 2V1ZA 1CEGA 4PM8A 1BLCA 2ZJ9A 3EQVA 1CK3A 3PBOA 4QU3A 5FA7A 4X55A 4HBTA 2XDMA 1KVMA 4QY5A 3VP0A 1HVBA 1OMEA 3GR2A 1BLPA 5EOOA 5IHVA 3UDFA 2R9WA 1IKIA 3OZHA 2C5WB 3FV7A 3VSLA 3LCEA 1QMFA 1AXBA 5EPHA 1PWDA 2Y2PA 1YLYA 4UA6A 3RXXA 2ZD8A 1KGGA 4OPQA 4JKTA 1BULA 1IYPA 3UNWA 5HW3A 2J9OA 2ZLYA 3IH9A 4Y0UA 1O7EA 2ZQDA 5TGFA 3G30A 2XLNA 4WMCA 2B5RA 3PBQA 2A49A 5GLAA 1ZG4A 1W79A 3UN7A 3HLBA 5E43A 3RXWA 3VOYA 5F1FA 1NJ4A 5HAPA 1IEMA 3ZG7B 2FFFB 4BL2A 5FQIA 3ZVWA 4U0TA 4LV2A 4KQOA 5DF9A 3BFFA 4U0XA 1EROA 5E2EA 5E2GA 4Z9QA 5FQMA 3ZG0A 4KZ9A 4E3KA 4EBNA 4X68A 4P85A 3SS5A 4N9LA 4ZJ2A 3HLCA 3DWKA 4OOYA 1WYCA 4RX3A 4DXBA 4ID4A 3AGDA 5FAPA 1W7FA 1IYQA 3Q7VA 1QMEA 1ES3A 1MWSA 4JLFA 2JCHA 2UWXA 4QD4A 1RP5A 2IWCA 4YFMA 1PZPA 3MZDA 4L0LA 1NZUA 2XD1A 3OCNA 2P74A 5CXWA 3UE3A 4GDBA 3D4FA 3SOIA 5FQQA 3W8KA 2J7VA 3ITAA 4JXWA 1XPBA 3PBNA 4D2OA 2RL3A 1HZOA 2ZMAA 3A3EA 1TEMA 3C4PA 4RX2A 4FH2A 3VP2A 4NETA 3Q7ZA 4BJPA 5KMWA 1PI5A 2JE5A 3HVFA 4IBRA 4KZ4A 4LV1A 4BQMA 5CECA 3BFCA 4ZJ3A 5AQ9A 1BSGA 1I5QA 1ZKJA 1KGFA 2ZQ9A 4S2NC 3UE0A 4DRTA 4PM9A 4DE0A 1BLSA 3UO9A 1Q2PA 1E3UD 3ZNYA 4ZDXA 3M2KA 4P0MA 4E3JA 2Q9MA 2PBYA 3M6HA 3HUMA 1FSYA 5FQJA 3E2KA 3N7WA 2HP5A 5FSRA 4GDNA 5F82A 2EX6A 1W8YA 5G18A 1H5XA 4KZ7A 5E2FA 3C5AA 4E6WA 1LLBA 1KGEA 2WKIA 5FAOA 2X01A 3Q07A 2IWBA 1MKIA 3TG9A 1PIOA 1K57A 2QPNA 3IWIA 1TDLA 3ZVTA 4WM9A 4XXRA 1PWCA 1K4EA 3S1YA 4K0XA 4RYEA 4WYYA 3W4OA 4OONA 4R3JA 1ES5A 4KZAA 4P87A 3Q7VB 3O3VA 3FYZA 5CHJA 3GMWA 4OP8A 3UPNA 3M6BA 4Y7PA 3GVBA 2EX8A 2XF3A 1GHIA 1YLPA 3WRZA 3ZG9B 1MBLA 4FD8A 1FCOA 1CEFA 3PAGA 1NRFA 3CG5A 2HDUA 2H0YA 3WS4A 1IYSA 2Y91A 2WZXA 2XQZA 4KG2A 3EQUA 1FSWA 4QB8A 1GA0A 1LI0A 4MEZA 2I72A 2ZQ8A 4MBKA 4Q8IA 1ERQA 1YLZA 2V20A 4LV3A 4WZ5C 3CJMA 3G31A 4PM6A 4S2IA 2OV5A 1KDWA 5FASA 1I2SA 1SDEA 2WZZA 3HLEA 3TOIA 1GA9A 3C4OA 2XH9A 4Y0OA 1ESUA 5GHZA 1C3BA 3VMAA 4CJNA 4EWFA 2JBFA 1ZG6A 3A3FA 1K38A 1XA1A 4WBGA 2ZQ7A 2WKHA 2H10A 1CI9A 5D3OA 1EWZA 3UPOA 4R23A 3HLDA 3IHAA 3SS4A 1JWPA 4OQIA 1L0DA 3NCKA 3N6IA 3DWZA 2PU4A 3HUOA 1FR1A 3G34A 1E25A 1FCNA 5HFOA 2Q9NA 2EFXA 4PMAA 5KSHA 3BRMA 3FWLA 2VGJA 3N8SA 1I2WA 3HBRA 4OKPA 3CZDA 1G6AA 2EFUA 2FFYA 5JYPA 1ES4A 1YLJA 2VGKA 3Q1FA 3NIAA 1K56D 4UAAA 1JTGA 4EV4A 2WAEA 1E4DA 2Y2JA 2ZM0A 2CC1A 3ZG8B 4PM7A 3BYDA 3LY4A 1YLWA 5EVIC 3NDEA 3IF6A 3V3RA 4Y0TA 4P6BA 2Y2IA 4K91A 4KZ3A 4S2KA 1SKFA 3VP3A 3BLSA 3Q82A 3DW0A 1IKGA 1YQSA 4EBPA 3LO7A 4QHCA 2XR0A 3QNCA 4S2JA 4K0WA 3ZGAB 3RJUA 3ZCZA 4LCMA 4C6YA 4HBUA 1K55C 1TVFA 4X53A 2Y2HA 2WGWA 1ERMA 3IXGA 5CTNA 3WWXA 1BT5A 4WEKA 3WRTA 4B4XA 1U60A 3HL9A 2HP6A 1IYOA 1FR6A 4GKUA 3VP4A 4N9KA 1RGYA 5DTSA 5FI7A 5HX9A 3SH7A 1XP4A 5CERA 1HTZA 1M6KA 3GTCA 1LL9A 2R9XA 4KQRA 1XGJA 1WYBA 4JF5A 4OLGA 2WGVA 3ZG5A 4OP5A 4R3BA 1DJCA 5DF7A 1N4OA 5GLDA 4EQIA 3QNBA 3UE1A 4EBLA 4U3TA 3OC2A 2Y59A 4F94A 3OPRA 4BD0A 5FI6A 3OPLA 4S2MA 4QJGA 5HL1A 2Y2GA 1PW1A 3ITBA 2Y2KA 4DXCA 1DJAA 3V3SA 1H8YA 2WKEA 4R1GA 4OOLA 4JXSA 5CHUA 3SS3A 5E2HA 5M19A 4GD8A 3WS2A 1BLHA 1WE4A 1KE0A 5CEDA 2EX2A 3VSKA 3PTEA 1BZAA 2ZM8A 3IF6B 3BM6A 4S2OA 1M40A 1ONHA 3BFDA 4S2LA 3OCLA 5FATA 1MXOA 4O7DA 5GLCA 1XXMA 4E3IA 4DDSA 1JTDA 1NYYA 4JF6A 2X02A 4GN2A 3BECA 2Y55A 1YMXA 3FKVA 1NYMA 4MBFA 2H0TA 4IVKA 3FKWA 4LCLA 4B4ZA 4WELA 5JYOA 4JXGA 2EXAA 2WGWB 3IHBA 4WZ5A 4ZJ1A 1E3UA 1NY0A 5CRFA 4PPRA 4UA9A 4IEDA 5CEBA 3NC8A 3Q81A 1FCMA 4MBHA 4IVIA 3HLGA 4JXVA 1MY8A 1YM1A 4OQGA 3SH8A 4DE2A 4OQ0A 3AGFA 1PWGA 2DCFA 4GNUA 4XUXA 4DE1A 5EVID 3V50A 2EXBA 3B3XA 3PAEA 3ZHHA 5EECA 2ZQCA 1ALQA 2IWDA 1JWVA 2WGIA 4OPRA 3IXBA 1ZC2A 1PYYA 1K54C 2ZC6B 3WS5A 4GD6A 2E8IA 5AQBA 4HEFA 3S4XA 5A93A 2WYXA 3UDIA 2ZC7A 4PM5A 4UA7A 5A92A 2WUQA
chains in the Genus database with same CATH superfamily
1XKZA 3GQZA 1DY6A 3IWQA 2VK3A 4F3LA 4ETXA 2JKTM 2PHYA 2K31A 1GSXA 2ZOHA 4E3NA 3WS1A 4GHIA 4DF6A 5GHYA 4MNRA 4M3KA 2Y2NA 3NI9A 1D06A 3MMHA 4KQQA 4L9FA 4E3MA 3GSGA 1CI8A 3HJKA 2BG1A 2A3UA 3A3DA 5EE8A 3IT9A 4OOMA 4GLQA 4R3AA 3CMZA 3S22A 5MC7A 5TFQA 1DJBA 1L0FA 2Y2LA 3D3OA 1MWRA 4IUKA 1O07A 1S0WA 2GX5A 2Z2MB 3FZCA 1K56A 1KVLA 5EUAA 2GDNA 4KENB 1N9BA 5CGXA 4MLLA 1MWUA 3LR4A 5EVIB 2XFTA 4MDZA 5HZHA 3K3DA 4HH3A 1LSVA 1S66L 3N8RA 3NBLA 3IQAA 2PU2A 1NZOA 1IELA 3C30A 3DBAA 1FQGA 1PW8A 1LSWA 3BEBA 4QY6A 3VE4A 5FL3A 5DTTA 2EX9A 4YWZA 1PI4A 1G28A 1SCWA 4JF4A 3NHQA 5F1GA 1GCEA 3VOZA 5L8MA 3MF0A 5DF8A 1YT4A 4OPZA 2ZMVA 2ZQAA 3A3JA 5BOHA 2PYPA 4NK3A 3QP6A 1NXYA 3V5MA 1L0GA 2KDKA 3NDGA 2HDSA 4BMWA 3E2LA 4X56A 1A0KA 4KZ5A 1FIKA 2QMIA 5GHXA 2KOIA 1XGIA 2Y2MA 4FUWA 1NLZA 2Y2OA 4C3QA 4GB7A 2V2FF 1GHMA 4GZBA 5FQ9A 4E6XA 1SKOB 1N9LA 1BLCA 3PBOA 4X55A 5HD3A 4HBTA 1OMEA 3VSLA 2B02A 3FG8A 1N9OA 5HSQA 3RXXA 4K08A 1GSVA 2ZD8A 4HP9A 5TBMA 5J7EA 1ZG4A 3VOYA 4LGWA 3RXWA 3H82B 4BL2A 5FQIA 3CUEA 4U0TA 5E2EA 4ETZA 2OAQ1 5E2GA 4Z9QA 3T4QA 4E3KA 3SS5A 3LEQA 4ZJ2A 3HLCA 3FPWA 1MKMA 4ID4A 3F1OB 1W7FA 5AJGA 3Q7VA 4X25A 1ES3A 1MWSA 3QP5A 4QD4A 1T1BA 2VEAA 3MZDA 2PD7A 4H6JB 2XD1A 2VV8A 4E04A 3UE3A 3SOIA 5FQQA 3W8KA 2J7VA 3ITAA 3IS2A 2VV6A 3PBNA 2RL3A 4JGQA 2ZMAA 3C4PA 3EOIA 2B18A 5AQ9A 3UE0A 4DRTA 4X1MA 1BLSA 1DP6A 3ZNYA 1TD5A 2Q9MA 2PBYA 3E2KA 5FSRA 2HP5A 3G6OA 2EX6A 1W8YA 4YOFA 5HPIA 3C5AA 1LLBA 3TG9A 2HJEA 4GW9A 1L3LA 2R78A 2VJWA 2OWJA 3T12B 1TDLA 3LR5A 1ES5A 4P87A 5CHJA 4OP8A 4Y7PA 4PKYA 5DFXA 2EX8A 1GHIA 1YLPA 3T1QB 4EU0A 4PHTA 3ICYA 2ZOIA 3WS4A 1IYSA 3E4OA 4M4XA 4R70A 4P6ZS 2WKPA 2ZQ8A 4Q8IA 2WZZA 5DJUA 4B93A 2JBFA 4I3JA 2OOLA 1OTBA 4WBGA 2P7JA 2HZ5A 1EWZA 3IHAA 3SS4A 3N6IA 2PU4A 1E25A 4CLCA 2EFXA 3BRMA 1VETA 4MN6A 3CZDA 3LIAA 1ES4A 4UAAA 1E4DA 5C5KA 2VLGA 3LY4A 4Y0TA 4K91A 4S2KA 1SKFA 2VV7A 1YQSA 5AVFA 4HHDA 3MS6A 3QNCA 3B33A 4DJ3A 3RJUA 1K55C 4X53A 2WGWA 5CTNA 3WWXA 5G4ZA 2V8FA 3DTEA 2K7SA 1U60A 5HX9A 3SH7A 4JGRA 3GTCA 4JF5A 3C8CA 4HY8A 3CUEC 4OP5A 5DF7A 3QNBA 4NXEA 5FDSA 1YSPA 4QJGA 4MMNA 4Y17A 1PW1A 4I3IA 1DJAA 2EWVA 4JXSA 4EQ1A 5E2HA 4GD8A 3H7WB 1UGUA 1BLHA 3VSKA 4HH2A 4S2LA 5FATA 4Y5FA 1LL8A 4DDSA 1NYYA 4GN2A 2Y55A 3C38A 4MBFA 4HNBA 4WELA 4JXGA 1F98A 3IHBA 4WZ5A 3D72A 3Q81A 3PXPA 4IVIA 4P6ZM 1XFQA 3AGFA 4DE1A 1NWZA 2ZQCA 2IWDA 3VE3A 3IXBA 3OLOA 4I38A 2E8IA 1WA9A 2LB5A 1Y4OA 2PR5A 5F6AA 2I9VA 3BQAA 1S6RA 2L4RA 4WMCD 5IS1A 2XK1A 4DDYA 1VM1A 5HWTA 4GJ4A 4I5SA 3DTMA 4DN0A 3EEAA 3PBTA 5DTKA 4OPYA 3ZDJA 5EVIA 5EFWA 1KE4A 5EOEA 1RCJA 3G4PA 5DJTA 5HDCA 5DKLA 4ZBEA 3BLMA 1DP9A 1S4RA 3NJAA 2ZC3B 1OJ5A 3T1XA 5HAIA 2LB9A 4XUZA 4JPMA 3E4PA 2Y2QA 4OQHA 4N92A 4JGPA 1HD8A 3A3IA 4KZ6A 4N1XA 5F5YA 4HJ4A 1YMSA 2OSUA 4E3OA 3LGOA 3KSHA 2O99A 5CTMA 2HDQA 1BYWA 5A90A 4BBUA 2G2WA 1XX2A 3HCYA 4HP4A 3G32A 4HIAA 3N8LA 2JN7A 3VFFA 5KZHA 1F5MA 3UE6A 3TW8A 1W8QA 4II7A 3IXHA 3PBSA 1LL5A 3I7JA 1L2SA 2M7VA 3OOVA 3UPPA 4OVDA 1SKOA 1TS8A 2BTFP 2Z2LB 5L2FA 2OLVA 3CAXA 3NECA 1EI5A 4DKIA 1GHPA 4RVAA 4WUJA 4S2PA 2J3TD 2MJ6A 1XJ4A 4O01A 1PZOA 2A2LA 3MXSA 3SZTA 4KG5A 3F1PB 4NEED 3ZFZA 5AQAA 3L9KA 1LI9A 4NXBA 2OLUA 4NXGA 3KYQA 3UY6A 2FH5A 1H8ZA 2YKFA 3NOPC 3SH9A 2VKSA 2ZC4B 1VEUB 2FZ0A 1YSQA 5GLBA 3S7NA 3LIEA 4ZTKA 2PBDP 3AGEA 3GV9A 4BD1A 5AVEA 1J9MA 3HJIA 4YNRA 4Q0HA 3F1NB 5EM0A 2BLSA 3F1OA 1JVJA 3OPHA 4WL9A 1CEGA 2ZJ9A 3EQVA 1CK3A 3H9WA 5FA7A 4H6JA 3VP0A 2VX8A 2CMNA 1BLPA 5EOOA 1QMFA 1W63Q 1PWDA 3IBJA 1TS6A 2GJ3A 1BULA 3QP4A 1IYPA 3IH9A 2JKRM 2ZQDA 2XLNA 2A49A 1W79A 2D02A 1NJ4A 5HAPA 1IEMA 1OTIA 3UB5P 3PR6A 3L7HA 4LV2A 2VA0A 3BFFA 4U0XA 1EROA 3ZG0A 3T4OA 5K5BA 4OOYA 2O9CA 3AGDA 1QMEA 4JLFA 2GNXA 4Y3IA 1P0ZA 2KX6A 4JXWA 1TS0A 4RX2A 3VP2A 3Q7ZA 1PI5A 4LV1A 2GZAA 4ZJ3A 1BSGA 1KGFA 3E4QA 1E3UD 4P0MA 5FQJA 3N7WA 1H5XA 1OT6A 3K2NA 4KZ7A 4E6WA 3U2AA 3P7NA 1K57A 3O5YA 2QPNA 1UWPX 1PWCA 4XXRA 2AVXA 3IX4A 1ZTUA 4R3JA 3O3VA 3UPNA 1W63M 3GVBA 3FPVA 3WRZA 3ZG9B 3EEHA 4HJ3A 3LR3A 3CG5A 3GDIA 5L10A 2XQZA 1FSWA 1LI0A 4MBKA 4EXOA 2ZBBA 1ERQA 4MN5A 2OV5A 1SDEA 3TOIA 2P04A 4Y0OA 4CJNA 1C3BA 1PRQA 2PYRA 3A3FA 3R7WB 1CI9A 3UPOA 1L0DA 1YAXA 4ZRRA 1FR1A 3G34A 2Q9NA 4PMAA 5KSHA 3PHYA 3UB6A 5J4EA 4OKPA 1G6AA 3T4SA 2VGKA 1K56D 3MQQA 2QWSA 3H7WA 3MQ0A 2WAEA 3NULA 2Y2JA 1Z09A 2NUPC 3ZG8B 1VHMA 3BYDA 4Y2FA 1YLWA 4RQ9A 1DP8A 2Y2IA 1PFLA 3BLSA 3MR0A 4EBPA 4QHCA 2XR0A 3E98A 5DKKA 3PYPA 2JKGA 4LCMA 2Y2HA 3IBRA 1VB6A 4B4XA 1FR6A 4GKUA 3VP4A 5DTSA 4F3LB 3UB9A 3NOUC 5CERA 1LT0A 4KQRA 2WGVA 1N4OA 1OT9A 5GLDA 4EQIA 4GHIB 2UV0E 2Y59A 3OPRA 4S2MA 4DXCA 4I39A 2WKEA 3V3SA 3C2WA 5CHUA 3WS2A 1AWIA 5F69A 2KLIA 4KUKA 1BZAA 3IF6B 3GECA 3BFDA 4O7DA 4GS9B 1XXMA 5G4YA 3LIDA 2X02A 3BECA 1YMXA 1NYMA 2H0TA 4IVKA 4LRYC 2W27A 1F2KA 5CRFA 4UA9A 4IEDA 3NC8A 1S1ZA 3HLGA 4Y15A 1YM1A 3V50A 4EEPA 3ZQ5A 3CLOA 5EECA 1T18A 1JWVA 2H28A 4OPRA 1ZC2A 3WS5A 4GD6A 1TF1A 5TJJA 5AQBA 5L07A 2WYXA 2ZC7A 4PM5A 4UA7A 2WUQA 4WEJA 3LUQA 2QJ5A 1TDGA 3IWOA 3MZEA 3IF5A 2H5SA 2QHKA 4RA7A 2WKQA 3QHYA 2JC7A 3HLWA 4I3AA 1YLTA 3MBZA 1LSXA 4X6TA 5KSCA 2O9AA 3T4LA 1JWZA 3KSGA 3VV4A 5AQ7A 4EUZA 4CPKA 1NLYA 2Y8HA 2V0UA 3G2YA 1MPLA 4KG6A 1D1JA 3OPPA 3WS0A 1CF0A 4IUHA 1D7EA 2G2UA 1OTEA 4LV0A 3HUNA 3TSGA 2XEPA 4FTXA 4R38A 4R4RA 1SHVA 1Z6FA 3EWKA 3F1PA 1Q2QA 2W0NA 2Y4AA 2ZM2A 1K4FA 5HAQA 3HLFA 1MZUA 2HV1A 3DAVA 3CPTB 3QP8A 3IH8A 4IBXA 3LFVA 1YPRA 5J3WA 1KE3A 2P9VB 4PKYG 1VEUA 4LENA 3P98A 2IA2A 4OLDA 3N4IA 4MN7A 3IX8A 5U47A 4ARZB 4BLMA 4O0PA 5HARA 1RGZA 5HWWA 2QYBA 2XD5A 3F1NA 5FQKA 1SDNA 3LY3A 1HLUP 2A24B 3BY8A 1KDSA 1K6RA 3M2JA 4E3LA 2ZC5B 1V9YA 1N9NA 4NXFA 5DFYA 4BENA 2J9PA 3P09A 3LI9A 4HESA 1MWTA 3KO6A 3BW6A 3O86A 4JBFA 1K54A 3HREA 4LPZA 4OH0A 3RFBA 2HPBA 3C7UA 1ONGA 3JYIA 4HI4A 2ZMFA 4YINA 5M1AA 4R4SA 3B47A 3ISGA 3T4KA 5CGSA 3V39A 1JNUA 2XFSA 2QZ6A 2WK0A 5CGWA 4N1HA 2WADA 4DE3A 3BFGA 3T50A 3LIBA 3O87A 1LHYA 2P08A 4C75A 3W4QA 4LRZE 1UWNX 5FI2A 4R0QA 4UHUA 3BFEA 1TS7A 2V1ZA 4QU3A 5LBRA 2HF6A 4QY5A 4KUOA 2NUTC 5IHVA 3UDFA 2R9WA 1IKIA 3OZHA 4B9OA 2VGLS 3FV7A 1AXBA 1G6OA 4UA6A 3VOLA 2PR6A 2JHEA 4JKTA 2L1MA 3UNWA 3MXQA 5HW3A 4R6LA 1O7EA 5TGFA 3PBQA 3UN7A 3HLBA 5F1FA 3ZG7B 2FFFB 3ZVWA 5DF9A 5FQMA 4CLCC 3TRCA 4EBNA 4X68A 3BWLA 4N9LA 1WYCA 4RX3A 2WKRA 1OPXA 5EVEA 5FAPA 4EETB 1IYQA 1RP5A 2IWCA 4YFMA 4EESA 4L0LA 2P74A 4NG2A 4UEYA 2ACGA 4GDBA 3D4FA 1P9RA 2PRFA 3LICA 4D2OA 1ZHHB 2JKRI 4NETA 3HVFA 5CECA 4KZ4A 4BQMA 3T4TA 5I5LA 1I5QA 4LFUA 4PM9A 4DE0A 3UO9A 4ZDXA 3M2KA 4E3JA 3UB7A 3M6HA 5EM1A 2L0WA 4G3VA 3Q07A 2IWBA 1MKIA 3R7WA 1PIOA 1H3QA 4IHQA 3IWIA 1K4EA 2HJ9C 3SW1A 4OONA 5EV0A 3FYZA 3GMWA 3LR0A 3M6BA 2XRNA 3MFXA 2J80A 2XF3A 3H82A 1MBLA 1FCOA 3CHWP 2HDUA 2H0YA 3MQOA 1EW0A 4QB8A 3T1SA 1YLZA 4WZ5C 3CJMA 3G31A 4S2IA 1I2SA 4AFIA 3HLEA 2XH9A 5HD5A 2PDRA 1ESUA 3KX0X 3VMAA 4EWFA 1K0KA 4D60A 2VGLM 1XA1A 2ZQ7A 3T1RA 2WKHA 4R23A 3HLDA 1J3WA 1STZA 5HFOA 4WF0A 2EWWA 3FWLA 3N8SA 4IJGA 1MC0A 3TE8A 2J3TC 2EFUA 3Q1FA 4EV4A 2ZM0A 2CC1A 5EVIC 3NDEA 3IF6A 5HDSA 4P6BA 3VP3A 3UB8A 4GS9A 3DW0A 1IKGA 2XROA 3UMDA 4ME4A 3KSFA 4C6YA 1ERMA 3MSHA 1BT5A 4HOIA 4WEKA 3WRTA 2BASA 2HP6A 1ODVA 4N9KA 5FI7A 1FILA 1YKDA 1M6KA 2R9XA 1XGJA 4OLGA 3ZG5A 3CWFA 1DJCA 4EBLA 3OC2A 3V67A 4BD0A 5FI6A 2Z6DA 2W3HA 3ITBA 2EA9A 2Y2KA 1H8YA 4OOLA 3SS3A 3A0VA 1WE4A 3KYZA 1KE0A 2EX2A 3BM6A 3E0YA 2W1TB 1M40A 1ONHA 1MXOA 5GLCA 4E3IA 3S7OA 2E8JA 1V9ZA 4LCLA 1NY0A 4PPRA 5CEBA 1FCMA 4MBHA 4JXVA 2Z6CA 2PT7A 1H8MA 1MY8A 4OQGA 3EGXC 1H0MA 1PWGA 2DCFA 5A8BA 4GNUA 2EXBA 3PAEA 1ALQA 4XT2B 2O0YA 1PYYA 2ZC6B 3S4XA 4HEFA 3BY9A 3BJNA 1IFQA 3BQ8A 5A92A 4WZ4A 3VFHA 4G3KA 3LI8A 5I94A 4ESPA 1Y54A 2DNSA 2ZL1B 1XJ3A 4EERA 3G35A 3KYEA 4L9GA 2XGNA 3UMEA 5CHMA 3OBFA 3PBRA 1OTAA 2XSSA 3C7VA 3MJQA 4ZAMA 3CPTA 5FEGA 3GRJA 4HQAA 4KZ8A 2P9VA 1XA7A 1XFNA 3B42A 5M18A 2V9AA 5A91A 1XJ6A 2HP9A 4X69A 1K55A 4ARZA 4FCFA 5FDHA 3QP1A 3ULFA 4B88A 4GOGA 2W3EA 2A24A 1BUEA 3DTIA 3ZNTA 2DRWA 4S2NA 3O88A 3MFDA 4H8RA 2WAFA 3R4KA 2X71A 1X0OA 3MXRA 2V8CA 1S4SA 4MCWA 1P97A 1P9WA 3IF6C 4EEUA 5GL9A 3MKEA 1VQQA 3ZYTA 2K2NA 4Q0IA 4BL3A 3S7PA 5F83A 2RCXA 2INWA 3A0SA 5HWVA 5FAQA 3G2ZA 3NY4A 4FH4A 1ES2A 5J8XA 1K6SA 2HDRA 1XJ2A 5TR7A 5HPFA 3W4PA 1G68A 1K25A 3LYXA 1KOUA 3VP1A 3UDXA 2OWHA 3LEZA 4UQIS 1L0EA 4FSFA 4BBTA 5DVAA 2QJ7A 4O8GA 1BTLA 5HDDA 2J8YA 1FOFA 4CQHA 2C6WB 4G3WA 4EW7A 3MKFA 2W3FA 4KQDA 3MZFA 2G7UA 1K57C 3NOTC 3EGDC 4QWOA 4DJ2A 1ESIA 5EVLA 3RH8B 4NKPA 4LLOB 1W5DA 4A5RA 3LIFA 4KZBA 1PNEA 3IXDA 3JVUA 4PM8A 2Y79A 1ACFA 2XDMA 1KVMA 4Q0JA 3A0RA 1HVBA 3GR2A 2C5WB 3LCEA 2W1RA 5EPHA 2Y2PA 1YLYA 1G5UA 1KGGA 4OPQA 1OJGA 2J9OA 2ZLYA 4Y0UA 3G30A 4WMCA 5HL6A 2B5RA 5GLAA 3P01A 3D9YA 5E43A 4HJ6A 4JGOA 2M7UA 1GSWA 3T4JA 4KQOA 4KZ9A 4P85A 4QPRA 3DWKA 2Q0OA 4DXBA 5L09A 3KSIA 3DTKA 4Y13A 1NRJA 2JCHA 2UWXA 1T1AA 1PZPA 2W3DA 1NZUA 5KIZA 3OCNA 5CXWA 1CJFA 2D01A 3JPUA 1CQAA 1S67L 1XPBA 1HZOA 3A3EA 1TEMA 4FH2A 4BJPA 5KMWA 2JE5A 4IBRA 3BFCA 1ZKJA 2ZQ9A 3IX3A 4S2NC 5TBMB 1Q2PA 3HUMA 1FSYA 4GDNA 5F82A 5G18A 5E2FA 4LRXC 4UQIM 1KGEA 2WKIA 3JVVA 5FAOA 2X01A 2V1AA 4BWIA 3ZVTA 4WM9A 3S1YA 4K0XA 4RYEA 4WYYA 3U4LP 3W4OA 4KZAA 3Q7VB 4BBVA 1S1YA 4FD8A 4PAUA 1CEFA 1SZVA 2XA7S 3PAGA 3IS2B 1NRFA 4CLCD 1T19A 2Y91A 2WZXA 4KG2A 5IT5A 3EQUA 1F9IA 1GA0A 4MEZA 2I72A 2V20A 4LV3A 4PM6A 1KDWA 5FASA 1GA9A 3C4OA 5GHZA 1Y28A 1ZG6A 2M1CA 2V0WA 2YKHA 1K38A 2H10A 5D3OA 5F68A 1JWPA 4OQIA 3NCKA 3DWZA 3HUOA 1FCNA 2J3WA 2HGVA 2VGJA 1I2WA 3HBRA 3W2ZA 2W3GA 4L9EA 2FFYA 5JYPA 1YLJA 3NIAA 2V1BA 1JTGA 5CX7A 4PM7A 3CITA 3V3RA 1IOUA 2W1TA 4KZ3A 3Q82A 4X1LA 2B95A 3LO7A 4S2JA 4K0WA 3ZGAB 3ZCZA 4HBUA 1TVFA 3IXGA 2JKTI 3HL9A 1IYOA 4EUVA 1RGYA 1XP4A 1HTZA 1DRMA 1LL9A 1WYBA 4R3BA 5IU1A 4CLCB 4Z1WA 3UE1A 1VETB 4XT2A 4U3TA 4F94A 2VZWA 3QP2A 3OPLA 5HL1A 2Y2GA 3CI6A 4R1GA 3S7QA 3TJZC 5M19A 3K3CA 4GCZA 5CEDA 3PTEA 2ZL1A 2ZM8A 1T1CA 4S2OA 2DMWA 3RTYA 3OCLA 2OAP1 1JTDA 4JF6A 2JKFA 4FOFA 3FKVA 4DMZA 3FKWA 4B4ZA 5JYOA 2EXAA 2WGWB 2XA7M 4ZJ1A 1E3UA 3FC7A 5FEFA 4WLAA 1OTDA 2PD8A 4DE2A 3SH8A 4OQ0A 2QKPA 2PAVP 4XUXA 5EVID 3B3XA 3ZHHA 2WGIA 1K54C 2O9BA 4CLCE 5A93A 3UDIA 4WN5A
chains in the Genus database with same CATH topology
1XKZA 3GQZA 4WZ4A 3VFHA 4WEJA 1DY6A 5I94A 3IWQA 1S6RA 1Y54A 2DNSA 1TDGA 3IWOA 4WMCD 3MZEA 3G35A 2XK1A 3IF5A 2H5SA 4DDYA 4E3NA 1VM1A 2XGNA 4RA7A 5CHMA 3QHYA 3PBRA 3C7VA 3DTMA 4ZAMA 3PBTA 3WS1A 5DTKA 4OPYA 3ZDJA 4DF6A 3GRJA 4MNRA 4KZ8A 5EVIA 5GHYA 4M3KA 1KE4A 2JC7A 3HLWA 2Y2NA 2P9VA 1RCJA 3NI9A 1YLTA 3G4PA 1XA7A 3MBZA 5EOEA 5M18A 4KQQA 4X6TA 5KSCA 4E3MA 3GSGA 1CI8A 1JWZA 2BG1A 5A91A 5AQ7A 3BLMA 4ZBEA 4EUZA 2HP9A 4X69A 1K55A 2A3UA 3A3DA 4FCFA 3IT9A 5EE8A 5FDHA 4OOMA 4B88A 2ZC3B 4CPKA 4GOGA 5HAIA 3CMZA 3S22A 4XUZA 3G2YA 4KG6A 1MPLA 4JPMA 1BUEA 2Y2QA 4OQHA 5TFQA 4N92A 1HD8A 3OPPA 3WS0A 3A3IA 1DJBA 4KZ6A 2G2UA 1L0FA 4N1XA 4LV0A 3HUNA 3ZNTA 3TSGA 2DRWA 4S2NA 2XEPA 2Y2LA 1YMSA 3O88A 4R4RA 3MFDA 2OSUA 1MWRA 4E3OA 1O07A 1SHVA 1S0WA 1Z6FA 4H8RA 2WAFA 2X71A 2Z2MB 5CTMA 3MXRA 1Q2QA 2Y4AA 2ZM2A 3FZCA 1K56A 2HDQA 1KVLA 5EUAA 5A90A 2GDNA 4KENB 1K4FA 5HAQA 2G2WA 1N9BA 3HLFA 5CGXA 1XX2A 4MLLA 1MWUA 3G32A 3N8LA 3IH8A 4IBXA 5EVIB 2XFTA 3VFFA 1KE3A 2P9VB 5KZHA 3IF6C 3N8RA 4LENA 3P98A 3NBLA 5GL9A 3IQAA 2PU2A 3MKEA 4OLDA 1VQQA 1NZOA 1IELA 1W8QA 3N4IA 5U47A 3IXHA 4BL3A 3PBSA 1LL5A 1FQGA 1PW8A 3I7JA 4BLMA 5HARA 1RGZA 2XD5A 5F83A 5FQKA 2RCXA 3BEBA 1L2SA 1SDNA 3LY3A 4QY6A 5FAQA 3G2ZA 3NY4A 4FH4A 1ES2A 3UPPA 5DTTA 1K6SA 4OVDA 5J8XA 1KDSA 1K6RA 2HDRA 2Z2LB 3M2JA 4E3LA 5L2FA 2OLVA 2EX9A 5TR7A 2ZC5B 1PI4A 1EI5A 1SCWA 4DKIA 3W4PA 4BENA 1G68A 1GHPA 2J9PA 4JF4A 3P09A 5F1GA 1GCEA 4HESA 1K25A 4RVAA 1MWTA 3VOZA 4S2PA 3VP1A 3O86A 4JBFA 1K54A 3UDXA 1PZOA 3HREA 5DF8A 3LEZA 1YT4A 3MXSA 4OH0A 1L0EA 4OPZA 4KG5A 2HPBA 3C7UA 4FSFA 2ZQAA 1ONGA 3A3JA 5DVAA 3ZFZA 1BTLA 5BOHA 5AQAA 3JYIA 1LI9A 4NK3A 2J8YA 4YINA 5M1AA 2OLUA 1NXYA 1FOFA 3V5MA 1L0GA 2C6WB 4R4SA 3UY6A 3ISGA 3NDGA 3MKFA 2HDSA 3E2LA 5CGSA 1H8ZA 3MZFA 4X56A 3V39A 2XFSA 2QZ6A 2WK0A 1K57C 3SH9A 4KZ5A 5CGWA 4N1HA 2WADA 2ZC4B 4DE3A 3BFGA 2QMIA 5GLBA 4ZTKA 5GHXA 3AGEA 3O87A 1LHYA 1XGIA 3GV9A 4BD1A 4C75A 1ESIA 2Y2MA 3W4QA 1J9MA 5EVLA 2Y2OA 4C3QA 4GB7A 2V2FF 1GHMA 1W5DA 5FI2A 4A5RA 4GZBA 4R0QA 4KZBA 4UHUA 2BLSA 3BFEA 3IXDA 5FQ9A 1JVJA 3OPHA 4E6XA 2V1ZA 1CEGA 4PM8A 1BLCA 2ZJ9A 3EQVA 1CK3A 3PBOA 4QU3A 5FA7A 4X55A 4HBTA 2XDMA 1KVMA 4QY5A 3VP0A 1HVBA 1OMEA 3GR2A 1BLPA 5EOOA 5IHVA 3UDFA 2R9WA 1IKIA 3OZHA 2C5WB 3FV7A 3VSLA 3LCEA 1QMFA 1AXBA 5EPHA 1PWDA 2Y2PA 1YLYA 4UA6A 3RXXA 2ZD8A 1KGGA 4OPQA 4JKTA 1BULA 1IYPA 3UNWA 5HW3A 2J9OA 2ZLYA 3IH9A 4Y0UA 1O7EA 2ZQDA 5TGFA 3G30A 2XLNA 4WMCA 2B5RA 3PBQA 2A49A 5GLAA 1ZG4A 1W79A 3UN7A 3HLBA 5E43A 3RXWA 3VOYA 5F1FA 1NJ4A 5HAPA 1IEMA 3ZG7B 2FFFB 4BL2A 5FQIA 3ZVWA 4U0TA 4LV2A 4KQOA 5DF9A 3BFFA 4U0XA 1EROA 5E2EA 5E2GA 4Z9QA 5FQMA 3ZG0A 4KZ9A 4E3KA 4EBNA 4X68A 4P85A 3SS5A 4N9LA 4ZJ2A 3HLCA 3DWKA 4OOYA 1WYCA 4RX3A 4DXBA 4ID4A 3AGDA 5FAPA 1W7FA 1IYQA 3Q7VA 1QMEA 1ES3A 1MWSA 4JLFA 2JCHA 2UWXA 4QD4A 1RP5A 2IWCA 4YFMA 1PZPA 3MZDA 4L0LA 1NZUA 2XD1A 3OCNA 2P74A 5CXWA 3UE3A 4GDBA 3D4FA 3SOIA 5FQQA 3W8KA 2J7VA 3ITAA 4JXWA 1XPBA 3PBNA 4D2OA 2RL3A 1HZOA 2ZMAA 3A3EA 1TEMA 3C4PA 4RX2A 4FH2A 3VP2A 4NETA 3Q7ZA 4BJPA 5KMWA 1PI5A 2JE5A 3HVFA 4IBRA 4KZ4A 4LV1A 4BQMA 5CECA 3BFCA 4ZJ3A 5AQ9A 1BSGA 1I5QA 1ZKJA 1KGFA 2ZQ9A 4S2NC 3UE0A 4DRTA 4PM9A 4DE0A 1BLSA 3UO9A 1Q2PA 1E3UD 3ZNYA 4ZDXA 3M2KA 4P0MA 4E3JA 2Q9MA 2PBYA 3M6HA 3HUMA 1FSYA 5FQJA 3E2KA 3N7WA 2HP5A 5FSRA 4GDNA 5F82A 2EX6A 1W8YA 5G18A 1H5XA 4KZ7A 5E2FA 3C5AA 4E6WA 1LLBA 1KGEA 2WKIA 5FAOA 2X01A 3Q07A 2IWBA 1MKIA 3TG9A 1PIOA 1K57A 2QPNA 3IWIA 1TDLA 3ZVTA 4WM9A 4XXRA 1PWCA 1K4EA 3S1YA 4K0XA 4RYEA 4WYYA 3W4OA 4OONA 4R3JA 1ES5A 4KZAA 4P87A 3Q7VB 3O3VA 3FYZA 5CHJA 3GMWA 4OP8A 3UPNA 3M6BA 4Y7PA 3GVBA 2EX8A 2XF3A 1GHIA 1YLPA 3WRZA 3ZG9B 1MBLA 4FD8A 1FCOA 1CEFA 3PAGA 1NRFA 3CG5A 2HDUA 2H0YA 3WS4A 1IYSA 2Y91A 2WZXA 2XQZA 4KG2A 3EQUA 1FSWA 4QB8A 1GA0A 1LI0A 4MEZA 2I72A 2ZQ8A 4MBKA 4Q8IA 1ERQA 1YLZA 2V20A 4LV3A 4WZ5C 3CJMA 3G31A 4PM6A 4S2IA 2OV5A 1KDWA 5FASA 1I2SA 1SDEA 2WZZA 3HLEA 3TOIA 1GA9A 3C4OA 2XH9A 4Y0OA 1ESUA 5GHZA 1C3BA 3VMAA 4CJNA 4EWFA 2JBFA 1ZG6A 3A3FA 1K38A 1XA1A 4WBGA 2ZQ7A 2WKHA 2H10A 1CI9A 5D3OA 1EWZA 3UPOA 4R23A 3HLDA 3IHAA 3SS4A 1JWPA 4OQIA 1L0DA 3NCKA 3N6IA 3DWZA 2PU4A 3HUOA 1FR1A 3G34A 1E25A 1FCNA 5HFOA 2Q9NA 2EFXA 4PMAA 5KSHA 3BRMA 3FWLA 2VGJA 3N8SA 1I2WA 3HBRA 4OKPA 3CZDA 1G6AA 2EFUA 2FFYA 5JYPA 1ES4A 1YLJA 2VGKA 3Q1FA 3NIAA 1K56D 4UAAA 1JTGA 4EV4A 2WAEA 1E4DA 2Y2JA 2ZM0A 2CC1A 3ZG8B 4PM7A 3BYDA 3LY4A 1YLWA 5EVIC 3NDEA 3IF6A 3V3RA 4Y0TA 4P6BA 2Y2IA 4K91A 4KZ3A 4S2KA 1SKFA 3VP3A 3BLSA 3Q82A 3DW0A 1IKGA 1YQSA 4EBPA 3LO7A 4QHCA 2XR0A 3QNCA 4S2JA 4K0WA 3ZGAB 3RJUA 3ZCZA 4LCMA 4C6YA 4HBUA 1K55C 1TVFA 4X53A 2Y2HA 2WGWA 1ERMA 3IXGA 5CTNA 3WWXA 1BT5A 4WEKA 3WRTA 4B4XA 1U60A 3HL9A 2HP6A 1IYOA 1FR6A 4GKUA 3VP4A 4N9KA 1RGYA 5DTSA 5FI7A 5HX9A 3SH7A 1XP4A 5CERA 1HTZA 1M6KA 3GTCA 1LL9A 2R9XA 4KQRA 1XGJA 1WYBA 4JF5A 4OLGA 2WGVA 3ZG5A 4OP5A 4R3BA 1DJCA 5DF7A 1N4OA 5GLDA 4EQIA 3QNBA 3UE1A 4EBLA 4U3TA 3OC2A 2Y59A 4F94A 3OPRA 4BD0A 5FI6A 3OPLA 4S2MA 4QJGA 5HL1A 2Y2GA 1PW1A 3ITBA 2Y2KA 4DXCA 1DJAA 3V3SA 1H8YA 2WKEA 4R1GA 4OOLA 4JXSA 5CHUA 3SS3A 5E2HA 5M19A 4GD8A 3WS2A 1BLHA 1WE4A 1KE0A 5CEDA 2EX2A 3VSKA 3PTEA 1BZAA 2ZM8A 3IF6B 3BM6A 4S2OA 1M40A 1ONHA 3BFDA 4S2LA 3OCLA 5FATA 1MXOA 4O7DA 5GLCA 1XXMA 4E3IA 4DDSA 1JTDA 1NYYA 4JF6A 2X02A 4GN2A 3BECA 2Y55A 1YMXA 3FKVA 1NYMA 4MBFA 2H0TA 4IVKA 3FKWA 4LCLA 4B4ZA 4WELA 5JYOA 4JXGA 2EXAA 2WGWB 3IHBA 4WZ5A 4ZJ1A 1E3UA 1NY0A 5CRFA 4PPRA 4UA9A 4IEDA 5CEBA 3NC8A 3Q81A 1FCMA 4MBHA 4IVIA 3HLGA 4JXVA 1MY8A 1YM1A 4OQGA 3SH8A 4DE2A 4OQ0A 3AGFA 1PWGA 2DCFA 4GNUA 4XUXA 4DE1A 5EVID 3V50A 2EXBA 3B3XA 3PAEA 3ZHHA 5EECA 2ZQCA 1ALQA 2IWDA 1JWVA 2WGIA 4OPRA 3IXBA 1ZC2A 1PYYA 1K54C 2ZC6B 3WS5A 4GD6A 2E8IA 5AQBA 4HEFA 3S4XA 5A93A 2WYXA 3UDIA 2ZC7A 4PM5A 4UA7A 5A92A 2WUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XKZ A;  3GQZ A;  4WZ4 A;  3VFH A;  4WEJ A;  1DY6 A;  5I94 A;  3IWQ A;  1S6R A;  1Y54 A;  2DNS A;  1TDG A;  3IWO A;  4WMC D;  3MZE A;  3G35 A;  2XK1 A;  3IF5 A;  2H5S A;  4DDY A;  4E3N A;  1VM1 A;  2XGN A;  4RA7 A;  5CHM A;  3QHY A;  3PBR A;  3C7V A;  3DTM A;  4ZAM A;  3PBT A;  3WS1 A;  5DTK A;  4OPY A;  3ZDJ A;  4DF6 A;  3GRJ A;  4MNR A;  4KZ8 A;  5EVI A;  5GHY A;  4M3K A;  1KE4 A;  2JC7 A;  3HLW A;  2Y2N A;  2P9V A;  1RCJ A;  3NI9 A;  1YLT A;  3G4P A;  1XA7 A;  3MBZ A;  5EOE A;  5M18 A;  4KQQ A;  4X6T A;  5KSC A;  4E3M A;  3GSG A;  1CI8 A;  1JWZ A;  2BG1 A;  5A91 A;  5AQ7 A;  3BLM A;  4ZBE A;  4EUZ A;  2HP9 A;  4X69 A;  1K55 A;  2A3U A;  3A3D A;  4FCF A;  3IT9 A;  5EE8 A;  5FDH A;  4OOM A;  4B88 A;  2ZC3 B;  4CPK A;  4GOG A;  5HAI A;  3CMZ A;  3S22 A;  4XUZ A;  3G2Y A;  4KG6 A;  1MPL A;  4JPM A;  1BUE A;  2Y2Q A;  4OQH A;  5TFQ A;  4N92 A;  1HD8 A;  3OPP A;  3WS0 A;  3A3I A;  1DJB A;  4KZ6 A;  2G2U A;  1L0F A;  4N1X A;  4LV0 A;  3HUN A;  3ZNT A;  3TSG A;  2DRW A;  4S2N A;  2XEP A;  2Y2L A;  1YMS A;  3O88 A;  4R4R A;  3MFD A;  2OSU A;  1MWR A;  4E3O A;  1O07 A;  1SHV A;  1S0W A;  1Z6F A;  4H8R A;  2WAF A;  2X71 A;  2Z2M B;  5CTM A;  3MXR A;  1Q2Q A;  2Y4A A;  2ZM2 A;  3FZC A;  1K56 A;  2HDQ A;  1KVL A;  5EUA A;  5A90 A;  2GDN A;  4KEN B;  1K4F A;  5HAQ A;  2G2W A;  1N9B A;  3HLF A;  5CGX A;  1XX2 A;  4MLL A;  1MWU A;  3G32 A;  3N8L A;  3IH8 A;  4IBX A;  5EVI B;  2XFT A;  3VFF A;  1KE3 A;  2P9V B;  5KZH A;  3IF6 C;  3N8R A;  4LEN A;  3P98 A;  3NBL A;  5GL9 A;  3IQA A;  2PU2 A;  3MKE A;  4OLD A;  1VQQ A;  1NZO A;  1IEL A;  1W8Q A;  3N4I A;  5U47 A;  3IXH A;  4BL3 A;  3PBS A;  1LL5 A;  1FQG A;  1PW8 A;  3I7J A;  4BLM A;  5HAR A;  1RGZ A;  2XD5 A;  5F83 A;  5FQK A;  2RCX A;  3BEB A;  1L2S A;  1SDN A;  3LY3 A;  4QY6 A;  5FAQ A;  3G2Z A;  3NY4 A;  4FH4 A;  1ES2 A;  3UPP A;  5DTT A;  1K6S A;  4OVD A;  5J8X A;  1KDS A;  1K6R A;  2HDR A;  2Z2L B;  3M2J A;  4E3L A;  5L2F A;  2OLV A;  2EX9 A;  5TR7 A;  2ZC5 B;  1PI4 A;  1EI5 A;  1SCW A;  4DKI A;  3W4P A;  4BEN A;  1G68 A;  1GHP A;  2J9P A;  4JF4 A;  3P09 A;  5F1G A;  1GCE A;  4HES A;  1K25 A;  4RVA A;  1MWT A;  3VOZ A;  4S2P A;  3VP1 A;  3O86 A;  4JBF A;  1K54 A;  3UDX A;  1PZO A;  3HRE A;  5DF8 A;  3LEZ A;  1YT4 A;  3MXS A;  4OH0 A;  1L0E A;  4OPZ A;  4KG5 A;  2HPB A;  3C7U A;  4FSF A;  2ZQA A;  1ONG A;  3A3J A;  5DVA A;  3ZFZ A;  1BTL A;  5BOH A;  5AQA A;  3JYI A;  1LI9 A;  4NK3 A;  2J8Y A;  4YIN A;  5M1A A;  2OLU A;  1NXY A;  1FOF A;  3V5M A;  1L0G A;  2C6W B;  4R4S A;  3UY6 A;  3ISG A;  3NDG A;  3MKF A;  2HDS A;  3E2L A;  5CGS A;  1H8Z A;  3MZF A;  4X56 A;  3V39 A;  2XFS A;  2QZ6 A;  2WK0 A;  1K57 C;  3SH9 A;  4KZ5 A;  5CGW A;  4N1H A;  2WAD A;  2ZC4 B;  4DE3 A;  3BFG A;  2QMI A;  5GLB A;  4ZTK A;  5GHX A;  3AGE A;  3O87 A;  1LHY A;  1XGI A;  3GV9 A;  4BD1 A;  4C75 A;  1ESI A;  2Y2M A;  3W4Q A;  1J9M A;  5EVL A;  2Y2O A;  4C3Q A;  4GB7 A;  2V2F F;  1GHM A;  1W5D A;  5FI2 A;  4A5R A;  4GZB A;  4R0Q A;  4KZB A;  4UHU A;  2BLS A;  3BFE A;  3IXD A;  5FQ9 A;  1JVJ A;  3OPH A;  4E6X A;  2V1Z A;  1CEG A;  4PM8 A;  1BLC A;  2ZJ9 A;  3EQV A;  1CK3 A;  3PBO A;  4QU3 A;  5FA7 A;  4X55 A;  4HBT A;  2XDM A;  1KVM A;  4QY5 A;  3VP0 A;  1HVB A;  1OME A;  3GR2 A;  1BLP A;  5EOO A;  5IHV A;  3UDF A;  2R9W A;  1IKI A;  3OZH A;  2C5W B;  3FV7 A;  3VSL A;  3LCE A;  1QMF A;  1AXB A;  5EPH A;  1PWD A;  2Y2P A;  1YLY A;  4UA6 A;  3RXX A;  2ZD8 A;  1KGG A;  4OPQ A;  4JKT A;  1BUL A;  1IYP A;  3UNW A;  5HW3 A;  2J9O A;  2ZLY A;  3IH9 A;  4Y0U A;  1O7E A;  2ZQD A;  5TGF A;  3G30 A;  2XLN A;  4WMC A;  2B5R A;  3PBQ A;  2A49 A;  5GLA A;  1ZG4 A;  1W79 A;  3UN7 A;  3HLB A;  5E43 A;  3RXW A;  3VOY A;  5F1F A;  1NJ4 A;  5HAP A;  1IEM A;  3ZG7 B;  2FFF B;  4BL2 A;  5FQI A;  3ZVW A;  4U0T A;  4LV2 A;  4KQO A;  5DF9 A;  3BFF A;  4U0X A;  1ERO A;  5E2E A;  5E2G A;  4Z9Q A;  5FQM A;  3ZG0 A;  4KZ9 A;  4E3K A;  4EBN A;  4X68 A;  4P85 A;  3SS5 A;  4N9L A;  4ZJ2 A;  3HLC A;  3DWK A;  4OOY A;  1WYC A;  4RX3 A;  4DXB A;  4ID4 A;  3AGD A;  5FAP A;  1W7F A;  1IYQ A;  3Q7V A;  1QME A;  1ES3 A;  1MWS A;  4JLF A;  2JCH A;  2UWX A;  4QD4 A;  1RP5 A;  2IWC A;  4YFM A;  1PZP A;  3MZD A;  4L0L A;  1NZU A;  2XD1 A;  3OCN A;  2P74 A;  5CXW A;  3UE3 A;  4GDB A;  3D4F A;  3SOI A;  5FQQ A;  3W8K A;  2J7V A;  3ITA A;  4JXW A;  1XPB A;  3PBN A;  4D2O A;  2RL3 A;  1HZO A;  2ZMA A;  3A3E A;  1TEM A;  3C4P A;  4RX2 A;  4FH2 A;  3VP2 A;  4NET A;  3Q7Z A;  4BJP A;  5KMW A;  1PI5 A;  2JE5 A;  3HVF A;  4IBR A;  4KZ4 A;  4LV1 A;  4BQM A;  5CEC A;  3BFC A;  4ZJ3 A;  5AQ9 A;  1BSG A;  1I5Q A;  1ZKJ A;  1KGF A;  2ZQ9 A;  4S2N C;  3UE0 A;  4DRT A;  4PM9 A;  4DE0 A;  1BLS A;  3UO9 A;  1Q2P A;  1E3U D;  3ZNY A;  4ZDX A;  3M2K A;  4P0M A;  4E3J A;  2Q9M A;  2PBY A;  3M6H A;  3HUM A;  1FSY A;  5FQJ A;  3E2K A;  3N7W A;  2HP5 A;  5FSR A;  4GDN A;  5F82 A;  2EX6 A;  1W8Y A;  5G18 A;  1H5X A;  4KZ7 A;  5E2F A;  3C5A A;  4E6W A;  1LLB A;  1KGE A;  2WKI A;  5FAO A;  2X01 A;  3Q07 A;  2IWB A;  1MKI A;  3TG9 A;  1PIO A;  1K57 A;  2QPN A;  3IWI A;  1TDL A;  3ZVT A;  4WM9 A;  4XXR A;  1PWC A;  1K4E A;  3S1Y A;  4K0X A;  4RYE A;  4WYY A;  3W4O A;  4OON A;  4R3J A;  1ES5 A;  4KZA A;  4P87 A;  3Q7V B;  3O3V A;  3FYZ A;  5CHJ A;  3GMW A;  4OP8 A;  3UPN A;  3M6B A;  4Y7P A;  3GVB A;  2EX8 A;  2XF3 A;  1GHI A;  1YLP A;  3WRZ A;  3ZG9 B;  1MBL A;  4FD8 A;  1FCO A;  1CEF A;  3PAG A;  1NRF A;  3CG5 A;  2HDU A;  2H0Y A;  3WS4 A;  1IYS A;  2Y91 A;  2WZX A;  2XQZ A;  4KG2 A;  3EQU A;  1FSW A;  4QB8 A;  1GA0 A;  1LI0 A;  4MEZ A;  2I72 A;  2ZQ8 A;  4MBK A;  4Q8I A;  1ERQ A;  1YLZ A;  2V20 A;  4LV3 A;  4WZ5 C;  3CJM A;  3G31 A;  4PM6 A;  4S2I A;  2OV5 A;  1KDW A;  5FAS A;  1I2S A;  1SDE A;  2WZZ A;  3HLE A;  3TOI A;  1GA9 A;  3C4O A;  2XH9 A;  4Y0O A;  1ESU A;  5GHZ A;  1C3B A;  3VMA A;  4CJN A;  4EWF A;  2JBF A;  1ZG6 A;  3A3F A;  1K38 A;  1XA1 A;  4WBG A;  2ZQ7 A;  2WKH A;  2H10 A;  1CI9 A;  5D3O A;  1EWZ A;  3UPO A;  4R23 A;  3HLD A;  3IHA A;  3SS4 A;  1JWP A;  4OQI A;  1L0D A;  3NCK A;  3N6I A;  3DWZ A;  2PU4 A;  3HUO A;  1FR1 A;  3G34 A;  1E25 A;  1FCN A;  5HFO A;  2Q9N A;  2EFX A;  4PMA A;  5KSH A;  3BRM A;  3FWL A;  2VGJ A;  3N8S A;  1I2W A;  3HBR A;  4OKP A;  3CZD A;  1G6A A;  2EFU A;  2FFY A;  5JYP A;  1ES4 A;  1YLJ A;  2VGK A;  3Q1F A;  3NIA A;  1K56 D;  4UAA A;  1JTG A;  4EV4 A;  2WAE A;  1E4D A;  2Y2J A;  2ZM0 A;  2CC1 A;  3ZG8 B;  4PM7 A;  3BYD A;  3LY4 A;  1YLW A;  5EVI C;  3NDE A;  3IF6 A;  3V3R A;  4Y0T A;  4P6B A;  2Y2I A;  4K91 A;  4KZ3 A;  4S2K A;  1SKF A;  3VP3 A;  3BLS A;  3Q82 A;  3DW0 A;  1IKG A;  1YQS A;  4EBP A;  3LO7 A;  4QHC A;  2XR0 A;  3QNC A;  4S2J A;  4K0W A;  3ZGA B;  3RJU A;  3ZCZ A;  4LCM A;  4C6Y A;  4HBU A;  1K55 C;  1TVF A;  4X53 A;  2Y2H A;  2WGW A;  1ERM A;  3IXG A;  5CTN A;  3WWX A;  1BT5 A;  4WEK A;  3WRT A;  4B4X A;  1U60 A;  3HL9 A;  2HP6 A;  1IYO A;  1FR6 A;  4GKU A;  3VP4 A;  4N9K A;  1RGY A;  5DTS A;  5FI7 A;  5HX9 A;  3SH7 A;  1XP4 A;  5CER A;  1HTZ A;  1M6K A;  3GTC A;  1LL9 A;  2R9X A;  4KQR A;  1XGJ A;  1WYB A;  4JF5 A;  4OLG A;  2WGV A;  3ZG5 A;  4OP5 A;  4R3B A;  1DJC A;  5DF7 A;  1N4O A;  5GLD A;  4EQI A;  3QNB A;  3UE1 A;  4EBL A;  4U3T A;  3OC2 A;  2Y59 A;  4F94 A;  3OPR A;  4BD0 A;  5FI6 A;  3OPL A;  4S2M A;  4QJG A;  5HL1 A;  2Y2G A;  1PW1 A;  3ITB A;  2Y2K A;  4DXC A;  1DJA A;  3V3S A;  1H8Y A;  2WKE A;  4R1G A;  4OOL A;  4JXS A;  5CHU A;  3SS3 A;  5E2H A;  5M19 A;  4GD8 A;  3WS2 A;  1BLH A;  1WE4 A;  1KE0 A;  5CED A;  2EX2 A;  3VSK A;  3PTE A;  1BZA A;  2ZM8 A;  3IF6 B;  3BM6 A;  4S2O A;  1M40 A;  1ONH A;  3BFD A;  4S2L A;  3OCL A;  5FAT A;  1MXO A;  4O7D A;  5GLC A;  1XXM A;  4E3I A;  4DDS A;  1JTD A;  1NYY A;  4JF6 A;  2X02 A;  4GN2 A;  3BEC A;  2Y55 A;  1YMX A;  3FKV A;  1NYM A;  4MBF A;  2H0T A;  4IVK A;  3FKW A;  4LCL A;  4B4Z A;  4WEL A;  5JYO A;  4JXG A;  2EXA A;  2WGW B;  3IHB A;  4WZ5 A;  4ZJ1 A;  1E3U A;  1NY0 A;  5CRF A;  4PPR A;  4UA9 A;  4IED A;  5CEB A;  3NC8 A;  3Q81 A;  1FCM A;  4MBH A;  4IVI A;  3HLG A;  4JXV A;  1MY8 A;  1YM1 A;  4OQG A;  3SH8 A;  4DE2 A;  4OQ0 A;  3AGF A;  1PWG A;  2DCF A;  4GNU A;  4XUX A;  4DE1 A;  5EVI D;  3V50 A;  2EXB A;  3B3X A;  3PAE A;  3ZHH A;  5EEC A;  2ZQC A;  1ALQ A;  2IWD A;  1JWV A;  2WGI A;  4OPR A;  3IXB A;  1ZC2 A;  1PYY A;  1K54 C;  2ZC6 B;  3WS5 A;  4GD6 A;  2E8I A;  5AQB A;  4HEF A;  3S4X A;  5A93 A;  2WYX A;  3UDI A;  2ZC7 A;  4PM5 A;  4UA7 A;  5A92 A;  2WUQ A; 
#chains in the Genus database with same CATH topology
 1XKZ A;  3GQZ A;  1DY6 A;  3IWQ A;  2VK3 A;  4F3L A;  4ETX A;  2JKT M;  2PHY A;  2K31 A;  1GSX A;  2ZOH A;  4E3N A;  3WS1 A;  4GHI A;  4DF6 A;  5GHY A;  4MNR A;  4M3K A;  2Y2N A;  3NI9 A;  1D06 A;  3MMH A;  4KQQ A;  4L9F A;  4E3M A;  3GSG A;  1CI8 A;  3HJK A;  2BG1 A;  2A3U A;  3A3D A;  5EE8 A;  3IT9 A;  4OOM A;  4GLQ A;  4R3A A;  3CMZ A;  3S22 A;  5MC7 A;  5TFQ A;  1DJB A;  1L0F A;  2Y2L A;  3D3O A;  1MWR A;  4IUK A;  1O07 A;  1S0W A;  2GX5 A;  2Z2M B;  3FZC A;  1K56 A;  1KVL A;  5EUA A;  2GDN A;  4KEN B;  1N9B A;  5CGX A;  4MLL A;  1MWU A;  3LR4 A;  5EVI B;  2XFT A;  4MDZ A;  5HZH A;  3K3D A;  4HH3 A;  1LSV A;  1S66 L;  3N8R A;  3NBL A;  3IQA A;  2PU2 A;  1NZO A;  1IEL A;  3C30 A;  3DBA A;  1FQG A;  1PW8 A;  1LSW A;  3BEB A;  4QY6 A;  3VE4 A;  5FL3 A;  5DTT A;  2EX9 A;  4YWZ A;  1PI4 A;  1G28 A;  1SCW A;  4JF4 A;  3NHQ A;  5F1G A;  1GCE A;  3VOZ A;  5L8M A;  3MF0 A;  5DF8 A;  1YT4 A;  4OPZ A;  2ZMV A;  2ZQA A;  3A3J A;  5BOH A;  2PYP A;  4NK3 A;  3QP6 A;  1NXY A;  3V5M A;  1L0G A;  2KDK A;  3NDG A;  2HDS A;  4BMW A;  3E2L A;  4X56 A;  1A0K A;  4KZ5 A;  1FIK A;  2QMI A;  5GHX A;  2KOI A;  1XGI A;  2Y2M A;  4FUW A;  1NLZ A;  2Y2O A;  4C3Q A;  4GB7 A;  2V2F F;  1GHM A;  4GZB A;  5FQ9 A;  4E6X A;  1SKO B;  1N9L A;  1BLC A;  3PBO A;  4X55 A;  5HD3 A;  4HBT A;  1OME A;  3VSL A;  2B02 A;  3FG8 A;  1N9O A;  5HSQ A;  3RXX A;  4K08 A;  1GSV A;  2ZD8 A;  4HP9 A;  5TBM A;  5J7E A;  1ZG4 A;  3VOY A;  4LGW A;  3RXW A;  3H82 B;  4BL2 A;  5FQI A;  3CUE A;  4U0T A;  5E2E A;  4ETZ A;  2OAQ 1;  5E2G A;  4Z9Q A;  3T4Q A;  4E3K A;  3SS5 A;  3LEQ A;  4ZJ2 A;  3HLC A;  3FPW A;  1MKM A;  4ID4 A;  3F1O B;  1W7F A;  5AJG A;  3Q7V A;  4X25 A;  1ES3 A;  1MWS A;  3QP5 A;  4QD4 A;  1T1B A;  2VEA A;  3MZD A;  2PD7 A;  4H6J B;  2XD1 A;  2VV8 A;  4E04 A;  3UE3 A;  3SOI A;  5FQQ A;  3W8K A;  2J7V A;  3ITA A;  3IS2 A;  2VV6 A;  3PBN A;  2RL3 A;  4JGQ A;  2ZMA A;  3C4P A;  3EOI A;  2B18 A;  5AQ9 A;  3UE0 A;  4DRT A;  4X1M A;  1BLS A;  1DP6 A;  3ZNY A;  1TD5 A;  2Q9M A;  2PBY A;  3E2K A;  5FSR A;  2HP5 A;  3G6O A;  2EX6 A;  1W8Y A;  4YOF A;  5HPI A;  3C5A A;  1LLB A;  3TG9 A;  2HJE A;  4GW9 A;  1L3L A;  2R78 A;  2VJW A;  2OWJ A;  3T12 B;  1TDL A;  3LR5 A;  1ES5 A;  4P87 A;  5CHJ A;  4OP8 A;  4Y7P A;  4PKY A;  5DFX A;  2EX8 A;  1GHI A;  1YLP A;  3T1Q B;  4EU0 A;  4PHT A;  3ICY A;  2ZOI A;  3WS4 A;  1IYS A;  3E4O A;  4M4X A;  4R70 A;  4P6Z S;  2WKP A;  2ZQ8 A;  4Q8I A;  2WZZ A;  5DJU A;  4B93 A;  2JBF A;  4I3J A;  2OOL A;  1OTB A;  4WBG A;  2P7J A;  2HZ5 A;  1EWZ A;  3IHA A;  3SS4 A;  3N6I A;  2PU4 A;  1E25 A;  4CLC A;  2EFX A;  3BRM A;  1VET A;  4MN6 A;  3CZD A;  3LIA A;  1ES4 A;  4UAA A;  1E4D A;  5C5K A;  2VLG A;  3LY4 A;  4Y0T A;  4K91 A;  4S2K A;  1SKF A;  2VV7 A;  1YQS A;  5AVF A;  4HHD A;  3MS6 A;  3QNC A;  3B33 A;  4DJ3 A;  3RJU A;  1K55 C;  4X53 A;  2WGW A;  5CTN A;  3WWX A;  5G4Z A;  2V8F A;  3DTE A;  2K7S A;  1U60 A;  5HX9 A;  3SH7 A;  4JGR A;  3GTC A;  4JF5 A;  3C8C A;  4HY8 A;  3CUE C;  4OP5 A;  5DF7 A;  3QNB A;  4NXE A;  5FDS A;  1YSP A;  4QJG A;  4MMN A;  4Y17 A;  1PW1 A;  4I3I A;  1DJA A;  2EWV A;  4JXS A;  4EQ1 A;  5E2H A;  4GD8 A;  3H7W B;  1UGU A;  1BLH A;  3VSK A;  4HH2 A;  4S2L A;  5FAT A;  4Y5F A;  1LL8 A;  4DDS A;  1NYY A;  4GN2 A;  2Y55 A;  3C38 A;  4MBF A;  4HNB A;  4WEL A;  4JXG A;  1F98 A;  3IHB A;  4WZ5 A;  3D72 A;  3Q81 A;  3PXP A;  4IVI A;  4P6Z M;  1XFQ A;  3AGF A;  4DE1 A;  1NWZ A;  2ZQC A;  2IWD A;  3VE3 A;  3IXB A;  3OLO A;  4I38 A;  2E8I A;  1WA9 A;  2LB5 A;  1Y4O A;  2PR5 A;  5F6A A;  2I9V A;  3BQA A;  1S6R A;  2L4R A;  4WMC D;  5IS1 A;  2XK1 A;  4DDY A;  1VM1 A;  5HWT A;  4GJ4 A;  4I5S A;  3DTM A;  4DN0 A;  3EEA A;  3PBT A;  5DTK A;  4OPY A;  3ZDJ A;  5EVI A;  5EFW A;  1KE4 A;  5EOE A;  1RCJ A;  3G4P A;  5DJT A;  5HDC A;  5DKL A;  4ZBE A;  3BLM A;  1DP9 A;  1S4R A;  3NJA A;  2ZC3 B;  1OJ5 A;  3T1X A;  5HAI A;  2LB9 A;  4XUZ A;  4JPM A;  3E4P A;  2Y2Q A;  4OQH A;  4N92 A;  4JGP A;  1HD8 A;  3A3I A;  4KZ6 A;  4N1X A;  5F5Y A;  4HJ4 A;  1YMS A;  2OSU A;  4E3O A;  3LGO A;  3KSH A;  2O99 A;  5CTM A;  2HDQ A;  1BYW A;  5A90 A;  4BBU A;  2G2W A;  1XX2 A;  3HCY A;  4HP4 A;  3G32 A;  4HIA A;  3N8L A;  2JN7 A;  3VFF A;  5KZH A;  1F5M A;  3UE6 A;  3TW8 A;  1W8Q A;  4II7 A;  3IXH A;  3PBS A;  1LL5 A;  3I7J A;  1L2S A;  2M7V A;  3OOV A;  3UPP A;  4OVD A;  1SKO A;  1TS8 A;  2BTF P;  2Z2L B;  5L2F A;  2OLV A;  3CAX A;  3NEC A;  1EI5 A;  4DKI A;  1GHP A;  4RVA A;  4WUJ A;  4S2P A;  2J3T D;  2MJ6 A;  1XJ4 A;  4O01 A;  1PZO A;  2A2L A;  3MXS A;  3SZT A;  4KG5 A;  3F1P B;  4NEE D;  3ZFZ A;  5AQA A;  3L9K A;  1LI9 A;  4NXB A;  2OLU A;  4NXG A;  3KYQ A;  3UY6 A;  2FH5 A;  1H8Z A;  2YKF A;  3NOP C;  3SH9 A;  2VKS A;  2ZC4 B;  1VEU B;  2FZ0 A;  1YSQ A;  5GLB A;  3S7N A;  3LIE A;  4ZTK A;  2PBD P;  3AGE A;  3GV9 A;  4BD1 A;  5AVE A;  1J9M A;  3HJI A;  4YNR A;  4Q0H A;  3F1N B;  5EM0 A;  2BLS A;  3F1O A;  1JVJ A;  3OPH A;  4WL9 A;  1CEG A;  2ZJ9 A;  3EQV A;  1CK3 A;  3H9W A;  5FA7 A;  4H6J A;  3VP0 A;  2VX8 A;  2CMN A;  1BLP A;  5EOO A;  1QMF A;  1W63 Q;  1PWD A;  3IBJ A;  1TS6 A;  2GJ3 A;  1BUL A;  3QP4 A;  1IYP A;  3IH9 A;  2JKR M;  2ZQD A;  2XLN A;  2A49 A;  1W79 A;  2D02 A;  1NJ4 A;  5HAP A;  1IEM A;  1OTI A;  3UB5 P;  3PR6 A;  3L7H A;  4LV2 A;  2VA0 A;  3BFF A;  4U0X A;  1ERO A;  3ZG0 A;  3T4O A;  5K5B A;  4OOY A;  2O9C A;  3AGD A;  1QME A;  4JLF A;  2GNX A;  4Y3I A;  1P0Z A;  2KX6 A;  4JXW A;  1TS0 A;  4RX2 A;  3VP2 A;  3Q7Z A;  1PI5 A;  4LV1 A;  2GZA A;  4ZJ3 A;  1BSG A;  1KGF A;  3E4Q A;  1E3U D;  4P0M A;  5FQJ A;  3N7W A;  1H5X A;  1OT6 A;  3K2N A;  4KZ7 A;  4E6W A;  3U2A A;  3P7N A;  1K57 A;  3O5Y A;  2QPN A;  1UWP X;  1PWC A;  4XXR A;  2AVX A;  3IX4 A;  1ZTU A;  4R3J A;  3O3V A;  3UPN A;  1W63 M;  3GVB A;  3FPV A;  3WRZ A;  3ZG9 B;  3EEH A;  4HJ3 A;  3LR3 A;  3CG5 A;  3GDI A;  5L10 A;  2XQZ A;  1FSW A;  1LI0 A;  4MBK A;  4EXO A;  2ZBB A;  1ERQ A;  4MN5 A;  2OV5 A;  1SDE A;  3TOI A;  2P04 A;  4Y0O A;  4CJN A;  1C3B A;  1PRQ A;  2PYR A;  3A3F A;  3R7W B;  1CI9 A;  3UPO A;  1L0D A;  1YAX A;  4ZRR A;  1FR1 A;  3G34 A;  2Q9N A;  4PMA A;  5KSH A;  3PHY A;  3UB6 A;  5J4E A;  4OKP A;  1G6A A;  3T4S A;  2VGK A;  1K56 D;  3MQQ A;  2QWS A;  3H7W A;  3MQ0 A;  2WAE A;  3NUL A;  2Y2J A;  1Z09 A;  2NUP C;  3ZG8 B;  1VHM A;  3BYD A;  4Y2F A;  1YLW A;  4RQ9 A;  1DP8 A;  2Y2I A;  1PFL A;  3BLS A;  3MR0 A;  4EBP A;  4QHC A;  2XR0 A;  3E98 A;  5DKK A;  3PYP A;  2JKG A;  4LCM A;  2Y2H A;  3IBR A;  1VB6 A;  4B4X A;  1FR6 A;  4GKU A;  3VP4 A;  5DTS A;  4F3L B;  3UB9 A;  3NOU C;  5CER A;  1LT0 A;  4KQR A;  2WGV A;  1N4O A;  1OT9 A;  5GLD A;  4EQI A;  4GHI B;  2UV0 E;  2Y59 A;  3OPR A;  4S2M A;  4DXC A;  4I39 A;  2WKE A;  3V3S A;  3C2W A;  5CHU A;  3WS2 A;  1AWI A;  5F69 A;  2KLI A;  4KUK A;  1BZA A;  3IF6 B;  3GEC A;  3BFD A;  4O7D A;  4GS9 B;  1XXM A;  5G4Y A;  3LID A;  2X02 A;  3BEC A;  1YMX A;  1NYM A;  2H0T A;  4IVK A;  4LRY C;  2W27 A;  1F2K A;  5CRF A;  4UA9 A;  4IED A;  3NC8 A;  1S1Z A;  3HLG A;  4Y15 A;  1YM1 A;  3V50 A;  4EEP A;  3ZQ5 A;  3CLO A;  5EEC A;  1T18 A;  1JWV A;  2H28 A;  4OPR A;  1ZC2 A;  3WS5 A;  4GD6 A;  1TF1 A;  5TJJ A;  5AQB A;  5L07 A;  2WYX A;  2ZC7 A;  4PM5 A;  4UA7 A;  2WUQ A;  4WEJ A;  3LUQ A;  2QJ5 A;  1TDG A;  3IWO A;  3MZE A;  3IF5 A;  2H5S A;  2QHK A;  4RA7 A;  2WKQ A;  3QHY A;  2JC7 A;  3HLW A;  4I3A A;  1YLT A;  3MBZ A;  1LSX A;  4X6T A;  5KSC A;  2O9A A;  3T4L A;  1JWZ A;  3KSG A;  3VV4 A;  5AQ7 A;  4EUZ A;  4CPK A;  1NLY A;  2Y8H A;  2V0U A;  3G2Y A;  1MPL A;  4KG6 A;  1D1J A;  3OPP A;  3WS0 A;  1CF0 A;  4IUH A;  1D7E A;  2G2U A;  1OTE A;  4LV0 A;  3HUN A;  3TSG A;  2XEP A;  4FTX A;  4R38 A;  4R4R A;  1SHV A;  1Z6F A;  3EWK A;  3F1P A;  1Q2Q A;  2W0N A;  2Y4A A;  2ZM2 A;  1K4F A;  5HAQ A;  3HLF A;  1MZU A;  2HV1 A;  3DAV A;  3CPT B;  3QP8 A;  3IH8 A;  4IBX A;  3LFV A;  1YPR A;  5J3W A;  1KE3 A;  2P9V B;  4PKY G;  1VEU A;  4LEN A;  3P98 A;  2IA2 A;  4OLD A;  3N4I A;  4MN7 A;  3IX8 A;  5U47 A;  4ARZ B;  4BLM A;  4O0P A;  5HAR A;  1RGZ A;  5HWW A;  2QYB A;  2XD5 A;  3F1N A;  5FQK A;  1SDN A;  3LY3 A;  1HLU P;  2A24 B;  3BY8 A;  1KDS A;  1K6R A;  3M2J A;  4E3L A;  2ZC5 B;  1V9Y A;  1N9N A;  4NXF A;  5DFY A;  4BEN A;  2J9P A;  3P09 A;  3LI9 A;  4HES A;  1MWT A;  3KO6 A;  3BW6 A;  3O86 A;  4JBF A;  1K54 A;  3HRE A;  4LPZ A;  4OH0 A;  3RFB A;  2HPB A;  3C7U A;  1ONG A;  3JYI A;  4HI4 A;  2ZMF A;  4YIN A;  5M1A A;  4R4S A;  3B47 A;  3ISG A;  3T4K A;  5CGS A;  3V39 A;  1JNU A;  2XFS A;  2QZ6 A;  2WK0 A;  5CGW A;  4N1H A;  2WAD A;  4DE3 A;  3BFG A;  3T50 A;  3LIB A;  3O87 A;  1LHY A;  2P08 A;  4C75 A;  3W4Q A;  4LRZ E;  1UWN X;  5FI2 A;  4R0Q A;  4UHU A;  3BFE A;  1TS7 A;  2V1Z A;  4QU3 A;  5LBR A;  2HF6 A;  4QY5 A;  4KUO A;  2NUT C;  5IHV A;  3UDF A;  2R9W A;  1IKI A;  3OZH A;  4B9O A;  2VGL S;  3FV7 A;  1AXB A;  1G6O A;  4UA6 A;  3VOL A;  2PR6 A;  2JHE A;  4JKT A;  2L1M A;  3UNW A;  3MXQ A;  5HW3 A;  4R6L A;  1O7E A;  5TGF A;  3PBQ A;  3UN7 A;  3HLB A;  5F1F A;  3ZG7 B;  2FFF B;  3ZVW A;  5DF9 A;  5FQM A;  4CLC C;  3TRC A;  4EBN A;  4X68 A;  3BWL A;  4N9L A;  1WYC A;  4RX3 A;  2WKR A;  1OPX A;  5EVE A;  5FAP A;  4EET B;  1IYQ A;  1RP5 A;  2IWC A;  4YFM A;  4EES A;  4L0L A;  2P74 A;  4NG2 A;  4UEY A;  2ACG A;  4GDB A;  3D4F A;  1P9R A;  2PRF A;  3LIC A;  4D2O A;  1ZHH B;  2JKR I;  4NET A;  3HVF A;  5CEC A;  4KZ4 A;  4BQM A;  3T4T A;  5I5L A;  1I5Q A;  4LFU A;  4PM9 A;  4DE0 A;  3UO9 A;  4ZDX A;  3M2K A;  4E3J A;  3UB7 A;  3M6H A;  5EM1 A;  2L0W A;  4G3V A;  3Q07 A;  2IWB A;  1MKI A;  3R7W A;  1PIO A;  1H3Q A;  4IHQ A;  3IWI A;  1K4E A;  2HJ9 C;  3SW1 A;  4OON A;  5EV0 A;  3FYZ A;  3GMW A;  3LR0 A;  3M6B A;  2XRN A;  3MFX A;  2J80 A;  2XF3 A;  3H82 A;  1MBL A;  1FCO A;  3CHW P;  2HDU A;  2H0Y A;  3MQO A;  1EW0 A;  4QB8 A;  3T1S A;  1YLZ A;  4WZ5 C;  3CJM A;  3G31 A;  4S2I A;  1I2S A;  4AFI A;  3HLE A;  2XH9 A;  5HD5 A;  2PDR A;  1ESU A;  3KX0 X;  3VMA A;  4EWF A;  1K0K A;  4D60 A;  2VGL M;  1XA1 A;  2ZQ7 A;  3T1R A;  2WKH A;  4R23 A;  3HLD A;  1J3W A;  1STZ A;  5HFO A;  4WF0 A;  2EWW A;  3FWL A;  3N8S A;  4IJG A;  1MC0 A;  3TE8 A;  2J3T C;  2EFU A;  3Q1F A;  4EV4 A;  2ZM0 A;  2CC1 A;  5EVI C;  3NDE A;  3IF6 A;  5HDS A;  4P6B A;  3VP3 A;  3UB8 A;  4GS9 A;  3DW0 A;  1IKG A;  2XRO A;  3UMD A;  4ME4 A;  3KSF A;  4C6Y A;  1ERM A;  3MSH A;  1BT5 A;  4HOI A;  4WEK A;  3WRT A;  2BAS A;  2HP6 A;  1ODV A;  4N9K A;  5FI7 A;  1FIL A;  1YKD A;  1M6K A;  2R9X A;  1XGJ A;  4OLG A;  3ZG5 A;  3CWF A;  1DJC A;  4EBL A;  3OC2 A;  3V67 A;  4BD0 A;  5FI6 A;  2Z6D A;  2W3H A;  3ITB A;  2EA9 A;  2Y2K A;  1H8Y A;  4OOL A;  3SS3 A;  3A0V A;  1WE4 A;  3KYZ A;  1KE0 A;  2EX2 A;  3BM6 A;  3E0Y A;  2W1T B;  1M40 A;  1ONH A;  1MXO A;  5GLC A;  4E3I A;  3S7O A;  2E8J A;  1V9Z A;  4LCL A;  1NY0 A;  4PPR A;  5CEB A;  1FCM A;  4MBH A;  4JXV A;  2Z6C A;  2PT7 A;  1H8M A;  1MY8 A;  4OQG A;  3EGX C;  1H0M A;  1PWG A;  2DCF A;  5A8B A;  4GNU A;  2EXB A;  3PAE A;  1ALQ A;  4XT2 B;  2O0Y A;  1PYY A;  2ZC6 B;  3S4X A;  4HEF A;  3BY9 A;  3BJN A;  1IFQ A;  3BQ8 A;  5A92 A;  4WZ4 A;  3VFH A;  4G3K A;  3LI8 A;  5I94 A;  4ESP A;  1Y54 A;  2DNS A;  2ZL1 B;  1XJ3 A;  4EER A;  3G35 A;  3KYE A;  4L9G A;  2XGN A;  3UME A;  5CHM A;  3OBF A;  3PBR A;  1OTA A;  2XSS A;  3C7V A;  3MJQ A;  4ZAM A;  3CPT A;  5FEG A;  3GRJ A;  4HQA A;  4KZ8 A;  2P9V A;  1XA7 A;  1XFN A;  3B42 A;  5M18 A;  2V9A A;  5A91 A;  1XJ6 A;  2HP9 A;  4X69 A;  1K55 A;  4ARZ A;  4FCF A;  5FDH A;  3QP1 A;  3ULF A;  4B88 A;  4GOG A;  2W3E A;  2A24 A;  1BUE A;  3DTI A;  3ZNT A;  2DRW A;  4S2N A;  3O88 A;  3MFD A;  4H8R A;  2WAF A;  3R4K A;  2X71 A;  1X0O A;  3MXR A;  2V8C A;  1S4S A;  4MCW A;  1P97 A;  1P9W A;  3IF6 C;  4EEU A;  5GL9 A;  3MKE A;  1VQQ A;  3ZYT A;  2K2N A;  4Q0I A;  4BL3 A;  3S7P A;  5F83 A;  2RCX A;  2INW A;  3A0S A;  5HWV A;  5FAQ A;  3G2Z A;  3NY4 A;  4FH4 A;  1ES2 A;  5J8X A;  1K6S A;  2HDR A;  1XJ2 A;  5TR7 A;  5HPF A;  3W4P A;  1G68 A;  1K25 A;  3LYX A;  1KOU A;  3VP1 A;  3UDX A;  2OWH A;  3LEZ A;  4UQI S;  1L0E A;  4FSF A;  4BBT A;  5DVA A;  2QJ7 A;  4O8G A;  1BTL A;  5HDD A;  2J8Y A;  1FOF A;  4CQH A;  2C6W B;  4G3W A;  4EW7 A;  3MKF A;  2W3F A;  4KQD A;  3MZF A;  2G7U A;  1K57 C;  3NOT C;  3EGD C;  4QWO A;  4DJ2 A;  1ESI A;  5EVL A;  3RH8 B;  4NKP A;  4LLO B;  1W5D A;  4A5R A;  3LIF A;  4KZB A;  1PNE A;  3IXD A;  3JVU A;  4PM8 A;  2Y79 A;  1ACF A;  2XDM A;  1KVM A;  4Q0J A;  3A0R A;  1HVB A;  3GR2 A;  2C5W B;  3LCE A;  2W1R A;  5EPH A;  2Y2P A;  1YLY A;  1G5U A;  1KGG A;  4OPQ A;  1OJG A;  2J9O A;  2ZLY A;  4Y0U A;  3G30 A;  4WMC A;  5HL6 A;  2B5R A;  5GLA A;  3P01 A;  3D9Y A;  5E43 A;  4HJ6 A;  4JGO A;  2M7U A;  1GSW A;  3T4J A;  4KQO A;  4KZ9 A;  4P85 A;  4QPR A;  3DWK A;  2Q0O A;  4DXB A;  5L09 A;  3KSI A;  3DTK A;  4Y13 A;  1NRJ A;  2JCH A;  2UWX A;  1T1A A;  1PZP A;  2W3D A;  1NZU A;  5KIZ A;  3OCN A;  5CXW A;  1CJF A;  2D01 A;  3JPU A;  1CQA A;  1S67 L;  1XPB A;  1HZO A;  3A3E A;  1TEM A;  4FH2 A;  4BJP A;  5KMW A;  2JE5 A;  4IBR A;  3BFC A;  1ZKJ A;  2ZQ9 A;  3IX3 A;  4S2N C;  5TBM B;  1Q2P A;  3HUM A;  1FSY A;  4GDN A;  5F82 A;  5G18 A;  5E2F A;  4LRX C;  4UQI M;  1KGE A;  2WKI A;  3JVV A;  5FAO A;  2X01 A;  2V1A A;  4BWI A;  3ZVT A;  4WM9 A;  3S1Y A;  4K0X A;  4RYE A;  4WYY A;  3U4L P;  3W4O A;  4KZA A;  3Q7V B;  4BBV A;  1S1Y A;  4FD8 A;  4PAU A;  1CEF A;  1SZV A;  2XA7 S;  3PAG A;  3IS2 B;  1NRF A;  4CLC D;  1T19 A;  2Y91 A;  2WZX A;  4KG2 A;  5IT5 A;  3EQU A;  1F9I A;  1GA0 A;  4MEZ A;  2I72 A;  2V20 A;  4LV3 A;  4PM6 A;  1KDW A;  5FAS A;  1GA9 A;  3C4O A;  5GHZ A;  1Y28 A;  1ZG6 A;  2M1C A;  2V0W A;  2YKH A;  1K38 A;  2H10 A;  5D3O A;  5F68 A;  1JWP A;  4OQI A;  3NCK A;  3DWZ A;  3HUO A;  1FCN A;  2J3W A;  2HGV A;  2VGJ A;  1I2W A;  3HBR A;  3W2Z A;  2W3G A;  4L9E A;  2FFY A;  5JYP A;  1YLJ A;  3NIA A;  2V1B A;  1JTG A;  5CX7 A;  4PM7 A;  3CIT A;  3V3R A;  1IOU A;  2W1T A;  4KZ3 A;  3Q82 A;  4X1L A;  2B95 A;  3LO7 A;  4S2J A;  4K0W A;  3ZGA B;  3ZCZ A;  4HBU A;  1TVF A;  3IXG A;  2JKT I;  3HL9 A;  1IYO A;  4EUV A;  1RGY A;  1XP4 A;  1HTZ A;  1DRM A;  1LL9 A;  1WYB A;  4R3B A;  5IU1 A;  4CLC B;  4Z1W A;  3UE1 A;  1VET B;  4XT2 A;  4U3T A;  4F94 A;  2VZW A;  3QP2 A;  3OPL A;  5HL1 A;  2Y2G A;  3CI6 A;  4R1G A;  3S7Q A;  3TJZ C;  5M19 A;  3K3C A;  4GCZ A;  5CED A;  3PTE A;  2ZL1 A;  2ZM8 A;  1T1C A;  4S2O A;  2DMW A;  3RTY A;  3OCL A;  2OAP 1;  1JTD A;  4JF6 A;  2JKF A;  4FOF A;  3FKV A;  4DMZ A;  3FKW A;  4B4Z A;  5JYO A;  2EXA A;  2WGW B;  2XA7 M;  4ZJ1 A;  1E3U A;  3FC7 A;  5FEF A;  4WLA A;  1OTD A;  2PD8 A;  4DE2 A;  3SH8 A;  4OQ0 A;  2QKP A;  2PAV P;  4XUX A;  5EVI D;  3B3X A;  3ZHH A;  2WGI A;  1K54 C;  2O9B A;  4CLC E;  5A93 A;  3UDI A;  4WN5 A; 
#chains in the Genus database with same CATH homology
 1XKZ A;  3GQZ A;  4WZ4 A;  3VFH A;  4WEJ A;  1DY6 A;  5I94 A;  3IWQ A;  1S6R A;  1Y54 A;  2DNS A;  1TDG A;  3IWO A;  4WMC D;  3MZE A;  3G35 A;  2XK1 A;  3IF5 A;  2H5S A;  4DDY A;  4E3N A;  1VM1 A;  2XGN A;  4RA7 A;  5CHM A;  3QHY A;  3PBR A;  3C7V A;  3DTM A;  4ZAM A;  3PBT A;  3WS1 A;  5DTK A;  4OPY A;  3ZDJ A;  4DF6 A;  3GRJ A;  4MNR A;  4KZ8 A;  5EVI A;  5GHY A;  4M3K A;  1KE4 A;  2JC7 A;  3HLW A;  2Y2N A;  2P9V A;  1RCJ A;  3NI9 A;  1YLT A;  3G4P A;  1XA7 A;  3MBZ A;  5EOE A;  5M18 A;  4KQQ A;  4X6T A;  5KSC A;  4E3M A;  3GSG A;  1CI8 A;  1JWZ A;  2BG1 A;  5A91 A;  5AQ7 A;  3BLM A;  4ZBE A;  4EUZ A;  2HP9 A;  4X69 A;  1K55 A;  2A3U A;  3A3D A;  4FCF A;  3IT9 A;  5EE8 A;  5FDH A;  4OOM A;  4B88 A;  2ZC3 B;  4CPK A;  4GOG A;  5HAI A;  3CMZ A;  3S22 A;  4XUZ A;  3G2Y A;  4KG6 A;  1MPL A;  4JPM A;  1BUE A;  2Y2Q A;  4OQH A;  5TFQ A;  4N92 A;  1HD8 A;  3OPP A;  3WS0 A;  3A3I A;  1DJB A;  4KZ6 A;  2G2U A;  1L0F A;  4N1X A;  4LV0 A;  3HUN A;  3ZNT A;  3TSG A;  2DRW A;  4S2N A;  2XEP A;  2Y2L A;  1YMS A;  3O88 A;  4R4R A;  3MFD A;  2OSU A;  1MWR A;  4E3O A;  1O07 A;  1SHV A;  1S0W A;  1Z6F A;  4H8R A;  2WAF A;  2X71 A;  2Z2M B;  5CTM A;  3MXR A;  1Q2Q A;  2Y4A A;  2ZM2 A;  3FZC A;  1K56 A;  2HDQ A;  1KVL A;  5EUA A;  5A90 A;  2GDN A;  4KEN B;  1K4F A;  5HAQ A;  2G2W A;  1N9B A;  3HLF A;  5CGX A;  1XX2 A;  4MLL A;  1MWU A;  3G32 A;  3N8L A;  3IH8 A;  4IBX A;  5EVI B;  2XFT A;  3VFF A;  1KE3 A;  2P9V B;  5KZH A;  3IF6 C;  3N8R A;  4LEN A;  3P98 A;  3NBL A;  5GL9 A;  3IQA A;  2PU2 A;  3MKE A;  4OLD A;  1VQQ A;  1NZO A;  1IEL A;  1W8Q A;  3N4I A;  5U47 A;  3IXH A;  4BL3 A;  3PBS A;  1LL5 A;  1FQG A;  1PW8 A;  3I7J A;  4BLM A;  5HAR A;  1RGZ A;  2XD5 A;  5F83 A;  5FQK A;  2RCX A;  3BEB A;  1L2S A;  1SDN A;  3LY3 A;  4QY6 A;  5FAQ A;  3G2Z A;  3NY4 A;  4FH4 A;  1ES2 A;  3UPP A;  5DTT A;  1K6S A;  4OVD A;  5J8X A;  1KDS A;  1K6R A;  2HDR A;  2Z2L B;  3M2J A;  4E3L A;  5L2F A;  2OLV A;  2EX9 A;  5TR7 A;  2ZC5 B;  1PI4 A;  1EI5 A;  1SCW A;  4DKI A;  3W4P A;  4BEN A;  1G68 A;  1GHP A;  2J9P A;  4JF4 A;  3P09 A;  5F1G A;  1GCE A;  4HES A;  1K25 A;  4RVA A;  1MWT A;  3VOZ A;  4S2P A;  3VP1 A;  3O86 A;  4JBF A;  1K54 A;  3UDX A;  1PZO A;  3HRE A;  5DF8 A;  3LEZ A;  1YT4 A;  3MXS A;  4OH0 A;  1L0E A;  4OPZ A;  4KG5 A;  2HPB A;  3C7U A;  4FSF A;  2ZQA A;  1ONG A;  3A3J A;  5DVA A;  3ZFZ A;  1BTL A;  5BOH A;  5AQA A;  3JYI A;  1LI9 A;  4NK3 A;  2J8Y A;  4YIN A;  5M1A A;  2OLU A;  1NXY A;  1FOF A;  3V5M A;  1L0G A;  2C6W B;  4R4S A;  3UY6 A;  3ISG A;  3NDG A;  3MKF A;  2HDS A;  3E2L A;  5CGS A;  1H8Z A;  3MZF A;  4X56 A;  3V39 A;  2XFS A;  2QZ6 A;  2WK0 A;  1K57 C;  3SH9 A;  4KZ5 A;  5CGW A;  4N1H A;  2WAD A;  2ZC4 B;  4DE3 A;  3BFG A;  2QMI A;  5GLB A;  4ZTK A;  5GHX A;  3AGE A;  3O87 A;  1LHY A;  1XGI A;  3GV9 A;  4BD1 A;  4C75 A;  1ESI A;  2Y2M A;  3W4Q A;  1J9M A;  5EVL A;  2Y2O A;  4C3Q A;  4GB7 A;  2V2F F;  1GHM A;  1W5D A;  5FI2 A;  4A5R A;  4GZB A;  4R0Q A;  4KZB A;  4UHU A;  2BLS A;  3BFE A;  3IXD A;  5FQ9 A;  1JVJ A;  3OPH A;  4E6X A;  2V1Z A;  1CEG A;  4PM8 A;  1BLC A;  2ZJ9 A;  3EQV A;  1CK3 A;  3PBO A;  4QU3 A;  5FA7 A;  4X55 A;  4HBT A;  2XDM A;  1KVM A;  4QY5 A;  3VP0 A;  1HVB A;  1OME A;  3GR2 A;  1BLP A;  5EOO A;  5IHV A;  3UDF A;  2R9W A;  1IKI A;  3OZH A;  2C5W B;  3FV7 A;  3VSL A;  3LCE A;  1QMF A;  1AXB A;  5EPH A;  1PWD A;  2Y2P A;  1YLY A;  4UA6 A;  3RXX A;  2ZD8 A;  1KGG A;  4OPQ A;  4JKT A;  1BUL A;  1IYP A;  3UNW A;  5HW3 A;  2J9O A;  2ZLY A;  3IH9 A;  4Y0U A;  1O7E A;  2ZQD A;  5TGF A;  3G30 A;  2XLN A;  4WMC A;  2B5R A;  3PBQ A;  2A49 A;  5GLA A;  1ZG4 A;  1W79 A;  3UN7 A;  3HLB A;  5E43 A;  3RXW A;  3VOY A;  5F1F A;  1NJ4 A;  5HAP A;  1IEM A;  3ZG7 B;  2FFF B;  4BL2 A;  5FQI A;  3ZVW A;  4U0T A;  4LV2 A;  4KQO A;  5DF9 A;  3BFF A;  4U0X A;  1ERO A;  5E2E A;  5E2G A;  4Z9Q A;  5FQM A;  3ZG0 A;  4KZ9 A;  4E3K A;  4EBN A;  4X68 A;  4P85 A;  3SS5 A;  4N9L A;  4ZJ2 A;  3HLC A;  3DWK A;  4OOY A;  1WYC A;  4RX3 A;  4DXB A;  4ID4 A;  3AGD A;  5FAP A;  1W7F A;  1IYQ A;  3Q7V A;  1QME A;  1ES3 A;  1MWS A;  4JLF A;  2JCH A;  2UWX A;  4QD4 A;  1RP5 A;  2IWC A;  4YFM A;  1PZP A;  3MZD A;  4L0L A;  1NZU A;  2XD1 A;  3OCN A;  2P74 A;  5CXW A;  3UE3 A;  4GDB A;  3D4F A;  3SOI A;  5FQQ A;  3W8K A;  2J7V A;  3ITA A;  4JXW A;  1XPB A;  3PBN A;  4D2O A;  2RL3 A;  1HZO A;  2ZMA A;  3A3E A;  1TEM A;  3C4P A;  4RX2 A;  4FH2 A;  3VP2 A;  4NET A;  3Q7Z A;  4BJP A;  5KMW A;  1PI5 A;  2JE5 A;  3HVF A;  4IBR A;  4KZ4 A;  4LV1 A;  4BQM A;  5CEC A;  3BFC A;  4ZJ3 A;  5AQ9 A;  1BSG A;  1I5Q A;  1ZKJ A;  1KGF A;  2ZQ9 A;  4S2N C;  3UE0 A;  4DRT A;  4PM9 A;  4DE0 A;  1BLS A;  3UO9 A;  1Q2P A;  1E3U D;  3ZNY A;  4ZDX A;  3M2K A;  4P0M A;  4E3J A;  2Q9M A;  2PBY A;  3M6H A;  3HUM A;  1FSY A;  5FQJ A;  3E2K A;  3N7W A;  2HP5 A;  5FSR A;  4GDN A;  5F82 A;  2EX6 A;  1W8Y A;  5G18 A;  1H5X A;  4KZ7 A;  5E2F A;  3C5A A;  4E6W A;  1LLB A;  1KGE A;  2WKI A;  5FAO A;  2X01 A;  3Q07 A;  2IWB A;  1MKI A;  3TG9 A;  1PIO A;  1K57 A;  2QPN A;  3IWI A;  1TDL A;  3ZVT A;  4WM9 A;  4XXR A;  1PWC A;  1K4E A;  3S1Y A;  4K0X A;  4RYE A;  4WYY A;  3W4O A;  4OON A;  4R3J A;  1ES5 A;  4KZA A;  4P87 A;  3Q7V B;  3O3V A;  3FYZ A;  5CHJ A;  3GMW A;  4OP8 A;  3UPN A;  3M6B A;  4Y7P A;  3GVB A;  2EX8 A;  2XF3 A;  1GHI A;  1YLP A;  3WRZ A;  3ZG9 B;  1MBL A;  4FD8 A;  1FCO A;  1CEF A;  3PAG A;  1NRF A;  3CG5 A;  2HDU A;  2H0Y A;  3WS4 A;  1IYS A;  2Y91 A;  2WZX A;  2XQZ A;  4KG2 A;  3EQU A;  1FSW A;  4QB8 A;  1GA0 A;  1LI0 A;  4MEZ A;  2I72 A;  2ZQ8 A;  4MBK A;  4Q8I A;  1ERQ A;  1YLZ A;  2V20 A;  4LV3 A;  4WZ5 C;  3CJM A;  3G31 A;  4PM6 A;  4S2I A;  2OV5 A;  1KDW A;  5FAS A;  1I2S A;  1SDE A;  2WZZ A;  3HLE A;  3TOI A;  1GA9 A;  3C4O A;  2XH9 A;  4Y0O A;  1ESU A;  5GHZ A;  1C3B A;  3VMA A;  4CJN A;  4EWF A;  2JBF A;  1ZG6 A;  3A3F A;  1K38 A;  1XA1 A;  4WBG A;  2ZQ7 A;  2WKH A;  2H10 A;  1CI9 A;  5D3O A;  1EWZ A;  3UPO A;  4R23 A;  3HLD A;  3IHA A;  3SS4 A;  1JWP A;  4OQI A;  1L0D A;  3NCK A;  3N6I A;  3DWZ A;  2PU4 A;  3HUO A;  1FR1 A;  3G34 A;  1E25 A;  1FCN A;  5HFO A;  2Q9N A;  2EFX A;  4PMA A;  5KSH A;  3BRM A;  3FWL A;  2VGJ A;  3N8S A;  1I2W A;  3HBR A;  4OKP A;  3CZD A;  1G6A A;  2EFU A;  2FFY A;  5JYP A;  1ES4 A;  1YLJ A;  2VGK A;  3Q1F A;  3NIA A;  1K56 D;  4UAA A;  1JTG A;  4EV4 A;  2WAE A;  1E4D A;  2Y2J A;  2ZM0 A;  2CC1 A;  3ZG8 B;  4PM7 A;  3BYD A;  3LY4 A;  1YLW A;  5EVI C;  3NDE A;  3IF6 A;  3V3R A;  4Y0T A;  4P6B A;  2Y2I A;  4K91 A;  4KZ3 A;  4S2K A;  1SKF A;  3VP3 A;  3BLS A;  3Q82 A;  3DW0 A;  1IKG A;  1YQS A;  4EBP A;  3LO7 A;  4QHC A;  2XR0 A;  3QNC A;  4S2J A;  4K0W A;  3ZGA B;  3RJU A;  3ZCZ A;  4LCM A;  4C6Y A;  4HBU A;  1K55 C;  1TVF A;  4X53 A;  2Y2H A;  2WGW A;  1ERM A;  3IXG A;  5CTN A;  3WWX A;  1BT5 A;  4WEK A;  3WRT A;  4B4X A;  1U60 A;  3HL9 A;  2HP6 A;  1IYO A;  1FR6 A;  4GKU A;  3VP4 A;  4N9K A;  1RGY A;  5DTS A;  5FI7 A;  5HX9 A;  3SH7 A;  1XP4 A;  5CER A;  1HTZ A;  1M6K A;  3GTC A;  1LL9 A;  2R9X A;  4KQR A;  1XGJ A;  1WYB A;  4JF5 A;  4OLG A;  2WGV A;  3ZG5 A;  4OP5 A;  4R3B A;  1DJC A;  5DF7 A;  1N4O A;  5GLD A;  4EQI A;  3QNB A;  3UE1 A;  4EBL A;  4U3T A;  3OC2 A;  2Y59 A;  4F94 A;  3OPR A;  4BD0 A;  5FI6 A;  3OPL A;  4S2M A;  4QJG A;  5HL1 A;  2Y2G A;  1PW1 A;  3ITB A;  2Y2K A;  4DXC A;  1DJA A;  3V3S A;  1H8Y A;  2WKE A;  4R1G A;  4OOL A;  4JXS A;  5CHU A;  3SS3 A;  5E2H A;  5M19 A;  4GD8 A;  3WS2 A;  1BLH A;  1WE4 A;  1KE0 A;  5CED A;  2EX2 A;  3VSK A;  3PTE A;  1BZA A;  2ZM8 A;  3IF6 B;  3BM6 A;  4S2O A;  1M40 A;  1ONH A;  3BFD A;  4S2L A;  3OCL A;  5FAT A;  1MXO A;  4O7D A;  5GLC A;  1XXM A;  4E3I A;  4DDS A;  1JTD A;  1NYY A;  4JF6 A;  2X02 A;  4GN2 A;  3BEC A;  2Y55 A;  1YMX A;  3FKV A;  1NYM A;  4MBF A;  2H0T A;  4IVK A;  3FKW A;  4LCL A;  4B4Z A;  4WEL A;  5JYO A;  4JXG A;  2EXA A;  2WGW B;  3IHB A;  4WZ5 A;  4ZJ1 A;  1E3U A;  1NY0 A;  5CRF A;  4PPR A;  4UA9 A;  4IED A;  5CEB A;  3NC8 A;  3Q81 A;  1FCM A;  4MBH A;  4IVI A;  3HLG A;  4JXV A;  1MY8 A;  1YM1 A;  4OQG A;  3SH8 A;  4DE2 A;  4OQ0 A;  3AGF A;  1PWG A;  2DCF A;  4GNU A;  4XUX A;  4DE1 A;  5EVI D;  3V50 A;  2EXB A;  3B3X A;  3PAE A;  3ZHH A;  5EEC A;  2ZQC A;  1ALQ A;  2IWD A;  1JWV A;  2WGI A;  4OPR A;  3IXB A;  1ZC2 A;  1PYY A;  1K54 C;  2ZC6 B;  3WS5 A;  4GD6 A;  2E8I A;  5AQB A;  4HEF A;  3S4X A;  5A93 A;  2WYX A;  3UDI A;  2ZC7 A;  4PM5 A;  4UA7 A;  5A92 A;  2WUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...