3S22A

Amp-c beta-lactamase (pseudomonas aeruginosa) in complex with an inhibitor
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
361
structure length
361
Chain Sequence
b'APADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
molecule tags Hydrolase/hydrolase inhibitor
source organism Pseudomonas aeruginosa
publication title Side chain SAR of bicyclic Beta-lactamase inhibitors (BLIs). 2. N-Alkylated and open chain analogs of MK-8712
pubmed doi rcsb
total genus 122
structure length 361
sequence length 361
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3s22A00
1EI5A 4WZ5C 5KSHA 5AQAA 4WEKA 2B5RA 1HD8A 5CTNA 5TFQA 3ZDJA 5AQ7A 1MY8A 1Q2QA 3WRZA 1IKIA 2WAEA 5A93A 5IHVA 4QY6A 1GHPA 5HW3A 4N1XA 1ZC2A 2Y2KA 4YINA 5E43A 3OCLA 3GR2A 1ZG4A 1HZOA 4OQHA 4WM9A 2ZM0A 4U0TA 4PM7A 2RL3A 5M18A 5TR7A 4R3JA 1MWSA 3HLBA 5DF8A 4E6WA 4CPKA 3LY3A 1IELA 5HAIA 1PYYA 5A90A 1K57C 4UHUA 4N9KA 3BRMA 3TG9A 3BFGA 4OPYA 3IF6B 2XLNA 3GRJA 1XGIA 3ZNYA 1JWPA 1YLYA 3HUOA 2WAFA 5E2HA 3AGFA 5HFOA 2WADA 4KZ3A 3ZG8B 2EFXA 1HTZA 4GNUA 4OQ0A 3WS2A 3CZDA 1KDSA 1DJBA 4KZBA 1W8YA 5A91A 3C5AA 4R4SA 5FQIA 5CEBA 1I5QA 2G2WA 5HARA 2PU2A 1K56D 1JTDA 1NYYA 4DE2A 2HDQA 4B4ZA 1MWRA 2XR0A 3DW0A 3IXBA 3Q82A 4S2JA 1KGGA 4ZAMA 3CG5A 5F83A 1YMXA 3VOZA 4EBNA 2C6WB 3UY6A 4E3LA 1TDGA 3ITBA 1FCOA 3HLEA 3IH8A 1BLHA 1E25A 3IWOA 4KG5A 4GDNA 2ZC3B 3M2JA 4QHCA 1WYBA 1G68A 4S2KA 4ZJ1A 3G35A 4GOGA 1YMSA 2XD1A 3QNCA 1YLWA 4WELA 3MKFA 4Z9QA 3C4PA 5GLBA 2WYXA 3MZFA 3Q7VA 4S2IA 5CHJA 2IWBA 3FWLA 2ZD8A 3MXSA 4LENA 4U0XA 3UDFA 3HUNA 4MBKA 3M6HA 1GA9A 4JPMA 4NETA 1YM1A 2EFUA 4IVIA 1WYCA 1XGJA 3I7JA 4P87A 4BD0A 4UA9A 3G32A 2HP6A 4KQQA 1NZOA 5FSRA 4PPRA 1MKIA 4L0LA 4N9LA 5DF7A 3HLDA 1YLTA 3B3XA 4JBFA 3ZVWA 3NI9A 1W8QA 3NIAA 3Q7VB 1DJCA 4R3BA 2P9VB 1FSYA 3GQZA 3FYZA 4JKTA 3CJMA 4X56A 5EVIC 3UPOA 3VSKA 1U60A 3SH9A 3ZGAB 3PBOA 5HL1A 4S2MA 1M40A 3N7WA 4Y7PA 3UDXA 1G6AA 3BFDA 3HL9A 4P85A 5E2FA 2XDMA 5GLCA 2H10A 2ZMAA 1HVBA 3ZVTA 2V1ZA 3PAEA 3BFFA 1ESIA 4CJNA 1GA0A 1NXYA 2Z2LB 1VQQA 2ZC5B 2HDUA 4EQIA 4WMCA 3ZFZA 3A3DA 3BYDA 1PZPA 4IBXA 1M6KA 1NY0A 2HDSA 3GV9A 4LV3A 4C3QA 4EWFA 3VP1A 3QHYA 2JC7A 1K56A 1FSWA 4C6YA 5FI7A 1NZUA 4GKUA 3O86A 5FQKA 3ZG0A 2ZJ9A 3S1YA 5FAPA 2H0TA 1K6SA 1SDNA 1IYQA 1CK3A 3OPHA 1XKZA 1BZAA 4PMAA 3UE1A 4LCMA 1KE4A 5FAOA 1BLCA 2A3UA 4KQOA 2WK0A 3DWZA 2GDNA 1PIOA 1PWGA 3BM6A 4IVKA 3BFEA 4PM8A 3ITAA 3O3VA 5FQ9A 3IWQA 5GL9A 4S2NC 4DDSA 5GLAA 1L0FA 1L0DA 3E2LA 3OC2A 4OQIA 2Z2MB 1LI9A 1K25A 5J8XA 1CEGA 2XFSA 3G30A 3WRTA 4ZJ3A 1K4FA 3BECA 2ZM8A 2EX9A 3S22A 3VP3A 3IXHA 5EUAA 5EECA 2QZ6A 2HDRA 2WZZA 1RGZA 1VM1A 3FKWA 3MZDA 1MPLA 1QMEA 3IHAA 1N4OA 4K0XA 2QPNA 1ZG6A 3ZNTA 2HP9A 3SS5A 5FQJA 2WGVA 1S6RA 3M2KA 3FKVA 3MXRA 2EX8A 4UA6A 2ZLYA 3JYIA 3V5MA 4BENA 4Y0TA 1DJAA 4E3KA 2XFTA 3PBNA 5FI6A 2C5WB 2V2FF 5G18A 2P9VA 3C7VA 5F82A 4QJGA 5KMWA 5CECA 4E3MA 4BD1A 5FAQA 4S2PA 4MEZA 3SS4A 4DXCA 4R0QA 1MWUA 2WUQA 2X02A 3NC8A 1IEMA 4IBRA 3V3SA 1XXMA 1ES5A 3IXGA 3IXDA 4NK3A 1ERMA 3UO9A 3GMWA 4QD4A 5TGFA 4KZ6A 5I94A 1YQSA 2HPBA 4MBFA 2Y2MA 3HBRA 4OP5A 2Y4AA 4ZJ2A 3HUMA 3IF5A 5E2GA 3DWKA 3NDEA 2WGWA 1JWVA 4FH2A 2HP5A 4OKPA 1K55C 3IH9A 3IQAA 4KZ4A 4R23A 2ZC6B 3P09A 3G31A 4BL3A 1GCEA 1XP4A 4QY5A 5KSCA 1S0WA 1EWZA 3PAGA 4BJPA 4KG6A 1RGYA 3RXXA 4M3KA 4K0WA 4KQRA 4JXSA 4QB8A 1LL5A 1C3BA 4C75A 1L0EA 5FQMA 1FQGA 5AQBA 1BLSA 2ZQ8A 4U3TA 1SKFA 1W5DA 2ZQ7A 3VP4A 3WWXA 4PM5A 5DVAA 3LCEA 1RCJA 3CMZA 4WZ4A 5EVID 2OV5A 5BOHA 2PBYA 3VFHA 2V20A 2OLUA 2PU4A 1NYMA 4DDYA 1ZKJA 2QMIA 3MKEA 4GZBA 4KZ7A 2Q9NA 3HLFA 2RCXA 2X01A 3V50A 5F1FA 3MBZA 2XK1A 4PM9A 1OMEA 3Q7ZA 3SS3A 3WS4A 1KE3A 4OP8A 2ZQDA 3UE3A 2XQZA 2WKIA 1LL9A 3E2KA 3NCKA 2DCFA 1FOFA 3Q07A 2ZC7A 1JTGA 1CI8A 5CRFA 3C7UA 4BLMA 1KGEA 1PWCA 3NY4A 1YLZA 3OPRA 2J9PA 1KE0A 4OPQA 3DTMA 2Y2OA 4DF6A 5FDHA 1K4EA 2BG1A 3PBTA 5CGSA 3UPPA 3S4XA 1QMFA 4ZDXA 1K54C 4MNRA 2VGJA 3BFCA 3O87A 4P6BA 4KENB 4PM6A 1BLPA 4OPZA 4JXWA 1IKGA 1PW8A 1ES3A 1ONHA 5EOOA 1SCWA 1Z6FA 1XPBA 1TDLA 2J8YA 4D2OA 1CEFA 5CGXA 3UE0A 2ZM2A 3IHBA 1K57A 1IYPA 4HESA 1O7EA 3EQVA 3AGDA 4JXVA 2DRWA 1KGFA 1H8YA 3N8SA 4O7DA 1FCNA 1FR6A 2XD5A 4RX3A 2Y91A 3BLMA 1K55A 2WGWB 3A3IA 3IWIA 3SH7A 5GHZA 1CI9A 1ONGA 4EBLA 2H0YA 3GTCA 1KDWA 3WS0A 3V3RA 1EROA 1TEMA 4XUXA 1ESUA 4X68A 5JYPA 4R4RA 3WS1A 2Y2PA 3GSGA 4ZBEA 4JF6A 3G4PA 4E3JA 4OPRA 3MZEA 1SHVA 4OH0A 4YFMA 4KZAA 3A3FA 5M1AA 3VP2A 2CC1A 3VP0A 1IYOA 4BQMA 4QU3A 3W4OA 1SDEA 3BEBA 3N6IA 3NBLA 4WMCD 4FCFA 5EVLA 2XEPA 1L2SA 4HEFA 5EOEA 1YLJA 5F1GA 1W79A 1PW1A 3ZHHA 4XXRA 2BLSA 3V39A 5DTKA 4OOMA 2EXBA 1E3UA 2VGKA 4ZTKA 1JWZA 1H8ZA 4JXGA 3ISGA 4OOLA 4OONA 1GHIA 4S2LA 1MBLA 2ZQCA 3M6BA 1K38A 3W8KA 1FCMA 3RJUA 2ZQAA 4UAAA 2R9WA 5FATA 3TSGA 4N1HA 4KZ9A 5GLDA 4WYYA 3LY4A 4DKIA 5EE8A 4GN2A 2EX2A 4RYEA 4WBGA 3VSLA 1IYSA 4OVDA 3HREA 3IT9A 3UDIA 2WZXA 5U47A 4N92A 5CXWA 4RX2A 3N8LA 2EXAA 4B88A 1LI0A 2Y2NA 3MFDA 4P0MA 3ZG5A 2WKHA 4KZ5A 2G2UA 4GD8A 2Y55A 1K54A 2R9XA 3NDGA 3AGEA 5FASA 4DRTA 1I2WA 3SH8A 4WEJA 5HAQA 4XUZA 3UPNA 5CHUA 5JYOA 3VMAA 1MWTA 3O88A 2Y2GA 3PBRA 1H5XA 5CERA 1XX2A 2WKEA 1XA1A 5CTMA 1NRFA 4EUZA 2J7VA 5CEDA 5E2EA 5FA7A 1BT5A 3D4FA 4HBTA 2E8IA 4JF5A 3Q81A 1Q2PA 2XF3A 2JCHA 3PBQA 4E3IA 4WZ5A 4FSFA 3IF6C 5FQQA 1W7FA 3FV7A 4MBHA 4X53A 4B4XA 1I2SA 2ZC4B 2OSUA 3Q1FA 5GHYA 3BLSA 3ZG9B 4E6XA 1GHMA 2ZQ9A 5DTTA 1RP5A 3OPPA 1DY6A 1LLBA 1XA7A 5EVIA 2XGNA 3FZCA 5M19A 4LV1A 4RVAA 1YLPA 2Y2HA 5D3OA 2Y2LA 4H8RA 2Y2QA 1J9MA 1BSGA 3SOIA 3GVBA 2X71A 3OPLA 2FFYA 2IWDA 4DE1A 3N8RA 3TOIA 2XH9A 4EBPA 3N4IA 2WGIA 5A92A 1O07A 5HAPA 3UNWA 2A49A 3G2ZA 3EQUA 4E3OA 4FH4A 4Y0OA 1NJ4A 1PI5A 5CGWA 1BULA 2Y2JA 2Y59A 4KZ8A 3W4PA 1K6RA 2H5SA 5CHMA 3ZG7B 2OLVA 3VFFA 2EX6A 3WS5A 4UA7A 2J9OA 4X6TA 3ZCZA 3OCNA 4X69A 4FD8A 4LCLA 2UWXA 4S2NA 5EPHA 4EV4A 3HVFA 3IF6A 4OQGA 2JE5A 2Q9MA 4OOYA 3C4OA 3A3EA 5HX9A 1WE4A 4ID4A 1E3UD 1PWDA 3HLGA 5DF9A 3QNBA 1FR1A 2IWCA 4HBUA 4OLGA 2Y2IA 3W4QA 3G2YA 4R1GA 4GD6A 3HLCA 4DXBA 3LO7A 1Y54A 1N9BA 3PBSA 4DE3A 4A5RA 1ES2A 1AXBA 4LV2A 3RXWA 1E4DA 4RA7A 4Q8IA 2JBFA 5EVIB 5GHXA 3PTEA 2FFFB 1TVFA 3OZHA 5AQ9A 1BUEA 4F94A 4Y0UA 3G34A 4K91A 3UN7A 5L2FA 3VOYA 4S2OA 4IEDA 2DNSA 4JF4A 1LHYA 4MLLA 4OLDA 4E3NA 4GDBA 4BL2A 1KVLA 4KG2A 1BTLA 3LEZA 1L0GA 1JVJA 1PI4A 3P98A 4DE0A 4GB7A 5KZHA 1YT4A 2P74A 5FI2A 1ERQA 1ES4A 1PZOA 1KVMA 5DTSA 3A3JA 1ALQA 3HLWA 4JLFA 1MXOA 2I72A 4LV0A 4X55A
chains in the Genus database with same CATH superfamily
1KOUA 5AQAA 5F68A 5CTNA 3ZDJA 1MY8A 3WRZA 1IKIA 2WAEA 3NULA 4N1XA 2GNXA 2Y2KA 4MDZA 2B18A 5HAIA 4OPYA 3DTKA 3T4KA 4KZ3A 4GNUA 4OQ0A 3WS2A 1W8YA 5A91A 1DP8A 5FQIA 3LI8A 4ARZB 5HARA 3UMDA 1J3WA 1JTDA 1K56D 2XR0A 3IXBA 1TS6A 3Q82A 4S2JA 4ZAMA 2Y8HA 4E3LA 3O5YA 1BLHA 2VA0A 2ZC3B 3M2JA 2WKQA 1G68A 4S2KA 3QP8A 2WKRA 3G35A 4Z9QA 3QNCA 1YLWA 3MKFA 2WYXA 3MXSA 3HCYA 2Z6CA 2EFUA 4IVIA 3OOVA 3I7JA 1ZTUA 4BD0A 1IOUA 3G32A 2HP6A 3RFBA 1MKIA 3HLDA 3K2NA 3B3XA 2P04A 3NIAA 4LFUA 1DRMA 2JKGA 4X56A 3GQZA 3CJMA 1UWPX 5EVIC 3UE6A 3KX0X 1OJGA 4Y13A 5E2FA 5GLCA 2ZMAA 1ESIA 1T18A 4CJNA 2HDUA 1S66L 2JKTM 3BYDA 4X25A 2HDSA 2O9CA 2GX5A 3MF0A 2KLIA 4HY8A 3VP1A 1FSWA 3MXQA 2H0TA 5FAPA 1K6SA 1MKMA 4NXFA 1PFLA 4PMAA 5FAOA 1W63M 2VKSA 2L4RA 4PM8A 5GL9A 1L0DA 4EUVA 3OC2A 1SKOB 3IXHA 4HI4A 2HDRA 3FKWA 1H8MA 3NOPC 1MPLA 1QMEA 1N4OA 3LYXA 2HP9A 3R4KA 2WGVA 3M2KA 3MXRA 3FKVA 2EX8A 3V5MA 4NEED 4F3LA 3CLOA 2V2FF 4QJGA 3BY9A 3SS4A 4DXCA 3EOIA 1IEMA 3DTIA 1XJ3A 1ES5A 1ERMA 4GCZA 1YQSA 1LL8A 3DWKA 3NJAA 2W3EA 5F6AA 1V9ZA 2MJ6A 4O8GA 3IH9A 4KZ4A 3FPWA 3P09A 4EU0A 2QKPA 1EWZA 2I9VA 3EGXC 3UB5P 2V0WA 2A24A 4KQRA 1LL5A 3CAXA 4PM5A 1BLSA 1W5DA 3SZTA 3LCEA 1RCJA 4WZ4A 4MCWA 2V20A 2YKFA 2PU4A 2QMIA 3HLFA 1LSVA 2WKIA 1LL9A 1S4SA 4R70A 3NCKA 2DCFA 1OTDA 2PDRA 2ZC7A 1CI8A 4MN6A 4BLMA 3H7WA 3LIAA 4O01A 3NY4A 1YLZA 3EEHA 3OPRA 2J9PA 3ULFA 4JGPA 2ZL1A 3EWKA 4MN7A 2JKFA 3DBAA 1QMFA 2JKRI 3S7OA 3BFCA 4KENB 1BLPA 3MQOA 2PRFA 1ONHA 4E04A 1Z6FA 1XPBA 1OT9A 2O9BA 2ZM2A 3IHBA 3EQVA 1HLUP 3AGDA 2DRWA 4EEPA 1DP6A 1FCNA 1FR6A 2XD5A 1OJ5A 3RH8B 3IWIA 3SH7A 4Q0IA 1ONGA 2OAQ1 3GTCA 2R78A 4II7A 1TEMA 2VGLM 1XJ2A 4GJ4A 1SHVA 2JKRM 4OH0A 5M1AA 3UMEA 2CC1A 4BQMA 4QU3A 3W4OA 1K0KA 1SDEA 2W1TB 5EVLA 2XEPA 3NOUC 1PW1A 2J3TD 2BLSA 1W63Q 1E3UA 4JXGA 3ISGA 1GHIA 1K38A 4Q0JA 1N9NA 2L0WA 2ZQAA 2EWWA 2R9WA 4UAAA 5FATA 4GHIA 3RJUA 3T12B 1Z09A 3TSGA 4KZ9A 5GLDA 4WYYA 5EE8A 1GSVA 4WBGA 1IYSA 4OVDA 3S7NA 1LI0A 3ZG5A 5HWWA 2Y55A 1K54A 2R9XA 1H0MA 3NDGA 3AGEA 5FASA 1T1AA 2P08A 3SH8A 5HAQA 5DFYA 1XFQA 3KYZA 4ZRRA 1YAXA 1S1YA 3PBQA 1UWNX 5HDDA 4MBHA 3UB7A 5GHYA 1VB6A 2JN7A 1GHMA 5DTTA 2L1MA 3IX8A 2XGNA 4LV1A 2Y2HA 1AWIA 3SOIA 3OPLA 2IWDA 4DE1A 2DMWA 2XH9A 4FH4A 5MC7A 3UB8A 5CGWA 2Y59A 3W4PA 5CHMA 3VFFA 5FEGA 4BBVA 2J9OA 3MQQA 4Z1WA 4FD8A 2UWXA 4OOYA 3T1RA 5HX9A 1WE4A 4ID4A 2O99A 3HLGA 3QNBA 1FR1A 3T4JA 2IWCA 4HBUA 2IA2A 1OTEA 3A0VA 4R1GA 2QWSA 1Y54A 1N9BA 4DE3A 4RA7A 2HJ9C 4HJ6A 5GHXA 4LRYC 3W2ZA 2FFFB 3LIBA 2ZOIA 1GSWA 3ZYTA 4IEDA 2DNSA 1LHYA 1NLZA 5HWTA 3T4OA 1KVLA 4KG2A 3LEZA 1JVJA 1YT4A 2P74A 3DTEA 2VV7A 2GJ3A 5KSHA 1HD8A 4P6ZM 2E8JA 5TFQA 5AQ7A 1Q2QA 5A93A 4QY6A 4CLCE 3LGOA 2Z6DA 3QP4A 4YINA 4FUWA 1YPRA 3GR2A 2FH5A 3ICYA 3E98A 3SW1A 3LUQA 2D02A 3IF6B 3GRJA 1XGIA 3ZNYA 1JWPA 5IS1A 2WAFA 1DP9A 2WADA 1YSPA 2EFXA 1SKOA 2VZWA 3T4TA 1FIKA 3CZDA 4R4SA 4CLCA 2G2WA 3VE3A 1NYYA 2HDQA 4B4ZA 1MWRA 4D60A 1KGGA 1IFQA 3VOZA 5F5YA 3UY6A 1TDGA 5TBMB 3NOTC 4ZJ1A 4GOGA 4WELA 5HZHA 3Q7VA 1OTAA 2A2LA 3HUNA 3M6HA 1GA9A 1XGJA 4UA9A 5FSRA 3NI9A 2W3HA 3Q7VB 2W27A 1DJCA 3KSIA 3S7QA 4R3BA 1FSYA 2ZL1B 3PBOA 5EM1A 4S2MA 5HL6A 3HL9A 4P85A 1NWZA 2XDMA 2J3WA 1HVBA 3ZVTA 2V1ZA 2OOLA 3BFFA 5EVEA 1GA0A 1NXYA 4WMCA 1M6KA 1NY0A 1K56A 3E4QA 4C6YA 5FI7A 1NZUA 1F98A 4GKUA 4EESA 2ZJ9A 3S1YA 3KSGA 1IYQA 1MC0A 1N9OA 2OWHA 4KQOA 2WK0A 3DWZA 3BM6A 1LT0A 3BFEA 3O3VA 3IWQA 4S2NC 5GLAA 3BWLA 2VK3A 3U4LP 5DKLA 5EM0A 5J8XA 1K25A 2XRNA 2XFSA 3BECA 2ZM8A 2EX9A 4HH3A 3S22A 5EUAA 2BASA 3IHAA 5HPFA 4K0XA 1ZG6A 4I38A 5FQJA 1S6RA 3GECA 4BENA 1H3QA 3EGDC 4ME4A 4UA6A 2A24B 5G18A 2C5WB 5HD3A 2P9VA 4E3MA 4S2PA 2WUQA 4IBRA 4PKYG 1XXMA 1EW0A 3IXDA 4QD4A 4F3LB 4KZ6A 5I94A 4MBFA 4EERA 2Y2MA 2VV8A 3HBRA 5J4EA 3NDEA 4OKPA 1K55C 4PHTA 3IQAA 2ZC6B 3G31A 2M7UA 1XP4A 4QY5A 4BBUA 3G6OA 4BJPA 4KG6A 1RGYA 2V1AA 5A8BA 2QJ7A 5FQMA 3T1QB 5HPIA 5AQBA 3VP4A 2ZQ7A 3CUEC 3LIEA 3D9YA 2ZOHA 3CMZA 2Q9NA 3QP1A 4R38A 3MBZA 4PM9A 4LRXC 3R7WA 3WS4A 2H28A 3OLOA 3UE3A 3H7WB 2XQZA 1TD5A 3LR5A 3K3DA 3P7NA 1JTGA 5CRFA 1KE0A 3DTMA 5FDHA 2BG1A 1K54C 1P97A 1PW8A 5EOOA 2XSSA 2J8YA 4D2OA 5CGXA 1K57A 2XA7M 4HESA 4R6LA 1O7EA 2QYBA 3BW6A 4JXVA 1KGFA 5AVFA 2CMNA 3N8SA 4O7DA 1TS8A 4RX3A 2O9AA 1PNEA 3VOLA 4HHDA 2M1CA 3T50A 3H9WA 2HJEA 3D3OA 4X68A 2Y2PA 4ZBEA 4JF6A 3MZEA 3IBJA 2ZMVA 2W0NA 3PHYA 5HWVA 4YNRA 4HEFA 1YLJA 5F1GA 1PRQA 1W79A 3ZHHA 3V39A 2PYPA 4OOMA 1JWZA 1H8ZA 3F1OB 1D1JA 4DKIA 3MS6A 3JVUA 3P01A 3UDIA 3CUEA 2KOIA 5U47A 2NUTC 3N8LA 2EXAA 4XT2A 4B88A 2Y2NA 1WA9A 1ODVA 4DRTA 3NECA 4WEJA 4HNBA 5CHUA 3VMAA 3PBRA 1H5XA 4L9EA 3IS2B 1XX2A 4IUHA 5E2EA 3T1XA 4XT2B 4FSFA 5FQQA 2ZC4B 3Q1FA 3H82A 4E6XA 3OPPA 1DY6A 5TBMA 2W3DA 5M19A 4RVAA 5D3OA 4H8RA 2Y2QA 3GVBA 3N8RA 4LRZE 4WF0A 3TOIA 5A92A 1O07A 3UNWA 5AJGA 3G2ZA 4KZ8A 2H5SA 3WS5A 4X6TA 3OCNA 4LCLA 4S2NA 4YOFA 4CLCD 3HVFA 3IF6A 4OQGA 1PWDA 4NKPA 5DF9A 5AVEA 4OLGA 2Y2IA 3W4QA 1VEUA 1S1ZA 3HLCA 4A5RA 1ES2A 4H6JB 4LV2A 4EEUA 2JBFA 1TVFA 4F94A 4UEYA 2VLGA 4K91A 4S2OA 5G4YA 2PAVP 2PR6A 4BL2A 4DJ2A 3BJNA 1PI4A 3P98A 4DE0A 1ES4A 5DTSA 1KVMA 3HLWA 4LV0A 1EI5A 3MMHA 3FPVA 4WZ5C 4WEKA 2B5RA 3BQ8A 5IHVA 1GHPA 1MZUA 5E43A 2YKHA 3OCLA 1HZOA 2ZM0A 4P6ZS 4PM7A 2RL3A 4U0TA 1MWSA 4E6WA 3IX4A 3LY3A 1IELA 1PYYA 4UHUA 1S4RA 3BRMA 2M7VA 1CQAA 4L9FA 4HOIA 3HUOA 5E2HA 3PR6A 4Y15A 2J80A 2OWJA 1KDSA 4YWZA 3LR4A 3JVVA 3L7HA 5CEBA 1I5QA 3OBFA 2PU2A 3LR3A 4DE2A 5CX7A 4ETZA 3CG5A 1P9RA 1FCOA 1UGUA 3HLEA 3IH8A 3S7PA 1E25A 4GDNA 2WKPA 1WYBA 1A0KA 3LIFA 1D7EA 2XD1A 3GDIA 3C4PA 4S2IA 2ZD8A 2PR5A 4I3IA 4NXGA 4JPMA 4NETA 2W1RA 1WYCA 4P87A 4PPRA 4L9GA 3LIDA 3ZVWA 1W8QA 2P9VB 3FYZA 4G3KA 3KYQA 3VSKA 1STZA 3SH9A 2JHEA 5HL1A 1M40A 3N7WA 1G6AA 2H10A 4I3AA 4G3WA 2HZ5A 2Z2LB 1VQQA 4EQIA 3CI6A 3A3DA 1LSXA 3QP6A 3D72A 1N9LA 4LV3A 4IBXA 1ACFA 4EWFA 2JC7A 4ARZA 4UQIM 5FQKA 3ZG0A 4O0PA 1CK3A 4CQHA 1XKZA 1BZAA 1P9WA 2LB5A 1KE4A 1BLCA 2A3UA 5EFWA 1PWGA 4EETB 4IVKA 4DDSA 4HJ3A 3E2LA 3T4LA 1LI9A 1CEGA 3G30A 3WRTA 1K4FA 2O0YA 3PXPA 2QZ6A 4PAUA 1RGZA 2VEAA 3MZDA 3MSHA 2V0UA 1VEUB 4HIAA 4Y0TA 1DJAA 2XFTA 3PBNA 5FI6A 4GLQA 3C7VA 5F82A 4R0QA 2EA9A 1MWUA 2X02A 4HH2A 5J7EA 3IXGA 4NK3A 3UO9A 5TGFA 4OP5A 4HQAA 1Y28A 5E2GA 1NLYA 2WGWA 3F1NB 4CLCB 4FH2A 5DFXA 2HP5A 3R7WB 4R23A 1GCEA 3CPTB 1S0WA 3RXXA 4M3KA 5FEFA 4K0WA 5HSQA 4JXSA 4C75A 3WWXA 4U3TA 1SKFA 5DVAA 5BOHA 2OV5A 2PBYA 2HV1A 4DDYA 3JPUA 1ZKJA 3MKEA 3C38A 4GZBA 4KZ7A 5F1FA 2RCXA 4FOFA 3V50A 2XK1A 3Q7ZA 1KE3A 2ZMFA 2FZ0A 3E2KA 1VETB 3Q07A 2V1BA 1PWCA 3KSHA 4DF6A 3PBTA 5CGSA 3UPPA 3S4XA 2XROA 3B33A 4JGQA 3O87A 2V8CA 4PM6A 4RQ9A 2G7UA 4JXWA 1IKGA 1OTBA 3UE0A 1IYPA 3ZQ5A 1H8YA 3KO6A 4GHIB 1K55A 5GHZA 1CI9A 1KDWA 3WS0A 1EROA 4XUXA 3LFVA 2J3TC 4MN5A 1T1CA 2ACGA 3G4PA 4E3JA 4YFMA 1G28A 4B9OA 3VP0A 4M4XA 3BEBA 4WMCD 5EOEA 4NXBA 5DTKA 2VGKA 4ZTKA 3LR0A 3LICA 4OONA 4S2LA 3W8KA 1ZHHB 4DMZA 3MQ0A 4CLCC 3HJKA 1BYWA 4N1HA 3LY4A 1Y4OA 4GN2A 2EX2A 3HJIA 3IT9A 2WZXA 1CJFA 1T19A 3VE4A 1YSQA 3BQAA 3MFDA 4HP4A 3U2AA 2AVXA 2G2UA 2PYRA 4GD8A 3BY8A 3UPNA 5JYOA 3TJZC 3O88A 2Y2GA 4Y3IA 3T1SA 5CTMA 1NRFA 4EUZA 3F1OA 5L07A 3DAVA 1VHMA 1BT5A 2KDKA 3D4FA 4KQDA 1Q2PA 2JCHA 4E3IA 4WZ5A 1TS0A 4B4XA 2VV6A 1RP5A 1LLBA 5EVIA 3FZCA 1YLPA 2Y2LA 4G3VA 2K7SA 1J9MA 2VGLS 2FFYA 3MR0A 4EBPA 2WGIA 1G5UA 3EQUA 4E3OA 4Y0OA 1BULA 3ZG7B 2OLVA 2EX6A 4UA7A 4GS9B 3ZCZA 4EV4A 2Q9MA 1E3UD 4HJ4A 5DKKA 3IBRA 3G2YA 5K5BA 4DXBA 4Q0HA 2Y79A 1LSWA 1E4DA 4Q8IA 5HDSA 5TJJA 1XJ6A 4IHQA 5EVIB 5KIZA 1GSXA 1BUEA 1XFNA 5AQ9A 4BWIA 3G34A 3UN7A 5L2FA 3CHWP 3TE8A 4GDBA 2JKTI 2BTFP 3CPTA 5L8MA 4KUKA 1L0GA 5HDCA 4GB7A 2Q0OA 5FI2A 3UB6A 1ERQA 1PZOA 3A3JA 1ALQA 3VV4A 2I72A 4X55A 2XA7S 1TS7A 4R3AA 1OPXA 4PKYA 5HW3A 2HGVA 2W3FA 1ZC2A 1F9IA 3C2WA 4QPRA 2KX6A 1ZG4A 2QJ5A 4OQHA 4WM9A 5M18A 5TR7A 4R3JA 3HLBA 5DF8A 4CPKA 5A90A 4NXEA 1K57C 4N9KA 3TG9A 3BFGA 2VJWA 2W3GA 1SZVA 2XLNA 1YLYA 3AGFA 5HFOA 3ZG8B 2LB9A 1HTZA 1DJBA 4KZBA 4X1LA 3C5AA 5EV0A 2NUPC 3DW0A 2HF6A 5F83A 3NHQA 2EWVA 1YMXA 3MJQA 3A0RA 2C6WB 4EBNA 5F69A 3ITBA 4Y17A 2PT7A 3IWOA 4H6JA 4KG5A 4QHCA 4GS9A 2V9AA 5GLBA 1YMSA 3KYEA 3MZFA 5CHJA 2IWBA 3FWLA 4U0XA 4LENA 3UDFA 4MBKA 5DJTA 1XJ4A 1YM1A 4KQQA 1NZOA 4L0LA 4N9LA 5DF7A 4JGRA 1YLTA 4JBFA 4JGOA 5C5KA 4JKTA 3UPOA 1U60A 3ZGAB 2QHKA 4KUOA 3T4SA 4Y7PA 1D06A 3IX3A 3UDXA 3BFDA 3PAEA 3FG8A 2ZC5B 5G4ZA 3ZFZA 1PZPA 4EW7A 4C3QA 3GV9A 3QHYA 5L09A 3O86A 4DJ3A 4WLAA 1SDNA 3E4PA 3OPHA 1X0OA 3UE1A 4LCMA 2PBDP 2GDNA 4QWOA 1PIOA 3ITAA 5FQ9A 1L0FA 4OQIA 2Z2MB 5LBRA 4EQ1A 4ZJ3A 3VP3A 5EECA 3LEQA 5J3WA 2WZZA 1VM1A 4X1MA 3T4QA 2QPNA 4WN5A 3ZNTA 3CITA 3SS5A 3LI9A 2ZBBA 2ZLYA 3JYIA 4E3KA 5KMWA 5CECA 4BD1A 3C30A 5FAQA 2B02A 4MEZA 3NC8A 1G6OA 3V3SA 5HD5A 1V9YA 3GMWA 2HPBA 2Y4AA 4ZJ2A 3HUMA 3IF5A 1JWVA 4K08A 5IU1A 4BL3A 5KSCA 3PAGA 4EXOA 2K31A 4QB8A 1C3BA 1L0EA 4LGWA 1FQGA 2ZQ8A 5EVID 3VFHA 4AFIA 2VX8A 2OLUA 1NYMA 2INWA 4LLOB 4FTXA 2X01A 4NG2A 1OMEA 3SS3A 3V67A 4OP8A 2ZQDA 3L9KA 3CWFA 2OAP1 1FOFA 1VETA 1T1BA 3B47A 3E4OA 3C7UA 4GW9A 2PHYA 1KGEA 5FDSA 4OPQA 4B93A 2Y2OA 1K4EA 3UB9A 4ZDXA 4IJGA 4MNRA 2VGJA 4P6BA 4ETXA 4OPZA 1ES3A 5IT5A 1SCWA 1TDLA 3FC7A 1CEFA 1S67L 4I39A 5I5LA 1OT6A 2Y91A 2W1TA 3BLMA 2WGWB 3A3IA 3E0YA 3F1NA 3C8CA 4BMWA 4EBLA 2H0YA 1FILA 3MFXA 3V3RA 1ESUA 5JYPA 4R4RA 3WS1A 3GSGA 4Y2FA 4OPRA 4KZAA 3A3FA 3VP2A 3F1PA 3K3CA 1IYOA 3EEAA 3N6IA 3NBLA 4DN0A 4FCFA 1L2SA 4XXRA 2EXBA 4WL9A 4OOLA 4UQIS 1MBLA 2ZQCA 3M6BA 3A0SA 1FCMA 4LPZA 3QP5A 2V8FA 4RYEA 3VSLA 3HREA 4N92A 3PYPA 5CXWA 1F2KA 4RX2A 1OTIA 4P0MA 2WKHA 1F5MA 4KZ5A 4I3JA 1I2WA 2K2NA 4XUZA 1MWTA 2P7JA 5CERA 2WKEA 3RTYA 3TW8A 2B95A 1XA1A 2J7VA 5CEDA 5FA7A 1NRJA 4HBTA 2E8IA 4JF5A 3Q81A 2XF3A 4Y5FA 3IF6C 1W7FA 3FV7A 4ESPA 4X53A 1I2SA 2OSUA 1JNUA 3BLSA 3ZG9B 2GZAA 2ZQ9A 1XA7A 2D01A 1BSGA 2X71A 4WUJA 3N4IA 5L10A 4I5SA 5HAPA 3TRCA 2A49A 1L3LA 1NJ4A 2PD7A 1PI5A 2Y2JA 1TF1A 5FL3A 1K6RA 1YKDA 5DJUA 4X69A 5EPHA 2JE5A 3C4OA 3A3EA 3QP2A 4HP9A 4GD6A 3LO7A 3PBSA 4BBTA 3F1PB 1AXBA 3RXWA 2PD8A 4IUKA 4MMNA 3PTEA 3OZHA 3KSFA 4Y0UA 3VOYA 3B42A 4JF4A 4MLLA 4OLDA 4E3NA 1BTLA 5KZHA 1CF0A 1P0ZA 3IS2A 4JLFA 3H82B 1MXOA 2UV0E
chains in the Genus database with same CATH topology
1EI5A 4WZ5C 5KSHA 5AQAA 4WEKA 2B5RA 1HD8A 5CTNA 5TFQA 3ZDJA 5AQ7A 1MY8A 1Q2QA 3WRZA 1IKIA 2WAEA 5A93A 5IHVA 4QY6A 1GHPA 5HW3A 4N1XA 1ZC2A 2Y2KA 4YINA 5E43A 3OCLA 3GR2A 1ZG4A 1HZOA 4OQHA 4WM9A 2ZM0A 4U0TA 4PM7A 2RL3A 5M18A 5TR7A 4R3JA 1MWSA 3HLBA 5DF8A 4E6WA 4CPKA 3LY3A 1IELA 5HAIA 1PYYA 5A90A 1K57C 4UHUA 4N9KA 3BRMA 3TG9A 3BFGA 4OPYA 3IF6B 2XLNA 3GRJA 1XGIA 3ZNYA 1JWPA 1YLYA 3HUOA 2WAFA 5E2HA 3AGFA 5HFOA 2WADA 4KZ3A 3ZG8B 2EFXA 1HTZA 4GNUA 4OQ0A 3WS2A 3CZDA 1KDSA 1DJBA 4KZBA 1W8YA 5A91A 3C5AA 4R4SA 5FQIA 5CEBA 1I5QA 2G2WA 5HARA 2PU2A 1K56D 1JTDA 1NYYA 4DE2A 2HDQA 4B4ZA 1MWRA 2XR0A 3DW0A 3IXBA 3Q82A 4S2JA 1KGGA 4ZAMA 3CG5A 5F83A 1YMXA 3VOZA 4EBNA 2C6WB 3UY6A 4E3LA 1TDGA 3ITBA 1FCOA 3HLEA 3IH8A 1BLHA 1E25A 3IWOA 4KG5A 4GDNA 2ZC3B 3M2JA 4QHCA 1WYBA 1G68A 4S2KA 4ZJ1A 3G35A 4GOGA 1YMSA 2XD1A 3QNCA 1YLWA 4WELA 3MKFA 4Z9QA 3C4PA 5GLBA 2WYXA 3MZFA 3Q7VA 4S2IA 5CHJA 2IWBA 3FWLA 2ZD8A 3MXSA 4LENA 4U0XA 3UDFA 3HUNA 4MBKA 3M6HA 1GA9A 4JPMA 4NETA 1YM1A 2EFUA 4IVIA 1WYCA 1XGJA 3I7JA 4P87A 4BD0A 4UA9A 3G32A 2HP6A 4KQQA 1NZOA 5FSRA 4PPRA 1MKIA 4L0LA 4N9LA 5DF7A 3HLDA 1YLTA 3B3XA 4JBFA 3ZVWA 3NI9A 1W8QA 3NIAA 3Q7VB 1DJCA 4R3BA 2P9VB 1FSYA 3GQZA 3FYZA 4JKTA 3CJMA 4X56A 5EVIC 3UPOA 3VSKA 1U60A 3SH9A 3ZGAB 3PBOA 5HL1A 4S2MA 1M40A 3N7WA 4Y7PA 3UDXA 1G6AA 3BFDA 3HL9A 4P85A 5E2FA 2XDMA 5GLCA 2H10A 2ZMAA 1HVBA 3ZVTA 2V1ZA 3PAEA 3BFFA 1ESIA 4CJNA 1GA0A 1NXYA 2Z2LB 1VQQA 2ZC5B 2HDUA 4EQIA 4WMCA 3ZFZA 3A3DA 3BYDA 1PZPA 4IBXA 1M6KA 1NY0A 2HDSA 3GV9A 4LV3A 4C3QA 4EWFA 3VP1A 3QHYA 2JC7A 1K56A 1FSWA 4C6YA 5FI7A 1NZUA 4GKUA 3O86A 5FQKA 3ZG0A 2ZJ9A 3S1YA 5FAPA 2H0TA 1K6SA 1SDNA 1IYQA 1CK3A 3OPHA 1XKZA 1BZAA 4PMAA 3UE1A 4LCMA 1KE4A 5FAOA 1BLCA 2A3UA 4KQOA 2WK0A 3DWZA 2GDNA 1PIOA 1PWGA 3BM6A 4IVKA 3BFEA 4PM8A 3ITAA 3O3VA 5FQ9A 3IWQA 5GL9A 4S2NC 4DDSA 5GLAA 1L0FA 1L0DA 3E2LA 3OC2A 4OQIA 2Z2MB 1LI9A 1K25A 5J8XA 1CEGA 2XFSA 3G30A 3WRTA 4ZJ3A 1K4FA 3BECA 2ZM8A 2EX9A 3S22A 3VP3A 3IXHA 5EUAA 5EECA 2QZ6A 2HDRA 2WZZA 1RGZA 1VM1A 3FKWA 3MZDA 1MPLA 1QMEA 3IHAA 1N4OA 4K0XA 2QPNA 1ZG6A 3ZNTA 2HP9A 3SS5A 5FQJA 2WGVA 1S6RA 3M2KA 3FKVA 3MXRA 2EX8A 4UA6A 2ZLYA 3JYIA 3V5MA 4BENA 4Y0TA 1DJAA 4E3KA 2XFTA 3PBNA 5FI6A 2C5WB 2V2FF 5G18A 2P9VA 3C7VA 5F82A 4QJGA 5KMWA 5CECA 4E3MA 4BD1A 5FAQA 4S2PA 4MEZA 3SS4A 4DXCA 4R0QA 1MWUA 2WUQA 2X02A 3NC8A 1IEMA 4IBRA 3V3SA 1XXMA 1ES5A 3IXGA 3IXDA 4NK3A 1ERMA 3UO9A 3GMWA 4QD4A 5TGFA 4KZ6A 5I94A 1YQSA 2HPBA 4MBFA 2Y2MA 3HBRA 4OP5A 2Y4AA 4ZJ2A 3HUMA 3IF5A 5E2GA 3DWKA 3NDEA 2WGWA 1JWVA 4FH2A 2HP5A 4OKPA 1K55C 3IH9A 3IQAA 4KZ4A 4R23A 2ZC6B 3P09A 3G31A 4BL3A 1GCEA 1XP4A 4QY5A 5KSCA 1S0WA 1EWZA 3PAGA 4BJPA 4KG6A 1RGYA 3RXXA 4M3KA 4K0WA 4KQRA 4JXSA 4QB8A 1LL5A 1C3BA 4C75A 1L0EA 5FQMA 1FQGA 5AQBA 1BLSA 2ZQ8A 4U3TA 1SKFA 1W5DA 2ZQ7A 3VP4A 3WWXA 4PM5A 5DVAA 3LCEA 1RCJA 3CMZA 4WZ4A 5EVID 2OV5A 5BOHA 2PBYA 3VFHA 2V20A 2OLUA 2PU4A 1NYMA 4DDYA 1ZKJA 2QMIA 3MKEA 4GZBA 4KZ7A 2Q9NA 3HLFA 2RCXA 2X01A 3V50A 5F1FA 3MBZA 2XK1A 4PM9A 1OMEA 3Q7ZA 3SS3A 3WS4A 1KE3A 4OP8A 2ZQDA 3UE3A 2XQZA 2WKIA 1LL9A 3E2KA 3NCKA 2DCFA 1FOFA 3Q07A 2ZC7A 1JTGA 1CI8A 5CRFA 3C7UA 4BLMA 1KGEA 1PWCA 3NY4A 1YLZA 3OPRA 2J9PA 1KE0A 4OPQA 3DTMA 2Y2OA 4DF6A 5FDHA 1K4EA 2BG1A 3PBTA 5CGSA 3UPPA 3S4XA 1QMFA 4ZDXA 1K54C 4MNRA 2VGJA 3BFCA 3O87A 4P6BA 4KENB 4PM6A 1BLPA 4OPZA 4JXWA 1IKGA 1PW8A 1ES3A 1ONHA 5EOOA 1SCWA 1Z6FA 1XPBA 1TDLA 2J8YA 4D2OA 1CEFA 5CGXA 3UE0A 2ZM2A 3IHBA 1K57A 1IYPA 4HESA 1O7EA 3EQVA 3AGDA 4JXVA 2DRWA 1KGFA 1H8YA 3N8SA 4O7DA 1FCNA 1FR6A 2XD5A 4RX3A 2Y91A 3BLMA 1K55A 2WGWB 3A3IA 3IWIA 3SH7A 5GHZA 1CI9A 1ONGA 4EBLA 2H0YA 3GTCA 1KDWA 3WS0A 3V3RA 1EROA 1TEMA 4XUXA 1ESUA 4X68A 5JYPA 4R4RA 3WS1A 2Y2PA 3GSGA 4ZBEA 4JF6A 3G4PA 4E3JA 4OPRA 3MZEA 1SHVA 4OH0A 4YFMA 4KZAA 3A3FA 5M1AA 3VP2A 2CC1A 3VP0A 1IYOA 4BQMA 4QU3A 3W4OA 1SDEA 3BEBA 3N6IA 3NBLA 4WMCD 4FCFA 5EVLA 2XEPA 1L2SA 4HEFA 5EOEA 1YLJA 5F1GA 1W79A 1PW1A 3ZHHA 4XXRA 2BLSA 3V39A 5DTKA 4OOMA 2EXBA 1E3UA 2VGKA 4ZTKA 1JWZA 1H8ZA 4JXGA 3ISGA 4OOLA 4OONA 1GHIA 4S2LA 1MBLA 2ZQCA 3M6BA 1K38A 3W8KA 1FCMA 3RJUA 2ZQAA 4UAAA 2R9WA 5FATA 3TSGA 4N1HA 4KZ9A 5GLDA 4WYYA 3LY4A 4DKIA 5EE8A 4GN2A 2EX2A 4RYEA 4WBGA 3VSLA 1IYSA 4OVDA 3HREA 3IT9A 3UDIA 2WZXA 5U47A 4N92A 5CXWA 4RX2A 3N8LA 2EXAA 4B88A 1LI0A 2Y2NA 3MFDA 4P0MA 3ZG5A 2WKHA 4KZ5A 2G2UA 4GD8A 2Y55A 1K54A 2R9XA 3NDGA 3AGEA 5FASA 4DRTA 1I2WA 3SH8A 4WEJA 5HAQA 4XUZA 3UPNA 5CHUA 5JYOA 3VMAA 1MWTA 3O88A 2Y2GA 3PBRA 1H5XA 5CERA 1XX2A 2WKEA 1XA1A 5CTMA 1NRFA 4EUZA 2J7VA 5CEDA 5E2EA 5FA7A 1BT5A 3D4FA 4HBTA 2E8IA 4JF5A 3Q81A 1Q2PA 2XF3A 2JCHA 3PBQA 4E3IA 4WZ5A 4FSFA 3IF6C 5FQQA 1W7FA 3FV7A 4MBHA 4X53A 4B4XA 1I2SA 2ZC4B 2OSUA 3Q1FA 5GHYA 3BLSA 3ZG9B 4E6XA 1GHMA 2ZQ9A 5DTTA 1RP5A 3OPPA 1DY6A 1LLBA 1XA7A 5EVIA 2XGNA 3FZCA 5M19A 4LV1A 4RVAA 1YLPA 2Y2HA 5D3OA 2Y2LA 4H8RA 2Y2QA 1J9MA 1BSGA 3SOIA 3GVBA 2X71A 3OPLA 2FFYA 2IWDA 4DE1A 3N8RA 3TOIA 2XH9A 4EBPA 3N4IA 2WGIA 5A92A 1O07A 5HAPA 3UNWA 2A49A 3G2ZA 3EQUA 4E3OA 4FH4A 4Y0OA 1NJ4A 1PI5A 5CGWA 1BULA 2Y2JA 2Y59A 4KZ8A 3W4PA 1K6RA 2H5SA 5CHMA 3ZG7B 2OLVA 3VFFA 2EX6A 3WS5A 4UA7A 2J9OA 4X6TA 3ZCZA 3OCNA 4X69A 4FD8A 4LCLA 2UWXA 4S2NA 5EPHA 4EV4A 3HVFA 3IF6A 4OQGA 2JE5A 2Q9MA 4OOYA 3C4OA 3A3EA 5HX9A 1WE4A 4ID4A 1E3UD 1PWDA 3HLGA 5DF9A 3QNBA 1FR1A 2IWCA 4HBUA 4OLGA 2Y2IA 3W4QA 3G2YA 4R1GA 4GD6A 3HLCA 4DXBA 3LO7A 1Y54A 1N9BA 3PBSA 4DE3A 4A5RA 1ES2A 1AXBA 4LV2A 3RXWA 1E4DA 4RA7A 4Q8IA 2JBFA 5EVIB 5GHXA 3PTEA 2FFFB 1TVFA 3OZHA 5AQ9A 1BUEA 4F94A 4Y0UA 3G34A 4K91A 3UN7A 5L2FA 3VOYA 4S2OA 4IEDA 2DNSA 4JF4A 1LHYA 4MLLA 4OLDA 4E3NA 4GDBA 4BL2A 1KVLA 4KG2A 1BTLA 3LEZA 1L0GA 1JVJA 1PI4A 3P98A 4DE0A 4GB7A 5KZHA 1YT4A 2P74A 5FI2A 1ERQA 1ES4A 1PZOA 1KVMA 5DTSA 3A3JA 1ALQA 3HLWA 4JLFA 1MXOA 2I72A 4LV0A 4X55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EI5 A;  4WZ5 C;  5KSH A;  5AQA A;  4WEK A;  2B5R A;  1HD8 A;  5CTN A;  5TFQ A;  3ZDJ A;  5AQ7 A;  1MY8 A;  1Q2Q A;  3WRZ A;  1IKI A;  2WAE A;  5A93 A;  5IHV A;  4QY6 A;  1GHP A;  5HW3 A;  4N1X A;  1ZC2 A;  2Y2K A;  4YIN A;  5E43 A;  3OCL A;  3GR2 A;  1ZG4 A;  1HZO A;  4OQH A;  4WM9 A;  2ZM0 A;  4U0T A;  4PM7 A;  2RL3 A;  5M18 A;  5TR7 A;  4R3J A;  1MWS A;  3HLB A;  5DF8 A;  4E6W A;  4CPK A;  3LY3 A;  1IEL A;  5HAI A;  1PYY A;  5A90 A;  1K57 C;  4UHU A;  4N9K A;  3BRM A;  3TG9 A;  3BFG A;  4OPY A;  3IF6 B;  2XLN A;  3GRJ A;  1XGI A;  3ZNY A;  1JWP A;  1YLY A;  3HUO A;  2WAF A;  5E2H A;  3AGF A;  5HFO A;  2WAD A;  4KZ3 A;  3ZG8 B;  2EFX A;  1HTZ A;  4GNU A;  4OQ0 A;  3WS2 A;  3CZD A;  1KDS A;  1DJB A;  4KZB A;  1W8Y A;  5A91 A;  3C5A A;  4R4S A;  5FQI A;  5CEB A;  1I5Q A;  2G2W A;  5HAR A;  2PU2 A;  1K56 D;  1JTD A;  1NYY A;  4DE2 A;  2HDQ A;  4B4Z A;  1MWR A;  2XR0 A;  3DW0 A;  3IXB A;  3Q82 A;  4S2J A;  1KGG A;  4ZAM A;  3CG5 A;  5F83 A;  1YMX A;  3VOZ A;  4EBN A;  2C6W B;  3UY6 A;  4E3L A;  1TDG A;  3ITB A;  1FCO A;  3HLE A;  3IH8 A;  1BLH A;  1E25 A;  3IWO A;  4KG5 A;  4GDN A;  2ZC3 B;  3M2J A;  4QHC A;  1WYB A;  1G68 A;  4S2K A;  4ZJ1 A;  3G35 A;  4GOG A;  1YMS A;  2XD1 A;  3QNC A;  1YLW A;  4WEL A;  3MKF A;  4Z9Q A;  3C4P A;  5GLB A;  2WYX A;  3MZF A;  3Q7V A;  4S2I A;  5CHJ A;  2IWB A;  3FWL A;  2ZD8 A;  3MXS A;  4LEN A;  4U0X A;  3UDF A;  3HUN A;  4MBK A;  3M6H A;  1GA9 A;  4JPM A;  4NET A;  1YM1 A;  2EFU A;  4IVI A;  1WYC A;  1XGJ A;  3I7J A;  4P87 A;  4BD0 A;  4UA9 A;  3G32 A;  2HP6 A;  4KQQ A;  1NZO A;  5FSR A;  4PPR A;  1MKI A;  4L0L A;  4N9L A;  5DF7 A;  3HLD A;  1YLT A;  3B3X A;  4JBF A;  3ZVW A;  3NI9 A;  1W8Q A;  3NIA A;  3Q7V B;  1DJC A;  4R3B A;  2P9V B;  1FSY A;  3GQZ A;  3FYZ A;  4JKT A;  3CJM A;  4X56 A;  5EVI C;  3UPO A;  3VSK A;  1U60 A;  3SH9 A;  3ZGA B;  3PBO A;  5HL1 A;  4S2M A;  1M40 A;  3N7W A;  4Y7P A;  3UDX A;  1G6A A;  3BFD A;  3HL9 A;  4P85 A;  5E2F A;  2XDM A;  5GLC A;  2H10 A;  2ZMA A;  1HVB A;  3ZVT A;  2V1Z A;  3PAE A;  3BFF A;  1ESI A;  4CJN A;  1GA0 A;  1NXY A;  2Z2L B;  1VQQ A;  2ZC5 B;  2HDU A;  4EQI A;  4WMC A;  3ZFZ A;  3A3D A;  3BYD A;  1PZP A;  4IBX A;  1M6K A;  1NY0 A;  2HDS A;  3GV9 A;  4LV3 A;  4C3Q A;  4EWF A;  3VP1 A;  3QHY A;  2JC7 A;  1K56 A;  1FSW A;  4C6Y A;  5FI7 A;  1NZU A;  4GKU A;  3O86 A;  5FQK A;  3ZG0 A;  2ZJ9 A;  3S1Y A;  5FAP A;  2H0T A;  1K6S A;  1SDN A;  1IYQ A;  1CK3 A;  3OPH A;  1XKZ A;  1BZA A;  4PMA A;  3UE1 A;  4LCM A;  1KE4 A;  5FAO A;  1BLC A;  2A3U A;  4KQO A;  2WK0 A;  3DWZ A;  2GDN A;  1PIO A;  1PWG A;  3BM6 A;  4IVK A;  3BFE A;  4PM8 A;  3ITA A;  3O3V A;  5FQ9 A;  3IWQ A;  5GL9 A;  4S2N C;  4DDS A;  5GLA A;  1L0F A;  1L0D A;  3E2L A;  3OC2 A;  4OQI A;  2Z2M B;  1LI9 A;  1K25 A;  5J8X A;  1CEG A;  2XFS A;  3G30 A;  3WRT A;  4ZJ3 A;  1K4F A;  3BEC A;  2ZM8 A;  2EX9 A;  3S22 A;  3VP3 A;  3IXH A;  5EUA A;  5EEC A;  2QZ6 A;  2HDR A;  2WZZ A;  1RGZ A;  1VM1 A;  3FKW A;  3MZD A;  1MPL A;  1QME A;  3IHA A;  1N4O A;  4K0X A;  2QPN A;  1ZG6 A;  3ZNT A;  2HP9 A;  3SS5 A;  5FQJ A;  2WGV A;  1S6R A;  3M2K A;  3FKV A;  3MXR A;  2EX8 A;  4UA6 A;  2ZLY A;  3JYI A;  3V5M A;  4BEN A;  4Y0T A;  1DJA A;  4E3K A;  2XFT A;  3PBN A;  5FI6 A;  2C5W B;  2V2F F;  5G18 A;  2P9V A;  3C7V A;  5F82 A;  4QJG A;  5KMW A;  5CEC A;  4E3M A;  4BD1 A;  5FAQ A;  4S2P A;  4MEZ A;  3SS4 A;  4DXC A;  4R0Q A;  1MWU A;  2WUQ A;  2X02 A;  3NC8 A;  1IEM A;  4IBR A;  3V3S A;  1XXM A;  1ES5 A;  3IXG A;  3IXD A;  4NK3 A;  1ERM A;  3UO9 A;  3GMW A;  4QD4 A;  5TGF A;  4KZ6 A;  5I94 A;  1YQS A;  2HPB A;  4MBF A;  2Y2M A;  3HBR A;  4OP5 A;  2Y4A A;  4ZJ2 A;  3HUM A;  3IF5 A;  5E2G A;  3DWK A;  3NDE A;  2WGW A;  1JWV A;  4FH2 A;  2HP5 A;  4OKP A;  1K55 C;  3IH9 A;  3IQA A;  4KZ4 A;  4R23 A;  2ZC6 B;  3P09 A;  3G31 A;  4BL3 A;  1GCE A;  1XP4 A;  4QY5 A;  5KSC A;  1S0W A;  1EWZ A;  3PAG A;  4BJP A;  4KG6 A;  1RGY A;  3RXX A;  4M3K A;  4K0W A;  4KQR A;  4JXS A;  4QB8 A;  1LL5 A;  1C3B A;  4C75 A;  1L0E A;  5FQM A;  1FQG A;  5AQB A;  1BLS A;  2ZQ8 A;  4U3T A;  1SKF A;  1W5D A;  2ZQ7 A;  3VP4 A;  3WWX A;  4PM5 A;  5DVA A;  3LCE A;  1RCJ A;  3CMZ A;  4WZ4 A;  5EVI D;  2OV5 A;  5BOH A;  2PBY A;  3VFH A;  2V20 A;  2OLU A;  2PU4 A;  1NYM A;  4DDY A;  1ZKJ A;  2QMI A;  3MKE A;  4GZB A;  4KZ7 A;  2Q9N A;  3HLF A;  2RCX A;  2X01 A;  3V50 A;  5F1F A;  3MBZ A;  2XK1 A;  4PM9 A;  1OME A;  3Q7Z A;  3SS3 A;  3WS4 A;  1KE3 A;  4OP8 A;  2ZQD A;  3UE3 A;  2XQZ A;  2WKI A;  1LL9 A;  3E2K A;  3NCK A;  2DCF A;  1FOF A;  3Q07 A;  2ZC7 A;  1JTG A;  1CI8 A;  5CRF A;  3C7U A;  4BLM A;  1KGE A;  1PWC A;  3NY4 A;  1YLZ A;  3OPR A;  2J9P A;  1KE0 A;  4OPQ A;  3DTM A;  2Y2O A;  4DF6 A;  5FDH A;  1K4E A;  2BG1 A;  3PBT A;  5CGS A;  3UPP A;  3S4X A;  1QMF A;  4ZDX A;  1K54 C;  4MNR A;  2VGJ A;  3BFC A;  3O87 A;  4P6B A;  4KEN B;  4PM6 A;  1BLP A;  4OPZ A;  4JXW A;  1IKG A;  1PW8 A;  1ES3 A;  1ONH A;  5EOO A;  1SCW A;  1Z6F A;  1XPB A;  1TDL A;  2J8Y A;  4D2O A;  1CEF A;  5CGX A;  3UE0 A;  2ZM2 A;  3IHB A;  1K57 A;  1IYP A;  4HES A;  1O7E A;  3EQV A;  3AGD A;  4JXV A;  2DRW A;  1KGF A;  1H8Y A;  3N8S A;  4O7D A;  1FCN A;  1FR6 A;  2XD5 A;  4RX3 A;  2Y91 A;  3BLM A;  1K55 A;  2WGW B;  3A3I A;  3IWI A;  3SH7 A;  5GHZ A;  1CI9 A;  1ONG A;  4EBL A;  2H0Y A;  3GTC A;  1KDW A;  3WS0 A;  3V3R A;  1ERO A;  1TEM A;  4XUX A;  1ESU A;  4X68 A;  5JYP A;  4R4R A;  3WS1 A;  2Y2P A;  3GSG A;  4ZBE A;  4JF6 A;  3G4P A;  4E3J A;  4OPR A;  3MZE A;  1SHV A;  4OH0 A;  4YFM A;  4KZA A;  3A3F A;  5M1A A;  3VP2 A;  2CC1 A;  3VP0 A;  1IYO A;  4BQM A;  4QU3 A;  3W4O A;  1SDE A;  3BEB A;  3N6I A;  3NBL A;  4WMC D;  4FCF A;  5EVL A;  2XEP A;  1L2S A;  4HEF A;  5EOE A;  1YLJ A;  5F1G A;  1W79 A;  1PW1 A;  3ZHH A;  4XXR A;  2BLS A;  3V39 A;  5DTK A;  4OOM A;  2EXB A;  1E3U A;  2VGK A;  4ZTK A;  1JWZ A;  1H8Z A;  4JXG A;  3ISG A;  4OOL A;  4OON A;  1GHI A;  4S2L A;  1MBL A;  2ZQC A;  3M6B A;  1K38 A;  3W8K A;  1FCM A;  3RJU A;  2ZQA A;  4UAA A;  2R9W A;  5FAT A;  3TSG A;  4N1H A;  4KZ9 A;  5GLD A;  4WYY A;  3LY4 A;  4DKI A;  5EE8 A;  4GN2 A;  2EX2 A;  4RYE A;  4WBG A;  3VSL A;  1IYS A;  4OVD A;  3HRE A;  3IT9 A;  3UDI A;  2WZX A;  5U47 A;  4N92 A;  5CXW A;  4RX2 A;  3N8L A;  2EXA A;  4B88 A;  1LI0 A;  2Y2N A;  3MFD A;  4P0M A;  3ZG5 A;  2WKH A;  4KZ5 A;  2G2U A;  4GD8 A;  2Y55 A;  1K54 A;  2R9X A;  3NDG A;  3AGE A;  5FAS A;  4DRT A;  1I2W A;  3SH8 A;  4WEJ A;  5HAQ A;  4XUZ A;  3UPN A;  5CHU A;  5JYO A;  3VMA A;  1MWT A;  3O88 A;  2Y2G A;  3PBR A;  1H5X A;  5CER A;  1XX2 A;  2WKE A;  1XA1 A;  5CTM A;  1NRF A;  4EUZ A;  2J7V A;  5CED A;  5E2E A;  5FA7 A;  1BT5 A;  3D4F A;  4HBT A;  2E8I A;  4JF5 A;  3Q81 A;  1Q2P A;  2XF3 A;  2JCH A;  3PBQ A;  4E3I A;  4WZ5 A;  4FSF A;  3IF6 C;  5FQQ A;  1W7F A;  3FV7 A;  4MBH A;  4X53 A;  4B4X A;  1I2S A;  2ZC4 B;  2OSU A;  3Q1F A;  5GHY A;  3BLS A;  3ZG9 B;  4E6X A;  1GHM A;  2ZQ9 A;  5DTT A;  1RP5 A;  3OPP A;  1DY6 A;  1LLB A;  1XA7 A;  5EVI A;  2XGN A;  3FZC A;  5M19 A;  4LV1 A;  4RVA A;  1YLP A;  2Y2H A;  5D3O A;  2Y2L A;  4H8R A;  2Y2Q A;  1J9M A;  1BSG A;  3SOI A;  3GVB A;  2X71 A;  3OPL A;  2FFY A;  2IWD A;  4DE1 A;  3N8R A;  3TOI A;  2XH9 A;  4EBP A;  3N4I A;  2WGI A;  5A92 A;  1O07 A;  5HAP A;  3UNW A;  2A49 A;  3G2Z A;  3EQU A;  4E3O A;  4FH4 A;  4Y0O A;  1NJ4 A;  1PI5 A;  5CGW A;  1BUL A;  2Y2J A;  2Y59 A;  4KZ8 A;  3W4P A;  1K6R A;  2H5S A;  5CHM A;  3ZG7 B;  2OLV A;  3VFF A;  2EX6 A;  3WS5 A;  4UA7 A;  2J9O A;  4X6T A;  3ZCZ A;  3OCN A;  4X69 A;  4FD8 A;  4LCL A;  2UWX A;  4S2N A;  5EPH A;  4EV4 A;  3HVF A;  3IF6 A;  4OQG A;  2JE5 A;  2Q9M A;  4OOY A;  3C4O A;  3A3E A;  5HX9 A;  1WE4 A;  4ID4 A;  1E3U D;  1PWD A;  3HLG A;  5DF9 A;  3QNB A;  1FR1 A;  2IWC A;  4HBU A;  4OLG A;  2Y2I A;  3W4Q A;  3G2Y A;  4R1G A;  4GD6 A;  3HLC A;  4DXB A;  3LO7 A;  1Y54 A;  1N9B A;  3PBS A;  4DE3 A;  4A5R A;  1ES2 A;  1AXB A;  4LV2 A;  3RXW A;  1E4D A;  4RA7 A;  4Q8I A;  2JBF A;  5EVI B;  5GHX A;  3PTE A;  2FFF B;  1TVF A;  3OZH A;  5AQ9 A;  1BUE A;  4F94 A;  4Y0U A;  3G34 A;  4K91 A;  3UN7 A;  5L2F A;  3VOY A;  4S2O A;  4IED A;  2DNS A;  4JF4 A;  1LHY A;  4MLL A;  4OLD A;  4E3N A;  4GDB A;  4BL2 A;  1KVL A;  4KG2 A;  1BTL A;  3LEZ A;  1L0G A;  1JVJ A;  1PI4 A;  3P98 A;  4DE0 A;  4GB7 A;  5KZH A;  1YT4 A;  2P74 A;  5FI2 A;  1ERQ A;  1ES4 A;  1PZO A;  1KVM A;  5DTS A;  3A3J A;  1ALQ A;  3HLW A;  4JLF A;  1MXO A;  2I72 A;  4LV0 A;  4X55 A; 
#chains in the Genus database with same CATH topology
 1KOU A;  5AQA A;  5F68 A;  5CTN A;  3ZDJ A;  1MY8 A;  3WRZ A;  1IKI A;  2WAE A;  3NUL A;  4N1X A;  2GNX A;  2Y2K A;  4MDZ A;  2B18 A;  5HAI A;  4OPY A;  3DTK A;  3T4K A;  4KZ3 A;  4GNU A;  4OQ0 A;  3WS2 A;  1W8Y A;  5A91 A;  1DP8 A;  5FQI A;  3LI8 A;  4ARZ B;  5HAR A;  3UMD A;  1J3W A;  1JTD A;  1K56 D;  2XR0 A;  3IXB A;  1TS6 A;  3Q82 A;  4S2J A;  4ZAM A;  2Y8H A;  4E3L A;  3O5Y A;  1BLH A;  2VA0 A;  2ZC3 B;  3M2J A;  2WKQ A;  1G68 A;  4S2K A;  3QP8 A;  2WKR A;  3G35 A;  4Z9Q A;  3QNC A;  1YLW A;  3MKF A;  2WYX A;  3MXS A;  3HCY A;  2Z6C A;  2EFU A;  4IVI A;  3OOV A;  3I7J A;  1ZTU A;  4BD0 A;  1IOU A;  3G32 A;  2HP6 A;  3RFB A;  1MKI A;  3HLD A;  3K2N A;  3B3X A;  2P04 A;  3NIA A;  4LFU A;  1DRM A;  2JKG A;  4X56 A;  3GQZ A;  3CJM A;  1UWP X;  5EVI C;  3UE6 A;  3KX0 X;  1OJG A;  4Y13 A;  5E2F A;  5GLC A;  2ZMA A;  1ESI A;  1T18 A;  4CJN A;  2HDU A;  1S66 L;  2JKT M;  3BYD A;  4X25 A;  2HDS A;  2O9C A;  2GX5 A;  3MF0 A;  2KLI A;  4HY8 A;  3VP1 A;  1FSW A;  3MXQ A;  2H0T A;  5FAP A;  1K6S A;  1MKM A;  4NXF A;  1PFL A;  4PMA A;  5FAO A;  1W63 M;  2VKS A;  2L4R A;  4PM8 A;  5GL9 A;  1L0D A;  4EUV A;  3OC2 A;  1SKO B;  3IXH A;  4HI4 A;  2HDR A;  3FKW A;  1H8M A;  3NOP C;  1MPL A;  1QME A;  1N4O A;  3LYX A;  2HP9 A;  3R4K A;  2WGV A;  3M2K A;  3MXR A;  3FKV A;  2EX8 A;  3V5M A;  4NEE D;  4F3L A;  3CLO A;  2V2F F;  4QJG A;  3BY9 A;  3SS4 A;  4DXC A;  3EOI A;  1IEM A;  3DTI A;  1XJ3 A;  1ES5 A;  1ERM A;  4GCZ A;  1YQS A;  1LL8 A;  3DWK A;  3NJA A;  2W3E A;  5F6A A;  1V9Z A;  2MJ6 A;  4O8G A;  3IH9 A;  4KZ4 A;  3FPW A;  3P09 A;  4EU0 A;  2QKP A;  1EWZ A;  2I9V A;  3EGX C;  3UB5 P;  2V0W A;  2A24 A;  4KQR A;  1LL5 A;  3CAX A;  4PM5 A;  1BLS A;  1W5D A;  3SZT A;  3LCE A;  1RCJ A;  4WZ4 A;  4MCW A;  2V20 A;  2YKF A;  2PU4 A;  2QMI A;  3HLF A;  1LSV A;  2WKI A;  1LL9 A;  1S4S A;  4R70 A;  3NCK A;  2DCF A;  1OTD A;  2PDR A;  2ZC7 A;  1CI8 A;  4MN6 A;  4BLM A;  3H7W A;  3LIA A;  4O01 A;  3NY4 A;  1YLZ A;  3EEH A;  3OPR A;  2J9P A;  3ULF A;  4JGP A;  2ZL1 A;  3EWK A;  4MN7 A;  2JKF A;  3DBA A;  1QMF A;  2JKR I;  3S7O A;  3BFC A;  4KEN B;  1BLP A;  3MQO A;  2PRF A;  1ONH A;  4E04 A;  1Z6F A;  1XPB A;  1OT9 A;  2O9B A;  2ZM2 A;  3IHB A;  3EQV A;  1HLU P;  3AGD A;  2DRW A;  4EEP A;  1DP6 A;  1FCN A;  1FR6 A;  2XD5 A;  1OJ5 A;  3RH8 B;  3IWI A;  3SH7 A;  4Q0I A;  1ONG A;  2OAQ 1;  3GTC A;  2R78 A;  4II7 A;  1TEM A;  2VGL M;  1XJ2 A;  4GJ4 A;  1SHV A;  2JKR M;  4OH0 A;  5M1A A;  3UME A;  2CC1 A;  4BQM A;  4QU3 A;  3W4O A;  1K0K A;  1SDE A;  2W1T B;  5EVL A;  2XEP A;  3NOU C;  1PW1 A;  2J3T D;  2BLS A;  1W63 Q;  1E3U A;  4JXG A;  3ISG A;  1GHI A;  1K38 A;  4Q0J A;  1N9N A;  2L0W A;  2ZQA A;  2EWW A;  2R9W A;  4UAA A;  5FAT A;  4GHI A;  3RJU A;  3T12 B;  1Z09 A;  3TSG A;  4KZ9 A;  5GLD A;  4WYY A;  5EE8 A;  1GSV A;  4WBG A;  1IYS A;  4OVD A;  3S7N A;  1LI0 A;  3ZG5 A;  5HWW A;  2Y55 A;  1K54 A;  2R9X A;  1H0M A;  3NDG A;  3AGE A;  5FAS A;  1T1A A;  2P08 A;  3SH8 A;  5HAQ A;  5DFY A;  1XFQ A;  3KYZ A;  4ZRR A;  1YAX A;  1S1Y A;  3PBQ A;  1UWN X;  5HDD A;  4MBH A;  3UB7 A;  5GHY A;  1VB6 A;  2JN7 A;  1GHM A;  5DTT A;  2L1M A;  3IX8 A;  2XGN A;  4LV1 A;  2Y2H A;  1AWI A;  3SOI A;  3OPL A;  2IWD A;  4DE1 A;  2DMW A;  2XH9 A;  4FH4 A;  5MC7 A;  3UB8 A;  5CGW A;  2Y59 A;  3W4P A;  5CHM A;  3VFF A;  5FEG A;  4BBV A;  2J9O A;  3MQQ A;  4Z1W A;  4FD8 A;  2UWX A;  4OOY A;  3T1R A;  5HX9 A;  1WE4 A;  4ID4 A;  2O99 A;  3HLG A;  3QNB A;  1FR1 A;  3T4J A;  2IWC A;  4HBU A;  2IA2 A;  1OTE A;  3A0V A;  4R1G A;  2QWS A;  1Y54 A;  1N9B A;  4DE3 A;  4RA7 A;  2HJ9 C;  4HJ6 A;  5GHX A;  4LRY C;  3W2Z A;  2FFF B;  3LIB A;  2ZOI A;  1GSW A;  3ZYT A;  4IED A;  2DNS A;  1LHY A;  1NLZ A;  5HWT A;  3T4O A;  1KVL A;  4KG2 A;  3LEZ A;  1JVJ A;  1YT4 A;  2P74 A;  3DTE A;  2VV7 A;  2GJ3 A;  5KSH A;  1HD8 A;  4P6Z M;  2E8J A;  5TFQ A;  5AQ7 A;  1Q2Q A;  5A93 A;  4QY6 A;  4CLC E;  3LGO A;  2Z6D A;  3QP4 A;  4YIN A;  4FUW A;  1YPR A;  3GR2 A;  2FH5 A;  3ICY A;  3E98 A;  3SW1 A;  3LUQ A;  2D02 A;  3IF6 B;  3GRJ A;  1XGI A;  3ZNY A;  1JWP A;  5IS1 A;  2WAF A;  1DP9 A;  2WAD A;  1YSP A;  2EFX A;  1SKO A;  2VZW A;  3T4T A;  1FIK A;  3CZD A;  4R4S A;  4CLC A;  2G2W A;  3VE3 A;  1NYY A;  2HDQ A;  4B4Z A;  1MWR A;  4D60 A;  1KGG A;  1IFQ A;  3VOZ A;  5F5Y A;  3UY6 A;  1TDG A;  5TBM B;  3NOT C;  4ZJ1 A;  4GOG A;  4WEL A;  5HZH A;  3Q7V A;  1OTA A;  2A2L A;  3HUN A;  3M6H A;  1GA9 A;  1XGJ A;  4UA9 A;  5FSR A;  3NI9 A;  2W3H A;  3Q7V B;  2W27 A;  1DJC A;  3KSI A;  3S7Q A;  4R3B A;  1FSY A;  2ZL1 B;  3PBO A;  5EM1 A;  4S2M A;  5HL6 A;  3HL9 A;  4P85 A;  1NWZ A;  2XDM A;  2J3W A;  1HVB A;  3ZVT A;  2V1Z A;  2OOL A;  3BFF A;  5EVE A;  1GA0 A;  1NXY A;  4WMC A;  1M6K A;  1NY0 A;  1K56 A;  3E4Q A;  4C6Y A;  5FI7 A;  1NZU A;  1F98 A;  4GKU A;  4EES A;  2ZJ9 A;  3S1Y A;  3KSG A;  1IYQ A;  1MC0 A;  1N9O A;  2OWH A;  4KQO A;  2WK0 A;  3DWZ A;  3BM6 A;  1LT0 A;  3BFE A;  3O3V A;  3IWQ A;  4S2N C;  5GLA A;  3BWL A;  2VK3 A;  3U4L P;  5DKL A;  5EM0 A;  5J8X A;  1K25 A;  2XRN A;  2XFS A;  3BEC A;  2ZM8 A;  2EX9 A;  4HH3 A;  3S22 A;  5EUA A;  2BAS A;  3IHA A;  5HPF A;  4K0X A;  1ZG6 A;  4I38 A;  5FQJ A;  1S6R A;  3GEC A;  4BEN A;  1H3Q A;  3EGD C;  4ME4 A;  4UA6 A;  2A24 B;  5G18 A;  2C5W B;  5HD3 A;  2P9V A;  4E3M A;  4S2P A;  2WUQ A;  4IBR A;  4PKY G;  1XXM A;  1EW0 A;  3IXD A;  4QD4 A;  4F3L B;  4KZ6 A;  5I94 A;  4MBF A;  4EER A;  2Y2M A;  2VV8 A;  3HBR A;  5J4E A;  3NDE A;  4OKP A;  1K55 C;  4PHT A;  3IQA A;  2ZC6 B;  3G31 A;  2M7U A;  1XP4 A;  4QY5 A;  4BBU A;  3G6O A;  4BJP A;  4KG6 A;  1RGY A;  2V1A A;  5A8B A;  2QJ7 A;  5FQM A;  3T1Q B;  5HPI A;  5AQB A;  3VP4 A;  2ZQ7 A;  3CUE C;  3LIE A;  3D9Y A;  2ZOH A;  3CMZ A;  2Q9N A;  3QP1 A;  4R38 A;  3MBZ A;  4PM9 A;  4LRX C;  3R7W A;  3WS4 A;  2H28 A;  3OLO A;  3UE3 A;  3H7W B;  2XQZ A;  1TD5 A;  3LR5 A;  3K3D A;  3P7N A;  1JTG A;  5CRF A;  1KE0 A;  3DTM A;  5FDH A;  2BG1 A;  1K54 C;  1P97 A;  1PW8 A;  5EOO A;  2XSS A;  2J8Y A;  4D2O A;  5CGX A;  1K57 A;  2XA7 M;  4HES A;  4R6L A;  1O7E A;  2QYB A;  3BW6 A;  4JXV A;  1KGF A;  5AVF A;  2CMN A;  3N8S A;  4O7D A;  1TS8 A;  4RX3 A;  2O9A A;  1PNE A;  3VOL A;  4HHD A;  2M1C A;  3T50 A;  3H9W A;  2HJE A;  3D3O A;  4X68 A;  2Y2P A;  4ZBE A;  4JF6 A;  3MZE A;  3IBJ A;  2ZMV A;  2W0N A;  3PHY A;  5HWV A;  4YNR A;  4HEF A;  1YLJ A;  5F1G A;  1PRQ A;  1W79 A;  3ZHH A;  3V39 A;  2PYP A;  4OOM A;  1JWZ A;  1H8Z A;  3F1O B;  1D1J A;  4DKI A;  3MS6 A;  3JVU A;  3P01 A;  3UDI A;  3CUE A;  2KOI A;  5U47 A;  2NUT C;  3N8L A;  2EXA A;  4XT2 A;  4B88 A;  2Y2N A;  1WA9 A;  1ODV A;  4DRT A;  3NEC A;  4WEJ A;  4HNB A;  5CHU A;  3VMA A;  3PBR A;  1H5X A;  4L9E A;  3IS2 B;  1XX2 A;  4IUH A;  5E2E A;  3T1X A;  4XT2 B;  4FSF A;  5FQQ A;  2ZC4 B;  3Q1F A;  3H82 A;  4E6X A;  3OPP A;  1DY6 A;  5TBM A;  2W3D A;  5M19 A;  4RVA A;  5D3O A;  4H8R A;  2Y2Q A;  3GVB A;  3N8R A;  4LRZ E;  4WF0 A;  3TOI A;  5A92 A;  1O07 A;  3UNW A;  5AJG A;  3G2Z A;  4KZ8 A;  2H5S A;  3WS5 A;  4X6T A;  3OCN A;  4LCL A;  4S2N A;  4YOF A;  4CLC D;  3HVF A;  3IF6 A;  4OQG A;  1PWD A;  4NKP A;  5DF9 A;  5AVE A;  4OLG A;  2Y2I A;  3W4Q A;  1VEU A;  1S1Z A;  3HLC A;  4A5R A;  1ES2 A;  4H6J B;  4LV2 A;  4EEU A;  2JBF A;  1TVF A;  4F94 A;  4UEY A;  2VLG A;  4K91 A;  4S2O A;  5G4Y A;  2PAV P;  2PR6 A;  4BL2 A;  4DJ2 A;  3BJN A;  1PI4 A;  3P98 A;  4DE0 A;  1ES4 A;  5DTS A;  1KVM A;  3HLW A;  4LV0 A;  1EI5 A;  3MMH A;  3FPV A;  4WZ5 C;  4WEK A;  2B5R A;  3BQ8 A;  5IHV A;  1GHP A;  1MZU A;  5E43 A;  2YKH A;  3OCL A;  1HZO A;  2ZM0 A;  4P6Z S;  4PM7 A;  2RL3 A;  4U0T A;  1MWS A;  4E6W A;  3IX4 A;  3LY3 A;  1IEL A;  1PYY A;  4UHU A;  1S4R A;  3BRM A;  2M7V A;  1CQA A;  4L9F A;  4HOI A;  3HUO A;  5E2H A;  3PR6 A;  4Y15 A;  2J80 A;  2OWJ A;  1KDS A;  4YWZ A;  3LR4 A;  3JVV A;  3L7H A;  5CEB A;  1I5Q A;  3OBF A;  2PU2 A;  3LR3 A;  4DE2 A;  5CX7 A;  4ETZ A;  3CG5 A;  1P9R A;  1FCO A;  1UGU A;  3HLE A;  3IH8 A;  3S7P A;  1E25 A;  4GDN A;  2WKP A;  1WYB A;  1A0K A;  3LIF A;  1D7E A;  2XD1 A;  3GDI A;  3C4P A;  4S2I A;  2ZD8 A;  2PR5 A;  4I3I A;  4NXG A;  4JPM A;  4NET A;  2W1R A;  1WYC A;  4P87 A;  4PPR A;  4L9G A;  3LID A;  3ZVW A;  1W8Q A;  2P9V B;  3FYZ A;  4G3K A;  3KYQ A;  3VSK A;  1STZ A;  3SH9 A;  2JHE A;  5HL1 A;  1M40 A;  3N7W A;  1G6A A;  2H10 A;  4I3A A;  4G3W A;  2HZ5 A;  2Z2L B;  1VQQ A;  4EQI A;  3CI6 A;  3A3D A;  1LSX A;  3QP6 A;  3D72 A;  1N9L A;  4LV3 A;  4IBX A;  1ACF A;  4EWF A;  2JC7 A;  4ARZ A;  4UQI M;  5FQK A;  3ZG0 A;  4O0P A;  1CK3 A;  4CQH A;  1XKZ A;  1BZA A;  1P9W A;  2LB5 A;  1KE4 A;  1BLC A;  2A3U A;  5EFW A;  1PWG A;  4EET B;  4IVK A;  4DDS A;  4HJ3 A;  3E2L A;  3T4L A;  1LI9 A;  1CEG A;  3G30 A;  3WRT A;  1K4F A;  2O0Y A;  3PXP A;  2QZ6 A;  4PAU A;  1RGZ A;  2VEA A;  3MZD A;  3MSH A;  2V0U A;  1VEU B;  4HIA A;  4Y0T A;  1DJA A;  2XFT A;  3PBN A;  5FI6 A;  4GLQ A;  3C7V A;  5F82 A;  4R0Q A;  2EA9 A;  1MWU A;  2X02 A;  4HH2 A;  5J7E A;  3IXG A;  4NK3 A;  3UO9 A;  5TGF A;  4OP5 A;  4HQA A;  1Y28 A;  5E2G A;  1NLY A;  2WGW A;  3F1N B;  4CLC B;  4FH2 A;  5DFX A;  2HP5 A;  3R7W B;  4R23 A;  1GCE A;  3CPT B;  1S0W A;  3RXX A;  4M3K A;  5FEF A;  4K0W A;  5HSQ A;  4JXS A;  4C75 A;  3WWX A;  4U3T A;  1SKF A;  5DVA A;  5BOH A;  2OV5 A;  2PBY A;  2HV1 A;  4DDY A;  3JPU A;  1ZKJ A;  3MKE A;  3C38 A;  4GZB A;  4KZ7 A;  5F1F A;  2RCX A;  4FOF A;  3V50 A;  2XK1 A;  3Q7Z A;  1KE3 A;  2ZMF A;  2FZ0 A;  3E2K A;  1VET B;  3Q07 A;  2V1B A;  1PWC A;  3KSH A;  4DF6 A;  3PBT A;  5CGS A;  3UPP A;  3S4X A;  2XRO A;  3B33 A;  4JGQ A;  3O87 A;  2V8C A;  4PM6 A;  4RQ9 A;  2G7U A;  4JXW A;  1IKG A;  1OTB A;  3UE0 A;  1IYP A;  3ZQ5 A;  1H8Y A;  3KO6 A;  4GHI B;  1K55 A;  5GHZ A;  1CI9 A;  1KDW A;  3WS0 A;  1ERO A;  4XUX A;  3LFV A;  2J3T C;  4MN5 A;  1T1C A;  2ACG A;  3G4P A;  4E3J A;  4YFM A;  1G28 A;  4B9O A;  3VP0 A;  4M4X A;  3BEB A;  4WMC D;  5EOE A;  4NXB A;  5DTK A;  2VGK A;  4ZTK A;  3LR0 A;  3LIC A;  4OON A;  4S2L A;  3W8K A;  1ZHH B;  4DMZ A;  3MQ0 A;  4CLC C;  3HJK A;  1BYW A;  4N1H A;  3LY4 A;  1Y4O A;  4GN2 A;  2EX2 A;  3HJI A;  3IT9 A;  2WZX A;  1CJF A;  1T19 A;  3VE4 A;  1YSQ A;  3BQA A;  3MFD A;  4HP4 A;  3U2A A;  2AVX A;  2G2U A;  2PYR A;  4GD8 A;  3BY8 A;  3UPN A;  5JYO A;  3TJZ C;  3O88 A;  2Y2G A;  4Y3I A;  3T1S A;  5CTM A;  1NRF A;  4EUZ A;  3F1O A;  5L07 A;  3DAV A;  1VHM A;  1BT5 A;  2KDK A;  3D4F A;  4KQD A;  1Q2P A;  2JCH A;  4E3I A;  4WZ5 A;  1TS0 A;  4B4X A;  2VV6 A;  1RP5 A;  1LLB A;  5EVI A;  3FZC A;  1YLP A;  2Y2L A;  4G3V A;  2K7S A;  1J9M A;  2VGL S;  2FFY A;  3MR0 A;  4EBP A;  2WGI A;  1G5U A;  3EQU A;  4E3O A;  4Y0O A;  1BUL A;  3ZG7 B;  2OLV A;  2EX6 A;  4UA7 A;  4GS9 B;  3ZCZ A;  4EV4 A;  2Q9M A;  1E3U D;  4HJ4 A;  5DKK A;  3IBR A;  3G2Y A;  5K5B A;  4DXB A;  4Q0H A;  2Y79 A;  1LSW A;  1E4D A;  4Q8I A;  5HDS A;  5TJJ A;  1XJ6 A;  4IHQ A;  5EVI B;  5KIZ A;  1GSX A;  1BUE A;  1XFN A;  5AQ9 A;  4BWI A;  3G34 A;  3UN7 A;  5L2F A;  3CHW P;  3TE8 A;  4GDB A;  2JKT I;  2BTF P;  3CPT A;  5L8M A;  4KUK A;  1L0G A;  5HDC A;  4GB7 A;  2Q0O A;  5FI2 A;  3UB6 A;  1ERQ A;  1PZO A;  3A3J A;  1ALQ A;  3VV4 A;  2I72 A;  4X55 A;  2XA7 S;  1TS7 A;  4R3A A;  1OPX A;  4PKY A;  5HW3 A;  2HGV A;  2W3F A;  1ZC2 A;  1F9I A;  3C2W A;  4QPR A;  2KX6 A;  1ZG4 A;  2QJ5 A;  4OQH A;  4WM9 A;  5M18 A;  5TR7 A;  4R3J A;  3HLB A;  5DF8 A;  4CPK A;  5A90 A;  4NXE A;  1K57 C;  4N9K A;  3TG9 A;  3BFG A;  2VJW A;  2W3G A;  1SZV A;  2XLN A;  1YLY A;  3AGF A;  5HFO A;  3ZG8 B;  2LB9 A;  1HTZ A;  1DJB A;  4KZB A;  4X1L A;  3C5A A;  5EV0 A;  2NUP C;  3DW0 A;  2HF6 A;  5F83 A;  3NHQ A;  2EWV A;  1YMX A;  3MJQ A;  3A0R A;  2C6W B;  4EBN A;  5F69 A;  3ITB A;  4Y17 A;  2PT7 A;  3IWO A;  4H6J A;  4KG5 A;  4QHC A;  4GS9 A;  2V9A A;  5GLB A;  1YMS A;  3KYE A;  3MZF A;  5CHJ A;  2IWB A;  3FWL A;  4U0X A;  4LEN A;  3UDF A;  4MBK A;  5DJT A;  1XJ4 A;  1YM1 A;  4KQQ A;  1NZO A;  4L0L A;  4N9L A;  5DF7 A;  4JGR A;  1YLT A;  4JBF A;  4JGO A;  5C5K A;  4JKT A;  3UPO A;  1U60 A;  3ZGA B;  2QHK A;  4KUO A;  3T4S A;  4Y7P A;  1D06 A;  3IX3 A;  3UDX A;  3BFD A;  3PAE A;  3FG8 A;  2ZC5 B;  5G4Z A;  3ZFZ A;  1PZP A;  4EW7 A;  4C3Q A;  3GV9 A;  3QHY A;  5L09 A;  3O86 A;  4DJ3 A;  4WLA A;  1SDN A;  3E4P A;  3OPH A;  1X0O A;  3UE1 A;  4LCM A;  2PBD P;  2GDN A;  4QWO A;  1PIO A;  3ITA A;  5FQ9 A;  1L0F A;  4OQI A;  2Z2M B;  5LBR A;  4EQ1 A;  4ZJ3 A;  3VP3 A;  5EEC A;  3LEQ A;  5J3W A;  2WZZ A;  1VM1 A;  4X1M A;  3T4Q A;  2QPN A;  4WN5 A;  3ZNT A;  3CIT A;  3SS5 A;  3LI9 A;  2ZBB A;  2ZLY A;  3JYI A;  4E3K A;  5KMW A;  5CEC A;  4BD1 A;  3C30 A;  5FAQ A;  2B02 A;  4MEZ A;  3NC8 A;  1G6O A;  3V3S A;  5HD5 A;  1V9Y A;  3GMW A;  2HPB A;  2Y4A A;  4ZJ2 A;  3HUM A;  3IF5 A;  1JWV A;  4K08 A;  5IU1 A;  4BL3 A;  5KSC A;  3PAG A;  4EXO A;  2K31 A;  4QB8 A;  1C3B A;  1L0E A;  4LGW A;  1FQG A;  2ZQ8 A;  5EVI D;  3VFH A;  4AFI A;  2VX8 A;  2OLU A;  1NYM A;  2INW A;  4LLO B;  4FTX A;  2X01 A;  4NG2 A;  1OME A;  3SS3 A;  3V67 A;  4OP8 A;  2ZQD A;  3L9K A;  3CWF A;  2OAP 1;  1FOF A;  1VET A;  1T1B A;  3B47 A;  3E4O A;  3C7U A;  4GW9 A;  2PHY A;  1KGE A;  5FDS A;  4OPQ A;  4B93 A;  2Y2O A;  1K4E A;  3UB9 A;  4ZDX A;  4IJG A;  4MNR A;  2VGJ A;  4P6B A;  4ETX A;  4OPZ A;  1ES3 A;  5IT5 A;  1SCW A;  1TDL A;  3FC7 A;  1CEF A;  1S67 L;  4I39 A;  5I5L A;  1OT6 A;  2Y91 A;  2W1T A;  3BLM A;  2WGW B;  3A3I A;  3E0Y A;  3F1N A;  3C8C A;  4BMW A;  4EBL A;  2H0Y A;  1FIL A;  3MFX A;  3V3R A;  1ESU A;  5JYP A;  4R4R A;  3WS1 A;  3GSG A;  4Y2F A;  4OPR A;  4KZA A;  3A3F A;  3VP2 A;  3F1P A;  3K3C A;  1IYO A;  3EEA A;  3N6I A;  3NBL A;  4DN0 A;  4FCF A;  1L2S A;  4XXR A;  2EXB A;  4WL9 A;  4OOL A;  4UQI S;  1MBL A;  2ZQC A;  3M6B A;  3A0S A;  1FCM A;  4LPZ A;  3QP5 A;  2V8F A;  4RYE A;  3VSL A;  3HRE A;  4N92 A;  3PYP A;  5CXW A;  1F2K A;  4RX2 A;  1OTI A;  4P0M A;  2WKH A;  1F5M A;  4KZ5 A;  4I3J A;  1I2W A;  2K2N A;  4XUZ A;  1MWT A;  2P7J A;  5CER A;  2WKE A;  3RTY A;  3TW8 A;  2B95 A;  1XA1 A;  2J7V A;  5CED A;  5FA7 A;  1NRJ A;  4HBT A;  2E8I A;  4JF5 A;  3Q81 A;  2XF3 A;  4Y5F A;  3IF6 C;  1W7F A;  3FV7 A;  4ESP A;  4X53 A;  1I2S A;  2OSU A;  1JNU A;  3BLS A;  3ZG9 B;  2GZA A;  2ZQ9 A;  1XA7 A;  2D01 A;  1BSG A;  2X71 A;  4WUJ A;  3N4I A;  5L10 A;  4I5S A;  5HAP A;  3TRC A;  2A49 A;  1L3L A;  1NJ4 A;  2PD7 A;  1PI5 A;  2Y2J A;  1TF1 A;  5FL3 A;  1K6R A;  1YKD A;  5DJU A;  4X69 A;  5EPH A;  2JE5 A;  3C4O A;  3A3E A;  3QP2 A;  4HP9 A;  4GD6 A;  3LO7 A;  3PBS A;  4BBT A;  3F1P B;  1AXB A;  3RXW A;  2PD8 A;  4IUK A;  4MMN A;  3PTE A;  3OZH A;  3KSF A;  4Y0U A;  3VOY A;  3B42 A;  4JF4 A;  4MLL A;  4OLD A;  4E3N A;  1BTL A;  5KZH A;  1CF0 A;  1P0Z A;  3IS2 A;  4JLF A;  3H82 B;  1MXO A;  2UV0 E; 
#chains in the Genus database with same CATH homology
 1EI5 A;  4WZ5 C;  5KSH A;  5AQA A;  4WEK A;  2B5R A;  1HD8 A;  5CTN A;  5TFQ A;  3ZDJ A;  5AQ7 A;  1MY8 A;  1Q2Q A;  3WRZ A;  1IKI A;  2WAE A;  5A93 A;  5IHV A;  4QY6 A;  1GHP A;  5HW3 A;  4N1X A;  1ZC2 A;  2Y2K A;  4YIN A;  5E43 A;  3OCL A;  3GR2 A;  1ZG4 A;  1HZO A;  4OQH A;  4WM9 A;  2ZM0 A;  4U0T A;  4PM7 A;  2RL3 A;  5M18 A;  5TR7 A;  4R3J A;  1MWS A;  3HLB A;  5DF8 A;  4E6W A;  4CPK A;  3LY3 A;  1IEL A;  5HAI A;  1PYY A;  5A90 A;  1K57 C;  4UHU A;  4N9K A;  3BRM A;  3TG9 A;  3BFG A;  4OPY A;  3IF6 B;  2XLN A;  3GRJ A;  1XGI A;  3ZNY A;  1JWP A;  1YLY A;  3HUO A;  2WAF A;  5E2H A;  3AGF A;  5HFO A;  2WAD A;  4KZ3 A;  3ZG8 B;  2EFX A;  1HTZ A;  4GNU A;  4OQ0 A;  3WS2 A;  3CZD A;  1KDS A;  1DJB A;  4KZB A;  1W8Y A;  5A91 A;  3C5A A;  4R4S A;  5FQI A;  5CEB A;  1I5Q A;  2G2W A;  5HAR A;  2PU2 A;  1K56 D;  1JTD A;  1NYY A;  4DE2 A;  2HDQ A;  4B4Z A;  1MWR A;  2XR0 A;  3DW0 A;  3IXB A;  3Q82 A;  4S2J A;  1KGG A;  4ZAM A;  3CG5 A;  5F83 A;  1YMX A;  3VOZ A;  4EBN A;  2C6W B;  3UY6 A;  4E3L A;  1TDG A;  3ITB A;  1FCO A;  3HLE A;  3IH8 A;  1BLH A;  1E25 A;  3IWO A;  4KG5 A;  4GDN A;  2ZC3 B;  3M2J A;  4QHC A;  1WYB A;  1G68 A;  4S2K A;  4ZJ1 A;  3G35 A;  4GOG A;  1YMS A;  2XD1 A;  3QNC A;  1YLW A;  4WEL A;  3MKF A;  4Z9Q A;  3C4P A;  5GLB A;  2WYX A;  3MZF A;  3Q7V A;  4S2I A;  5CHJ A;  2IWB A;  3FWL A;  2ZD8 A;  3MXS A;  4LEN A;  4U0X A;  3UDF A;  3HUN A;  4MBK A;  3M6H A;  1GA9 A;  4JPM A;  4NET A;  1YM1 A;  2EFU A;  4IVI A;  1WYC A;  1XGJ A;  3I7J A;  4P87 A;  4BD0 A;  4UA9 A;  3G32 A;  2HP6 A;  4KQQ A;  1NZO A;  5FSR A;  4PPR A;  1MKI A;  4L0L A;  4N9L A;  5DF7 A;  3HLD A;  1YLT A;  3B3X A;  4JBF A;  3ZVW A;  3NI9 A;  1W8Q A;  3NIA A;  3Q7V B;  1DJC A;  4R3B A;  2P9V B;  1FSY A;  3GQZ A;  3FYZ A;  4JKT A;  3CJM A;  4X56 A;  5EVI C;  3UPO A;  3VSK A;  1U60 A;  3SH9 A;  3ZGA B;  3PBO A;  5HL1 A;  4S2M A;  1M40 A;  3N7W A;  4Y7P A;  3UDX A;  1G6A A;  3BFD A;  3HL9 A;  4P85 A;  5E2F A;  2XDM A;  5GLC A;  2H10 A;  2ZMA A;  1HVB A;  3ZVT A;  2V1Z A;  3PAE A;  3BFF A;  1ESI A;  4CJN A;  1GA0 A;  1NXY A;  2Z2L B;  1VQQ A;  2ZC5 B;  2HDU A;  4EQI A;  4WMC A;  3ZFZ A;  3A3D A;  3BYD A;  1PZP A;  4IBX A;  1M6K A;  1NY0 A;  2HDS A;  3GV9 A;  4LV3 A;  4C3Q A;  4EWF A;  3VP1 A;  3QHY A;  2JC7 A;  1K56 A;  1FSW A;  4C6Y A;  5FI7 A;  1NZU A;  4GKU A;  3O86 A;  5FQK A;  3ZG0 A;  2ZJ9 A;  3S1Y A;  5FAP A;  2H0T A;  1K6S A;  1SDN A;  1IYQ A;  1CK3 A;  3OPH A;  1XKZ A;  1BZA A;  4PMA A;  3UE1 A;  4LCM A;  1KE4 A;  5FAO A;  1BLC A;  2A3U A;  4KQO A;  2WK0 A;  3DWZ A;  2GDN A;  1PIO A;  1PWG A;  3BM6 A;  4IVK A;  3BFE A;  4PM8 A;  3ITA A;  3O3V A;  5FQ9 A;  3IWQ A;  5GL9 A;  4S2N C;  4DDS A;  5GLA A;  1L0F A;  1L0D A;  3E2L A;  3OC2 A;  4OQI A;  2Z2M B;  1LI9 A;  1K25 A;  5J8X A;  1CEG A;  2XFS A;  3G30 A;  3WRT A;  4ZJ3 A;  1K4F A;  3BEC A;  2ZM8 A;  2EX9 A;  3S22 A;  3VP3 A;  3IXH A;  5EUA A;  5EEC A;  2QZ6 A;  2HDR A;  2WZZ A;  1RGZ A;  1VM1 A;  3FKW A;  3MZD A;  1MPL A;  1QME A;  3IHA A;  1N4O A;  4K0X A;  2QPN A;  1ZG6 A;  3ZNT A;  2HP9 A;  3SS5 A;  5FQJ A;  2WGV A;  1S6R A;  3M2K A;  3FKV A;  3MXR A;  2EX8 A;  4UA6 A;  2ZLY A;  3JYI A;  3V5M A;  4BEN A;  4Y0T A;  1DJA A;  4E3K A;  2XFT A;  3PBN A;  5FI6 A;  2C5W B;  2V2F F;  5G18 A;  2P9V A;  3C7V A;  5F82 A;  4QJG A;  5KMW A;  5CEC A;  4E3M A;  4BD1 A;  5FAQ A;  4S2P A;  4MEZ A;  3SS4 A;  4DXC A;  4R0Q A;  1MWU A;  2WUQ A;  2X02 A;  3NC8 A;  1IEM A;  4IBR A;  3V3S A;  1XXM A;  1ES5 A;  3IXG A;  3IXD A;  4NK3 A;  1ERM A;  3UO9 A;  3GMW A;  4QD4 A;  5TGF A;  4KZ6 A;  5I94 A;  1YQS A;  2HPB A;  4MBF A;  2Y2M A;  3HBR A;  4OP5 A;  2Y4A A;  4ZJ2 A;  3HUM A;  3IF5 A;  5E2G A;  3DWK A;  3NDE A;  2WGW A;  1JWV A;  4FH2 A;  2HP5 A;  4OKP A;  1K55 C;  3IH9 A;  3IQA A;  4KZ4 A;  4R23 A;  2ZC6 B;  3P09 A;  3G31 A;  4BL3 A;  1GCE A;  1XP4 A;  4QY5 A;  5KSC A;  1S0W A;  1EWZ A;  3PAG A;  4BJP A;  4KG6 A;  1RGY A;  3RXX A;  4M3K A;  4K0W A;  4KQR A;  4JXS A;  4QB8 A;  1LL5 A;  1C3B A;  4C75 A;  1L0E A;  5FQM A;  1FQG A;  5AQB A;  1BLS A;  2ZQ8 A;  4U3T A;  1SKF A;  1W5D A;  2ZQ7 A;  3VP4 A;  3WWX A;  4PM5 A;  5DVA A;  3LCE A;  1RCJ A;  3CMZ A;  4WZ4 A;  5EVI D;  2OV5 A;  5BOH A;  2PBY A;  3VFH A;  2V20 A;  2OLU A;  2PU4 A;  1NYM A;  4DDY A;  1ZKJ A;  2QMI A;  3MKE A;  4GZB A;  4KZ7 A;  2Q9N A;  3HLF A;  2RCX A;  2X01 A;  3V50 A;  5F1F A;  3MBZ A;  2XK1 A;  4PM9 A;  1OME A;  3Q7Z A;  3SS3 A;  3WS4 A;  1KE3 A;  4OP8 A;  2ZQD A;  3UE3 A;  2XQZ A;  2WKI A;  1LL9 A;  3E2K A;  3NCK A;  2DCF A;  1FOF A;  3Q07 A;  2ZC7 A;  1JTG A;  1CI8 A;  5CRF A;  3C7U A;  4BLM A;  1KGE A;  1PWC A;  3NY4 A;  1YLZ A;  3OPR A;  2J9P A;  1KE0 A;  4OPQ A;  3DTM A;  2Y2O A;  4DF6 A;  5FDH A;  1K4E A;  2BG1 A;  3PBT A;  5CGS A;  3UPP A;  3S4X A;  1QMF A;  4ZDX A;  1K54 C;  4MNR A;  2VGJ A;  3BFC A;  3O87 A;  4P6B A;  4KEN B;  4PM6 A;  1BLP A;  4OPZ A;  4JXW A;  1IKG A;  1PW8 A;  1ES3 A;  1ONH A;  5EOO A;  1SCW A;  1Z6F A;  1XPB A;  1TDL A;  2J8Y A;  4D2O A;  1CEF A;  5CGX A;  3UE0 A;  2ZM2 A;  3IHB A;  1K57 A;  1IYP A;  4HES A;  1O7E A;  3EQV A;  3AGD A;  4JXV A;  2DRW A;  1KGF A;  1H8Y A;  3N8S A;  4O7D A;  1FCN A;  1FR6 A;  2XD5 A;  4RX3 A;  2Y91 A;  3BLM A;  1K55 A;  2WGW B;  3A3I A;  3IWI A;  3SH7 A;  5GHZ A;  1CI9 A;  1ONG A;  4EBL A;  2H0Y A;  3GTC A;  1KDW A;  3WS0 A;  3V3R A;  1ERO A;  1TEM A;  4XUX A;  1ESU A;  4X68 A;  5JYP A;  4R4R A;  3WS1 A;  2Y2P A;  3GSG A;  4ZBE A;  4JF6 A;  3G4P A;  4E3J A;  4OPR A;  3MZE A;  1SHV A;  4OH0 A;  4YFM A;  4KZA A;  3A3F A;  5M1A A;  3VP2 A;  2CC1 A;  3VP0 A;  1IYO A;  4BQM A;  4QU3 A;  3W4O A;  1SDE A;  3BEB A;  3N6I A;  3NBL A;  4WMC D;  4FCF A;  5EVL A;  2XEP A;  1L2S A;  4HEF A;  5EOE A;  1YLJ A;  5F1G A;  1W79 A;  1PW1 A;  3ZHH A;  4XXR A;  2BLS A;  3V39 A;  5DTK A;  4OOM A;  2EXB A;  1E3U A;  2VGK A;  4ZTK A;  1JWZ A;  1H8Z A;  4JXG A;  3ISG A;  4OOL A;  4OON A;  1GHI A;  4S2L A;  1MBL A;  2ZQC A;  3M6B A;  1K38 A;  3W8K A;  1FCM A;  3RJU A;  2ZQA A;  4UAA A;  2R9W A;  5FAT A;  3TSG A;  4N1H A;  4KZ9 A;  5GLD A;  4WYY A;  3LY4 A;  4DKI A;  5EE8 A;  4GN2 A;  2EX2 A;  4RYE A;  4WBG A;  3VSL A;  1IYS A;  4OVD A;  3HRE A;  3IT9 A;  3UDI A;  2WZX A;  5U47 A;  4N92 A;  5CXW A;  4RX2 A;  3N8L A;  2EXA A;  4B88 A;  1LI0 A;  2Y2N A;  3MFD A;  4P0M A;  3ZG5 A;  2WKH A;  4KZ5 A;  2G2U A;  4GD8 A;  2Y55 A;  1K54 A;  2R9X A;  3NDG A;  3AGE A;  5FAS A;  4DRT A;  1I2W A;  3SH8 A;  4WEJ A;  5HAQ A;  4XUZ A;  3UPN A;  5CHU A;  5JYO A;  3VMA A;  1MWT A;  3O88 A;  2Y2G A;  3PBR A;  1H5X A;  5CER A;  1XX2 A;  2WKE A;  1XA1 A;  5CTM A;  1NRF A;  4EUZ A;  2J7V A;  5CED A;  5E2E A;  5FA7 A;  1BT5 A;  3D4F A;  4HBT A;  2E8I A;  4JF5 A;  3Q81 A;  1Q2P A;  2XF3 A;  2JCH A;  3PBQ A;  4E3I A;  4WZ5 A;  4FSF A;  3IF6 C;  5FQQ A;  1W7F A;  3FV7 A;  4MBH A;  4X53 A;  4B4X A;  1I2S A;  2ZC4 B;  2OSU A;  3Q1F A;  5GHY A;  3BLS A;  3ZG9 B;  4E6X A;  1GHM A;  2ZQ9 A;  5DTT A;  1RP5 A;  3OPP A;  1DY6 A;  1LLB A;  1XA7 A;  5EVI A;  2XGN A;  3FZC A;  5M19 A;  4LV1 A;  4RVA A;  1YLP A;  2Y2H A;  5D3O A;  2Y2L A;  4H8R A;  2Y2Q A;  1J9M A;  1BSG A;  3SOI A;  3GVB A;  2X71 A;  3OPL A;  2FFY A;  2IWD A;  4DE1 A;  3N8R A;  3TOI A;  2XH9 A;  4EBP A;  3N4I A;  2WGI A;  5A92 A;  1O07 A;  5HAP A;  3UNW A;  2A49 A;  3G2Z A;  3EQU A;  4E3O A;  4FH4 A;  4Y0O A;  1NJ4 A;  1PI5 A;  5CGW A;  1BUL A;  2Y2J A;  2Y59 A;  4KZ8 A;  3W4P A;  1K6R A;  2H5S A;  5CHM A;  3ZG7 B;  2OLV A;  3VFF A;  2EX6 A;  3WS5 A;  4UA7 A;  2J9O A;  4X6T A;  3ZCZ A;  3OCN A;  4X69 A;  4FD8 A;  4LCL A;  2UWX A;  4S2N A;  5EPH A;  4EV4 A;  3HVF A;  3IF6 A;  4OQG A;  2JE5 A;  2Q9M A;  4OOY A;  3C4O A;  3A3E A;  5HX9 A;  1WE4 A;  4ID4 A;  1E3U D;  1PWD A;  3HLG A;  5DF9 A;  3QNB A;  1FR1 A;  2IWC A;  4HBU A;  4OLG A;  2Y2I A;  3W4Q A;  3G2Y A;  4R1G A;  4GD6 A;  3HLC A;  4DXB A;  3LO7 A;  1Y54 A;  1N9B A;  3PBS A;  4DE3 A;  4A5R A;  1ES2 A;  1AXB A;  4LV2 A;  3RXW A;  1E4D A;  4RA7 A;  4Q8I A;  2JBF A;  5EVI B;  5GHX A;  3PTE A;  2FFF B;  1TVF A;  3OZH A;  5AQ9 A;  1BUE A;  4F94 A;  4Y0U A;  3G34 A;  4K91 A;  3UN7 A;  5L2F A;  3VOY A;  4S2O A;  4IED A;  2DNS A;  4JF4 A;  1LHY A;  4MLL A;  4OLD A;  4E3N A;  4GDB A;  4BL2 A;  1KVL A;  4KG2 A;  1BTL A;  3LEZ A;  1L0G A;  1JVJ A;  1PI4 A;  3P98 A;  4DE0 A;  4GB7 A;  5KZH A;  1YT4 A;  2P74 A;  5FI2 A;  1ERQ A;  1ES4 A;  1PZO A;  1KVM A;  5DTS A;  3A3J A;  1ALQ A;  3HLW A;  4JLF A;  1MXO A;  2I72 A;  4LV0 A;  4X55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...