3S22A

Amp-c beta-lactamase (pseudomonas aeruginosa) in complex with an inhibitor
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
361
structure length
361
Chain Sequence
APADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase
publication title Side chain SAR of bicyclic Beta-lactamase inhibitors (BLIs). 2. N-Alkylated and open chain analogs of MK-8712
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 122
structure length 361
sequence length 361
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3s22A00
3NCKA 3ZFZA 4FCFA 3IH9A 2HDQA 4R4RA 4RA7A 4OPRA 3IF5A 4FH2A 5DF8A 1FR1A 1KDSA 1RGYA 3WS1A 3ZG9B 4UA9A 3V39A 3SS4A 3MKFA 4BJPA 2XR0A 4ZAMA 1J9MA 2HDRA 1HVBA 3A3EA 2XH9A 3AGDA 3BRMA 4WEKA 5F82A 1PWGA 4BQMA 4EBLA 1EROA 4FSFA 4KZ6A 3NBLA 5TR7A 3WS0A 1W8QA 2RCXA 3MFDA 1PI4A 1SKFA 3RXWA 2WKHA 2ZQ9A 3Q1FA 1TDGA 4ZJ3A 4ID4A 1GHMA 1L0FA 3ZG8B 4HEFA 3BM6A 1ALQA 1O7EA 2WGWB 3PBSA 3HBRA 4RYEA 3EQUA 4GB7A 1AXBA 4Y0UA 2Y2PA 4R3JA 1YLTA 5J8XA 2FFFB 4H8RA 2WGWA 4KQRA 3VP1A 4JXGA 2H5SA 3FWLA 2Y2GA 1NY0A 2CC1A 5FI7A 2Y2IA 5KZHA 2ZC6B 1PYYA 3OPRA 2GDNA 1BSGA 1PW1A 2ZLYA 4PM6A 3GRJA 4ZJ2A 5GLAA 4MBFA 2R9XA 5FA7A 3HLEA 4WMCD 3O3VA 1NXYA 1YLYA 2EX9A 4QHCA 1M6KA 3PAGA 1OMEA 3Q7VA 3FZCA 4KZ9A 4E3OA 2Y2OA 5HAQA 1BLHA 3ZCZA 4E3LA 1HZOA 4KG6A 2XQZA 3GSGA 3LCEA 4KG2A 5TGFA 3HLBA 2ZQDA 2ZQ8A 4R23A 3VP0A 4BD0A 1FCNA 2P9VB 1K57C 4HBUA 5U47A 1K54C 1IYSA 1KGEA 3RXXA 2WUQA 1IELA 2VGKA 4B4ZA 3P09A 1H5XA 1XXMA 4IVKA 4S2LA 2WZXA 3Q81A 1ERMA 3ITAA 4JF5A 3UE1A 5IHVA 5GHXA 3NIAA 4OP8A 4BLMA 1JTGA 5DTTA 1L0EA 4WZ4A 4GDNA 3ZG5A 1W5DA 1TDLA 1CK3A 3N6IA 3NC8A 4JF6A 4YINA 3BEBA 1E3UA 4PM7A 2V2FF 3HLCA 3IXDA 3M2JA 5FSRA 4E3MA 3CG5A 4QB8A 1DJAA 3PBQA 5CGXA 4NETA 2WGIA 3V5MA 3BFEA 4K0XA 5FI6A 3NDGA 2JC7A 1MWRA 2C6WB 4S2IA 4Y7PA 1PZPA 2WADA 1K6RA 1KE4A 3N4IA 5CEDA 4MBHA 4OQHA 3IXBA 4OQIA 5E2EA 3ZDJA 2QPNA 3CMZA 1N9BA 3A3JA 4ZJ1A 1Z6FA 4DRTA 4F94A 2G2UA 1PWDA 4R4SA 4IEDA 4R1GA 5EPHA 4KZBA 1L0GA 1XPBA 1TVFA 3IQAA 3ZG7B 2HP6A 2G2WA 2Y2KA 3TG9A 5KSCA 5GL9A 1W7FA 3IF6A 4PM9A 1DJCA 3IHAA 4BL3A 3A3IA 3UN7A 1LI0A 1LHYA 2Y91A 5TFQA 4E3KA 4OPQA 1YQSA 3HLDA 5CGWA 4X6TA 4GZBA 4B4XA 1LI9A 1Q2PA 2XLNA 5KSHA 2HDUA 5HL1A 4S2NC 1SHVA 4RX2A 3Q82A 4CJNA 4YFMA 5GLBA 4KZ5A 5BOHA 5DF9A 3SS5A 1ERQA 5FQIA 4X69A 3N8RA 3LY4A 3HUNA 4MNRA 4L0LA 3SS3A 4P6BA 3TSGA 1VQQA 3G34A 3AGFA 5FATA 2Y2LA 2J9PA 4GD8A 1Y54A 1YT4A 2C5WB 4C6YA 4KZ3A 3FYZA 4JXVA 3DTMA 1YLWA 2ZQAA 4N92A 1IYOA 3UE3A 3PBNA 3SOIA 4MEZA 2EFUA 2ZM8A 5AQ9A 1BLSA 5FAQA 3C4OA 4P87A 2I72A 2ZC4B 4WZ5A 1ZG4A 1MPLA 5AQAA 5HARA 1G68A 3PBOA 4OLDA 5A91A 2EX2A 3FKWA 5EVIB 1YMSA 2IWBA 3C7UA 1K25A 2Y2QA 3ZNYA 1K38A 3GQZA 5E2FA 3BFGA 4KZ4A 4XXRA 4DE0A 4IBRA 1IYQA 2Y4AA 4BL2A 1YLPA 2HDSA 5I94A 4IVIA 4QY5A 5DTKA 4MLLA 2WYXA 4GD6A 3ZVTA 3LEZA 4OOLA 1PW8A 2EX6A 3MZEA 5AQ7A 4GNUA 2WZZA 1E3UD 1KE3A 2X71A 1ES3A 3A3FA 3W4PA 5A90A 5CRFA 2Y2MA 2Y55A 2ZJ9A 3VOYA 4OOMA 3WS4A 2A49A 4S2MA 3BYDA 4WEJA 5EECA 4N1XA 1ZG6A 2Z2LB 2OV5A 1XGIA 4KQQA 3EQVA 3IWQA 4E6XA 5FQ9A 3VMAA 4EWFA 3MBZA 4XUZA 3MZDA 2PU2A 4OKPA 2Q9MA 3BFFA 2ZMAA 1BUEA 3DWKA 5EUAA 1SDNA 4QD4A 2Y59A 1JWVA 1MWUA 3G4PA 3UPOA 1IEMA 5FASA 3MKEA 4PMAA 2P9VA 1SCWA 4OQGA 1Q2QA 1H8ZA 1JVJA 3FV7A 3OZHA 2B5RA 2DCFA 2V20A 2H10A 5CECA 3VP3A 2R9WA 4Y0OA 1MKIA 2ZC3B 2XFTA 1FOFA 3HUOA 3UNWA 3V3SA 4ZDXA 1MBLA 4EBNA 4LV1A 3AGEA 3LY3A 1K55C 4OQ0A 4PM8A 4R0QA 4DXCA 1WYCA 4X55A 3OPPA 2JCHA 3O87A 3Q7ZA 2OLUA 2XK1A 5FQJA 4IBXA 5HX9A 3P98A 4B88A 4BD1A 3UE0A 4UA6A 4N9LA 2H0YA 1K56A 5FAPA 1I5QA 1SDEA 2IWDA 1XA1A 4PM5A 3WS5A 5JYPA 2ZD8A 5F83A 4JXSA 1K57A 1XGJA 2DRWA 4OLGA 4QY6A 4XUXA 3IF6C 2V1ZA 4N1HA 4U0TA 1NJ4A 1WE4A 4LENA 5EE8A 1DY6A 2Z2MB 1XA7A 2X01A 2XF3A 5A93A 3NY4A 1C3BA 4OPZA 2XDMA 2XFSA 3LO7A 1WYBA 2HP9A 2Q9NA 3VFFA 4DDSA 4Z9QA 2J8YA 4JXWA 4RX3A 4LV0A 4EQIA 5KMWA 1CI9A 3ZG0A 1FR6A 1JWZA 3HUMA 5CTNA 5E2HA 4GDBA 3TOIA 3UDXA 1E25A 1EWZA 1JTDA 1QMEA 4JPMA 3IT9A 1KDWA 5EVLA 1HTZA 3WS2A 4DKIA 3GMWA 1FQGA 3IWOA 4U3TA 3UPPA 3PBRA 4U0XA 4D2OA 1I2WA 5F1FA 3ZVWA 4KZ8A 1LL9A 5E2GA 2Y2NA 3N8LA 3N7WA 3HL9A 5CGSA 1K4EA 1CI8A 3UDFA 5A92A 1S0WA 1PWCA 2HP5A 2WKEA 3N8SA 1ONGA 3OCNA 4GN2A 4X68A 1U60A 5FQKA 4E3NA 1LLBA 3PAEA 5JYOA 2ZM2A 1CEGA 1L0DA 3C4PA 3O86A 3BFDA 2E8IA 5G18A 1K6SA 5DTSA 4WZ5C 2WGVA 1BULA 3ISGA 5HW3A 4E3JA 5GHZA 2J7VA 4S2JA 4OPYA 2XD5A 5GLDA 1KVLA 2WKIA 4EV4A 4UA7A 3UDIA 4ZBEA 3DWZA 2EX8A 3G2YA 2XD1A 3G32A 1QMFA 4S2KA 1ES2A 3PTEA 4HESA 5EVIA 4GOGA 3SH9A 3G30A 1G6AA 1ONHA 1PI5A 5D3OA 5E43A 3VFHA 1ES5A 5CEBA 1KVMA 2BG1A 4OOYA 3HREA 1BTLA 3C7VA 4K0WA 4M3KA 1MWTA 1RP5A 2IWCA 2WAEA 3WRTA 1HD8A 4KZAA 2ZC7A 4S2OA 4Q8IA 3VSLA 3NDEA 4CPKA 1TEMA 2Y2JA 4OONA 5FQMA 2QZ6A 3SH8A 3W8KA 3DW0A 4DF6A 1ES4A 1I2SA 4P85A 1YLZA 3I7JA 3ZGAB 1ZKJA 2WAFA 2HPBA 3VP4A 3M2KA 5HAPA 3BLMA 1K56D 2RL3A 2OSUA 5DVAA 1XP4A 5CERA 3OC2A 2ZC5B 3G35A 4JF4A 4KG5A 3IXGA 4QJGA 1BZAA 2BLSA 3WRZA 4JLFA 1GHIA 1S6RA 5FAOA 4KZ7A 4OVDA 3ITBA 3V3RA 3BLSA 1MY8A 1FSYA 4P0MA 1IKIA 3UO9A 2UWXA 4EUZA 3GVBA 4WYYA 1GCEA 1W8YA 4KQOA 3S4XA 1YLJA 3Q7VB 4O7DA 2ZQCA 3Q07A 2VGJA 4FH4A 4S2PA 4C75A 1XKZA 1RGZA 3A3DA 1L2SA 2OLVA 4QU3A 4ZTKA 3RJUA 4BENA 4LCMA 5HAIA 2XGNA 3B3XA 4K91A 1PIOA 4DDYA 1W79A 4N9KA 3C5AA 4DXBA 2EXAA 2A3UA 5M1AA 3VOZA 4Y0TA 3MZFA 1BT5A 3CJMA 3CZDA 3S1YA 5L2FA 3FKVA 1E4DA 5CHJA 3HVFA 3ZNTA 4X56A 5GHYA 3G31A 1KE0A 5DF7A 1K54A 3VSKA 1FCOA 3G2ZA 4JKTA 1XX2A 4WELA 3VP2A 5CHMA 3S22A 3W4QA 3PBTA 4X53A 5CHUA 4R3BA 1NYMA 2EXBA 1BLPA 3BECA 2Y2HA 1GA0A 4WMCA 4OP5A 4UHUA 1ZC2A 1EI5A 1NYYA 3MXRA 3IH8A 3D4FA 3HLFA 1K55A 1NZUA 3M6BA 5AQBA 3WWXA 3V50A 4E3IA 3OPLA 4FD8A 1M40A 1VM1A 4E6WA 2X02A 4NK3A 3QHYA 3UY6A 4A5RA 4KENB 1O07A 3JYIA 1ESUA 1N4OA 3E2LA 5HFOA 3IF6B 4C3QA 5FI2A 5EVID 3GTCA 1NZOA 4WM9A 5EOOA 5F1GA 3BFCA 3QNCA 1H8YA 1ESIA 3NI9A 4DE3A 4UAAA 5FQQA 2WK0A 1MWSA 2JBFA 1GA9A 2QMIA 4GKUA 5EOEA 3IXHA 3ZHHA 4JBFA 1MXOA 1YMXA 2XEPA 3E2KA 3HLWA 2H0TA 2J9OA 4LV3A 5CXWA 3GV9A 2PBYA 4DE2A 3W4OA 1YM1A 3OCLA 1K4FA 5FDHA 3O88A 5GLCA 4EBPA 2ZQ7A 1GHPA 1PZOA 2EFXA 3M6HA 2PU4A 3QNBA 1KGFA 4HBTA 1IKGA 2P74A 4PPRA 1IYPA 3GR2A 1FSWA 1BLCA 1DJBA 2FFYA 4OH0A 4RVAA 2JE5A 2DNSA 3HLGA 3MXSA 4MBKA 5EVIC 4DE1A 5M18A 4LCLA 3IWIA 4S2NA 1KGGA 3IHBA 5M19A 2ZM0A 4LV2A 4WBGA 3OPHA 1LL5A 3UPNA 1FCMA 1JWPA 1NRFA 3SH7A 1RCJA 1CEFA 5CTMA
chains in the Genus database with same CATH superfamily
4EU0A 2HDQA 4R4RA 4O01A 5DF8A 1RGYA 1IFQA 4ZAMA 5EFWA 3VOLA 2UV0E 1PWGA 2O9BA 4EBLA 1A0KA 1PI4A 1SKFA 3CHWP 3RXWA 2WKHA 2INWA 4EQ1A 2VLGA 1J3WA 2WGWB 4NXGA 1WA9A 2Y2PA 2FFFB 3R7WB 2HF6A 4KQDA 3VP1A 3FC7A 2CC1A 2ZC6B 2EWWA 3IS2A 3MR0A 3H7WB 2VGLS 2R9XA 4MN6A 3TE8A 1OMEA 4AFIA 2Y2OA 4KG6A 2XQZA 4CLCE 4BD0A 5DKLA 2P9VB 5J3WA 3H82B 1FIKA 1IELA 3F1OA 4WN5A 2WZXA 3Q81A 3ITAA 3UE1A 5IHVA 3CPTB 4BLMA 1JTGA 5DTTA 1L0EA 3N6IA 4JF6A 3EEAA 5FSRA 3CG5A 1VHMA 4QB8A 3T1RA 4H6JA 1DJAA 5CGXA 4I3AA 4PHTA 4K0XA 2JC7A 2WADA 3OOVA 5CEDA 3IXBA 2XRNA 1XPBA 3C30A 4HJ6A 5HPFA 4FOFA 2Y2KA 5KSCA 5F68A 5GL9A 4BL3A 2JKFA 3VE3A 2L4RA 3KO6A 3EWKA 4OPQA 4IUHA 5CGWA 4X6TA 4GZBA 3OBFA 3MF0A 2YKHA 4CJNA 5GLBA 3LY4A 2EA9A 3TSGA 3G34A 5IS1A 2C5WB 1TS7A 3LFVA 3DTMA 5HWTA 1IYOA 1ACFA 5FAQA 3C4OA 3UB6A 5L09A 3T50A 2I72A 1MPLA 2EX2A 1K25A 2Y2QA 1K38A 5E2FA 3BFGA 4KZ4A 4L9FA 4BL2A 2HDSA 4GLQA 2CMNA 3CUEC 4QY5A 4MLLA 3R7WA 4KUOA 1PW8A 2EX6A 5FL3A 2PRFA 2WZZA 1KE3A 2WKQA 5A90A 3A3FA 2Y2MA 2Y55A 2ZJ9A 4OOMA 2A49A 3BYDA 4WEJA 2Z2LB 2OV5A 2JKTM 3H7WA 3IWQA 4E6XA 5FQ9A 3MBZA 1EW0A 3UPOA 2P9VA 3H82A 1Q2QA 3CPTA 2XFTA 2P7JA 2M7UA 1W63M 1MBLA 1YPRA 1XJ3A 2M7VA 4HIAA 2GJ3A 4B88A 2XK1A 3P98A 3E4PA 2H0YA 2L1MA 4JXSA 1K57A 2DRWA 4XUXA 4N1HA 1H3QA 2XA7S 3E0YA 1WE4A 2LB9A 1DY6A 3DAVA 2W27A 5A93A 3KSIA 1C3BA 4OPZA 4DDSA 2HP9A 2Q9NA 3VFFA 5I5LA 4JGRA 3TRCA 4JXWA 3K2NA 1Y28A 2QJ5A 2GX5A 3ZG0A 1FR6A 1F2KA 1EWZA 1JTDA 3PHYA 3E4QA 3UB7A 5EVLA 1HTZA 4ETXA 3UPPA 3PBRA 4U0XA 5F1FA 1T1CA 2VA0A 3ZVWA 3N8LA 3UDFA 5F69A 4CLCC 3OCNA 4X68A 3PAEA 5HWWA 3O86A 2E8IA 3KX0X 1TF1A 5DTSA 2ACGA 1L3LA 1OT6A 3R4KA 4S2JA 2OAP1 2V8FA 3G30A 1G6AA 3O5YA 1FILA 1RP5A 2WAEA 3WRTA 2ZC7A 4S2OA 4Q0JA 3NDEA 4GW9A 3KYEA 1TEMA 4OONA 3W8KA 1T18A 4DF6A 4P85A 3MFXA 2R78A 1YLZA 1MC0A 3I7JA 3ZGAB 1ZKJA 3M2KA 2RL3A 5DVAA 3G35A 3IXGA 4QJGA 1BZAA 1OTEA 3ITBA 2QKPA 3V3RA 1IKIA 4DJ2A 4LPZA 1GCEA 4HP9A 3HJIA 3Q7VB 3Q07A 4S2PA 1OPXA 4BENA 1D7EA 3B3XA 1PIOA 1W79A 4X1LA 4Y0TA 2A3UA 3SZTA 3CZDA 3S1YA 2E8JA 3HVFA 3MMHA 5DF7A 3VSKA 1XX2A 3W4QA 2EXBA 2Y2HA 5AVFA 1EI5A 1NYYA 1Z09A 1NZUA 3M6BA 1P9WA 4E3IA 3OPLA 5MC7A 1VM1A 2W1TB 1SZVA 3QHYA 4KENB 1Y4OA 2AVXA 3E2LA 5HFOA 4IUKA 1H8YA 1ESIA 3NI9A 4DE3A 1GA9A 4JBFA 3HLWA 4LV3A 3W4OA 3OCLA 1K4FA 5FDHA 3O88A 5GLCA 2ZQ7A 2PU4A 3C2WA 2P74A 2WKRA 4PPRA 1IYPA 1BLCA 1DJBA 2FFYA 2JE5A 3MXSA 2ZOHA 4E04A 4WBGA 2W3GA 1RCJA 1CEFA 5CTMA 3NCKA 3IH9A 1ZTUA 3IF5A 3LI8A 1UGUA 2LB5A 3ZG9B 4UA9A 3SS4A 3D72A 1J9MA 2HDRA 3AGDA 4JGQA 2VV7A 1EROA 4KZ6A 5TR7A 4NXBA 2RCXA 4I3JA 3MFDA 2MJ6A 3Q1FA 1L0FA 3ZG8B 3BM6A 1ALQA 1O7EA 3PBSA 4Y0UA 4R3JA 3OLOA 2H5SA 3FWLA 2Y2GA 5HD3A 2Y2IA 4R70A 1PYYA 4GHIB 2K31A 3OPRA 2GDNA 1BSGA 2PR5A 4ZJ2A 5GLAA 2VJWA 4KUKA 4WMCD 4HP4A 3UE6A 3MSHA 4HH2A 4ME4A 3Q7VA 2FH5A 4KZ9A 3ZCZA 5TBMB 2ZQ8A 3VP0A 1FCNA 2PHYA 3RXXA 1KGEA 3LI9A 2VGKA 3P09A 3BWLA 4WZ4A 4GDNA 3ZG5A 1W5DA 4YINA 2P08A 2V2FF 3HLCA 2QJ7A 4UEYA 4NETA 2WGIA 3V5MA 1P97A 3DTEA 3BFEA 2C6WB 3F1PB 3A0RA 1K6RA 4OQHA 5E2EA 2QPNA 1N9BA 4G3VA 1PWDA 1YSQA 3IBRA 4R4SA 1L0GA 2W1TA 2O9AA 3S7NA 1N9LA 2W3HA 3UN7A 5HL6A 4I3IA 2Y91A 4E3KA 1LI9A 2XLNA 2HDUA 5HL1A 1PFLA 2J80A 4RX2A 5FQIA 1SKOB 4MNRA 4L0LA 4P6BA 5FATA 3LR4A 1Y54A 1YT4A 4C6YA 4KZ3A 4JXVA 1AWIA 2VZWA 3SOIA 4MEZA 2EFUA 2GZAA 1P0ZA 4WZ5A 5A91A 5EVIB 1YMSA 1VB6A 2PDRA 3C7UA 4LRZE 4O0PA 3QP5A 4XXRA 4IBRA 1IYQA 1MZUA 1YLPA 5I94A 1XJ6A 5DTKA 4GD6A 3LR3A 4RQ9A 3MZEA 5AQ7A 2JKTI 4D60A 4L9EA 3VOYA 4GHIA 4S2MA 3T4SA 2HZ5A 1IOUA 1XGIA 4KQQA 1XJ4A 3EQVA 5EV0A 1DP9A 4XUZA 4JGOA 4OKPA 1OTIA 2QWSA 1MWUA 3SW1A 3G4PA 5FASA 2V0WA 3ICYA 5TBMA 5FDSA 2JKGA 1H8ZA 1JVJA 1S67L 2H10A 5CECA 2R9WA 1MKIA 4EBNA 3LY3A 1K55C 4DXCA 2Y8HA 4II7A 1NLYA 4X55A 3OPPA 2JCHA 3O87A 4IBXA 3PXPA 3LUQA 3UE0A 4UA6A 4N9LA 2W0NA 5FAPA 1XA1A 4PM5A 3WS5A 5F83A 1XGJA 3F1PA 4QY6A 2V1ZA 5HDCA 5EE8A 1XA7A 1LSWA 1S1ZA 2PT7A 3NY4A 1N9NA 2XFSA 4CLCD 1WYBA 4EQIA 2PAVP 4NXEA 3HUMA 5DKKA 1T1AA 3UDXA 4JPMA 5K5BA 1STZA 3WS2A 2I9VA 4DKIA 1I2WA 1G28A 4NEED 1VEUA 4EXOA 5CGSA 5A92A 1S0WA 2B18A 1SKOA 1ONGA 3LEQA 3GECA 4BBVA 5FQKA 1LLBA 1L0DA 5DFXA 5G18A 1K6SA 4WZ5C 3QP2A 3RTYA 5GHZA 2J7VA 3IX4A 3PR6A 4OPYA 2D01A 2XD5A 5GLDA 2WKIA 4UA7A 1X0OA 3LIDA 3G32A 3UMEA 3CI6A 5EVIA 4CQHA 1ONHA 1PI5A 1XFQA 3VFHA 1ES5A 5AJGA 4WL9A 1S1YA 4K0WA 4M3KA 2IWCA 4HOIA 4UQIM 1HD8A 2OOLA 4KZAA 3W2ZA 3VSLA 4CPKA 3T1XA 5FQMA 3SH8A 5G4YA 2D02A 2K7SA 5EM0A 2WAFA 3MJQA 3G6OA 5HAPA 3BLMA 3OC2A 1NRJA 2ZL1B 4NG2A 4L9GA 1LT0A 3BY8A 2V1AA 4EW7A 1FSYA 1GSXA 4WYYA 3S4XA 1YLJA 4O7DA 2ZQCA 4ETZA 5CX7A 2VGJA 5EVEA 4C75A 1XKZA 3B33A 3A3DA 3RFBA 1L2SA 2OLVA 4ZTKA 3RJUA 2K2NA 4LCMA 1K0KA 2EXAA 3VOZA 1TS0A 3CJMA 3FKVA 5CHJA 3T4OA 1OTBA 3F1NB 4X56A 3G31A 3LGOA 3DBAA 3G2ZA 4JKTA 4WELA 3T4QA 4X53A 3LICA 1GA0A 4UHUA 4NKPA 4LLOB 1M40A 3UY6A 3JYIA 1ESUA 5J7EA 3LYXA 5FI2A 1MKMA 5AVEA 3GTCA 1T19A 1NZOA 5F1GA 3BFCA 4UAAA 1UWNX 1MWSA 4MMNA 2VX8A 5EOEA 4GKUA 3T12B 2ZOIA 1YMXA 3E2KA 3GV9A 3KSGA 2PBYA 5HWVA 3EGDC 4EBPA 3QNBA 1IKGA 3NOPC 4PKYA 2DNSA 5EVIC 4DE1A 4LCLA 4I38A 3IHBA 3OPHA 1FCMA 1JWPA 1NRFA 3SH7A 4HH3A 4OPRA 3KYQA 1KDSA 2PD8A 3V39A 4BJPA 3BRMA 4WEKA 5F82A 2QHKA 3WS0A 5L07A 4LGWA 4EEUA 4ZJ3A 1GHMA 4HEFA 5F5YA 4HHDA 3EQUA 4GB7A 1YLTA 3DTIA 2M1CA 5J8XA 4KQRA 4JXGA 5FI7A 4JGPA 5KZHA 3L7HA 2HGVA 2ZL1A 2ZLYA 4PM6A 5HDDA 4MBFA 5FA7A 2P04A 3O3VA 5LBRA 3FZCA 4M4XA 1BLHA 3TW8A 1HZOA 1TS8A 3GSGA 3LCEA 5TGFA 3HLBA 1YSPA 2ZQDA 1GSWA 1K57C 5U47A 1H8MA 1IYSA 1DP8A 4B4ZA 1XXMA 4S2LA 4FUWA 1ERMA 4JF5A 2L0WA 3TJZC 3NIAA 4OP8A 4DJ3A 3F1NA 3NC8A 2V1BA 1E3UA 3M2JA 4DMZA 3PBQA 4Y2FA 1UWPX 4WLAA 4S2IA 1MWRA 1PZPA 1KE4A 3N4IA 4OQIA 3CMZA 3A3JA 1Z6FA 2KOIA 4Y15A 4DRTA 4F94A 2G2UA 5EPHA 1DRMA 2VGLM 1TVFA 3IQAA 3ZG7B 3TG9A 1W7FA 2ZMVA 4R38A 2B02A 1LI0A 3T4TA 4O8GA 2DMWA 1V9YA 1YQSA 4B4XA 1Q2PA 3NJAA 1XJ2A 1SHVA 3Q82A 3BQAA 4KZ5A 5BOHA 5DF9A 3SS5A 1ERQA 2HV1A 3N8RA 3JVVA 3HUNA 3SS3A 1VQQA 1T1BA 3AGFA 4R6LA 5TJJA 4GD8A 1D1JA 4B93A 2ZQAA 3UE3A 3L9KA 4HNBA 5AQ9A 1BLSA 3T1QB 2ZC4B 2J3WA 4OLDA 1H0MA 5C5KA 2V0UA 3ZNYA 4DN0A 4I39A 4BWIA 2O0YA 1S4RA 3ZVTA 4K08A 4OOLA 1OT9A 4QPRA 4EEPA 3E4OA 4GNUA 3W4PA 1ES3A 4EERA 4F3LB 5CRFA 1TS6A 4EWFA 2PU2A 4ARZB 2Q9MA 3BFFA 4Y17A 5FEGA 1BUEA 3DWKA 2VV8A 2O99A 5EUAA 1V9ZA 4YOFA 4QD4A 1JWVA 2A24A 1IEMA 3MKEA 1G6OA 2KX6A 4MN5A 1SCWA 3KYZA 3OZHA 2DCFA 3VP3A 4MCWA 2ZC3B 1FOFA 4YNRA 4GS9B 3AGEA 4LV1A 4OQ0A 4R0QA 4G3WA 3LIEA 2J3TC 4BD1A 2XSSA 1K56A 1SDEA 5L10A 2JKRI 4OLGA 2PYRA 1NJ4A 2Z2MB 2XF3A 2EWVA 2XDMA 3LO7A 2J8YA 4RX3A 2Q0OA 4LV0A 3JPUA 3CWFA 5KMWA 1CI9A 2ZMFA 2PR6A 5E2HA 3TOIA 1CJFA 4IJGA 2GNXA 3CAXA 4X25A 4U3TA 3U4LP 1VEUB 3RH8B 4KZ8A 2NUPC 1LL9A 3NULA 5E2GA 2V8CA 1S4SA 3HL9A 1CI8A 3N8SA 3ZQ5A 3UB8A 1U60A 4E3NA 1CEGA 3C8CA 3A0SA 3C4PA 1CQAA 3MQQA 1BULA 4PKYG 2VV6A 3UDIA 4ZBEA 3DWZA 1QMFA 4S2KA 1ES2A 4GOGA 3T4JA 3T4KA 5CEBA 1KVMA 1YKDA 2BG1A 4OOYA 3HREA 4BBUA 5F6AA 4EESA 4Q8IA 4ZRRA 4F3LA 1S66L 4R3AA 1OTAA 3K3CA 4JF4A 4KG5A 4ARZA 2BLSA 4JLFA 1S6RA 4KZ7A 5DFYA 4OVDA 3CUEA 3BLSA 1OJGA 3UO9A 2UWXA 4EUZA 3GVBA 1W8YA 4KQOA 3HCYA 3K3DA 1G5UA 3NECA 5HAIA 2XGNA 4K91A 4QWOA 4GS9A 3C5AA 4N9KA 5M1AA 4DXBA 3QP8A 1BT5A 5L2FA 1E4DA 3FPVA 2WKPA 3D9YA 4Y3IA 3S7PA 1K54A 2BTFP 2BASA 5HSQA 5CHMA 3S22A 3PBTA 5CHUA 1NYMA 1BLPA 3BECA 2JKRM 4OP5A 1NLZA 3IH8A 3D4FA 1N9OA 4HJ3A 3V50A 1GSVA 2X02A 3U2AA 1O07A 3T1SA 3IF6B 1DP6A 5EVID 5EOOA 2WK0A 2JBFA 3CLOA 5EM1A 2QMIA 3LIBA 3ZHHA 1MXOA 2H0TA 2J9OA 5CXWA 3QP6A 4LRYC 1YM1A 3ULFA 1HLUP 1GHPA 1PZOA 4Z1WA 1KGFA 4HBTA 1FSWA 2PYPA 4HJ4A 3HLGA 4MBKA 5M18A 4S2NA 3IWIA 2ZM0A 3UPNA 1LL5A 3ZFZA 4FCFA 3S7QA 4RA7A 1ODVA 4FH2A 1FR1A 4CLCA 3WS1A 4MDZA 4NXFA 3MKFA 4Q0HA 2XR0A 3A3EA 1HVBA 2XH9A 4HI4A 3BQ8A 4G3KA 4BQMA 4FSFA 3NBLA 1W8QA 3MQ0A 3NOUC 2KLIA 2ZQ9A 1TDGA 4ID4A 3HBRA 4RYEA 1OTDA 2XROA 1AXBA 4FTXA 4H8RA 2WGWA 3IX3A 5DJTA 2B95A 1YAXA 1NY0A 4P6ZM 1PNEA 1PW1A 3GRJA 3KSHA 3HLEA 1NXYA 1YLYA 2EX9A 4QHCA 2KDKA 1M6KA 3PAGA 4E3OA 5HAQA 2VEAA 4E3LA 4KG2A 3CITA 4R23A 4HBUA 1K54C 2OWHA 3B47A 2WUQA 1H5XA 4IVKA 5GHXA 2O9CA 3IBJA 1TDLA 1CK3A 1F98A 3BEBA 4HY8A 4PM7A 4EUVA 3IXDA 2W3FA 4E3MA 3BJNA 3EGXC 5FI6A 3NDGA 4Y7PA 4Y13A 4MN7A 4MBHA 3ZDJA 4ZJ1A 4IEDA 4R1GA 4KZBA 4EETB 4WUJA 5L8MA 2HP6A 2G2WA 3IF6A 4PM9A 3S7OA 1DJCA 3IHAA 3A3IA 1LL8A 1LHYA 5TFQA 2Z6CA 3HLDA 2OWJA 5KSHA 4S2NC 4YFMA 4BBTA 4X69A 2W3DA 2Y2LA 2J9PA 3HJKA 3FYZA 1YLWA 4N92A 1OJ5A 3PBNA 2HJEA 2ZM8A 1PRQA 2Y79A 4P87A 1ZG4A 5AQAA 5HARA 1G68A 3PBOA 4PAUA 3FKWA 3EOIA 2IWBA 2YKFA 5DJUA 3GQZA 4DE0A 2Y4AA 3NHQA 3MS6A 5A8BA 4IVIA 2WYXA 3LEZA 4B9OA 1E3UD 2X71A 3WS4A 5EECA 4N1XA 1ZG6A 3VMAA 3MZDA 2ZMAA 2A24B 2J3TD 1SDNA 4ESPA 2Y59A 3D3OA 1W63Q 4X1MA 4PMAA 4OQGA 2FZ0A 3FV7A 3UB5P 2B5RA 2V20A 4Y0OA 3HUOA 3UNWA 3UB9A 3V3SA 4ZDXA 2PD7A 4PM8A 1WYCA 3A0VA 3Q7ZA 5FQJA 2OLUA 5HX9A 4BMWA 1F9IA 5FEFA 3MQOA 5IT5A 1I5QA 2OAQ1 2IWDA 5JYPA 2ZD8A 3IF6C 4U0TA 3VE4A 4LENA 2X01A 4Z9QA 2QYBA 1JWZA 5CTNA 5HZHA 4GDBA 1E25A 1QMEA 2H28A 3IT9A 1KDWA 3ZYTA 1NWZA 4UQIS 3GMWA 1FQGA 3IWOA 2PBDP 4D2OA 4XT2B 2W3EA 1VETB 2Y2NA 3N7WA 1TD5A 1K4EA 3E98A 3LR5A 1PWCA 2HP5A 2WKEA 4GN2A 5JYOA 2ZM2A 2G7UA 3BFDA 3JVUA 4P6ZS 5KIZA 3T4LA 2WGVA 3ISGA 5HW3A 4E3JA 1KVLA 5IU1A 4EV4A 2EX8A 3G2YA 2XD1A 1CF0A 3PTEA 3IX8A 4HESA 1XFNA 3SH9A 5D3OA 5E43A 2JN7A 4LFUA 4GCZA 1BTLA 3C7VA 3LR0A 3H9WA 1MWTA 4Q0IA 2W1RA 2VKSA 2Y2JA 2QZ6A 2V9AA 3DW0A 4IHQA 1ES4A 1I2SA 2IA2A 3LIAA 2HPBA 3VP4A 1K56D 2OSUA 1XP4A 5CERA 2ZC5B 4LRXC 3IS2B 3WRZA 3PYPA 1GHIA 3VV4A 5FAOA 3GDIA 4Y5FA 3P01A 1MY8A 4P0MA 4FH4A 2JHEA 3KSFA 1RGZA 4QU3A 4YWZA 4I5SA 3B42A 4DDYA 3F1OB 3MZFA 2A2LA 3MXQA 2HJ9C 3ZNTA 3P7NA 5GHYA 1KE0A 2ZBBA 2NUTC 3EEHA 1FCOA 4HQAA 3VP2A 4H6JB 4R3BA 3FPWA 1D06A 2VK3A 2Z6DA 4WF0A 4WMCA 5J4EA 1ZC2A 3MXRA 1BYWA 3HLFA 1K55A 5AQBA 3WWXA 1KOUA 3C38A 4FD8A 4E6WA 5HDSA 4NK3A 4A5RA 1JNUA 3LIFA 1F5MA 1P9RA 3UMDA 1N4OA 4C3QA 3BY9A 4WM9A 3QNCA 3NOTC 4XT2A 5FQQA 1LSXA 1VETA 3V67A 3QP4A 3IXHA 2XEPA 5HPIA 4DE2A 2EFXA 3M6HA 3BW6A 5HD5A 3GR2A 4OH0A 4RVAA 3QP1A 3DTKA 5G4ZA 2XA7M 4GJ4A 1KGGA 5M19A 4LV2A 1ZHHB 1LSVA 3FG8A 4CLCB
chains in the Genus database with same CATH topology
3NCKA 3ZFZA 4FCFA 3IH9A 2HDQA 4R4RA 4RA7A 4OPRA 3IF5A 4FH2A 5DF8A 1FR1A 1KDSA 1RGYA 3WS1A 3ZG9B 4UA9A 3V39A 3SS4A 3MKFA 4BJPA 2XR0A 4ZAMA 1J9MA 2HDRA 1HVBA 3A3EA 2XH9A 3AGDA 3BRMA 4WEKA 5F82A 1PWGA 4BQMA 4EBLA 1EROA 4FSFA 4KZ6A 3NBLA 5TR7A 3WS0A 1W8QA 2RCXA 3MFDA 1PI4A 1SKFA 3RXWA 2WKHA 2ZQ9A 3Q1FA 1TDGA 4ZJ3A 4ID4A 1GHMA 1L0FA 3ZG8B 4HEFA 3BM6A 1ALQA 1O7EA 2WGWB 3PBSA 3HBRA 4RYEA 3EQUA 4GB7A 1AXBA 4Y0UA 2Y2PA 4R3JA 1YLTA 5J8XA 2FFFB 4H8RA 2WGWA 4KQRA 3VP1A 4JXGA 2H5SA 3FWLA 2Y2GA 1NY0A 2CC1A 5FI7A 2Y2IA 5KZHA 2ZC6B 1PYYA 3OPRA 2GDNA 1BSGA 1PW1A 2ZLYA 4PM6A 3GRJA 4ZJ2A 5GLAA 4MBFA 2R9XA 5FA7A 3HLEA 4WMCD 3O3VA 1NXYA 1YLYA 2EX9A 4QHCA 1M6KA 3PAGA 1OMEA 3Q7VA 3FZCA 4KZ9A 4E3OA 2Y2OA 5HAQA 1BLHA 3ZCZA 4E3LA 1HZOA 4KG6A 2XQZA 3GSGA 3LCEA 4KG2A 5TGFA 3HLBA 2ZQDA 2ZQ8A 4R23A 3VP0A 4BD0A 1FCNA 2P9VB 1K57C 4HBUA 5U47A 1K54C 1IYSA 1KGEA 3RXXA 2WUQA 1IELA 2VGKA 4B4ZA 3P09A 1H5XA 1XXMA 4IVKA 4S2LA 2WZXA 3Q81A 1ERMA 3ITAA 4JF5A 3UE1A 5IHVA 5GHXA 3NIAA 4OP8A 4BLMA 1JTGA 5DTTA 1L0EA 4WZ4A 4GDNA 3ZG5A 1W5DA 1TDLA 1CK3A 3N6IA 3NC8A 4JF6A 4YINA 3BEBA 1E3UA 4PM7A 2V2FF 3HLCA 3IXDA 3M2JA 5FSRA 4E3MA 3CG5A 4QB8A 1DJAA 3PBQA 5CGXA 4NETA 2WGIA 3V5MA 3BFEA 4K0XA 5FI6A 3NDGA 2JC7A 1MWRA 2C6WB 4S2IA 4Y7PA 1PZPA 2WADA 1K6RA 1KE4A 3N4IA 5CEDA 4MBHA 4OQHA 3IXBA 4OQIA 5E2EA 3ZDJA 2QPNA 3CMZA 1N9BA 3A3JA 4ZJ1A 1Z6FA 4DRTA 4F94A 2G2UA 1PWDA 4R4SA 4IEDA 4R1GA 5EPHA 4KZBA 1L0GA 1XPBA 1TVFA 3IQAA 3ZG7B 2HP6A 2G2WA 2Y2KA 3TG9A 5KSCA 5GL9A 1W7FA 3IF6A 4PM9A 1DJCA 3IHAA 4BL3A 3A3IA 3UN7A 1LI0A 1LHYA 2Y91A 5TFQA 4E3KA 4OPQA 1YQSA 3HLDA 5CGWA 4X6TA 4GZBA 4B4XA 1LI9A 1Q2PA 2XLNA 5KSHA 2HDUA 5HL1A 4S2NC 1SHVA 4RX2A 3Q82A 4CJNA 4YFMA 5GLBA 4KZ5A 5BOHA 5DF9A 3SS5A 1ERQA 5FQIA 4X69A 3N8RA 3LY4A 3HUNA 4MNRA 4L0LA 3SS3A 4P6BA 3TSGA 1VQQA 3G34A 3AGFA 5FATA 2Y2LA 2J9PA 4GD8A 1Y54A 1YT4A 2C5WB 4C6YA 4KZ3A 3FYZA 4JXVA 3DTMA 1YLWA 2ZQAA 4N92A 1IYOA 3UE3A 3PBNA 3SOIA 4MEZA 2EFUA 2ZM8A 5AQ9A 1BLSA 5FAQA 3C4OA 4P87A 2I72A 2ZC4B 4WZ5A 1ZG4A 1MPLA 5AQAA 5HARA 1G68A 3PBOA 4OLDA 5A91A 2EX2A 3FKWA 5EVIB 1YMSA 2IWBA 3C7UA 1K25A 2Y2QA 3ZNYA 1K38A 3GQZA 5E2FA 3BFGA 4KZ4A 4XXRA 4DE0A 4IBRA 1IYQA 2Y4AA 4BL2A 1YLPA 2HDSA 5I94A 4IVIA 4QY5A 5DTKA 4MLLA 2WYXA 4GD6A 3ZVTA 3LEZA 4OOLA 1PW8A 2EX6A 3MZEA 5AQ7A 4GNUA 2WZZA 1E3UD 1KE3A 2X71A 1ES3A 3A3FA 3W4PA 5A90A 5CRFA 2Y2MA 2Y55A 2ZJ9A 3VOYA 4OOMA 3WS4A 2A49A 4S2MA 3BYDA 4WEJA 5EECA 4N1XA 1ZG6A 2Z2LB 2OV5A 1XGIA 4KQQA 3EQVA 3IWQA 4E6XA 5FQ9A 3VMAA 4EWFA 3MBZA 4XUZA 3MZDA 2PU2A 4OKPA 2Q9MA 3BFFA 2ZMAA 1BUEA 3DWKA 5EUAA 1SDNA 4QD4A 2Y59A 1JWVA 1MWUA 3G4PA 3UPOA 1IEMA 5FASA 3MKEA 4PMAA 2P9VA 1SCWA 4OQGA 1Q2QA 1H8ZA 1JVJA 3FV7A 3OZHA 2B5RA 2DCFA 2V20A 2H10A 5CECA 3VP3A 2R9WA 4Y0OA 1MKIA 2ZC3B 2XFTA 1FOFA 3HUOA 3UNWA 3V3SA 4ZDXA 1MBLA 4EBNA 4LV1A 3AGEA 3LY3A 1K55C 4OQ0A 4PM8A 4R0QA 4DXCA 1WYCA 4X55A 3OPPA 2JCHA 3O87A 3Q7ZA 2OLUA 2XK1A 5FQJA 4IBXA 5HX9A 3P98A 4B88A 4BD1A 3UE0A 4UA6A 4N9LA 2H0YA 1K56A 5FAPA 1I5QA 1SDEA 2IWDA 1XA1A 4PM5A 3WS5A 5JYPA 2ZD8A 5F83A 4JXSA 1K57A 1XGJA 2DRWA 4OLGA 4QY6A 4XUXA 3IF6C 2V1ZA 4N1HA 4U0TA 1NJ4A 1WE4A 4LENA 5EE8A 1DY6A 2Z2MB 1XA7A 2X01A 2XF3A 5A93A 3NY4A 1C3BA 4OPZA 2XDMA 2XFSA 3LO7A 1WYBA 2HP9A 2Q9NA 3VFFA 4DDSA 4Z9QA 2J8YA 4JXWA 4RX3A 4LV0A 4EQIA 5KMWA 1CI9A 3ZG0A 1FR6A 1JWZA 3HUMA 5CTNA 5E2HA 4GDBA 3TOIA 3UDXA 1E25A 1EWZA 1JTDA 1QMEA 4JPMA 3IT9A 1KDWA 5EVLA 1HTZA 3WS2A 4DKIA 3GMWA 1FQGA 3IWOA 4U3TA 3UPPA 3PBRA 4U0XA 4D2OA 1I2WA 5F1FA 3ZVWA 4KZ8A 1LL9A 5E2GA 2Y2NA 3N8LA 3N7WA 3HL9A 5CGSA 1K4EA 1CI8A 3UDFA 5A92A 1S0WA 1PWCA 2HP5A 2WKEA 3N8SA 1ONGA 3OCNA 4GN2A 4X68A 1U60A 5FQKA 4E3NA 1LLBA 3PAEA 5JYOA 2ZM2A 1CEGA 1L0DA 3C4PA 3O86A 3BFDA 2E8IA 5G18A 1K6SA 5DTSA 4WZ5C 2WGVA 1BULA 3ISGA 5HW3A 4E3JA 5GHZA 2J7VA 4S2JA 4OPYA 2XD5A 5GLDA 1KVLA 2WKIA 4EV4A 4UA7A 3UDIA 4ZBEA 3DWZA 2EX8A 3G2YA 2XD1A 3G32A 1QMFA 4S2KA 1ES2A 3PTEA 4HESA 5EVIA 4GOGA 3SH9A 3G30A 1G6AA 1ONHA 1PI5A 5D3OA 5E43A 3VFHA 1ES5A 5CEBA 1KVMA 2BG1A 4OOYA 3HREA 1BTLA 3C7VA 4K0WA 4M3KA 1MWTA 1RP5A 2IWCA 2WAEA 3WRTA 1HD8A 4KZAA 2ZC7A 4S2OA 4Q8IA 3VSLA 3NDEA 4CPKA 1TEMA 2Y2JA 4OONA 5FQMA 2QZ6A 3SH8A 3W8KA 3DW0A 4DF6A 1ES4A 1I2SA 4P85A 1YLZA 3I7JA 3ZGAB 1ZKJA 2WAFA 2HPBA 3VP4A 3M2KA 5HAPA 3BLMA 1K56D 2RL3A 2OSUA 5DVAA 1XP4A 5CERA 3OC2A 2ZC5B 3G35A 4JF4A 4KG5A 3IXGA 4QJGA 1BZAA 2BLSA 3WRZA 4JLFA 1GHIA 1S6RA 5FAOA 4KZ7A 4OVDA 3ITBA 3V3RA 3BLSA 1MY8A 1FSYA 4P0MA 1IKIA 3UO9A 2UWXA 4EUZA 3GVBA 4WYYA 1GCEA 1W8YA 4KQOA 3S4XA 1YLJA 3Q7VB 4O7DA 2ZQCA 3Q07A 2VGJA 4FH4A 4S2PA 4C75A 1XKZA 1RGZA 3A3DA 1L2SA 2OLVA 4QU3A 4ZTKA 3RJUA 4BENA 4LCMA 5HAIA 2XGNA 3B3XA 4K91A 1PIOA 4DDYA 1W79A 4N9KA 3C5AA 4DXBA 2EXAA 2A3UA 5M1AA 3VOZA 4Y0TA 3MZFA 1BT5A 3CJMA 3CZDA 3S1YA 5L2FA 3FKVA 1E4DA 5CHJA 3HVFA 3ZNTA 4X56A 5GHYA 3G31A 1KE0A 5DF7A 1K54A 3VSKA 1FCOA 3G2ZA 4JKTA 1XX2A 4WELA 3VP2A 5CHMA 3S22A 3W4QA 3PBTA 4X53A 5CHUA 4R3BA 1NYMA 2EXBA 1BLPA 3BECA 2Y2HA 1GA0A 4WMCA 4OP5A 4UHUA 1ZC2A 1EI5A 1NYYA 3MXRA 3IH8A 3D4FA 3HLFA 1K55A 1NZUA 3M6BA 5AQBA 3WWXA 3V50A 4E3IA 3OPLA 4FD8A 1M40A 1VM1A 4E6WA 2X02A 4NK3A 3QHYA 3UY6A 4A5RA 4KENB 1O07A 3JYIA 1ESUA 1N4OA 3E2LA 5HFOA 3IF6B 4C3QA 5FI2A 5EVID 3GTCA 1NZOA 4WM9A 5EOOA 5F1GA 3BFCA 3QNCA 1H8YA 1ESIA 3NI9A 4DE3A 4UAAA 5FQQA 2WK0A 1MWSA 2JBFA 1GA9A 2QMIA 4GKUA 5EOEA 3IXHA 3ZHHA 4JBFA 1MXOA 1YMXA 2XEPA 3E2KA 3HLWA 2H0TA 2J9OA 4LV3A 5CXWA 3GV9A 2PBYA 4DE2A 3W4OA 1YM1A 3OCLA 1K4FA 5FDHA 3O88A 5GLCA 4EBPA 2ZQ7A 1GHPA 1PZOA 2EFXA 3M6HA 2PU4A 3QNBA 1KGFA 4HBTA 1IKGA 2P74A 4PPRA 1IYPA 3GR2A 1FSWA 1BLCA 1DJBA 2FFYA 4OH0A 4RVAA 2JE5A 2DNSA 3HLGA 3MXSA 4MBKA 5EVIC 4DE1A 5M18A 4LCLA 3IWIA 4S2NA 1KGGA 3IHBA 5M19A 2ZM0A 4LV2A 4WBGA 3OPHA 1LL5A 3UPNA 1FCMA 1JWPA 1NRFA 3SH7A 1RCJA 1CEFA 5CTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NCK A;  3ZFZ A;  4FCF A;  3IH9 A;  2HDQ A;  4R4R A;  4RA7 A;  4OPR A;  3IF5 A;  4FH2 A;  5DF8 A;  1FR1 A;  1KDS A;  1RGY A;  3WS1 A;  3ZG9 B;  4UA9 A;  3V39 A;  3SS4 A;  3MKF A;  4BJP A;  2XR0 A;  4ZAM A;  1J9M A;  2HDR A;  1HVB A;  3A3E A;  2XH9 A;  3AGD A;  3BRM A;  4WEK A;  5F82 A;  1PWG A;  4BQM A;  4EBL A;  1ERO A;  4FSF A;  4KZ6 A;  3NBL A;  5TR7 A;  3WS0 A;  1W8Q A;  2RCX A;  3MFD A;  1PI4 A;  1SKF A;  3RXW A;  2WKH A;  2ZQ9 A;  3Q1F A;  1TDG A;  4ZJ3 A;  4ID4 A;  1GHM A;  1L0F A;  3ZG8 B;  4HEF A;  3BM6 A;  1ALQ A;  1O7E A;  2WGW B;  3PBS A;  3HBR A;  4RYE A;  3EQU A;  4GB7 A;  1AXB A;  4Y0U A;  2Y2P A;  4R3J A;  1YLT A;  5J8X A;  2FFF B;  4H8R A;  2WGW A;  4KQR A;  3VP1 A;  4JXG A;  2H5S A;  3FWL A;  2Y2G A;  1NY0 A;  2CC1 A;  5FI7 A;  2Y2I A;  5KZH A;  2ZC6 B;  1PYY A;  3OPR A;  2GDN A;  1BSG A;  1PW1 A;  2ZLY A;  4PM6 A;  3GRJ A;  4ZJ2 A;  5GLA A;  4MBF A;  2R9X A;  5FA7 A;  3HLE A;  4WMC D;  3O3V A;  1NXY A;  1YLY A;  2EX9 A;  4QHC A;  1M6K A;  3PAG A;  1OME A;  3Q7V A;  3FZC A;  4KZ9 A;  4E3O A;  2Y2O A;  5HAQ A;  1BLH A;  3ZCZ A;  4E3L A;  1HZO A;  4KG6 A;  2XQZ A;  3GSG A;  3LCE A;  4KG2 A;  5TGF A;  3HLB A;  2ZQD A;  2ZQ8 A;  4R23 A;  3VP0 A;  4BD0 A;  1FCN A;  2P9V B;  1K57 C;  4HBU A;  5U47 A;  1K54 C;  1IYS A;  1KGE A;  3RXX A;  2WUQ A;  1IEL A;  2VGK A;  4B4Z A;  3P09 A;  1H5X A;  1XXM A;  4IVK A;  4S2L A;  2WZX A;  3Q81 A;  1ERM A;  3ITA A;  4JF5 A;  3UE1 A;  5IHV A;  5GHX A;  3NIA A;  4OP8 A;  4BLM A;  1JTG A;  5DTT A;  1L0E A;  4WZ4 A;  4GDN A;  3ZG5 A;  1W5D A;  1TDL A;  1CK3 A;  3N6I A;  3NC8 A;  4JF6 A;  4YIN A;  3BEB A;  1E3U A;  4PM7 A;  2V2F F;  3HLC A;  3IXD A;  3M2J A;  5FSR A;  4E3M A;  3CG5 A;  4QB8 A;  1DJA A;  3PBQ A;  5CGX A;  4NET A;  2WGI A;  3V5M A;  3BFE A;  4K0X A;  5FI6 A;  3NDG A;  2JC7 A;  1MWR A;  2C6W B;  4S2I A;  4Y7P A;  1PZP A;  2WAD A;  1K6R A;  1KE4 A;  3N4I A;  5CED A;  4MBH A;  4OQH A;  3IXB A;  4OQI A;  5E2E A;  3ZDJ A;  2QPN A;  3CMZ A;  1N9B A;  3A3J A;  4ZJ1 A;  1Z6F A;  4DRT A;  4F94 A;  2G2U A;  1PWD A;  4R4S A;  4IED A;  4R1G A;  5EPH A;  4KZB A;  1L0G A;  1XPB A;  1TVF A;  3IQA A;  3ZG7 B;  2HP6 A;  2G2W A;  2Y2K A;  3TG9 A;  5KSC A;  5GL9 A;  1W7F A;  3IF6 A;  4PM9 A;  1DJC A;  3IHA A;  4BL3 A;  3A3I A;  3UN7 A;  1LI0 A;  1LHY A;  2Y91 A;  5TFQ A;  4E3K A;  4OPQ A;  1YQS A;  3HLD A;  5CGW A;  4X6T A;  4GZB A;  4B4X A;  1LI9 A;  1Q2P A;  2XLN A;  5KSH A;  2HDU A;  5HL1 A;  4S2N C;  1SHV A;  4RX2 A;  3Q82 A;  4CJN A;  4YFM A;  5GLB A;  4KZ5 A;  5BOH A;  5DF9 A;  3SS5 A;  1ERQ A;  5FQI A;  4X69 A;  3N8R A;  3LY4 A;  3HUN A;  4MNR A;  4L0L A;  3SS3 A;  4P6B A;  3TSG A;  1VQQ A;  3G34 A;  3AGF A;  5FAT A;  2Y2L A;  2J9P A;  4GD8 A;  1Y54 A;  1YT4 A;  2C5W B;  4C6Y A;  4KZ3 A;  3FYZ A;  4JXV A;  3DTM A;  1YLW A;  2ZQA A;  4N92 A;  1IYO A;  3UE3 A;  3PBN A;  3SOI A;  4MEZ A;  2EFU A;  2ZM8 A;  5AQ9 A;  1BLS A;  5FAQ A;  3C4O A;  4P87 A;  2I72 A;  2ZC4 B;  4WZ5 A;  1ZG4 A;  1MPL A;  5AQA A;  5HAR A;  1G68 A;  3PBO A;  4OLD A;  5A91 A;  2EX2 A;  3FKW A;  5EVI B;  1YMS A;  2IWB A;  3C7U A;  1K25 A;  2Y2Q A;  3ZNY A;  1K38 A;  3GQZ A;  5E2F A;  3BFG A;  4KZ4 A;  4XXR A;  4DE0 A;  4IBR A;  1IYQ A;  2Y4A A;  4BL2 A;  1YLP A;  2HDS A;  5I94 A;  4IVI A;  4QY5 A;  5DTK A;  4MLL A;  2WYX A;  4GD6 A;  3ZVT A;  3LEZ A;  4OOL A;  1PW8 A;  2EX6 A;  3MZE A;  5AQ7 A;  4GNU A;  2WZZ A;  1E3U D;  1KE3 A;  2X71 A;  1ES3 A;  3A3F A;  3W4P A;  5A90 A;  5CRF A;  2Y2M A;  2Y55 A;  2ZJ9 A;  3VOY A;  4OOM A;  3WS4 A;  2A49 A;  4S2M A;  3BYD A;  4WEJ A;  5EEC A;  4N1X A;  1ZG6 A;  2Z2L B;  2OV5 A;  1XGI A;  4KQQ A;  3EQV A;  3IWQ A;  4E6X A;  5FQ9 A;  3VMA A;  4EWF A;  3MBZ A;  4XUZ A;  3MZD A;  2PU2 A;  4OKP A;  2Q9M A;  3BFF A;  2ZMA A;  1BUE A;  3DWK A;  5EUA A;  1SDN A;  4QD4 A;  2Y59 A;  1JWV A;  1MWU A;  3G4P A;  3UPO A;  1IEM A;  5FAS A;  3MKE A;  4PMA A;  2P9V A;  1SCW A;  4OQG A;  1Q2Q A;  1H8Z A;  1JVJ A;  3FV7 A;  3OZH A;  2B5R A;  2DCF A;  2V20 A;  2H10 A;  5CEC A;  3VP3 A;  2R9W A;  4Y0O A;  1MKI A;  2ZC3 B;  2XFT A;  1FOF A;  3HUO A;  3UNW A;  3V3S A;  4ZDX A;  1MBL A;  4EBN A;  4LV1 A;  3AGE A;  3LY3 A;  1K55 C;  4OQ0 A;  4PM8 A;  4R0Q A;  4DXC A;  1WYC A;  4X55 A;  3OPP A;  2JCH A;  3O87 A;  3Q7Z A;  2OLU A;  2XK1 A;  5FQJ A;  4IBX A;  5HX9 A;  3P98 A;  4B88 A;  4BD1 A;  3UE0 A;  4UA6 A;  4N9L A;  2H0Y A;  1K56 A;  5FAP A;  1I5Q A;  1SDE A;  2IWD A;  1XA1 A;  4PM5 A;  3WS5 A;  5JYP A;  2ZD8 A;  5F83 A;  4JXS A;  1K57 A;  1XGJ A;  2DRW A;  4OLG A;  4QY6 A;  4XUX A;  3IF6 C;  2V1Z A;  4N1H A;  4U0T A;  1NJ4 A;  1WE4 A;  4LEN A;  5EE8 A;  1DY6 A;  2Z2M B;  1XA7 A;  2X01 A;  2XF3 A;  5A93 A;  3NY4 A;  1C3B A;  4OPZ A;  2XDM A;  2XFS A;  3LO7 A;  1WYB A;  2HP9 A;  2Q9N A;  3VFF A;  4DDS A;  4Z9Q A;  2J8Y A;  4JXW A;  4RX3 A;  4LV0 A;  4EQI A;  5KMW A;  1CI9 A;  3ZG0 A;  1FR6 A;  1JWZ A;  3HUM A;  5CTN A;  5E2H A;  4GDB A;  3TOI A;  3UDX A;  1E25 A;  1EWZ A;  1JTD A;  1QME A;  4JPM A;  3IT9 A;  1KDW A;  5EVL A;  1HTZ A;  3WS2 A;  4DKI A;  3GMW A;  1FQG A;  3IWO A;  4U3T A;  3UPP A;  3PBR A;  4U0X A;  4D2O A;  1I2W A;  5F1F A;  3ZVW A;  4KZ8 A;  1LL9 A;  5E2G A;  2Y2N A;  3N8L A;  3N7W A;  3HL9 A;  5CGS A;  1K4E A;  1CI8 A;  3UDF A;  5A92 A;  1S0W A;  1PWC A;  2HP5 A;  2WKE A;  3N8S A;  1ONG A;  3OCN A;  4GN2 A;  4X68 A;  1U60 A;  5FQK A;  4E3N A;  1LLB A;  3PAE A;  5JYO A;  2ZM2 A;  1CEG A;  1L0D A;  3C4P A;  3O86 A;  3BFD A;  2E8I A;  5G18 A;  1K6S A;  5DTS A;  4WZ5 C;  2WGV A;  1BUL A;  3ISG A;  5HW3 A;  4E3J A;  5GHZ A;  2J7V A;  4S2J A;  4OPY A;  2XD5 A;  5GLD A;  1KVL A;  2WKI A;  4EV4 A;  4UA7 A;  3UDI A;  4ZBE A;  3DWZ A;  2EX8 A;  3G2Y A;  2XD1 A;  3G32 A;  1QMF A;  4S2K A;  1ES2 A;  3PTE A;  4HES A;  5EVI A;  4GOG A;  3SH9 A;  3G30 A;  1G6A A;  1ONH A;  1PI5 A;  5D3O A;  5E43 A;  3VFH A;  1ES5 A;  5CEB A;  1KVM A;  2BG1 A;  4OOY A;  3HRE A;  1BTL A;  3C7V A;  4K0W A;  4M3K A;  1MWT A;  1RP5 A;  2IWC A;  2WAE A;  3WRT A;  1HD8 A;  4KZA A;  2ZC7 A;  4S2O A;  4Q8I A;  3VSL A;  3NDE A;  4CPK A;  1TEM A;  2Y2J A;  4OON A;  5FQM A;  2QZ6 A;  3SH8 A;  3W8K A;  3DW0 A;  4DF6 A;  1ES4 A;  1I2S A;  4P85 A;  1YLZ A;  3I7J A;  3ZGA B;  1ZKJ A;  2WAF A;  2HPB A;  3VP4 A;  3M2K A;  5HAP A;  3BLM A;  1K56 D;  2RL3 A;  2OSU A;  5DVA A;  1XP4 A;  5CER A;  3OC2 A;  2ZC5 B;  3G35 A;  4JF4 A;  4KG5 A;  3IXG A;  4QJG A;  1BZA A;  2BLS A;  3WRZ A;  4JLF A;  1GHI A;  1S6R A;  5FAO A;  4KZ7 A;  4OVD A;  3ITB A;  3V3R A;  3BLS A;  1MY8 A;  1FSY A;  4P0M A;  1IKI A;  3UO9 A;  2UWX A;  4EUZ A;  3GVB A;  4WYY A;  1GCE A;  1W8Y A;  4KQO A;  3S4X A;  1YLJ A;  3Q7V B;  4O7D A;  2ZQC A;  3Q07 A;  2VGJ A;  4FH4 A;  4S2P A;  4C75 A;  1XKZ A;  1RGZ A;  3A3D A;  1L2S A;  2OLV A;  4QU3 A;  4ZTK A;  3RJU A;  4BEN A;  4LCM A;  5HAI A;  2XGN A;  3B3X A;  4K91 A;  1PIO A;  4DDY A;  1W79 A;  4N9K A;  3C5A A;  4DXB A;  2EXA A;  2A3U A;  5M1A A;  3VOZ A;  4Y0T A;  3MZF A;  1BT5 A;  3CJM A;  3CZD A;  3S1Y A;  5L2F A;  3FKV A;  1E4D A;  5CHJ A;  3HVF A;  3ZNT A;  4X56 A;  5GHY A;  3G31 A;  1KE0 A;  5DF7 A;  1K54 A;  3VSK A;  1FCO A;  3G2Z A;  4JKT A;  1XX2 A;  4WEL A;  3VP2 A;  5CHM A;  3S22 A;  3W4Q A;  3PBT A;  4X53 A;  5CHU A;  4R3B A;  1NYM A;  2EXB A;  1BLP A;  3BEC A;  2Y2H A;  1GA0 A;  4WMC A;  4OP5 A;  4UHU A;  1ZC2 A;  1EI5 A;  1NYY A;  3MXR A;  3IH8 A;  3D4F A;  3HLF A;  1K55 A;  1NZU A;  3M6B A;  5AQB A;  3WWX A;  3V50 A;  4E3I A;  3OPL A;  4FD8 A;  1M40 A;  1VM1 A;  4E6W A;  2X02 A;  4NK3 A;  3QHY A;  3UY6 A;  4A5R A;  4KEN B;  1O07 A;  3JYI A;  1ESU A;  1N4O A;  3E2L A;  5HFO A;  3IF6 B;  4C3Q A;  5FI2 A;  5EVI D;  3GTC A;  1NZO A;  4WM9 A;  5EOO A;  5F1G A;  3BFC A;  3QNC A;  1H8Y A;  1ESI A;  3NI9 A;  4DE3 A;  4UAA A;  5FQQ A;  2WK0 A;  1MWS A;  2JBF A;  1GA9 A;  2QMI A;  4GKU A;  5EOE A;  3IXH A;  3ZHH A;  4JBF A;  1MXO A;  1YMX A;  2XEP A;  3E2K A;  3HLW A;  2H0T A;  2J9O A;  4LV3 A;  5CXW A;  3GV9 A;  2PBY A;  4DE2 A;  3W4O A;  1YM1 A;  3OCL A;  1K4F A;  5FDH A;  3O88 A;  5GLC A;  4EBP A;  2ZQ7 A;  1GHP A;  1PZO A;  2EFX A;  3M6H A;  2PU4 A;  3QNB A;  1KGF A;  4HBT A;  1IKG A;  2P74 A;  4PPR A;  1IYP A;  3GR2 A;  1FSW A;  1BLC A;  1DJB A;  2FFY A;  4OH0 A;  4RVA A;  2JE5 A;  2DNS A;  3HLG A;  3MXS A;  4MBK A;  5EVI C;  4DE1 A;  5M18 A;  4LCL A;  3IWI A;  4S2N A;  1KGG A;  3IHB A;  5M19 A;  2ZM0 A;  4LV2 A;  4WBG A;  3OPH A;  1LL5 A;  3UPN A;  1FCM A;  1JWP A;  1NRF A;  3SH7 A;  1RCJ A;  1CEF A;  5CTM A; 
#chains in the Genus database with same CATH topology
 4EU0 A;  2HDQ A;  4R4R A;  4O01 A;  5DF8 A;  1RGY A;  1IFQ A;  4ZAM A;  5EFW A;  3VOL A;  2UV0 E;  1PWG A;  2O9B A;  4EBL A;  1A0K A;  1PI4 A;  1SKF A;  3CHW P;  3RXW A;  2WKH A;  2INW A;  4EQ1 A;  2VLG A;  1J3W A;  2WGW B;  4NXG A;  1WA9 A;  2Y2P A;  2FFF B;  3R7W B;  2HF6 A;  4KQD A;  3VP1 A;  3FC7 A;  2CC1 A;  2ZC6 B;  2EWW A;  3IS2 A;  3MR0 A;  3H7W B;  2VGL S;  2R9X A;  4MN6 A;  3TE8 A;  1OME A;  4AFI A;  2Y2O A;  4KG6 A;  2XQZ A;  4CLC E;  4BD0 A;  5DKL A;  2P9V B;  5J3W A;  3H82 B;  1FIK A;  1IEL A;  3F1O A;  4WN5 A;  2WZX A;  3Q81 A;  3ITA A;  3UE1 A;  5IHV A;  3CPT B;  4BLM A;  1JTG A;  5DTT A;  1L0E A;  3N6I A;  4JF6 A;  3EEA A;  5FSR A;  3CG5 A;  1VHM A;  4QB8 A;  3T1R A;  4H6J A;  1DJA A;  5CGX A;  4I3A A;  4PHT A;  4K0X A;  2JC7 A;  2WAD A;  3OOV A;  5CED A;  3IXB A;  2XRN A;  1XPB A;  3C30 A;  4HJ6 A;  5HPF A;  4FOF A;  2Y2K A;  5KSC A;  5F68 A;  5GL9 A;  4BL3 A;  2JKF A;  3VE3 A;  2L4R A;  3KO6 A;  3EWK A;  4OPQ A;  4IUH A;  5CGW A;  4X6T A;  4GZB A;  3OBF A;  3MF0 A;  2YKH A;  4CJN A;  5GLB A;  3LY4 A;  2EA9 A;  3TSG A;  3G34 A;  5IS1 A;  2C5W B;  1TS7 A;  3LFV A;  3DTM A;  5HWT A;  1IYO A;  1ACF A;  5FAQ A;  3C4O A;  3UB6 A;  5L09 A;  3T50 A;  2I72 A;  1MPL A;  2EX2 A;  1K25 A;  2Y2Q A;  1K38 A;  5E2F A;  3BFG A;  4KZ4 A;  4L9F A;  4BL2 A;  2HDS A;  4GLQ A;  2CMN A;  3CUE C;  4QY5 A;  4MLL A;  3R7W A;  4KUO A;  1PW8 A;  2EX6 A;  5FL3 A;  2PRF A;  2WZZ A;  1KE3 A;  2WKQ A;  5A90 A;  3A3F A;  2Y2M A;  2Y55 A;  2ZJ9 A;  4OOM A;  2A49 A;  3BYD A;  4WEJ A;  2Z2L B;  2OV5 A;  2JKT M;  3H7W A;  3IWQ A;  4E6X A;  5FQ9 A;  3MBZ A;  1EW0 A;  3UPO A;  2P9V A;  3H82 A;  1Q2Q A;  3CPT A;  2XFT A;  2P7J A;  2M7U A;  1W63 M;  1MBL A;  1YPR A;  1XJ3 A;  2M7V A;  4HIA A;  2GJ3 A;  4B88 A;  2XK1 A;  3P98 A;  3E4P A;  2H0Y A;  2L1M A;  4JXS A;  1K57 A;  2DRW A;  4XUX A;  4N1H A;  1H3Q A;  2XA7 S;  3E0Y A;  1WE4 A;  2LB9 A;  1DY6 A;  3DAV A;  2W27 A;  5A93 A;  3KSI A;  1C3B A;  4OPZ A;  4DDS A;  2HP9 A;  2Q9N A;  3VFF A;  5I5L A;  4JGR A;  3TRC A;  4JXW A;  3K2N A;  1Y28 A;  2QJ5 A;  2GX5 A;  3ZG0 A;  1FR6 A;  1F2K A;  1EWZ A;  1JTD A;  3PHY A;  3E4Q A;  3UB7 A;  5EVL A;  1HTZ A;  4ETX A;  3UPP A;  3PBR A;  4U0X A;  5F1F A;  1T1C A;  2VA0 A;  3ZVW A;  3N8L A;  3UDF A;  5F69 A;  4CLC C;  3OCN A;  4X68 A;  3PAE A;  5HWW A;  3O86 A;  2E8I A;  3KX0 X;  1TF1 A;  5DTS A;  2ACG A;  1L3L A;  1OT6 A;  3R4K A;  4S2J A;  2OAP 1;  2V8F A;  3G30 A;  1G6A A;  3O5Y A;  1FIL A;  1RP5 A;  2WAE A;  3WRT A;  2ZC7 A;  4S2O A;  4Q0J A;  3NDE A;  4GW9 A;  3KYE A;  1TEM A;  4OON A;  3W8K A;  1T18 A;  4DF6 A;  4P85 A;  3MFX A;  2R78 A;  1YLZ A;  1MC0 A;  3I7J A;  3ZGA B;  1ZKJ A;  3M2K A;  2RL3 A;  5DVA A;  3G35 A;  3IXG A;  4QJG A;  1BZA A;  1OTE A;  3ITB A;  2QKP A;  3V3R A;  1IKI A;  4DJ2 A;  4LPZ A;  1GCE A;  4HP9 A;  3HJI A;  3Q7V B;  3Q07 A;  4S2P A;  1OPX A;  4BEN A;  1D7E A;  3B3X A;  1PIO A;  1W79 A;  4X1L A;  4Y0T A;  2A3U A;  3SZT A;  3CZD A;  3S1Y A;  2E8J A;  3HVF A;  3MMH A;  5DF7 A;  3VSK A;  1XX2 A;  3W4Q A;  2EXB A;  2Y2H A;  5AVF A;  1EI5 A;  1NYY A;  1Z09 A;  1NZU A;  3M6B A;  1P9W A;  4E3I A;  3OPL A;  5MC7 A;  1VM1 A;  2W1T B;  1SZV A;  3QHY A;  4KEN B;  1Y4O A;  2AVX A;  3E2L A;  5HFO A;  4IUK A;  1H8Y A;  1ESI A;  3NI9 A;  4DE3 A;  1GA9 A;  4JBF A;  3HLW A;  4LV3 A;  3W4O A;  3OCL A;  1K4F A;  5FDH A;  3O88 A;  5GLC A;  2ZQ7 A;  2PU4 A;  3C2W A;  2P74 A;  2WKR A;  4PPR A;  1IYP A;  1BLC A;  1DJB A;  2FFY A;  2JE5 A;  3MXS A;  2ZOH A;  4E04 A;  4WBG A;  2W3G A;  1RCJ A;  1CEF A;  5CTM A;  3NCK A;  3IH9 A;  1ZTU A;  3IF5 A;  3LI8 A;  1UGU A;  2LB5 A;  3ZG9 B;  4UA9 A;  3SS4 A;  3D72 A;  1J9M A;  2HDR A;  3AGD A;  4JGQ A;  2VV7 A;  1ERO A;  4KZ6 A;  5TR7 A;  4NXB A;  2RCX A;  4I3J A;  3MFD A;  2MJ6 A;  3Q1F A;  1L0F A;  3ZG8 B;  3BM6 A;  1ALQ A;  1O7E A;  3PBS A;  4Y0U A;  4R3J A;  3OLO A;  2H5S A;  3FWL A;  2Y2G A;  5HD3 A;  2Y2I A;  4R70 A;  1PYY A;  4GHI B;  2K31 A;  3OPR A;  2GDN A;  1BSG A;  2PR5 A;  4ZJ2 A;  5GLA A;  2VJW A;  4KUK A;  4WMC D;  4HP4 A;  3UE6 A;  3MSH A;  4HH2 A;  4ME4 A;  3Q7V A;  2FH5 A;  4KZ9 A;  3ZCZ A;  5TBM B;  2ZQ8 A;  3VP0 A;  1FCN A;  2PHY A;  3RXX A;  1KGE A;  3LI9 A;  2VGK A;  3P09 A;  3BWL A;  4WZ4 A;  4GDN A;  3ZG5 A;  1W5D A;  4YIN A;  2P08 A;  2V2F F;  3HLC A;  2QJ7 A;  4UEY A;  4NET A;  2WGI A;  3V5M A;  1P97 A;  3DTE A;  3BFE A;  2C6W B;  3F1P B;  3A0R A;  1K6R A;  4OQH A;  5E2E A;  2QPN A;  1N9B A;  4G3V A;  1PWD A;  1YSQ A;  3IBR A;  4R4S A;  1L0G A;  2W1T A;  2O9A A;  3S7N A;  1N9L A;  2W3H A;  3UN7 A;  5HL6 A;  4I3I A;  2Y91 A;  4E3K A;  1LI9 A;  2XLN A;  2HDU A;  5HL1 A;  1PFL A;  2J80 A;  4RX2 A;  5FQI A;  1SKO B;  4MNR A;  4L0L A;  4P6B A;  5FAT A;  3LR4 A;  1Y54 A;  1YT4 A;  4C6Y A;  4KZ3 A;  4JXV A;  1AWI A;  2VZW A;  3SOI A;  4MEZ A;  2EFU A;  2GZA A;  1P0Z A;  4WZ5 A;  5A91 A;  5EVI B;  1YMS A;  1VB6 A;  2PDR A;  3C7U A;  4LRZ E;  4O0P A;  3QP5 A;  4XXR A;  4IBR A;  1IYQ A;  1MZU A;  1YLP A;  5I94 A;  1XJ6 A;  5DTK A;  4GD6 A;  3LR3 A;  4RQ9 A;  3MZE A;  5AQ7 A;  2JKT I;  4D60 A;  4L9E A;  3VOY A;  4GHI A;  4S2M A;  3T4S A;  2HZ5 A;  1IOU A;  1XGI A;  4KQQ A;  1XJ4 A;  3EQV A;  5EV0 A;  1DP9 A;  4XUZ A;  4JGO A;  4OKP A;  1OTI A;  2QWS A;  1MWU A;  3SW1 A;  3G4P A;  5FAS A;  2V0W A;  3ICY A;  5TBM A;  5FDS A;  2JKG A;  1H8Z A;  1JVJ A;  1S67 L;  2H10 A;  5CEC A;  2R9W A;  1MKI A;  4EBN A;  3LY3 A;  1K55 C;  4DXC A;  2Y8H A;  4II7 A;  1NLY A;  4X55 A;  3OPP A;  2JCH A;  3O87 A;  4IBX A;  3PXP A;  3LUQ A;  3UE0 A;  4UA6 A;  4N9L A;  2W0N A;  5FAP A;  1XA1 A;  4PM5 A;  3WS5 A;  5F83 A;  1XGJ A;  3F1P A;  4QY6 A;  2V1Z A;  5HDC A;  5EE8 A;  1XA7 A;  1LSW A;  1S1Z A;  2PT7 A;  3NY4 A;  1N9N A;  2XFS A;  4CLC D;  1WYB A;  4EQI A;  2PAV P;  4NXE A;  3HUM A;  5DKK A;  1T1A A;  3UDX A;  4JPM A;  5K5B A;  1STZ A;  3WS2 A;  2I9V A;  4DKI A;  1I2W A;  1G28 A;  4NEE D;  1VEU A;  4EXO A;  5CGS A;  5A92 A;  1S0W A;  2B18 A;  1SKO A;  1ONG A;  3LEQ A;  3GEC A;  4BBV A;  5FQK A;  1LLB A;  1L0D A;  5DFX A;  5G18 A;  1K6S A;  4WZ5 C;  3QP2 A;  3RTY A;  5GHZ A;  2J7V A;  3IX4 A;  3PR6 A;  4OPY A;  2D01 A;  2XD5 A;  5GLD A;  2WKI A;  4UA7 A;  1X0O A;  3LID A;  3G32 A;  3UME A;  3CI6 A;  5EVI A;  4CQH A;  1ONH A;  1PI5 A;  1XFQ A;  3VFH A;  1ES5 A;  5AJG A;  4WL9 A;  1S1Y A;  4K0W A;  4M3K A;  2IWC A;  4HOI A;  4UQI M;  1HD8 A;  2OOL A;  4KZA A;  3W2Z A;  3VSL A;  4CPK A;  3T1X A;  5FQM A;  3SH8 A;  5G4Y A;  2D02 A;  2K7S A;  5EM0 A;  2WAF A;  3MJQ A;  3G6O A;  5HAP A;  3BLM A;  3OC2 A;  1NRJ A;  2ZL1 B;  4NG2 A;  4L9G A;  1LT0 A;  3BY8 A;  2V1A A;  4EW7 A;  1FSY A;  1GSX A;  4WYY A;  3S4X A;  1YLJ A;  4O7D A;  2ZQC A;  4ETZ A;  5CX7 A;  2VGJ A;  5EVE A;  4C75 A;  1XKZ A;  3B33 A;  3A3D A;  3RFB A;  1L2S A;  2OLV A;  4ZTK A;  3RJU A;  2K2N A;  4LCM A;  1K0K A;  2EXA A;  3VOZ A;  1TS0 A;  3CJM A;  3FKV A;  5CHJ A;  3T4O A;  1OTB A;  3F1N B;  4X56 A;  3G31 A;  3LGO A;  3DBA A;  3G2Z A;  4JKT A;  4WEL A;  3T4Q A;  4X53 A;  3LIC A;  1GA0 A;  4UHU A;  4NKP A;  4LLO B;  1M40 A;  3UY6 A;  3JYI A;  1ESU A;  5J7E A;  3LYX A;  5FI2 A;  1MKM A;  5AVE A;  3GTC A;  1T19 A;  1NZO A;  5F1G A;  3BFC A;  4UAA A;  1UWN X;  1MWS A;  4MMN A;  2VX8 A;  5EOE A;  4GKU A;  3T12 B;  2ZOI A;  1YMX A;  3E2K A;  3GV9 A;  3KSG A;  2PBY A;  5HWV A;  3EGD C;  4EBP A;  3QNB A;  1IKG A;  3NOP C;  4PKY A;  2DNS A;  5EVI C;  4DE1 A;  4LCL A;  4I38 A;  3IHB A;  3OPH A;  1FCM A;  1JWP A;  1NRF A;  3SH7 A;  4HH3 A;  4OPR A;  3KYQ A;  1KDS A;  2PD8 A;  3V39 A;  4BJP A;  3BRM A;  4WEK A;  5F82 A;  2QHK A;  3WS0 A;  5L07 A;  4LGW A;  4EEU A;  4ZJ3 A;  1GHM A;  4HEF A;  5F5Y A;  4HHD A;  3EQU A;  4GB7 A;  1YLT A;  3DTI A;  2M1C A;  5J8X A;  4KQR A;  4JXG A;  5FI7 A;  4JGP A;  5KZH A;  3L7H A;  2HGV A;  2ZL1 A;  2ZLY A;  4PM6 A;  5HDD A;  4MBF A;  5FA7 A;  2P04 A;  3O3V A;  5LBR A;  3FZC A;  4M4X A;  1BLH A;  3TW8 A;  1HZO A;  1TS8 A;  3GSG A;  3LCE A;  5TGF A;  3HLB A;  1YSP A;  2ZQD A;  1GSW A;  1K57 C;  5U47 A;  1H8M A;  1IYS A;  1DP8 A;  4B4Z A;  1XXM A;  4S2L A;  4FUW A;  1ERM A;  4JF5 A;  2L0W A;  3TJZ C;  3NIA A;  4OP8 A;  4DJ3 A;  3F1N A;  3NC8 A;  2V1B A;  1E3U A;  3M2J A;  4DMZ A;  3PBQ A;  4Y2F A;  1UWP X;  4WLA A;  4S2I A;  1MWR A;  1PZP A;  1KE4 A;  3N4I A;  4OQI A;  3CMZ A;  3A3J A;  1Z6F A;  2KOI A;  4Y15 A;  4DRT A;  4F94 A;  2G2U A;  5EPH A;  1DRM A;  2VGL M;  1TVF A;  3IQA A;  3ZG7 B;  3TG9 A;  1W7F A;  2ZMV A;  4R38 A;  2B02 A;  1LI0 A;  3T4T A;  4O8G A;  2DMW A;  1V9Y A;  1YQS A;  4B4X A;  1Q2P A;  3NJA A;  1XJ2 A;  1SHV A;  3Q82 A;  3BQA A;  4KZ5 A;  5BOH A;  5DF9 A;  3SS5 A;  1ERQ A;  2HV1 A;  3N8R A;  3JVV A;  3HUN A;  3SS3 A;  1VQQ A;  1T1B A;  3AGF A;  4R6L A;  5TJJ A;  4GD8 A;  1D1J A;  4B93 A;  2ZQA A;  3UE3 A;  3L9K A;  4HNB A;  5AQ9 A;  1BLS A;  3T1Q B;  2ZC4 B;  2J3W A;  4OLD A;  1H0M A;  5C5K A;  2V0U A;  3ZNY A;  4DN0 A;  4I39 A;  4BWI A;  2O0Y A;  1S4R A;  3ZVT A;  4K08 A;  4OOL A;  1OT9 A;  4QPR A;  4EEP A;  3E4O A;  4GNU A;  3W4P A;  1ES3 A;  4EER A;  4F3L B;  5CRF A;  1TS6 A;  4EWF A;  2PU2 A;  4ARZ B;  2Q9M A;  3BFF A;  4Y17 A;  5FEG A;  1BUE A;  3DWK A;  2VV8 A;  2O99 A;  5EUA A;  1V9Z A;  4YOF A;  4QD4 A;  1JWV A;  2A24 A;  1IEM A;  3MKE A;  1G6O A;  2KX6 A;  4MN5 A;  1SCW A;  3KYZ A;  3OZH A;  2DCF A;  3VP3 A;  4MCW A;  2ZC3 B;  1FOF A;  4YNR A;  4GS9 B;  3AGE A;  4LV1 A;  4OQ0 A;  4R0Q A;  4G3W A;  3LIE A;  2J3T C;  4BD1 A;  2XSS A;  1K56 A;  1SDE A;  5L10 A;  2JKR I;  4OLG A;  2PYR A;  1NJ4 A;  2Z2M B;  2XF3 A;  2EWV A;  2XDM A;  3LO7 A;  2J8Y A;  4RX3 A;  2Q0O A;  4LV0 A;  3JPU A;  3CWF A;  5KMW A;  1CI9 A;  2ZMF A;  2PR6 A;  5E2H A;  3TOI A;  1CJF A;  4IJG A;  2GNX A;  3CAX A;  4X25 A;  4U3T A;  3U4L P;  1VEU B;  3RH8 B;  4KZ8 A;  2NUP C;  1LL9 A;  3NUL A;  5E2G A;  2V8C A;  1S4S A;  3HL9 A;  1CI8 A;  3N8S A;  3ZQ5 A;  3UB8 A;  1U60 A;  4E3N A;  1CEG A;  3C8C A;  3A0S A;  3C4P A;  1CQA A;  3MQQ A;  1BUL A;  4PKY G;  2VV6 A;  3UDI A;  4ZBE A;  3DWZ A;  1QMF A;  4S2K A;  1ES2 A;  4GOG A;  3T4J A;  3T4K A;  5CEB A;  1KVM A;  1YKD A;  2BG1 A;  4OOY A;  3HRE A;  4BBU A;  5F6A A;  4EES A;  4Q8I A;  4ZRR A;  4F3L A;  1S66 L;  4R3A A;  1OTA A;  3K3C A;  4JF4 A;  4KG5 A;  4ARZ A;  2BLS A;  4JLF A;  1S6R A;  4KZ7 A;  5DFY A;  4OVD A;  3CUE A;  3BLS A;  1OJG A;  3UO9 A;  2UWX A;  4EUZ A;  3GVB A;  1W8Y A;  4KQO A;  3HCY A;  3K3D A;  1G5U A;  3NEC A;  5HAI A;  2XGN A;  4K91 A;  4QWO A;  4GS9 A;  3C5A A;  4N9K A;  5M1A A;  4DXB A;  3QP8 A;  1BT5 A;  5L2F A;  1E4D A;  3FPV A;  2WKP A;  3D9Y A;  4Y3I A;  3S7P A;  1K54 A;  2BTF P;  2BAS A;  5HSQ A;  5CHM A;  3S22 A;  3PBT A;  5CHU A;  1NYM A;  1BLP A;  3BEC A;  2JKR M;  4OP5 A;  1NLZ A;  3IH8 A;  3D4F A;  1N9O A;  4HJ3 A;  3V50 A;  1GSV A;  2X02 A;  3U2A A;  1O07 A;  3T1S A;  3IF6 B;  1DP6 A;  5EVI D;  5EOO A;  2WK0 A;  2JBF A;  3CLO A;  5EM1 A;  2QMI A;  3LIB A;  3ZHH A;  1MXO A;  2H0T A;  2J9O A;  5CXW A;  3QP6 A;  4LRY C;  1YM1 A;  3ULF A;  1HLU P;  1GHP A;  1PZO A;  4Z1W A;  1KGF A;  4HBT A;  1FSW A;  2PYP A;  4HJ4 A;  3HLG A;  4MBK A;  5M18 A;  4S2N A;  3IWI A;  2ZM0 A;  3UPN A;  1LL5 A;  3ZFZ A;  4FCF A;  3S7Q A;  4RA7 A;  1ODV A;  4FH2 A;  1FR1 A;  4CLC A;  3WS1 A;  4MDZ A;  4NXF A;  3MKF A;  4Q0H A;  2XR0 A;  3A3E A;  1HVB A;  2XH9 A;  4HI4 A;  3BQ8 A;  4G3K A;  4BQM A;  4FSF A;  3NBL A;  1W8Q A;  3MQ0 A;  3NOU C;  2KLI A;  2ZQ9 A;  1TDG A;  4ID4 A;  3HBR A;  4RYE A;  1OTD A;  2XRO A;  1AXB A;  4FTX A;  4H8R A;  2WGW A;  3IX3 A;  5DJT A;  2B95 A;  1YAX A;  1NY0 A;  4P6Z M;  1PNE A;  1PW1 A;  3GRJ A;  3KSH A;  3HLE A;  1NXY A;  1YLY A;  2EX9 A;  4QHC A;  2KDK A;  1M6K A;  3PAG A;  4E3O A;  5HAQ A;  2VEA A;  4E3L A;  4KG2 A;  3CIT A;  4R23 A;  4HBU A;  1K54 C;  2OWH A;  3B47 A;  2WUQ A;  1H5X A;  4IVK A;  5GHX A;  2O9C A;  3IBJ A;  1TDL A;  1CK3 A;  1F98 A;  3BEB A;  4HY8 A;  4PM7 A;  4EUV A;  3IXD A;  2W3F A;  4E3M A;  3BJN A;  3EGX C;  5FI6 A;  3NDG A;  4Y7P A;  4Y13 A;  4MN7 A;  4MBH A;  3ZDJ A;  4ZJ1 A;  4IED A;  4R1G A;  4KZB A;  4EET B;  4WUJ A;  5L8M A;  2HP6 A;  2G2W A;  3IF6 A;  4PM9 A;  3S7O A;  1DJC A;  3IHA A;  3A3I A;  1LL8 A;  1LHY A;  5TFQ A;  2Z6C A;  3HLD A;  2OWJ A;  5KSH A;  4S2N C;  4YFM A;  4BBT A;  4X69 A;  2W3D A;  2Y2L A;  2J9P A;  3HJK A;  3FYZ A;  1YLW A;  4N92 A;  1OJ5 A;  3PBN A;  2HJE A;  2ZM8 A;  1PRQ A;  2Y79 A;  4P87 A;  1ZG4 A;  5AQA A;  5HAR A;  1G68 A;  3PBO A;  4PAU A;  3FKW A;  3EOI A;  2IWB A;  2YKF A;  5DJU A;  3GQZ A;  4DE0 A;  2Y4A A;  3NHQ A;  3MS6 A;  5A8B A;  4IVI A;  2WYX A;  3LEZ A;  4B9O A;  1E3U D;  2X71 A;  3WS4 A;  5EEC A;  4N1X A;  1ZG6 A;  3VMA A;  3MZD A;  2ZMA A;  2A24 B;  2J3T D;  1SDN A;  4ESP A;  2Y59 A;  3D3O A;  1W63 Q;  4X1M A;  4PMA A;  4OQG A;  2FZ0 A;  3FV7 A;  3UB5 P;  2B5R A;  2V20 A;  4Y0O A;  3HUO A;  3UNW A;  3UB9 A;  3V3S A;  4ZDX A;  2PD7 A;  4PM8 A;  1WYC A;  3A0V A;  3Q7Z A;  5FQJ A;  2OLU A;  5HX9 A;  4BMW A;  1F9I A;  5FEF A;  3MQO A;  5IT5 A;  1I5Q A;  2OAQ 1;  2IWD A;  5JYP A;  2ZD8 A;  3IF6 C;  4U0T A;  3VE4 A;  4LEN A;  2X01 A;  4Z9Q A;  2QYB A;  1JWZ A;  5CTN A;  5HZH A;  4GDB A;  1E25 A;  1QME A;  2H28 A;  3IT9 A;  1KDW A;  3ZYT A;  1NWZ A;  4UQI S;  3GMW A;  1FQG A;  3IWO A;  2PBD P;  4D2O A;  4XT2 B;  2W3E A;  1VET B;  2Y2N A;  3N7W A;  1TD5 A;  1K4E A;  3E98 A;  3LR5 A;  1PWC A;  2HP5 A;  2WKE A;  4GN2 A;  5JYO A;  2ZM2 A;  2G7U A;  3BFD A;  3JVU A;  4P6Z S;  5KIZ A;  3T4L A;  2WGV A;  3ISG A;  5HW3 A;  4E3J A;  1KVL A;  5IU1 A;  4EV4 A;  2EX8 A;  3G2Y A;  2XD1 A;  1CF0 A;  3PTE A;  3IX8 A;  4HES A;  1XFN A;  3SH9 A;  5D3O A;  5E43 A;  2JN7 A;  4LFU A;  4GCZ A;  1BTL A;  3C7V A;  3LR0 A;  3H9W A;  1MWT A;  4Q0I A;  2W1R A;  2VKS A;  2Y2J A;  2QZ6 A;  2V9A A;  3DW0 A;  4IHQ A;  1ES4 A;  1I2S A;  2IA2 A;  3LIA A;  2HPB A;  3VP4 A;  1K56 D;  2OSU A;  1XP4 A;  5CER A;  2ZC5 B;  4LRX C;  3IS2 B;  3WRZ A;  3PYP A;  1GHI A;  3VV4 A;  5FAO A;  3GDI A;  4Y5F A;  3P01 A;  1MY8 A;  4P0M A;  4FH4 A;  2JHE A;  3KSF A;  1RGZ A;  4QU3 A;  4YWZ A;  4I5S A;  3B42 A;  4DDY A;  3F1O B;  3MZF A;  2A2L A;  3MXQ A;  2HJ9 C;  3ZNT A;  3P7N A;  5GHY A;  1KE0 A;  2ZBB A;  2NUT C;  3EEH A;  1FCO A;  4HQA A;  3VP2 A;  4H6J B;  4R3B A;  3FPW A;  1D06 A;  2VK3 A;  2Z6D A;  4WF0 A;  4WMC A;  5J4E A;  1ZC2 A;  3MXR A;  1BYW A;  3HLF A;  1K55 A;  5AQB A;  3WWX A;  1KOU A;  3C38 A;  4FD8 A;  4E6W A;  5HDS A;  4NK3 A;  4A5R A;  1JNU A;  3LIF A;  1F5M A;  1P9R A;  3UMD A;  1N4O A;  4C3Q A;  3BY9 A;  4WM9 A;  3QNC A;  3NOT C;  4XT2 A;  5FQQ A;  1LSX A;  1VET A;  3V67 A;  3QP4 A;  3IXH A;  2XEP A;  5HPI A;  4DE2 A;  2EFX A;  3M6H A;  3BW6 A;  5HD5 A;  3GR2 A;  4OH0 A;  4RVA A;  3QP1 A;  3DTK A;  5G4Z A;  2XA7 M;  4GJ4 A;  1KGG A;  5M19 A;  4LV2 A;  1ZHH B;  1LSV A;  3FG8 A;  4CLC B; 
#chains in the Genus database with same CATH homology
 3NCK A;  3ZFZ A;  4FCF A;  3IH9 A;  2HDQ A;  4R4R A;  4RA7 A;  4OPR A;  3IF5 A;  4FH2 A;  5DF8 A;  1FR1 A;  1KDS A;  1RGY A;  3WS1 A;  3ZG9 B;  4UA9 A;  3V39 A;  3SS4 A;  3MKF A;  4BJP A;  2XR0 A;  4ZAM A;  1J9M A;  2HDR A;  1HVB A;  3A3E A;  2XH9 A;  3AGD A;  3BRM A;  4WEK A;  5F82 A;  1PWG A;  4BQM A;  4EBL A;  1ERO A;  4FSF A;  4KZ6 A;  3NBL A;  5TR7 A;  3WS0 A;  1W8Q A;  2RCX A;  3MFD A;  1PI4 A;  1SKF A;  3RXW A;  2WKH A;  2ZQ9 A;  3Q1F A;  1TDG A;  4ZJ3 A;  4ID4 A;  1GHM A;  1L0F A;  3ZG8 B;  4HEF A;  3BM6 A;  1ALQ A;  1O7E A;  2WGW B;  3PBS A;  3HBR A;  4RYE A;  3EQU A;  4GB7 A;  1AXB A;  4Y0U A;  2Y2P A;  4R3J A;  1YLT A;  5J8X A;  2FFF B;  4H8R A;  2WGW A;  4KQR A;  3VP1 A;  4JXG A;  2H5S A;  3FWL A;  2Y2G A;  1NY0 A;  2CC1 A;  5FI7 A;  2Y2I A;  5KZH A;  2ZC6 B;  1PYY A;  3OPR A;  2GDN A;  1BSG A;  1PW1 A;  2ZLY A;  4PM6 A;  3GRJ A;  4ZJ2 A;  5GLA A;  4MBF A;  2R9X A;  5FA7 A;  3HLE A;  4WMC D;  3O3V A;  1NXY A;  1YLY A;  2EX9 A;  4QHC A;  1M6K A;  3PAG A;  1OME A;  3Q7V A;  3FZC A;  4KZ9 A;  4E3O A;  2Y2O A;  5HAQ A;  1BLH A;  3ZCZ A;  4E3L A;  1HZO A;  4KG6 A;  2XQZ A;  3GSG A;  3LCE A;  4KG2 A;  5TGF A;  3HLB A;  2ZQD A;  2ZQ8 A;  4R23 A;  3VP0 A;  4BD0 A;  1FCN A;  2P9V B;  1K57 C;  4HBU A;  5U47 A;  1K54 C;  1IYS A;  1KGE A;  3RXX A;  2WUQ A;  1IEL A;  2VGK A;  4B4Z A;  3P09 A;  1H5X A;  1XXM A;  4IVK A;  4S2L A;  2WZX A;  3Q81 A;  1ERM A;  3ITA A;  4JF5 A;  3UE1 A;  5IHV A;  5GHX A;  3NIA A;  4OP8 A;  4BLM A;  1JTG A;  5DTT A;  1L0E A;  4WZ4 A;  4GDN A;  3ZG5 A;  1W5D A;  1TDL A;  1CK3 A;  3N6I A;  3NC8 A;  4JF6 A;  4YIN A;  3BEB A;  1E3U A;  4PM7 A;  2V2F F;  3HLC A;  3IXD A;  3M2J A;  5FSR A;  4E3M A;  3CG5 A;  4QB8 A;  1DJA A;  3PBQ A;  5CGX A;  4NET A;  2WGI A;  3V5M A;  3BFE A;  4K0X A;  5FI6 A;  3NDG A;  2JC7 A;  1MWR A;  2C6W B;  4S2I A;  4Y7P A;  1PZP A;  2WAD A;  1K6R A;  1KE4 A;  3N4I A;  5CED A;  4MBH A;  4OQH A;  3IXB A;  4OQI A;  5E2E A;  3ZDJ A;  2QPN A;  3CMZ A;  1N9B A;  3A3J A;  4ZJ1 A;  1Z6F A;  4DRT A;  4F94 A;  2G2U A;  1PWD A;  4R4S A;  4IED A;  4R1G A;  5EPH A;  4KZB A;  1L0G A;  1XPB A;  1TVF A;  3IQA A;  3ZG7 B;  2HP6 A;  2G2W A;  2Y2K A;  3TG9 A;  5KSC A;  5GL9 A;  1W7F A;  3IF6 A;  4PM9 A;  1DJC A;  3IHA A;  4BL3 A;  3A3I A;  3UN7 A;  1LI0 A;  1LHY A;  2Y91 A;  5TFQ A;  4E3K A;  4OPQ A;  1YQS A;  3HLD A;  5CGW A;  4X6T A;  4GZB A;  4B4X A;  1LI9 A;  1Q2P A;  2XLN A;  5KSH A;  2HDU A;  5HL1 A;  4S2N C;  1SHV A;  4RX2 A;  3Q82 A;  4CJN A;  4YFM A;  5GLB A;  4KZ5 A;  5BOH A;  5DF9 A;  3SS5 A;  1ERQ A;  5FQI A;  4X69 A;  3N8R A;  3LY4 A;  3HUN A;  4MNR A;  4L0L A;  3SS3 A;  4P6B A;  3TSG A;  1VQQ A;  3G34 A;  3AGF A;  5FAT A;  2Y2L A;  2J9P A;  4GD8 A;  1Y54 A;  1YT4 A;  2C5W B;  4C6Y A;  4KZ3 A;  3FYZ A;  4JXV A;  3DTM A;  1YLW A;  2ZQA A;  4N92 A;  1IYO A;  3UE3 A;  3PBN A;  3SOI A;  4MEZ A;  2EFU A;  2ZM8 A;  5AQ9 A;  1BLS A;  5FAQ A;  3C4O A;  4P87 A;  2I72 A;  2ZC4 B;  4WZ5 A;  1ZG4 A;  1MPL A;  5AQA A;  5HAR A;  1G68 A;  3PBO A;  4OLD A;  5A91 A;  2EX2 A;  3FKW A;  5EVI B;  1YMS A;  2IWB A;  3C7U A;  1K25 A;  2Y2Q A;  3ZNY A;  1K38 A;  3GQZ A;  5E2F A;  3BFG A;  4KZ4 A;  4XXR A;  4DE0 A;  4IBR A;  1IYQ A;  2Y4A A;  4BL2 A;  1YLP A;  2HDS A;  5I94 A;  4IVI A;  4QY5 A;  5DTK A;  4MLL A;  2WYX A;  4GD6 A;  3ZVT A;  3LEZ A;  4OOL A;  1PW8 A;  2EX6 A;  3MZE A;  5AQ7 A;  4GNU A;  2WZZ A;  1E3U D;  1KE3 A;  2X71 A;  1ES3 A;  3A3F A;  3W4P A;  5A90 A;  5CRF A;  2Y2M A;  2Y55 A;  2ZJ9 A;  3VOY A;  4OOM A;  3WS4 A;  2A49 A;  4S2M A;  3BYD A;  4WEJ A;  5EEC A;  4N1X A;  1ZG6 A;  2Z2L B;  2OV5 A;  1XGI A;  4KQQ A;  3EQV A;  3IWQ A;  4E6X A;  5FQ9 A;  3VMA A;  4EWF A;  3MBZ A;  4XUZ A;  3MZD A;  2PU2 A;  4OKP A;  2Q9M A;  3BFF A;  2ZMA A;  1BUE A;  3DWK A;  5EUA A;  1SDN A;  4QD4 A;  2Y59 A;  1JWV A;  1MWU A;  3G4P A;  3UPO A;  1IEM A;  5FAS A;  3MKE A;  4PMA A;  2P9V A;  1SCW A;  4OQG A;  1Q2Q A;  1H8Z A;  1JVJ A;  3FV7 A;  3OZH A;  2B5R A;  2DCF A;  2V20 A;  2H10 A;  5CEC A;  3VP3 A;  2R9W A;  4Y0O A;  1MKI A;  2ZC3 B;  2XFT A;  1FOF A;  3HUO A;  3UNW A;  3V3S A;  4ZDX A;  1MBL A;  4EBN A;  4LV1 A;  3AGE A;  3LY3 A;  1K55 C;  4OQ0 A;  4PM8 A;  4R0Q A;  4DXC A;  1WYC A;  4X55 A;  3OPP A;  2JCH A;  3O87 A;  3Q7Z A;  2OLU A;  2XK1 A;  5FQJ A;  4IBX A;  5HX9 A;  3P98 A;  4B88 A;  4BD1 A;  3UE0 A;  4UA6 A;  4N9L A;  2H0Y A;  1K56 A;  5FAP A;  1I5Q A;  1SDE A;  2IWD A;  1XA1 A;  4PM5 A;  3WS5 A;  5JYP A;  2ZD8 A;  5F83 A;  4JXS A;  1K57 A;  1XGJ A;  2DRW A;  4OLG A;  4QY6 A;  4XUX A;  3IF6 C;  2V1Z A;  4N1H A;  4U0T A;  1NJ4 A;  1WE4 A;  4LEN A;  5EE8 A;  1DY6 A;  2Z2M B;  1XA7 A;  2X01 A;  2XF3 A;  5A93 A;  3NY4 A;  1C3B A;  4OPZ A;  2XDM A;  2XFS A;  3LO7 A;  1WYB A;  2HP9 A;  2Q9N A;  3VFF A;  4DDS A;  4Z9Q A;  2J8Y A;  4JXW A;  4RX3 A;  4LV0 A;  4EQI A;  5KMW A;  1CI9 A;  3ZG0 A;  1FR6 A;  1JWZ A;  3HUM A;  5CTN A;  5E2H A;  4GDB A;  3TOI A;  3UDX A;  1E25 A;  1EWZ A;  1JTD A;  1QME A;  4JPM A;  3IT9 A;  1KDW A;  5EVL A;  1HTZ A;  3WS2 A;  4DKI A;  3GMW A;  1FQG A;  3IWO A;  4U3T A;  3UPP A;  3PBR A;  4U0X A;  4D2O A;  1I2W A;  5F1F A;  3ZVW A;  4KZ8 A;  1LL9 A;  5E2G A;  2Y2N A;  3N8L A;  3N7W A;  3HL9 A;  5CGS A;  1K4E A;  1CI8 A;  3UDF A;  5A92 A;  1S0W A;  1PWC A;  2HP5 A;  2WKE A;  3N8S A;  1ONG A;  3OCN A;  4GN2 A;  4X68 A;  1U60 A;  5FQK A;  4E3N A;  1LLB A;  3PAE A;  5JYO A;  2ZM2 A;  1CEG A;  1L0D A;  3C4P A;  3O86 A;  3BFD A;  2E8I A;  5G18 A;  1K6S A;  5DTS A;  4WZ5 C;  2WGV A;  1BUL A;  3ISG A;  5HW3 A;  4E3J A;  5GHZ A;  2J7V A;  4S2J A;  4OPY A;  2XD5 A;  5GLD A;  1KVL A;  2WKI A;  4EV4 A;  4UA7 A;  3UDI A;  4ZBE A;  3DWZ A;  2EX8 A;  3G2Y A;  2XD1 A;  3G32 A;  1QMF A;  4S2K A;  1ES2 A;  3PTE A;  4HES A;  5EVI A;  4GOG A;  3SH9 A;  3G30 A;  1G6A A;  1ONH A;  1PI5 A;  5D3O A;  5E43 A;  3VFH A;  1ES5 A;  5CEB A;  1KVM A;  2BG1 A;  4OOY A;  3HRE A;  1BTL A;  3C7V A;  4K0W A;  4M3K A;  1MWT A;  1RP5 A;  2IWC A;  2WAE A;  3WRT A;  1HD8 A;  4KZA A;  2ZC7 A;  4S2O A;  4Q8I A;  3VSL A;  3NDE A;  4CPK A;  1TEM A;  2Y2J A;  4OON A;  5FQM A;  2QZ6 A;  3SH8 A;  3W8K A;  3DW0 A;  4DF6 A;  1ES4 A;  1I2S A;  4P85 A;  1YLZ A;  3I7J A;  3ZGA B;  1ZKJ A;  2WAF A;  2HPB A;  3VP4 A;  3M2K A;  5HAP A;  3BLM A;  1K56 D;  2RL3 A;  2OSU A;  5DVA A;  1XP4 A;  5CER A;  3OC2 A;  2ZC5 B;  3G35 A;  4JF4 A;  4KG5 A;  3IXG A;  4QJG A;  1BZA A;  2BLS A;  3WRZ A;  4JLF A;  1GHI A;  1S6R A;  5FAO A;  4KZ7 A;  4OVD A;  3ITB A;  3V3R A;  3BLS A;  1MY8 A;  1FSY A;  4P0M A;  1IKI A;  3UO9 A;  2UWX A;  4EUZ A;  3GVB A;  4WYY A;  1GCE A;  1W8Y A;  4KQO A;  3S4X A;  1YLJ A;  3Q7V B;  4O7D A;  2ZQC A;  3Q07 A;  2VGJ A;  4FH4 A;  4S2P A;  4C75 A;  1XKZ A;  1RGZ A;  3A3D A;  1L2S A;  2OLV A;  4QU3 A;  4ZTK A;  3RJU A;  4BEN A;  4LCM A;  5HAI A;  2XGN A;  3B3X A;  4K91 A;  1PIO A;  4DDY A;  1W79 A;  4N9K A;  3C5A A;  4DXB A;  2EXA A;  2A3U A;  5M1A A;  3VOZ A;  4Y0T A;  3MZF A;  1BT5 A;  3CJM A;  3CZD A;  3S1Y A;  5L2F A;  3FKV A;  1E4D A;  5CHJ A;  3HVF A;  3ZNT A;  4X56 A;  5GHY A;  3G31 A;  1KE0 A;  5DF7 A;  1K54 A;  3VSK A;  1FCO A;  3G2Z A;  4JKT A;  1XX2 A;  4WEL A;  3VP2 A;  5CHM A;  3S22 A;  3W4Q A;  3PBT A;  4X53 A;  5CHU A;  4R3B A;  1NYM A;  2EXB A;  1BLP A;  3BEC A;  2Y2H A;  1GA0 A;  4WMC A;  4OP5 A;  4UHU A;  1ZC2 A;  1EI5 A;  1NYY A;  3MXR A;  3IH8 A;  3D4F A;  3HLF A;  1K55 A;  1NZU A;  3M6B A;  5AQB A;  3WWX A;  3V50 A;  4E3I A;  3OPL A;  4FD8 A;  1M40 A;  1VM1 A;  4E6W A;  2X02 A;  4NK3 A;  3QHY A;  3UY6 A;  4A5R A;  4KEN B;  1O07 A;  3JYI A;  1ESU A;  1N4O A;  3E2L A;  5HFO A;  3IF6 B;  4C3Q A;  5FI2 A;  5EVI D;  3GTC A;  1NZO A;  4WM9 A;  5EOO A;  5F1G A;  3BFC A;  3QNC A;  1H8Y A;  1ESI A;  3NI9 A;  4DE3 A;  4UAA A;  5FQQ A;  2WK0 A;  1MWS A;  2JBF A;  1GA9 A;  2QMI A;  4GKU A;  5EOE A;  3IXH A;  3ZHH A;  4JBF A;  1MXO A;  1YMX A;  2XEP A;  3E2K A;  3HLW A;  2H0T A;  2J9O A;  4LV3 A;  5CXW A;  3GV9 A;  2PBY A;  4DE2 A;  3W4O A;  1YM1 A;  3OCL A;  1K4F A;  5FDH A;  3O88 A;  5GLC A;  4EBP A;  2ZQ7 A;  1GHP A;  1PZO A;  2EFX A;  3M6H A;  2PU4 A;  3QNB A;  1KGF A;  4HBT A;  1IKG A;  2P74 A;  4PPR A;  1IYP A;  3GR2 A;  1FSW A;  1BLC A;  1DJB A;  2FFY A;  4OH0 A;  4RVA A;  2JE5 A;  2DNS A;  3HLG A;  3MXS A;  4MBK A;  5EVI C;  4DE1 A;  5M18 A;  4LCL A;  3IWI A;  4S2N A;  1KGG A;  3IHB A;  5M19 A;  2ZM0 A;  4LV2 A;  4WBG A;  3OPH A;  1LL5 A;  3UPN A;  1FCM A;  1JWP A;  1NRF A;  3SH7 A;  1RCJ A;  1CEF A;  5CTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...