3MMHA

X-ray structure of free methionine-r-sulfoxide reductase from neisseria meningitidis in complex with its substrate
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
167
structure length
167
Chain Sequence
b'MHALHFSASDKAALYREVLPQIESVVADETDWVANLANTAAVLKEAFGWFWVGFYLVDTRSDELVLAPFQGPLACTRIPFGRGVCGQAWAKGGTVVVGDVDAHPDHIACSSLSRSEIVVPLFSDGRCIGVLDADSEHLAQFDETDALYLGELAKILEKRFEASRQAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine-R-sulfoxide reductase
publication title Structural and Biochemical Characterization of Free Methionine-R-sulfoxide Reductase from Neisseria meningitidis.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Oxidoreductase
total genus 52
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature ec 1.8.4.14: L-methionine (R)-S-oxide reductase.
pdb deposition date 2010-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3mmhA00
4MMNA 4MN7A 4Y2FA 2XSSA 3K2NA 2W3FA 3NOPC 2LB5A 3HCYA 3NOUC 2HGVA 2W3DA 3D3OA 5K5BA 5C5KA 2VZWA 4Q0JA 4FOFA 3S7QA 3KSHA 1TF1A 2GX5A 3OBFA 3R4KA 2G7UA 2XRNA 3MQ0A 3C2WA 4Y5FA 4DN0A 2K2NA 3NHQA 5AJGA 4O01A 2M7VA 4Z1WA 4BWIA 4EU0A 4ZRRA 2W1RA 2W1TA 3CI6A 1TD5A 5HPIA 4MDZA 3VV4A 4E04A 3O5YA 4O8GA 2OOLA 1VHMA 4MCWA 2KOIA 5HSQA 4ETZA 2O9AA 3S7PA 1STZA 3KSIA 1F5MA 4LRXC 2O9BA 3CITA 4ME4A 2O99A 1MC0A 2LB9A 2VEAA 3IBJA 1YKDA 5HPFA 3TRCA 4CQHA 3NOTC 2W3GA 4G3WA 4IUHA 5DFYA 3OOVA 4Q0IA 3EEAA 2XROA 3S7OA 2W1TB 3E98A 4RQ9A 4R6LA 2VKSA 4G3VA 1MKMA 4EUVA 2KLIA 3KSGA 5HL6A 3KO6A 2Y8HA 3G6OA 4YNRA 4ETXA 2M7UA 3RFBA 4Q0HA 4G3KA 3ZQ5A 5LBRA 1YSQA 2K31A 3E0YA 4LRYC 4R70A 2O0YA 4DMZA 2Y79A 2O9CA 5TJJA 4GLQA 3S7NA 2VJWA 3W2ZA 4IJGA 2QYBA 3MF0A 4LRZE 4QPRA 2B18A 3BJNA 3DBAA 3LFVA 4PAUA 3KSFA 4GW9A 4YOFA 5I5LA 3MMHA 1ZTUA 2ZMFA 4Y3IA 5L8MA 1YSPA 3IBRA 4O0PA 5DFXA 2W3EA 2W3HA 2IA2A 4IUKA
chains in the Genus database with same CATH superfamily
1L0DA 4NXEA 3NI9A 2Y2KA 1ZC2A 3NOPC 3IXGA 2P9VA 3SOIA 5AQ9A 1K38A 5C5KA 2X02A 1M40A 4K08A 1TVFA 3FZCA 3NJAA 4DE1A 5AQAA 3OCLA 1L0FA 1K4FA 2PDRA 2ZC4B 3TJZC 4O01A 2OSUA 1MXOA 1EW0A 4S2JA 3F1PA 4N9LA 2DRWA 4F3LA 1LSVA 3VV4A 4O8GA 4MN5A 4P6ZM 4Y13A 2PU4A 4ETZA 5HWWA 2O9AA 4EV4A 5A93A 5FA7A 4HEFA 2Q9NA 5M19A 1F9IA 2VGLS 4X25A 3U2AA 2WZZA 2VEAA 3BECA 2P08A 2Y2GA 3O87A 1YLJA 2WUQA 5DFYA 1OJ5A 3T50A 4Y0TA 1PW8A 2BASA 2UV0E 3WWXA 3KSGA 5U47A 1DJCA 1DJBA 2XF3A 3P7NA 3NDGA 2Y91A 5EM0A 4R70A 4PKYG 2XGNA 2JN7A 1Q2QA 4D60A 4PM5A 4S2KA 4WELA 1FOFA 1YLTA 3H7WB 3MMHA 3TOIA 3OZHA 2VLGA 1N9OA 4H8RA 4JGQA 3WRZA 3OLOA 2LB5A 2XH9A 1XJ4A 3AGFA 3IXHA 1TDGA 4FOFA 1I5QA 1G28A 3U4LP 4WF0A 5FQMA 3WRTA 5IS1A 4Y5FA 2ZC6B 4C3QA 1K57A 4KZ7A 2J3WA 3E4OA 4DDYA 4B9OA 1T1AA 3BWLA 4M4XA 4JF5A 1H0MA 1VM1A 5FQKA 4EETB 4WM9A 4X1MA 3FYZA 5J3WA 3H82A 3HUOA 5FQJA 3WS2A 4XUZA 3QP2A 3A3IA 3NOTC 3UE1A 4QD4A 2QHKA 1D06A 3RXXA 3EQUA 2OV5A 2VA0A 4B4XA 5DKKA 3E2KA 3IF6B 2P74A 4HOIA 5EECA 1UWNX 5GHZA 1N9LA 3A0RA 1ES2A 3FG8A 4OVDA 2QJ7A 3O88A 1V9ZA 4ID4A 5HWVA 4F94A 1N9NA 2VJWA 2WADA 3E2LA 3HJIA 3KYEA 4DDSA 1ES3A 2QMIA 3FKWA 2XFSA 4ZJ1A 2XA7M 1LT0A 4R4SA 1ZTUA 1WYBA 5M1AA 1K54C 2IA2A 3WS5A 4X69A 5HZHA 1EROA 4MN7A 4E3JA 3IHBA 2PYRA 3ZG9B 5JYPA 3CLOA 4WEJA 1JTDA 4JGRA 3LEQA 3LO7A 3UDFA 2Z2LB 1XFQA 2ZOIA 3S22A 3C7UA 5IHVA 5HL1A 3HLCA 5FAOA 3UNWA 1PZPA 1YM1A 5F82A 4E04A 2R9WA 3Q1FA 3HVFA 1FR6A 4NXBA 2W0NA 3TE8A 3VE3A 3G2ZA 4KUKA 5HAPA 2WK0A 5EOEA 4JXWA 4G3WA 1CI8A 4HBTA 4PPRA 4UA9A 3LR0A 4EBPA 3VP3A 5CXWA 5E2GA 4WZ5A 5DTKA 3IWQA 3VMAA 1N4OA 4BD0A 5L10A 4EESA 3QP1A 5HL6A 3IF5A 4E6WA 3N8LA 3T4JA 4R4RA 3BEBA 4WZ4A 1IYOA 2BLSA 1BLCA 2V1BA 1YSQA 5TBMA 1P97A 2J7VA 3S7NA 1S6RA 5HX9A 4IHQA 4BJPA 2ZMFA 1GHIA 3C38A 5FI7A 2PR5A 2IWBA 1N9BA 2V2FF 2PR6A 1PI4A 3MFDA 1E3UD 2OWHA 3LYXA 4FH4A 2PYPA 3NOUC 1G68A 5FQ9A 4FH2A 1XKZA 1IKIA 3KSHA 2GX5A 5KMWA 2JCHA 3MQ0A 1S67L 1ALQA 5FDHA 2M7VA 5E2EA 3PHYA 5M18A 2A24A 3A3JA 1S1ZA 3UDXA 3LIEA 1S0WA 4P6BA 1SHVA 3GRJA 1NRJA 3PTEA 3H7WA 4OLDA 1FSYA 1C3BA 5KSHA 1JTGA 2PU2A 3TW8A 1XJ3A 1D7EA 3ZG5A 4BLMA 1SKOB 1CK3A 1E3UA 3UB8A 5EVID 2HDSA 3T1XA 3PBNA 2HP5A 3A0VA 2HDQA 3Q82A 1NZOA 3OPRA 4ZAMA 3IX8A 3UE0A 3PBOA 4FUWA 1GA0A 2Q9MA 4X6TA 4LFUA 1FCNA 4QWOA 5A92A 4S2NC 1VEUB 1G6AA 3UB9A 4ZJ3A 4PM8A 4BQMA 3IS2B 3MKEA 4Y0UA 3UPPA 2L4RA 4BBUA 4WUJA 3EGXC 2BTFP 5EPHA 4L0LA 5L8MA 1O7EA 4EQIA 4KZ8A 4KZ6A 3HL9A 3R7WB 4KZ9A 1GHMA 4XT2B 5EVIA 4KZ4A 3IF6A 1BLSA 1XP4A 4JXVA 3QP5A 4LCLA 3BFCA 3N8RA 4S2PA 3KX0X 4Y7PA 2PBYA 2OLUA 1G6OA 4Z1WA 1SZVA 4HESA 2B02A 2HPBA 2W1RA 2ZD8A 4NXFA 3BW6A 1TS7A 2H0YA 1PIOA 4MCWA 2XQZA 5AQ7A 1S4SA 5CX7A 4U0TA 2V0WA 4GZBA 5HAQA 4HJ6A 3SH8A 3T4LA 4R38A 1MZUA 3UMEA 1XFNA 5DJTA 4IEDA 1YPRA 3DAVA 5HPFA 2ZQAA 2WZXA 3NBLA 2AVXA 3OOVA 3EEAA 3LUQA 3ICYA 4KENB 3C7VA 1T18A 1K55C 5BOHA 3T1SA 4YNRA 4NK3A 5LBRA 4B88A 2P04A 5F6AA 5AVFA 3Q7VA 4QB8A 1WE4A 5E43A 3O86A 4OQIA 2OAQ1 5L07A 3CPTA 4DF6A 1TDLA 3DBAA 2FFFB 2YKHA 3QP4A 2H28A 3RTYA 5EM1A 2WYXA 1YSPA 3P01A 3VP1A 3CUEA 1W63Q 3ZVWA 4BBTA 3QP8A 4MMNA 3K2NA 4NXGA 4DE3A 1PRQA 5HWTA 2L1MA 3D3OA 1XXMA 1PWDA 3C4OA 2WKEA 4OPYA 2QPNA 4HY8A 3SS3A 2JKGA 1P0ZA 1ZKJA 5DVAA 3CI6A 5CGSA 5EVLA 5HPIA 1FSWA 4P85A 2OLVA 2JHEA 5G4ZA 3IQAA 3O5YA 3T4OA 1OT9A 3BFFA 4N9KA 2WKQA 5FL3A 1FCMA 3BLSA 4I3IA 1X0OA 1STZA 2XD1A 4DJ3A 1FR1A 3K3CA 3CITA 5TGFA 3NCKA 4ME4A 3BQ8A 3MZDA 3FWLA 3GQZA 3P09A 1IYSA 1YKDA 4E3LA 1BULA 2Y2MA 2FFYA 4L9GA 4QJGA 4U3TA 2Y55A 1JWZA 1K4EA 3SH7A 3VOLA 2P7JA 4L9FA 4R3AA 3G4PA 2V8FA 3LGOA 3UB7A 5DF9A 2A3UA 4OQHA 2XLNA 4JBFA 1V9YA 5EUAA 2GNXA 3OPPA 4OOYA 4HH3A 4S2OA 1W8YA 2O0YA 1LLBA 2ZQ9A 2EWWA 1GA9A 2R78A 2VGKA 4QY6A 1IELA 1SKOA 4PAUA 2GJ3A 3ZNTA 3F1OA 4ESPA 3KYQA 4OPQA 5DTSA 1LL5A 3LIAA 2Z6CA 3IBRA 1ERMA 2W3EA 3HBRA 4KZBA 3ZG0A 3IH8A 3PBQA 4Y2FA 1GSVA 3MJQA 3HCYA 5CGWA 2Y2LA 1JWVA 1DJAA 1UWPX 3GTCA 4JGOA 3KYZA 4S2IA 5CHUA 3TG9A 4Z9QA 4JF6A 3MKFA 3LR3A 4P0MA 4ZTKA 4N92A 1ES4A 3IS2A 3W4QA 4GHIB 4NETA 4EU0A 3M2JA 4E3KA 1LHYA 4OPRA 1XGIA 5HD3A 2ZM8A 4CLCB 1VHMA 3C8CA 1LI9A 3MFXA 2BG1A 2ZBBA 1F5MA 2O9BA 3ZVTA 1QMFA 3IH9A 2O99A 2GZAA 2C6WB 3F1NB 2WKPA 4HBUA 5IU1A 4M3KA 2XD5A 1ZHHB 5DTTA 5KSCA 1KGEA 1MWUA 4EUZA 1QMEA 4HP9A 5GHXA 5HD5A 4RQ9A 1HTZA 3B42A 5HDDA 1W8QA 4KQRA 4XXRA 1PZOA 2JBFA 3CAXA 3JYIA 2PHYA 1VETA 4LCMA 1K57C 4Y15A 1PWGA 2WKHA 1DY6A 4KG5A 1YQSA 4EQ1A 4P6ZS 5D3OA 5F1FA 3T4SA 4BL2A 3PBRA 1RCJA 3P98A 1K6SA 3WS4A 3OCNA 3I7JA 2I9VA 3QNBA 3C5AA 1E4DA 1K25A 2HV1A 2W3DA 3OPHA 1HZOA 3W4PA 2VZWA 3MXQA 4S2LA 3R4KA 2IWCA 3DWKA 3OPLA 5EVEA 4DN0A 3HLGA 3CG5A 1Y4OA 4JXSA 4ZRRA 4MNRA 3C30A 4LV3A 3MSHA 4Y0OA 3VFHA 3G30A 4NKPA 2Y2HA 1DP6A 2QJ5A 1O07A 1JNUA 3S7PA 2ZL1B 3MR0A 2I72A 2J3TD 4UQIM 5HW3A 3MXRA 4II7A 1YMXA 3T1RA 4JLFA 5GLDA 5AVEA 1Y28A 2ZQCA 5J4EA 3DTIA 2W1TB 5DF7A 2UWXA 1J3WA 2VV7A 1W7FA 5CHJA 5FATA 1ES5A 1JWPA 3W8KA 3LEZA 3E4PA 4ETXA 5DF8A 3RFBA 5GL9A 3VFFA 3B3XA 2ZC7A 2V9AA 3ZG8B 4EXOA 4OOMA 2ZJ9A 2X01A 1OTDA 4HQAA 3M2KA 3EWKA 1KDWA 3NC8A 2DCFA 1M6KA 3G34A 1MPLA 5HAIA 4R23A 4I3AA 1Q2PA 3HUNA 4FSFA 4Q0JA 4HIAA 4U0XA 1TF1A 2FZ0A 1MBLA 4IBRA 4WZ5C 1XA7A 2RCXA 2K2NA 3NHQA 4DXCA 3T1QB 1MWTA 2JKTI 2OAP1 1JVJA 4CLCD 1YAXA 3S4XA 4UAAA 3UE6A 1H8ZA 4LV2A 4IBXA 1GHPA 1ZG4A 1OTAA 2D01A 1BLPA 1TS0A 3HLWA 1XX2A 2P9VB 2XA7S 3RH8B 3IT9A 3FV7A 1FQGA 3CZDA 4KQDA 1NLYA 3N4IA 3BY9A 3OC2A 3TSGA 4CQHA 4PM6A 3UPOA 1OPXA 2Z6DA 3T4QA 1L0GA 3F1PB 4GS9B 1S66L 4CLCE 4UHUA 3SH9A 2JKTM 2VKSA 2Y4AA 4GHIA 4BMWA 4UQIS 4EUVA 5FQIA 1IYQA 2H10A 3ISGA 3KO6A 1DP8A 4P87A 2ZMAA 3CJMA 1YMSA 1YLPA 2A49A 1XJ6A 2XK1A 5AQBA 4CLCA 4QU3A 4RX3A 4MBKA 4LRYC 3BM6A 2OWJA 3MQQA 4YINA 4BL3A 5GLAA 1DRMA 4MBHA 2NUPC 4GDNA 1W79A 4JF4A 1CF0A 3EQVA 3F1NA 5A91A 2JC7A 1KGFA 1BTLA 2X71A 4GOGA 3S1YA 5FASA 2EA9A 1IFQA 1OMEA 5FQQA 4DJ2A 1DP9A 1OTBA 4KG6A 4NEED 4DXBA 5K5BA 1RP5A 1VQQA 1S4RA 2J9PA 3IXBA 1K0KA 2IWDA 1MY8A 2XEPA 2XRNA 3HUMA 3C2WA 4HJ4A 1NLZA 2M1CA 2R9XA 3DWZA 3CWFA 1TS8A 1NYMA 4BBVA 3T12B 2VV8A 2XFTA 4HJ3A 4WL9A 3GSGA 5FEGA 1T19A 1LSWA 3V50A 3LR4A 1VB6A 4DE2A 3KSIA 1SKFA 4EWFA 2GDNA 4KZ3A 3AGEA 4ZJ2A 1MC0A 3FKVA 4X68A 2QWSA 3IBJA 3BY8A 5F83A 4L9EA 5CEBA 5G18A 3VP0A 2W3GA 2XROA 5EVIC 5FI2A 3IF6C 3HLEA 2ZM0A 4HP4A 2V20A 4G3VA 2FH5A 1NWZA 3UB5P 3UPNA 4AFIA 4K0WA 1H8MA 2A2LA 3NDEA 2INWA 3V39A 1KDSA 3JVVA 2ZL1A 5L2FA 2JE5A 3HJKA 5DJUA 3LIFA 2WGWB 3VP2A 4IJGA 3MF0A 4QPRA 4LRZE 3ZHHA 5GHYA 4MBFA 4N1HA 4YOFA 3PR6A 4ZDXA 1ODVA 2W3HA 3N6IA 3DTMA 3Q7ZA 2VGLM 1CI9A 3ZDJA 3LI9A 2Q0OA 3SW1A 2KX6A 4KQOA 1KVMA 2YKFA 1K56D 4GD6A 1EWZA 3IX4A 3MQOA 2Y2QA 1S1YA 3UE3A 2DMWA 3LICA 1XPBA 3ZFZA 2W27A 4EERA 1ONGA 5TR7A 3M6HA 1FIKA 2B95A 5HSQA 1T1BA 3SS4A 4RX2A 5TFQA 2HZ5A 4RA7A 2V0UA 3V5MA 1KOUA 2Y2JA 4E6XA 3LY3A 3A3DA 3MXSA 1BSGA 3EEHA 3CUEC 3LIBA 2PAVP 2H0TA 5F5YA 3A0SA 4JPMA 1K56A 3G31A 3LIDA 2MJ6A 1IEMA 3A3EA 2HP9A 3M6BA 5FAQA 3BYDA 1ACFA 3G6OA 1LI0A 5DKLA 3ZQ5A 2CC1A 1NZUA 2Y2NA 3GECA 2PRFA 1ERQA 3NULA 3IHAA 1PI5A 3RXWA 4YFMA 4I5SA 2JKFA 4OLGA 1MKIA 2Z2MB 4PM7A 5J8XA 3ZCZA 3EOIA 3G35A 3IX3A 4GS9A 1TEMA 1MWSA 1HD8A 3NY4A 2HGVA 2EXBA 4N1XA 5TBMB 4HI4A 1CEGA 2Y2OA 2D02A 4R3BA 4LV0A 5FDSA 3CMZA 2WAFA 3MZFA 3AGDA 5AJGA 5HDSA 1UGUA 1TS6A 4PM9A 5A90A 5KIZA 3L9KA 5F68A 3HREA 1H3QA 4HH2A 2KOIA 1I2WA 3SS5A 3DTEA 4EBLA 4MEZA 4FCFA 1RGZA 1W5DA 4YWZA 1VEUA 4RVAA 3VSKA 4LRXC 4WMCD 1PW1A 4GDBA 3LR5A 4WEKA 4BENA 5CTNA 2WGVA 3VSLA 2HJEA 2A24B 4B4ZA 3LI8A 4X1LA 3UN7A 4GB7A 3R7WA 3ULFA 4XT2A 2ZC5B 4CJNA 3JVUA 4R1GA 2M7UA 2ZQDA 3MZEA 1WYCA 2WGIA 1OT6A 4KZAA 3N8SA 1BUEA 1H8YA 1EI5A 5TJJA 3PXPA 5GLBA 2B18A 4RYEA 4WMCA 3QP6A 5DFXA 1AXBA 2HF6A 1ESUA 4EW7A 1MWRA 3B33A 2XR0A 2EWVA 4WYYA 3IWIA 2Y2IA 2WAEA 1F2KA 5HFOA 2G7UA 3K3DA 1YLYA 5E2FA 3FPVA 4GN2A 5FI6A 1CJFA 1XGJA 1IYPA 2WGWA 5EV0A 1GSWA 4WLAA 4O7DA 2EX6A 1Z6FA 3ITBA 5GLCA 1YLZA 5EVIB 2WKIA 2HP6A 1WA9A 3ZNYA 4UA7A 1K54A 2PBDP 3BFDA 3ITAA 3CHWP 4D2OA 3DTKA 3UB6A 4KUOA 1A0KA 3GMWA 1ESIA 3FC7A 4MN6A 2EFXA 3QNCA 4OQGA 4GJ4A 3PAGA 4C75A 3D72A 1PWCA 1MKMA 1KE4A 4GKUA 4K91A 2Y8HA 1D1JA 2EX2A 4OQ0A 3O3VA 3WS0A 2PD8A 2ZOHA 5E2HA 2EX9A 5CERA 3UMDA 3PYPA 4E3MA 4GLQA 3UO9A 5CEDA 2DNSA 5FSRA 4WBGA 4I38A 3BJNA 1I2SA 4ARZB 3Q81A 4JXGA 4B93A 2Y2PA 4ZBEA 4FTXA 4LGWA 4IUKA 3UDIA 4H6JB 1U60A 2XSSA 1J9MA 1K6RA 3VE4A 3HLFA 1HLUP 3S7QA 3GV9A 3Q7VB 3BFEA 5CTMA 4E3NA 5F1GA 3CPTB 3HLDA 5CGXA 4S2MA 4KZ5A 1KVLA 3ZYTA 2J9OA 4I3JA 1PNEA 3LY4A 1TD5A 3V3SA 2EFUA 2PT7A 3SZTA 3VOZA 1SCWA 3T4KA 5A8BA 1XA1A 2V8CA 4OKPA 3PAEA 4EEPA 3ZG7B 2J8YA 1IKGA 3PBTA 4KG2A 2VV6A 4HNBA 5G4YA 2ZQ7A 2NUTC 2J3TC 4UEYA 3MBZA 1NY0A 1CEFA 4LV1A 1Y54A 3TRCA 3V67A 4Q0IA 5KZHA 3S7OA 4GCZA 3E98A 4UA6A 1KE3A 4R6LA 3BFGA 3WS1A 2J80A 3VOYA 1P9RA 4EEUA 1RGYA 1YLWA 1G5UA 3L7HA 1F98A 1KGGA 3MS6A 4DMZA 2ACGA 3ZGAB 4C6YA 4K0XA 1CQAA 4OH0A 4DE0A 2QYBA 4BD1A 1Z09A 4F3LB 3RJUA 1PFLA 3W4OA 3G32A 4O0PA 4A5RA 1OTEA 4KQQA 2E8IA 2W3FA 2ZM2A 4PHTA 3GDIA 1SDEA 2PD7A 3H9WA 3BLMA 5IT5A 5J7EA 3IXDA 2ZC3B 1AWIA 3OBFA 4LENA 2Y59A 4S2NA 5HDCA 4JGPA 3F1OB 4GD8A 4QHCA 2C5WB 5CECA 2QZ6A 3QHYA 1FCOA 4CLCC 4NG2A 1LL8A 3EGDC 3VP4A 1OJGA 1KE0A 3GVBA 4Y17A 2G2UA 3NIAA 5L09A 1ONHA 3A3FA 2EX8A 4OONA 2V1ZA 4QY5A 1OTIA 3IWOA 4LPZA 1XJ2A 2ZQ8A 3PBSA 2CMNA 4IUHA 1E25A 1NRFA 1L3LA 3C4PA 4R0QA 3V3RA 4GNUA 2L0WA 2KLIA 4X55A 1SDNA 4OP5A 2VGJA 4XUXA 4Q0HA 3T4TA 5EFWA 1L0EA 3G2YA 5MC7A 1NXYA 1T1CA 3UY6A 2Y79A 4CPKA 1FILA 1IOUA 3D4FA 1HVBA 3W2ZA 5I94A 3HLBA 3KSFA 2B5RA 4X53A 4OOLA 4R3JA 4E3OA 1LSXA 2KDKA 3GR2A 4HHDA 4Q8IA 4X56A 2VX8A 4DRTA 4OP8A 1GCEA 1PYYA 3H82B 1VETB 4E3IA 1YT4A 3Q07A 1K55A 2HDRA 4EBNA 3D9YA 1L2SA 3BRMA 4MLLA 4WN5A 2E8JA 2ZMVA 4BWIA 2WKRA 2HJ9C 4PKYA 2W1TA 2RL3A 4MDZA 1LL9A 3E4QA 4ARZA 2OOLA 1W63M 1H5XA 2G2WA 2QKPA 3BQAA 5FAPA 5FEFA 1BYWA 4H6JA 5EOOA 2LB9A 5F69A 2EXAA 1NYYA 3B47A 3FPWA 1BT5A 5EE8A 2HDUA 3N7WA 2V1AA 3LCEA 3JPUA 1GSXA 2JKRI 3DW0A 2K7SA 4DKIA 1BZAA 4PMAA 4I39A 5CHMA 4G3KA 5HARA 4OPZA 5CRFA 5JYOA 2K31A 3E0YA 2XDMA 2ZLYA 4IVIA 2VK3A 2O9CA 1BLHA 1P9WA 3LFVA 2H5SA 1NJ4A 1ZG6A 4GW9A 5I5LA 4Y3IA 4LLOB 4FD8A 4JKTA 3NECA 2JKRM 4IVKA
chains in the Genus database with same CATH topology
3R7WB 4EW7A 4NXEA 4XT2B 3NOPC 3B33A 2EWVA 4FSFA 5C5KA 4Q0JA 4HIAA 4K08A 1TF1A 3KX0X 2FZ0A 2G7UA 3K3DA 3NJAA 3OCLA 2PDRA 1G6OA 3FPVA 2K2NA 3NHQA 3TJZC 4O01A 4Z1WA 2JKTI 2B02A 2OAP1 1EW0A 4CLCD 1YAXA 3F1PA 2W1RA 1GSWA 4WLAA 3UE6A 4F3LA 1LSVA 3VV4A 4NXFA 3BW6A 1TS7A 4O8GA 1OTAA 2D01A 4MCWA 1TS0A 4MN5A 4P6ZM 4ETZA 1S4SA 5HWWA 2O9AA 1WA9A 2XA7S 5CX7A 3RH8B 2V0WA 4HJ6A 3T4LA 4KQDA 1F9IA 1MZUA 1NLYA 2VGLS 1XFNA 4R38A 5DJTA 3U2AA 3UMEA 2VEAA 3UB6A 3BY9A 3OC2A 4KUOA 2P08A 5HPFA 4CQHA 1OPXA 2Z6DA 3FC7A 3T4QA 4MN6A 5DFYA 3OOVA 3EEAA 1OJ5A 3T50A 3LUQA 3F1PB 3ICYA 4GS9B 1S66L 4GJ4A 4CLCE 3D72A 2JKTM 2BASA 2VKSA 4GHIA 4BMWA 4UQIS 1MKMA 4EUVA 3KSGA 1T18A 3KO6A 1DP8A 2Y8HA 4YNRA 3P7NA 1XJ6A 4CLCA 5LBRA 2P04A 5F6AA 4LRYC 2PD8A 2ZOHA 4R70A 5AVFA 4PKYG 3UMDA 2OWJA 2JN7A 3PYPA 2OAQ1 4GLQA 3MQQA 1DRMA 4I38A 2NUPC 3BJNA 3DBAA 4ARZB 2YKHA 4WELA 3EQVA 2H28A 3F1NA 4B93A 3H7WB 3MMHA 3RTYA 1YSPA 3P01A 3CUEA 1W63Q 4JGQA 2VLGA 1N9OA 4IUKA 4BBTA 4MMNA 2EA9A 4H6JB 2XSSA 3K2NA 4NXGA 3OLOA 1IFQA 2LB5A 4DJ2A 1XJ4A 3VE4A 1DP9A 1OTBA 4NEED 5HWTA 2L1MA 3D3OA 5K5BA 1S4RA 4FOFA 1G28A 3S7QA 4WF0A 4HY8A 2XRNA 5IS1A 1P0ZA 3C2WA 4HJ4A 4Y5FA 1NLZA 2M1CA 3ZYTA 3CWFA 2J3WA 4I3JA 1TS8A 3E4OA 4BBVA 3CI6A 1TD5A 5HPIA 2PT7A 4B9OA 2JHEA 2VV8A 4HJ3A 3O5YA 5G4ZA 1OT9A 3T4OA 1T1AA 3BWLA 4WL9A 3T4KA 5A8BA 2WKQA 4M4XA 1T19A 4EEPA 1LSWA 5FL3A 4I3IA 3LR4A 1X0OA 1VB6A 1STZA 3KSIA 3PBTA 4DJ3A 4EETB 2VV6A 3K3CA 4HNBA 3CITA 5G4YA 2NUTC 4ME4A 2J3TC 3BQ8A 4UEYA 5J3WA 1MC0A 3H82A 2QWSA 3IBJA 1YKDA 3BY8A 3TRCA 4L9EA 3NOTC 2W3GA 3V67A 2QHKA 1D06A 4L9GA 4Q0IA 2XROA 3EQUA 3S7OA 4GCZA 3E98A 3VOLA 2VA0A 2P7JA 4R6LA 4HP4A 4L9FA 4R3AA 5DKKA 4G3VA 2J80A 2FH5A 4HOIA 1NWZA 1P9RA 4EEUA 1UWNX 3UB7A 1N9LA 4AFIA 3A0RA 5DF9A 1H8MA 3FG8A 1V9YA 1F98A 2A2LA 2QJ7A 2GNXA 4HH3A 2INWA 1V9ZA 2O0YA 3JVVA 5HWVA 2EWWA 4DMZA 3HJKA 2R78A 5DJUA 3LIFA 1N9NA 2VJWA 3HJIA 4IJGA 2QYBA 3MF0A 4LRZE 4QPRA 4F3LB 4PAUA 2GJ3A 3F1OA 4YOFA 2XA7M 1LT0A 3KYQA 3PR6A 1ZTUA 3LIAA 2Z6CA 3IBRA 4O0PA 1OTEA 1ODVA 2W3EA 2W3HA 2IA2A 2VGLM 5HZHA 3PBQA 4MN7A 4Y2FA 1GSVA 2W3FA 3MJQA 3LI9A 2PYRA 4PHTA 3GDIA 2PD7A 3H9WA 3CLOA 3HCYA 2KX6A 3SW1A 4WEJA 1UWPX 4JGOA 4KQOA 3KYZA 5IT5A 5J7EA 2YKFA 4JGRA 3OBFA 1XFQA 3LR3A 3MQOA 1S1YA 5HDCA 3UE3A 2ZOIA 4JGPA 3IS2A 4GHIB 2DMWA 3F1OB 3LICA 4EU0A 2W27A 4EERA 4CLCC 1LL8A 3EGDC 5HD3A 4E04A 1OJGA 4CLCB 1VHMA 5HSQA 3C8CA 1T1BA 3MFXA 4NXBA 2W0NA 2ZBBA 1F5MA 3TE8A 3VE3A 2V0UA 1KOUA 2O9BA 4KUKA 3EEHA 2O99A 2GZAA 1OTIA 4LPZA 3CUEC 3F1NB 1XJ2A 2WKPA 3LIBA 3PBSA 2CMNA 4G3WA 5IU1A 4IUHA 5F5YA 1ZHHB 3A0SA 3LR0A 4HP9A 5HD5A 4RQ9A 3LIDA 2MJ6A 2L0WA 2KLIA 3B42A 5HDDA 4EESA 5HL6A 3G6OA 3T4JA 5DKLA 4Q0HA 3CAXA 3ZQ5A 3T4TA 2V1BA 2PHYA 1YSQA 3GECA 5EFWA 5TBMA 5MC7A 1T1CA 2Y79A 4EQ1A 4I5SA 4P6ZS 1P97A 1IOUA 3S7NA 3W2ZA 3T4SA 3PBRA 3KSFA 4IHQA 4OOLA 2ZMFA 4BJPA 3OCNA 3C38A 2PR5A 1LSXA 2KDKA 2PR6A 3EOIA 2I9VA 4HHDA 4GS9A 2VX8A 2OWHA 3LYXA 2PYPA 2HV1A 3NOUC 2HGVA 2W3DA 3H82B 2VZWA 3MXQA 5TBMB 4HI4A 3KSHA 2D02A 2GX5A 3R4KA 3MQ0A 4WN5A 1S67L 2ZMVA 4DN0A 5AJGA 2M7VA 5HDSA 4BWIA 3PHYA 2WKRA 2HJ9C 4PKYA 1UGUA 1TS6A 2A24A 4ZRRA 1S1ZA 2W1TA 3C30A 3LIEA 4MDZA 5KIZA 5F68A 3E4QA 1H3QA 4HH2A 4ARZA 1NRJA 4NKPA 2OOLA 1W63M 2KOIA 2QKPA 1DP6A 3H7WA 2QJ5A 3BQAA 5KSHA 1JNUA 3S7PA 1BYWA 3MR0A 1XJ3A 1D7EA 4YWZA 3TW8A 2J3TD 4H6JA 4UQIM 4LRXC 4II7A 2LB9A 3LR5A 5F69A 3B47A 3FPWA 4WEKA 3UB8A 5AVEA 1Y28A 3PBNA 5J4EA 2HJEA 3A0VA 2V1AA 2A24B 1GSXA 2JKRI 2W1TB 2K7SA 3LI8A 2VV7A 3PBOA 3R7WA 3ULFA 4I39A 4XT2A 3E4PA 4ETXA 3JVUA 2M7UA 3RFBA 4G3KA 3UB9A 2K31A 3E0YA 2V9AA 1OT6A 4EXOA 3IS2B 4OOMA 2O9CA 5TJJA 3PXPA 2L4RA 4BBUA 1OTDA 2B18A 1P9WA 3LFVA 4HQAA 4WUJA 3EWKA 3EGXC 4GW9A 5I5LA 4L0LA 5L8MA 4Y3IA 4LLOB 4I3AA 5DFXA 2JKRM 2HF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MMN A;  4MN7 A;  4Y2F A;  2XSS A;  3K2N A;  2W3F A;  3NOP C;  2LB5 A;  3HCY A;  3NOU C;  2HGV A;  2W3D A;  3D3O A;  5K5B A;  5C5K A;  2VZW A;  4Q0J A;  4FOF A;  3S7Q A;  3KSH A;  1TF1 A;  2GX5 A;  3OBF A;  3R4K A;  2G7U A;  2XRN A;  3MQ0 A;  3C2W A;  4Y5F A;  4DN0 A;  2K2N A;  3NHQ A;  5AJG A;  4O01 A;  2M7V A;  4Z1W A;  4BWI A;  4EU0 A;  4ZRR A;  2W1R A;  2W1T A;  3CI6 A;  1TD5 A;  5HPI A;  4MDZ A;  3VV4 A;  4E04 A;  3O5Y A;  4O8G A;  2OOL A;  1VHM A;  4MCW A;  2KOI A;  5HSQ A;  4ETZ A;  2O9A A;  3S7P A;  1STZ A;  3KSI A;  1F5M A;  4LRX C;  2O9B A;  3CIT A;  4ME4 A;  2O99 A;  1MC0 A;  2LB9 A;  2VEA A;  3IBJ A;  1YKD A;  5HPF A;  3TRC A;  4CQH A;  3NOT C;  2W3G A;  4G3W A;  4IUH A;  5DFY A;  3OOV A;  4Q0I A;  3EEA A;  2XRO A;  3S7O A;  2W1T B;  3E98 A;  4RQ9 A;  4R6L A;  2VKS A;  4G3V A;  1MKM A;  4EUV A;  2KLI A;  3KSG A;  5HL6 A;  3KO6 A;  2Y8H A;  3G6O A;  4YNR A;  4ETX A;  2M7U A;  3RFB A;  4Q0H A;  4G3K A;  3ZQ5 A;  5LBR A;  1YSQ A;  2K31 A;  3E0Y A;  4LRY C;  4R70 A;  2O0Y A;  4DMZ A;  2Y79 A;  2O9C A;  5TJJ A;  4GLQ A;  3S7N A;  2VJW A;  3W2Z A;  4IJG A;  2QYB A;  3MF0 A;  4LRZ E;  4QPR A;  2B18 A;  3BJN A;  3DBA A;  3LFV A;  4PAU A;  3KSF A;  4GW9 A;  4YOF A;  5I5L A;  3MMH A;  1ZTU A;  2ZMF A;  4Y3I A;  5L8M A;  1YSP A;  3IBR A;  4O0P A;  5DFX A;  2W3E A;  2W3H A;  2IA2 A;  4IUK A; 
#chains in the Genus database with same CATH topology
 1L0D A;  4NXE A;  3NI9 A;  2Y2K A;  1ZC2 A;  3NOP C;  3IXG A;  2P9V A;  3SOI A;  5AQ9 A;  1K38 A;  5C5K A;  2X02 A;  1M40 A;  4K08 A;  1TVF A;  3FZC A;  3NJA A;  4DE1 A;  5AQA A;  3OCL A;  1L0F A;  1K4F A;  2PDR A;  2ZC4 B;  3TJZ C;  4O01 A;  2OSU A;  1MXO A;  1EW0 A;  4S2J A;  3F1P A;  4N9L A;  2DRW A;  4F3L A;  1LSV A;  3VV4 A;  4O8G A;  4MN5 A;  4P6Z M;  4Y13 A;  2PU4 A;  4ETZ A;  5HWW A;  2O9A A;  4EV4 A;  5A93 A;  5FA7 A;  4HEF A;  2Q9N A;  5M19 A;  1F9I A;  2VGL S;  4X25 A;  3U2A A;  2WZZ A;  2VEA A;  3BEC A;  2P08 A;  2Y2G A;  3O87 A;  1YLJ A;  2WUQ A;  5DFY A;  1OJ5 A;  3T50 A;  4Y0T A;  1PW8 A;  2BAS A;  2UV0 E;  3WWX A;  3KSG A;  5U47 A;  1DJC A;  1DJB A;  2XF3 A;  3P7N A;  3NDG A;  2Y91 A;  5EM0 A;  4R70 A;  4PKY G;  2XGN A;  2JN7 A;  1Q2Q A;  4D60 A;  4PM5 A;  4S2K A;  4WEL A;  1FOF A;  1YLT A;  3H7W B;  3MMH A;  3TOI A;  3OZH A;  2VLG A;  1N9O A;  4H8R A;  4JGQ A;  3WRZ A;  3OLO A;  2LB5 A;  2XH9 A;  1XJ4 A;  3AGF A;  3IXH A;  1TDG A;  4FOF A;  1I5Q A;  1G28 A;  3U4L P;  4WF0 A;  5FQM A;  3WRT A;  5IS1 A;  4Y5F A;  2ZC6 B;  4C3Q A;  1K57 A;  4KZ7 A;  2J3W A;  3E4O A;  4DDY A;  4B9O A;  1T1A A;  3BWL A;  4M4X A;  4JF5 A;  1H0M A;  1VM1 A;  5FQK A;  4EET B;  4WM9 A;  4X1M A;  3FYZ A;  5J3W A;  3H82 A;  3HUO A;  5FQJ A;  3WS2 A;  4XUZ A;  3QP2 A;  3A3I A;  3NOT C;  3UE1 A;  4QD4 A;  2QHK A;  1D06 A;  3RXX A;  3EQU A;  2OV5 A;  2VA0 A;  4B4X A;  5DKK A;  3E2K A;  3IF6 B;  2P74 A;  4HOI A;  5EEC A;  1UWN X;  5GHZ A;  1N9L A;  3A0R A;  1ES2 A;  3FG8 A;  4OVD A;  2QJ7 A;  3O88 A;  1V9Z A;  4ID4 A;  5HWV A;  4F94 A;  1N9N A;  2VJW A;  2WAD A;  3E2L A;  3HJI A;  3KYE A;  4DDS A;  1ES3 A;  2QMI A;  3FKW A;  2XFS A;  4ZJ1 A;  2XA7 M;  1LT0 A;  4R4S A;  1ZTU A;  1WYB A;  5M1A A;  1K54 C;  2IA2 A;  3WS5 A;  4X69 A;  5HZH A;  1ERO A;  4MN7 A;  4E3J A;  3IHB A;  2PYR A;  3ZG9 B;  5JYP A;  3CLO A;  4WEJ A;  1JTD A;  4JGR A;  3LEQ A;  3LO7 A;  3UDF A;  2Z2L B;  1XFQ A;  2ZOI A;  3S22 A;  3C7U A;  5IHV A;  5HL1 A;  3HLC A;  5FAO A;  3UNW A;  1PZP A;  1YM1 A;  5F82 A;  4E04 A;  2R9W A;  3Q1F A;  3HVF A;  1FR6 A;  4NXB A;  2W0N A;  3TE8 A;  3VE3 A;  3G2Z A;  4KUK A;  5HAP A;  2WK0 A;  5EOE A;  4JXW A;  4G3W A;  1CI8 A;  4HBT A;  4PPR A;  4UA9 A;  3LR0 A;  4EBP A;  3VP3 A;  5CXW A;  5E2G A;  4WZ5 A;  5DTK A;  3IWQ A;  3VMA A;  1N4O A;  4BD0 A;  5L10 A;  4EES A;  3QP1 A;  5HL6 A;  3IF5 A;  4E6W A;  3N8L A;  3T4J A;  4R4R A;  3BEB A;  4WZ4 A;  1IYO A;  2BLS A;  1BLC A;  2V1B A;  1YSQ A;  5TBM A;  1P97 A;  2J7V A;  3S7N A;  1S6R A;  5HX9 A;  4IHQ A;  4BJP A;  2ZMF A;  1GHI A;  3C38 A;  5FI7 A;  2PR5 A;  2IWB A;  1N9B A;  2V2F F;  2PR6 A;  1PI4 A;  3MFD A;  1E3U D;  2OWH A;  3LYX A;  4FH4 A;  2PYP A;  3NOU C;  1G68 A;  5FQ9 A;  4FH2 A;  1XKZ A;  1IKI A;  3KSH A;  2GX5 A;  5KMW A;  2JCH A;  3MQ0 A;  1S67 L;  1ALQ A;  5FDH A;  2M7V A;  5E2E A;  3PHY A;  5M18 A;  2A24 A;  3A3J A;  1S1Z A;  3UDX A;  3LIE A;  1S0W A;  4P6B A;  1SHV A;  3GRJ A;  1NRJ A;  3PTE A;  3H7W A;  4OLD A;  1FSY A;  1C3B A;  5KSH A;  1JTG A;  2PU2 A;  3TW8 A;  1XJ3 A;  1D7E A;  3ZG5 A;  4BLM A;  1SKO B;  1CK3 A;  1E3U A;  3UB8 A;  5EVI D;  2HDS A;  3T1X A;  3PBN A;  2HP5 A;  3A0V A;  2HDQ A;  3Q82 A;  1NZO A;  3OPR A;  4ZAM A;  3IX8 A;  3UE0 A;  3PBO A;  4FUW A;  1GA0 A;  2Q9M A;  4X6T A;  4LFU A;  1FCN A;  4QWO A;  5A92 A;  4S2N C;  1VEU B;  1G6A A;  3UB9 A;  4ZJ3 A;  4PM8 A;  4BQM A;  3IS2 B;  3MKE A;  4Y0U A;  3UPP A;  2L4R A;  4BBU A;  4WUJ A;  3EGX C;  2BTF P;  5EPH A;  4L0L A;  5L8M A;  1O7E A;  4EQI A;  4KZ8 A;  4KZ6 A;  3HL9 A;  3R7W B;  4KZ9 A;  1GHM A;  4XT2 B;  5EVI A;  4KZ4 A;  3IF6 A;  1BLS A;  1XP4 A;  4JXV A;  3QP5 A;  4LCL A;  3BFC A;  3N8R A;  4S2P A;  3KX0 X;  4Y7P A;  2PBY A;  2OLU A;  1G6O A;  4Z1W A;  1SZV A;  4HES A;  2B02 A;  2HPB A;  2W1R A;  2ZD8 A;  4NXF A;  3BW6 A;  1TS7 A;  2H0Y A;  1PIO A;  4MCW A;  2XQZ A;  5AQ7 A;  1S4S A;  5CX7 A;  4U0T A;  2V0W A;  4GZB A;  5HAQ A;  4HJ6 A;  3SH8 A;  3T4L A;  4R38 A;  1MZU A;  3UME A;  1XFN A;  5DJT A;  4IED A;  1YPR A;  3DAV A;  5HPF A;  2ZQA A;  2WZX A;  3NBL A;  2AVX A;  3OOV A;  3EEA A;  3LUQ A;  3ICY A;  4KEN B;  3C7V A;  1T18 A;  1K55 C;  5BOH A;  3T1S A;  4YNR A;  4NK3 A;  5LBR A;  4B88 A;  2P04 A;  5F6A A;  5AVF A;  3Q7V A;  4QB8 A;  1WE4 A;  5E43 A;  3O86 A;  4OQI A;  2OAQ 1;  5L07 A;  3CPT A;  4DF6 A;  1TDL A;  3DBA A;  2FFF B;  2YKH A;  3QP4 A;  2H28 A;  3RTY A;  5EM1 A;  2WYX A;  1YSP A;  3P01 A;  3VP1 A;  3CUE A;  1W63 Q;  3ZVW A;  4BBT A;  3QP8 A;  4MMN A;  3K2N A;  4NXG A;  4DE3 A;  1PRQ A;  5HWT A;  2L1M A;  3D3O A;  1XXM A;  1PWD A;  3C4O A;  2WKE A;  4OPY A;  2QPN A;  4HY8 A;  3SS3 A;  2JKG A;  1P0Z A;  1ZKJ A;  5DVA A;  3CI6 A;  5CGS A;  5EVL A;  5HPI A;  1FSW A;  4P85 A;  2OLV A;  2JHE A;  5G4Z A;  3IQA A;  3O5Y A;  3T4O A;  1OT9 A;  3BFF A;  4N9K A;  2WKQ A;  5FL3 A;  1FCM A;  3BLS A;  4I3I A;  1X0O A;  1STZ A;  2XD1 A;  4DJ3 A;  1FR1 A;  3K3C A;  3CIT A;  5TGF A;  3NCK A;  4ME4 A;  3BQ8 A;  3MZD A;  3FWL A;  3GQZ A;  3P09 A;  1IYS A;  1YKD A;  4E3L A;  1BUL A;  2Y2M A;  2FFY A;  4L9G A;  4QJG A;  4U3T A;  2Y55 A;  1JWZ A;  1K4E A;  3SH7 A;  3VOL A;  2P7J A;  4L9F A;  4R3A A;  3G4P A;  2V8F A;  3LGO A;  3UB7 A;  5DF9 A;  2A3U A;  4OQH A;  2XLN A;  4JBF A;  1V9Y A;  5EUA A;  2GNX A;  3OPP A;  4OOY A;  4HH3 A;  4S2O A;  1W8Y A;  2O0Y A;  1LLB A;  2ZQ9 A;  2EWW A;  1GA9 A;  2R78 A;  2VGK A;  4QY6 A;  1IEL A;  1SKO A;  4PAU A;  2GJ3 A;  3ZNT A;  3F1O A;  4ESP A;  3KYQ A;  4OPQ A;  5DTS A;  1LL5 A;  3LIA A;  2Z6C A;  3IBR A;  1ERM A;  2W3E A;  3HBR A;  4KZB A;  3ZG0 A;  3IH8 A;  3PBQ A;  4Y2F A;  1GSV A;  3MJQ A;  3HCY A;  5CGW A;  2Y2L A;  1JWV A;  1DJA A;  1UWP X;  3GTC A;  4JGO A;  3KYZ A;  4S2I A;  5CHU A;  3TG9 A;  4Z9Q A;  4JF6 A;  3MKF A;  3LR3 A;  4P0M A;  4ZTK A;  4N92 A;  1ES4 A;  3IS2 A;  3W4Q A;  4GHI B;  4NET A;  4EU0 A;  3M2J A;  4E3K A;  1LHY A;  4OPR A;  1XGI A;  5HD3 A;  2ZM8 A;  4CLC B;  1VHM A;  3C8C A;  1LI9 A;  3MFX A;  2BG1 A;  2ZBB A;  1F5M A;  2O9B A;  3ZVT A;  1QMF A;  3IH9 A;  2O99 A;  2GZA A;  2C6W B;  3F1N B;  2WKP A;  4HBU A;  5IU1 A;  4M3K A;  2XD5 A;  1ZHH B;  5DTT A;  5KSC A;  1KGE A;  1MWU A;  4EUZ A;  1QME A;  4HP9 A;  5GHX A;  5HD5 A;  4RQ9 A;  1HTZ A;  3B42 A;  5HDD A;  1W8Q A;  4KQR A;  4XXR A;  1PZO A;  2JBF A;  3CAX A;  3JYI A;  2PHY A;  1VET A;  4LCM A;  1K57 C;  4Y15 A;  1PWG A;  2WKH A;  1DY6 A;  4KG5 A;  1YQS A;  4EQ1 A;  4P6Z S;  5D3O A;  5F1F A;  3T4S A;  4BL2 A;  3PBR A;  1RCJ A;  3P98 A;  1K6S A;  3WS4 A;  3OCN A;  3I7J A;  2I9V A;  3QNB A;  3C5A A;  1E4D A;  1K25 A;  2HV1 A;  2W3D A;  3OPH A;  1HZO A;  3W4P A;  2VZW A;  3MXQ A;  4S2L A;  3R4K A;  2IWC A;  3DWK A;  3OPL A;  5EVE A;  4DN0 A;  3HLG A;  3CG5 A;  1Y4O A;  4JXS A;  4ZRR A;  4MNR A;  3C30 A;  4LV3 A;  3MSH A;  4Y0O A;  3VFH A;  3G30 A;  4NKP A;  2Y2H A;  1DP6 A;  2QJ5 A;  1O07 A;  1JNU A;  3S7P A;  2ZL1 B;  3MR0 A;  2I72 A;  2J3T D;  4UQI M;  5HW3 A;  3MXR A;  4II7 A;  1YMX A;  3T1R A;  4JLF A;  5GLD A;  5AVE A;  1Y28 A;  2ZQC A;  5J4E A;  3DTI A;  2W1T B;  5DF7 A;  2UWX A;  1J3W A;  2VV7 A;  1W7F A;  5CHJ A;  5FAT A;  1ES5 A;  1JWP A;  3W8K A;  3LEZ A;  3E4P A;  4ETX A;  5DF8 A;  3RFB A;  5GL9 A;  3VFF A;  3B3X A;  2ZC7 A;  2V9A A;  3ZG8 B;  4EXO A;  4OOM A;  2ZJ9 A;  2X01 A;  1OTD A;  4HQA A;  3M2K A;  3EWK A;  1KDW A;  3NC8 A;  2DCF A;  1M6K A;  3G34 A;  1MPL A;  5HAI A;  4R23 A;  4I3A A;  1Q2P A;  3HUN A;  4FSF A;  4Q0J A;  4HIA A;  4U0X A;  1TF1 A;  2FZ0 A;  1MBL A;  4IBR A;  4WZ5 C;  1XA7 A;  2RCX A;  2K2N A;  3NHQ A;  4DXC A;  3T1Q B;  1MWT A;  2JKT I;  2OAP 1;  1JVJ A;  4CLC D;  1YAX A;  3S4X A;  4UAA A;  3UE6 A;  1H8Z A;  4LV2 A;  4IBX A;  1GHP A;  1ZG4 A;  1OTA A;  2D01 A;  1BLP A;  1TS0 A;  3HLW A;  1XX2 A;  2P9V B;  2XA7 S;  3RH8 B;  3IT9 A;  3FV7 A;  1FQG A;  3CZD A;  4KQD A;  1NLY A;  3N4I A;  3BY9 A;  3OC2 A;  3TSG A;  4CQH A;  4PM6 A;  3UPO A;  1OPX A;  2Z6D A;  3T4Q A;  1L0G A;  3F1P B;  4GS9 B;  1S66 L;  4CLC E;  4UHU A;  3SH9 A;  2JKT M;  2VKS A;  2Y4A A;  4GHI A;  4BMW A;  4UQI S;  4EUV A;  5FQI A;  1IYQ A;  2H10 A;  3ISG A;  3KO6 A;  1DP8 A;  4P87 A;  2ZMA A;  3CJM A;  1YMS A;  1YLP A;  2A49 A;  1XJ6 A;  2XK1 A;  5AQB A;  4CLC A;  4QU3 A;  4RX3 A;  4MBK A;  4LRY C;  3BM6 A;  2OWJ A;  3MQQ A;  4YIN A;  4BL3 A;  5GLA A;  1DRM A;  4MBH A;  2NUP C;  4GDN A;  1W79 A;  4JF4 A;  1CF0 A;  3EQV A;  3F1N A;  5A91 A;  2JC7 A;  1KGF A;  1BTL A;  2X71 A;  4GOG A;  3S1Y A;  5FAS A;  2EA9 A;  1IFQ A;  1OME A;  5FQQ A;  4DJ2 A;  1DP9 A;  1OTB A;  4KG6 A;  4NEE D;  4DXB A;  5K5B A;  1RP5 A;  1VQQ A;  1S4R A;  2J9P A;  3IXB A;  1K0K A;  2IWD A;  1MY8 A;  2XEP A;  2XRN A;  3HUM A;  3C2W A;  4HJ4 A;  1NLZ A;  2M1C A;  2R9X A;  3DWZ A;  3CWF A;  1TS8 A;  1NYM A;  4BBV A;  3T12 B;  2VV8 A;  2XFT A;  4HJ3 A;  4WL9 A;  3GSG A;  5FEG A;  1T19 A;  1LSW A;  3V50 A;  3LR4 A;  1VB6 A;  4DE2 A;  3KSI A;  1SKF A;  4EWF A;  2GDN A;  4KZ3 A;  3AGE A;  4ZJ2 A;  1MC0 A;  3FKV A;  4X68 A;  2QWS A;  3IBJ A;  3BY8 A;  5F83 A;  4L9E A;  5CEB A;  5G18 A;  3VP0 A;  2W3G A;  2XRO A;  5EVI C;  5FI2 A;  3IF6 C;  3HLE A;  2ZM0 A;  4HP4 A;  2V20 A;  4G3V A;  2FH5 A;  1NWZ A;  3UB5 P;  3UPN A;  4AFI A;  4K0W A;  1H8M A;  2A2L A;  3NDE A;  2INW A;  3V39 A;  1KDS A;  3JVV A;  2ZL1 A;  5L2F A;  2JE5 A;  3HJK A;  5DJU A;  3LIF A;  2WGW B;  3VP2 A;  4IJG A;  3MF0 A;  4QPR A;  4LRZ E;  3ZHH A;  5GHY A;  4MBF A;  4N1H A;  4YOF A;  3PR6 A;  4ZDX A;  1ODV A;  2W3H A;  3N6I A;  3DTM A;  3Q7Z A;  2VGL M;  1CI9 A;  3ZDJ A;  3LI9 A;  2Q0O A;  3SW1 A;  2KX6 A;  4KQO A;  1KVM A;  2YKF A;  1K56 D;  4GD6 A;  1EWZ A;  3IX4 A;  3MQO A;  2Y2Q A;  1S1Y A;  3UE3 A;  2DMW A;  3LIC A;  1XPB A;  3ZFZ A;  2W27 A;  4EER A;  1ONG A;  5TR7 A;  3M6H A;  1FIK A;  2B95 A;  5HSQ A;  1T1B A;  3SS4 A;  4RX2 A;  5TFQ A;  2HZ5 A;  4RA7 A;  2V0U A;  3V5M A;  1KOU A;  2Y2J A;  4E6X A;  3LY3 A;  3A3D A;  3MXS A;  1BSG A;  3EEH A;  3CUE C;  3LIB A;  2PAV P;  2H0T A;  5F5Y A;  3A0S A;  4JPM A;  1K56 A;  3G31 A;  3LID A;  2MJ6 A;  1IEM A;  3A3E A;  2HP9 A;  3M6B A;  5FAQ A;  3BYD A;  1ACF A;  3G6O A;  1LI0 A;  5DKL A;  3ZQ5 A;  2CC1 A;  1NZU A;  2Y2N A;  3GEC A;  2PRF A;  1ERQ A;  3NUL A;  3IHA A;  1PI5 A;  3RXW A;  4YFM A;  4I5S A;  2JKF A;  4OLG A;  1MKI A;  2Z2M B;  4PM7 A;  5J8X A;  3ZCZ A;  3EOI A;  3G35 A;  3IX3 A;  4GS9 A;  1TEM A;  1MWS A;  1HD8 A;  3NY4 A;  2HGV A;  2EXB A;  4N1X A;  5TBM B;  4HI4 A;  1CEG A;  2Y2O A;  2D02 A;  4R3B A;  4LV0 A;  5FDS A;  3CMZ A;  2WAF A;  3MZF A;  3AGD A;  5AJG A;  5HDS A;  1UGU A;  1TS6 A;  4PM9 A;  5A90 A;  5KIZ A;  3L9K A;  5F68 A;  3HRE A;  1H3Q A;  4HH2 A;  2KOI A;  1I2W A;  3SS5 A;  3DTE A;  4EBL A;  4MEZ A;  4FCF A;  1RGZ A;  1W5D A;  4YWZ A;  1VEU A;  4RVA A;  3VSK A;  4LRX C;  4WMC D;  1PW1 A;  4GDB A;  3LR5 A;  4WEK A;  4BEN A;  5CTN A;  2WGV A;  3VSL A;  2HJE A;  2A24 B;  4B4Z A;  3LI8 A;  4X1L A;  3UN7 A;  4GB7 A;  3R7W A;  3ULF A;  4XT2 A;  2ZC5 B;  4CJN A;  3JVU A;  4R1G A;  2M7U A;  2ZQD A;  3MZE A;  1WYC A;  2WGI A;  1OT6 A;  4KZA A;  3N8S A;  1BUE A;  1H8Y A;  1EI5 A;  5TJJ A;  3PXP A;  5GLB A;  2B18 A;  4RYE A;  4WMC A;  3QP6 A;  5DFX A;  1AXB A;  2HF6 A;  1ESU A;  4EW7 A;  1MWR A;  3B33 A;  2XR0 A;  2EWV A;  4WYY A;  3IWI A;  2Y2I A;  2WAE A;  1F2K A;  5HFO A;  2G7U A;  3K3D A;  1YLY A;  5E2F A;  3FPV A;  4GN2 A;  5FI6 A;  1CJF A;  1XGJ A;  1IYP A;  2WGW A;  5EV0 A;  1GSW A;  4WLA A;  4O7D A;  2EX6 A;  1Z6F A;  3ITB A;  5GLC A;  1YLZ A;  5EVI B;  2WKI A;  2HP6 A;  1WA9 A;  3ZNY A;  4UA7 A;  1K54 A;  2PBD P;  3BFD A;  3ITA A;  3CHW P;  4D2O A;  3DTK A;  3UB6 A;  4KUO A;  1A0K A;  3GMW A;  1ESI A;  3FC7 A;  4MN6 A;  2EFX A;  3QNC A;  4OQG A;  4GJ4 A;  3PAG A;  4C75 A;  3D72 A;  1PWC A;  1MKM A;  1KE4 A;  4GKU A;  4K91 A;  2Y8H A;  1D1J A;  2EX2 A;  4OQ0 A;  3O3V A;  3WS0 A;  2PD8 A;  2ZOH A;  5E2H A;  2EX9 A;  5CER A;  3UMD A;  3PYP A;  4E3M A;  4GLQ A;  3UO9 A;  5CED A;  2DNS A;  5FSR A;  4WBG A;  4I38 A;  3BJN A;  1I2S A;  4ARZ B;  3Q81 A;  4JXG A;  4B93 A;  2Y2P A;  4ZBE A;  4FTX A;  4LGW A;  4IUK A;  3UDI A;  4H6J B;  1U60 A;  2XSS A;  1J9M A;  1K6R A;  3VE4 A;  3HLF A;  1HLU P;  3S7Q A;  3GV9 A;  3Q7V B;  3BFE A;  5CTM A;  4E3N A;  5F1G A;  3CPT B;  3HLD A;  5CGX A;  4S2M A;  4KZ5 A;  1KVL A;  3ZYT A;  2J9O A;  4I3J A;  1PNE A;  3LY4 A;  1TD5 A;  3V3S A;  2EFU A;  2PT7 A;  3SZT A;  3VOZ A;  1SCW A;  3T4K A;  5A8B A;  1XA1 A;  2V8C A;  4OKP A;  3PAE A;  4EEP A;  3ZG7 B;  2J8Y A;  1IKG A;  3PBT A;  4KG2 A;  2VV6 A;  4HNB A;  5G4Y A;  2ZQ7 A;  2NUT C;  2J3T C;  4UEY A;  3MBZ A;  1NY0 A;  1CEF A;  4LV1 A;  1Y54 A;  3TRC A;  3V67 A;  4Q0I A;  5KZH A;  3S7O A;  4GCZ A;  3E98 A;  4UA6 A;  1KE3 A;  4R6L A;  3BFG A;  3WS1 A;  2J80 A;  3VOY A;  1P9R A;  4EEU A;  1RGY A;  1YLW A;  1G5U A;  3L7H A;  1F98 A;  1KGG A;  3MS6 A;  4DMZ A;  2ACG A;  3ZGA B;  4C6Y A;  4K0X A;  1CQA A;  4OH0 A;  4DE0 A;  2QYB A;  4BD1 A;  1Z09 A;  4F3L B;  3RJU A;  1PFL A;  3W4O A;  3G32 A;  4O0P A;  4A5R A;  1OTE A;  4KQQ A;  2E8I A;  2W3F A;  2ZM2 A;  4PHT A;  3GDI A;  1SDE A;  2PD7 A;  3H9W A;  3BLM A;  5IT5 A;  5J7E A;  3IXD A;  2ZC3 B;  1AWI A;  3OBF A;  4LEN A;  2Y59 A;  4S2N A;  5HDC A;  4JGP A;  3F1O B;  4GD8 A;  4QHC A;  2C5W B;  5CEC A;  2QZ6 A;  3QHY A;  1FCO A;  4CLC C;  4NG2 A;  1LL8 A;  3EGD C;  3VP4 A;  1OJG A;  1KE0 A;  3GVB A;  4Y17 A;  2G2U A;  3NIA A;  5L09 A;  1ONH A;  3A3F A;  2EX8 A;  4OON A;  2V1Z A;  4QY5 A;  1OTI A;  3IWO A;  4LPZ A;  1XJ2 A;  2ZQ8 A;  3PBS A;  2CMN A;  4IUH A;  1E25 A;  1NRF A;  1L3L A;  3C4P A;  4R0Q A;  3V3R A;  4GNU A;  2L0W A;  2KLI A;  4X55 A;  1SDN A;  4OP5 A;  2VGJ A;  4XUX A;  4Q0H A;  3T4T A;  5EFW A;  1L0E A;  3G2Y A;  5MC7 A;  1NXY A;  1T1C A;  3UY6 A;  2Y79 A;  4CPK A;  1FIL A;  1IOU A;  3D4F A;  1HVB A;  3W2Z A;  5I94 A;  3HLB A;  3KSF A;  2B5R A;  4X53 A;  4OOL A;  4R3J A;  4E3O A;  1LSX A;  2KDK A;  3GR2 A;  4HHD A;  4Q8I A;  4X56 A;  2VX8 A;  4DRT A;  4OP8 A;  1GCE A;  1PYY A;  3H82 B;  1VET B;  4E3I A;  1YT4 A;  3Q07 A;  1K55 A;  2HDR A;  4EBN A;  3D9Y A;  1L2S A;  3BRM A;  4MLL A;  4WN5 A;  2E8J A;  2ZMV A;  4BWI A;  2WKR A;  2HJ9 C;  4PKY A;  2W1T A;  2RL3 A;  4MDZ A;  1LL9 A;  3E4Q A;  4ARZ A;  2OOL A;  1W63 M;  1H5X A;  2G2W A;  2QKP A;  3BQA A;  5FAP A;  5FEF A;  1BYW A;  4H6J A;  5EOO A;  2LB9 A;  5F69 A;  2EXA A;  1NYY A;  3B47 A;  3FPW A;  1BT5 A;  5EE8 A;  2HDU A;  3N7W A;  2V1A A;  3LCE A;  3JPU A;  1GSX A;  2JKR I;  3DW0 A;  2K7S A;  4DKI A;  1BZA A;  4PMA A;  4I39 A;  5CHM A;  4G3K A;  5HAR A;  4OPZ A;  5CRF A;  5JYO A;  2K31 A;  3E0Y A;  2XDM A;  2ZLY A;  4IVI A;  2VK3 A;  2O9C A;  1BLH A;  1P9W A;  3LFV A;  2H5S A;  1NJ4 A;  1ZG6 A;  4GW9 A;  5I5L A;  4Y3I A;  4LLO B;  4FD8 A;  4JKT A;  3NEC A;  2JKR M;  4IVK A; 
#chains in the Genus database with same CATH homology
 3R7W B;  4EW7 A;  4NXE A;  4XT2 B;  3NOP C;  3B33 A;  2EWV A;  4FSF A;  5C5K A;  4Q0J A;  4HIA A;  4K08 A;  1TF1 A;  3KX0 X;  2FZ0 A;  2G7U A;  3K3D A;  3NJA A;  3OCL A;  2PDR A;  1G6O A;  3FPV A;  2K2N A;  3NHQ A;  3TJZ C;  4O01 A;  4Z1W A;  2JKT I;  2B02 A;  2OAP 1;  1EW0 A;  4CLC D;  1YAX A;  3F1P A;  2W1R A;  1GSW A;  4WLA A;  3UE6 A;  4F3L A;  1LSV A;  3VV4 A;  4NXF A;  3BW6 A;  1TS7 A;  4O8G A;  1OTA A;  2D01 A;  4MCW A;  1TS0 A;  4MN5 A;  4P6Z M;  4ETZ A;  1S4S A;  5HWW A;  2O9A A;  1WA9 A;  2XA7 S;  5CX7 A;  3RH8 B;  2V0W A;  4HJ6 A;  3T4L A;  4KQD A;  1F9I A;  1MZU A;  1NLY A;  2VGL S;  1XFN A;  4R38 A;  5DJT A;  3U2A A;  3UME A;  2VEA A;  3UB6 A;  3BY9 A;  3OC2 A;  4KUO A;  2P08 A;  5HPF A;  4CQH A;  1OPX A;  2Z6D A;  3FC7 A;  3T4Q A;  4MN6 A;  5DFY A;  3OOV A;  3EEA A;  1OJ5 A;  3T50 A;  3LUQ A;  3F1P B;  3ICY A;  4GS9 B;  1S66 L;  4GJ4 A;  4CLC E;  3D72 A;  2JKT M;  2BAS A;  2VKS A;  4GHI A;  4BMW A;  4UQI S;  1MKM A;  4EUV A;  3KSG A;  1T18 A;  3KO6 A;  1DP8 A;  2Y8H A;  4YNR A;  3P7N A;  1XJ6 A;  4CLC A;  5LBR A;  2P04 A;  5F6A A;  4LRY C;  2PD8 A;  2ZOH A;  4R70 A;  5AVF A;  4PKY G;  3UMD A;  2OWJ A;  2JN7 A;  3PYP A;  2OAQ 1;  4GLQ A;  3MQQ A;  1DRM A;  4I38 A;  2NUP C;  3BJN A;  3DBA A;  4ARZ B;  2YKH A;  4WEL A;  3EQV A;  2H28 A;  3F1N A;  4B93 A;  3H7W B;  3MMH A;  3RTY A;  1YSP A;  3P01 A;  3CUE A;  1W63 Q;  4JGQ A;  2VLG A;  1N9O A;  4IUK A;  4BBT A;  4MMN A;  2EA9 A;  4H6J B;  2XSS A;  3K2N A;  4NXG A;  3OLO A;  1IFQ A;  2LB5 A;  4DJ2 A;  1XJ4 A;  3VE4 A;  1DP9 A;  1OTB A;  4NEE D;  5HWT A;  2L1M A;  3D3O A;  5K5B A;  1S4R A;  4FOF A;  1G28 A;  3S7Q A;  4WF0 A;  4HY8 A;  2XRN A;  5IS1 A;  1P0Z A;  3C2W A;  4HJ4 A;  4Y5F A;  1NLZ A;  2M1C A;  3ZYT A;  3CWF A;  2J3W A;  4I3J A;  1TS8 A;  3E4O A;  4BBV A;  3CI6 A;  1TD5 A;  5HPI A;  2PT7 A;  4B9O A;  2JHE A;  2VV8 A;  4HJ3 A;  3O5Y A;  5G4Z A;  1OT9 A;  3T4O A;  1T1A A;  3BWL A;  4WL9 A;  3T4K A;  5A8B A;  2WKQ A;  4M4X A;  1T19 A;  4EEP A;  1LSW A;  5FL3 A;  4I3I A;  3LR4 A;  1X0O A;  1VB6 A;  1STZ A;  3KSI A;  3PBT A;  4DJ3 A;  4EET B;  2VV6 A;  3K3C A;  4HNB A;  3CIT A;  5G4Y A;  2NUT C;  4ME4 A;  2J3T C;  3BQ8 A;  4UEY A;  5J3W A;  1MC0 A;  3H82 A;  2QWS A;  3IBJ A;  1YKD A;  3BY8 A;  3TRC A;  4L9E A;  3NOT C;  2W3G A;  3V67 A;  2QHK A;  1D06 A;  4L9G A;  4Q0I A;  2XRO A;  3EQU A;  3S7O A;  4GCZ A;  3E98 A;  3VOL A;  2VA0 A;  2P7J A;  4R6L A;  4HP4 A;  4L9F A;  4R3A A;  5DKK A;  4G3V A;  2J80 A;  2FH5 A;  4HOI A;  1NWZ A;  1P9R A;  4EEU A;  1UWN X;  3UB7 A;  1N9L A;  4AFI A;  3A0R A;  5DF9 A;  1H8M A;  3FG8 A;  1V9Y A;  1F98 A;  2A2L A;  2QJ7 A;  2GNX A;  4HH3 A;  2INW A;  1V9Z A;  2O0Y A;  3JVV A;  5HWV A;  2EWW A;  4DMZ A;  3HJK A;  2R78 A;  5DJU A;  3LIF A;  1N9N A;  2VJW A;  3HJI A;  4IJG A;  2QYB A;  3MF0 A;  4LRZ E;  4QPR A;  4F3L B;  4PAU A;  2GJ3 A;  3F1O A;  4YOF A;  2XA7 M;  1LT0 A;  3KYQ A;  3PR6 A;  1ZTU A;  3LIA A;  2Z6C A;  3IBR A;  4O0P A;  1OTE A;  1ODV A;  2W3E A;  2W3H A;  2IA2 A;  2VGL M;  5HZH A;  3PBQ A;  4MN7 A;  4Y2F A;  1GSV A;  2W3F A;  3MJQ A;  3LI9 A;  2PYR A;  4PHT A;  3GDI A;  2PD7 A;  3H9W A;  3CLO A;  3HCY A;  2KX6 A;  3SW1 A;  4WEJ A;  1UWP X;  4JGO A;  4KQO A;  3KYZ A;  5IT5 A;  5J7E A;  2YKF A;  4JGR A;  3OBF A;  1XFQ A;  3LR3 A;  3MQO A;  1S1Y A;  5HDC A;  3UE3 A;  2ZOI A;  4JGP A;  3IS2 A;  4GHI B;  2DMW A;  3F1O B;  3LIC A;  4EU0 A;  2W27 A;  4EER A;  4CLC C;  1LL8 A;  3EGD C;  5HD3 A;  4E04 A;  1OJG A;  4CLC B;  1VHM A;  5HSQ A;  3C8C A;  1T1B A;  3MFX A;  4NXB A;  2W0N A;  2ZBB A;  1F5M A;  3TE8 A;  3VE3 A;  2V0U A;  1KOU A;  2O9B A;  4KUK A;  3EEH A;  2O99 A;  2GZA A;  1OTI A;  4LPZ A;  3CUE C;  3F1N B;  1XJ2 A;  2WKP A;  3LIB A;  3PBS A;  2CMN A;  4G3W A;  5IU1 A;  4IUH A;  5F5Y A;  1ZHH B;  3A0S A;  3LR0 A;  4HP9 A;  5HD5 A;  4RQ9 A;  3LID A;  2MJ6 A;  2L0W A;  2KLI A;  3B42 A;  5HDD A;  4EES A;  5HL6 A;  3G6O A;  3T4J A;  5DKL A;  4Q0H A;  3CAX A;  3ZQ5 A;  3T4T A;  2V1B A;  2PHY A;  1YSQ A;  3GEC A;  5EFW A;  5TBM A;  5MC7 A;  1T1C A;  2Y79 A;  4EQ1 A;  4I5S A;  4P6Z S;  1P97 A;  1IOU A;  3S7N A;  3W2Z A;  3T4S A;  3PBR A;  3KSF A;  4IHQ A;  4OOL A;  2ZMF A;  4BJP A;  3OCN A;  3C38 A;  2PR5 A;  1LSX A;  2KDK A;  2PR6 A;  3EOI A;  2I9V A;  4HHD A;  4GS9 A;  2VX8 A;  2OWH A;  3LYX A;  2PYP A;  2HV1 A;  3NOU C;  2HGV A;  2W3D A;  3H82 B;  2VZW A;  3MXQ A;  5TBM B;  4HI4 A;  3KSH A;  2D02 A;  2GX5 A;  3R4K A;  3MQ0 A;  4WN5 A;  1S67 L;  2ZMV A;  4DN0 A;  5AJG A;  2M7V A;  5HDS A;  4BWI A;  3PHY A;  2WKR A;  2HJ9 C;  4PKY A;  1UGU A;  1TS6 A;  2A24 A;  4ZRR A;  1S1Z A;  2W1T A;  3C30 A;  3LIE A;  4MDZ A;  5KIZ A;  5F68 A;  3E4Q A;  1H3Q A;  4HH2 A;  4ARZ A;  1NRJ A;  4NKP A;  2OOL A;  1W63 M;  2KOI A;  2QKP A;  1DP6 A;  3H7W A;  2QJ5 A;  3BQA A;  5KSH A;  1JNU A;  3S7P A;  1BYW A;  3MR0 A;  1XJ3 A;  1D7E A;  4YWZ A;  3TW8 A;  2J3T D;  4H6J A;  4UQI M;  4LRX C;  4II7 A;  2LB9 A;  3LR5 A;  5F69 A;  3B47 A;  3FPW A;  4WEK A;  3UB8 A;  5AVE A;  1Y28 A;  3PBN A;  5J4E A;  2HJE A;  3A0V A;  2V1A A;  2A24 B;  1GSX A;  2JKR I;  2W1T B;  2K7S A;  3LI8 A;  2VV7 A;  3PBO A;  3R7W A;  3ULF A;  4I39 A;  4XT2 A;  3E4P A;  4ETX A;  3JVU A;  2M7U A;  3RFB A;  4G3K A;  3UB9 A;  2K31 A;  3E0Y A;  2V9A A;  1OT6 A;  4EXO A;  3IS2 B;  4OOM A;  2O9C A;  5TJJ A;  3PXP A;  2L4R A;  4BBU A;  1OTD A;  2B18 A;  1P9W A;  3LFV A;  4HQA A;  4WUJ A;  3EWK A;  3EGX C;  4GW9 A;  5I5L A;  4L0L A;  5L8M A;  4Y3I A;  4LLO B;  4I3A A;  5DFX A;  2JKR M;  2HF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...