3MMHA

X-ray structure of free methionine-r-sulfoxide reductase from neisseria meningitidis in complex with its substrate
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
167
structure length
167
Chain Sequence
MHALHFSASDKAALYREVLPQIESVVADETDWVANLANTAAVLKEAFGWFWVGFYLVDTRSDELVLAPFQGPLACTRIPFGRGVCGQAWAKGGTVVVGDVDAHPDHIACSSLSRSEIVVPLFSDGRCIGVLDADSEHLAQFDETDALYLGELAKILEKRFEASRQAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Methionine-R-sulfoxide reductase
publication title Structural and Biochemical Characterization of Free Methionine-R-sulfoxide Reductase from Neisseria meningitidis.
pubmed doi rcsb
source organism Neisseria meningitidis
total genus 52
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature ec 1.8.4.14: L-methionine (R)-S-oxide reductase.
pdb deposition date 2010-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3mmhA00
3BJNA 4Y3IA 3S7PA 4ZRRA 2O0YA 3KO6A 4LRZE 5L8MA 1YSPA 3K2NA 2O9AA 3OBFA 2O9CA 4MMNA 2W1TA 3NOPC 4CQHA 4FOFA 2O99A 3S7QA 1VHMA 4EU0A 1ZTUA 4G3WA 5HPFA 4Q0HA 1YKDA 2W3HA 4IUHA 2O9BA 3OOVA 5LBRA 4O0PA 2HGVA 2Y8HA 4MN7A 2OOLA 2IA2A 4LRXC 5AJGA 3KSIA 3DBAA 2W3DA 3MMHA 5HPIA 3EEAA 4R70A 2M7UA 2XSSA 2LB9A 4O01A 3TRCA 5HSQA 2VKSA 2W3FA 2G7UA 2KLIA 3IBRA 2KOIA 4YOFA 2Y79A 2W1RA 2M7VA 3C2WA 4EUVA 3E0YA 2VEAA 4ETXA 2W1TB 2W3EA 3NOUC 3KSHA 3MQ0A 4MCWA 2VZWA 4Y5FA 5I5LA 4G3KA 2QYBA 4Q0IA 4IJGA 3ZQ5A 3S7NA 3S7OA 1STZA 4DMZA 2W3GA 3CITA 5K5BA 4Y2FA 4MDZA 3KSFA 1TD5A 4LRYC 3MF0A 1MC0A 4R6LA 3R4KA 4G3VA 2K31A 3G6OA 3NHQA 3RFBA 4GLQA 2GX5A 2K2NA 4ME4A 3O5YA 5DFXA 2LB5A 4E04A 3E98A 4PAUA 3D3OA 3NOTC 1MKMA 2VJWA 3VV4A 1F5MA 4GW9A 4ETZA 3W2ZA 4Z1WA 1TF1A 4RQ9A 4Q0JA 1YSQA 4O8GA 4YNRA 2B18A 3LFVA 4QPRA 3HCYA 3CI6A 3KSGA 2XROA 5TJJA 4IUKA 5HL6A 3IBJA 4DN0A 2ZMFA 5DFYA 4BWIA 5C5KA 2XRNA
chains in the Genus database with same CATH superfamily
2VLGA 3U4LP 4UA6A 2WZXA 3NBLA 1PZPA 4KZBA 4QY6A 2ZM0A 5TBMB 3B47A 4XXRA 2Y2LA 3OOVA 5LBRA 3GR2A 2ZL1B 4OQIA 5HFOA 3A3DA 3MQOA 5HDDA 4KZ4A 3IS2B 4R70A 3PBRA 4GHIA 1QMEA 4BBVA 1IKIA 2OWJA 4IVKA 1TVFA 1BLSA 2KDKA 3G4PA 2HP6A 4ZJ1A 2KOIA 2IWDA 2W1RA 3C4OA 4O7DA 1KVLA 3V3SA 4B93A 3B3XA 3ZNYA 1JWZA 3W8KA 5G4YA 4BQMA 1SZVA 2Y4AA 4OQHA 3OPHA 3ZG9B 4FSFA 1H3QA 2WKHA 3IXGA 2B5RA 4QJGA 4MDZA 5FL3A 3UB9A 2Q9MA 2PBDP 4CPKA 4RVAA 3LR3A 4GLQA 5AVFA 3E4QA 2EXAA 3C7VA 4MN5A 4N1XA 2A24B 3K3DA 4LV2A 3Q7VB 3FG8A 3B42A 3GRJA 3IF5A 2HP5A 1KE0A 3SH8A 3VOLA 3W4OA 3T50A 3Q82A 4PHTA 5EPHA 3ZG0A 4IUKA 4P0MA 4DE2A 3IBJA 4U0TA 1K0KA 2D02A 4HI4A 4KZ8A 5E2GA 4UEYA 2QJ7A 1DP8A 1PW8A 3HLCA 4QD4A 2EFXA 3NULA 5M1AA 3VOZA 3DTIA 1PWDA 4OLGA 5F5YA 3W4QA 4KZ3A 1H8MA 4XUXA 5CEDA 5HW3A 5J7EA 1ES5A 4O0PA 1ZC2A 2HGVA 2OOLA 3ISGA 1S4SA 3MFDA 5J3WA 4HJ6A 4MLLA 1N9LA 3FKVA 1EW0A 2J7VA 3WRTA 3VP1A 3AGDA 3CWFA 2JKTM 1UGUA 4UHUA 4R38A 4MN6A 4P6ZM 4BBUA 4XUZA 2QKPA 3HLGA 3W4PA 3BFGA 4EESA 2KX6A 5FI6A 3NOUC 4OQGA 4R4SA 2V0UA 3LGOA 1K4FA 4Y5FA 4WZ5A 1KDWA 3PBNA 5HD5A 2VV8A 5CTMA 3T4OA 1YLJA 4DRTA 3PBQA 5FAPA 5U47A 5JYPA 2GZAA 1AXBA 2Z6CA 3RFBA 4EW7A 4D2OA 1J9MA 1LL5A 1RGZA 3JVUA 4ME4A 3BM6A 5DFXA 1SKOA 2PT7A 3MXSA 2XA7S 1WYBA 2B95A 1T18A 4EEPA 5M18A 5DF7A 1S0WA 1YT4A 4KUOA 2PR6A 4IHQA 2XQZA 5L10A 1YSQA 2XD1A 4O8GA 1TS8A 2HJEA 3GDIA 4IEDA 2EWWA 4FH2A 4DN0A 3HLEA 4OP8A 3BJNA 3IXHA 4KZ5A 4WN5A 1T1AA 3OBFA 4AFIA 4MMNA 4WUJA 5EVIB 2O99A 3UPNA 4OONA 1TS7A 3R7WB 3VSLA 1CI9A 3GECA 3UDXA 3DAVA 2J80A 4NXFA 5KIZA 1S4RA 2H0TA 2WKEA 4X1LA 2XH9A 1N4OA 2PRFA 4O01A 4HESA 4GZBA 1O7EA 5EM0A 4WZ5C 1GSVA 4YOFA 4ESPA 2A3UA 3T4TA 1JWPA 1FQGA 4EWFA 3MFXA 1I5QA 3CMZA 2Y2JA 3BRMA 5FQMA 4M4XA 5EVIA 3LIEA 4IJGA 4UQIS 3R7WA 3LEZA 3WRZA 3FZCA 3BYDA 4KQOA 3MBZA 5FASA 5K5BA 3PYPA 4DJ3A 3PBSA 1PIOA 4MBKA 3KSFA 5FI7A 2XDMA 1FSYA 2XEPA 4G3VA 3EEHA 2V8CA 5AQ9A 1P0ZA 2W0NA 1KGFA 3A3IA 2D01A 3UE1A 1KDSA 5DTTA 1TEMA 2YKHA 3FPWA 4EQ1A 3KYQA 5A92A 4E3OA 2DNSA 3F1PB 4L0LA 3HVFA 2Y2PA 4E3LA 1LL8A 4GJ4A 5E43A 4ZTKA 5DTSA 1T1BA 2MJ6A 3LICA 4BWIA 5C5KA 3MZEA 3BY8A 4OH0A 2OLVA 1NRFA 1K38A 3G35A 3VP3A 3FKWA 2RCXA 5GHYA 2ZQAA 5FEGA 3EQUA 4GOGA 1W79A 1GCEA 1S67L 2J9OA 4XT2B 2W3DA 5CGXA 2R9XA 1U60A 4I3AA 3T1XA 5EVIC 3AGEA 1YPRA 1Z09A 4E3KA 3A3JA 1EWZA 1G6OA 2M7VA 5DF9A 4C6YA 2JCHA 3IF6B 4HBUA 2PBYA 1TS0A 4H8RA 2H5SA 1XP4A 2V1BA 1ZG6A 3V3RA 3F1NB 4C3QA 2W3GA 3T1RA 3IH8A 1J3WA 4Y0TA 4HIAA 2HDUA 4R3BA 4HBTA 1I2SA 2OWHA 4HEFA 3NCKA 4U3TA 2CC1A 3T4LA 1M6KA 4ETZA 4K0WA 3L7HA 2WGWA 2ZM2A 4Z1WA 2L4RA 1TF1A 3LR5A 3OPRA 3OC2A 3LR4A 4BD0A 4KZAA 1ES2A 1IYQA 1KE4A 2NUPC 2WKRA 2XGNA 2P04A 2OV5A 2QZ6A 1PRQA 3VFHA 4P85A 1YLZA 3A0RA 5L8MA 1ES3A 1LI0A 1YSPA 5HWTA 1E3UD 4K08A 2J3TD 4PKYA 5F82A 3CUEA 3UB8A 2O9CA 2V1AA 1K57A 4JGRA 3IXBA 2W3HA 2XFSA 2ZBBA 2Z2LB 3M2KA 5HAQA 4OP5A 3BY9A 4GS9A 5HZHA 1BLHA 4BENA 4S2IA 1VB6A 4Y17A 5FQQA 4U0XA 2V20A 4ZJ2A 3E4OA 1WE4A 4S2MA 3T12B 3C5AA 2VX8A 3KSHA 4YWZA 3IX8A 4OKPA 3C7UA 4RX2A 1M40A 4R3JA 3WS1A 3C38A 3PAEA 2PD8A 1JWVA 4EQIA 3CLOA 2YKFA 3SS5A 1MC0A 1AWIA 3LCEA 3T4KA 3UE0A 3T1QB 4X53A 2WKPA 5CHMA 3IWQA 5F1GA 4NG2A 3A0SA 4RQ9A 1H0MA 2WKQA 4QPRA 5FDSA 3PHYA 3CUEC 1Z6FA 2XROA 5HL6A 4ID4A 5J8XA 2PHYA 1K57C 4CLCD 3MR0A 4UA9A 1PW1A 3HUNA 3KO6A 1PYYA 3IWOA 4P6BA 2QPNA 4FUWA 3DTEA 2Z6DA 3F1OB 3G34A 5HAIA 1YKDA 5KSHA 4FH4A 4BD1A 3LIBA 2Y8HA 2XLNA 4CJNA 3CZDA 3ZG7B 4DF6A 3N6IA 1MWTA 2HV1A 2EXBA 2W3FA 1OJGA 2QMIA 3FYZA 3T4JA 1JTDA 2Q9NA 3B33A 1X0OA 4BL2A 4R23A 2WGVA 4X56A 1NZUA 3SZTA 1CI8A 2L1MA 2XK1A 1OT9A 1IELA 1CJFA 2PR5A 2XA7M 4FD8A 4DXBA 3LI8A 2HZ5A 4OPQA 2WK0A 5I5LA 3D72A 1XFQA 4N9KA 1A0KA 4NEED 3NJAA 4LV0A 3CITA 2P9VA 1BULA 4DJ2A 2JKFA 3SS4A 3ZHHA 3VP4A 5CEBA 4JXGA 4KQDA 2G2WA 1WA9A 4QB8A 5L07A 1FR6A 5TBMA 1F98A 5E2EA 3QP1A 2ZL1A 2XD5A 1XFNA 3IS2A 1L0GA 3N7WA 1XPBA 4DE0A 2NUTC 5CECA 1LSWA 4HH2A 2XRNA 2ZQDA 5E2HA 4E6WA 1OTAA 3Q07A 1S6RA 1OPXA 3S22A 2ZOHA 3H9WA 1NYMA 3UPOA 5FA7A 1VETB 2QWSA 3OPPA 5FSRA 3JVVA 4S2PA 4LLOB 4MN7A 4LFUA 3KSIA 2HDRA 5GLAA 5FQ9A 2Y2KA 4UQIM 4EV4A 5CRFA 5HSQA 4PM9A 2Y2NA 1OTBA 1MWUA 3N8LA 2DCFA 2Y79A 3T4SA 4EBLA 2UV0E 1LSVA 5F6AA 2A24A 5IS1A 1TDLA 1ES4A 3Q7VA 3TE8A 1W63M 4RA7A 3WS5A 3KYEA 1D7EA 4MCWA 3LIDA 3DTKA 1S1YA 5GLDA 1BZAA 2DRWA 4JF5A 4Y15A 4K91A 4JLFA 2RL3A 1GSXA 2Y55A 3P01A 3L9KA 1PI4A 1NJ4A 2H10A 2EX2A 3RXWA 4Y2FA 3Q81A 2J3WA 2ZC7A 5D3OA 1FSWA 5AQ7A 4DDSA 4B88A 5FDHA 3TW8A 3A3FA 2X71A 4F3LB 1PWCA 4PAUA 4M3KA 3NOTC 4BL3A 4KZ6A 1ODVA 1EROA 1F5MA 3LR0A 3VE3A 2GJ3A 3N4IA 4LV3A 4YNRA 1LSXA 2B18A 3K3CA 3IH9A 1YM1A 2ZM8A 2ZMFA 4OPZA 3V5MA 3PTEA 4N92A 3G31A 3AGFA 5TFQA 3S7PA 5DF8A 2V9AA 3HUOA 4P87A 3G32A 2A49A 1LI9A 3VP0A 3H82B 1RGYA 4R0QA 4WEKA 4NETA 5CERA 3GTCA 1H5XA 3BLMA 3HLFA 5GHZA 2WGIA 3ZG5A 4D60A 3DW0A 3MJQA 4MEZA 3UPPA 4JF6A 4NXBA 1SDEA 1DY6A 1XA7A 2W3EA 1L0DA 3LIFA 1VEUB 2JKRI 3T1SA 3ITAA 4KG5A 1D1JA 4C75A 3SW1A 1PFLA 4DMZA 3HUMA 1ALQA 4PPRA 3UY6A 5FQJA 5GLBA 3WS2A 4L9FA 4ZAMA 4KQQA 3MZFA 3RH8B 3O5YA 4DKIA 4EBPA 1XGIA 2C5WB 3MKEA 5CGSA 2INWA 4WELA 4WL9A 2Y91A 1NRJA 3LIAA 5AVEA 2XFTA 3ZGAB 4JXSA 4OOLA 1PNEA 3Q7ZA 1K56A 4RYEA 5DFYA 2BLSA 3HLBA 3MKFA 4E3NA 1RCJA 1FIKA 1FILA 1GHMA 5DVAA 4KQRA 1MBLA 1XGJA 3NDEA 4CQHA 1LL9A 1HZOA 4EU0A 1ZKJA 1UWNX 4BLMA 4HJ4A 3H7WB 4IUHA 4S2OA 4WZ4A 2VK3A 5CHUA 1N9BA 5F83A 3EEAA 2ZQCA 4QHCA 3PBTA 2XSSA 2ZMAA 4F94A 2ZD8A 1G5UA 2VKSA 4GD6A 2VGJA 2BG1A 1YQSA 3QP2A 4PMAA 5DJUA 1VM1A 4LENA 1GSWA 2V8FA 2HPBA 1K54A 4UAAA 3SH9A 3F1PA 4L9GA 5L09A 4JGPA 1KE3A 2JC7A 3O3VA 4UA7A 4Y7PA 1W63Q 5HD3A 4JKTA 3NHQA 4ARZB 2GX5A 1DJBA 3WS0A 4R4RA 3E98A 4R3AA 1YAXA 2Z2MB 2HDQA 4GW9A 4X1MA 2V1ZA 1T19A 3TSGA 3RJUA 3MXQA 5EE8A 5EFWA 4XT2A 3UMEA 4Q0JA 3ULFA 4JBFA 1MXOA 5A8BA 3CI6A 1PZOA 4IVIA 2A2LA 3CPTB 4GCZA 4PM6A 1YMSA 5FQKA 4Y3IA 2O0YA 2P74A 5TR7A 5FEFA 4GNUA 3K2NA 2Y2MA 4H6JB 5F68A 3NOPC 1VHMA 3IF6A 3IX4A 2VA0A 4OVDA 2M1CA 2JHEA 3UB6A 3VMAA 3LEQA 5FI2A 3DBAA 2PYRA 3F1NA 1SCWA 2M7UA 4OLDA 3TRCA 1Y4OA 1K54C 1NXYA 3UMDA 5A91A 3C2WA 4HH3A 2W1TB 3N8SA 3IHBA 2EX8A 4H6JA 3BECA 2OAP1 3HL9A 2P7JA 1D06A 4GB7A 4II7A 4KENB 3JPUA 1NY0A 3G30A 4E6XA 1IFQA 5KMWA 3NY4A 4R1GA 4QU3A 2FFYA 3MSHA 1DP9A 2VGLM 4A5RA 5HWWA 5CTNA 2VV7A 5IHVA 1FCMA 5G18A 1FR1A 4BBTA 2PAVP 3JYIA 1SKFA 3KSGA 1DJCA 5TJJA 2JE5A 3IF6C 2OSUA 3LY3A 2JKTI 1LHYA 3O86A 5DTKA 5CXWA 2FH5A 5CHJA 1I2WA 2IWBA 3PR6A 1BUEA 4NXGA 5HPFA 1TS6A 1JTGA 5EVID 5M19A 2I9VA 3E4PA 1FCOA 4K0XA 3SH7A 4PM8A 3VFFA 1WYCA 2ZC6B 2G7UA 1K56D 3BFFA 1L2SA 3IBRA 1T1CA 2OLUA 3VSKA 2HP9A 4KG6A 4B9OA 2Y2GA 5CX7A 3NECA 4ETXA 3KYZA 1CQAA 3ICYA 1O07A 2CMNA 3VP2A 1BLPA 1ONHA 3HBRA 4WYYA 1S1ZA 2H28A 5G4ZA 2QYBA 4BMWA 1N9OA 4HOIA 2E8IA 1Y54A 4Y13A 4GD8A 3O87A 3ZNTA 4GHIB 3BQAA 2ZJ9A 1CK3A 1ONGA 2XF3A 4R6LA 1NYYA 3OCLA 2WYXA 1BLCA 4LPZA 3RXXA 3UO9A 4EUZA 1MKIA 2Y2QA 2C6WB 4WBGA 1XXMA 1W8YA 3F1OA 3UE3A 2EFUA 4I39A 1G28A 3SOIA 3LFVA 1MPLA 1XKZA 3M6BA 1F2KA 4QY5A 1XA1A 1XX2A 1S66L 4LV1A 3UDIA 3DWZA 1L0FA 5DKKA 1DRMA 4OQ0A 3ITBA 5CGWA 1FCNA 1MY8A 2JBFA 3HLDA 2AVXA 5GHXA 4WMCA 3UN7A 4OPRA 1DP6A 3IT9A 3FWLA 3MMHA 4ZDXA 3SS3A 2WKIA 2VGLS 4X68A 5KSCA 5HL1A 3ZDJA 5J4EA 4JGQA 5EECA 4DE1A 4I3IA 1KGEA 3BW6A 4EUVA 3GV9A 1JNUA 4QWOA 1ERQA 2WADA 3G2ZA 3M6HA 4G3KA 3GMWA 4OOMA 3BFCA 3ZQ5A 1P9RA 1FOFA 5EVLA 1ZG4A 4JXVA 3RTYA 1Q2QA 4HQAA 3EOIA 2ZQ8A 3MF0A 4E3JA 3N8RA 1OTDA 2J9PA 2ZC4B 2EX6A 5TGFA 5EUAA 4E04A 2G2UA 4B4ZA 1VETA 3D3OA 1XJ2A 3QNCA 3MXRA 1SHVA 4EEUA 4HP9A 3IWIA 2ZC3B 1BT5A 4KUKA 3IQAA 1K55A 1G6AA 2GNXA 3C4PA 3S4XA 3MQQA 1SKOB 1IOUA 4HJ3A 2EX9A 4FOFA 2JN7A 3NI9A 1MWRA 1H8YA 4DXCA 2Q0OA 2O9BA 2XR0A 5GLCA 3DWKA 4GDBA 1ACFA 3S1YA 5EOEA 2E8JA 2LB9A 3UB7A 3P98A 4JF4A 1H8ZA 2DMWA 2EA9A 3V50A 4LCMA 5HARA 2VGKA 1E25A 5EM1A 4F3LA 1E3UA 1NWZA 1MWSA 3MQ0A 4HHDA 1BSGA 4S2NA 1IYSA 5HWVA 3UDFA 3CHWP 3OLOA 4S2LA 1HVBA 3NC8A 2VV6A 2ZMVA 3S7OA 1STZA 5I94A 1F9IA 1JVJA 3G2YA 1HD8A 3FPVA 4X6TA 2K7SA 1KOUA 1NLYA 3LO7A 1BYWA 1C3BA 4I5SA 3QHYA 4GDNA 1K6RA 3VV4A 1K55C 3TJZC 3NDGA 3H82A 3GVBA 1BTLA 3OZHA 3C8CA 1ZHHB 4FCFA 4ZJ3A 2EWVA 4CLCB 1HTZA 2OAQ1 3UB5P 2H0YA 4ZRRA 1CEFA 4LRZE 2PU2A 1VQQA 4GKUA 5EVEA 3WS4A 4EXOA 4CLCE 3TG9A 1TDGA 1ZTUA 1Y28A 4G3WA 1VEUA 3HLWA 2Y59A 1IYPA 2ZLYA 4NK3A 3WWXA 1V9ZA 2J3TC 5EOOA 1YLPA 3OPLA 2WAFA 2ZC5B 4WLAA 3P7NA 4CLCA 4S2NC 4ZBEA 2PD7A 2W27A 1P9WA 5A90A 4I3JA 2PU4A 3HREA 5HDSA 2X02A 5E2FA 5JYOA 3IXDA 4DE3A 1P97A 4HNBA 1ESIA 3QP8A 4WMCD 1KVMA 3QP5A 1L3LA 3S7NA 4BJPA 1K4EA 4JPMA 4P6ZS 1IKGA 4HP4A 4PM7A 3QP4A 2K31A 2L0WA 2K2NA 2ACGA 3IX3A 1XJ3A 3VE4A 3QNBA 4FTXA 1GA9A 5IT5A 3BEBA 3MS6A 2QHKA 4WM9A 3NIAA 1MKMA 3EGDC 2HF6A 5IU1A 1UWPX 2Y2OA 4JXWA 2HDSA 2ZQ9A 3H7WA 1YMXA 3ZVWA 2WUQA 3V39A 2WAEA 1SDNA 4EBNA 5AQAA 3PAGA 4KG2A 3UNWA 4KZ7A 2X01A 1YLWA 1K6SA 3V67A 3A0VA 4NXEA 4JGOA 3I7JA 5HDCA 3O88A 3Q1FA 1RP5A 3PBOA 1GHIA 1GA0A 1ERMA 2UWXA 3M2JA 3S7QA 3LY4A 1OJ5A 1PI5A 4CLCC 2WGWB 4B4XA 2IWCA 3E2KA 3BWLA 2V2FF 5L2FA 4LRXC 5AJGA 1W7FA 4I38A 1GHPA 4Y0UA 1V9YA 2ZQ7A 3ZG8B 1CEGA 3BFDA 4E3MA 1IEMA 4X55A 2GDNA 4KZ9A 5FAOA 1CF0A 4ARZA 4N9LA 3FC7A 5GL9A 3BLSA 1NLZA 2R9WA 2JKGA 3ZFZA 1ESUA 5F69A 5HX9A 3D9YA 2Y2IA 2VZWA 3DTMA 3MZDA 3ZYTA 5FATA 3ZCZA 4GS9B 3HJIA 3U2AA 3PXPA 3CPTA 4N1HA 2BASA 1TD5A 5FAQA 3E2LA 3R4KA 3G6OA 4WF0A 1OT6A 3C30A 3FV7A 5BOHA 1W8QA 1L0EA 2LB5A 5EV0A 4DDYA 3EGXC 2VJWA 2I72A 4IBRA 5DJTA 4MBFA 2JKRM 4L9EA 3TOIA 1EI5A 4LCLA 4Q8IA 4PM5A 1K25A 4E3IA 1HLUP 1N9NA 4X69A 3CJMA 5FQIA 3P09A 1MZUA 2O9AA 4EERA 3GQZA 4Z9QA 2W1TA 4GN2A 1IYOA 4Q0HA 5F1FA 4YINA 3ZVTA 1DJAA 2IA2A 5HPIA 4EETB 2HJ9C 3LI9A 4HY8A 3LUQA 1PWGA 4Y0OA 3BFEA 2FFFB 3EWKA 5AQBA 5HAPA 5A93A 1YLYA 2KLIA 1QMFA 2PYPA 1OTIA 3BQ8A 4WEJA 3EQVA 4S2JA 3E0YA 1KGGA 2VEAA 3IHAA 4X25A 1LT0A 3HJKA 4MBHA 2B02A 2PDRA 4YFMA 1XJ6A 4S2KA 1OMEA 3CAXA 3T4QA 1E4DA 2BTFP 4Q0IA 2P08A 4NKPA 5KZHA 3KX0X 4OPYA 4MNRA 5MC7A 3UE6A 3QP6A 1XJ4A 3GSGA 4LRYC 2FZ0A 4RX3A 3OCNA 3VOYA 4IBXA 4OOYA 2V0WA 3D4FA 1LLBA 1YLTA 3LYXA 1G68A 2ZOIA 3W2ZA 1NZOA 4LGWA 2WZZA 1OTEA 1Q2PA 2R78A 2J8YA 3HCYA 1W5DA 3A3EA 2P9VB 3CG5A 2Y2HA 4PKYG 5DKLA 2QJ5A
chains in the Genus database with same CATH topology
2VLGA 2GNXA 3A0RA 5L8MA 3MQQA 1YSPA 5HWTA 4K08A 2J3TD 1IOUA 4PKYA 3CUEA 3UB8A 4HJ3A 2O9CA 4CQHA 4FOFA 4EU0A 2JN7A 2V1AA 4JGRA 5TBMB 1UWNX 3B47A 2W3HA 4HJ4A 2O9BA 3H7WB 2ZBBA 4IUHA 3OOVA 5LBRA 3BY9A 4GS9A 3MQOA 5HDDA 5HZHA 3IS2B 3EEAA 4R70A 3PBRA 4GHIA 3PBTA 1VB6A 4BBVA 2XSSA 2LB9A 2OWJA 3UB7A 2VKSA 2KDKA 2DMWA 2EA9A 2KOIA 3E4OA 2W1RA 4F3LA 1NWZA 4B93A 5DJUA 2VX8A 1GSWA 3KSHA 3MQ0A 4HHDA 4YWZA 5G4YA 5HWVA 3C38A 3F1PA 2PD8A 3OLOA 4FSFA 4L9GA 2VV6A 2ZMVA 3S7OA 1H3QA 1STZA 1F9IA 4JGPA 3CLOA 4MDZA 3FPVA 5HD3A 1W63Q 2K7SA 2YKFA 5FL3A 1KOUA 1MC0A 3UB9A 3NHQA 3LR3A 4GLQA 2GX5A 4ARZB 5AVFA 1NLYA 3E4QA 1BYWA 4MN5A 2A24B 3T4KA 3K3DA 3E98A 4I5SA 4R3AA 1YAXA 3B42A 3FG8A 3VV4A 4GW9A 2WKPA 1T19A 3TJZC 3MXQA 3H82A 3A0SA 4RQ9A 5EFWA 4XT2A 3UMEA 3VOLA 4Q0JA 3ULFA 3C8CA 1ZHHB 3T50A 2WKQA 4PHTA 5A8BA 4QPRA 3CI6A 3PHYA 2EWVA 3CUEC 4CLCB 2XROA 4IUKA 5HL6A 2A2LA 3IBJA 2PHYA 4GCZA 4CLCD 3MR0A 2OAQ1 2D02A 4HI4A 4Y3IA 4UEYA 2O0YA 4ZRRA 2QJ7A 1DP8A 3KO6A 4LRZE 3K2NA 4H6JB 4EXOA 5F68A 4CLCE 3NOPC 5F5YA 1VHMA 1H8MA 1ZTUA 1Y28A 4G3WA 2Z6DA 3F1OB 2VA0A 2M1CA 1YKDA 2JHEA 3UB6A 5J7EA 5KSHA 4O0PA 2HGVA 3LIBA 2Y8HA 2OOLA 3DBAA 1S4SA 2PYRA 5J3WA 1V9ZA 4HJ6A 2J3TC 1N9LA 3F1NA 1EW0A 2M7UA 3CWFA 3TRCA 4WLAA 2HV1A 3P7NA 2JKTM 2W3FA 1UGUA 1OJGA 4CLCA 3T4JA 4R38A 3B33A 4MN6A 1X0OA 4P6ZM 3UMDA 4BBUA 2PD7A 2W27A 1P9WA 3C2WA 4HH3A 4I3JA 2QKPA 2L1MA 4EESA 2W1TB 1OT9A 5HDSA 2XA7M 2PR5A 2KX6A 3NOUC 4H6JA 2V0UA 1P97A 3LI8A 4HNBA 2OAP1 4Y5FA 5I5LA 2P7JA 3D72A 1XFQA 3PBNA 5HD5A 1D06A 2VV8A 3S7NA 3T4OA 4BJPA 4NEED 3NJAA 4II7A 3CITA 4DJ2A 3PBQA 4P6ZS 2GZAA 4HP4A 1IFQA 2K31A 2Z6CA 3RFBA 2L0WA 4EW7A 2K2NA 3JVUA 1XJ3A 4ME4A 3VE4A 5DFXA 2PT7A 1DP9A 4KQDA 2XA7S 2VGLM 5IT5A 2QHKA 1WA9A 1T18A 5HWWA 4EEPA 1MKMA 3EGDC 2HF6A 5IU1A 1UWPX 2VV7A 4KUOA 2PR6A 5TBMA 4IHQA 1F98A 3H7WA 4BBTA 1YSQA 4O8GA 1XFNA 3IS2A 3KSGA 1TS8A 2HJEA 3GDIA 5TJJA 2EWWA 2NUTC 1LSWA 4DN0A 4HH2A 2XRNA 3V67A 2JKTI 3A0VA 1OTAA 3BJNA 4NXEA 4JGOA 5HDCA 1OPXA 3PBOA 2FH5A 2ZOHA 4WN5A 1T1AA 3H9WA 3OBFA 4AFIA 4MMNA 2QWSA 4WUJA 3PR6A 2O99A 3S7QA 1OJ5A 4NXGA 5HPFA 1TS6A 4CLCC 1TS7A 3JVVA 3R7WB 3GECA 4LLOB 2I9VA 2J80A 3E4PA 4MN7A 3BWLA 4NXFA 5KIZA 4LRXC 5AJGA 3KSIA 1S4RA 4I38A 4UQIM 4O01A 1V9YA 5HSQA 2G7UA 1OTBA 1GSVA 3IBRA 4ARZA 1T1CA 4YOFA 3FC7A 2Y79A 3T4SA 3T4TA 1NLZA 1LSVA 5F6AA 2A24A 4B9OA 5IS1A 5CX7A 3TE8A 4ETXA 5F69A 1W63M 3KYZA 3MFXA 3ICYA 1D7EA 2CMNA 3LIDA 4MCWA 1S1YA 2VZWA 4M4XA 3ZYTA 1S1ZA 2H28A 3LIEA 5G4ZA 2QYBA 4BMWA 4IJGA 4UQIS 1N9OA 4GS9B 3R7WA 1GSXA 4HOIA 3P01A 3HJIA 4KQOA 3PXPA 4GHIB 3U2AA 3BQAA 5K5BA 2BASA 3PYPA 3PBSA 4DJ3A 4Y2FA 2J3WA 3KSFA 1TD5A 4R6LA 3R4KA 4G3VA 3OCLA 3EEHA 3G6OA 4WF0A 1OT6A 3TW8A 1P0ZA 2W0NA 3C30A 4LPZA 4F3LB 2LB5A 2D01A 4PAUA 3EGXC 3NOTC 1ODVA 2VJWA 2YKHA 1F5MA 3F1OA 3FPWA 3LR0A 5DJTA 3UE3A 3VE3A 4EQ1A 2JKRM 2GJ3A 4L9EA 3KYQA 4I39A 3F1PB 4YNRA 4L0LA 1G28A 1LSXA 2B18A 3LFVA 3K3CA 1LL8A 4GJ4A 1T1BA 1S66L 2ZMFA 2MJ6A 3LICA 1N9NA 4BWIA 5C5KA 3BY8A 3S7PA 5DKKA 1DRMA 1MZUA 2O9AA 4EERA 3EQUA 2V9AA 2W1TA 4Q0HA 1S67L 3H82B 4XT2B 1DP6A 2IA2A 4WEKA 2W3DA 3MMHA 4EETB 5HPIA 2HJ9C 3LI9A 4HY8A 3LUQA 4I3AA 2VGLS 3EWKA 2KLIA 4JGQA 5J4EA 2PYPA 3MJQA 4I3IA 1OTIA 3BQ8A 4WEJA 3EQVA 4NXBA 2M7VA 1G6OA 3BW6A 4EUVA 5DF9A 3E0YA 2VEAA 1JNUA 1LT0A 3HJKA 2B02A 2PDRA 1XJ6A 2W3EA 3CAXA 3LIFA 2JKRI 1TS0A 4G3KA 3T4QA 4OOMA 4Q0IA 2V1BA 2P08A 3ZQ5A 1P9RA 4NKPA 3SW1A 3F1NB 3RTYA 4DMZA 3KX0X 2W3GA 5MC7A 3UE6A 1XJ4A 4HQAA 3EOIA 4LRYC 2FZ0A 3MF0A 3OCNA 4L9FA 4HIAA 1OTDA 2V0WA 3RH8B 2OWHA 3O5YA 4E04A 3LYXA 3D3OA 1XJ2A 2ZOIA 3T4LA 2INWA 4ETZA 3W2ZA 4WELA 4WL9A 2L4RA 4Z1WA 1TF1A 3LR5A 4EEUA 4HP9A 1OTEA 3OC2A 1NRJA 3LR4A 2R78A 3LIAA 3HCYA 5AVEA 4KUKA 4OOLA 2NUPC 2WKRA 4PKYG 2P04A 5DFYA 5DKLA 2QJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BJN A;  4Y3I A;  3S7P A;  4ZRR A;  2O0Y A;  3KO6 A;  4LRZ E;  5L8M A;  1YSP A;  3K2N A;  2O9A A;  3OBF A;  2O9C A;  4MMN A;  2W1T A;  3NOP C;  4CQH A;  4FOF A;  2O99 A;  3S7Q A;  1VHM A;  4EU0 A;  1ZTU A;  4G3W A;  5HPF A;  4Q0H A;  1YKD A;  2W3H A;  4IUH A;  2O9B A;  3OOV A;  5LBR A;  4O0P A;  2HGV A;  2Y8H A;  4MN7 A;  2OOL A;  2IA2 A;  4LRX C;  5AJG A;  3KSI A;  3DBA A;  2W3D A;  3MMH A;  5HPI A;  3EEA A;  4R70 A;  2M7U A;  2XSS A;  2LB9 A;  4O01 A;  3TRC A;  5HSQ A;  2VKS A;  2W3F A;  2G7U A;  2KLI A;  3IBR A;  2KOI A;  4YOF A;  2Y79 A;  2W1R A;  2M7V A;  3C2W A;  4EUV A;  3E0Y A;  2VEA A;  4ETX A;  2W1T B;  2W3E A;  3NOU C;  3KSH A;  3MQ0 A;  4MCW A;  2VZW A;  4Y5F A;  5I5L A;  4G3K A;  2QYB A;  4Q0I A;  4IJG A;  3ZQ5 A;  3S7N A;  3S7O A;  1STZ A;  4DMZ A;  2W3G A;  3CIT A;  5K5B A;  4Y2F A;  4MDZ A;  3KSF A;  1TD5 A;  4LRY C;  3MF0 A;  1MC0 A;  4R6L A;  3R4K A;  4G3V A;  2K31 A;  3G6O A;  3NHQ A;  3RFB A;  4GLQ A;  2GX5 A;  2K2N A;  4ME4 A;  3O5Y A;  5DFX A;  2LB5 A;  4E04 A;  3E98 A;  4PAU A;  3D3O A;  3NOT C;  1MKM A;  2VJW A;  3VV4 A;  1F5M A;  4GW9 A;  4ETZ A;  3W2Z A;  4Z1W A;  1TF1 A;  4RQ9 A;  4Q0J A;  1YSQ A;  4O8G A;  4YNR A;  2B18 A;  3LFV A;  4QPR A;  3HCY A;  3CI6 A;  3KSG A;  2XRO A;  5TJJ A;  4IUK A;  5HL6 A;  3IBJ A;  4DN0 A;  2ZMF A;  5DFY A;  4BWI A;  5C5K A;  2XRN A; 
#chains in the Genus database with same CATH topology
 2VLG A;  3U4L P;  4UA6 A;  2WZX A;  3NBL A;  1PZP A;  4KZB A;  4QY6 A;  2ZM0 A;  5TBM B;  3B47 A;  4XXR A;  2Y2L A;  3OOV A;  5LBR A;  3GR2 A;  2ZL1 B;  4OQI A;  5HFO A;  3A3D A;  3MQO A;  5HDD A;  4KZ4 A;  3IS2 B;  4R70 A;  3PBR A;  4GHI A;  1QME A;  4BBV A;  1IKI A;  2OWJ A;  4IVK A;  1TVF A;  1BLS A;  2KDK A;  3G4P A;  2HP6 A;  4ZJ1 A;  2KOI A;  2IWD A;  2W1R A;  3C4O A;  4O7D A;  1KVL A;  3V3S A;  4B93 A;  3B3X A;  3ZNY A;  1JWZ A;  3W8K A;  5G4Y A;  4BQM A;  1SZV A;  2Y4A A;  4OQH A;  3OPH A;  3ZG9 B;  4FSF A;  1H3Q A;  2WKH A;  3IXG A;  2B5R A;  4QJG A;  4MDZ A;  5FL3 A;  3UB9 A;  2Q9M A;  2PBD P;  4CPK A;  4RVA A;  3LR3 A;  4GLQ A;  5AVF A;  3E4Q A;  2EXA A;  3C7V A;  4MN5 A;  4N1X A;  2A24 B;  3K3D A;  4LV2 A;  3Q7V B;  3FG8 A;  3B42 A;  3GRJ A;  3IF5 A;  2HP5 A;  1KE0 A;  3SH8 A;  3VOL A;  3W4O A;  3T50 A;  3Q82 A;  4PHT A;  5EPH A;  3ZG0 A;  4IUK A;  4P0M A;  4DE2 A;  3IBJ A;  4U0T A;  1K0K A;  2D02 A;  4HI4 A;  4KZ8 A;  5E2G A;  4UEY A;  2QJ7 A;  1DP8 A;  1PW8 A;  3HLC A;  4QD4 A;  2EFX A;  3NUL A;  5M1A A;  3VOZ A;  3DTI A;  1PWD A;  4OLG A;  5F5Y A;  3W4Q A;  4KZ3 A;  1H8M A;  4XUX A;  5CED A;  5HW3 A;  5J7E A;  1ES5 A;  4O0P A;  1ZC2 A;  2HGV A;  2OOL A;  3ISG A;  1S4S A;  3MFD A;  5J3W A;  4HJ6 A;  4MLL A;  1N9L A;  3FKV A;  1EW0 A;  2J7V A;  3WRT A;  3VP1 A;  3AGD A;  3CWF A;  2JKT M;  1UGU A;  4UHU A;  4R38 A;  4MN6 A;  4P6Z M;  4BBU A;  4XUZ A;  2QKP A;  3HLG A;  3W4P A;  3BFG A;  4EES A;  2KX6 A;  5FI6 A;  3NOU C;  4OQG A;  4R4S A;  2V0U A;  3LGO A;  1K4F A;  4Y5F A;  4WZ5 A;  1KDW A;  3PBN A;  5HD5 A;  2VV8 A;  5CTM A;  3T4O A;  1YLJ A;  4DRT A;  3PBQ A;  5FAP A;  5U47 A;  5JYP A;  2GZA A;  1AXB A;  2Z6C A;  3RFB A;  4EW7 A;  4D2O A;  1J9M A;  1LL5 A;  1RGZ A;  3JVU A;  4ME4 A;  3BM6 A;  5DFX A;  1SKO A;  2PT7 A;  3MXS A;  2XA7 S;  1WYB A;  2B95 A;  1T18 A;  4EEP A;  5M18 A;  5DF7 A;  1S0W A;  1YT4 A;  4KUO A;  2PR6 A;  4IHQ A;  2XQZ A;  5L10 A;  1YSQ A;  2XD1 A;  4O8G A;  1TS8 A;  2HJE A;  3GDI A;  4IED A;  2EWW A;  4FH2 A;  4DN0 A;  3HLE A;  4OP8 A;  3BJN A;  3IXH A;  4KZ5 A;  4WN5 A;  1T1A A;  3OBF A;  4AFI A;  4MMN A;  4WUJ A;  5EVI B;  2O99 A;  3UPN A;  4OON A;  1TS7 A;  3R7W B;  3VSL A;  1CI9 A;  3GEC A;  3UDX A;  3DAV A;  2J80 A;  4NXF A;  5KIZ A;  1S4R A;  2H0T A;  2WKE A;  4X1L A;  2XH9 A;  1N4O A;  2PRF A;  4O01 A;  4HES A;  4GZB A;  1O7E A;  5EM0 A;  4WZ5 C;  1GSV A;  4YOF A;  4ESP A;  2A3U A;  3T4T A;  1JWP A;  1FQG A;  4EWF A;  3MFX A;  1I5Q A;  3CMZ A;  2Y2J A;  3BRM A;  5FQM A;  4M4X A;  5EVI A;  3LIE A;  4IJG A;  4UQI S;  3R7W A;  3LEZ A;  3WRZ A;  3FZC A;  3BYD A;  4KQO A;  3MBZ A;  5FAS A;  5K5B A;  3PYP A;  4DJ3 A;  3PBS A;  1PIO A;  4MBK A;  3KSF A;  5FI7 A;  2XDM A;  1FSY A;  2XEP A;  4G3V A;  3EEH A;  2V8C A;  5AQ9 A;  1P0Z A;  2W0N A;  1KGF A;  3A3I A;  2D01 A;  3UE1 A;  1KDS A;  5DTT A;  1TEM A;  2YKH A;  3FPW A;  4EQ1 A;  3KYQ A;  5A92 A;  4E3O A;  2DNS A;  3F1P B;  4L0L A;  3HVF A;  2Y2P A;  4E3L A;  1LL8 A;  4GJ4 A;  5E43 A;  4ZTK A;  5DTS A;  1T1B A;  2MJ6 A;  3LIC A;  4BWI A;  5C5K A;  3MZE A;  3BY8 A;  4OH0 A;  2OLV A;  1NRF A;  1K38 A;  3G35 A;  3VP3 A;  3FKW A;  2RCX A;  5GHY A;  2ZQA A;  5FEG A;  3EQU A;  4GOG A;  1W79 A;  1GCE A;  1S67 L;  2J9O A;  4XT2 B;  2W3D A;  5CGX A;  2R9X A;  1U60 A;  4I3A A;  3T1X A;  5EVI C;  3AGE A;  1YPR A;  1Z09 A;  4E3K A;  3A3J A;  1EWZ A;  1G6O A;  2M7V A;  5DF9 A;  4C6Y A;  2JCH A;  3IF6 B;  4HBU A;  2PBY A;  1TS0 A;  4H8R A;  2H5S A;  1XP4 A;  2V1B A;  1ZG6 A;  3V3R A;  3F1N B;  4C3Q A;  2W3G A;  3T1R A;  3IH8 A;  1J3W A;  4Y0T A;  4HIA A;  2HDU A;  4R3B A;  4HBT A;  1I2S A;  2OWH A;  4HEF A;  3NCK A;  4U3T A;  2CC1 A;  3T4L A;  1M6K A;  4ETZ A;  4K0W A;  3L7H A;  2WGW A;  2ZM2 A;  4Z1W A;  2L4R A;  1TF1 A;  3LR5 A;  3OPR A;  3OC2 A;  3LR4 A;  4BD0 A;  4KZA A;  1ES2 A;  1IYQ A;  1KE4 A;  2NUP C;  2WKR A;  2XGN A;  2P04 A;  2OV5 A;  2QZ6 A;  1PRQ A;  3VFH A;  4P85 A;  1YLZ A;  3A0R A;  5L8M A;  1ES3 A;  1LI0 A;  1YSP A;  5HWT A;  1E3U D;  4K08 A;  2J3T D;  4PKY A;  5F82 A;  3CUE A;  3UB8 A;  2O9C A;  2V1A A;  1K57 A;  4JGR A;  3IXB A;  2W3H A;  2XFS A;  2ZBB A;  2Z2L B;  3M2K A;  5HAQ A;  4OP5 A;  3BY9 A;  4GS9 A;  5HZH A;  1BLH A;  4BEN A;  4S2I A;  1VB6 A;  4Y17 A;  5FQQ A;  4U0X A;  2V20 A;  4ZJ2 A;  3E4O A;  1WE4 A;  4S2M A;  3T12 B;  3C5A A;  2VX8 A;  3KSH A;  4YWZ A;  3IX8 A;  4OKP A;  3C7U A;  4RX2 A;  1M40 A;  4R3J A;  3WS1 A;  3C38 A;  3PAE A;  2PD8 A;  1JWV A;  4EQI A;  3CLO A;  2YKF A;  3SS5 A;  1MC0 A;  1AWI A;  3LCE A;  3T4K A;  3UE0 A;  3T1Q B;  4X53 A;  2WKP A;  5CHM A;  3IWQ A;  5F1G A;  4NG2 A;  3A0S A;  4RQ9 A;  1H0M A;  2WKQ A;  4QPR A;  5FDS A;  3PHY A;  3CUE C;  1Z6F A;  2XRO A;  5HL6 A;  4ID4 A;  5J8X A;  2PHY A;  1K57 C;  4CLC D;  3MR0 A;  4UA9 A;  1PW1 A;  3HUN A;  3KO6 A;  1PYY A;  3IWO A;  4P6B A;  2QPN A;  4FUW A;  3DTE A;  2Z6D A;  3F1O B;  3G34 A;  5HAI A;  1YKD A;  5KSH A;  4FH4 A;  4BD1 A;  3LIB A;  2Y8H A;  2XLN A;  4CJN A;  3CZD A;  3ZG7 B;  4DF6 A;  3N6I A;  1MWT A;  2HV1 A;  2EXB A;  2W3F A;  1OJG A;  2QMI A;  3FYZ A;  3T4J A;  1JTD A;  2Q9N A;  3B33 A;  1X0O A;  4BL2 A;  4R23 A;  2WGV A;  4X56 A;  1NZU A;  3SZT A;  1CI8 A;  2L1M A;  2XK1 A;  1OT9 A;  1IEL A;  1CJF A;  2PR5 A;  2XA7 M;  4FD8 A;  4DXB A;  3LI8 A;  2HZ5 A;  4OPQ A;  2WK0 A;  5I5L A;  3D72 A;  1XFQ A;  4N9K A;  1A0K A;  4NEE D;  3NJA A;  4LV0 A;  3CIT A;  2P9V A;  1BUL A;  4DJ2 A;  2JKF A;  3SS4 A;  3ZHH A;  3VP4 A;  5CEB A;  4JXG A;  4KQD A;  2G2W A;  1WA9 A;  4QB8 A;  5L07 A;  1FR6 A;  5TBM A;  1F98 A;  5E2E A;  3QP1 A;  2ZL1 A;  2XD5 A;  1XFN A;  3IS2 A;  1L0G A;  3N7W A;  1XPB A;  4DE0 A;  2NUT C;  5CEC A;  1LSW A;  4HH2 A;  2XRN A;  2ZQD A;  5E2H A;  4E6W A;  1OTA A;  3Q07 A;  1S6R A;  1OPX A;  3S22 A;  2ZOH A;  3H9W A;  1NYM A;  3UPO A;  5FA7 A;  1VET B;  2QWS A;  3OPP A;  5FSR A;  3JVV A;  4S2P A;  4LLO B;  4MN7 A;  4LFU A;  3KSI A;  2HDR A;  5GLA A;  5FQ9 A;  2Y2K A;  4UQI M;  4EV4 A;  5CRF A;  5HSQ A;  4PM9 A;  2Y2N A;  1OTB A;  1MWU A;  3N8L A;  2DCF A;  2Y79 A;  3T4S A;  4EBL A;  2UV0 E;  1LSV A;  5F6A A;  2A24 A;  5IS1 A;  1TDL A;  1ES4 A;  3Q7V A;  3TE8 A;  1W63 M;  4RA7 A;  3WS5 A;  3KYE A;  1D7E A;  4MCW A;  3LID A;  3DTK A;  1S1Y A;  5GLD A;  1BZA A;  2DRW A;  4JF5 A;  4Y15 A;  4K91 A;  4JLF A;  2RL3 A;  1GSX A;  2Y55 A;  3P01 A;  3L9K A;  1PI4 A;  1NJ4 A;  2H10 A;  2EX2 A;  3RXW A;  4Y2F A;  3Q81 A;  2J3W A;  2ZC7 A;  5D3O A;  1FSW A;  5AQ7 A;  4DDS A;  4B88 A;  5FDH A;  3TW8 A;  3A3F A;  2X71 A;  4F3L B;  1PWC A;  4PAU A;  4M3K A;  3NOT C;  4BL3 A;  4KZ6 A;  1ODV A;  1ERO A;  1F5M A;  3LR0 A;  3VE3 A;  2GJ3 A;  3N4I A;  4LV3 A;  4YNR A;  1LSX A;  2B18 A;  3K3C A;  3IH9 A;  1YM1 A;  2ZM8 A;  2ZMF A;  4OPZ A;  3V5M A;  3PTE A;  4N92 A;  3G31 A;  3AGF A;  5TFQ A;  3S7P A;  5DF8 A;  2V9A A;  3HUO A;  4P87 A;  3G32 A;  2A49 A;  1LI9 A;  3VP0 A;  3H82 B;  1RGY A;  4R0Q A;  4WEK A;  4NET A;  5CER A;  3GTC A;  1H5X A;  3BLM A;  3HLF A;  5GHZ A;  2WGI A;  3ZG5 A;  4D60 A;  3DW0 A;  3MJQ A;  4MEZ A;  3UPP A;  4JF6 A;  4NXB A;  1SDE A;  1DY6 A;  1XA7 A;  2W3E A;  1L0D A;  3LIF A;  1VEU B;  2JKR I;  3T1S A;  3ITA A;  4KG5 A;  1D1J A;  4C75 A;  3SW1 A;  1PFL A;  4DMZ A;  3HUM A;  1ALQ A;  4PPR A;  3UY6 A;  5FQJ A;  5GLB A;  3WS2 A;  4L9F A;  4ZAM A;  4KQQ A;  3MZF A;  3RH8 B;  3O5Y A;  4DKI A;  4EBP A;  1XGI A;  2C5W B;  3MKE A;  5CGS A;  2INW A;  4WEL A;  4WL9 A;  2Y91 A;  1NRJ A;  3LIA A;  5AVE A;  2XFT A;  3ZGA B;  4JXS A;  4OOL A;  1PNE A;  3Q7Z A;  1K56 A;  4RYE A;  5DFY A;  2BLS A;  3HLB A;  3MKF A;  4E3N A;  1RCJ A;  1FIK A;  1FIL A;  1GHM A;  5DVA A;  4KQR A;  1MBL A;  1XGJ A;  3NDE A;  4CQH A;  1LL9 A;  1HZO A;  4EU0 A;  1ZKJ A;  1UWN X;  4BLM A;  4HJ4 A;  3H7W B;  4IUH A;  4S2O A;  4WZ4 A;  2VK3 A;  5CHU A;  1N9B A;  5F83 A;  3EEA A;  2ZQC A;  4QHC A;  3PBT A;  2XSS A;  2ZMA A;  4F94 A;  2ZD8 A;  1G5U A;  2VKS A;  4GD6 A;  2VGJ A;  2BG1 A;  1YQS A;  3QP2 A;  4PMA A;  5DJU A;  1VM1 A;  4LEN A;  1GSW A;  2V8F A;  2HPB A;  1K54 A;  4UAA A;  3SH9 A;  3F1P A;  4L9G A;  5L09 A;  4JGP A;  1KE3 A;  2JC7 A;  3O3V A;  4UA7 A;  4Y7P A;  1W63 Q;  5HD3 A;  4JKT A;  3NHQ A;  4ARZ B;  2GX5 A;  1DJB A;  3WS0 A;  4R4R A;  3E98 A;  4R3A A;  1YAX A;  2Z2M B;  2HDQ A;  4GW9 A;  4X1M A;  2V1Z A;  1T19 A;  3TSG A;  3RJU A;  3MXQ A;  5EE8 A;  5EFW A;  4XT2 A;  3UME A;  4Q0J A;  3ULF A;  4JBF A;  1MXO A;  5A8B A;  3CI6 A;  1PZO A;  4IVI A;  2A2L A;  3CPT B;  4GCZ A;  4PM6 A;  1YMS A;  5FQK A;  4Y3I A;  2O0Y A;  2P74 A;  5TR7 A;  5FEF A;  4GNU A;  3K2N A;  2Y2M A;  4H6J B;  5F68 A;  3NOP C;  1VHM A;  3IF6 A;  3IX4 A;  2VA0 A;  4OVD A;  2M1C A;  2JHE A;  3UB6 A;  3VMA A;  3LEQ A;  5FI2 A;  3DBA A;  2PYR A;  3F1N A;  1SCW A;  2M7U A;  4OLD A;  3TRC A;  1Y4O A;  1K54 C;  1NXY A;  3UMD A;  5A91 A;  3C2W A;  4HH3 A;  2W1T B;  3N8S A;  3IHB A;  2EX8 A;  4H6J A;  3BEC A;  2OAP 1;  3HL9 A;  2P7J A;  1D06 A;  4GB7 A;  4II7 A;  4KEN B;  3JPU A;  1NY0 A;  3G30 A;  4E6X A;  1IFQ A;  5KMW A;  3NY4 A;  4R1G A;  4QU3 A;  2FFY A;  3MSH A;  1DP9 A;  2VGL M;  4A5R A;  5HWW A;  5CTN A;  2VV7 A;  5IHV A;  1FCM A;  5G18 A;  1FR1 A;  4BBT A;  2PAV P;  3JYI A;  1SKF A;  3KSG A;  1DJC A;  5TJJ A;  2JE5 A;  3IF6 C;  2OSU A;  3LY3 A;  2JKT I;  1LHY A;  3O86 A;  5DTK A;  5CXW A;  2FH5 A;  5CHJ A;  1I2W A;  2IWB A;  3PR6 A;  1BUE A;  4NXG A;  5HPF A;  1TS6 A;  1JTG A;  5EVI D;  5M19 A;  2I9V A;  3E4P A;  1FCO A;  4K0X A;  3SH7 A;  4PM8 A;  3VFF A;  1WYC A;  2ZC6 B;  2G7U A;  1K56 D;  3BFF A;  1L2S A;  3IBR A;  1T1C A;  2OLU A;  3VSK A;  2HP9 A;  4KG6 A;  4B9O A;  2Y2G A;  5CX7 A;  3NEC A;  4ETX A;  3KYZ A;  1CQA A;  3ICY A;  1O07 A;  2CMN A;  3VP2 A;  1BLP A;  1ONH A;  3HBR A;  4WYY A;  1S1Z A;  2H28 A;  5G4Z A;  2QYB A;  4BMW A;  1N9O A;  4HOI A;  2E8I A;  1Y54 A;  4Y13 A;  4GD8 A;  3O87 A;  3ZNT A;  4GHI B;  3BQA A;  2ZJ9 A;  1CK3 A;  1ONG A;  2XF3 A;  4R6L A;  1NYY A;  3OCL A;  2WYX A;  1BLC A;  4LPZ A;  3RXX A;  3UO9 A;  4EUZ A;  1MKI A;  2Y2Q A;  2C6W B;  4WBG A;  1XXM A;  1W8Y A;  3F1O A;  3UE3 A;  2EFU A;  4I39 A;  1G28 A;  3SOI A;  3LFV A;  1MPL A;  1XKZ A;  3M6B A;  1F2K A;  4QY5 A;  1XA1 A;  1XX2 A;  1S66 L;  4LV1 A;  3UDI A;  3DWZ A;  1L0F A;  5DKK A;  1DRM A;  4OQ0 A;  3ITB A;  5CGW A;  1FCN A;  1MY8 A;  2JBF A;  3HLD A;  2AVX A;  5GHX A;  4WMC A;  3UN7 A;  4OPR A;  1DP6 A;  3IT9 A;  3FWL A;  3MMH A;  4ZDX A;  3SS3 A;  2WKI A;  2VGL S;  4X68 A;  5KSC A;  5HL1 A;  3ZDJ A;  5J4E A;  4JGQ A;  5EEC A;  4DE1 A;  4I3I A;  1KGE A;  3BW6 A;  4EUV A;  3GV9 A;  1JNU A;  4QWO A;  1ERQ A;  2WAD A;  3G2Z A;  3M6H A;  4G3K A;  3GMW A;  4OOM A;  3BFC A;  3ZQ5 A;  1P9R A;  1FOF A;  5EVL A;  1ZG4 A;  4JXV A;  3RTY A;  1Q2Q A;  4HQA A;  3EOI A;  2ZQ8 A;  3MF0 A;  4E3J A;  3N8R A;  1OTD A;  2J9P A;  2ZC4 B;  2EX6 A;  5TGF A;  5EUA A;  4E04 A;  2G2U A;  4B4Z A;  1VET A;  3D3O A;  1XJ2 A;  3QNC A;  3MXR A;  1SHV A;  4EEU A;  4HP9 A;  3IWI A;  2ZC3 B;  1BT5 A;  4KUK A;  3IQA A;  1K55 A;  1G6A A;  2GNX A;  3C4P A;  3S4X A;  3MQQ A;  1SKO B;  1IOU A;  4HJ3 A;  2EX9 A;  4FOF A;  2JN7 A;  3NI9 A;  1MWR A;  1H8Y A;  4DXC A;  2Q0O A;  2O9B A;  2XR0 A;  5GLC A;  3DWK A;  4GDB A;  1ACF A;  3S1Y A;  5EOE A;  2E8J A;  2LB9 A;  3UB7 A;  3P98 A;  4JF4 A;  1H8Z A;  2DMW A;  2EA9 A;  3V50 A;  4LCM A;  5HAR A;  2VGK A;  1E25 A;  5EM1 A;  4F3L A;  1E3U A;  1NWZ A;  1MWS A;  3MQ0 A;  4HHD A;  1BSG A;  4S2N A;  1IYS A;  5HWV A;  3UDF A;  3CHW P;  3OLO A;  4S2L A;  1HVB A;  3NC8 A;  2VV6 A;  2ZMV A;  3S7O A;  1STZ A;  5I94 A;  1F9I A;  1JVJ A;  3G2Y A;  1HD8 A;  3FPV A;  4X6T A;  2K7S A;  1KOU A;  1NLY A;  3LO7 A;  1BYW A;  1C3B A;  4I5S A;  3QHY A;  4GDN A;  1K6R A;  3VV4 A;  1K55 C;  3TJZ C;  3NDG A;  3H82 A;  3GVB A;  1BTL A;  3OZH A;  3C8C A;  1ZHH B;  4FCF A;  4ZJ3 A;  2EWV A;  4CLC B;  1HTZ A;  2OAQ 1;  3UB5 P;  2H0Y A;  4ZRR A;  1CEF A;  4LRZ E;  2PU2 A;  1VQQ A;  4GKU A;  5EVE A;  3WS4 A;  4EXO A;  4CLC E;  3TG9 A;  1TDG A;  1ZTU A;  1Y28 A;  4G3W A;  1VEU A;  3HLW A;  2Y59 A;  1IYP A;  2ZLY A;  4NK3 A;  3WWX A;  1V9Z A;  2J3T C;  5EOO A;  1YLP A;  3OPL A;  2WAF A;  2ZC5 B;  4WLA A;  3P7N A;  4CLC A;  4S2N C;  4ZBE A;  2PD7 A;  2W27 A;  1P9W A;  5A90 A;  4I3J A;  2PU4 A;  3HRE A;  5HDS A;  2X02 A;  5E2F A;  5JYO A;  3IXD A;  4DE3 A;  1P97 A;  4HNB A;  1ESI A;  3QP8 A;  4WMC D;  1KVM A;  3QP5 A;  1L3L A;  3S7N A;  4BJP A;  1K4E A;  4JPM A;  4P6Z S;  1IKG A;  4HP4 A;  4PM7 A;  3QP4 A;  2K31 A;  2L0W A;  2K2N A;  2ACG A;  3IX3 A;  1XJ3 A;  3VE4 A;  3QNB A;  4FTX A;  1GA9 A;  5IT5 A;  3BEB A;  3MS6 A;  2QHK A;  4WM9 A;  3NIA A;  1MKM A;  3EGD C;  2HF6 A;  5IU1 A;  1UWP X;  2Y2O A;  4JXW A;  2HDS A;  2ZQ9 A;  3H7W A;  1YMX A;  3ZVW A;  2WUQ A;  3V39 A;  2WAE A;  1SDN A;  4EBN A;  5AQA A;  3PAG A;  4KG2 A;  3UNW A;  4KZ7 A;  2X01 A;  1YLW A;  1K6S A;  3V67 A;  3A0V A;  4NXE A;  4JGO A;  3I7J A;  5HDC A;  3O88 A;  3Q1F A;  1RP5 A;  3PBO A;  1GHI A;  1GA0 A;  1ERM A;  2UWX A;  3M2J A;  3S7Q A;  3LY4 A;  1OJ5 A;  1PI5 A;  4CLC C;  2WGW B;  4B4X A;  2IWC A;  3E2K A;  3BWL A;  2V2F F;  5L2F A;  4LRX C;  5AJG A;  1W7F A;  4I38 A;  1GHP A;  4Y0U A;  1V9Y A;  2ZQ7 A;  3ZG8 B;  1CEG A;  3BFD A;  4E3M A;  1IEM A;  4X55 A;  2GDN A;  4KZ9 A;  5FAO A;  1CF0 A;  4ARZ A;  4N9L A;  3FC7 A;  5GL9 A;  3BLS A;  1NLZ A;  2R9W A;  2JKG A;  3ZFZ A;  1ESU A;  5F69 A;  5HX9 A;  3D9Y A;  2Y2I A;  2VZW A;  3DTM A;  3MZD A;  3ZYT A;  5FAT A;  3ZCZ A;  4GS9 B;  3HJI A;  3U2A A;  3PXP A;  3CPT A;  4N1H A;  2BAS A;  1TD5 A;  5FAQ A;  3E2L A;  3R4K A;  3G6O A;  4WF0 A;  1OT6 A;  3C30 A;  3FV7 A;  5BOH A;  1W8Q A;  1L0E A;  2LB5 A;  5EV0 A;  4DDY A;  3EGX C;  2VJW A;  2I72 A;  4IBR A;  5DJT A;  4MBF A;  2JKR M;  4L9E A;  3TOI A;  1EI5 A;  4LCL A;  4Q8I A;  4PM5 A;  1K25 A;  4E3I A;  1HLU P;  1N9N A;  4X69 A;  3CJM A;  5FQI A;  3P09 A;  1MZU A;  2O9A A;  4EER A;  3GQZ A;  4Z9Q A;  2W1T A;  4GN2 A;  1IYO A;  4Q0H A;  5F1F A;  4YIN A;  3ZVT A;  1DJA A;  2IA2 A;  5HPI A;  4EET B;  2HJ9 C;  3LI9 A;  4HY8 A;  3LUQ A;  1PWG A;  4Y0O A;  3BFE A;  2FFF B;  3EWK A;  5AQB A;  5HAP A;  5A93 A;  1YLY A;  2KLI A;  1QMF A;  2PYP A;  1OTI A;  3BQ8 A;  4WEJ A;  3EQV A;  4S2J A;  3E0Y A;  1KGG A;  2VEA A;  3IHA A;  4X25 A;  1LT0 A;  3HJK A;  4MBH A;  2B02 A;  2PDR A;  4YFM A;  1XJ6 A;  4S2K A;  1OME A;  3CAX A;  3T4Q A;  1E4D A;  2BTF P;  4Q0I A;  2P08 A;  4NKP A;  5KZH A;  3KX0 X;  4OPY A;  4MNR A;  5MC7 A;  3UE6 A;  3QP6 A;  1XJ4 A;  3GSG A;  4LRY C;  2FZ0 A;  4RX3 A;  3OCN A;  3VOY A;  4IBX A;  4OOY A;  2V0W A;  3D4F A;  1LLB A;  1YLT A;  3LYX A;  1G68 A;  2ZOI A;  3W2Z A;  1NZO A;  4LGW A;  2WZZ A;  1OTE A;  1Q2P A;  2R78 A;  2J8Y A;  3HCY A;  1W5D A;  3A3E A;  2P9V B;  3CG5 A;  2Y2H A;  4PKY G;  5DKL A;  2QJ5 A; 
#chains in the Genus database with same CATH homology
 2VLG A;  2GNX A;  3A0R A;  5L8M A;  3MQQ A;  1YSP A;  5HWT A;  4K08 A;  2J3T D;  1IOU A;  4PKY A;  3CUE A;  3UB8 A;  4HJ3 A;  2O9C A;  4CQH A;  4FOF A;  4EU0 A;  2JN7 A;  2V1A A;  4JGR A;  5TBM B;  1UWN X;  3B47 A;  2W3H A;  4HJ4 A;  2O9B A;  3H7W B;  2ZBB A;  4IUH A;  3OOV A;  5LBR A;  3BY9 A;  4GS9 A;  3MQO A;  5HDD A;  5HZH A;  3IS2 B;  3EEA A;  4R70 A;  3PBR A;  4GHI A;  3PBT A;  1VB6 A;  4BBV A;  2XSS A;  2LB9 A;  2OWJ A;  3UB7 A;  2VKS A;  2KDK A;  2DMW A;  2EA9 A;  2KOI A;  3E4O A;  2W1R A;  4F3L A;  1NWZ A;  4B93 A;  5DJU A;  2VX8 A;  1GSW A;  3KSH A;  3MQ0 A;  4HHD A;  4YWZ A;  5G4Y A;  5HWV A;  3C38 A;  3F1P A;  2PD8 A;  3OLO A;  4FSF A;  4L9G A;  2VV6 A;  2ZMV A;  3S7O A;  1H3Q A;  1STZ A;  1F9I A;  4JGP A;  3CLO A;  4MDZ A;  3FPV A;  5HD3 A;  1W63 Q;  2K7S A;  2YKF A;  5FL3 A;  1KOU A;  1MC0 A;  3UB9 A;  3NHQ A;  3LR3 A;  4GLQ A;  2GX5 A;  4ARZ B;  5AVF A;  1NLY A;  3E4Q A;  1BYW A;  4MN5 A;  2A24 B;  3T4K A;  3K3D A;  3E98 A;  4I5S A;  4R3A A;  1YAX A;  3B42 A;  3FG8 A;  3VV4 A;  4GW9 A;  2WKP A;  1T19 A;  3TJZ C;  3MXQ A;  3H82 A;  3A0S A;  4RQ9 A;  5EFW A;  4XT2 A;  3UME A;  3VOL A;  4Q0J A;  3ULF A;  3C8C A;  1ZHH B;  3T50 A;  2WKQ A;  4PHT A;  5A8B A;  4QPR A;  3CI6 A;  3PHY A;  2EWV A;  3CUE C;  4CLC B;  2XRO A;  4IUK A;  5HL6 A;  2A2L A;  3IBJ A;  2PHY A;  4GCZ A;  4CLC D;  3MR0 A;  2OAQ 1;  2D02 A;  4HI4 A;  4Y3I A;  4UEY A;  2O0Y A;  4ZRR A;  2QJ7 A;  1DP8 A;  3KO6 A;  4LRZ E;  3K2N A;  4H6J B;  4EXO A;  5F68 A;  4CLC E;  3NOP C;  5F5Y A;  1VHM A;  1H8M A;  1ZTU A;  1Y28 A;  4G3W A;  2Z6D A;  3F1O B;  2VA0 A;  2M1C A;  1YKD A;  2JHE A;  3UB6 A;  5J7E A;  5KSH A;  4O0P A;  2HGV A;  3LIB A;  2Y8H A;  2OOL A;  3DBA A;  1S4S A;  2PYR A;  5J3W A;  1V9Z A;  4HJ6 A;  2J3T C;  1N9L A;  3F1N A;  1EW0 A;  2M7U A;  3CWF A;  3TRC A;  4WLA A;  2HV1 A;  3P7N A;  2JKT M;  2W3F A;  1UGU A;  1OJG A;  4CLC A;  3T4J A;  4R38 A;  3B33 A;  4MN6 A;  1X0O A;  4P6Z M;  3UMD A;  4BBU A;  2PD7 A;  2W27 A;  1P9W A;  3C2W A;  4HH3 A;  4I3J A;  2QKP A;  2L1M A;  4EES A;  2W1T B;  1OT9 A;  5HDS A;  2XA7 M;  2PR5 A;  2KX6 A;  3NOU C;  4H6J A;  2V0U A;  1P97 A;  3LI8 A;  4HNB A;  2OAP 1;  4Y5F A;  5I5L A;  2P7J A;  3D72 A;  1XFQ A;  3PBN A;  5HD5 A;  1D06 A;  2VV8 A;  3S7N A;  3T4O A;  4BJP A;  4NEE D;  3NJA A;  4II7 A;  3CIT A;  4DJ2 A;  3PBQ A;  4P6Z S;  2GZA A;  4HP4 A;  1IFQ A;  2K31 A;  2Z6C A;  3RFB A;  2L0W A;  4EW7 A;  2K2N A;  3JVU A;  1XJ3 A;  4ME4 A;  3VE4 A;  5DFX A;  2PT7 A;  1DP9 A;  4KQD A;  2XA7 S;  2VGL M;  5IT5 A;  2QHK A;  1WA9 A;  1T18 A;  5HWW A;  4EEP A;  1MKM A;  3EGD C;  2HF6 A;  5IU1 A;  1UWP X;  2VV7 A;  4KUO A;  2PR6 A;  5TBM A;  4IHQ A;  1F98 A;  3H7W A;  4BBT A;  1YSQ A;  4O8G A;  1XFN A;  3IS2 A;  3KSG A;  1TS8 A;  2HJE A;  3GDI A;  5TJJ A;  2EWW A;  2NUT C;  1LSW A;  4DN0 A;  4HH2 A;  2XRN A;  3V67 A;  2JKT I;  3A0V A;  1OTA A;  3BJN A;  4NXE A;  4JGO A;  5HDC A;  1OPX A;  3PBO A;  2FH5 A;  2ZOH A;  4WN5 A;  1T1A A;  3H9W A;  3OBF A;  4AFI A;  4MMN A;  2QWS A;  4WUJ A;  3PR6 A;  2O99 A;  3S7Q A;  1OJ5 A;  4NXG A;  5HPF A;  1TS6 A;  4CLC C;  1TS7 A;  3JVV A;  3R7W B;  3GEC A;  4LLO B;  2I9V A;  2J80 A;  3E4P A;  4MN7 A;  3BWL A;  4NXF A;  5KIZ A;  4LRX C;  5AJG A;  3KSI A;  1S4R A;  4I38 A;  4UQI M;  4O01 A;  1V9Y A;  5HSQ A;  2G7U A;  1OTB A;  1GSV A;  3IBR A;  4ARZ A;  1T1C A;  4YOF A;  3FC7 A;  2Y79 A;  3T4S A;  3T4T A;  1NLZ A;  1LSV A;  5F6A A;  2A24 A;  4B9O A;  5IS1 A;  5CX7 A;  3TE8 A;  4ETX A;  5F69 A;  1W63 M;  3KYZ A;  3MFX A;  3ICY A;  1D7E A;  2CMN A;  3LID A;  4MCW A;  1S1Y A;  2VZW A;  4M4X A;  3ZYT A;  1S1Z A;  2H28 A;  3LIE A;  5G4Z A;  2QYB A;  4BMW A;  4IJG A;  4UQI S;  1N9O A;  4GS9 B;  3R7W A;  1GSX A;  4HOI A;  3P01 A;  3HJI A;  4KQO A;  3PXP A;  4GHI B;  3U2A A;  3BQA A;  5K5B A;  2BAS A;  3PYP A;  3PBS A;  4DJ3 A;  4Y2F A;  2J3W A;  3KSF A;  1TD5 A;  4R6L A;  3R4K A;  4G3V A;  3OCL A;  3EEH A;  3G6O A;  4WF0 A;  1OT6 A;  3TW8 A;  1P0Z A;  2W0N A;  3C30 A;  4LPZ A;  4F3L B;  2LB5 A;  2D01 A;  4PAU A;  3EGX C;  3NOT C;  1ODV A;  2VJW A;  2YKH A;  1F5M A;  3F1O A;  3FPW A;  3LR0 A;  5DJT A;  3UE3 A;  3VE3 A;  4EQ1 A;  2JKR M;  2GJ3 A;  4L9E A;  3KYQ A;  4I39 A;  3F1P B;  4YNR A;  4L0L A;  1G28 A;  1LSX A;  2B18 A;  3LFV A;  3K3C A;  1LL8 A;  4GJ4 A;  1T1B A;  1S66 L;  2ZMF A;  2MJ6 A;  3LIC A;  1N9N A;  4BWI A;  5C5K A;  3BY8 A;  3S7P A;  5DKK A;  1DRM A;  1MZU A;  2O9A A;  4EER A;  3EQU A;  2V9A A;  2W1T A;  4Q0H A;  1S67 L;  3H82 B;  4XT2 B;  1DP6 A;  2IA2 A;  4WEK A;  2W3D A;  3MMH A;  4EET B;  5HPI A;  2HJ9 C;  3LI9 A;  4HY8 A;  3LUQ A;  4I3A A;  2VGL S;  3EWK A;  2KLI A;  4JGQ A;  5J4E A;  2PYP A;  3MJQ A;  4I3I A;  1OTI A;  3BQ8 A;  4WEJ A;  3EQV A;  4NXB A;  2M7V A;  1G6O A;  3BW6 A;  4EUV A;  5DF9 A;  3E0Y A;  2VEA A;  1JNU A;  1LT0 A;  3HJK A;  2B02 A;  2PDR A;  1XJ6 A;  2W3E A;  3CAX A;  3LIF A;  2JKR I;  1TS0 A;  4G3K A;  3T4Q A;  4OOM A;  4Q0I A;  2V1B A;  2P08 A;  3ZQ5 A;  1P9R A;  4NKP A;  3SW1 A;  3F1N B;  3RTY A;  4DMZ A;  3KX0 X;  2W3G A;  5MC7 A;  3UE6 A;  1XJ4 A;  4HQA A;  3EOI A;  4LRY C;  2FZ0 A;  3MF0 A;  3OCN A;  4L9F A;  4HIA A;  1OTD A;  2V0W A;  3RH8 B;  2OWH A;  3O5Y A;  4E04 A;  3LYX A;  3D3O A;  1XJ2 A;  2ZOI A;  3T4L A;  2INW A;  4ETZ A;  3W2Z A;  4WEL A;  4WL9 A;  2L4R A;  4Z1W A;  1TF1 A;  3LR5 A;  4EEU A;  4HP9 A;  1OTE A;  3OC2 A;  1NRJ A;  3LR4 A;  2R78 A;  3LIA A;  3HCY A;  5AVE A;  4KUK A;  4OOL A;  2NUP C;  2WKR A;  4PKY G;  2P04 A;  5DFY A;  5DKL A;  2QJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...