3MMHA

X-ray structure of free methionine-r-sulfoxide reductase from neisseria meningitidis in complex with its substrate
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
167
structure length
167
Chain Sequence
MHALHFSASDKAALYREVLPQIESVVADETDWVANLANTAAVLKEAFGWFWVGFYLVDTRSDELVLAPFQGPLACTRIPFGRGVCGQAWAKGGTVVVGDVDAHPDHIACSSLSRSEIVVPLFSDGRCIGVLDADSEHLAQFDETDALYLGELAKILEKRFEASRQAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine-R-sulfoxide reductase
publication title Structural and Biochemical Characterization of Free Methionine-R-sulfoxide Reductase from Neisseria meningitidis.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Oxidoreductase
total genus 52
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature ec 1.8.4.14: L-methionine (R)-S-oxide reductase.
pdb deposition date 2010-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3mmhA00
2KLIA 2W3GA 4QPRA 4E04A 2LB9A 2HGVA 1STZA 3ZQ5A 4Y2FA 2XROA 2B18A 3OBFA 2W3DA 4LRZE 4YOFA 5DFXA 4DN0A 3W2ZA 3NHQA 1YSQA 2K31A 4R70A 4ME4A 4YNRA 2O9AA 3NOUC 5L8MA 4G3WA 3E98A 2GX5A 5TJJA 2VEAA 2W3HA 4BWIA 4Z1WA 2O9BA 4RQ9A 3LFVA 3EEAA 5HPFA 1TD5A 2W1TB 4MDZA 1F5MA 1ZTUA 4Y5FA 3TRCA 2W3EA 4LRXC 5LBRA 5HPIA 3K2NA 3DBAA 4ETZA 1MC0A 2W3FA 1MKMA 2M7VA 2Y8HA 3BJNA 3C2WA 4G3KA 4Q0JA 4IUKA 3S7QA 3MF0A 2O0YA 2O99A 2ZMFA 1TF1A 4MCWA 2K2NA 4MN7A 4GW9A 2VJWA 3S7OA 2W1RA 3KO6A 2XSSA 5HL6A 1YKDA 3S7NA 3KSHA 3OOVA 4O8GA 4GLQA 4Y3IA 2OOLA 2XRNA 5DFYA 4EUVA 3S7PA 4O0PA 4EU0A 2QYBA 5HSQA 2VKSA 4O01A 2W1TA 3NOPC 2O9CA 5C5KA 2IA2A 3MMHA 2G7UA 2KOIA 4PAUA 3VV4A 2Y79A 5AJGA 3RFBA 4IUHA 1VHMA 5K5BA 3CITA 4IJGA 2VZWA 4Q0HA 3KSFA 2LB5A 4ZRRA 3KSGA 3R4KA 1YSPA 4ETXA 4CQHA 5I5LA 3E0YA 4FOFA 3CI6A 3HCYA 4DMZA 3IBRA 4MMNA 4R6LA 3O5YA 4G3VA 3NOTC 2M7UA 3IBJA 3MQ0A 4LRYC 4Q0IA 3KSIA 3G6OA 3D3OA
chains in the Genus database with same CATH superfamily
2KLIA 2ZMAA 2R78A 3MJQA 4L0LA 3QP5A 2PR5A 3O86A 5FI7A 1ZHHB 4NKPA 4X6TA 2Y2QA 1OTAA 3N7WA 3PAGA 2XF3A 1ONHA 1L0EA 1H8MA 4KZ8A 3C30A 1TS0A 1F98A 3MZDA 4NXBA 3PBSA 3PBTA 5FATA 1ES4A 3DTMA 1F2KA 4BD1A 3GDIA 4LV0A 1T1CA 4KG5A 1RCJA 4GS9A 1OT9A 2W3FA 2V8CA 4PM9A 5TFQA 1S6RA 2Y8HA 2GZAA 1JVJA 4D60A 2WAFA 1XX2A 2PHYA 2VGKA 5HAQA 3A3FA 3GTCA 3S1YA 1FR6A 4HH2A 1KDWA 4LENA 1MWUA 1M40A 1XKZA 3KYQA 2V9AA 2VX8A 3SH7A 3BQAA 4JLFA 4JBFA 5GHXA 1BLCA 5AJGA 4H6JA 5K5BA 1Q2QA 4EBLA 2W27A 2Y2KA 2X71A 2V8FA 3R4KA 3CUEA 3VE4A 3ZHHA 3MR0A 4ETXA 4KZ4A 3SS4A 4DKIA 4DMZA 3EGDC 1EROA 3ZVTA 1S67L 3HLWA 3OC2A 4PKYA 2UV0E 3IF6B 4P6ZM 1T1BA 4PM8A 2DRWA 1BSGA 3OZHA 2ACGA 2WKIA 3ZYTA 5EUAA 4R70A 3TW8A 5M1AA 5EM0A 1MPLA 4MN6A 4DXCA 3ZG0A 2HDRA 4EETB 5CXWA 2PDRA 1W5DA 2JKGA 3PAEA 2ZQDA 3BEBA 5HAIA 4PKYG 3ICYA 3P98A 1OTIA 4ETZA 4E3JA 3FV7A 1BZAA 3IS2B 2HZ5A 4EQ1A 2HP6A 1QMEA 4LCMA 5HL6A 1MBLA 2XD1A 4B88A 3F1PA 4E3LA 3SS3A 5IHVA 4Y3IA 4BQMA 3N6IA 3P09A 3ZNYA 4PM7A 1SKFA 1VETA 4WM9A 5GLDA 2VKSA 5JYOA 3IXHA 3HL9A 1NYYA 2H0TA 1VB6A 3T4JA 4DDSA 1GSVA 4QWOA 3BFGA 4ZBEA 2IWBA 3T4QA 3EWKA 3BLSA 4KQOA 4ARZA 4K0WA 3PBNA 1YSPA 3JYIA 2KDKA 3G32A 5TR7A 4FOFA 1L0DA 3CI6A 4GN2A 3WRTA 1GHPA 1Y4OA 3ZCZA 2EFXA 5A90A 3Q82A 3IWOA 5DTSA 2LB9A 3FZCA 1FILA 2OAP1 3V3SA 3CWFA 4JGPA 4OQHA 5E2EA 3PTEA 5A8BA 4X1MA 1XJ4A 4H8RA 4UQIM 3ZDJA 1I5QA 3R7WB 5KZHA 3EQUA 1WYBA 3F1NA 5CGXA 2Y2JA 4EEUA 1GHIA 5HDSA 2WAEA 2VEAA 4D2OA 5BOHA 1U60A 4HQAA 3B47A 2ZM2A 3LR5A 4LRXC 4UHUA 1OPXA 1ES2A 1OMEA 1ERMA 1P9WA 3CPTA 2UWXA 3PYPA 5DKLA 2FH5A 4C75A 4K08A 3SH9A 2CC1A 4WMCA 4S2NC 1RGZA 2XH9A 4I5SA 1VQQA 3UMEA 4N1HA 3MBZA 4R0QA 3TE8A 1J3WA 5G4ZA 1SDEA 1NZOA 5C5KA 3S4XA 3IWIA 5HWTA 4CLCE 3SS5A 5CX7A 5CHMA 4B4ZA 4ZTKA 3LYXA 4NXFA 1MXOA 2V20A 3KSFA 5EOEA 1CEGA 5CTMA 2Y2LA 4UAAA 5EVEA 5DJTA 2XD5A 3D72A 1LSWA 1XA1A 3UDFA 3GMWA 1P9RA 4P85A 3FYZA 1WA9A 1G6AA 3SOIA 5GL9A 3V3RA 3OCNA 1S0WA 3E2KA 4HJ4A 2B02A 2PBYA 1CF0A 5GHYA 3NDEA 4R4SA 5FQMA 3NDGA 5HAPA 2VGLM 3EEAA 3IX8A 2DNSA 3P7NA 5F83A 3HUOA 3K2NA 2A3UA 3QNBA 4KQRA 4JGQA 4GOGA 1BTLA 2RCXA 3LEQA 4MN7A 2V2FF 4WF0A 3W8KA 4HP4A 2C6WB 3V39A 5AQAA 4EBNA 1TVFA 4E3KA 2ZOIA 3GECA 3BECA 4II7A 3AGDA 3OPRA 1I2SA 1SZVA 2O9CA 3IXGA 5EM1A 2Z2LB 3Q7VA 1N4OA 3VV4A 3CITA 1ZG6A 2OAQ1 3FKWA 1QMFA 2ZLYA 1I2WA 4EWFA 2WUQA 3VMAA 3GR2A 5E43A 4WYYA 3IX4A 1TEMA 3RXWA 1S66L 3KSIA 3ZG5A 4JF4A 3IXDA 5E2HA 5GLAA 4S2MA 4MBHA 4R38A 5L07A 2XROA 2P7JA 1O7EA 3ZFZA 3K3DA 3LI8A 3LUQA 1NZUA 4YNRA 4R3JA 2BTFP 5A92A 4KQDA 1K56D 5AQBA 1MWTA 1WYCA 1ACFA 4YFMA 5G4YA 4KUKA 4KQQA 4BWIA 4ZJ2A 4RQ9A 2L0WA 3SH8A 3PBOA 2VLGA 2Z2MB 4GHIA 4KZAA 5FEGA 1F5MA 4BBVA 1YLYA 4S2OA 3A0RA 4HJ6A 4WL9A 3H82B 2HJ9C 3C2WA 3NECA 4ESPA 1KGGA 3T1QB 3WS4A 1X0OA 1TF1A 3ISGA 4CPKA 3F1OB 3S7OA 1M6KA 2W1RA 4Y0OA 1S4RA 3N8SA 1PWDA 4E3OA 2I72A 2PYRA 4X25A 5FDSA 2EWWA 2G7UA 3E2LA 2OWJA 4Y7PA 2QPNA 4IJGA 4DDYA 2OLVA 2Y2OA 2JN7A 3T4TA 3UE1A 2EWVA 1CI9A 1JWVA 3UO9A 3LIEA 1KOUA 4C6YA 4JKTA 3E4QA 4MMNA 3O5YA 2A24B 1G68A 2V0UA 4U3TA 1NWZA 3T1SA 1DJCA 2ZQ7A 2EX2A 3O3VA 5TBMB 4BL2A 2E8JA 1S1ZA 3C7VA 3HJIA 2J7VA 1XPBA 1PZPA 3ZG8B 3M2JA 4HH3A 3UDIA 4XXRA 1FOFA 5L8MA 2QHKA 5FL3A 3HLCA 1K25A 1Z6FA 1KVLA 3FC7A 5FA7A 3Q7ZA 1H8ZA 1PIOA 1T18A 2JCHA 1YLZA 3T1RA 3MXRA 2XA7S 1YT4A 1FSWA 1LHYA 4L9GA 3DBAA 3HBRA 1MC0A 3W4OA 3MKFA 1ZC2A 4S2IA 2O0YA 4DRTA 2WK0A 4GW9A 2P08A 3VP2A 5FASA 3ZG7B 3MQOA 2WGVA 3BFEA 4EUVA 4IBXA 3UMDA 3LCEA 3OPPA 3C4OA 3VP0A 2D02A 3QP1A 2RL3A 3NBLA 1TS6A 2PAVP 4EBPA 3FPWA 1L2SA 3MSHA 2OV5A 4KZ5A 4KZ9A 4CQHA 2INWA 4RYEA 3NOTC 2J3WA 4QU3A 2WGIA 4QJGA 2Z6DA 4R4RA 2ZMVA 4QB8A 2EXAA 3D3OA 4I3IA 2W3GA 3HUMA 4WEJA 3U4LP 1EWZA 2ZC7A 4S2LA 1ES5A 5F82A 1LL9A 2B18A 4CLCB 2HPBA 4YOFA 2A2LA 4DN0A 1JWZA 5HZHA 2ZM0A 4X55A 4RX3A 2C5WB 3AGEA 5J4EA 4OQ0A 5F68A 4GD8A 3VP1A 4BBTA 1IKIA 1E4DA 1DJBA 2IWDA 3M2KA 3WS0A 5DTTA 3ULFA 5M18A 4NK3A 3KYZA 1TD5A 3ITAA 4JF6A 4ZJ3A 4BMWA 2HV1A 4OLDA 4NG2A 1CI8A 1K55C 4OONA 1PW8A 2BG1A 3R7WA 2O99A 1Z09A 3LIDA 3DWKA 3S7NA 1K6RA 3LIBA 3RH8B 4GLQA 4UA6A 5CRFA 5HW3A 5HSQA 3B3XA 3PR6A 3IQAA 1N9NA 5DF9A 4R3AA 2ZC4B 4PAUA 2Y2NA 4F94A 3RFBA 4OOLA 4N1XA 1K38A 1YAXA 2XQZA 1HD8A 4X53A 1YPRA 1KVMA 3UB6A 1IFQA 3BYDA 3IXBA 3IBRA 4KZ6A 4JGRA 1PZOA 4OPYA 4F3LA 2K7SA 1YMXA 4XT2A 2DMWA 3CLOA 4FUWA 4HHDA 1LT0A 1GHMA 1GSXA 2XK1A 1D06A 3MKEA 4I38A 1TS8A 1K56A 1HVBA 1PYYA 1LI0A 1YLPA 1L0FA 4H6JB 3QP4A 2B95A 1KE3A 1ZKJA 3ZGAB 4R3BA 4IVIA 3WWXA 1P0ZA 2NUTC 3C4PA 3CG5A 5F1FA 2EFUA 4M3KA 1CEFA 1YMSA 1K54C 4QY5A 4MEZA 2R9XA 3M6HA 3P01A 4MBKA 5HPIA 5CEDA 4NETA 2V1AA 5F6AA 1FQGA 2Y2MA 3BJNA 4NXEA 2X01A 4P6BA 2JBFA 1E25A 3A3JA 4OQGA 1GA0A 1ONGA 2EX6A 2XSSA 2P04A 4EW7A 3EEHA 3IH8A 5DJUA 2XRNA 2QYBA 3O87A 1W63M 4O01A 5FI6A 3NOPC 4OH0A 1O07A 1XGIA 2G2WA 1OJ5A 4GCZA 4I39A 4PPRA 3HVFA 3HREA 3E0YA 3SZTA 5CECA 2ZJ9A 1HZOA 4OLGA 2VGJA 1CQAA 3BFFA 2A49A 4Q8IA 4U0XA 4Q0IA 4WUJA 3F1PB 5CEBA 4IVKA 5A93A 3DW0A 4QHCA 4WZ5C 5HL1A 1VETB 3IH9A 3ZQ5A 4JXVA 1SKOA 3WS1A 4BBUA 1ALQA 3JVVA 2XGNA 3UN7A 4WEKA 4DE1A 1V9ZA 4OOMA 2GX5A 1K0KA 3AGFA 3ZVWA 1WE4A 3A0VA 1DY6A 1BLSA 2JKRI 2PRFA 2HDQA 5D3OA 5FI2A 4YWZA 2EA9A 4Y5FA 2J8YA 1K55A 4B4XA 2Y2IA 3K3CA 1RGYA 2NUPC 4G3KA 1L3LA 4B93A 4L9EA 3MF0A 1HTZA 3BLMA 2QJ7A 3Q81A 3QP6A 1SHVA 1D1JA 1JTGA 1UGUA 5HWWA 1G5UA 1LL8A 1YKDA 2XFSA 3IF6C 3F1NB 4N9LA 3A3DA 1ODVA 4LFUA 3LICA 1K57C 5EOOA 4BD0A 1AXBA 3B33A 2Y79A 3DTKA 3H82A 3ZG9B 4IUHA 1N9BA 1J9MA 3IHAA 1IYOA 4HIAA 4LV1A 2P9VA 3HCYA 1NJ4A 2B5RA 2PR6A 3G4PA 1G28A 2ZBBA 3CPTB 3W4QA 2M7UA 3NIAA 3NC8A 1GA9A 3SW1A 4UA7A 2HJEA 1K6SA 1W63Q 2VV7A 3G35A 1OTDA 2WZXA 1C3BA 4LRZE 2XLNA 3W2ZA 3NHQA 1A0KA 4EQIA 3NOUC 3MFXA 1CJFA 4JXWA 4BLMA 4YINA 5DF8A 3T50A 2ZL1A 2VK3A 2XEPA 3E4OA 4ZAMA 4LLOB 4HI4A 5GLBA 1K54A 3BWLA 4UA9A 4DE3A 2BLSA 1NY0A 1FR1A 2W3EA 3UB8A 4N92A 4IBRA 5CERA 2GDNA 3S7QA 1F9IA 4I3JA 1E3UD 1S1YA 1N9OA 5DF7A 3FG8A 1PW1A 2P74A 2Y2PA 3PHYA 2ZQ8A 3S22A 3KSHA 2BASA 4LV3A 2OOLA 1NLZA 3CUEC 4O0PA 3MXSA 4EU0A 5FDHA 1BLPA 4ZJ1A 4FH2A 1FSYA 3QP8A 2IA2A 2H0YA 2WKPA 3CMZA 3T4SA 4PM6A 4ID4A 4WN5A 1NLYA 4S2NA 5F69A 3UE0A 4E6XA 4OVDA 5AQ9A 5FQQA 4O7DA 1W7FA 4PM5A 2H5SA 4R6LA 2IWCA 4RX2A 4AFIA 2L4RA 1S4SA 3OPHA 3HLBA 3T4LA 5JYPA 4P87A 1DRMA 3UPPA 4WZ5A 3IWQA 3MZEA 2E8IA 1XJ3A 2XR0A 2V1ZA 1GCEA 1V9YA 2OWHA 3QNCA 5HX9A 3Q7VB 3L7HA 4ME4A 3IT9A 1VEUB 5HWVA 5IT5A 2MJ6A 5KSCA 1MKIA 2W3HA 4ZDXA 3UB5P 3C38A 1XFNA 4HESA 1FCMA 1LSXA 1BYWA 4X56A 2VA0A 5EVIB 2W1TB 3UNWA 5FQ9A 2AVXA 2WYXA 3PBQA 4EESA 1MKMA 5HDDA 3PBRA 4QY6A 4NXGA 4MCWA 4EERA 5CHJA 2VJWA 2FFFB 3U2AA 4HP9A 4Y17A 5IU1A 3Q1FA 1LL5A 3FWLA 3IF6A 2V0WA 3NULA 1BLHA 2WADA 4HY8A 4GZBA 1K57A 3LR3A 3G30A 5FSRA 3BQ8A 5J8XA 4OPQA 5DKKA 3EQVA 4M4XA 2DCFA 3TJZC 1FIKA 2J3TD 2HP5A 3H7WB 2JKRM 2VZWA 1Y54A 2L1MA 3LGOA 4Y0TA 4GHIB 4Q0HA 1IKGA 3C7UA 4MLLA 3LO7A 1XXMA 1HLUP 5IS1A 4WBGA 1LI9A 2XFTA 3JPUA 3KYEA 2WGWB 5A91A 3MXQA 5EV0A 2G2UA 2QKPA 4OP8A 3LIFA 5F1GA 3G6OA 3GV9A 1EW0A 3BFDA 3IS2A 4E04A 5MC7A 1ESUA 4GB7A 4MNRA 5AQ7A 3CHWP 1Q2PA 2I9VA 3LR4A 3G2ZA 4PHTA 3EGXC 4R23A 1IYQA 4P6ZS 2VV6A 4G3WA 2XA7M 1W8QA 5FAPA 5DVAA 3G31A 4X69A 3V50A 1XJ6A 3GQZA 3IX3A 4A5RA 4Z9QA 4X68A 2ZM8A 5F5YA 4DXBA 4DF6A 3UDXA 4S2JA 3BW6A 1MWSA 2Y55A 3VOZA 2HDSA 4HOIA 4RA7A 4R1GA 4LGWA 4HNBA 3LY4A 3HLFA 5E2FA 4B9OA 3KO6A 3TOIA 2WKEA 3G34A 1H8YA 4KZ3A 4LPZA 2J3TC 2KOIA 5EVID 1XJ2A 2W0NA 1FCNA 5CHUA 5TGFA 1JWPA 1YLTA 3KSGA 1JTDA 1JNUA 4L9FA 4X1LA 2ZQAA 1K4EA 2Y4AA 4K91A 3T4KA 1LLBA 1NYMA 4EV4A 1W79A 1VM1A 1XP4A 3HLEA 3UPNA 1MY8A 4PMAA 4K0XA 5FQJA 4HBTA 4JXGA 2H10A 4Y2FA 3OBFA 2D01A 2JHEA 3LEZA 4GS9B 5DFXA 3V67A 2O9AA 4FTXA 1TS7A 2KX6A 3E98A 3M6BA 4IEDA 2J9OA 2FFYA 1DP9A 3TG9A 3BY9A 5J7EA 1H0MA 4Z1WA 3BFCA 3HLDA 5AVFA 4UQIS 5EE8A 4Y0UA 1NRFA 5EVLA 4MDZA 3TRCA 1ZG4A 5LBRA 1OJGA 1H5XA 4GNUA 4FD8A 4P0MA 4Y15A 4FCFA 2H28A 1E3UA 3I7JA 1G6OA 5CTNA 2PD8A 2Q0OA 3DWZA 1OT6A 4U0TA 4FSFA 1KE4A 4DE0A 5M19A 3OCLA 3O88A 2QWSA 1K4FA 3N8LA 5HD3A 2QZ6A 3BY8A 4C3QA 5EVIC 3MQQA 2OSUA 4E3NA 3UB7A 4CLCD 1P97A 4E3MA 2X02A 4LCLA 1L0GA 2GNXA 5FQIA 4WLAA 1T19A 2Y59A 1TDGA 3L9KA 1PWCA 3DTEA 4JF5A 1D7EA 3VSLA 1YLJA 3CAXA 3UY6A 2PU2A 5EFWA 1YM1A 4KZBA 1DJAA 2HGVA 4GJ4A 3MZFA 3VP4A 5I94A 3RTYA 3KX0X 5DTKA 1YSQA 2K31A 4WZ4A 1OTBA 2JKTI 4GKUA 5L10A 3VE3A 4JPMA 3IF5A 3NCKA 3HUNA 2OLUA 4QD4A 5TJJA 1TDLA 2O9BA 3D9YA 5FAOA 1SDNA 4HJ3A 4OKPA 3OLOA 3Q07A 4BENA 1PWGA 4F3LB 3CZDA 5CGSA 1ZTUA 2QMIA 4OQIA 2R9WA 3VFHA 3V5MA 3VFFA 4XT2B 3T4OA 5HD5A 4ARZB 4Q0JA 4IUKA 2VGLS 3C5AA 4KG2A 4BJPA 2WKRA 2K2NA 4GD6A 3RJUA 4EUZA 3BRMA 4MN5A 3E4PA 4BL3A 3DTIA 2EX8A 2FZ0A 2XDMA 1IELA 2EX9A 1KGFA 4JXSA 3T12B 2WKQA 3DAVA 4CLCC 3WRZA 3A0SA 1KE0A 1PNEA 3A3EA 4HBUA 5GHZA 1VHMA 2HP9A 3VSKA 3GRJA 4OOYA 4N9KA 4XUZA 1BUEA 3WS2A 3CJMA 5FEFA 5EECA 1IOUA 3TSGA 3C8CA 1T1AA 3GSGA 4G3VA 3IHBA 3HJKA 1UWPX 3IBJA 3MQ0A 5J3WA 3OPLA 5G18A 3D4FA 3UE3A 5FAQA 1IYPA 1STZA 2Y2HA 2ZC6B 2ZQCA 2W3DA 3F1OA 5E2GA 5L2FA 3MS6A 1KGEA 1N9LA 3H9WA 1GSWA 1YQSA 1ERQA 3WS5A 2Z6CA 2PBDP 1PI4A 2QJ5A 2YKHA 3BM6A 2Q9MA 1RP5A 2ZC5B 3LFVA 4OPZA 3T1XA 4KG6A 5HPFA 3EOIA 2YKFA 3MFDA 2M1CA 4E3IA 1VEUA 2A24A 2Y91A 2ZMFA 1XGJA 4DJ3A 1W8YA 1SKOB 3N4IA 2WKHA 1ES3A 3QHYA 5U47A 5KSHA 3LY3A 5TBMA 1IYSA 2HF6A 4HEFA 4O8GA 5KMWA 4Y13A 2PD7A 5FQKA 5DFYA 3S7PA 1XA7A 1MZUA 5EVIA 4RVAA 2W1TA 4E6WA 2ZOHA 4FH4A 4CJNA 2J9PA 1PFLA 3W4PA 1AWIA 1KDSA 1MWRA 4LV2A 2PU4A 3UE6A 3VOYA 1PI5A 2J80A 3B42A 3N8RA 2JE5A 4DJ2A 1EI5A 5HARA 1YLWA 5L09A 3VOLA 4I3AA 1UWNX 4DE2A 4LRYC 5CGWA 1Y28A 5EPHA 1BULA 5KIZA 2ZQ9A 4QPRA 4JGOA 4KZ7A 4GDBA 3A3IA 3ITBA 3H7WA 1XFQA 4OP5A 1OTEA 2VV8A 4EEPA 1H3QA 2CMNA 4S2KA 2Q9NA 2WGWA 4NEED 2Y2GA 2WZZA 4WELA 1PRQA 2P9VB 3HLGA 3ZNTA 2ZC3B 3GVBA 3NI9A 1FCOA 5AVEA 2HDUA 2M7VA 4UEYA 4IHQA 2ZD8A 3NJAA 1ESIA 2JKFA 5HDCA 4EXOA 4MBFA 3UB9A 4S2PA 2EXBA 3LR0A 3OOVA 1NRJA 3RXXA 2GJ3A 1CK3A 2JKTM 1IEMA 4CLCA 2ZL1B 3G2YA 3PXPA 4KENB 4WMCD 2V1BA 5HFOA 1NXYA 3MMHA 2JC7A 3UPOA 3JVUA 1BT5A 3LIAA 4KUOA 3FKVA 2LB5A 4ZRRA 4GDNA 5I5LA 1DP6A 4XUXA 5GLCA 1SCWA 3VP3A 1DP8A 3QP2A 1LSVA 4OPRA 3FPVA 3NY4A 3LI9A 2PT7A 2PYPA
chains in the Genus database with same CATH topology
2KLIA 2R78A 3MJQA 4L0LA 4R38A 3ZQ5A 2PR5A 4Y2FA 2XROA 3OBFA 1ZHHB 2D01A 2JHEA 4GS9B 4NKPA 2P7JA 5DFXA 3V67A 4BBUA 3K3DA 3LI8A 3LUQA 1OTAA 3JVVA 4YNRA 2O9AA 1TS7A 1H8MA 4WEKA 3C30A 4KQDA 2KX6A 1V9ZA 3E98A 4OOMA 1TS0A 2GX5A 1DP9A 1F98A 4NXBA 3BY9A 3PBSA 3PBTA 3A0VA 5G4YA 5J7EA 4KUKA 4Z1WA 4BWIA 4RQ9A 2L0WA 5AVFA 2JKRI 3GDIA 2VLGA 3PBOA 4UQIS 4YWZA 2EA9A 4GHIA 4MDZA 1F5MA 1T1CA 4Y5FA 4BBVA 3TRCA 5LBRA 1OJGA 4GS9A 1OT9A 2W3FA 3A0RA 4HJ6A 4WL9A 3H82B 2H28A 3K3CA 2HJ9C 2Y8HA 3C2WA 4G3KA 2NUPC 2GZAA 1G6OA 4B93A 4L9EA 2PD8A 3MF0A 2PHYA 1X0OA 1TF1A 1OT6A 2QJ7A 4FSFA 3F1OB 3S7OA 1UGUA 2W1RA 5HWWA 1LL8A 1S4RA 1YKDA 4HH2A 3OCLA 2QWSA 3F1NB 2PYRA 5HD3A 1ODVA 3KYQA 3BY8A 3LICA 2V9AA 2VX8A 3BQAA 3MQQA 2EWWA 2G7UA 2OWJA 3B33A 2Y79A 5AJGA 3UB7A 4CLCD 1P97A 3H82A 4H6JA 4IUHA 5K5BA 4IJGA 2W27A 2JN7A 3T4TA 4HIAA 2EWVA 2GNXA 3R4KA 1T19A 4WLAA 3CUEA 3VE4A 3MR0A 4ETXA 3LIEA 1KOUA 3HCYA 4DMZA 3E4QA 3EGDC 2PR6A 4MMNA 3O5YA 1D7EA 2A24B 1G28A 2ZBBA 2V0UA 2M7UA 1S67L 4PKYA 1NWZA 3OC2A 3CAXA 3SW1A 5TBMB 4P6ZM 2HJEA 5EFWA 1T1BA 1S1ZA 1W63Q 2VV7A 2HGVA 3HJIA 1OTDA 4GJ4A 3RTYA 4LRZE 4HH3A 3ZYTA 3KX0X 3W2ZA 3NHQA 1YSQA 2K31A 4R70A 3NOUC 3TW8A 1OTBA 2JKTI 3MFXA 5L8MA 2QHKA 5FL3A 3VE3A 4MN6A 3T50A 5TJJA 4EETB 3E4OA 3FC7A 2PDRA 4HI4A 4LLOB 2O9BA 3BWLA 1T18A 4HJ3A 3OLOA 2XA7S 4F3LB 1ZTUA 4PKYG 3ICYA 2W3EA 1OTIA 4L9GA 3DBAA 4ETZA 3UB8A 1MC0A 3IS2B 4XT2B 3T4OA 5HD5A 4ARZB 4Q0JA 4IUKA 3S7QA 2VGLS 2O0YA 4BJPA 2WKRA 4EQ1A 2K2NA 1F9IA 4GW9A 4I3JA 2P08A 1S1YA 1N9OA 3FG8A 5HL6A 3F1PA 3PHYA 3KSHA 4MN5A 2BASA 3MQOA 4Y3IA 2OOLA 3E4PA 1NLZA 4EUVA 3CUEC 4O0PA 3UMDA 4EU0A 2FZ0A 2VKSA 2D02A 1VB6A 3T4JA 2WKQA 1GSVA 4CLCC 3A0SA 2IA2A 1TS6A 2WKPA 3T4QA 1VHMA 3EWKA 3T4SA 3FPWA 4KQOA 4ARZA 4WN5A 1NLYA 3PBNA 5F69A 1YSPA 2KDKA 1IOUA 4CQHA 4FOFA 3C8CA 3CI6A 1T1AA 2INWA 4R6LA 4G3VA 3NOTC 4AFIA 2L4RA 1S4SA 2J3WA 3T4LA 3HJKA 1UWPX 3IBJA 3MQ0A 5J3WA 2Z6DA 2ZMVA 1DRMA 3D3OA 4I3IA 2W3GA 3UE3A 2LB9A 4WEJA 1XJ3A 1STZA 2OAP1 4CLCB 2B18A 3CWFA 4JGPA 2W3DA 3F1OA 4YOFA 1V9YA 2A2LA 4DN0A 2OWHA 5A8BA 1N9LA 3H9WA 4ME4A 1XJ4A 5HZHA 1GSWA 4UQIM 5HWVA 3R7WB 5J4EA 3EQUA 2Z6CA 3F1NA 5IT5A 2MJ6A 5F68A 4EEUA 5HDSA 4BBTA 2QJ5A 2YKHA 2VEAA 2W3HA 3C38A 1XFNA 4HQAA 3LFVA 3B47A 3ULFA 1LSXA 1BYWA 5HPFA 3EOIA 3KYZA 2VA0A 1TD5A 3LR5A 2W1TB 4BMWA 2HV1A 4LRXC 2YKFA 3PBQA 4EESA 1MKMA 2M1CA 5HDDA 3PBRA 1OPXA 4NXGA 2A24A 3R7WA 1P9WA 2O99A 2ZMFA 4MCWA 4DJ3A 3PYPA 4EERA 5DKLA 2VJWA 3U2AA 4HP9A 2FH5A 3LIDA 5IU1A 3S7NA 5KSHA 3LIBA 5TBMA 2HF6A 2V0WA 4O8GA 4K08A 3RH8B 4GLQA 2PD7A 5DFYA 4I5SA 3UMEA 3S7PA 4HY8A 5HSQA 3TE8A 5G4ZA 1MZUA 3LR3A 2W1TA 3PR6A 2ZOHA 3BQ8A 5DKKA 5C5KA 1N9NA 5DF9A 4WUJA 4R3AA 3EQVA 4M4XA 4PAUA 5HWTA 3TJZC 4CLCE 3RFBA 2J3TD 5CX7A 3H7WB 4OOLA 2JKRM 2VZWA 2L1MA 4GHIB 4Q0HA 3UE6A 3LYXA 4NXFA 1YAXA 3KSFA 2J80A 3B42A 3UB6A 4DJ2A 1IFQA 5IS1A 3IBRA 3VOLA 5DJTA 4JGRA 3MXQA 4I3AA 4F3LA 3D72A 1UWNX 1LSWA 2K7SA 2QKPA 3LIFA 4LRYC 1Y28A 3G6OA 3IS2A 1EW0A 4XT2A 1P9RA 2DMWA 3CLOA 5KIZA 4HHDA 4QPRA 4E04A 4JGOA 1LT0A 1WA9A 1GSXA 5MC7A 1D06A 3H7WA 1XFQA 4I38A 2I9VA 3LR4A 4PHTA 1TS8A 1OTEA 2VV8A 3EGXC 4EEPA 1H3QA 3OCNA 4H6JB 4P6ZS 2VV6A 4G3WA 2XA7M 2CMNA 4HJ4A 2B02A 4NEED 1XJ6A 1P0ZA 2NUTC 4WELA 5F5YA 2VGLM 3BW6A 3EEAA 3P7NA 3P01A 5HPIA 3K2NA 5AVEA 4HOIA 2V1AA 5F6AA 2M7VA 4UEYA 3BJNA 4JGQA 4IHQA 4NXEA 4HNBA 3NJAA 4B9OA 4MN7A 5HDCA 4EXOA 4WF0A 3UB9A 3KO6A 2XSSA 4HP4A 2P04A 4EW7A 3LR0A 3EEHA 3OOVA 1NRJA 2GJ3A 2ZOIA 5DJUA 2XRNA 3GECA 2JKTM 2QYBA 4II7A 1W63M 4O01A 4CLCA 3NOPC 3PXPA 2V1BA 2O9CA 3MMHA 4LPZA 2J3TC 2KOIA 3VV4A 1XJ2A 2W0NA 3JVUA 1OJ5A 3CITA 3LIAA 2OAQ1 4GCZA 4I39A 4KUOA 2LB5A 4ZRRA 3KSGA 1JNUA 5I5LA 1DP6A 3E0YA 4L9FA 1DP8A 1LSVA 3T4KA 3FPVA 3LI9A 2PT7A 1S66L 4Q0IA 3KSIA 2PYPA 3F1PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KLI A;  2W3G A;  4QPR A;  4E04 A;  2LB9 A;  2HGV A;  1STZ A;  3ZQ5 A;  4Y2F A;  2XRO A;  2B18 A;  3OBF A;  2W3D A;  4LRZ E;  4YOF A;  5DFX A;  4DN0 A;  3W2Z A;  3NHQ A;  1YSQ A;  2K31 A;  4R70 A;  4ME4 A;  4YNR A;  2O9A A;  3NOU C;  5L8M A;  4G3W A;  3E98 A;  2GX5 A;  5TJJ A;  2VEA A;  2W3H A;  4BWI A;  4Z1W A;  2O9B A;  4RQ9 A;  3LFV A;  3EEA A;  5HPF A;  1TD5 A;  2W1T B;  4MDZ A;  1F5M A;  1ZTU A;  4Y5F A;  3TRC A;  2W3E A;  4LRX C;  5LBR A;  5HPI A;  3K2N A;  3DBA A;  4ETZ A;  1MC0 A;  2W3F A;  1MKM A;  2M7V A;  2Y8H A;  3BJN A;  3C2W A;  4G3K A;  4Q0J A;  4IUK A;  3S7Q A;  3MF0 A;  2O0Y A;  2O99 A;  2ZMF A;  1TF1 A;  4MCW A;  2K2N A;  4MN7 A;  4GW9 A;  2VJW A;  3S7O A;  2W1R A;  3KO6 A;  2XSS A;  5HL6 A;  1YKD A;  3S7N A;  3KSH A;  3OOV A;  4O8G A;  4GLQ A;  4Y3I A;  2OOL A;  2XRN A;  5DFY A;  4EUV A;  3S7P A;  4O0P A;  4EU0 A;  2QYB A;  5HSQ A;  2VKS A;  4O01 A;  2W1T A;  3NOP C;  2O9C A;  5C5K A;  2IA2 A;  3MMH A;  2G7U A;  2KOI A;  4PAU A;  3VV4 A;  2Y79 A;  5AJG A;  3RFB A;  4IUH A;  1VHM A;  5K5B A;  3CIT A;  4IJG A;  2VZW A;  4Q0H A;  3KSF A;  2LB5 A;  4ZRR A;  3KSG A;  3R4K A;  1YSP A;  4ETX A;  4CQH A;  5I5L A;  3E0Y A;  4FOF A;  3CI6 A;  3HCY A;  4DMZ A;  3IBR A;  4MMN A;  4R6L A;  3O5Y A;  4G3V A;  3NOT C;  2M7U A;  3IBJ A;  3MQ0 A;  4LRY C;  4Q0I A;  3KSI A;  3G6O A;  3D3O A; 
#chains in the Genus database with same CATH topology
 2KLI A;  2ZMA A;  2R78 A;  3MJQ A;  4L0L A;  3QP5 A;  2PR5 A;  3O86 A;  5FI7 A;  1ZHH B;  4NKP A;  4X6T A;  2Y2Q A;  1OTA A;  3N7W A;  3PAG A;  2XF3 A;  1ONH A;  1L0E A;  1H8M A;  4KZ8 A;  3C30 A;  1TS0 A;  1F98 A;  3MZD A;  4NXB A;  3PBS A;  3PBT A;  5FAT A;  1ES4 A;  3DTM A;  1F2K A;  4BD1 A;  3GDI A;  4LV0 A;  1T1C A;  4KG5 A;  1RCJ A;  4GS9 A;  1OT9 A;  2W3F A;  2V8C A;  4PM9 A;  5TFQ A;  1S6R A;  2Y8H A;  2GZA A;  1JVJ A;  4D60 A;  2WAF A;  1XX2 A;  2PHY A;  2VGK A;  5HAQ A;  3A3F A;  3GTC A;  3S1Y A;  1FR6 A;  4HH2 A;  1KDW A;  4LEN A;  1MWU A;  1M40 A;  1XKZ A;  3KYQ A;  2V9A A;  2VX8 A;  3SH7 A;  3BQA A;  4JLF A;  4JBF A;  5GHX A;  1BLC A;  5AJG A;  4H6J A;  5K5B A;  1Q2Q A;  4EBL A;  2W27 A;  2Y2K A;  2X71 A;  2V8F A;  3R4K A;  3CUE A;  3VE4 A;  3ZHH A;  3MR0 A;  4ETX A;  4KZ4 A;  3SS4 A;  4DKI A;  4DMZ A;  3EGD C;  1ERO A;  3ZVT A;  1S67 L;  3HLW A;  3OC2 A;  4PKY A;  2UV0 E;  3IF6 B;  4P6Z M;  1T1B A;  4PM8 A;  2DRW A;  1BSG A;  3OZH A;  2ACG A;  2WKI A;  3ZYT A;  5EUA A;  4R70 A;  3TW8 A;  5M1A A;  5EM0 A;  1MPL A;  4MN6 A;  4DXC A;  3ZG0 A;  2HDR A;  4EET B;  5CXW A;  2PDR A;  1W5D A;  2JKG A;  3PAE A;  2ZQD A;  3BEB A;  5HAI A;  4PKY G;  3ICY A;  3P98 A;  1OTI A;  4ETZ A;  4E3J A;  3FV7 A;  1BZA A;  3IS2 B;  2HZ5 A;  4EQ1 A;  2HP6 A;  1QME A;  4LCM A;  5HL6 A;  1MBL A;  2XD1 A;  4B88 A;  3F1P A;  4E3L A;  3SS3 A;  5IHV A;  4Y3I A;  4BQM A;  3N6I A;  3P09 A;  3ZNY A;  4PM7 A;  1SKF A;  1VET A;  4WM9 A;  5GLD A;  2VKS A;  5JYO A;  3IXH A;  3HL9 A;  1NYY A;  2H0T A;  1VB6 A;  3T4J A;  4DDS A;  1GSV A;  4QWO A;  3BFG A;  4ZBE A;  2IWB A;  3T4Q A;  3EWK A;  3BLS A;  4KQO A;  4ARZ A;  4K0W A;  3PBN A;  1YSP A;  3JYI A;  2KDK A;  3G32 A;  5TR7 A;  4FOF A;  1L0D A;  3CI6 A;  4GN2 A;  3WRT A;  1GHP A;  1Y4O A;  3ZCZ A;  2EFX A;  5A90 A;  3Q82 A;  3IWO A;  5DTS A;  2LB9 A;  3FZC A;  1FIL A;  2OAP 1;  3V3S A;  3CWF A;  4JGP A;  4OQH A;  5E2E A;  3PTE A;  5A8B A;  4X1M A;  1XJ4 A;  4H8R A;  4UQI M;  3ZDJ A;  1I5Q A;  3R7W B;  5KZH A;  3EQU A;  1WYB A;  3F1N A;  5CGX A;  2Y2J A;  4EEU A;  1GHI A;  5HDS A;  2WAE A;  2VEA A;  4D2O A;  5BOH A;  1U60 A;  4HQA A;  3B47 A;  2ZM2 A;  3LR5 A;  4LRX C;  4UHU A;  1OPX A;  1ES2 A;  1OME A;  1ERM A;  1P9W A;  3CPT A;  2UWX A;  3PYP A;  5DKL A;  2FH5 A;  4C75 A;  4K08 A;  3SH9 A;  2CC1 A;  4WMC A;  4S2N C;  1RGZ A;  2XH9 A;  4I5S A;  1VQQ A;  3UME A;  4N1H A;  3MBZ A;  4R0Q A;  3TE8 A;  1J3W A;  5G4Z A;  1SDE A;  1NZO A;  5C5K A;  3S4X A;  3IWI A;  5HWT A;  4CLC E;  3SS5 A;  5CX7 A;  5CHM A;  4B4Z A;  4ZTK A;  3LYX A;  4NXF A;  1MXO A;  2V20 A;  3KSF A;  5EOE A;  1CEG A;  5CTM A;  2Y2L A;  4UAA A;  5EVE A;  5DJT A;  2XD5 A;  3D72 A;  1LSW A;  1XA1 A;  3UDF A;  3GMW A;  1P9R A;  4P85 A;  3FYZ A;  1WA9 A;  1G6A A;  3SOI A;  5GL9 A;  3V3R A;  3OCN A;  1S0W A;  3E2K A;  4HJ4 A;  2B02 A;  2PBY A;  1CF0 A;  5GHY A;  3NDE A;  4R4S A;  5FQM A;  3NDG A;  5HAP A;  2VGL M;  3EEA A;  3IX8 A;  2DNS A;  3P7N A;  5F83 A;  3HUO A;  3K2N A;  2A3U A;  3QNB A;  4KQR A;  4JGQ A;  4GOG A;  1BTL A;  2RCX A;  3LEQ A;  4MN7 A;  2V2F F;  4WF0 A;  3W8K A;  4HP4 A;  2C6W B;  3V39 A;  5AQA A;  4EBN A;  1TVF A;  4E3K A;  2ZOI A;  3GEC A;  3BEC A;  4II7 A;  3AGD A;  3OPR A;  1I2S A;  1SZV A;  2O9C A;  3IXG A;  5EM1 A;  2Z2L B;  3Q7V A;  1N4O A;  3VV4 A;  3CIT A;  1ZG6 A;  2OAQ 1;  3FKW A;  1QMF A;  2ZLY A;  1I2W A;  4EWF A;  2WUQ A;  3VMA A;  3GR2 A;  5E43 A;  4WYY A;  3IX4 A;  1TEM A;  3RXW A;  1S66 L;  3KSI A;  3ZG5 A;  4JF4 A;  3IXD A;  5E2H A;  5GLA A;  4S2M A;  4MBH A;  4R38 A;  5L07 A;  2XRO A;  2P7J A;  1O7E A;  3ZFZ A;  3K3D A;  3LI8 A;  3LUQ A;  1NZU A;  4YNR A;  4R3J A;  2BTF P;  5A92 A;  4KQD A;  1K56 D;  5AQB A;  1MWT A;  1WYC A;  1ACF A;  4YFM A;  5G4Y A;  4KUK A;  4KQQ A;  4BWI A;  4ZJ2 A;  4RQ9 A;  2L0W A;  3SH8 A;  3PBO A;  2VLG A;  2Z2M B;  4GHI A;  4KZA A;  5FEG A;  1F5M A;  4BBV A;  1YLY A;  4S2O A;  3A0R A;  4HJ6 A;  4WL9 A;  3H82 B;  2HJ9 C;  3C2W A;  3NEC A;  4ESP A;  1KGG A;  3T1Q B;  3WS4 A;  1X0O A;  1TF1 A;  3ISG A;  4CPK A;  3F1O B;  3S7O A;  1M6K A;  2W1R A;  4Y0O A;  1S4R A;  3N8S A;  1PWD A;  4E3O A;  2I72 A;  2PYR A;  4X25 A;  5FDS A;  2EWW A;  2G7U A;  3E2L A;  2OWJ A;  4Y7P A;  2QPN A;  4IJG A;  4DDY A;  2OLV A;  2Y2O A;  2JN7 A;  3T4T A;  3UE1 A;  2EWV A;  1CI9 A;  1JWV A;  3UO9 A;  3LIE A;  1KOU A;  4C6Y A;  4JKT A;  3E4Q A;  4MMN A;  3O5Y A;  2A24 B;  1G68 A;  2V0U A;  4U3T A;  1NWZ A;  3T1S A;  1DJC A;  2ZQ7 A;  2EX2 A;  3O3V A;  5TBM B;  4BL2 A;  2E8J A;  1S1Z A;  3C7V A;  3HJI A;  2J7V A;  1XPB A;  1PZP A;  3ZG8 B;  3M2J A;  4HH3 A;  3UDI A;  4XXR A;  1FOF A;  5L8M A;  2QHK A;  5FL3 A;  3HLC A;  1K25 A;  1Z6F A;  1KVL A;  3FC7 A;  5FA7 A;  3Q7Z A;  1H8Z A;  1PIO A;  1T18 A;  2JCH A;  1YLZ A;  3T1R A;  3MXR A;  2XA7 S;  1YT4 A;  1FSW A;  1LHY A;  4L9G A;  3DBA A;  3HBR A;  1MC0 A;  3W4O A;  3MKF A;  1ZC2 A;  4S2I A;  2O0Y A;  4DRT A;  2WK0 A;  4GW9 A;  2P08 A;  3VP2 A;  5FAS A;  3ZG7 B;  3MQO A;  2WGV A;  3BFE A;  4EUV A;  4IBX A;  3UMD A;  3LCE A;  3OPP A;  3C4O A;  3VP0 A;  2D02 A;  3QP1 A;  2RL3 A;  3NBL A;  1TS6 A;  2PAV P;  4EBP A;  3FPW A;  1L2S A;  3MSH A;  2OV5 A;  4KZ5 A;  4KZ9 A;  4CQH A;  2INW A;  4RYE A;  3NOT C;  2J3W A;  4QU3 A;  2WGI A;  4QJG A;  2Z6D A;  4R4R A;  2ZMV A;  4QB8 A;  2EXA A;  3D3O A;  4I3I A;  2W3G A;  3HUM A;  4WEJ A;  3U4L P;  1EWZ A;  2ZC7 A;  4S2L A;  1ES5 A;  5F82 A;  1LL9 A;  2B18 A;  4CLC B;  2HPB A;  4YOF A;  2A2L A;  4DN0 A;  1JWZ A;  5HZH A;  2ZM0 A;  4X55 A;  4RX3 A;  2C5W B;  3AGE A;  5J4E A;  4OQ0 A;  5F68 A;  4GD8 A;  3VP1 A;  4BBT A;  1IKI A;  1E4D A;  1DJB A;  2IWD A;  3M2K A;  3WS0 A;  5DTT A;  3ULF A;  5M18 A;  4NK3 A;  3KYZ A;  1TD5 A;  3ITA A;  4JF6 A;  4ZJ3 A;  4BMW A;  2HV1 A;  4OLD A;  4NG2 A;  1CI8 A;  1K55 C;  4OON A;  1PW8 A;  2BG1 A;  3R7W A;  2O99 A;  1Z09 A;  3LID A;  3DWK A;  3S7N A;  1K6R A;  3LIB A;  3RH8 B;  4GLQ A;  4UA6 A;  5CRF A;  5HW3 A;  5HSQ A;  3B3X A;  3PR6 A;  3IQA A;  1N9N A;  5DF9 A;  4R3A A;  2ZC4 B;  4PAU A;  2Y2N A;  4F94 A;  3RFB A;  4OOL A;  4N1X A;  1K38 A;  1YAX A;  2XQZ A;  1HD8 A;  4X53 A;  1YPR A;  1KVM A;  3UB6 A;  1IFQ A;  3BYD A;  3IXB A;  3IBR A;  4KZ6 A;  4JGR A;  1PZO A;  4OPY A;  4F3L A;  2K7S A;  1YMX A;  4XT2 A;  2DMW A;  3CLO A;  4FUW A;  4HHD A;  1LT0 A;  1GHM A;  1GSX A;  2XK1 A;  1D06 A;  3MKE A;  4I38 A;  1TS8 A;  1K56 A;  1HVB A;  1PYY A;  1LI0 A;  1YLP A;  1L0F A;  4H6J B;  3QP4 A;  2B95 A;  1KE3 A;  1ZKJ A;  3ZGA B;  4R3B A;  4IVI A;  3WWX A;  1P0Z A;  2NUT C;  3C4P A;  3CG5 A;  5F1F A;  2EFU A;  4M3K A;  1CEF A;  1YMS A;  1K54 C;  4QY5 A;  4MEZ A;  2R9X A;  3M6H A;  3P01 A;  4MBK A;  5HPI A;  5CED A;  4NET A;  2V1A A;  5F6A A;  1FQG A;  2Y2M A;  3BJN A;  4NXE A;  2X01 A;  4P6B A;  2JBF A;  1E25 A;  3A3J A;  4OQG A;  1GA0 A;  1ONG A;  2EX6 A;  2XSS A;  2P04 A;  4EW7 A;  3EEH A;  3IH8 A;  5DJU A;  2XRN A;  2QYB A;  3O87 A;  1W63 M;  4O01 A;  5FI6 A;  3NOP C;  4OH0 A;  1O07 A;  1XGI A;  2G2W A;  1OJ5 A;  4GCZ A;  4I39 A;  4PPR A;  3HVF A;  3HRE A;  3E0Y A;  3SZT A;  5CEC A;  2ZJ9 A;  1HZO A;  4OLG A;  2VGJ A;  1CQA A;  3BFF A;  2A49 A;  4Q8I A;  4U0X A;  4Q0I A;  4WUJ A;  3F1P B;  5CEB A;  4IVK A;  5A93 A;  3DW0 A;  4QHC A;  4WZ5 C;  5HL1 A;  1VET B;  3IH9 A;  3ZQ5 A;  4JXV A;  1SKO A;  3WS1 A;  4BBU A;  1ALQ A;  3JVV A;  2XGN A;  3UN7 A;  4WEK A;  4DE1 A;  1V9Z A;  4OOM A;  2GX5 A;  1K0K A;  3AGF A;  3ZVW A;  1WE4 A;  3A0V A;  1DY6 A;  1BLS A;  2JKR I;  2PRF A;  2HDQ A;  5D3O A;  5FI2 A;  4YWZ A;  2EA9 A;  4Y5F A;  2J8Y A;  1K55 A;  4B4X A;  2Y2I A;  3K3C A;  1RGY A;  2NUP C;  4G3K A;  1L3L A;  4B93 A;  4L9E A;  3MF0 A;  1HTZ A;  3BLM A;  2QJ7 A;  3Q81 A;  3QP6 A;  1SHV A;  1D1J A;  1JTG A;  1UGU A;  5HWW A;  1G5U A;  1LL8 A;  1YKD A;  2XFS A;  3IF6 C;  3F1N B;  4N9L A;  3A3D A;  1ODV A;  4LFU A;  3LIC A;  1K57 C;  5EOO A;  4BD0 A;  1AXB A;  3B33 A;  2Y79 A;  3DTK A;  3H82 A;  3ZG9 B;  4IUH A;  1N9B A;  1J9M A;  3IHA A;  1IYO A;  4HIA A;  4LV1 A;  2P9V A;  3HCY A;  1NJ4 A;  2B5R A;  2PR6 A;  3G4P A;  1G28 A;  2ZBB A;  3CPT B;  3W4Q A;  2M7U A;  3NIA A;  3NC8 A;  1GA9 A;  3SW1 A;  4UA7 A;  2HJE A;  1K6S A;  1W63 Q;  2VV7 A;  3G35 A;  1OTD A;  2WZX A;  1C3B A;  4LRZ E;  2XLN A;  3W2Z A;  3NHQ A;  1A0K A;  4EQI A;  3NOU C;  3MFX A;  1CJF A;  4JXW A;  4BLM A;  4YIN A;  5DF8 A;  3T50 A;  2ZL1 A;  2VK3 A;  2XEP A;  3E4O A;  4ZAM A;  4LLO B;  4HI4 A;  5GLB A;  1K54 A;  3BWL A;  4UA9 A;  4DE3 A;  2BLS A;  1NY0 A;  1FR1 A;  2W3E A;  3UB8 A;  4N92 A;  4IBR A;  5CER A;  2GDN A;  3S7Q A;  1F9I A;  4I3J A;  1E3U D;  1S1Y A;  1N9O A;  5DF7 A;  3FG8 A;  1PW1 A;  2P74 A;  2Y2P A;  3PHY A;  2ZQ8 A;  3S22 A;  3KSH A;  2BAS A;  4LV3 A;  2OOL A;  1NLZ A;  3CUE C;  4O0P A;  3MXS A;  4EU0 A;  5FDH A;  1BLP A;  4ZJ1 A;  4FH2 A;  1FSY A;  3QP8 A;  2IA2 A;  2H0Y A;  2WKP A;  3CMZ A;  3T4S A;  4PM6 A;  4ID4 A;  4WN5 A;  1NLY A;  4S2N A;  5F69 A;  3UE0 A;  4E6X A;  4OVD A;  5AQ9 A;  5FQQ A;  4O7D A;  1W7F A;  4PM5 A;  2H5S A;  4R6L A;  2IWC A;  4RX2 A;  4AFI A;  2L4R A;  1S4S A;  3OPH A;  3HLB A;  3T4L A;  5JYP A;  4P87 A;  1DRM A;  3UPP A;  4WZ5 A;  3IWQ A;  3MZE A;  2E8I A;  1XJ3 A;  2XR0 A;  2V1Z A;  1GCE A;  1V9Y A;  2OWH A;  3QNC A;  5HX9 A;  3Q7V B;  3L7H A;  4ME4 A;  3IT9 A;  1VEU B;  5HWV A;  5IT5 A;  2MJ6 A;  5KSC A;  1MKI A;  2W3H A;  4ZDX A;  3UB5 P;  3C38 A;  1XFN A;  4HES A;  1FCM A;  1LSX A;  1BYW A;  4X56 A;  2VA0 A;  5EVI B;  2W1T B;  3UNW A;  5FQ9 A;  2AVX A;  2WYX A;  3PBQ A;  4EES A;  1MKM A;  5HDD A;  3PBR A;  4QY6 A;  4NXG A;  4MCW A;  4EER A;  5CHJ A;  2VJW A;  2FFF B;  3U2A A;  4HP9 A;  4Y17 A;  5IU1 A;  3Q1F A;  1LL5 A;  3FWL A;  3IF6 A;  2V0W A;  3NUL A;  1BLH A;  2WAD A;  4HY8 A;  4GZB A;  1K57 A;  3LR3 A;  3G30 A;  5FSR A;  3BQ8 A;  5J8X A;  4OPQ A;  5DKK A;  3EQV A;  4M4X A;  2DCF A;  3TJZ C;  1FIK A;  2J3T D;  2HP5 A;  3H7W B;  2JKR M;  2VZW A;  1Y54 A;  2L1M A;  3LGO A;  4Y0T A;  4GHI B;  4Q0H A;  1IKG A;  3C7U A;  4MLL A;  3LO7 A;  1XXM A;  1HLU P;  5IS1 A;  4WBG A;  1LI9 A;  2XFT A;  3JPU A;  3KYE A;  2WGW B;  5A91 A;  3MXQ A;  5EV0 A;  2G2U A;  2QKP A;  4OP8 A;  3LIF A;  5F1G A;  3G6O A;  3GV9 A;  1EW0 A;  3BFD A;  3IS2 A;  4E04 A;  5MC7 A;  1ESU A;  4GB7 A;  4MNR A;  5AQ7 A;  3CHW P;  1Q2P A;  2I9V A;  3LR4 A;  3G2Z A;  4PHT A;  3EGX C;  4R23 A;  1IYQ A;  4P6Z S;  2VV6 A;  4G3W A;  2XA7 M;  1W8Q A;  5FAP A;  5DVA A;  3G31 A;  4X69 A;  3V50 A;  1XJ6 A;  3GQZ A;  3IX3 A;  4A5R A;  4Z9Q A;  4X68 A;  2ZM8 A;  5F5Y A;  4DXB A;  4DF6 A;  3UDX A;  4S2J A;  3BW6 A;  1MWS A;  2Y55 A;  3VOZ A;  2HDS A;  4HOI A;  4RA7 A;  4R1G A;  4LGW A;  4HNB A;  3LY4 A;  3HLF A;  5E2F A;  4B9O A;  3KO6 A;  3TOI A;  2WKE A;  3G34 A;  1H8Y A;  4KZ3 A;  4LPZ A;  2J3T C;  2KOI A;  5EVI D;  1XJ2 A;  2W0N A;  1FCN A;  5CHU A;  5TGF A;  1JWP A;  1YLT A;  3KSG A;  1JTD A;  1JNU A;  4L9F A;  4X1L A;  2ZQA A;  1K4E A;  2Y4A A;  4K91 A;  3T4K A;  1LLB A;  1NYM A;  4EV4 A;  1W79 A;  1VM1 A;  1XP4 A;  3HLE A;  3UPN A;  1MY8 A;  4PMA A;  4K0X A;  5FQJ A;  4HBT A;  4JXG A;  2H10 A;  4Y2F A;  3OBF A;  2D01 A;  2JHE A;  3LEZ A;  4GS9 B;  5DFX A;  3V67 A;  2O9A A;  4FTX A;  1TS7 A;  2KX6 A;  3E98 A;  3M6B A;  4IED A;  2J9O A;  2FFY A;  1DP9 A;  3TG9 A;  3BY9 A;  5J7E A;  1H0M A;  4Z1W A;  3BFC A;  3HLD A;  5AVF A;  4UQI S;  5EE8 A;  4Y0U A;  1NRF A;  5EVL A;  4MDZ A;  3TRC A;  1ZG4 A;  5LBR A;  1OJG A;  1H5X A;  4GNU A;  4FD8 A;  4P0M A;  4Y15 A;  4FCF A;  2H28 A;  1E3U A;  3I7J A;  1G6O A;  5CTN A;  2PD8 A;  2Q0O A;  3DWZ A;  1OT6 A;  4U0T A;  4FSF A;  1KE4 A;  4DE0 A;  5M19 A;  3OCL A;  3O88 A;  2QWS A;  1K4F A;  3N8L A;  5HD3 A;  2QZ6 A;  3BY8 A;  4C3Q A;  5EVI C;  3MQQ A;  2OSU A;  4E3N A;  3UB7 A;  4CLC D;  1P97 A;  4E3M A;  2X02 A;  4LCL A;  1L0G A;  2GNX A;  5FQI A;  4WLA A;  1T19 A;  2Y59 A;  1TDG A;  3L9K A;  1PWC A;  3DTE A;  4JF5 A;  1D7E A;  3VSL A;  1YLJ A;  3CAX A;  3UY6 A;  2PU2 A;  5EFW A;  1YM1 A;  4KZB A;  1DJA A;  2HGV A;  4GJ4 A;  3MZF A;  3VP4 A;  5I94 A;  3RTY A;  3KX0 X;  5DTK A;  1YSQ A;  2K31 A;  4WZ4 A;  1OTB A;  2JKT I;  4GKU A;  5L10 A;  3VE3 A;  4JPM A;  3IF5 A;  3NCK A;  3HUN A;  2OLU A;  4QD4 A;  5TJJ A;  1TDL A;  2O9B A;  3D9Y A;  5FAO A;  1SDN A;  4HJ3 A;  4OKP A;  3OLO A;  3Q07 A;  4BEN A;  1PWG A;  4F3L B;  3CZD A;  5CGS A;  1ZTU A;  2QMI A;  4OQI A;  2R9W A;  3VFH A;  3V5M A;  3VFF A;  4XT2 B;  3T4O A;  5HD5 A;  4ARZ B;  4Q0J A;  4IUK A;  2VGL S;  3C5A A;  4KG2 A;  4BJP A;  2WKR A;  2K2N A;  4GD6 A;  3RJU A;  4EUZ A;  3BRM A;  4MN5 A;  3E4P A;  4BL3 A;  3DTI A;  2EX8 A;  2FZ0 A;  2XDM A;  1IEL A;  2EX9 A;  1KGF A;  4JXS A;  3T12 B;  2WKQ A;  3DAV A;  4CLC C;  3WRZ A;  3A0S A;  1KE0 A;  1PNE A;  3A3E A;  4HBU A;  5GHZ A;  1VHM A;  2HP9 A;  3VSK A;  3GRJ A;  4OOY A;  4N9K A;  4XUZ A;  1BUE A;  3WS2 A;  3CJM A;  5FEF A;  5EEC A;  1IOU A;  3TSG A;  3C8C A;  1T1A A;  3GSG A;  4G3V A;  3IHB A;  3HJK A;  1UWP X;  3IBJ A;  3MQ0 A;  5J3W A;  3OPL A;  5G18 A;  3D4F A;  3UE3 A;  5FAQ A;  1IYP A;  1STZ A;  2Y2H A;  2ZC6 B;  2ZQC A;  2W3D A;  3F1O A;  5E2G A;  5L2F A;  3MS6 A;  1KGE A;  1N9L A;  3H9W A;  1GSW A;  1YQS A;  1ERQ A;  3WS5 A;  2Z6C A;  2PBD P;  1PI4 A;  2QJ5 A;  2YKH A;  3BM6 A;  2Q9M A;  1RP5 A;  2ZC5 B;  3LFV A;  4OPZ A;  3T1X A;  4KG6 A;  5HPF A;  3EOI A;  2YKF A;  3MFD A;  2M1C A;  4E3I A;  1VEU A;  2A24 A;  2Y91 A;  2ZMF A;  1XGJ A;  4DJ3 A;  1W8Y A;  1SKO B;  3N4I A;  2WKH A;  1ES3 A;  3QHY A;  5U47 A;  5KSH A;  3LY3 A;  5TBM A;  1IYS A;  2HF6 A;  4HEF A;  4O8G A;  5KMW A;  4Y13 A;  2PD7 A;  5FQK A;  5DFY A;  3S7P A;  1XA7 A;  1MZU A;  5EVI A;  4RVA A;  2W1T A;  4E6W A;  2ZOH A;  4FH4 A;  4CJN A;  2J9P A;  1PFL A;  3W4P A;  1AWI A;  1KDS A;  1MWR A;  4LV2 A;  2PU4 A;  3UE6 A;  3VOY A;  1PI5 A;  2J80 A;  3B42 A;  3N8R A;  2JE5 A;  4DJ2 A;  1EI5 A;  5HAR A;  1YLW A;  5L09 A;  3VOL A;  4I3A A;  1UWN X;  4DE2 A;  4LRY C;  5CGW A;  1Y28 A;  5EPH A;  1BUL A;  5KIZ A;  2ZQ9 A;  4QPR A;  4JGO A;  4KZ7 A;  4GDB A;  3A3I A;  3ITB A;  3H7W A;  1XFQ A;  4OP5 A;  1OTE A;  2VV8 A;  4EEP A;  1H3Q A;  2CMN A;  4S2K A;  2Q9N A;  2WGW A;  4NEE D;  2Y2G A;  2WZZ A;  4WEL A;  1PRQ A;  2P9V B;  3HLG A;  3ZNT A;  2ZC3 B;  3GVB A;  3NI9 A;  1FCO A;  5AVE A;  2HDU A;  2M7V A;  4UEY A;  4IHQ A;  2ZD8 A;  3NJA A;  1ESI A;  2JKF A;  5HDC A;  4EXO A;  4MBF A;  3UB9 A;  4S2P A;  2EXB A;  3LR0 A;  3OOV A;  1NRJ A;  3RXX A;  2GJ3 A;  1CK3 A;  2JKT M;  1IEM A;  4CLC A;  2ZL1 B;  3G2Y A;  3PXP A;  4KEN B;  4WMC D;  2V1B A;  5HFO A;  1NXY A;  3MMH A;  2JC7 A;  3UPO A;  3JVU A;  1BT5 A;  3LIA A;  4KUO A;  3FKV A;  2LB5 A;  4ZRR A;  4GDN A;  5I5L A;  1DP6 A;  4XUX A;  5GLC A;  1SCW A;  3VP3 A;  1DP8 A;  3QP2 A;  1LSV A;  4OPR A;  3FPV A;  3NY4 A;  3LI9 A;  2PT7 A;  2PYP A; 
#chains in the Genus database with same CATH homology
 2KLI A;  2R78 A;  3MJQ A;  4L0L A;  4R38 A;  3ZQ5 A;  2PR5 A;  4Y2F A;  2XRO A;  3OBF A;  1ZHH B;  2D01 A;  2JHE A;  4GS9 B;  4NKP A;  2P7J A;  5DFX A;  3V67 A;  4BBU A;  3K3D A;  3LI8 A;  3LUQ A;  1OTA A;  3JVV A;  4YNR A;  2O9A A;  1TS7 A;  1H8M A;  4WEK A;  3C30 A;  4KQD A;  2KX6 A;  1V9Z A;  3E98 A;  4OOM A;  1TS0 A;  2GX5 A;  1DP9 A;  1F98 A;  4NXB A;  3BY9 A;  3PBS A;  3PBT A;  3A0V A;  5G4Y A;  5J7E A;  4KUK A;  4Z1W A;  4BWI A;  4RQ9 A;  2L0W A;  5AVF A;  2JKR I;  3GDI A;  2VLG A;  3PBO A;  4UQI S;  4YWZ A;  2EA9 A;  4GHI A;  4MDZ A;  1F5M A;  1T1C A;  4Y5F A;  4BBV A;  3TRC A;  5LBR A;  1OJG A;  4GS9 A;  1OT9 A;  2W3F A;  3A0R A;  4HJ6 A;  4WL9 A;  3H82 B;  2H28 A;  3K3C A;  2HJ9 C;  2Y8H A;  3C2W A;  4G3K A;  2NUP C;  2GZA A;  1G6O A;  4B93 A;  4L9E A;  2PD8 A;  3MF0 A;  2PHY A;  1X0O A;  1TF1 A;  1OT6 A;  2QJ7 A;  4FSF A;  3F1O B;  3S7O A;  1UGU A;  2W1R A;  5HWW A;  1LL8 A;  1S4R A;  1YKD A;  4HH2 A;  3OCL A;  2QWS A;  3F1N B;  2PYR A;  5HD3 A;  1ODV A;  3KYQ A;  3BY8 A;  3LIC A;  2V9A A;  2VX8 A;  3BQA A;  3MQQ A;  2EWW A;  2G7U A;  2OWJ A;  3B33 A;  2Y79 A;  5AJG A;  3UB7 A;  4CLC D;  1P97 A;  3H82 A;  4H6J A;  4IUH A;  5K5B A;  4IJG A;  2W27 A;  2JN7 A;  3T4T A;  4HIA A;  2EWV A;  2GNX A;  3R4K A;  1T19 A;  4WLA A;  3CUE A;  3VE4 A;  3MR0 A;  4ETX A;  3LIE A;  1KOU A;  3HCY A;  4DMZ A;  3E4Q A;  3EGD C;  2PR6 A;  4MMN A;  3O5Y A;  1D7E A;  2A24 B;  1G28 A;  2ZBB A;  2V0U A;  2M7U A;  1S67 L;  4PKY A;  1NWZ A;  3OC2 A;  3CAX A;  3SW1 A;  5TBM B;  4P6Z M;  2HJE A;  5EFW A;  1T1B A;  1S1Z A;  1W63 Q;  2VV7 A;  2HGV A;  3HJI A;  1OTD A;  4GJ4 A;  3RTY A;  4LRZ E;  4HH3 A;  3ZYT A;  3KX0 X;  3W2Z A;  3NHQ A;  1YSQ A;  2K31 A;  4R70 A;  3NOU C;  3TW8 A;  1OTB A;  2JKT I;  3MFX A;  5L8M A;  2QHK A;  5FL3 A;  3VE3 A;  4MN6 A;  3T50 A;  5TJJ A;  4EET B;  3E4O A;  3FC7 A;  2PDR A;  4HI4 A;  4LLO B;  2O9B A;  3BWL A;  1T18 A;  4HJ3 A;  3OLO A;  2XA7 S;  4F3L B;  1ZTU A;  4PKY G;  3ICY A;  2W3E A;  1OTI A;  4L9G A;  3DBA A;  4ETZ A;  3UB8 A;  1MC0 A;  3IS2 B;  4XT2 B;  3T4O A;  5HD5 A;  4ARZ B;  4Q0J A;  4IUK A;  3S7Q A;  2VGL S;  2O0Y A;  4BJP A;  2WKR A;  4EQ1 A;  2K2N A;  1F9I A;  4GW9 A;  4I3J A;  2P08 A;  1S1Y A;  1N9O A;  3FG8 A;  5HL6 A;  3F1P A;  3PHY A;  3KSH A;  4MN5 A;  2BAS A;  3MQO A;  4Y3I A;  2OOL A;  3E4P A;  1NLZ A;  4EUV A;  3CUE C;  4O0P A;  3UMD A;  4EU0 A;  2FZ0 A;  2VKS A;  2D02 A;  1VB6 A;  3T4J A;  2WKQ A;  1GSV A;  4CLC C;  3A0S A;  2IA2 A;  1TS6 A;  2WKP A;  3T4Q A;  1VHM A;  3EWK A;  3T4S A;  3FPW A;  4KQO A;  4ARZ A;  4WN5 A;  1NLY A;  3PBN A;  5F69 A;  1YSP A;  2KDK A;  1IOU A;  4CQH A;  4FOF A;  3C8C A;  3CI6 A;  1T1A A;  2INW A;  4R6L A;  4G3V A;  3NOT C;  4AFI A;  2L4R A;  1S4S A;  2J3W A;  3T4L A;  3HJK A;  1UWP X;  3IBJ A;  3MQ0 A;  5J3W A;  2Z6D A;  2ZMV A;  1DRM A;  3D3O A;  4I3I A;  2W3G A;  3UE3 A;  2LB9 A;  4WEJ A;  1XJ3 A;  1STZ A;  2OAP 1;  4CLC B;  2B18 A;  3CWF A;  4JGP A;  2W3D A;  3F1O A;  4YOF A;  1V9Y A;  2A2L A;  4DN0 A;  2OWH A;  5A8B A;  1N9L A;  3H9W A;  4ME4 A;  1XJ4 A;  5HZH A;  1GSW A;  4UQI M;  5HWV A;  3R7W B;  5J4E A;  3EQU A;  2Z6C A;  3F1N A;  5IT5 A;  2MJ6 A;  5F68 A;  4EEU A;  5HDS A;  4BBT A;  2QJ5 A;  2YKH A;  2VEA A;  2W3H A;  3C38 A;  1XFN A;  4HQA A;  3LFV A;  3B47 A;  3ULF A;  1LSX A;  1BYW A;  5HPF A;  3EOI A;  3KYZ A;  2VA0 A;  1TD5 A;  3LR5 A;  2W1T B;  4BMW A;  2HV1 A;  4LRX C;  2YKF A;  3PBQ A;  4EES A;  1MKM A;  2M1C A;  5HDD A;  3PBR A;  1OPX A;  4NXG A;  2A24 A;  3R7W A;  1P9W A;  2O99 A;  2ZMF A;  4MCW A;  4DJ3 A;  3PYP A;  4EER A;  5DKL A;  2VJW A;  3U2A A;  4HP9 A;  2FH5 A;  3LID A;  5IU1 A;  3S7N A;  5KSH A;  3LIB A;  5TBM A;  2HF6 A;  2V0W A;  4O8G A;  4K08 A;  3RH8 B;  4GLQ A;  2PD7 A;  5DFY A;  4I5S A;  3UME A;  3S7P A;  4HY8 A;  5HSQ A;  3TE8 A;  5G4Z A;  1MZU A;  3LR3 A;  2W1T A;  3PR6 A;  2ZOH A;  3BQ8 A;  5DKK A;  5C5K A;  1N9N A;  5DF9 A;  4WUJ A;  4R3A A;  3EQV A;  4M4X A;  4PAU A;  5HWT A;  3TJZ C;  4CLC E;  3RFB A;  2J3T D;  5CX7 A;  3H7W B;  4OOL A;  2JKR M;  2VZW A;  2L1M A;  4GHI B;  4Q0H A;  3UE6 A;  3LYX A;  4NXF A;  1YAX A;  3KSF A;  2J80 A;  3B42 A;  3UB6 A;  4DJ2 A;  1IFQ A;  5IS1 A;  3IBR A;  3VOL A;  5DJT A;  4JGR A;  3MXQ A;  4I3A A;  4F3L A;  3D72 A;  1UWN X;  1LSW A;  2K7S A;  2QKP A;  3LIF A;  4LRY C;  1Y28 A;  3G6O A;  3IS2 A;  1EW0 A;  4XT2 A;  1P9R A;  2DMW A;  3CLO A;  5KIZ A;  4HHD A;  4QPR A;  4E04 A;  4JGO A;  1LT0 A;  1WA9 A;  1GSX A;  5MC7 A;  1D06 A;  3H7W A;  1XFQ A;  4I38 A;  2I9V A;  3LR4 A;  4PHT A;  1TS8 A;  1OTE A;  2VV8 A;  3EGX C;  4EEP A;  1H3Q A;  3OCN A;  4H6J B;  4P6Z S;  2VV6 A;  4G3W A;  2XA7 M;  2CMN A;  4HJ4 A;  2B02 A;  4NEE D;  1XJ6 A;  1P0Z A;  2NUT C;  4WEL A;  5F5Y A;  2VGL M;  3BW6 A;  3EEA A;  3P7N A;  3P01 A;  5HPI A;  3K2N A;  5AVE A;  4HOI A;  2V1A A;  5F6A A;  2M7V A;  4UEY A;  3BJN A;  4JGQ A;  4IHQ A;  4NXE A;  4HNB A;  3NJA A;  4B9O A;  4MN7 A;  5HDC A;  4EXO A;  4WF0 A;  3UB9 A;  3KO6 A;  2XSS A;  4HP4 A;  2P04 A;  4EW7 A;  3LR0 A;  3EEH A;  3OOV A;  1NRJ A;  2GJ3 A;  2ZOI A;  5DJU A;  2XRN A;  3GEC A;  2JKT M;  2QYB A;  4II7 A;  1W63 M;  4O01 A;  4CLC A;  3NOP C;  3PXP A;  2V1B A;  2O9C A;  3MMH A;  4LPZ A;  2J3T C;  2KOI A;  3VV4 A;  1XJ2 A;  2W0N A;  3JVU A;  1OJ5 A;  3CIT A;  3LIA A;  2OAQ 1;  4GCZ A;  4I39 A;  4KUO A;  2LB5 A;  4ZRR A;  3KSG A;  1JNU A;  5I5L A;  1DP6 A;  3E0Y A;  4L9F A;  1DP8 A;  1LSV A;  3T4K A;  3FPV A;  3LI9 A;  2PT7 A;  1S66 L;  4Q0I A;  3KSI A;  2PYP A;  3F1P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...