3HUOA

X-ray crystallographic structure of ctx-m-9 s70g in complex with benzylpenicillin
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
262
structure length
262
Chain Sequence
TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CTX-M-9 extended-spectrum beta-lactamase
publication title Dynamic view of the early and late steps of the catalytic mechanism mediated by the emerging enzymes CTX-M.
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 95
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3huoA00
3MZFA 1FSWA 2J7VA 3S22A 4P85A 2C5WB 1E4DA 4R23A 3IQAA 4BL3A 4OQ0A 5FAQA 3W4OA 4BD1A 4GD8A 3HL9A 4MBHA 2ZD8A 2QPNA 2XD1A 2ZC7A 4UA7A 3DWZA 5AQAA 2ZJ9A 4JLFA 4KZ3A 1CEFA 3HLGA 2HDRA 2Y2JA 2B5RA 4GDNA 4GOGA 2ZC3B 4OOYA 5GHYA 1NY0A 2JBFA 3G32A 1SKFA 5CGXA 1LHYA 3Q7VB 1YMXA 1BZAA 3O86A 4KQQA 2ZM2A 1ONGA 5M18A 1FR1A 1KE0A 3OCNA 1IKGA 3V3RA 4OOLA 3IF6A 4ZJ2A 3DTMA 3MBZA 2XFTA 4X56A 1YLYA 3HUMA 2EFXA 3UN7A 3ZDJA 4DF6A 3Q81A 5EECA 5TR7A 4DKIA 2XR0A 1GCEA 3G2YA 3VFHA 4QB8A 1YLWA 3HUOA 1CI8A 3BYDA 2JC7A 4IVKA 1PYYA 4Y0TA 5DTKA 1K25A 3AGEA 5CHJA 1M6KA 5FQJA 4RX2A 5KSHA 4BJPA 4WMCA 4LV1A 5EVIC 3PBNA 2WGIA 3SS4A 3ZVTA 2Y2HA 4WELA 4OVDA 4WM9A 4ZJ1A 1ES4A 2FFFB 5DF7A 3ZHHA 4KZBA 3NY4A 5CTNA 4DE3A 2X02A 5FI7A 2CC1A 2Y59A 1KDSA 4JF4A 5M19A 3NC8A 4RA7A 3VP4A 3P98A 3BM6A 3WS0A 3ISGA 3IWOA 3GTCA 3GQZA 2V20A 3P09A 4KG6A 3Q7ZA 1YM1A 4LV0A 1MXOA 3QNCA 1WYBA 4OPZA 1BSGA 4E3NA 3HBRA 1SCWA 1XX2A 3FWLA 4OOMA 3IF5A 4UA9A 3UDXA 1JVJA 2PU2A 3IH8A 1IELA 4MBFA 1KE3A 5FAOA 4EBNA 5DF8A 3HLFA 1L0DA 3W8KA 1H5XA 5EPHA 1K4FA 4GKUA 4RVAA 3VP2A 1IEMA 3ZFZA 2XQZA 2H5SA 3CMZA 1ERMA 3V5MA 2EXAA 4QU3A 1NJ4A 2J8YA 5CHUA 2HP6A 5GHXA 4F94A 3GV9A 1NRFA 4PM7A 1Q2PA 5E2FA 2EX9A 2JE5A 4DXCA 4KZ4A 5D3OA 3HLDA 5HARA 3EQUA 3IWQA 3ZGAB 5GLCA 4GZBA 1CI9A 1I2SA 1NYMA 2A49A 2IWBA 3SH7A 1YLZA 1TDGA 1K6RA 2ZQ7A 3C5AA 4U0TA 1PWDA 3BECA 4GD6A 3IXDA 4EWFA 2A3UA 3M2JA 4E3JA 1ZC2A 4KZ8A 1BUEA 2WAEA 4X6TA 3DWKA 1RCJA 1TVFA 4KZ9A 1NZOA 2V2FF 1E3UD 4LENA 4WZ5C 3MXRA 3SS5A 2RL3A 3LO7A 4EBLA 4X55A 1MWUA 3Q07A 3O87A 2WGWB 3B3XA 3G31A 1DJAA 3OPRA 4M3KA 3G4PA 2RCXA 1DJCA 3Q1FA 3N7WA 2WKHA 3IHAA 2Y4AA 4QJGA 3A3IA 3OPHA 4HESA 4WZ5A 5FQKA 1ONHA 4PPRA 4R1GA 3BFGA 4FCFA 1O7EA 5E43A 4E3MA 2WYXA 3WS1A 2P74A 4BENA 4Z9QA 4GN2A 4ZAMA 2Y2KA 4LCLA 3VP1A 1MWTA 2J9OA 2Y2QA 5CEDA 4PM5A 1JTGA 1NZUA 3LEZA 5EOOA 5A91A 3V39A 3DW0A 3NDGA 2EXBA 2OSUA 2ZQCA 4OQHA 3VOYA 3Q7VA 1QMFA 3MKFA 1O07A 4FH4A 3N8LA 4L0LA 4DRTA 1YMSA 1ZG6A 1K38A 3IWIA 3UPNA 3BFDA 3NIAA 1IKIA 4K91A 3SH8A 3IF6C 4FD8A 5IHVA 4E3OA 1WE4A 3V3SA 4OP5A 1MPLA 1PW1A 2DNSA 4KENB 1ERQA 4LV3A 1L0FA 4UA6A 4Y0OA 5AQ7A 3BLSA 5J8XA 4K0XA 1NYYA 2H0TA 3VP0A 1W79A 4X68A 3AGDA 4E3LA 2XF3A 1LL5A 5DTTA 5E2EA 4LV2A 1C3BA 2H0YA 4YINA 1OMEA 4EBPA 1MY8A 5F82A 3BFFA 1JWZA 5HAIA 1GHMA 1N4OA 1E25A 4JXVA 3MKEA 3UDFA 1FCMA 3E2KA 4B88A 5CTMA 4UAAA 2I72A 5HFOA 3OZHA 3ZG0A 1S6RA 4QD4A 3ITAA 3WS4A 1PI4A 1KGEA 3ZG9B 4OLDA 4KZAA 3A3JA 5CEBA 1K4EA 1KGGA 2IWDA 2ZQAA 1Q2QA 4MEZA 1RGZA 3HLEA 4S2PA 2QZ6A 4S2JA 4QY6A 4DXBA 1XGJA 4PM9A 2G2UA 4S2NC 3GSGA 3QNBA 3UPOA 2PU4A 3C4PA 3FV7A 1XA1A 1PZPA 4BLMA 4X69A 1KVLA 5EVID 5CECA 1IYOA 1ZG4A 2HDSA 5HAQA 1FCNA 1FCOA 4N1HA 3RXXA 3UNWA 4Q8IA 1ES3A 1ESIA 1JWVA 1K55A 3EQVA 4OPYA 4WZ4A 1YLJA 1K57A 4JXWA 4S2NA 2G2WA 4JF6A 1W5DA 4YFMA 2Y55A 3IT9A 4LCMA 1ES5A 1EWZA 3TG9A 1BLPA 1LLBA 3CG5A 2XH9A 1CK3A 2X01A 4B4XA 2PBYA 3PBQA 3WS2A 4H8RA 4E6XA 4GB7A 1EROA 5CHMA 4ZJ3A 1SDNA 3G30A 3N8SA 4S2MA 3ITBA 3M6BA 3C7VA 4IEDA 3GMWA 4O7DA 4EV4A 1GHIA 1N9BA 4S2IA 1TEMA 1ESUA 4NK3A 1YQSA 3WRTA 1FSYA 3HVFA 5EVIB 5GLDA 4IVIA 3PAGA 4OPQA 4RX3A 3PTEA 3IH9A 4ZTKA 2UWXA 3N6IA 5JYPA 2WZZA 3ZNYA 2WGWA 4KQOA 4KZ6A 3MZDA 4XUZA 5FQIA 3PAEA 4KG2A 5FSRA 4JPMA 5L2FA 1KDWA 1RP5A 5EUAA 2VGKA 2Y91A 5EVLA 1IYQA 2P9VB 2ZC4B 4A5RA 2Y2PA 3BFCA 4P0MA 2Q9NA 4FSFA 3M6HA 1XKZA 1BLSA 1ES2A 1YLPA 1JWPA 3OC2A 4MNRA 5A92A 1Y54A 1IYPA 2XLNA 4ZDXA 4BL2A 4PM6A 1IYSA 3IXBA 1L2SA 4EQIA 1SHVA 3GVBA 5HAPA 4QY5A 2R9XA 4E6WA 2Y2LA 1FQGA 2FFYA 3N8RA 1E3UA 5CXWA 4RYEA 2HP9A 4HEFA 3SH9A 1TDLA 1PWCA 3PBTA 2C6WB 2Y2OA 4UHUA 2OLVA 3LY3A 4CPKA 3UY6A 4OONA 3S4XA 4JBFA 1XXMA 1NXYA 3IXHA 3VMAA 1MKIA 2EX2A 1G68A 1RGYA 4ZBEA 4IBXA 2Y2GA 4FH2A 1DY6A 1WYCA 3VSLA 3A3EA 3HUNA 4N9LA 3WS5A 1YT4A 3A3DA 3FZCA 3WRZA 3GR2A 3C4OA 5HL1A 1BULA 1W8YA 2OV5A 3ZG8B 3UDIA 2XDMA 4WYYA 1MWRA 4WBGA 1K54C 4KZ5A 1BTLA 5FQQA 3W4PA 1LI9A 5CRFA 4EUZA 4X53A 3FKVA 3W4QA 4R4SA 5FI6A 2EX8A 3NBLA 2ZC5B 2ZM0A 4CJNA 1HVBA 1VQQA 1JTDA 3UPPA 2Y2NA 5BOHA 3MFDA 5DTSA 1VM1A 4ID4A 4N1XA 3BFEA 3OPPA 2HDQA 1S0WA 1K54A 2WKIA 2BLSA 3LY4A 5F83A 5U47A 5G18A 2XFSA 4JXSA 4S2OA 4OLGA 4JF5A 3BLMA 5I94A 4DE0A 4K0WA 3TOIA 4MLLA 2EFUA 3PBSA 4PMAA 5GLAA 3RXWA 3ZCZA 1PW8A 2WUQA 4NETA 4OKPA 3BRMA 1BT5A 3VFFA 5DF9A 1J9MA 1FR6A 2HPBA 4DDYA 4WEKA 4WMCD 3HLBA 5CERA 3RJUA 3GRJA 1H8ZA 5F1GA 4IBRA 1QMEA 5GLBA 3HLCA 5TGFA 3S1YA 3VOZA 1GHPA 3JYIA 2R9WA 3OPLA 3WWXA 5A90A 1K55C 5FDHA 3TSGA 4C75A 2WADA 3MZEA 5CGWA 2XEPA 1FOFA 4KZ7A 1K57C 4U0XA 1ALQA 5M1AA 3IF6B 4BD0A 4GNUA 1HTZA 2Y2IA 4E3IA 1U60A 5FATA 1HZOA 2Z2LB 4WEJA 3UE3A 3QHYA 2WKEA 1XP4A 4BQMA 1G6AA 4DDSA 5AQ9A 3UE0A 1EI5A 1W7FA 3VSKA 4C3QA 2ZQ9A 1PZOA 1K56D 5AQBA 3N4IA 1XA7A 3ZVWA 3FYZA 3V50A 5TFQA 3AGFA 2DRWA 1LL9A 2HP5A 3A3FA 3E2LA 2ZM8A 1I2WA 3D4FA 4C6YA 1KGFA 4OPRA 1GA0A 1DJBA 4D2OA 4E3KA 2H10A 1Z6FA 5EVIA 5E2GA 2Y2MA 3I7JA 3NDEA 2ZC6B 1K6SA 3MXSA 2HDUA 5E2HA 1PI5A 1MWSA 2X71A 3C7UA 5KMWA 3UE1A 4S2KA 5HX9A 1H8YA 2IWCA 1M40A 2ZLYA 4OP8A 3CZDA 1GA9A 1K56A 2P9VA 1W8QA 2WZXA 5CGSA 4MBKA 4PM8A 4R3JA 4P6BA 5KSCA 1HD8A 2XGNA 4OQIA 5JYOA 4Y0UA 2QMIA 3O3VA 4DE2A 2V1ZA 4KG5A 2Q9MA 5FI2A 1YLTA 5GHZA 3CJMA 3FKWA 2EX6A 4XXRA 3NI9A 5KZHA 3NCKA 3IHBA 5F1FA 1CEGA 1BLHA 3OCLA 4N92A 4P87A 1L0EA 2OLUA 5DVAA 2JCHA 5EE8A 3LCEA 4N9KA 3ZNTA 4JKTA 5EOEA 2ZQ8A 2VGJA 3BEBA 4OQGA 3HREA 4HBTA 3VP3A 2E8IA 5A93A 2WGVA 3G2ZA 1I5QA 4DE1A 2GDNA 3ZG7B 3ZG5A 1XGIA 3PBRA 4U3TA 2WK0A 5FASA 1KVMA 5FQMA 3SOIA 1BLCA 4QHCA 4S2LA 2ZMAA 1AXBA 3G34A 1XPBA 2XD5A 4GDBA 4Y7PA 1PIOA 5GL9A 1MBLA 5HW3A 3M2KA 5FQ9A 4R0QA 2J9PA 3Q82A 1PWGA 4OH0A 4B4ZA 2ZQDA 1SDEA 1ZKJA 3HLWA 2WAFA 1LI0A 2BG1A 4R3BA 1KE4A 2Z2MB 3PBOA 4KQRA 5FA7A 2XK1A 3G35A 5FAPA 4R4RA 3O88A 1L0GA 3IXGA 4HBUA 3UO9A 3SS3A 4JXGA 2DCFA 4XUXA
chains in the Genus database with same CATH superfamily
4DN0A 4P85A 2C5WB 4R23A 4BL3A 4BD1A 2QPNA 2ZC7A 4UA7A 5AQAA 4JLFA 3HLGA 2HDRA 3CAXA 1H3QA 2B5RA 4GOGA 2Z6CA 1VB6A 1GSVA 5L8MA 2VEAA 2ZM2A 4ZRRA 3V3RA 2QHKA 4GW9A 3MR0A 2M1CA 3HUMA 3ZDJA 5TR7A 1YLWA 5IT5A 2JC7A 3B33A 4IVKA 1PYYA 1K25A 5AVFA 5CHJA 1SKOA 4KQDA 4LRZE 5FDSA 4WELA 1S4RA 4EEUA 4ZJ1A 1ES4A 2FFFB 3NY4A 2CC1A 1KDSA 4JF4A 3T1RA 3P98A 3QP6A 3ISGA 3QP8A 3BY8A 1YM1A 1L3LA 4YOFA 5FEFA 2JN7A 1WYBA 2XRNA 1BSGA 3FWLA 3U4LP 1JVJA 3IH8A 1IELA 4O01A 5IS1A 3W8KA 1K4FA 2L1MA 3ZFZA 2HZ5A 5CHUA 5GHXA 2HP6A 2JKGA 4PM7A 1Q2PA 1OT6A 4DXCA 3FG8A 3BW6A 3EQUA 2IWBA 1YLZA 4X1LA 1TDGA 3BECA 4GD6A 4UQIS 2V1BA 5HWVA 1BUEA 1TVFA 1NZOA 2V2FF 1E3UD 3EEAA 2RL3A 3TW8A 3O87A 3B3XA 3OPRA 3G4PA 3Q1FA 2O9BA 4I3AA 3N7WA 1NLYA 5FQKA 5DFXA 2Y8HA 1F2KA 2P74A 5HD3A 2Y2KA 4LCLA 2J9OA 2JHEA 5CEDA 2QYBA 3LEZA 3V39A 3DW0A 3NDGA 1QMFA 3MKFA 3KO6A 4EU0A 3SH8A 3IS2A 3V3SA 1MPLA 4KENB 2VLGA 5J8XA 2H0TA 1W79A 4E3LA 2W27A 5DTTA 3L7HA 4YINA 4EBPA 1JWZA 5HAIA 3CUEA 3P7NA 3MKEA 4MMNA 3MXQA 5HFOA 1KOUA 1S6RA 3ITAA 3HCYA 4OLDA 1KGGA 1D1JA 4MEZA 2ZQAA 3UB6A 1VEUB 3DBAA 3D3OA 4S2PA 1XGJA 3FV7A 2W3DA 1ZG4A 5HAQA 1FCNA 3EQVA 1ZHHB 1YLJA 2JKTI 2G2WA 4YFMA 2Y55A 1BLPA 1GSXA 4B4XA 4EERA 3WS2A 3R7WA 3BQ8A 2INWA 1EROA 4ZJ3A 1SDNA 3G30A 3N8SA 1D06A 3ITBA 3C7VA 3OLOA 4EV4A 2ZBBA 2ZL1B 4RQ9A 1ESUA 3DTKA 5MC7A 4RX3A 3ZNYA 4KQOA 5FQIA 5FSRA 1KDWA 1RP5A 5EVLA 3PYPA 5AVEA 1BLSA 3OC2A 1JWPA 2XLNA 4ZDXA 1J3WA 2VA0A 3MS6A 1NLZA 1IYSA 4EQIA 1SHVA 2V9AA 3GVBA 2EWWA 4E6WA 4NEED 5CXWA 2FFYA 4HEFA 3VOLA 4OONA 3S4XA 1MKIA 1RGYA 5TJJA 1S1ZA 1DY6A 1WYCA 3HJKA 1G5UA 5CX7A 3A3DA 5HL1A 1BULA 1W8YA 3ZG8B 3TJZC 4GS9B 1MWRA 1K54C 1BTLA 4JGQA 5CRFA 4EUZA 4R4SA 5FI6A 4F3LB 2ZC5B 4Y17A 4CJNA 3UPPA 5BOHA 1VM1A 3BFEA 3OPPA 1K54A 5G18A 2XFSA 1YKDA 4JF5A 3BLMA 4O8GA 4UQIM 2WUQA 5G4YA 1BT5A 1FR6A 4WEKA 3HLBA 4FOFA 3GRJA 3K3DA 1QMEA 3HLCA 1GHPA 2A24A 2R9WA 5A90A 4HI4A 5CGWA 4U0XA 1ALQA 1YSPA 2JKTM 4BD0A 2OOLA 2Y2IA 4WEJA 1P9WA 2VV8A 3UE0A 1EI5A 1W7FA 3ZVWA 3FYZA 3CHWP 5TFQA 1SKOB 4C6YA 1KGFA 3T4QA 1GA0A 4BBVA 5EVIA 2Y2MA 3KYZA 5E2HA 1MWSA 2X71A 1VETA 4OP8A 1GA9A 1F9IA 2WZXA 1W8QA 5CGSA 5KSCA 1HD8A 5TBMA 5JYOA 2YKFA 4IHQA 2Q9MA 5FI2A 5GHZA 2EX6A 3VV4A 2Q0OA 1N9OA 4YWZA 2V0WA 3U2AA 1T1AA 2ZQ8A 4PKYA 4LRXC 3UB5P 5A93A 4I5SA 1I5QA 4Q0IA 1KVMA 4QHCA 4S2LA 3S7QA 1UWNX 1OTIA 1MBLA 2V0UA 1PWGA 2ZQDA 2BG1A 4R3BA 4DJ3A 2Z2MB 3KSHA 3CWFA 3UMEA 2XK1A 4MN5A 5FAPA 4R4RA 3SS3A 1CEGA 1XXMA 5L07A 2PT7A 3MZFA 1E4DA 4OQ0A 3HL9A 1TS6A 4KZ3A 1CEFA 2PDRA 2PHYA 4OOYA 5GHYA 1SKFA 5CGXA 1YMXA 1ONGA 2DMWA 3OCNA 4Y3IA 4OOLA 3IS2B 3IF6A 3MMHA 3ZYTA 3LR3A 2XR0A 4DKIA 2V8CA 1GCEA 4X25A 3VFHA 4QB8A 2O9CA 3BYDA 1XFNA 4Y0TA 2ZOIA 3AGEA 3E0YA 3JVVA 1X0OA 2V8FA 3QP1A 4RX2A 3P01A 4BJPA 3IX4A 2WGIA 4OVDA 4QWOA 4I3IA 3ZHHA 2X02A 5FI7A 1PFLA 3LI8A 2G7UA 5M19A 3VP4A 1AWIA 4YNRA 3IWOA 3GTCA 4KG6A 4B9OA 4E3NA 3HBRA 2O0YA 4OOMA 5DF8A 2O9AA 1L0DA 1H5XA 5EPHA 4RVAA 3VP2A 4HJ6A 1IEMA 2XQZA 1ERMA 2K2NA 3V5MA 3D9YA 1NJ4A 2J8YA 3EGDC 2PAVP 4F94A 2KOIA 1NRFA 5E2FA 2EX9A 4KZ4A 4BMWA 5HARA 3ZGAB 3C2WA 5GLCA 2A49A 3R7WB 2ZQ7A 1H0MA 2O99A 4HNBA 3M2JA 2WAEA 4X6TA 1RCJA 4KZ9A 4PKYG 4WZ5C 3NECA 4EXOA 5DKLA 3G31A 3SW1A 1W63M 3MF0A 3K3CA 1MKMA 4L9EA 1NRJA 3OPHA 4WZ5A 2Z6DA 1O7EA 2ZMFA 4GHIA 4E3MA 2WYXA 4MDZA 2VZWA 4Z9QA 4Q0JA 1MWTA 2Y2QA 4PM5A 1NZUA 2EXBA 4OQHA 3Q7VA 4FH4A 3N8LA 2UV0E 3H82A 1MC0A 1K38A 3BFDA 1ODVA 4FD8A 4HOIA 1WE4A 4ETZA 1PW1A 3T50A 4R3AA 2DNSA 1ERQA 3O5YA 3BLSA 2QJ5A 4K0XA 3VP0A 5HWWA 3KSGA 3LR5A 1LL5A 3F1PA 5F82A 3BFFA 1GHMA 2VGLM 5EV0A 3UDFA 3E2KA 4UAAA 2I72A 3OZHA 5F68A 4NXFA 4QD4A 3FPWA 1PI4A 3ZG9B 4KZAA 5KIZA 3B47A 4CLCE 2QZ6A 4PM9A 4S2NC 3L9KA 3GSGA 1OTDA 3T4OA 1FIKA 1PZPA 5EVID 5CECA 1IYOA 5HDSA 2HDSA 2A24B 1FCOA 3GDIA 1ES3A 3LIAA 4K08A 1ESIA 1K55A 1K57A 4S2NA 4LCMA 1ES5A 1CK3A 3NHQA 4MN7A 2K31A 4WL9A 4H8RA 1GHIA 1TEMA 3WRTA 5GLDA 5EVIB 4IVIA 3PAGA 3PTEA 4ZTKA 3N6IA 1VETB 4KZ6A 3V67A 1H8MA 2ZC4B 4A5RA 2Y2PA 5TBMB 2Q9NA 4FSFA 1XKZA 2WKQA 4MNRA 1Y54A 3G6OA 2PR5A 4HP9A 4PM6A 4MN6A 1FILA 3IXBA 3LFVA 2R9XA 2Y2LA 3UB8A 3DTEA 3LEQA 1PWCA 3LI9A 4II7A 3JVUA 3PBTA 2C6WB 3W2ZA 3LY3A 4CPKA 3UY6A 3BQAA 4LFUA 4X1MA 1NXYA 3VMAA 5FEGA 1G68A 4ZBEA 1V9ZA 3BY9A 3VSLA 3A3EA 4N9LA 3WS5A 1YT4A 3FZCA 3GR2A 3C4OA 4HJ3A 4WYYA 5I5LA 1XJ3A 3S7PA 2CMNA 5FQQA 3CUEC 3FKVA 3RTYA 2PYRA 2ZM0A 2Y2NA 3DAVA 2WKIA 5F83A 4S2OA 5I94A 4K0WA 3TOIA 2EFUA 3PBSA 4PMAA 3ZCZA 2FH5A 4OKPA 3VFFA 5DF9A 4NXEA 5CERA 1H8ZA 4IBRA 5TGFA 3S1YA 1Y28A 3JYIA 2WADA 3MZEA 4KZ7A 2I9VA 5M1AA 2K7SA 3IF6B 4GNUA 3MQ0A 1U60A 5FATA 1HZOA 2W3HA 4BQMA 1G6AA 4DDSA 4EEPA 2VV7A 4EETB 5A8BA 4R6LA 1PZOA 5L09A 2J3WA 1K56D 5AQBA 3N4IA 3AGFA 3BWLA 2HP5A 5DFYA 2WKPA 3CITA 3NOPC 3MSHA 1K6SA 3MXSA 4Z1WA 2B18A 5KMWA 5HX9A 4R3JA 4PM8A 4OQIA 4CLCA 4DE2A 2V1ZA 2P7JA 4XXRA 3NI9A 1WA9A 5KZHA 2HJEA 3NCKA 4HP4A 4EESA 2OAQ1 4P6ZS 3PXPA 1L0EA 2JCHA 2XROA 4N9KA 4JKTA 4NKPA 4OQGA 2WGVA 3G2ZA 2GDNA 3ZG7B 1XGIA 3PBRA 1OJGA 5FQMA 1BLCA 3NULA 1XJ6A 1OTEA 1AXBA 2ZMAA 4KUOA 4D60A 1PIOA 2W3FA 3M2KA 4ARZA 1SDEA 1K0KA 2WAFA 1LI0A 2PR6A 1KE4A 3PBOA 4KQRA 5FA7A 2LB9A 3G35A 3VE3A 3O88A 1L0GA 4HBUA 3UO9A 1YAXA 3KYQA 1FSWA 5EM0A 3IQAA 1JNUA 5G4ZA 4MBHA 4GHIB 2ZD8A 3DWZA 2ZJ9A 1S67L 2Y2JA 3T12B 2ZC3B 3EGXC 3Q7VB 4BBTA 1YSQA 3O86A 3H82B 2HF6A 1KE0A 2PYPA 3MBZA 2WKRA 3Q81A 4JGRA 5HDDA 3HUOA 1CI8A 3EOIA 5DTKA 5F69A 5IU1A 1M6KA 3F1PB 3E98A 4LV1A 5EVIC 1TS7A 4IJGA 1OJ5A 1D7EA 5DF7A 4KZBA 4DE3A 1DP9A 1IFQA 2Y59A 3NC8A 3RH8B 3BM6A 3WS0A 2KX6A 3GQZA 2V20A 4LV0A 3UMDA 5EFWA 3HJIA 3QNCA 4HJ4A 2J80A 2BASA 1XX2A 3UDXA 4EBNA 1KE3A 3S7NA 1T19A 3K2NA 2J3TD 2W3GA 3CMZA 2B95A 2EXAA 4QU3A 1BYWA 1Y4OA 3GV9A 2JE5A 5D3OA 3HLDA 3IWQA 1NYMA 2VGLS 3C5AA 1PWDA 2HJ9C 3T1QB 4EWFA 3ICYA 1ZC2A 4KZ8A 3DWKA 4B93A 3MXRA 3SS5A 3LO7A 1MWUA 5HWTA 3A0SA 2PBDP 1DJAA 4M3KA 1N9NA 1TF1A 1DJCA 5L10A 2WKHA 1PNEA 1XJ4A 2AVXA 3A3IA 3ULFA 3KX0X 4PPRA 4R1GA 4FCFA 3WS1A 4BENA 4GN2A 3VP1A 4QPRA 5EOOA 3T4TA 3F1OA 4I39A 2ZQCA 4DMZA 1CF0A 3VOYA 1O07A 1LT0A 1ZG6A 3NIAA 1IKIA 1UGUA 3IF6C 3UB9A 5IHVA 4E3OA 4OP5A 1V9YA 4Y0OA 4LV3A 1L0FA 4O0PA 4UA6A 1NYYA 1LL8A 1A0KA 2P08A 3H7WA 4X68A 4P6ZM 2XF3A 3MQOA 4LV2A 1C3BA 2H0YA 1MY8A 4NXBA 3LIBA 3LYXA 4HIAA 1N4OA 1E25A 3C8CA 4JXVA 1FCMA 4B88A 5CTMA 1ZTUA 1IOUA 3A3JA 3BJNA 5CEBA 2IWDA 1Q2QA 1RGZA 3T4KA 4DXBA 4Y5FA 2G2UA 5AJGA 2PU4A 3C4PA 4X69A 4Q8IA 2L0WA 2W0NA 4ETXA 1LSWA 2OWHA 1P9RA 1W5DA 4XT2A 2PBYA 4DJ2A 4E6XA 4GB7A 1T18A 4Y13A 4S2MA 3IBRA 2VJWA 1T1CA 4O7DA 1N9BA 4S2IA 4NK3A 1YQSA 4OPQA 4KUKA 3IH9A 2UWXA 2WGWA 4KG2A 5L2FA 4JPMA 4CQHA 3E4PA 4CLCB 3M6HA 5A92A 1YLPA 3C38A 1S66L 5HAPA 4QY5A 4M4XA 4Y15A 4I38A 3IX8A 1FQGA 3N8RA 4RYEA 2QJ7A 2EWVA 4Q0HA 3IXHA 3OOVA 3MQQA 4IBXA 3NOTC 3HUNA 3WRZA 4ARZB 2PD7A 3T4LA 3UDIA 2XDMA 4WBGA 2ACGA 2W1TA 4EQ1A 1LI9A 4X53A 3W4QA 3NBLA 1HVBA 1JTDA 5F6AA 2JKFA 3MFDA 5DTSA 2HDQA 1S0WA 2BLSA 3LY4A 5U47A 4FUWA 4JXSA 2NUPC 4DE0A 4MLLA 5GLAA 3H9WA 1J9MA 2ZOHA 4WUJA 4LPZA 1XJ2A 3WWXA 3OPLA 1K55C 4C75A 5FL3A 1SZVA 1K57C 3RFBA 3B42A 2HGVA 1HTZA 4JGPA 3UE3A 3QHYA 2WKEA 1Z09A 4G3VA 4NXGA 5AQ9A 3VSKA 4C3QA 2ZQ9A 1DP6A 2QWSA 2VX8A 3A0VA 3LIFA 1YPRA 1XA7A 3LUQA 3LIDA 1LL9A 3E2LA 2ZM8A 1DJBA 1Z6FA 2ZC6B 2HDUA 2GNXA 3C7UA 2J3TC 1MZUA 3F1NA 3UE1A 4S2KA 2IWCA 1M40A 3IBJA 2ZLYA 5K5BA 3CZDA 2P9VA 4MBKA 3GECA 4KG5A 1YLTA 3CJMA 3FKWA 1ACFA 1CJFA 3OCLA 4P87A 2OLUA 3QP2A 4L9GA 4UEYA 3ZNTA 5EOEA 3E4OA 2P04A 3HREA 4HBTA 3VP3A 2E8IA 3R4KA 1HLUP 4DE1A 4U3TA 2WK0A 5DJUA 5FASA 2M7UA 4LRYC 1XPBA 2XD5A 4GDBA 4Y7PA 2QKPA 5GL9A 2J9PA 4OH0A 3HLWA 4MCWA 2PRFA 4JXGA 4XUXA 2J7VA 4GLQA 3S22A 5FAQA 3W4OA 4GD8A 2XD1A 1DRMA 2XSSA 3F1OB 4GDNA 1NY0A 2JBFA 3G32A 1F98A 3NOUC 1LHYA 2ZMVA 1BZAA 4KQQA 4EW7A 2GJ3A 5HL6A 5M18A 1FR1A 1IKGA 2W3EA 4ZJ2A 3DTMA 2XFTA 4X56A 2JKRI 1YLYA 2VK3A 5HZHA 2EFXA 3UN7A 4DF6A 5EECA 1P0ZA 3G2YA 3H7WB 4AFIA 5FQJA 5KSHA 4WMCA 4ESPA 1S4SA 1TD5A 3PBNA 3SS4A 3ZVTA 3LIEA 2Y2HA 3EEHA 4H6JA 4WM9A 2Y79A 3UB7A 3D72A 5CTNA 4CLCC 4RA7A 4BWIA 4LGWA 4G3KA 1UWPX 3P09A 3Q7ZA 4WN5A 4HHDA 1MXOA 5HPFA 4OPZA 2B02A 3SZTA 1SCWA 5HDCA 3IF5A 4UA9A 4HY8A 5EM1A 2PU2A 2XA7S 4MBFA 5FAOA 3CPTA 3HLFA 1PRQA 4GKUA 3KSFA 2H5SA 1DP8A 4XT2B 4G3WA 4GZBA 1CI9A 1I2SA 3PR6A 3SH7A 1K6RA 4U0TA 3IXDA 4Y2FA 2A3UA 4LLOB 4E3JA 1S1YA 5J7EA 3TRCA 4LENA 3C30A 4EBLA 4X55A 3Q07A 2WGWB 3JPUA 2RCXA 4HH3A 4EUVA 3IX3A 2OAP1 3IHAA 4PHTA 2Y4AA 4QJGA 3T1XA 4HESA 1ONHA 3VE4A 1EW0A 3BFGA 5E43A 2BTFP 4ZAMA 3T4JA 1JTGA 4HH2A 5A91A 2OSUA 5HD5A 4L0LA 4DRTA 2D01A 2M7VA 1YMSA 3IWIA 4HQAA 3UPNA 3FPVA 4K91A 1STZA 2VV6A 2OWJA 3S7OA 3DTIA 2JKRM 5AQ7A 3T1SA 3CI6A 1OTAA 3AGDA 5E2EA 1OMEA 2W1TB 3QP5A 1T1BA 2VKSA 3ZG0A 2A2LA 2R78A 2W1RA 3WS4A 3NJAA 1KGEA 1K4EA 3HLEA 3LR4A 4S2JA 4QY6A 3MFXA 3QNBA 3UPOA 1XA1A 4BLMA 1KVLA 4N1HA 3RXXA 3UNWA 2NUTC 1JWVA 4OPYA 4WZ4A 3OBFA 3MJQA 5C5KA 1NWZA 2FZ0A 5DJTA 4NG2A 4JXWA 4JF6A 1GSWA 4R38A 3IT9A 3TG9A 1EWZA 1TS8A 1LLBA 1N9LA 3CG5A 2XH9A 3KSIA 2X01A 2D02A 3PBQA 1VHMA 2YKHA 5CHMA 1TS0A 3M6BA 4IEDA 3GMWA 5LBRA 1CQAA 1FSYA 3HVFA 4I3JA 4JGOA 5JYPA 4WLAA 2WZZA 4XUZA 3F1NB 3MZDA 3PAEA 4WF0A 5EUAA 2VGKA 2Y91A 1IYQA 2P9VB 3UE6A 3BFCA 2GZAA 4P0MA 3FC7A 1ES2A 2HV1A 3EWKA 1IYPA 4BL2A 3LR0A 1L2SA 2MJ6A 1E3UA 2HP9A 3SH9A 1TDLA 2Y2OA 4UHUA 2OLVA 2L4RA 2LB5A 4JBFA 2E8JA 2EX2A 2Y2GA 4FH2A 3E4QA 3PHYA 2OV5A 4BBUA 4IUKA 2XA7M 4R70A 5HPIA 1W63Q 4KZ5A 1LSXA 3W4PA 3T4SA 4L9FA 5HSQA 2EX8A 2V1AA 3ZQ5A 1VQQA 5J3WA 3LICA 4ID4A 4N1XA 2PD8A 4OLGA 3RXWA 1P97A 1VEUA 1PW8A 4NETA 5J4EA 3BRMA 2HPBA 4DDYA 3RJUA 4WMCD 4ME4A 5F1GA 5GLBA 3VOZA 5EVEA 5FDHA 3TSGA 2XEPA 1FOFA 1LSVA 4GCZA 1G6OA 3KYEA 4E3IA 2Z2LB 1XP4A 4PAUA 2KDKA 3TE8A 3V50A 4CLCD 2DRWA 3A3FA 4FTXA 4IUHA 1I2WA 2ZL1A 3D4FA 4OPRA 4D2OA 2EA9A 4E3KA 2H10A 5E2GA 3NDEA 3I7JA 4H6JB 1OPXA 1PI5A 3CLOA 1H8YA 1K56A 4P6BA 2XGNA 4Y0UA 2QMIA 3O3VA 3LGOA 1F5MA 3IHBA 5F1FA 1BLHA 5F5YA 4N92A 2KLIA 5DVAA 5EE8A 3LCEA 3CPTB 5DKKA 1XFQA 2VGJA 2H28A 3BEBA 4E04A 4GJ4A 3ZG5A 1G28A 1OTBA 3A0RA 3SOIA 3G34A 1OT9A 2IA2A 5HW3A 5FQ9A 4R0QA 3QP4A 4B4ZA 3Q82A 1ZKJA 4GS9A 3IXGA 4F3LA 2DCFA 2GX5A
chains in the Genus database with same CATH topology
3MZFA 1FSWA 2J7VA 3S22A 4P85A 2C5WB 1E4DA 4R23A 3IQAA 4BL3A 4OQ0A 5FAQA 3W4OA 4BD1A 4GD8A 3HL9A 4MBHA 2ZD8A 2QPNA 2XD1A 2ZC7A 4UA7A 3DWZA 5AQAA 2ZJ9A 4JLFA 4KZ3A 1CEFA 3HLGA 2HDRA 2Y2JA 2B5RA 4GDNA 4GOGA 2ZC3B 4OOYA 5GHYA 1NY0A 2JBFA 3G32A 1SKFA 5CGXA 1LHYA 3Q7VB 1YMXA 1BZAA 3O86A 4KQQA 2ZM2A 1ONGA 5M18A 1FR1A 1KE0A 3OCNA 1IKGA 3V3RA 4OOLA 3IF6A 4ZJ2A 3DTMA 3MBZA 2XFTA 4X56A 1YLYA 3HUMA 2EFXA 3UN7A 3ZDJA 4DF6A 3Q81A 5EECA 5TR7A 4DKIA 2XR0A 1GCEA 3G2YA 3VFHA 4QB8A 1YLWA 3HUOA 1CI8A 3BYDA 2JC7A 4IVKA 1PYYA 4Y0TA 5DTKA 1K25A 3AGEA 5CHJA 1M6KA 5FQJA 4RX2A 5KSHA 4BJPA 4WMCA 4LV1A 5EVIC 3PBNA 2WGIA 3SS4A 3ZVTA 2Y2HA 4WELA 4OVDA 4WM9A 4ZJ1A 1ES4A 2FFFB 5DF7A 3ZHHA 4KZBA 3NY4A 5CTNA 4DE3A 2X02A 5FI7A 2CC1A 2Y59A 1KDSA 4JF4A 5M19A 3NC8A 4RA7A 3VP4A 3P98A 3BM6A 3WS0A 3ISGA 3IWOA 3GTCA 3GQZA 2V20A 3P09A 4KG6A 3Q7ZA 1YM1A 4LV0A 1MXOA 3QNCA 1WYBA 4OPZA 1BSGA 4E3NA 3HBRA 1SCWA 1XX2A 3FWLA 4OOMA 3IF5A 4UA9A 3UDXA 1JVJA 2PU2A 3IH8A 1IELA 4MBFA 1KE3A 5FAOA 4EBNA 5DF8A 3HLFA 1L0DA 3W8KA 1H5XA 5EPHA 1K4FA 4GKUA 4RVAA 3VP2A 1IEMA 3ZFZA 2XQZA 2H5SA 3CMZA 1ERMA 3V5MA 2EXAA 4QU3A 1NJ4A 2J8YA 5CHUA 2HP6A 5GHXA 4F94A 3GV9A 1NRFA 4PM7A 1Q2PA 5E2FA 2EX9A 2JE5A 4DXCA 4KZ4A 5D3OA 3HLDA 5HARA 3EQUA 3IWQA 3ZGAB 5GLCA 4GZBA 1CI9A 1I2SA 1NYMA 2A49A 2IWBA 3SH7A 1YLZA 1TDGA 1K6RA 2ZQ7A 3C5AA 4U0TA 1PWDA 3BECA 4GD6A 3IXDA 4EWFA 2A3UA 3M2JA 4E3JA 1ZC2A 4KZ8A 1BUEA 2WAEA 4X6TA 3DWKA 1RCJA 1TVFA 4KZ9A 1NZOA 2V2FF 1E3UD 4LENA 4WZ5C 3MXRA 3SS5A 2RL3A 3LO7A 4EBLA 4X55A 1MWUA 3Q07A 3O87A 2WGWB 3B3XA 3G31A 1DJAA 3OPRA 4M3KA 3G4PA 2RCXA 1DJCA 3Q1FA 3N7WA 2WKHA 3IHAA 2Y4AA 4QJGA 3A3IA 3OPHA 4HESA 4WZ5A 5FQKA 1ONHA 4PPRA 4R1GA 3BFGA 4FCFA 1O7EA 5E43A 4E3MA 2WYXA 3WS1A 2P74A 4BENA 4Z9QA 4GN2A 4ZAMA 2Y2KA 4LCLA 3VP1A 1MWTA 2J9OA 2Y2QA 5CEDA 4PM5A 1JTGA 1NZUA 3LEZA 5EOOA 5A91A 3V39A 3DW0A 3NDGA 2EXBA 2OSUA 2ZQCA 4OQHA 3VOYA 3Q7VA 1QMFA 3MKFA 1O07A 4FH4A 3N8LA 4L0LA 4DRTA 1YMSA 1ZG6A 1K38A 3IWIA 3UPNA 3BFDA 3NIAA 1IKIA 4K91A 3SH8A 3IF6C 4FD8A 5IHVA 4E3OA 1WE4A 3V3SA 4OP5A 1MPLA 1PW1A 2DNSA 4KENB 1ERQA 4LV3A 1L0FA 4UA6A 4Y0OA 5AQ7A 3BLSA 5J8XA 4K0XA 1NYYA 2H0TA 3VP0A 1W79A 4X68A 3AGDA 4E3LA 2XF3A 1LL5A 5DTTA 5E2EA 4LV2A 1C3BA 2H0YA 4YINA 1OMEA 4EBPA 1MY8A 5F82A 3BFFA 1JWZA 5HAIA 1GHMA 1N4OA 1E25A 4JXVA 3MKEA 3UDFA 1FCMA 3E2KA 4B88A 5CTMA 4UAAA 2I72A 5HFOA 3OZHA 3ZG0A 1S6RA 4QD4A 3ITAA 3WS4A 1PI4A 1KGEA 3ZG9B 4OLDA 4KZAA 3A3JA 5CEBA 1K4EA 1KGGA 2IWDA 2ZQAA 1Q2QA 4MEZA 1RGZA 3HLEA 4S2PA 2QZ6A 4S2JA 4QY6A 4DXBA 1XGJA 4PM9A 2G2UA 4S2NC 3GSGA 3QNBA 3UPOA 2PU4A 3C4PA 3FV7A 1XA1A 1PZPA 4BLMA 4X69A 1KVLA 5EVID 5CECA 1IYOA 1ZG4A 2HDSA 5HAQA 1FCNA 1FCOA 4N1HA 3RXXA 3UNWA 4Q8IA 1ES3A 1ESIA 1JWVA 1K55A 3EQVA 4OPYA 4WZ4A 1YLJA 1K57A 4JXWA 4S2NA 2G2WA 4JF6A 1W5DA 4YFMA 2Y55A 3IT9A 4LCMA 1ES5A 1EWZA 3TG9A 1BLPA 1LLBA 3CG5A 2XH9A 1CK3A 2X01A 4B4XA 2PBYA 3PBQA 3WS2A 4H8RA 4E6XA 4GB7A 1EROA 5CHMA 4ZJ3A 1SDNA 3G30A 3N8SA 4S2MA 3ITBA 3M6BA 3C7VA 4IEDA 3GMWA 4O7DA 4EV4A 1GHIA 1N9BA 4S2IA 1TEMA 1ESUA 4NK3A 1YQSA 3WRTA 1FSYA 3HVFA 5EVIB 5GLDA 4IVIA 3PAGA 4OPQA 4RX3A 3PTEA 3IH9A 4ZTKA 2UWXA 3N6IA 5JYPA 2WZZA 3ZNYA 2WGWA 4KQOA 4KZ6A 3MZDA 4XUZA 5FQIA 3PAEA 4KG2A 5FSRA 4JPMA 5L2FA 1KDWA 1RP5A 5EUAA 2VGKA 2Y91A 5EVLA 1IYQA 2P9VB 2ZC4B 4A5RA 2Y2PA 3BFCA 4P0MA 2Q9NA 4FSFA 3M6HA 1XKZA 1BLSA 1ES2A 1YLPA 1JWPA 3OC2A 4MNRA 5A92A 1Y54A 1IYPA 2XLNA 4ZDXA 4BL2A 4PM6A 1IYSA 3IXBA 1L2SA 4EQIA 1SHVA 3GVBA 5HAPA 4QY5A 2R9XA 4E6WA 2Y2LA 1FQGA 2FFYA 3N8RA 1E3UA 5CXWA 4RYEA 2HP9A 4HEFA 3SH9A 1TDLA 1PWCA 3PBTA 2C6WB 2Y2OA 4UHUA 2OLVA 3LY3A 4CPKA 3UY6A 4OONA 3S4XA 4JBFA 1XXMA 1NXYA 3IXHA 3VMAA 1MKIA 2EX2A 1G68A 1RGYA 4ZBEA 4IBXA 2Y2GA 4FH2A 1DY6A 1WYCA 3VSLA 3A3EA 3HUNA 4N9LA 3WS5A 1YT4A 3A3DA 3FZCA 3WRZA 3GR2A 3C4OA 5HL1A 1BULA 1W8YA 2OV5A 3ZG8B 3UDIA 2XDMA 4WYYA 1MWRA 4WBGA 1K54C 4KZ5A 1BTLA 5FQQA 3W4PA 1LI9A 5CRFA 4EUZA 4X53A 3FKVA 3W4QA 4R4SA 5FI6A 2EX8A 3NBLA 2ZC5B 2ZM0A 4CJNA 1HVBA 1VQQA 1JTDA 3UPPA 2Y2NA 5BOHA 3MFDA 5DTSA 1VM1A 4ID4A 4N1XA 3BFEA 3OPPA 2HDQA 1S0WA 1K54A 2WKIA 2BLSA 3LY4A 5F83A 5U47A 5G18A 2XFSA 4JXSA 4S2OA 4OLGA 4JF5A 3BLMA 5I94A 4DE0A 4K0WA 3TOIA 4MLLA 2EFUA 3PBSA 4PMAA 5GLAA 3RXWA 3ZCZA 1PW8A 2WUQA 4NETA 4OKPA 3BRMA 1BT5A 3VFFA 5DF9A 1J9MA 1FR6A 2HPBA 4DDYA 4WEKA 4WMCD 3HLBA 5CERA 3RJUA 3GRJA 1H8ZA 5F1GA 4IBRA 1QMEA 5GLBA 3HLCA 5TGFA 3S1YA 3VOZA 1GHPA 3JYIA 2R9WA 3OPLA 3WWXA 5A90A 1K55C 5FDHA 3TSGA 4C75A 2WADA 3MZEA 5CGWA 2XEPA 1FOFA 4KZ7A 1K57C 4U0XA 1ALQA 5M1AA 3IF6B 4BD0A 4GNUA 1HTZA 2Y2IA 4E3IA 1U60A 5FATA 1HZOA 2Z2LB 4WEJA 3UE3A 3QHYA 2WKEA 1XP4A 4BQMA 1G6AA 4DDSA 5AQ9A 3UE0A 1EI5A 1W7FA 3VSKA 4C3QA 2ZQ9A 1PZOA 1K56D 5AQBA 3N4IA 1XA7A 3ZVWA 3FYZA 3V50A 5TFQA 3AGFA 2DRWA 1LL9A 2HP5A 3A3FA 3E2LA 2ZM8A 1I2WA 3D4FA 4C6YA 1KGFA 4OPRA 1GA0A 1DJBA 4D2OA 4E3KA 2H10A 1Z6FA 5EVIA 5E2GA 2Y2MA 3I7JA 3NDEA 2ZC6B 1K6SA 3MXSA 2HDUA 5E2HA 1PI5A 1MWSA 2X71A 3C7UA 5KMWA 3UE1A 4S2KA 5HX9A 1H8YA 2IWCA 1M40A 2ZLYA 4OP8A 3CZDA 1GA9A 1K56A 2P9VA 1W8QA 2WZXA 5CGSA 4MBKA 4PM8A 4R3JA 4P6BA 5KSCA 1HD8A 2XGNA 4OQIA 5JYOA 4Y0UA 2QMIA 3O3VA 4DE2A 2V1ZA 4KG5A 2Q9MA 5FI2A 1YLTA 5GHZA 3CJMA 3FKWA 2EX6A 4XXRA 3NI9A 5KZHA 3NCKA 3IHBA 5F1FA 1CEGA 1BLHA 3OCLA 4N92A 4P87A 1L0EA 2OLUA 5DVAA 2JCHA 5EE8A 3LCEA 4N9KA 3ZNTA 4JKTA 5EOEA 2ZQ8A 2VGJA 3BEBA 4OQGA 3HREA 4HBTA 3VP3A 2E8IA 5A93A 2WGVA 3G2ZA 1I5QA 4DE1A 2GDNA 3ZG7B 3ZG5A 1XGIA 3PBRA 4U3TA 2WK0A 5FASA 1KVMA 5FQMA 3SOIA 1BLCA 4QHCA 4S2LA 2ZMAA 1AXBA 3G34A 1XPBA 2XD5A 4GDBA 4Y7PA 1PIOA 5GL9A 1MBLA 5HW3A 3M2KA 5FQ9A 4R0QA 2J9PA 3Q82A 1PWGA 4OH0A 4B4ZA 2ZQDA 1SDEA 1ZKJA 3HLWA 2WAFA 1LI0A 2BG1A 4R3BA 1KE4A 2Z2MB 3PBOA 4KQRA 5FA7A 2XK1A 3G35A 5FAPA 4R4RA 3O88A 1L0GA 3IXGA 4HBUA 3UO9A 3SS3A 4JXGA 2DCFA 4XUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MZF A;  1FSW A;  2J7V A;  3S22 A;  4P85 A;  2C5W B;  1E4D A;  4R23 A;  3IQA A;  4BL3 A;  4OQ0 A;  5FAQ A;  3W4O A;  4BD1 A;  4GD8 A;  3HL9 A;  4MBH A;  2ZD8 A;  2QPN A;  2XD1 A;  2ZC7 A;  4UA7 A;  3DWZ A;  5AQA A;  2ZJ9 A;  4JLF A;  4KZ3 A;  1CEF A;  3HLG A;  2HDR A;  2Y2J A;  2B5R A;  4GDN A;  4GOG A;  2ZC3 B;  4OOY A;  5GHY A;  1NY0 A;  2JBF A;  3G32 A;  1SKF A;  5CGX A;  1LHY A;  3Q7V B;  1YMX A;  1BZA A;  3O86 A;  4KQQ A;  2ZM2 A;  1ONG A;  5M18 A;  1FR1 A;  1KE0 A;  3OCN A;  1IKG A;  3V3R A;  4OOL A;  3IF6 A;  4ZJ2 A;  3DTM A;  3MBZ A;  2XFT A;  4X56 A;  1YLY A;  3HUM A;  2EFX A;  3UN7 A;  3ZDJ A;  4DF6 A;  3Q81 A;  5EEC A;  5TR7 A;  4DKI A;  2XR0 A;  1GCE A;  3G2Y A;  3VFH A;  4QB8 A;  1YLW A;  3HUO A;  1CI8 A;  3BYD A;  2JC7 A;  4IVK A;  1PYY A;  4Y0T A;  5DTK A;  1K25 A;  3AGE A;  5CHJ A;  1M6K A;  5FQJ A;  4RX2 A;  5KSH A;  4BJP A;  4WMC A;  4LV1 A;  5EVI C;  3PBN A;  2WGI A;  3SS4 A;  3ZVT A;  2Y2H A;  4WEL A;  4OVD A;  4WM9 A;  4ZJ1 A;  1ES4 A;  2FFF B;  5DF7 A;  3ZHH A;  4KZB A;  3NY4 A;  5CTN A;  4DE3 A;  2X02 A;  5FI7 A;  2CC1 A;  2Y59 A;  1KDS A;  4JF4 A;  5M19 A;  3NC8 A;  4RA7 A;  3VP4 A;  3P98 A;  3BM6 A;  3WS0 A;  3ISG A;  3IWO A;  3GTC A;  3GQZ A;  2V20 A;  3P09 A;  4KG6 A;  3Q7Z A;  1YM1 A;  4LV0 A;  1MXO A;  3QNC A;  1WYB A;  4OPZ A;  1BSG A;  4E3N A;  3HBR A;  1SCW A;  1XX2 A;  3FWL A;  4OOM A;  3IF5 A;  4UA9 A;  3UDX A;  1JVJ A;  2PU2 A;  3IH8 A;  1IEL A;  4MBF A;  1KE3 A;  5FAO A;  4EBN A;  5DF8 A;  3HLF A;  1L0D A;  3W8K A;  1H5X A;  5EPH A;  1K4F A;  4GKU A;  4RVA A;  3VP2 A;  1IEM A;  3ZFZ A;  2XQZ A;  2H5S A;  3CMZ A;  1ERM A;  3V5M A;  2EXA A;  4QU3 A;  1NJ4 A;  2J8Y A;  5CHU A;  2HP6 A;  5GHX A;  4F94 A;  3GV9 A;  1NRF A;  4PM7 A;  1Q2P A;  5E2F A;  2EX9 A;  2JE5 A;  4DXC A;  4KZ4 A;  5D3O A;  3HLD A;  5HAR A;  3EQU A;  3IWQ A;  3ZGA B;  5GLC A;  4GZB A;  1CI9 A;  1I2S A;  1NYM A;  2A49 A;  2IWB A;  3SH7 A;  1YLZ A;  1TDG A;  1K6R A;  2ZQ7 A;  3C5A A;  4U0T A;  1PWD A;  3BEC A;  4GD6 A;  3IXD A;  4EWF A;  2A3U A;  3M2J A;  4E3J A;  1ZC2 A;  4KZ8 A;  1BUE A;  2WAE A;  4X6T A;  3DWK A;  1RCJ A;  1TVF A;  4KZ9 A;  1NZO A;  2V2F F;  1E3U D;  4LEN A;  4WZ5 C;  3MXR A;  3SS5 A;  2RL3 A;  3LO7 A;  4EBL A;  4X55 A;  1MWU A;  3Q07 A;  3O87 A;  2WGW B;  3B3X A;  3G31 A;  1DJA A;  3OPR A;  4M3K A;  3G4P A;  2RCX A;  1DJC A;  3Q1F A;  3N7W A;  2WKH A;  3IHA A;  2Y4A A;  4QJG A;  3A3I A;  3OPH A;  4HES A;  4WZ5 A;  5FQK A;  1ONH A;  4PPR A;  4R1G A;  3BFG A;  4FCF A;  1O7E A;  5E43 A;  4E3M A;  2WYX A;  3WS1 A;  2P74 A;  4BEN A;  4Z9Q A;  4GN2 A;  4ZAM A;  2Y2K A;  4LCL A;  3VP1 A;  1MWT A;  2J9O A;  2Y2Q A;  5CED A;  4PM5 A;  1JTG A;  1NZU A;  3LEZ A;  5EOO A;  5A91 A;  3V39 A;  3DW0 A;  3NDG A;  2EXB A;  2OSU A;  2ZQC A;  4OQH A;  3VOY A;  3Q7V A;  1QMF A;  3MKF A;  1O07 A;  4FH4 A;  3N8L A;  4L0L A;  4DRT A;  1YMS A;  1ZG6 A;  1K38 A;  3IWI A;  3UPN A;  3BFD A;  3NIA A;  1IKI A;  4K91 A;  3SH8 A;  3IF6 C;  4FD8 A;  5IHV A;  4E3O A;  1WE4 A;  3V3S A;  4OP5 A;  1MPL A;  1PW1 A;  2DNS A;  4KEN B;  1ERQ A;  4LV3 A;  1L0F A;  4UA6 A;  4Y0O A;  5AQ7 A;  3BLS A;  5J8X A;  4K0X A;  1NYY A;  2H0T A;  3VP0 A;  1W79 A;  4X68 A;  3AGD A;  4E3L A;  2XF3 A;  1LL5 A;  5DTT A;  5E2E A;  4LV2 A;  1C3B A;  2H0Y A;  4YIN A;  1OME A;  4EBP A;  1MY8 A;  5F82 A;  3BFF A;  1JWZ A;  5HAI A;  1GHM A;  1N4O A;  1E25 A;  4JXV A;  3MKE A;  3UDF A;  1FCM A;  3E2K A;  4B88 A;  5CTM A;  4UAA A;  2I72 A;  5HFO A;  3OZH A;  3ZG0 A;  1S6R A;  4QD4 A;  3ITA A;  3WS4 A;  1PI4 A;  1KGE A;  3ZG9 B;  4OLD A;  4KZA A;  3A3J A;  5CEB A;  1K4E A;  1KGG A;  2IWD A;  2ZQA A;  1Q2Q A;  4MEZ A;  1RGZ A;  3HLE A;  4S2P A;  2QZ6 A;  4S2J A;  4QY6 A;  4DXB A;  1XGJ A;  4PM9 A;  2G2U A;  4S2N C;  3GSG A;  3QNB A;  3UPO A;  2PU4 A;  3C4P A;  3FV7 A;  1XA1 A;  1PZP A;  4BLM A;  4X69 A;  1KVL A;  5EVI D;  5CEC A;  1IYO A;  1ZG4 A;  2HDS A;  5HAQ A;  1FCN A;  1FCO A;  4N1H A;  3RXX A;  3UNW A;  4Q8I A;  1ES3 A;  1ESI A;  1JWV A;  1K55 A;  3EQV A;  4OPY A;  4WZ4 A;  1YLJ A;  1K57 A;  4JXW A;  4S2N A;  2G2W A;  4JF6 A;  1W5D A;  4YFM A;  2Y55 A;  3IT9 A;  4LCM A;  1ES5 A;  1EWZ A;  3TG9 A;  1BLP A;  1LLB A;  3CG5 A;  2XH9 A;  1CK3 A;  2X01 A;  4B4X A;  2PBY A;  3PBQ A;  3WS2 A;  4H8R A;  4E6X A;  4GB7 A;  1ERO A;  5CHM A;  4ZJ3 A;  1SDN A;  3G30 A;  3N8S A;  4S2M A;  3ITB A;  3M6B A;  3C7V A;  4IED A;  3GMW A;  4O7D A;  4EV4 A;  1GHI A;  1N9B A;  4S2I A;  1TEM A;  1ESU A;  4NK3 A;  1YQS A;  3WRT A;  1FSY A;  3HVF A;  5EVI B;  5GLD A;  4IVI A;  3PAG A;  4OPQ A;  4RX3 A;  3PTE A;  3IH9 A;  4ZTK A;  2UWX A;  3N6I A;  5JYP A;  2WZZ A;  3ZNY A;  2WGW A;  4KQO A;  4KZ6 A;  3MZD A;  4XUZ A;  5FQI A;  3PAE A;  4KG2 A;  5FSR A;  4JPM A;  5L2F A;  1KDW A;  1RP5 A;  5EUA A;  2VGK A;  2Y91 A;  5EVL A;  1IYQ A;  2P9V B;  2ZC4 B;  4A5R A;  2Y2P A;  3BFC A;  4P0M A;  2Q9N A;  4FSF A;  3M6H A;  1XKZ A;  1BLS A;  1ES2 A;  1YLP A;  1JWP A;  3OC2 A;  4MNR A;  5A92 A;  1Y54 A;  1IYP A;  2XLN A;  4ZDX A;  4BL2 A;  4PM6 A;  1IYS A;  3IXB A;  1L2S A;  4EQI A;  1SHV A;  3GVB A;  5HAP A;  4QY5 A;  2R9X A;  4E6W A;  2Y2L A;  1FQG A;  2FFY A;  3N8R A;  1E3U A;  5CXW A;  4RYE A;  2HP9 A;  4HEF A;  3SH9 A;  1TDL A;  1PWC A;  3PBT A;  2C6W B;  2Y2O A;  4UHU A;  2OLV A;  3LY3 A;  4CPK A;  3UY6 A;  4OON A;  3S4X A;  4JBF A;  1XXM A;  1NXY A;  3IXH A;  3VMA A;  1MKI A;  2EX2 A;  1G68 A;  1RGY A;  4ZBE A;  4IBX A;  2Y2G A;  4FH2 A;  1DY6 A;  1WYC A;  3VSL A;  3A3E A;  3HUN A;  4N9L A;  3WS5 A;  1YT4 A;  3A3D A;  3FZC A;  3WRZ A;  3GR2 A;  3C4O A;  5HL1 A;  1BUL A;  1W8Y A;  2OV5 A;  3ZG8 B;  3UDI A;  2XDM A;  4WYY A;  1MWR A;  4WBG A;  1K54 C;  4KZ5 A;  1BTL A;  5FQQ A;  3W4P A;  1LI9 A;  5CRF A;  4EUZ A;  4X53 A;  3FKV A;  3W4Q A;  4R4S A;  5FI6 A;  2EX8 A;  3NBL A;  2ZC5 B;  2ZM0 A;  4CJN A;  1HVB A;  1VQQ A;  1JTD A;  3UPP A;  2Y2N A;  5BOH A;  3MFD A;  5DTS A;  1VM1 A;  4ID4 A;  4N1X A;  3BFE A;  3OPP A;  2HDQ A;  1S0W A;  1K54 A;  2WKI A;  2BLS A;  3LY4 A;  5F83 A;  5U47 A;  5G18 A;  2XFS A;  4JXS A;  4S2O A;  4OLG A;  4JF5 A;  3BLM A;  5I94 A;  4DE0 A;  4K0W A;  3TOI A;  4MLL A;  2EFU A;  3PBS A;  4PMA A;  5GLA A;  3RXW A;  3ZCZ A;  1PW8 A;  2WUQ A;  4NET A;  4OKP A;  3BRM A;  1BT5 A;  3VFF A;  5DF9 A;  1J9M A;  1FR6 A;  2HPB A;  4DDY A;  4WEK A;  4WMC D;  3HLB A;  5CER A;  3RJU A;  3GRJ A;  1H8Z A;  5F1G A;  4IBR A;  1QME A;  5GLB A;  3HLC A;  5TGF A;  3S1Y A;  3VOZ A;  1GHP A;  3JYI A;  2R9W A;  3OPL A;  3WWX A;  5A90 A;  1K55 C;  5FDH A;  3TSG A;  4C75 A;  2WAD A;  3MZE A;  5CGW A;  2XEP A;  1FOF A;  4KZ7 A;  1K57 C;  4U0X A;  1ALQ A;  5M1A A;  3IF6 B;  4BD0 A;  4GNU A;  1HTZ A;  2Y2I A;  4E3I A;  1U60 A;  5FAT A;  1HZO A;  2Z2L B;  4WEJ A;  3UE3 A;  3QHY A;  2WKE A;  1XP4 A;  4BQM A;  1G6A A;  4DDS A;  5AQ9 A;  3UE0 A;  1EI5 A;  1W7F A;  3VSK A;  4C3Q A;  2ZQ9 A;  1PZO A;  1K56 D;  5AQB A;  3N4I A;  1XA7 A;  3ZVW A;  3FYZ A;  3V50 A;  5TFQ A;  3AGF A;  2DRW A;  1LL9 A;  2HP5 A;  3A3F A;  3E2L A;  2ZM8 A;  1I2W A;  3D4F A;  4C6Y A;  1KGF A;  4OPR A;  1GA0 A;  1DJB A;  4D2O A;  4E3K A;  2H10 A;  1Z6F A;  5EVI A;  5E2G A;  2Y2M A;  3I7J A;  3NDE A;  2ZC6 B;  1K6S A;  3MXS A;  2HDU A;  5E2H A;  1PI5 A;  1MWS A;  2X71 A;  3C7U A;  5KMW A;  3UE1 A;  4S2K A;  5HX9 A;  1H8Y A;  2IWC A;  1M40 A;  2ZLY A;  4OP8 A;  3CZD A;  1GA9 A;  1K56 A;  2P9V A;  1W8Q A;  2WZX A;  5CGS A;  4MBK A;  4PM8 A;  4R3J A;  4P6B A;  5KSC A;  1HD8 A;  2XGN A;  4OQI A;  5JYO A;  4Y0U A;  2QMI A;  3O3V A;  4DE2 A;  2V1Z A;  4KG5 A;  2Q9M A;  5FI2 A;  1YLT A;  5GHZ A;  3CJM A;  3FKW A;  2EX6 A;  4XXR A;  3NI9 A;  5KZH A;  3NCK A;  3IHB A;  5F1F A;  1CEG A;  1BLH A;  3OCL A;  4N92 A;  4P87 A;  1L0E A;  2OLU A;  5DVA A;  2JCH A;  5EE8 A;  3LCE A;  4N9K A;  3ZNT A;  4JKT A;  5EOE A;  2ZQ8 A;  2VGJ A;  3BEB A;  4OQG A;  3HRE A;  4HBT A;  3VP3 A;  2E8I A;  5A93 A;  2WGV A;  3G2Z A;  1I5Q A;  4DE1 A;  2GDN A;  3ZG7 B;  3ZG5 A;  1XGI A;  3PBR A;  4U3T A;  2WK0 A;  5FAS A;  1KVM A;  5FQM A;  3SOI A;  1BLC A;  4QHC A;  4S2L A;  2ZMA A;  1AXB A;  3G34 A;  1XPB A;  2XD5 A;  4GDB A;  4Y7P A;  1PIO A;  5GL9 A;  1MBL A;  5HW3 A;  3M2K A;  5FQ9 A;  4R0Q A;  2J9P A;  3Q82 A;  1PWG A;  4OH0 A;  4B4Z A;  2ZQD A;  1SDE A;  1ZKJ A;  3HLW A;  2WAF A;  1LI0 A;  2BG1 A;  4R3B A;  1KE4 A;  2Z2M B;  3PBO A;  4KQR A;  5FA7 A;  2XK1 A;  3G35 A;  5FAP A;  4R4R A;  3O88 A;  1L0G A;  3IXG A;  4HBU A;  3UO9 A;  3SS3 A;  4JXG A;  2DCF A;  4XUX A; 
#chains in the Genus database with same CATH topology
 4DN0 A;  4P85 A;  2C5W B;  4R23 A;  4BL3 A;  4BD1 A;  2QPN A;  2ZC7 A;  4UA7 A;  5AQA A;  4JLF A;  3HLG A;  2HDR A;  3CAX A;  1H3Q A;  2B5R A;  4GOG A;  2Z6C A;  1VB6 A;  1GSV A;  5L8M A;  2VEA A;  2ZM2 A;  4ZRR A;  3V3R A;  2QHK A;  4GW9 A;  3MR0 A;  2M1C A;  3HUM A;  3ZDJ A;  5TR7 A;  1YLW A;  5IT5 A;  2JC7 A;  3B33 A;  4IVK A;  1PYY A;  1K25 A;  5AVF A;  5CHJ A;  1SKO A;  4KQD A;  4LRZ E;  5FDS A;  4WEL A;  1S4R A;  4EEU A;  4ZJ1 A;  1ES4 A;  2FFF B;  3NY4 A;  2CC1 A;  1KDS A;  4JF4 A;  3T1R A;  3P98 A;  3QP6 A;  3ISG A;  3QP8 A;  3BY8 A;  1YM1 A;  1L3L A;  4YOF A;  5FEF A;  2JN7 A;  1WYB A;  2XRN A;  1BSG A;  3FWL A;  3U4L P;  1JVJ A;  3IH8 A;  1IEL A;  4O01 A;  5IS1 A;  3W8K A;  1K4F A;  2L1M A;  3ZFZ A;  2HZ5 A;  5CHU A;  5GHX A;  2HP6 A;  2JKG A;  4PM7 A;  1Q2P A;  1OT6 A;  4DXC A;  3FG8 A;  3BW6 A;  3EQU A;  2IWB A;  1YLZ A;  4X1L A;  1TDG A;  3BEC A;  4GD6 A;  4UQI S;  2V1B A;  5HWV A;  1BUE A;  1TVF A;  1NZO A;  2V2F F;  1E3U D;  3EEA A;  2RL3 A;  3TW8 A;  3O87 A;  3B3X A;  3OPR A;  3G4P A;  3Q1F A;  2O9B A;  4I3A A;  3N7W A;  1NLY A;  5FQK A;  5DFX A;  2Y8H A;  1F2K A;  2P74 A;  5HD3 A;  2Y2K A;  4LCL A;  2J9O A;  2JHE A;  5CED A;  2QYB A;  3LEZ A;  3V39 A;  3DW0 A;  3NDG A;  1QMF A;  3MKF A;  3KO6 A;  4EU0 A;  3SH8 A;  3IS2 A;  3V3S A;  1MPL A;  4KEN B;  2VLG A;  5J8X A;  2H0T A;  1W79 A;  4E3L A;  2W27 A;  5DTT A;  3L7H A;  4YIN A;  4EBP A;  1JWZ A;  5HAI A;  3CUE A;  3P7N A;  3MKE A;  4MMN A;  3MXQ A;  5HFO A;  1KOU A;  1S6R A;  3ITA A;  3HCY A;  4OLD A;  1KGG A;  1D1J A;  4MEZ A;  2ZQA A;  3UB6 A;  1VEU B;  3DBA A;  3D3O A;  4S2P A;  1XGJ A;  3FV7 A;  2W3D A;  1ZG4 A;  5HAQ A;  1FCN A;  3EQV A;  1ZHH B;  1YLJ A;  2JKT I;  2G2W A;  4YFM A;  2Y55 A;  1BLP A;  1GSX A;  4B4X A;  4EER A;  3WS2 A;  3R7W A;  3BQ8 A;  2INW A;  1ERO A;  4ZJ3 A;  1SDN A;  3G30 A;  3N8S A;  1D06 A;  3ITB A;  3C7V A;  3OLO A;  4EV4 A;  2ZBB A;  2ZL1 B;  4RQ9 A;  1ESU A;  3DTK A;  5MC7 A;  4RX3 A;  3ZNY A;  4KQO A;  5FQI A;  5FSR A;  1KDW A;  1RP5 A;  5EVL A;  3PYP A;  5AVE A;  1BLS A;  3OC2 A;  1JWP A;  2XLN A;  4ZDX A;  1J3W A;  2VA0 A;  3MS6 A;  1NLZ A;  1IYS A;  4EQI A;  1SHV A;  2V9A A;  3GVB A;  2EWW A;  4E6W A;  4NEE D;  5CXW A;  2FFY A;  4HEF A;  3VOL A;  4OON A;  3S4X A;  1MKI A;  1RGY A;  5TJJ A;  1S1Z A;  1DY6 A;  1WYC A;  3HJK A;  1G5U A;  5CX7 A;  3A3D A;  5HL1 A;  1BUL A;  1W8Y A;  3ZG8 B;  3TJZ C;  4GS9 B;  1MWR A;  1K54 C;  1BTL A;  4JGQ A;  5CRF A;  4EUZ A;  4R4S A;  5FI6 A;  4F3L B;  2ZC5 B;  4Y17 A;  4CJN A;  3UPP A;  5BOH A;  1VM1 A;  3BFE A;  3OPP A;  1K54 A;  5G18 A;  2XFS A;  1YKD A;  4JF5 A;  3BLM A;  4O8G A;  4UQI M;  2WUQ A;  5G4Y A;  1BT5 A;  1FR6 A;  4WEK A;  3HLB A;  4FOF A;  3GRJ A;  3K3D A;  1QME A;  3HLC A;  1GHP A;  2A24 A;  2R9W A;  5A90 A;  4HI4 A;  5CGW A;  4U0X A;  1ALQ A;  1YSP A;  2JKT M;  4BD0 A;  2OOL A;  2Y2I A;  4WEJ A;  1P9W A;  2VV8 A;  3UE0 A;  1EI5 A;  1W7F A;  3ZVW A;  3FYZ A;  3CHW P;  5TFQ A;  1SKO B;  4C6Y A;  1KGF A;  3T4Q A;  1GA0 A;  4BBV A;  5EVI A;  2Y2M A;  3KYZ A;  5E2H A;  1MWS A;  2X71 A;  1VET A;  4OP8 A;  1GA9 A;  1F9I A;  2WZX A;  1W8Q A;  5CGS A;  5KSC A;  1HD8 A;  5TBM A;  5JYO A;  2YKF A;  4IHQ A;  2Q9M A;  5FI2 A;  5GHZ A;  2EX6 A;  3VV4 A;  2Q0O A;  1N9O A;  4YWZ A;  2V0W A;  3U2A A;  1T1A A;  2ZQ8 A;  4PKY A;  4LRX C;  3UB5 P;  5A93 A;  4I5S A;  1I5Q A;  4Q0I A;  1KVM A;  4QHC A;  4S2L A;  3S7Q A;  1UWN X;  1OTI A;  1MBL A;  2V0U A;  1PWG A;  2ZQD A;  2BG1 A;  4R3B A;  4DJ3 A;  2Z2M B;  3KSH A;  3CWF A;  3UME A;  2XK1 A;  4MN5 A;  5FAP A;  4R4R A;  3SS3 A;  1CEG A;  1XXM A;  5L07 A;  2PT7 A;  3MZF A;  1E4D A;  4OQ0 A;  3HL9 A;  1TS6 A;  4KZ3 A;  1CEF A;  2PDR A;  2PHY A;  4OOY A;  5GHY A;  1SKF A;  5CGX A;  1YMX A;  1ONG A;  2DMW A;  3OCN A;  4Y3I A;  4OOL A;  3IS2 B;  3IF6 A;  3MMH A;  3ZYT A;  3LR3 A;  2XR0 A;  4DKI A;  2V8C A;  1GCE A;  4X25 A;  3VFH A;  4QB8 A;  2O9C A;  3BYD A;  1XFN A;  4Y0T A;  2ZOI A;  3AGE A;  3E0Y A;  3JVV A;  1X0O A;  2V8F A;  3QP1 A;  4RX2 A;  3P01 A;  4BJP A;  3IX4 A;  2WGI A;  4OVD A;  4QWO A;  4I3I A;  3ZHH A;  2X02 A;  5FI7 A;  1PFL A;  3LI8 A;  2G7U A;  5M19 A;  3VP4 A;  1AWI A;  4YNR A;  3IWO A;  3GTC A;  4KG6 A;  4B9O A;  4E3N A;  3HBR A;  2O0Y A;  4OOM A;  5DF8 A;  2O9A A;  1L0D A;  1H5X A;  5EPH A;  4RVA A;  3VP2 A;  4HJ6 A;  1IEM A;  2XQZ A;  1ERM A;  2K2N A;  3V5M A;  3D9Y A;  1NJ4 A;  2J8Y A;  3EGD C;  2PAV P;  4F94 A;  2KOI A;  1NRF A;  5E2F A;  2EX9 A;  4KZ4 A;  4BMW A;  5HAR A;  3ZGA B;  3C2W A;  5GLC A;  2A49 A;  3R7W B;  2ZQ7 A;  1H0M A;  2O99 A;  4HNB A;  3M2J A;  2WAE A;  4X6T A;  1RCJ A;  4KZ9 A;  4PKY G;  4WZ5 C;  3NEC A;  4EXO A;  5DKL A;  3G31 A;  3SW1 A;  1W63 M;  3MF0 A;  3K3C A;  1MKM A;  4L9E A;  1NRJ A;  3OPH A;  4WZ5 A;  2Z6D A;  1O7E A;  2ZMF A;  4GHI A;  4E3M A;  2WYX A;  4MDZ A;  2VZW A;  4Z9Q A;  4Q0J A;  1MWT A;  2Y2Q A;  4PM5 A;  1NZU A;  2EXB A;  4OQH A;  3Q7V A;  4FH4 A;  3N8L A;  2UV0 E;  3H82 A;  1MC0 A;  1K38 A;  3BFD A;  1ODV A;  4FD8 A;  4HOI A;  1WE4 A;  4ETZ A;  1PW1 A;  3T50 A;  4R3A A;  2DNS A;  1ERQ A;  3O5Y A;  3BLS A;  2QJ5 A;  4K0X A;  3VP0 A;  5HWW A;  3KSG A;  3LR5 A;  1LL5 A;  3F1P A;  5F82 A;  3BFF A;  1GHM A;  2VGL M;  5EV0 A;  3UDF A;  3E2K A;  4UAA A;  2I72 A;  3OZH A;  5F68 A;  4NXF A;  4QD4 A;  3FPW A;  1PI4 A;  3ZG9 B;  4KZA A;  5KIZ A;  3B47 A;  4CLC E;  2QZ6 A;  4PM9 A;  4S2N C;  3L9K A;  3GSG A;  1OTD A;  3T4O A;  1FIK A;  1PZP A;  5EVI D;  5CEC A;  1IYO A;  5HDS A;  2HDS A;  2A24 B;  1FCO A;  3GDI A;  1ES3 A;  3LIA A;  4K08 A;  1ESI A;  1K55 A;  1K57 A;  4S2N A;  4LCM A;  1ES5 A;  1CK3 A;  3NHQ A;  4MN7 A;  2K31 A;  4WL9 A;  4H8R A;  1GHI A;  1TEM A;  3WRT A;  5GLD A;  5EVI B;  4IVI A;  3PAG A;  3PTE A;  4ZTK A;  3N6I A;  1VET B;  4KZ6 A;  3V67 A;  1H8M A;  2ZC4 B;  4A5R A;  2Y2P A;  5TBM B;  2Q9N A;  4FSF A;  1XKZ A;  2WKQ A;  4MNR A;  1Y54 A;  3G6O A;  2PR5 A;  4HP9 A;  4PM6 A;  4MN6 A;  1FIL A;  3IXB A;  3LFV A;  2R9X A;  2Y2L A;  3UB8 A;  3DTE A;  3LEQ A;  1PWC A;  3LI9 A;  4II7 A;  3JVU A;  3PBT A;  2C6W B;  3W2Z A;  3LY3 A;  4CPK A;  3UY6 A;  3BQA A;  4LFU A;  4X1M A;  1NXY A;  3VMA A;  5FEG A;  1G68 A;  4ZBE A;  1V9Z A;  3BY9 A;  3VSL A;  3A3E A;  4N9L A;  3WS5 A;  1YT4 A;  3FZC A;  3GR2 A;  3C4O A;  4HJ3 A;  4WYY A;  5I5L A;  1XJ3 A;  3S7P A;  2CMN A;  5FQQ A;  3CUE C;  3FKV A;  3RTY A;  2PYR A;  2ZM0 A;  2Y2N A;  3DAV A;  2WKI A;  5F83 A;  4S2O A;  5I94 A;  4K0W A;  3TOI A;  2EFU A;  3PBS A;  4PMA A;  3ZCZ A;  2FH5 A;  4OKP A;  3VFF A;  5DF9 A;  4NXE A;  5CER A;  1H8Z A;  4IBR A;  5TGF A;  3S1Y A;  1Y28 A;  3JYI A;  2WAD A;  3MZE A;  4KZ7 A;  2I9V A;  5M1A A;  2K7S A;  3IF6 B;  4GNU A;  3MQ0 A;  1U60 A;  5FAT A;  1HZO A;  2W3H A;  4BQM A;  1G6A A;  4DDS A;  4EEP A;  2VV7 A;  4EET B;  5A8B A;  4R6L A;  1PZO A;  5L09 A;  2J3W A;  1K56 D;  5AQB A;  3N4I A;  3AGF A;  3BWL A;  2HP5 A;  5DFY A;  2WKP A;  3CIT A;  3NOP C;  3MSH A;  1K6S A;  3MXS A;  4Z1W A;  2B18 A;  5KMW A;  5HX9 A;  4R3J A;  4PM8 A;  4OQI A;  4CLC A;  4DE2 A;  2V1Z A;  2P7J A;  4XXR A;  3NI9 A;  1WA9 A;  5KZH A;  2HJE A;  3NCK A;  4HP4 A;  4EES A;  2OAQ 1;  4P6Z S;  3PXP A;  1L0E A;  2JCH A;  2XRO A;  4N9K A;  4JKT A;  4NKP A;  4OQG A;  2WGV A;  3G2Z A;  2GDN A;  3ZG7 B;  1XGI A;  3PBR A;  1OJG A;  5FQM A;  1BLC A;  3NUL A;  1XJ6 A;  1OTE A;  1AXB A;  2ZMA A;  4KUO A;  4D60 A;  1PIO A;  2W3F A;  3M2K A;  4ARZ A;  1SDE A;  1K0K A;  2WAF A;  1LI0 A;  2PR6 A;  1KE4 A;  3PBO A;  4KQR A;  5FA7 A;  2LB9 A;  3G35 A;  3VE3 A;  3O88 A;  1L0G A;  4HBU A;  3UO9 A;  1YAX A;  3KYQ A;  1FSW A;  5EM0 A;  3IQA A;  1JNU A;  5G4Z A;  4MBH A;  4GHI B;  2ZD8 A;  3DWZ A;  2ZJ9 A;  1S67 L;  2Y2J A;  3T12 B;  2ZC3 B;  3EGX C;  3Q7V B;  4BBT A;  1YSQ A;  3O86 A;  3H82 B;  2HF6 A;  1KE0 A;  2PYP A;  3MBZ A;  2WKR A;  3Q81 A;  4JGR A;  5HDD A;  3HUO A;  1CI8 A;  3EOI A;  5DTK A;  5F69 A;  5IU1 A;  1M6K A;  3F1P B;  3E98 A;  4LV1 A;  5EVI C;  1TS7 A;  4IJG A;  1OJ5 A;  1D7E A;  5DF7 A;  4KZB A;  4DE3 A;  1DP9 A;  1IFQ A;  2Y59 A;  3NC8 A;  3RH8 B;  3BM6 A;  3WS0 A;  2KX6 A;  3GQZ A;  2V20 A;  4LV0 A;  3UMD A;  5EFW A;  3HJI A;  3QNC A;  4HJ4 A;  2J80 A;  2BAS A;  1XX2 A;  3UDX A;  4EBN A;  1KE3 A;  3S7N A;  1T19 A;  3K2N A;  2J3T D;  2W3G A;  3CMZ A;  2B95 A;  2EXA A;  4QU3 A;  1BYW A;  1Y4O A;  3GV9 A;  2JE5 A;  5D3O A;  3HLD A;  3IWQ A;  1NYM A;  2VGL S;  3C5A A;  1PWD A;  2HJ9 C;  3T1Q B;  4EWF A;  3ICY A;  1ZC2 A;  4KZ8 A;  3DWK A;  4B93 A;  3MXR A;  3SS5 A;  3LO7 A;  1MWU A;  5HWT A;  3A0S A;  2PBD P;  1DJA A;  4M3K A;  1N9N A;  1TF1 A;  1DJC A;  5L10 A;  2WKH A;  1PNE A;  1XJ4 A;  2AVX A;  3A3I A;  3ULF A;  3KX0 X;  4PPR A;  4R1G A;  4FCF A;  3WS1 A;  4BEN A;  4GN2 A;  3VP1 A;  4QPR A;  5EOO A;  3T4T A;  3F1O A;  4I39 A;  2ZQC A;  4DMZ A;  1CF0 A;  3VOY A;  1O07 A;  1LT0 A;  1ZG6 A;  3NIA A;  1IKI A;  1UGU A;  3IF6 C;  3UB9 A;  5IHV A;  4E3O A;  4OP5 A;  1V9Y A;  4Y0O A;  4LV3 A;  1L0F A;  4O0P A;  4UA6 A;  1NYY A;  1LL8 A;  1A0K A;  2P08 A;  3H7W A;  4X68 A;  4P6Z M;  2XF3 A;  3MQO A;  4LV2 A;  1C3B A;  2H0Y A;  1MY8 A;  4NXB A;  3LIB A;  3LYX A;  4HIA A;  1N4O A;  1E25 A;  3C8C A;  4JXV A;  1FCM A;  4B88 A;  5CTM A;  1ZTU A;  1IOU A;  3A3J A;  3BJN A;  5CEB A;  2IWD A;  1Q2Q A;  1RGZ A;  3T4K A;  4DXB A;  4Y5F A;  2G2U A;  5AJG A;  2PU4 A;  3C4P A;  4X69 A;  4Q8I A;  2L0W A;  2W0N A;  4ETX A;  1LSW A;  2OWH A;  1P9R A;  1W5D A;  4XT2 A;  2PBY A;  4DJ2 A;  4E6X A;  4GB7 A;  1T18 A;  4Y13 A;  4S2M A;  3IBR A;  2VJW A;  1T1C A;  4O7D A;  1N9B A;  4S2I A;  4NK3 A;  1YQS A;  4OPQ A;  4KUK A;  3IH9 A;  2UWX A;  2WGW A;  4KG2 A;  5L2F A;  4JPM A;  4CQH A;  3E4P A;  4CLC B;  3M6H A;  5A92 A;  1YLP A;  3C38 A;  1S66 L;  5HAP A;  4QY5 A;  4M4X A;  4Y15 A;  4I38 A;  3IX8 A;  1FQG A;  3N8R A;  4RYE A;  2QJ7 A;  2EWV A;  4Q0H A;  3IXH A;  3OOV A;  3MQQ A;  4IBX A;  3NOT C;  3HUN A;  3WRZ A;  4ARZ B;  2PD7 A;  3T4L A;  3UDI A;  2XDM A;  4WBG A;  2ACG A;  2W1T A;  4EQ1 A;  1LI9 A;  4X53 A;  3W4Q A;  3NBL A;  1HVB A;  1JTD A;  5F6A A;  2JKF A;  3MFD A;  5DTS A;  2HDQ A;  1S0W A;  2BLS A;  3LY4 A;  5U47 A;  4FUW A;  4JXS A;  2NUP C;  4DE0 A;  4MLL A;  5GLA A;  3H9W A;  1J9M A;  2ZOH A;  4WUJ A;  4LPZ A;  1XJ2 A;  3WWX A;  3OPL A;  1K55 C;  4C75 A;  5FL3 A;  1SZV A;  1K57 C;  3RFB A;  3B42 A;  2HGV A;  1HTZ A;  4JGP A;  3UE3 A;  3QHY A;  2WKE A;  1Z09 A;  4G3V A;  4NXG A;  5AQ9 A;  3VSK A;  4C3Q A;  2ZQ9 A;  1DP6 A;  2QWS A;  2VX8 A;  3A0V A;  3LIF A;  1YPR A;  1XA7 A;  3LUQ A;  3LID A;  1LL9 A;  3E2L A;  2ZM8 A;  1DJB A;  1Z6F A;  2ZC6 B;  2HDU A;  2GNX A;  3C7U A;  2J3T C;  1MZU A;  3F1N A;  3UE1 A;  4S2K A;  2IWC A;  1M40 A;  3IBJ A;  2ZLY A;  5K5B A;  3CZD A;  2P9V A;  4MBK A;  3GEC A;  4KG5 A;  1YLT A;  3CJM A;  3FKW A;  1ACF A;  1CJF A;  3OCL A;  4P87 A;  2OLU A;  3QP2 A;  4L9G A;  4UEY A;  3ZNT A;  5EOE A;  3E4O A;  2P04 A;  3HRE A;  4HBT A;  3VP3 A;  2E8I A;  3R4K A;  1HLU P;  4DE1 A;  4U3T A;  2WK0 A;  5DJU A;  5FAS A;  2M7U A;  4LRY C;  1XPB A;  2XD5 A;  4GDB A;  4Y7P A;  2QKP A;  5GL9 A;  2J9P A;  4OH0 A;  3HLW A;  4MCW A;  2PRF A;  4JXG A;  4XUX A;  2J7V A;  4GLQ A;  3S22 A;  5FAQ A;  3W4O A;  4GD8 A;  2XD1 A;  1DRM A;  2XSS A;  3F1O B;  4GDN A;  1NY0 A;  2JBF A;  3G32 A;  1F98 A;  3NOU C;  1LHY A;  2ZMV A;  1BZA A;  4KQQ A;  4EW7 A;  2GJ3 A;  5HL6 A;  5M18 A;  1FR1 A;  1IKG A;  2W3E A;  4ZJ2 A;  3DTM A;  2XFT A;  4X56 A;  2JKR I;  1YLY A;  2VK3 A;  5HZH A;  2EFX A;  3UN7 A;  4DF6 A;  5EEC A;  1P0Z A;  3G2Y A;  3H7W B;  4AFI A;  5FQJ A;  5KSH A;  4WMC A;  4ESP A;  1S4S A;  1TD5 A;  3PBN A;  3SS4 A;  3ZVT A;  3LIE A;  2Y2H A;  3EEH A;  4H6J A;  4WM9 A;  2Y79 A;  3UB7 A;  3D72 A;  5CTN A;  4CLC C;  4RA7 A;  4BWI A;  4LGW A;  4G3K A;  1UWP X;  3P09 A;  3Q7Z A;  4WN5 A;  4HHD A;  1MXO A;  5HPF A;  4OPZ A;  2B02 A;  3SZT A;  1SCW A;  5HDC A;  3IF5 A;  4UA9 A;  4HY8 A;  5EM1 A;  2PU2 A;  2XA7 S;  4MBF A;  5FAO A;  3CPT A;  3HLF A;  1PRQ A;  4GKU A;  3KSF A;  2H5S A;  1DP8 A;  4XT2 B;  4G3W A;  4GZB A;  1CI9 A;  1I2S A;  3PR6 A;  3SH7 A;  1K6R A;  4U0T A;  3IXD A;  4Y2F A;  2A3U A;  4LLO B;  4E3J A;  1S1Y A;  5J7E A;  3TRC A;  4LEN A;  3C30 A;  4EBL A;  4X55 A;  3Q07 A;  2WGW B;  3JPU A;  2RCX A;  4HH3 A;  4EUV A;  3IX3 A;  2OAP 1;  3IHA A;  4PHT A;  2Y4A A;  4QJG A;  3T1X A;  4HES A;  1ONH A;  3VE4 A;  1EW0 A;  3BFG A;  5E43 A;  2BTF P;  4ZAM A;  3T4J A;  1JTG A;  4HH2 A;  5A91 A;  2OSU A;  5HD5 A;  4L0L A;  4DRT A;  2D01 A;  2M7V A;  1YMS A;  3IWI A;  4HQA A;  3UPN A;  3FPV A;  4K91 A;  1STZ A;  2VV6 A;  2OWJ A;  3S7O A;  3DTI A;  2JKR M;  5AQ7 A;  3T1S A;  3CI6 A;  1OTA A;  3AGD A;  5E2E A;  1OME A;  2W1T B;  3QP5 A;  1T1B A;  2VKS A;  3ZG0 A;  2A2L A;  2R78 A;  2W1R A;  3WS4 A;  3NJA A;  1KGE A;  1K4E A;  3HLE A;  3LR4 A;  4S2J A;  4QY6 A;  3MFX A;  3QNB A;  3UPO A;  1XA1 A;  4BLM A;  1KVL A;  4N1H A;  3RXX A;  3UNW A;  2NUT C;  1JWV A;  4OPY A;  4WZ4 A;  3OBF A;  3MJQ A;  5C5K A;  1NWZ A;  2FZ0 A;  5DJT A;  4NG2 A;  4JXW A;  4JF6 A;  1GSW A;  4R38 A;  3IT9 A;  3TG9 A;  1EWZ A;  1TS8 A;  1LLB A;  1N9L A;  3CG5 A;  2XH9 A;  3KSI A;  2X01 A;  2D02 A;  3PBQ A;  1VHM A;  2YKH A;  5CHM A;  1TS0 A;  3M6B A;  4IED A;  3GMW A;  5LBR A;  1CQA A;  1FSY A;  3HVF A;  4I3J A;  4JGO A;  5JYP A;  4WLA A;  2WZZ A;  4XUZ A;  3F1N B;  3MZD A;  3PAE A;  4WF0 A;  5EUA A;  2VGK A;  2Y91 A;  1IYQ A;  2P9V B;  3UE6 A;  3BFC A;  2GZA A;  4P0M A;  3FC7 A;  1ES2 A;  2HV1 A;  3EWK A;  1IYP A;  4BL2 A;  3LR0 A;  1L2S A;  2MJ6 A;  1E3U A;  2HP9 A;  3SH9 A;  1TDL A;  2Y2O A;  4UHU A;  2OLV A;  2L4R A;  2LB5 A;  4JBF A;  2E8J A;  2EX2 A;  2Y2G A;  4FH2 A;  3E4Q A;  3PHY A;  2OV5 A;  4BBU A;  4IUK A;  2XA7 M;  4R70 A;  5HPI A;  1W63 Q;  4KZ5 A;  1LSX A;  3W4P A;  3T4S A;  4L9F A;  5HSQ A;  2EX8 A;  2V1A A;  3ZQ5 A;  1VQQ A;  5J3W A;  3LIC A;  4ID4 A;  4N1X A;  2PD8 A;  4OLG A;  3RXW A;  1P97 A;  1VEU A;  1PW8 A;  4NET A;  5J4E A;  3BRM A;  2HPB A;  4DDY A;  3RJU A;  4WMC D;  4ME4 A;  5F1G A;  5GLB A;  3VOZ A;  5EVE A;  5FDH A;  3TSG A;  2XEP A;  1FOF A;  1LSV A;  4GCZ A;  1G6O A;  3KYE A;  4E3I A;  2Z2L B;  1XP4 A;  4PAU A;  2KDK A;  3TE8 A;  3V50 A;  4CLC D;  2DRW A;  3A3F A;  4FTX A;  4IUH A;  1I2W A;  2ZL1 A;  3D4F A;  4OPR A;  4D2O A;  2EA9 A;  4E3K A;  2H10 A;  5E2G A;  3NDE A;  3I7J A;  4H6J B;  1OPX A;  1PI5 A;  3CLO A;  1H8Y A;  1K56 A;  4P6B A;  2XGN A;  4Y0U A;  2QMI A;  3O3V A;  3LGO A;  1F5M A;  3IHB A;  5F1F A;  1BLH A;  5F5Y A;  4N92 A;  2KLI A;  5DVA A;  5EE8 A;  3LCE A;  3CPT B;  5DKK A;  1XFQ A;  2VGJ A;  2H28 A;  3BEB A;  4E04 A;  4GJ4 A;  3ZG5 A;  1G28 A;  1OTB A;  3A0R A;  3SOI A;  3G34 A;  1OT9 A;  2IA2 A;  5HW3 A;  5FQ9 A;  4R0Q A;  3QP4 A;  4B4Z A;  3Q82 A;  1ZKJ A;  4GS9 A;  3IXG A;  4F3L A;  2DCF A;  2GX5 A; 
#chains in the Genus database with same CATH homology
 3MZF A;  1FSW A;  2J7V A;  3S22 A;  4P85 A;  2C5W B;  1E4D A;  4R23 A;  3IQA A;  4BL3 A;  4OQ0 A;  5FAQ A;  3W4O A;  4BD1 A;  4GD8 A;  3HL9 A;  4MBH A;  2ZD8 A;  2QPN A;  2XD1 A;  2ZC7 A;  4UA7 A;  3DWZ A;  5AQA A;  2ZJ9 A;  4JLF A;  4KZ3 A;  1CEF A;  3HLG A;  2HDR A;  2Y2J A;  2B5R A;  4GDN A;  4GOG A;  2ZC3 B;  4OOY A;  5GHY A;  1NY0 A;  2JBF A;  3G32 A;  1SKF A;  5CGX A;  1LHY A;  3Q7V B;  1YMX A;  1BZA A;  3O86 A;  4KQQ A;  2ZM2 A;  1ONG A;  5M18 A;  1FR1 A;  1KE0 A;  3OCN A;  1IKG A;  3V3R A;  4OOL A;  3IF6 A;  4ZJ2 A;  3DTM A;  3MBZ A;  2XFT A;  4X56 A;  1YLY A;  3HUM A;  2EFX A;  3UN7 A;  3ZDJ A;  4DF6 A;  3Q81 A;  5EEC A;  5TR7 A;  4DKI A;  2XR0 A;  1GCE A;  3G2Y A;  3VFH A;  4QB8 A;  1YLW A;  3HUO A;  1CI8 A;  3BYD A;  2JC7 A;  4IVK A;  1PYY A;  4Y0T A;  5DTK A;  1K25 A;  3AGE A;  5CHJ A;  1M6K A;  5FQJ A;  4RX2 A;  5KSH A;  4BJP A;  4WMC A;  4LV1 A;  5EVI C;  3PBN A;  2WGI A;  3SS4 A;  3ZVT A;  2Y2H A;  4WEL A;  4OVD A;  4WM9 A;  4ZJ1 A;  1ES4 A;  2FFF B;  5DF7 A;  3ZHH A;  4KZB A;  3NY4 A;  5CTN A;  4DE3 A;  2X02 A;  5FI7 A;  2CC1 A;  2Y59 A;  1KDS A;  4JF4 A;  5M19 A;  3NC8 A;  4RA7 A;  3VP4 A;  3P98 A;  3BM6 A;  3WS0 A;  3ISG A;  3IWO A;  3GTC A;  3GQZ A;  2V20 A;  3P09 A;  4KG6 A;  3Q7Z A;  1YM1 A;  4LV0 A;  1MXO A;  3QNC A;  1WYB A;  4OPZ A;  1BSG A;  4E3N A;  3HBR A;  1SCW A;  1XX2 A;  3FWL A;  4OOM A;  3IF5 A;  4UA9 A;  3UDX A;  1JVJ A;  2PU2 A;  3IH8 A;  1IEL A;  4MBF A;  1KE3 A;  5FAO A;  4EBN A;  5DF8 A;  3HLF A;  1L0D A;  3W8K A;  1H5X A;  5EPH A;  1K4F A;  4GKU A;  4RVA A;  3VP2 A;  1IEM A;  3ZFZ A;  2XQZ A;  2H5S A;  3CMZ A;  1ERM A;  3V5M A;  2EXA A;  4QU3 A;  1NJ4 A;  2J8Y A;  5CHU A;  2HP6 A;  5GHX A;  4F94 A;  3GV9 A;  1NRF A;  4PM7 A;  1Q2P A;  5E2F A;  2EX9 A;  2JE5 A;  4DXC A;  4KZ4 A;  5D3O A;  3HLD A;  5HAR A;  3EQU A;  3IWQ A;  3ZGA B;  5GLC A;  4GZB A;  1CI9 A;  1I2S A;  1NYM A;  2A49 A;  2IWB A;  3SH7 A;  1YLZ A;  1TDG A;  1K6R A;  2ZQ7 A;  3C5A A;  4U0T A;  1PWD A;  3BEC A;  4GD6 A;  3IXD A;  4EWF A;  2A3U A;  3M2J A;  4E3J A;  1ZC2 A;  4KZ8 A;  1BUE A;  2WAE A;  4X6T A;  3DWK A;  1RCJ A;  1TVF A;  4KZ9 A;  1NZO A;  2V2F F;  1E3U D;  4LEN A;  4WZ5 C;  3MXR A;  3SS5 A;  2RL3 A;  3LO7 A;  4EBL A;  4X55 A;  1MWU A;  3Q07 A;  3O87 A;  2WGW B;  3B3X A;  3G31 A;  1DJA A;  3OPR A;  4M3K A;  3G4P A;  2RCX A;  1DJC A;  3Q1F A;  3N7W A;  2WKH A;  3IHA A;  2Y4A A;  4QJG A;  3A3I A;  3OPH A;  4HES A;  4WZ5 A;  5FQK A;  1ONH A;  4PPR A;  4R1G A;  3BFG A;  4FCF A;  1O7E A;  5E43 A;  4E3M A;  2WYX A;  3WS1 A;  2P74 A;  4BEN A;  4Z9Q A;  4GN2 A;  4ZAM A;  2Y2K A;  4LCL A;  3VP1 A;  1MWT A;  2J9O A;  2Y2Q A;  5CED A;  4PM5 A;  1JTG A;  1NZU A;  3LEZ A;  5EOO A;  5A91 A;  3V39 A;  3DW0 A;  3NDG A;  2EXB A;  2OSU A;  2ZQC A;  4OQH A;  3VOY A;  3Q7V A;  1QMF A;  3MKF A;  1O07 A;  4FH4 A;  3N8L A;  4L0L A;  4DRT A;  1YMS A;  1ZG6 A;  1K38 A;  3IWI A;  3UPN A;  3BFD A;  3NIA A;  1IKI A;  4K91 A;  3SH8 A;  3IF6 C;  4FD8 A;  5IHV A;  4E3O A;  1WE4 A;  3V3S A;  4OP5 A;  1MPL A;  1PW1 A;  2DNS A;  4KEN B;  1ERQ A;  4LV3 A;  1L0F A;  4UA6 A;  4Y0O A;  5AQ7 A;  3BLS A;  5J8X A;  4K0X A;  1NYY A;  2H0T A;  3VP0 A;  1W79 A;  4X68 A;  3AGD A;  4E3L A;  2XF3 A;  1LL5 A;  5DTT A;  5E2E A;  4LV2 A;  1C3B A;  2H0Y A;  4YIN A;  1OME A;  4EBP A;  1MY8 A;  5F82 A;  3BFF A;  1JWZ A;  5HAI A;  1GHM A;  1N4O A;  1E25 A;  4JXV A;  3MKE A;  3UDF A;  1FCM A;  3E2K A;  4B88 A;  5CTM A;  4UAA A;  2I72 A;  5HFO A;  3OZH A;  3ZG0 A;  1S6R A;  4QD4 A;  3ITA A;  3WS4 A;  1PI4 A;  1KGE A;  3ZG9 B;  4OLD A;  4KZA A;  3A3J A;  5CEB A;  1K4E A;  1KGG A;  2IWD A;  2ZQA A;  1Q2Q A;  4MEZ A;  1RGZ A;  3HLE A;  4S2P A;  2QZ6 A;  4S2J A;  4QY6 A;  4DXB A;  1XGJ A;  4PM9 A;  2G2U A;  4S2N C;  3GSG A;  3QNB A;  3UPO A;  2PU4 A;  3C4P A;  3FV7 A;  1XA1 A;  1PZP A;  4BLM A;  4X69 A;  1KVL A;  5EVI D;  5CEC A;  1IYO A;  1ZG4 A;  2HDS A;  5HAQ A;  1FCN A;  1FCO A;  4N1H A;  3RXX A;  3UNW A;  4Q8I A;  1ES3 A;  1ESI A;  1JWV A;  1K55 A;  3EQV A;  4OPY A;  4WZ4 A;  1YLJ A;  1K57 A;  4JXW A;  4S2N A;  2G2W A;  4JF6 A;  1W5D A;  4YFM A;  2Y55 A;  3IT9 A;  4LCM A;  1ES5 A;  1EWZ A;  3TG9 A;  1BLP A;  1LLB A;  3CG5 A;  2XH9 A;  1CK3 A;  2X01 A;  4B4X A;  2PBY A;  3PBQ A;  3WS2 A;  4H8R A;  4E6X A;  4GB7 A;  1ERO A;  5CHM A;  4ZJ3 A;  1SDN A;  3G30 A;  3N8S A;  4S2M A;  3ITB A;  3M6B A;  3C7V A;  4IED A;  3GMW A;  4O7D A;  4EV4 A;  1GHI A;  1N9B A;  4S2I A;  1TEM A;  1ESU A;  4NK3 A;  1YQS A;  3WRT A;  1FSY A;  3HVF A;  5EVI B;  5GLD A;  4IVI A;  3PAG A;  4OPQ A;  4RX3 A;  3PTE A;  3IH9 A;  4ZTK A;  2UWX A;  3N6I A;  5JYP A;  2WZZ A;  3ZNY A;  2WGW A;  4KQO A;  4KZ6 A;  3MZD A;  4XUZ A;  5FQI A;  3PAE A;  4KG2 A;  5FSR A;  4JPM A;  5L2F A;  1KDW A;  1RP5 A;  5EUA A;  2VGK A;  2Y91 A;  5EVL A;  1IYQ A;  2P9V B;  2ZC4 B;  4A5R A;  2Y2P A;  3BFC A;  4P0M A;  2Q9N A;  4FSF A;  3M6H A;  1XKZ A;  1BLS A;  1ES2 A;  1YLP A;  1JWP A;  3OC2 A;  4MNR A;  5A92 A;  1Y54 A;  1IYP A;  2XLN A;  4ZDX A;  4BL2 A;  4PM6 A;  1IYS A;  3IXB A;  1L2S A;  4EQI A;  1SHV A;  3GVB A;  5HAP A;  4QY5 A;  2R9X A;  4E6W A;  2Y2L A;  1FQG A;  2FFY A;  3N8R A;  1E3U A;  5CXW A;  4RYE A;  2HP9 A;  4HEF A;  3SH9 A;  1TDL A;  1PWC A;  3PBT A;  2C6W B;  2Y2O A;  4UHU A;  2OLV A;  3LY3 A;  4CPK A;  3UY6 A;  4OON A;  3S4X A;  4JBF A;  1XXM A;  1NXY A;  3IXH A;  3VMA A;  1MKI A;  2EX2 A;  1G68 A;  1RGY A;  4ZBE A;  4IBX A;  2Y2G A;  4FH2 A;  1DY6 A;  1WYC A;  3VSL A;  3A3E A;  3HUN A;  4N9L A;  3WS5 A;  1YT4 A;  3A3D A;  3FZC A;  3WRZ A;  3GR2 A;  3C4O A;  5HL1 A;  1BUL A;  1W8Y A;  2OV5 A;  3ZG8 B;  3UDI A;  2XDM A;  4WYY A;  1MWR A;  4WBG A;  1K54 C;  4KZ5 A;  1BTL A;  5FQQ A;  3W4P A;  1LI9 A;  5CRF A;  4EUZ A;  4X53 A;  3FKV A;  3W4Q A;  4R4S A;  5FI6 A;  2EX8 A;  3NBL A;  2ZC5 B;  2ZM0 A;  4CJN A;  1HVB A;  1VQQ A;  1JTD A;  3UPP A;  2Y2N A;  5BOH A;  3MFD A;  5DTS A;  1VM1 A;  4ID4 A;  4N1X A;  3BFE A;  3OPP A;  2HDQ A;  1S0W A;  1K54 A;  2WKI A;  2BLS A;  3LY4 A;  5F83 A;  5U47 A;  5G18 A;  2XFS A;  4JXS A;  4S2O A;  4OLG A;  4JF5 A;  3BLM A;  5I94 A;  4DE0 A;  4K0W A;  3TOI A;  4MLL A;  2EFU A;  3PBS A;  4PMA A;  5GLA A;  3RXW A;  3ZCZ A;  1PW8 A;  2WUQ A;  4NET A;  4OKP A;  3BRM A;  1BT5 A;  3VFF A;  5DF9 A;  1J9M A;  1FR6 A;  2HPB A;  4DDY A;  4WEK A;  4WMC D;  3HLB A;  5CER A;  3RJU A;  3GRJ A;  1H8Z A;  5F1G A;  4IBR A;  1QME A;  5GLB A;  3HLC A;  5TGF A;  3S1Y A;  3VOZ A;  1GHP A;  3JYI A;  2R9W A;  3OPL A;  3WWX A;  5A90 A;  1K55 C;  5FDH A;  3TSG A;  4C75 A;  2WAD A;  3MZE A;  5CGW A;  2XEP A;  1FOF A;  4KZ7 A;  1K57 C;  4U0X A;  1ALQ A;  5M1A A;  3IF6 B;  4BD0 A;  4GNU A;  1HTZ A;  2Y2I A;  4E3I A;  1U60 A;  5FAT A;  1HZO A;  2Z2L B;  4WEJ A;  3UE3 A;  3QHY A;  2WKE A;  1XP4 A;  4BQM A;  1G6A A;  4DDS A;  5AQ9 A;  3UE0 A;  1EI5 A;  1W7F A;  3VSK A;  4C3Q A;  2ZQ9 A;  1PZO A;  1K56 D;  5AQB A;  3N4I A;  1XA7 A;  3ZVW A;  3FYZ A;  3V50 A;  5TFQ A;  3AGF A;  2DRW A;  1LL9 A;  2HP5 A;  3A3F A;  3E2L A;  2ZM8 A;  1I2W A;  3D4F A;  4C6Y A;  1KGF A;  4OPR A;  1GA0 A;  1DJB A;  4D2O A;  4E3K A;  2H10 A;  1Z6F A;  5EVI A;  5E2G A;  2Y2M A;  3I7J A;  3NDE A;  2ZC6 B;  1K6S A;  3MXS A;  2HDU A;  5E2H A;  1PI5 A;  1MWS A;  2X71 A;  3C7U A;  5KMW A;  3UE1 A;  4S2K A;  5HX9 A;  1H8Y A;  2IWC A;  1M40 A;  2ZLY A;  4OP8 A;  3CZD A;  1GA9 A;  1K56 A;  2P9V A;  1W8Q A;  2WZX A;  5CGS A;  4MBK A;  4PM8 A;  4R3J A;  4P6B A;  5KSC A;  1HD8 A;  2XGN A;  4OQI A;  5JYO A;  4Y0U A;  2QMI A;  3O3V A;  4DE2 A;  2V1Z A;  4KG5 A;  2Q9M A;  5FI2 A;  1YLT A;  5GHZ A;  3CJM A;  3FKW A;  2EX6 A;  4XXR A;  3NI9 A;  5KZH A;  3NCK A;  3IHB A;  5F1F A;  1CEG A;  1BLH A;  3OCL A;  4N92 A;  4P87 A;  1L0E A;  2OLU A;  5DVA A;  2JCH A;  5EE8 A;  3LCE A;  4N9K A;  3ZNT A;  4JKT A;  5EOE A;  2ZQ8 A;  2VGJ A;  3BEB A;  4OQG A;  3HRE A;  4HBT A;  3VP3 A;  2E8I A;  5A93 A;  2WGV A;  3G2Z A;  1I5Q A;  4DE1 A;  2GDN A;  3ZG7 B;  3ZG5 A;  1XGI A;  3PBR A;  4U3T A;  2WK0 A;  5FAS A;  1KVM A;  5FQM A;  3SOI A;  1BLC A;  4QHC A;  4S2L A;  2ZMA A;  1AXB A;  3G34 A;  1XPB A;  2XD5 A;  4GDB A;  4Y7P A;  1PIO A;  5GL9 A;  1MBL A;  5HW3 A;  3M2K A;  5FQ9 A;  4R0Q A;  2J9P A;  3Q82 A;  1PWG A;  4OH0 A;  4B4Z A;  2ZQD A;  1SDE A;  1ZKJ A;  3HLW A;  2WAF A;  1LI0 A;  2BG1 A;  4R3B A;  1KE4 A;  2Z2M B;  3PBO A;  4KQR A;  5FA7 A;  2XK1 A;  3G35 A;  5FAP A;  4R4R A;  3O88 A;  1L0G A;  3IXG A;  4HBU A;  3UO9 A;  3SS3 A;  4JXG A;  2DCF A;  4XUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...