3HUOA

X-ray crystallographic structure of ctx-m-9 s70g in complex with benzylpenicillin
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
262
structure length
262
Chain Sequence
TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dynamic view of the early and late steps of the catalytic mechanism mediated by the emerging enzymes CTX-M.
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords CTX-M-9 extended-spectrum beta-lactamase
total genus 95
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3huoA00
4BD0A 2FFFB 3IQAA 3IWIA 4UHUA 1ES4A 4LENA 3UNWA 2JBFA 4L0LA 2EFUA 1PI4A 3AGFA 1MBLA 2XH9A 1YLWA 3HLWA 2I72A 4YFMA 3WWXA 4BL3A 1G68A 4EBNA 4WMCA 2GDNA 1IYPA 1SDNA 1LL9A 3E2LA 3MXRA 3SH7A 3LY3A 3N8LA 1CI9A 3VP4A 3WS5A 3VFHA 3UDXA 3N8RA 4OOYA 3IH8A 1LI0A 2ZD8A 1YM1A 4ZJ2A 4C75A 3C7UA 1ERMA 1K6RA 1L0EA 2Y55A 3BFDA 1KDSA 1SCWA 1ZKJA 3IWOA 4LV3A 2ZQAA 3LO7A 1W5DA 3Q7ZA 4KZ6A 2ZQCA 3AGEA 3O3VA 4Y0UA 1Z6FA 3Q81A 4EUZA 2XEPA 4IVIA 5HAIA 4JPMA 3ZG0A 5DTSA 2EX9A 3N8SA 4X69A 2XGNA 5TR7A 4FH4A 3S4XA 3UE1A 2Y2LA 1KGFA 4KG2A 1IEMA 3V3SA 1NJ4A 3HLCA 3MZFA 2E8IA 5M1AA 4X56A 1K6SA 2WGIA 5FI2A 3EQVA 2ZC6B 1E3UA 2Y91A 2Y2KA 4KQQA 2P9VA 1EI5A 4S2LA 5DVAA 3UPNA 4MLLA 2EXBA 2XR0A 3Q82A 4WEJA 2IWBA 1XA7A 5AQ7A 3UN7A 4N9KA 1K54C 3M6BA 1IYQA 4Y0TA 4OOMA 4OOLA 2H0TA 2RCXA 3BLSA 5TGFA 5HAQA 3MXSA 5KSCA 1K25A 3SS4A 4PM8A 4GB7A 3WS1A 1YLPA 3BFGA 2Y2MA 1K38A 3IXHA 4JXSA 4E3NA 3B3XA 1RCJA 4NETA 1ZG6A 5CGXA 1M6KA 2IWDA 4MBKA 4U0TA 4N1XA 1K55C 2WZXA 2HP9A 2V20A 2R9XA 1C3BA 3CMZA 2DCFA 3PBQA 4N9LA 4P6BA 4RX2A 2JC7A 3BFEA 4IVKA 2WKIA 3IXBA 5JYOA 4EQIA 2WAFA 1BT5A 4GZBA 2Y59A 3BFCA 1BZAA 1EWZA 4PMAA 5HARA 4MNRA 4R0QA 5FQQA 1W79A 3M6HA 5FI6A 5EOOA 2WAEA 4CJNA 4MBHA 3G4PA 5GLAA 3PAEA 1NY0A 2J7VA 2WKHA 3M2JA 3PBTA 1AXBA 4K91A 2Y2IA 1MWSA 3UE0A 5KSHA 1YMSA 4C3QA 3PBSA 3IHAA 1E25A 1BLPA 2WYXA 1SKFA 1ESUA 4XUXA 4EV4A 3ZCZA 3WRTA 3G2ZA 1JTGA 3CJMA 4OQIA 1Q2PA 4S2KA 3HUMA 4GDBA 1E3UD 4OPYA 4E6XA 2XK1A 3ITAA 3W4PA 3W8KA 5M19A 1CK3A 3ZG5A 4X68A 4Z9QA 3VP0A 4ZDXA 3PTEA 1K54A 4GNUA 3ZG7B 2G2UA 1L0GA 3ZG8B 3HUNA 1ESIA 3VP1A 1GA9A 2EX2A 4RX3A 4HBTA 3GMWA 1FCNA 3MKFA 1DY6A 4QD4A 4GDNA 4QB8A 5HAPA 4QU3A 4MBFA 2Z2MB 1H5XA 5DTKA 4ID4A 3M2KA 5FSRA 5JYPA 3VP2A 3SS5A 3VOYA 3ZFZA 3OPHA 1WYBA 1L0FA 1RP5A 2ZLYA 3QNBA 2UWXA 4XXRA 5EE8A 3Q1FA 3HBRA 4X53A 5F82A 1IELA 1XGIA 4WEKA 2ZM8A 1G6AA 3RXXA 4R1GA 4X6TA 1L0DA 3IXGA 1DJCA 2H5SA 3C5AA 5L2FA 2HP6A 3C4PA 3LY4A 1XP4A 2A3UA 2X01A 1PW1A 3FKWA 1O07A 1CEGA 1LHYA 3PBRA 2HP5A 4WM9A 5AQ9A 1DJAA 4S2OA 1S0WA 1QMEA 4YINA 4BJPA 4D2OA 2V2FF 3A3DA 1WE4A 4ZJ1A 5IHVA 3DWZA 3ISGA 2CC1A 4K0XA 4UA6A 2HDUA 4JKTA 2ZQ7A 3BM6A 3ZGAB 3UDFA 1O7EA 1K57C 1MXOA 4OKPA 2Q9NA 3HLGA 4H8RA 5DF7A 3A3FA 5HX9A 2Y2OA 3IHBA 4ZTKA 2A49A 3ZG9B 3PAGA 3AGDA 2VGJA 3WS4A 5EVIC 1JWPA 4R4SA 3HLDA 4WELA 4OONA 4DKIA 5GLCA 1KVLA 1NXYA 4QY5A 1FCOA 1YLTA 2DNSA 4P87A 2OLUA 4LV1A 3IF6B 1W7FA 1YLZA 1N9BA 1MKIA 2H10A 3VFFA 1L2SA 2ZM2A 1Y54A 2G2WA 1K4FA 5E2GA 2XDMA 3GSGA 4RYEA 1GHMA 3IXDA 3MFDA 3SS3A 1LLBA 1NYYA 2HDQA 3UPPA 1NZOA 1JWZA 5KMWA 3BYDA 5GLBA 3HLEA 5GHXA 3V5MA 1PZPA 5CHJA 5DTTA 1I2WA 4P0MA 5FASA 1GCEA 1ONHA 2BG1A 2ZQ8A 3ZNYA 1MY8A 1GHPA 4KZ7A 4LV2A 2B5RA 3MBZA 5F1GA 4JBFA 1HZOA 1CI8A 2X02A 1K57A 3GQZA 4B4XA 3WS0A 2Y2QA 3MKEA 4S2PA 4N92A 5DF8A 4BL2A 3UPOA 2XLNA 3OPPA 5CHUA 4WYYA 2WGVA 5CHMA 1YLJA 3GV9A 4M3KA 3QNCA 4R23A 4K0WA 1FR6A 1KGGA 3HLBA 3Q7VA 3FKVA 3GVBA 4BLMA 4OPRA 3OZHA 1WYCA 3TOIA 3D4FA 3BEBA 2V1ZA 5F83A 3W4QA 1BLCA 5A93A 4DRTA 5CERA 3HREA 1KE4A 2BLSA 3ITBA 1ES3A 3DTMA 3FWLA 2PU4A 3PBNA 1E4DA 2PBYA 3MZDA 1XPBA 2C6WB 3C7VA 1K4EA 3IT9A 4OQ0A 1GHIA 2Y4AA 5E2FA 1HVBA 4F94A 4A5RA 1FOFA 2DRWA 3PBOA 3JYIA 5KZHA 1KE0A 1ERQA 5CGWA 4Y7PA 3O87A 1BUEA 4GD6A 3V3RA 3DW0A 4EBLA 4WZ5A 4S2MA 4DE0A 1CEFA 4OH0A 5A91A 1ONGA 2XD1A 2ZQDA 2HPBA 2QMIA 2WGWB 4PM6A 1SHVA 3OCNA 5D3OA 5AQAA 4KZ4A 4KZAA 3TSGA 3G31A 4C6YA 2ZMAA 1TEMA 2HDSA 3GR2A 1PWGA 2FFYA 3GTCA 2PU2A 2J8YA 1PI5A 3IWQA 4FSFA 5FAOA 3UO9A 1BULA 5EECA 5E43A 5GHYA 4E3JA 1IKIA 4CPKA 4MEZA 5EVLA 1ES5A 2ZC7A 1W8YA 3ZDJA 5EVID 3NIAA 3VSLA 4GOGA 3FV7A 3LCEA 1IYOA 5CTNA 4EBPA 2Q9MA 2OV5A 4LV0A 4B4ZA 3IF6C 3FZCA 1TDLA 4QY6A 3OC2A 1MWUA 2XFSA 4BENA 1NZUA 3WRZA 1IYSA 4DE2A 3Q07A 3HUOA 4KZ5A 4OQGA 4N1HA 2Y2HA 5HW3A 4LCMA 4ZJ3A 1ZG4A 4GD8A 3OPRA 4KZBA 1PWDA 1H8YA 4R3BA 1PW8A 4GKUA 1LL5A 4S2IA 1BLHA 4JF4A 1BTLA 5FQ9A 4E6WA 5I94A 1Q2QA 4KQRA 2XFTA 2P74A 5EUAA 3IH9A 1GA0A 4OPQA 4PM5A 5FAPA 4FCFA 4KQOA 4OP5A 1NRFA 1RGZA 1BLSA 2Y2NA 3DWKA 3NBLA 5E2HA 5FI7A 4XUZA 4KG6A 3SH9A 2WK0A 1YQSA 2HDRA 2ZC3B 4PM7A 1DJBA 3A3EA 4OLDA 5CXWA 2ZC5B 4JF6A 2R9WA 1ALQA 4P85A 2QZ6A 1MWTA 2J9OA 2VGKA 3SOIA 3O86A 2ZQ9A 1VQQA 5FQJA 2P9VB 1ZC2A 4U3TA 1TDGA 1MPLA 5CGSA 4NK3A 4IBXA 4OVDA 4WMCD 2RL3A 4B88A 4PM9A 5HFOA 1PYYA 1ES2A 3NDEA 3NDGA 3G2YA 4Q8IA 1SDEA 2XF3A 4BD1A 3BFFA 2Y2GA 5CTMA 1PWCA 2ZC4B 1BSGA 3HLFA 3RJUA 4S2JA 3N4IA 3OPLA 4HEFA 4WZ5C 2JE5A 4JLFA 4O7DA 1VM1A 3MZEA 5DF9A 3P98A 3NCKA 4BQMA 5EVIB 4QJGA 4IEDA 4OQHA 3SH8A 1XXMA 5CEBA 4KG5A 3Q7VB 4JF5A 4KZ8A 1JTDA 3CG5A 4R4RA 3TG9A 3OCLA 1FCMA 4QHCA 5GHZA 5HL1A 3IF5A 4HESA 1H8ZA 5FA7A 4JXVA 3G32A 3UDIA 4X55A 1XA1A 3RXWA 2WADA 2EX8A 5GLDA 1K56D 1HTZA 3UY6A 4S2NA 5AQBA 4LCLA 2X71A 4FH2A 5J8XA 4S2NC 3HL9A 2EX6A 5BOHA 1MWRA 4ZAMA 3E2KA 5CEDA 2WUQA 4OP8A 4DXCA 1FQGA 1LI9A 3BLMA 3HVFA 2OSUA 2XD5A 5FATA 3ZNTA 2WKEA 4KZ9A 3G34A 3QHYA 2H0YA 4FD8A 1NYMA 1K55A 4U0XA 3IF6A 3ZHHA 4RVAA 3ZVWA 2Z2LB 5G18A 4E3OA 2C5WB 1JWVA 1K56A 1FSWA 2EXAA 3VP3A 3O88A 4UAAA 1KE3A 1PZOA 2OLVA 3LEZA 4EWFA 2WGWA 4JXWA 3S22A 1XGJA 3S1YA 4KENB 2XQZA 4DE1A 4DF6A 2IWCA 5TFQA 1KVMA 3G30A 1U60A 5FQIA 1KGEA 1I5QA 2J9PA 2Y2PA 3NI9A 3A3JA 1YLYA 3NY4A 4R3JA 3I7JA 5EVIA 3VMAA 3N6IA 4Y0OA 5FQMA 4WZ4A 2Y2JA 4JXGA 1OMEA 5A92A 4OPZA 5E2EA 1N4OA 4E3IA 4GN2A 5M18A 1S6RA 3GRJA 4DE3A 1I2SA 3V50A 1YMXA 2WZZA 4UA7A 4OLGA 4E3KA 5U47A 1FR1A 3WS2A 1TVFA 5F1FA 3NC8A 5FAQA 5A90A 1FSYA 1IKGA 4DDSA 1W8QA 4UA9A 5CRFA 5EOEA 4E3MA 3C4OA 3BRMA 1XKZA 4ZBEA 2ZJ9A 1QMFA 1J9MA 5GL9A 3VSKA 3W4OA 1HD8A 3UE3A 1RGYA 1M40A 4HBUA 3BECA 3P09A 1EROA 5FDHA 5CECA 4IBRA 4RA7A 3G35A 4KZ3A 4E3LA 1KDWA 3A3IA 4WBGA 5EPHA 1XX2A 1JVJA 3EQUA 3ZVTA 1YT4A 3VOZA 3N7WA 4PPRA 3V39A 5FQKA 4DDYA 1PIOA 2EFXA 3CZDA 3FYZA 4DXBA 2ZM0A 2JCHA 2QPNA
chains in the Genus database with same CATH superfamily
2Y79A 4BD0A 3IQAA 3F1NA 3LR0A 3A0RA 4I38A 1ES4A 4LENA 3UNWA 2JBFA 3NJAA 2XH9A 4WN5A 2GDNA 4Y3IA 1SDNA 1LL9A 1NWZA 3MXRA 1A0KA 4WL9A 3UDXA 4OOYA 3QP8A 2ZD8A 1YM1A 3C7UA 1TF1A 2MJ6A 2Y55A 5AJGA 3IWOA 2ZQAA 2ZQCA 1Z6FA 2XEPA 1L3LA 4EESA 4FH4A 3UE1A 4KG2A 3V3SA 2E8IA 2WGIA 1YSQA 5L09A 1E3UA 2P9VA 3UPNA 4MLLA 2IWBA 1K54C 4Y0TA 4OOMA 5TGFA 3BLSA 5HAQA 5KSCA 4CLCE 1F2KA 4GB7A 4JXSA 1ZG6A 4U0TA 2OAP1 4UQIM 3S7QA 2R9XA 4N9LA 2ZBBA 3IXBA 2WAFA 2Y59A 4MNRA 2PYPA 3KSGA 4MBHA 3DTIA 2J7VA 1AXBA 1MWSA 3UE0A 5KSHA 4C3QA 3PBSA 1E25A 1BLPA 3ZCZA 3V67A 1XJ3A 1Q2PA 2QWSA 4GDBA 1E3UD 4JGOA 4OPYA 2ZL1B 4E6XA 2XK1A 5TBMA 3W4PA 4Z9QA 3VP0A 4GNUA 2G2UA 3H7WA 3VP1A 2EX2A 4GHIA 1S1YA 5HAPA 4QU3A 5L07A 4I5SA 5JYPA 1WYBA 2ZLYA 3C8CA 3QNBA 3UB9A 2ZM8A 2H5SA 2HP6A 2A3UA 2X01A 3NOPC 4G3VA 2A2LA 2HP5A 3CHWP 3ISGA 2CC1A 4UA6A 3BM6A 2OWJA 3UDFA 1O7EA 5HX9A 1K0KA 2Y2OA 3IHBA 3KSHA 1TD5A 4OONA 5GLCA 3KYEA 1YLTA 3NECA 2PD8A 3VFFA 2QHKA 1L2SA 1Y54A 3FG8A 4ETZA 5E2GA 3GSGA 1GHMA 4O0PA 1LLBA 2HDQA 5GLBA 3V5MA 4P6ZM 5FASA 3PR6A 2BG1A 2ZQ8A 1GHPA 3MBZA 3EEAA 5F1GA 1J3WA 4S2PA 2XLNA 3W2ZA 5J3WA 4GJ4A 4K0WA 5HSQA 5LBRA 5DJTA 4OPRA 2HGVA 1WYCA 3D4FA 3W4QA 5CERA 3HREA 1XJ6A 1ES3A 5DJUA 1HVBA 1FOFA 4BBTA 1BUEA 4GD6A 4WZ5A 5A91A 2JKTM 2HPBA 3OCNA 1PRQA 2ZMAA 3GR2A 2Q0OA 3IWQA 5FAOA 3UO9A 1BULA 5GHYA 4E3JA 5J7EA 2XROA 2ZC7A 3NIAA 5CTNA 1TS7A 2J3WA 1MWUA 3Q07A 2JKFA 2PDRA 2Y2HA 3LFVA 4LCMA 5HW3A 4I3AA 2PAVP 3IX3A 3OPRA 1PWDA 4GKUA 1LL5A 1S1ZA 1XFNA 1Q2QA 1GA0A 1S66L 3DWKA 2V8CA 2HDRA 4PM7A 4JF6A 4HP4A 4P85A 2QZ6A 1MWTA 5G4ZA 2P9VB 2J80A 4JGQA 4IBXA 2RL3A 4B88A 4PM9A 1ODVA 3NDGA 4ETXA 3N4IA 3OPLA 4O7DA 1VM1A 4WUJA 5DF9A 2P7JA 3CPTA 3T4SA 1XXMA 4H6JB 2XSSA 4KZ8A 1JTDA 4FOFA 5GHZA 4JXVA 1XA1A 5GLDA 1N9LA 5AQBA 4ZAMA 3E2KA 2V9AA 1G6OA 4H6JA 3T1XA 1FQGA 4Q0JA 3BLMA 2OSUA 2XD5A 3A0VA 3ZNTA 2WKEA 3G34A 2VLGA 1DP9A 3CUEC 4FD8A 4U0XA 3PXPA 5G18A 4E3OA 1FSWA 2EXAA 1OJ5A 1PZOA 2V1BA 3S22A 1ZTUA 2A24B 4KENB 1TS8A 4QWOA 4DF6A 2IWCA 1I5QA 3QP5A 3JVVA 4QPRA 3NI9A 1YLYA 2O9CA 3TE8A 5EVIA 4Y0OA 2M1CA 4OPZA 4E3IA 1N4OA 2HF6A 3MQOA 4OLGA 3HJKA 1OT9A 1FR1A 3WS2A 1TVFA 5F1FA 5FAQA 5A90A 4DDSA 2BTFP 5CRFA 4E3MA 3C4OA 4ZBEA 2VKSA 3W4OA 4HBUA 5CECA 3G35A 1KDWA 5EPHA 3QP6A 5FL3A 1YT4A 4EW7A 4HQAA 1PIOA 4YOFA 4DXBA 4WF0A 3BFGA 5HPIA 3IBRA 3H7WB 3IWIA 3MFXA 4L0LA 4UEYA 3S7NA 1MBLA 1YLWA 3WWXA 4WMCA 3E2LA 4HIAA 3SH7A 2BASA 3WS5A 4F3LA 3E4QA 3EWKA 1XFQA 3UB8A 1K6RA 1L0EA 3BFDA 2YKHA 5MC7A 3LO7A 5EFWA 5HWVA 4Y0UA 3Q81A 4NXEA 4IVIA 4JPMA 3F1PB 5DTSA 3N8SA 2AVXA 1UGUA 1IEMA 3LIDA 3HLCA 4NXGA 1K6SA 2Y91A 4KQQA 4HJ6A 2Z6CA 3NOUC 5DVAA 4HH2A 1F98A 3UN7A 5AQ7A 2G7UA 1K25A 3S7PA 3HJIA 2W3DA 2Y2MA 4DJ2A 1K38A 2QJ5A 3LEQA 5CGXA 2IWDA 4MBKA 1K55C 2WZXA 4IUKA 2DCFA 5EM0A 2JC7A 3DBAA 5JYOA 2VV7A 3FPWA 4GZBA 5HARA 4IJGA 4CJNA 3G4PA 5GLAA 3T4LA 2WKHA 2Y2IA 5HDCA 2V8FA 4I3JA 1ESUA 1LSWA 4HOIA 4OQIA 3EGDC 3HUMA 3QP4A 2VK3A 4YNRA 3W8KA 1CK3A 1XJ4A 4ME4A 3PTEA 1K54A 1GA9A 4RX3A 1GSVA 4HBTA 1FCNA 1DY6A 4GDNA 4QB8A 2XRNA 4MBFA 3DAVA 1PFLA 4ID4A 5FSRA 3VP2A 2VV6A 3OPHA 2UWXA 5EE8A 3Q1FA 5F82A 1IELA 4GW9A 3RXXA 4X6TA 1P9RA 1GSWA 1DJCA 4HY8A 5CX7A 3FKWA 1OTAA 3K3DA 4S2OA 2V1AA 4R70A 4YINA 3SZTA 1OTBA 4K0XA 1DP8A 1GSXA 2ZQ7A 1T18A 4OKPA 2Q9NA 3U2AA 2A49A 3ZG9B 3PAGA 2VGJA 4DKIA 5F69A 1KVLA 1Y4OA 2LB9A 4JGPA 2OLUA 3IF6B 1W7FA 3BW6A 4HJ3A 1N9BA 2H10A 2ZM2A 4RYEA 2JN7A 4E04A 1NYYA 5KMWA 3QP2A 2J3TD 3HLEA 4BBVA 5GHXA 3T4JA 4B93A 5CHJA 2O9BA 1I2WA 3VV4A 4NKPA 3MQ0A 4KZ7A 1VETB 1HZOA 4Y5FA 1CI8A 4B4XA 1K57A 3WS0A 2ZMVA 5CHMA 1OJGA 1YLJA 4M3KA 3QNCA 2V0WA 1DP6A 1KGGA 3HLBA 3Q7VA 3KO6A 3TOIA 1BLCA 1KE4A 2BLSA 3ICYA 1X0OA 1E4DA 2C6WB 4F94A 1VEUB 3U4LP 2KDKA 1HLUP 3JYIA 4Y7PA 3O87A 3V3RA 4AFIA 2L0WA 4DE0A 1CEFA 2W27A 1WA9A 4KZAA 3C38A 3B42A 4C6YA 3GTCA 2FFYA 4FSFA 5E43A 1IKIA 2OWHA 1ES5A 3ZDJA 3MMHA 3LCEA 2IA2A 4GHIB 4EBPA 2H28A 4LV0A 3R7WB 3IF6C 4PKYA 3TRCA 3A0SA 1NZUA 3WRZA 1IYSA 1TS0A 4KZ5A 2J3TC 2FZ0A 1ZG4A 5HD5A 3BWLA 2DMWA 1YKDA 1BLHA 1BTLA 4KQRA 3UE6A 2P74A 5EUAA 1D7EA 5FAPA 4KG6A 2ZC3B 3A3EA 2R9WA 1ALQA 2VGKA 3SOIA 1CQAA 2I9VA 4U3TA 4R3AA 5CGSA 4NK3A 4WMCD 1ES2A 3NDEA 3F1OA 2W3GA 2XF3A 3BFFA 4Y17A 5CTMA 1BSGA 3LI9A 2EA9A 4HEFA 4JLFA 3MZEA 3DTEA 3P98A 3NCKA 5EVIB 4QJGA 4IEDA 2QJ7A 1P0ZA 4M4XA 1W63Q 3CG5A 2KLIA 4BWIA 3OCLA 2A24A 3LICA 4HESA 1VB6A 1YPRA 3G32A 3UDIA 3RXWA 2M7VA 2EX8A 4S2NA 5BOHA 1MWRA 4OP8A 2PHYA 2VV8A 2GZAA 3HVFA 3NOTC 4KZ9A 5HWWA 1NLZA 1NYMA 1K55A 3IF6A 3UB6A 1D1JA 1JNUA 2C5WB 5IT5A 3O88A 1KE3A 4DMZA 5F68A 1NLYA 1IFQA 2WGWA 3S1YA 1IOUA 2XQZA 3E4PA 3TJZC 3G30A 1U60A 2XA7M 5F5YA 2WKQA 2Y2PA 3A3JA 4R3JA 5TJJA 3N6IA 3T4OA 2Y2JA 5E2EA 1P9WA 1S6RA 1I2SA 3V50A 4E3KA 1LT0A 4X1MA 1OTDA 4EQ1A 1FSYA 1IKGA 1W8QA 1T1CA 3BRMA 5C5KA 1XKZA 4MCWA 2ZJ9A 1MKMA 1QMFA 5GL9A 3VSKA 4HH3A 2HZ5A 1HD8A 1RGYA 1M40A 3P09A 5FDHA 3T4KA 4IBRA 4RA7A 4E3LA 4KZ3A 1G28A 4PPRA 3V39A 1YSPA 3FYZA 3IH8A 3LR4A 2P08A 4I39A 5EVEA 3R4KA 2EFUA 3AGFA 4HNBA 2K2NA 2PRFA 3HLWA 4EBNA 4MDZA 3R7WA 3N8LA 1CI9A 1OTIA 3UB7A 3N8RA 1LI0A 4ZJ2A 3PYPA 1KDSA 4FTXA 4L9FA 3Q7ZA 1NRJA 4KZ6A 3AGEA 3O3VA 2K7SA 4EUZA 3IX8A 3GDIA 5L10A 3ZG0A 2EX9A 2XGNA 2ZOIA 2B18A 2Y2LA 1NJ4A 3MZFA 5M1AA 3E0YA 2JKTI 2VJWA 2Y2KA 1EI5A 3PHYA 3Q82A 4WEJA 1IYQA 4OOLA 2RCXA 3MXSA 3SS4A 3LIEA 4PM8A 1H0MA 4BMWA 3WS1A 1YLPA 4NETA 1M6KA 4N1XA 3OBFA 2V20A 4RX2A 4XT2B 2Z6DA 3BFEA 1W63M 2W3EA 3BFCA 5EV0A 1BZAA 1EWZA 4PMAA 1W79A 3M6HA 5FI6A 5EOOA 2WAEA 4Q0IA 3PAEA 1NY0A 3PBTA 4JGRA 4K91A 4PHTA 2Y8HA 2WYXA 1SKFA 5FEFA 4EV4A 3WRTA 3G2ZA 4S2KA 3ITAA 4LRYC 1P97A 4X68A 4ZDXA 3UB5P 3ZG8B 1L0GA 4IHQA 4QD4A 1FIKA 5DTKA 3M2KA 5I5LA 3SS5A 3EOIA 3BY9A 1L0FA 4XXRA 3HBRA 4X53A 2O0YA 2HJEA 3C4PA 1V9ZA 1PW1A 1T1BA 1O07A 1VEUA 1CEGA 4LRXC 3D3OA 3PBRA 4WM9A 4R38A 4DN0A 5AQ9A 1DJAA 1S0WA 2PT7A 1QMEA 4BJPA 4D2OA 1BYWA 3T1SA 2V2FF 1WE4A 4ZJ1A 5IHVA 3DWZA 4F3LB 4RQ9A 3ZGAB 5DF7A 3A3FA 4ZTKA 4UQIS 3C2WA 5EVIC 4R4SA 2PYRA 1FCOA 4LV1A 1YLZA 4Y2FA 1ACFA 2G2WA 1K4FA 3JVUA 3IXDA 3K2NA 3UPPA 2YKFA 3MR0A 3L9KA 5HPFA 4P0MA 1GCEA 1ONHA 5KIZA 3ZNYA 1MY8A 4B9OA 4MN6A 3GQZA 2WKPA 2Y2QA 5DF8A 4ZRRA 3UPOA 4X1LA 1S67L 3GV9A 1FR6A 3FKVA 3GVBA 1UWPX 3OZHA 3D72A 3BEBA 2V1ZA 4DRTA 3ITBA 2PU4A 1F9IA 2PBYA 3MZDA 1K4EA 3FC7A 1GHIA 2Y4AA 3KYQA 1KE0A 1ERQA 3DW0A 4EBLA 4S2MA 1FILA 4OH0A 3LR5A 2XD1A 2WGWB 1DRMA 1MZUA 2NUTC 4KZ4A 3TSGA 4PAUA 3LIAA 1TEMA 2HDSA 1PWGA 1VETA 2PU2A 2K31A 4O8GA 1LSVA 5DFXA 2NUPC 4CPKA 3P01A 2W1TB 1W8YA 2R78A 5EVID 3FV7A 3MSHA 1T1AA 2D01A 4B4ZA 3CUEA 1TDLA 3OC2A 2XFSA 4BENA 4DE2A 3HUOA 4N1HA 3UMDA 4ZJ3A 4XT2A 4KZBA 3LR3A 1H8YA 4R3BA 1PW8A 4L9GA 4E6WA 3KSIA 3IH9A 4OPQA 4OP5A 2Y2NA 1BLSA 3LI8A 3NBLA 5FI7A 3SH9A 2WK0A 1YQSA 1DJBA 4OLDA 5CXWA 2ZC5B 4GS9A 1CJFA 2JKGA 3O86A 2ZQ9A 4HI4A 3BQ8A 5FQJA 2M7UA 4L9EA 3T4QA 2VX8A 3T12B 1SDEA 2Y2GA 3T1QB 1PWCA 2ZC4B 3H82B 4GS9B 3CPTB 2JE5A 2KX6A 4GLQA 4EU0A 5F6AA 3MJQA 4KQDA 5CEBA 3Q7VB 3TG9A 4R4RA 4QHCA 5L8MA 5HL1A 3IF5A 3KSFA 4X55A 2WADA 3UY6A 3MXQA 4FH2A 5J8XA 4S2NC 3HL9A 2EX6A 3IX4A 4PKYG 5CEDA 1LI9A 2VGLM 5FATA 3RTYA 1AWIA 2W3FA 1S4RA 2OOLA 3ZHHA 4RVAA 3ZVWA 4X25A 1JWVA 3VP3A 4UAAA 2OLVA 4O01A 4JXWA 1XGJA 2VEAA 3QP1A 4DE1A 2EWVA 5TFQA 1N9OA 1MC0A 1KGEA 2J9PA 3NHQA 4LLOB 4G3KA 5HL6A 4HJ4A 4WLAA 3VMAA 5FEGA 4K08A 5FQMA 3KX0X 1OMEA 3BQAA 1T19A 3GRJA 4DE3A 3E98A 1YMXA 3RFBA 3IBJA 5A8BA 4UA9A 5EOEA 1STZA 2INWA 1J9MA 2EWWA 4P6ZS 3UE3A 3KYZA 4CLCB 3A3IA 4WBGA 1XX2A 1JVJA 3VOZA 4DDYA 2EFXA 2ZM0A 2W1RA 2D02A 2JCHA 2QPNA 1SKOB 2FFFB 3OLOA 4UHUA 1Z09A 4YWZA 4EEPA 2ZL1A 1PI4A 3LIBA 4YFMA 2I72A 4CLCD 4BL3A 2VA0A 1G68A 5HD3A 1CF0A 1IYPA 2VZWA 3VP4A 3LY3A 3VFHA 4C75A 1ERMA 1SCWA 1ZKJA 4LV3A 2GX5A 1W5DA 2VGLS 5HAIA 2GJ3A 3TW8A 4X69A 5TR7A 1LL8A 3S4XA 2W3HA 1KGFA 4X56A 5FI2A 3EQVA 2ZC6B 3F1NB 3IS2B 4S2LA 2EXBA 2XR0A 1XA7A 4N9KA 3M6BA 4EUVA 2W1TA 2H0TA 3FPVA 3IXHA 4E3NA 3B3XA 3RH8B 1RCJA 3LIFA 3EEHA 4MMNA 2HP9A 4P6BA 1C3BA 3CMZA 3PBQA 4IVKA 2WKIA 4II7A 3O5YA 4FUWA 4EERA 5IS1A 4EQIA 1BT5A 2JKRM 4HP9A 5EM1A 4R0QA 5FQQA 4ARZB 2E8JA 4NEED 1LSXA 3M2JA 1YMSA 3S7OA 3IHAA 4G3WA 2HV1A 4XUXA 2WKRA 2CMNA 1JTGA 3CJMA 4HHDA 4IUHA 3LGOA 5M19A 3ZYTA 3ZG5A 5AVFA 3CITA 3CLOA 3ZG7B 1G5UA 1ZHHB 3HUNA 1ESIA 5HDDA 3GMWA 3MKFA 3CI6A 2Z2MB 4D60A 1H5XA 2L4RA 3P7NA 3VOYA 3ZFZA 1RP5A 4CQHA 2UV0E 1XGIA 3EGXC 3IS2A 4WEKA 1G6AA 4R1GA 1L0DA 3F1OB 3IXGA 3C5AA 5L2FA 3LY4A 1XP4A 4EEUA 1LHYA 1OTEA 2V0UA 1H8MA 4I3IA 3A3DA 2HDUA 4JKTA 3T4TA 5G4YA 1K57C 1MXOA 3HLGA 4H8RA 2O9AA 4LRZE 5TBMB 2PR6A 2OAQ1 3AGDA 3WS4A 1JWPA 3HLDA 4WELA 4LFUA 1NXYA 4QY5A 2DNSA 4P87A 1MKIA 3VE4A 1S4SA 4EETB 3L7HA 2XDMA 3MFDA 3SS3A 3BJNA 3MF0A 2O99A 1NZOA 1JWZA 3BYDA 2XA7S 1PZPA 5DTTA 1N9NA 3ZQ5A 2KOIA 5HWTA 2P04A 4LV2A 2B5RA 4JBFA 3DTKA 3K3CA 2GNXA 5DKKA 4Y13A 2X02A 3MKEA 4N92A 4BL2A 3OPPA 1V9YA 5CHUA 4WYYA 2WGVA 3B33A 3HCYA 4R23A 5HZHA 4NXFA 4LGWA 4BLMA 2PD7A 1D06A 5F83A 4DJ3A 4R6LA 5A93A 3DTMA 3FWLA 4ARZA 3PBNA 1F5MA 3H82A 2ZOHA 1XPBA 3C7VA 4OQ0A 3IT9A 5E2FA 4CLCA 4A5RA 2DRWA 3PBOA 5KZHA 5CGWA 2ACGA 5DFYA 1ONGA 2ZQDA 1H3QA 2QMIA 4PM6A 1SHVA 5AQAA 5D3OA 3G6OA 3G31A 2HJ9C 2JHEA 2J8YA 1PI5A 3T1RA 5EECA 2PR5A 1OPXA 4MEZA 5EVLA 4ESPA 3VSLA 4GOGA 5DKLA 4Y15A 1IYOA 2Q9MA 2OV5A 4GCZA 1Y28A 3FZCA 3OOVA 4QY6A 5AVEA 4BBUA 3B47A 4CLCC 4OQGA 4GD8A 4S2IA 4JF4A 5FQ9A 5I94A 2ZMFA 2XFTA 4PM5A 4FCFA 4KQOA 1NRFA 1RGZA 3CWFA 5E2HA 4XUZA 3NULA 2J9OA 1VQQA 3CAXA 3VOLA 1ZC2A 3LYXA 1TDGA 3LUQA 1MPLA 4Q0HA 3JPUA 2W0NA 4OVDA 5HFOA 1PYYA 5J4EA 3G2YA 4Q8IA 4BD1A 1SKOA 3HLFA 3RJUA 4S2JA 1TS6A 4WZ5C 1KOUA 3T50A 4BQMA 4OQHA 3SH8A 4KG5A 3ULFA 4JF5A 3VE3A 1FCMA 3C30A 4NXBA 1H8ZA 5FA7A 1YAXA 3UMEA 1K56D 1HTZA 4LCLA 2X71A 1XJ2A 2WUQA 4DXCA 3MQQA 4KUKA 2JKRI 3MS6A 3QHYA 5K5BA 1EW0A 2H0YA 1UWNX 2Z2LB 4MN7A 1K56A 3LEZA 4Z1WA 4EWFA 5FDSA 2FH5A 5IU1A 2B02A 1PNEA 3GECA 1KVMA 5FQIA 2PBDP 4EXOA 1VHMA 3NY4A 3I7JA 3H9WA 4WZ4A 4LPZA 4JXGA 5A92A 5M18A 2L1MA 4GN2A 2QYBA 4KUOA 4UA7A 2WZZA 3D9YA 5U47A 3NC8A 3BY8A 3SW1A 4NG2A 1SZVA 1OT6A 3BECA 2LB5A 1EROA 3F1PA 3E4OA 4MN5A 2B95A 3EQUA 3ZVTA 3N7WA 5FQKA 2QKPA 3CZDA 5HDSA
chains in the Genus database with same CATH topology
4BD0A 2FFFB 3IQAA 3IWIA 4UHUA 1ES4A 4LENA 3UNWA 2JBFA 4L0LA 2EFUA 1PI4A 3AGFA 1MBLA 2XH9A 1YLWA 3HLWA 2I72A 4YFMA 3WWXA 4BL3A 1G68A 4EBNA 4WMCA 2GDNA 1IYPA 1SDNA 1LL9A 3E2LA 3MXRA 3SH7A 3LY3A 3N8LA 1CI9A 3VP4A 3WS5A 3VFHA 3UDXA 3N8RA 4OOYA 3IH8A 1LI0A 2ZD8A 1YM1A 4ZJ2A 4C75A 3C7UA 1ERMA 1K6RA 1L0EA 2Y55A 3BFDA 1KDSA 1SCWA 1ZKJA 3IWOA 4LV3A 2ZQAA 3LO7A 1W5DA 3Q7ZA 4KZ6A 2ZQCA 3AGEA 3O3VA 4Y0UA 1Z6FA 3Q81A 4EUZA 2XEPA 4IVIA 5HAIA 4JPMA 3ZG0A 5DTSA 2EX9A 3N8SA 4X69A 2XGNA 5TR7A 4FH4A 3S4XA 3UE1A 2Y2LA 1KGFA 4KG2A 1IEMA 3V3SA 1NJ4A 3HLCA 3MZFA 2E8IA 5M1AA 4X56A 1K6SA 2WGIA 5FI2A 3EQVA 2ZC6B 1E3UA 2Y91A 2Y2KA 4KQQA 2P9VA 1EI5A 4S2LA 5DVAA 3UPNA 4MLLA 2EXBA 2XR0A 3Q82A 4WEJA 2IWBA 1XA7A 5AQ7A 3UN7A 4N9KA 1K54C 3M6BA 1IYQA 4Y0TA 4OOMA 4OOLA 2H0TA 2RCXA 3BLSA 5TGFA 5HAQA 3MXSA 5KSCA 1K25A 3SS4A 4PM8A 4GB7A 3WS1A 1YLPA 3BFGA 2Y2MA 1K38A 3IXHA 4JXSA 4E3NA 3B3XA 1RCJA 4NETA 1ZG6A 5CGXA 1M6KA 2IWDA 4MBKA 4U0TA 4N1XA 1K55C 2WZXA 2HP9A 2V20A 2R9XA 1C3BA 3CMZA 2DCFA 3PBQA 4N9LA 4P6BA 4RX2A 2JC7A 3BFEA 4IVKA 2WKIA 3IXBA 5JYOA 4EQIA 2WAFA 1BT5A 4GZBA 2Y59A 3BFCA 1BZAA 1EWZA 4PMAA 5HARA 4MNRA 4R0QA 5FQQA 1W79A 3M6HA 5FI6A 5EOOA 2WAEA 4CJNA 4MBHA 3G4PA 5GLAA 3PAEA 1NY0A 2J7VA 2WKHA 3M2JA 3PBTA 1AXBA 4K91A 2Y2IA 1MWSA 3UE0A 5KSHA 1YMSA 4C3QA 3PBSA 3IHAA 1E25A 1BLPA 2WYXA 1SKFA 1ESUA 4XUXA 4EV4A 3ZCZA 3WRTA 3G2ZA 1JTGA 3CJMA 4OQIA 1Q2PA 4S2KA 3HUMA 4GDBA 1E3UD 4OPYA 4E6XA 2XK1A 3ITAA 3W4PA 3W8KA 5M19A 1CK3A 3ZG5A 4X68A 4Z9QA 3VP0A 4ZDXA 3PTEA 1K54A 4GNUA 3ZG7B 2G2UA 1L0GA 3ZG8B 3HUNA 1ESIA 3VP1A 1GA9A 2EX2A 4RX3A 4HBTA 3GMWA 1FCNA 3MKFA 1DY6A 4QD4A 4GDNA 4QB8A 5HAPA 4QU3A 4MBFA 2Z2MB 1H5XA 5DTKA 4ID4A 3M2KA 5FSRA 5JYPA 3VP2A 3SS5A 3VOYA 3ZFZA 3OPHA 1WYBA 1L0FA 1RP5A 2ZLYA 3QNBA 2UWXA 4XXRA 5EE8A 3Q1FA 3HBRA 4X53A 5F82A 1IELA 1XGIA 4WEKA 2ZM8A 1G6AA 3RXXA 4R1GA 4X6TA 1L0DA 3IXGA 1DJCA 2H5SA 3C5AA 5L2FA 2HP6A 3C4PA 3LY4A 1XP4A 2A3UA 2X01A 1PW1A 3FKWA 1O07A 1CEGA 1LHYA 3PBRA 2HP5A 4WM9A 5AQ9A 1DJAA 4S2OA 1S0WA 1QMEA 4YINA 4BJPA 4D2OA 2V2FF 3A3DA 1WE4A 4ZJ1A 5IHVA 3DWZA 3ISGA 2CC1A 4K0XA 4UA6A 2HDUA 4JKTA 2ZQ7A 3BM6A 3ZGAB 3UDFA 1O7EA 1K57C 1MXOA 4OKPA 2Q9NA 3HLGA 4H8RA 5DF7A 3A3FA 5HX9A 2Y2OA 3IHBA 4ZTKA 2A49A 3ZG9B 3PAGA 3AGDA 2VGJA 3WS4A 5EVIC 1JWPA 4R4SA 3HLDA 4WELA 4OONA 4DKIA 5GLCA 1KVLA 1NXYA 4QY5A 1FCOA 1YLTA 2DNSA 4P87A 2OLUA 4LV1A 3IF6B 1W7FA 1YLZA 1N9BA 1MKIA 2H10A 3VFFA 1L2SA 2ZM2A 1Y54A 2G2WA 1K4FA 5E2GA 2XDMA 3GSGA 4RYEA 1GHMA 3IXDA 3MFDA 3SS3A 1LLBA 1NYYA 2HDQA 3UPPA 1NZOA 1JWZA 5KMWA 3BYDA 5GLBA 3HLEA 5GHXA 3V5MA 1PZPA 5CHJA 5DTTA 1I2WA 4P0MA 5FASA 1GCEA 1ONHA 2BG1A 2ZQ8A 3ZNYA 1MY8A 1GHPA 4KZ7A 4LV2A 2B5RA 3MBZA 5F1GA 4JBFA 1HZOA 1CI8A 2X02A 1K57A 3GQZA 4B4XA 3WS0A 2Y2QA 3MKEA 4S2PA 4N92A 5DF8A 4BL2A 3UPOA 2XLNA 3OPPA 5CHUA 4WYYA 2WGVA 5CHMA 1YLJA 3GV9A 4M3KA 3QNCA 4R23A 4K0WA 1FR6A 1KGGA 3HLBA 3Q7VA 3FKVA 3GVBA 4BLMA 4OPRA 3OZHA 1WYCA 3TOIA 3D4FA 3BEBA 2V1ZA 5F83A 3W4QA 1BLCA 5A93A 4DRTA 5CERA 3HREA 1KE4A 2BLSA 3ITBA 1ES3A 3DTMA 3FWLA 2PU4A 3PBNA 1E4DA 2PBYA 3MZDA 1XPBA 2C6WB 3C7VA 1K4EA 3IT9A 4OQ0A 1GHIA 2Y4AA 5E2FA 1HVBA 4F94A 4A5RA 1FOFA 2DRWA 3PBOA 3JYIA 5KZHA 1KE0A 1ERQA 5CGWA 4Y7PA 3O87A 1BUEA 4GD6A 3V3RA 3DW0A 4EBLA 4WZ5A 4S2MA 4DE0A 1CEFA 4OH0A 5A91A 1ONGA 2XD1A 2ZQDA 2HPBA 2QMIA 2WGWB 4PM6A 1SHVA 3OCNA 5D3OA 5AQAA 4KZ4A 4KZAA 3TSGA 3G31A 4C6YA 2ZMAA 1TEMA 2HDSA 3GR2A 1PWGA 2FFYA 3GTCA 2PU2A 2J8YA 1PI5A 3IWQA 4FSFA 5FAOA 3UO9A 1BULA 5EECA 5E43A 5GHYA 4E3JA 1IKIA 4CPKA 4MEZA 5EVLA 1ES5A 2ZC7A 1W8YA 3ZDJA 5EVID 3NIAA 3VSLA 4GOGA 3FV7A 3LCEA 1IYOA 5CTNA 4EBPA 2Q9MA 2OV5A 4LV0A 4B4ZA 3IF6C 3FZCA 1TDLA 4QY6A 3OC2A 1MWUA 2XFSA 4BENA 1NZUA 3WRZA 1IYSA 4DE2A 3Q07A 3HUOA 4KZ5A 4OQGA 4N1HA 2Y2HA 5HW3A 4LCMA 4ZJ3A 1ZG4A 4GD8A 3OPRA 4KZBA 1PWDA 1H8YA 4R3BA 1PW8A 4GKUA 1LL5A 4S2IA 1BLHA 4JF4A 1BTLA 5FQ9A 4E6WA 5I94A 1Q2QA 4KQRA 2XFTA 2P74A 5EUAA 3IH9A 1GA0A 4OPQA 4PM5A 5FAPA 4FCFA 4KQOA 4OP5A 1NRFA 1RGZA 1BLSA 2Y2NA 3DWKA 3NBLA 5E2HA 5FI7A 4XUZA 4KG6A 3SH9A 2WK0A 1YQSA 2HDRA 2ZC3B 4PM7A 1DJBA 3A3EA 4OLDA 5CXWA 2ZC5B 4JF6A 2R9WA 1ALQA 4P85A 2QZ6A 1MWTA 2J9OA 2VGKA 3SOIA 3O86A 2ZQ9A 1VQQA 5FQJA 2P9VB 1ZC2A 4U3TA 1TDGA 1MPLA 5CGSA 4NK3A 4IBXA 4OVDA 4WMCD 2RL3A 4B88A 4PM9A 5HFOA 1PYYA 1ES2A 3NDEA 3NDGA 3G2YA 4Q8IA 1SDEA 2XF3A 4BD1A 3BFFA 2Y2GA 5CTMA 1PWCA 2ZC4B 1BSGA 3HLFA 3RJUA 4S2JA 3N4IA 3OPLA 4HEFA 4WZ5C 2JE5A 4JLFA 4O7DA 1VM1A 3MZEA 5DF9A 3P98A 3NCKA 4BQMA 5EVIB 4QJGA 4IEDA 4OQHA 3SH8A 1XXMA 5CEBA 4KG5A 3Q7VB 4JF5A 4KZ8A 1JTDA 3CG5A 4R4RA 3TG9A 3OCLA 1FCMA 4QHCA 5GHZA 5HL1A 3IF5A 4HESA 1H8ZA 5FA7A 4JXVA 3G32A 3UDIA 4X55A 1XA1A 3RXWA 2WADA 2EX8A 5GLDA 1K56D 1HTZA 3UY6A 4S2NA 5AQBA 4LCLA 2X71A 4FH2A 5J8XA 4S2NC 3HL9A 2EX6A 5BOHA 1MWRA 4ZAMA 3E2KA 5CEDA 2WUQA 4OP8A 4DXCA 1FQGA 1LI9A 3BLMA 3HVFA 2OSUA 2XD5A 5FATA 3ZNTA 2WKEA 4KZ9A 3G34A 3QHYA 2H0YA 4FD8A 1NYMA 1K55A 4U0XA 3IF6A 3ZHHA 4RVAA 3ZVWA 2Z2LB 5G18A 4E3OA 2C5WB 1JWVA 1K56A 1FSWA 2EXAA 3VP3A 3O88A 4UAAA 1KE3A 1PZOA 2OLVA 3LEZA 4EWFA 2WGWA 4JXWA 3S22A 1XGJA 3S1YA 4KENB 2XQZA 4DE1A 4DF6A 2IWCA 5TFQA 1KVMA 3G30A 1U60A 5FQIA 1KGEA 1I5QA 2J9PA 2Y2PA 3NI9A 3A3JA 1YLYA 3NY4A 4R3JA 3I7JA 5EVIA 3VMAA 3N6IA 4Y0OA 5FQMA 4WZ4A 2Y2JA 4JXGA 1OMEA 5A92A 4OPZA 5E2EA 1N4OA 4E3IA 4GN2A 5M18A 1S6RA 3GRJA 4DE3A 1I2SA 3V50A 1YMXA 2WZZA 4UA7A 4OLGA 4E3KA 5U47A 1FR1A 3WS2A 1TVFA 5F1FA 3NC8A 5FAQA 5A90A 1FSYA 1IKGA 4DDSA 1W8QA 4UA9A 5CRFA 5EOEA 4E3MA 3C4OA 3BRMA 1XKZA 4ZBEA 2ZJ9A 1QMFA 1J9MA 5GL9A 3VSKA 3W4OA 1HD8A 3UE3A 1RGYA 1M40A 4HBUA 3BECA 3P09A 1EROA 5FDHA 5CECA 4IBRA 4RA7A 3G35A 4KZ3A 4E3LA 1KDWA 3A3IA 4WBGA 5EPHA 1XX2A 1JVJA 3EQUA 3ZVTA 1YT4A 3VOZA 3N7WA 4PPRA 3V39A 5FQKA 4DDYA 1PIOA 2EFXA 3CZDA 3FYZA 4DXBA 2ZM0A 2JCHA 2QPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BD0 A;  2FFF B;  3IQA A;  3IWI A;  4UHU A;  1ES4 A;  4LEN A;  3UNW A;  2JBF A;  4L0L A;  2EFU A;  1PI4 A;  3AGF A;  1MBL A;  2XH9 A;  1YLW A;  3HLW A;  2I72 A;  4YFM A;  3WWX A;  4BL3 A;  1G68 A;  4EBN A;  4WMC A;  2GDN A;  1IYP A;  1SDN A;  1LL9 A;  3E2L A;  3MXR A;  3SH7 A;  3LY3 A;  3N8L A;  1CI9 A;  3VP4 A;  3WS5 A;  3VFH A;  3UDX A;  3N8R A;  4OOY A;  3IH8 A;  1LI0 A;  2ZD8 A;  1YM1 A;  4ZJ2 A;  4C75 A;  3C7U A;  1ERM A;  1K6R A;  1L0E A;  2Y55 A;  3BFD A;  1KDS A;  1SCW A;  1ZKJ A;  3IWO A;  4LV3 A;  2ZQA A;  3LO7 A;  1W5D A;  3Q7Z A;  4KZ6 A;  2ZQC A;  3AGE A;  3O3V A;  4Y0U A;  1Z6F A;  3Q81 A;  4EUZ A;  2XEP A;  4IVI A;  5HAI A;  4JPM A;  3ZG0 A;  5DTS A;  2EX9 A;  3N8S A;  4X69 A;  2XGN A;  5TR7 A;  4FH4 A;  3S4X A;  3UE1 A;  2Y2L A;  1KGF A;  4KG2 A;  1IEM A;  3V3S A;  1NJ4 A;  3HLC A;  3MZF A;  2E8I A;  5M1A A;  4X56 A;  1K6S A;  2WGI A;  5FI2 A;  3EQV A;  2ZC6 B;  1E3U A;  2Y91 A;  2Y2K A;  4KQQ A;  2P9V A;  1EI5 A;  4S2L A;  5DVA A;  3UPN A;  4MLL A;  2EXB A;  2XR0 A;  3Q82 A;  4WEJ A;  2IWB A;  1XA7 A;  5AQ7 A;  3UN7 A;  4N9K A;  1K54 C;  3M6B A;  1IYQ A;  4Y0T A;  4OOM A;  4OOL A;  2H0T A;  2RCX A;  3BLS A;  5TGF A;  5HAQ A;  3MXS A;  5KSC A;  1K25 A;  3SS4 A;  4PM8 A;  4GB7 A;  3WS1 A;  1YLP A;  3BFG A;  2Y2M A;  1K38 A;  3IXH A;  4JXS A;  4E3N A;  3B3X A;  1RCJ A;  4NET A;  1ZG6 A;  5CGX A;  1M6K A;  2IWD A;  4MBK A;  4U0T A;  4N1X A;  1K55 C;  2WZX A;  2HP9 A;  2V20 A;  2R9X A;  1C3B A;  3CMZ A;  2DCF A;  3PBQ A;  4N9L A;  4P6B A;  4RX2 A;  2JC7 A;  3BFE A;  4IVK A;  2WKI A;  3IXB A;  5JYO A;  4EQI A;  2WAF A;  1BT5 A;  4GZB A;  2Y59 A;  3BFC A;  1BZA A;  1EWZ A;  4PMA A;  5HAR A;  4MNR A;  4R0Q A;  5FQQ A;  1W79 A;  3M6H A;  5FI6 A;  5EOO A;  2WAE A;  4CJN A;  4MBH A;  3G4P A;  5GLA A;  3PAE A;  1NY0 A;  2J7V A;  2WKH A;  3M2J A;  3PBT A;  1AXB A;  4K91 A;  2Y2I A;  1MWS A;  3UE0 A;  5KSH A;  1YMS A;  4C3Q A;  3PBS A;  3IHA A;  1E25 A;  1BLP A;  2WYX A;  1SKF A;  1ESU A;  4XUX A;  4EV4 A;  3ZCZ A;  3WRT A;  3G2Z A;  1JTG A;  3CJM A;  4OQI A;  1Q2P A;  4S2K A;  3HUM A;  4GDB A;  1E3U D;  4OPY A;  4E6X A;  2XK1 A;  3ITA A;  3W4P A;  3W8K A;  5M19 A;  1CK3 A;  3ZG5 A;  4X68 A;  4Z9Q A;  3VP0 A;  4ZDX A;  3PTE A;  1K54 A;  4GNU A;  3ZG7 B;  2G2U A;  1L0G A;  3ZG8 B;  3HUN A;  1ESI A;  3VP1 A;  1GA9 A;  2EX2 A;  4RX3 A;  4HBT A;  3GMW A;  1FCN A;  3MKF A;  1DY6 A;  4QD4 A;  4GDN A;  4QB8 A;  5HAP A;  4QU3 A;  4MBF A;  2Z2M B;  1H5X A;  5DTK A;  4ID4 A;  3M2K A;  5FSR A;  5JYP A;  3VP2 A;  3SS5 A;  3VOY A;  3ZFZ A;  3OPH A;  1WYB A;  1L0F A;  1RP5 A;  2ZLY A;  3QNB A;  2UWX A;  4XXR A;  5EE8 A;  3Q1F A;  3HBR A;  4X53 A;  5F82 A;  1IEL A;  1XGI A;  4WEK A;  2ZM8 A;  1G6A A;  3RXX A;  4R1G A;  4X6T A;  1L0D A;  3IXG A;  1DJC A;  2H5S A;  3C5A A;  5L2F A;  2HP6 A;  3C4P A;  3LY4 A;  1XP4 A;  2A3U A;  2X01 A;  1PW1 A;  3FKW A;  1O07 A;  1CEG A;  1LHY A;  3PBR A;  2HP5 A;  4WM9 A;  5AQ9 A;  1DJA A;  4S2O A;  1S0W A;  1QME A;  4YIN A;  4BJP A;  4D2O A;  2V2F F;  3A3D A;  1WE4 A;  4ZJ1 A;  5IHV A;  3DWZ A;  3ISG A;  2CC1 A;  4K0X A;  4UA6 A;  2HDU A;  4JKT A;  2ZQ7 A;  3BM6 A;  3ZGA B;  3UDF A;  1O7E A;  1K57 C;  1MXO A;  4OKP A;  2Q9N A;  3HLG A;  4H8R A;  5DF7 A;  3A3F A;  5HX9 A;  2Y2O A;  3IHB A;  4ZTK A;  2A49 A;  3ZG9 B;  3PAG A;  3AGD A;  2VGJ A;  3WS4 A;  5EVI C;  1JWP A;  4R4S A;  3HLD A;  4WEL A;  4OON A;  4DKI A;  5GLC A;  1KVL A;  1NXY A;  4QY5 A;  1FCO A;  1YLT A;  2DNS A;  4P87 A;  2OLU A;  4LV1 A;  3IF6 B;  1W7F A;  1YLZ A;  1N9B A;  1MKI A;  2H10 A;  3VFF A;  1L2S A;  2ZM2 A;  1Y54 A;  2G2W A;  1K4F A;  5E2G A;  2XDM A;  3GSG A;  4RYE A;  1GHM A;  3IXD A;  3MFD A;  3SS3 A;  1LLB A;  1NYY A;  2HDQ A;  3UPP A;  1NZO A;  1JWZ A;  5KMW A;  3BYD A;  5GLB A;  3HLE A;  5GHX A;  3V5M A;  1PZP A;  5CHJ A;  5DTT A;  1I2W A;  4P0M A;  5FAS A;  1GCE A;  1ONH A;  2BG1 A;  2ZQ8 A;  3ZNY A;  1MY8 A;  1GHP A;  4KZ7 A;  4LV2 A;  2B5R A;  3MBZ A;  5F1G A;  4JBF A;  1HZO A;  1CI8 A;  2X02 A;  1K57 A;  3GQZ A;  4B4X A;  3WS0 A;  2Y2Q A;  3MKE A;  4S2P A;  4N92 A;  5DF8 A;  4BL2 A;  3UPO A;  2XLN A;  3OPP A;  5CHU A;  4WYY A;  2WGV A;  5CHM A;  1YLJ A;  3GV9 A;  4M3K A;  3QNC A;  4R23 A;  4K0W A;  1FR6 A;  1KGG A;  3HLB A;  3Q7V A;  3FKV A;  3GVB A;  4BLM A;  4OPR A;  3OZH A;  1WYC A;  3TOI A;  3D4F A;  3BEB A;  2V1Z A;  5F83 A;  3W4Q A;  1BLC A;  5A93 A;  4DRT A;  5CER A;  3HRE A;  1KE4 A;  2BLS A;  3ITB A;  1ES3 A;  3DTM A;  3FWL A;  2PU4 A;  3PBN A;  1E4D A;  2PBY A;  3MZD A;  1XPB A;  2C6W B;  3C7V A;  1K4E A;  3IT9 A;  4OQ0 A;  1GHI A;  2Y4A A;  5E2F A;  1HVB A;  4F94 A;  4A5R A;  1FOF A;  2DRW A;  3PBO A;  3JYI A;  5KZH A;  1KE0 A;  1ERQ A;  5CGW A;  4Y7P A;  3O87 A;  1BUE A;  4GD6 A;  3V3R A;  3DW0 A;  4EBL A;  4WZ5 A;  4S2M A;  4DE0 A;  1CEF A;  4OH0 A;  5A91 A;  1ONG A;  2XD1 A;  2ZQD A;  2HPB A;  2QMI A;  2WGW B;  4PM6 A;  1SHV A;  3OCN A;  5D3O A;  5AQA A;  4KZ4 A;  4KZA A;  3TSG A;  3G31 A;  4C6Y A;  2ZMA A;  1TEM A;  2HDS A;  3GR2 A;  1PWG A;  2FFY A;  3GTC A;  2PU2 A;  2J8Y A;  1PI5 A;  3IWQ A;  4FSF A;  5FAO A;  3UO9 A;  1BUL A;  5EEC A;  5E43 A;  5GHY A;  4E3J A;  1IKI A;  4CPK A;  4MEZ A;  5EVL A;  1ES5 A;  2ZC7 A;  1W8Y A;  3ZDJ A;  5EVI D;  3NIA A;  3VSL A;  4GOG A;  3FV7 A;  3LCE A;  1IYO A;  5CTN A;  4EBP A;  2Q9M A;  2OV5 A;  4LV0 A;  4B4Z A;  3IF6 C;  3FZC A;  1TDL A;  4QY6 A;  3OC2 A;  1MWU A;  2XFS A;  4BEN A;  1NZU A;  3WRZ A;  1IYS A;  4DE2 A;  3Q07 A;  3HUO A;  4KZ5 A;  4OQG A;  4N1H A;  2Y2H A;  5HW3 A;  4LCM A;  4ZJ3 A;  1ZG4 A;  4GD8 A;  3OPR A;  4KZB A;  1PWD A;  1H8Y A;  4R3B A;  1PW8 A;  4GKU A;  1LL5 A;  4S2I A;  1BLH A;  4JF4 A;  1BTL A;  5FQ9 A;  4E6W A;  5I94 A;  1Q2Q A;  4KQR A;  2XFT A;  2P74 A;  5EUA A;  3IH9 A;  1GA0 A;  4OPQ A;  4PM5 A;  5FAP A;  4FCF A;  4KQO A;  4OP5 A;  1NRF A;  1RGZ A;  1BLS A;  2Y2N A;  3DWK A;  3NBL A;  5E2H A;  5FI7 A;  4XUZ A;  4KG6 A;  3SH9 A;  2WK0 A;  1YQS A;  2HDR A;  2ZC3 B;  4PM7 A;  1DJB A;  3A3E A;  4OLD A;  5CXW A;  2ZC5 B;  4JF6 A;  2R9W A;  1ALQ A;  4P85 A;  2QZ6 A;  1MWT A;  2J9O A;  2VGK A;  3SOI A;  3O86 A;  2ZQ9 A;  1VQQ A;  5FQJ A;  2P9V B;  1ZC2 A;  4U3T A;  1TDG A;  1MPL A;  5CGS A;  4NK3 A;  4IBX A;  4OVD A;  4WMC D;  2RL3 A;  4B88 A;  4PM9 A;  5HFO A;  1PYY A;  1ES2 A;  3NDE A;  3NDG A;  3G2Y A;  4Q8I A;  1SDE A;  2XF3 A;  4BD1 A;  3BFF A;  2Y2G A;  5CTM A;  1PWC A;  2ZC4 B;  1BSG A;  3HLF A;  3RJU A;  4S2J A;  3N4I A;  3OPL A;  4HEF A;  4WZ5 C;  2JE5 A;  4JLF A;  4O7D A;  1VM1 A;  3MZE A;  5DF9 A;  3P98 A;  3NCK A;  4BQM A;  5EVI B;  4QJG A;  4IED A;  4OQH A;  3SH8 A;  1XXM A;  5CEB A;  4KG5 A;  3Q7V B;  4JF5 A;  4KZ8 A;  1JTD A;  3CG5 A;  4R4R A;  3TG9 A;  3OCL A;  1FCM A;  4QHC A;  5GHZ A;  5HL1 A;  3IF5 A;  4HES A;  1H8Z A;  5FA7 A;  4JXV A;  3G32 A;  3UDI A;  4X55 A;  1XA1 A;  3RXW A;  2WAD A;  2EX8 A;  5GLD A;  1K56 D;  1HTZ A;  3UY6 A;  4S2N A;  5AQB A;  4LCL A;  2X71 A;  4FH2 A;  5J8X A;  4S2N C;  3HL9 A;  2EX6 A;  5BOH A;  1MWR A;  4ZAM A;  3E2K A;  5CED A;  2WUQ A;  4OP8 A;  4DXC A;  1FQG A;  1LI9 A;  3BLM A;  3HVF A;  2OSU A;  2XD5 A;  5FAT A;  3ZNT A;  2WKE A;  4KZ9 A;  3G34 A;  3QHY A;  2H0Y A;  4FD8 A;  1NYM A;  1K55 A;  4U0X A;  3IF6 A;  3ZHH A;  4RVA A;  3ZVW A;  2Z2L B;  5G18 A;  4E3O A;  2C5W B;  1JWV A;  1K56 A;  1FSW A;  2EXA A;  3VP3 A;  3O88 A;  4UAA A;  1KE3 A;  1PZO A;  2OLV A;  3LEZ A;  4EWF A;  2WGW A;  4JXW A;  3S22 A;  1XGJ A;  3S1Y A;  4KEN B;  2XQZ A;  4DE1 A;  4DF6 A;  2IWC A;  5TFQ A;  1KVM A;  3G30 A;  1U60 A;  5FQI A;  1KGE A;  1I5Q A;  2J9P A;  2Y2P A;  3NI9 A;  3A3J A;  1YLY A;  3NY4 A;  4R3J A;  3I7J A;  5EVI A;  3VMA A;  3N6I A;  4Y0O A;  5FQM A;  4WZ4 A;  2Y2J A;  4JXG A;  1OME A;  5A92 A;  4OPZ A;  5E2E A;  1N4O A;  4E3I A;  4GN2 A;  5M18 A;  1S6R A;  3GRJ A;  4DE3 A;  1I2S A;  3V50 A;  1YMX A;  2WZZ A;  4UA7 A;  4OLG A;  4E3K A;  5U47 A;  1FR1 A;  3WS2 A;  1TVF A;  5F1F A;  3NC8 A;  5FAQ A;  5A90 A;  1FSY A;  1IKG A;  4DDS A;  1W8Q A;  4UA9 A;  5CRF A;  5EOE A;  4E3M A;  3C4O A;  3BRM A;  1XKZ A;  4ZBE A;  2ZJ9 A;  1QMF A;  1J9M A;  5GL9 A;  3VSK A;  3W4O A;  1HD8 A;  3UE3 A;  1RGY A;  1M40 A;  4HBU A;  3BEC A;  3P09 A;  1ERO A;  5FDH A;  5CEC A;  4IBR A;  4RA7 A;  3G35 A;  4KZ3 A;  4E3L A;  1KDW A;  3A3I A;  4WBG A;  5EPH A;  1XX2 A;  1JVJ A;  3EQU A;  3ZVT A;  1YT4 A;  3VOZ A;  3N7W A;  4PPR A;  3V39 A;  5FQK A;  4DDY A;  1PIO A;  2EFX A;  3CZD A;  3FYZ A;  4DXB A;  2ZM0 A;  2JCH A;  2QPN A; 
#chains in the Genus database with same CATH topology
 2Y79 A;  4BD0 A;  3IQA A;  3F1N A;  3LR0 A;  3A0R A;  4I38 A;  1ES4 A;  4LEN A;  3UNW A;  2JBF A;  3NJA A;  2XH9 A;  4WN5 A;  2GDN A;  4Y3I A;  1SDN A;  1LL9 A;  1NWZ A;  3MXR A;  1A0K A;  4WL9 A;  3UDX A;  4OOY A;  3QP8 A;  2ZD8 A;  1YM1 A;  3C7U A;  1TF1 A;  2MJ6 A;  2Y55 A;  5AJG A;  3IWO A;  2ZQA A;  2ZQC A;  1Z6F A;  2XEP A;  1L3L A;  4EES A;  4FH4 A;  3UE1 A;  4KG2 A;  3V3S A;  2E8I A;  2WGI A;  1YSQ A;  5L09 A;  1E3U A;  2P9V A;  3UPN A;  4MLL A;  2IWB A;  1K54 C;  4Y0T A;  4OOM A;  5TGF A;  3BLS A;  5HAQ A;  5KSC A;  4CLC E;  1F2K A;  4GB7 A;  4JXS A;  1ZG6 A;  4U0T A;  2OAP 1;  4UQI M;  3S7Q A;  2R9X A;  4N9L A;  2ZBB A;  3IXB A;  2WAF A;  2Y59 A;  4MNR A;  2PYP A;  3KSG A;  4MBH A;  3DTI A;  2J7V A;  1AXB A;  1MWS A;  3UE0 A;  5KSH A;  4C3Q A;  3PBS A;  1E25 A;  1BLP A;  3ZCZ A;  3V67 A;  1XJ3 A;  1Q2P A;  2QWS A;  4GDB A;  1E3U D;  4JGO A;  4OPY A;  2ZL1 B;  4E6X A;  2XK1 A;  5TBM A;  3W4P A;  4Z9Q A;  3VP0 A;  4GNU A;  2G2U A;  3H7W A;  3VP1 A;  2EX2 A;  4GHI A;  1S1Y A;  5HAP A;  4QU3 A;  5L07 A;  4I5S A;  5JYP A;  1WYB A;  2ZLY A;  3C8C A;  3QNB A;  3UB9 A;  2ZM8 A;  2H5S A;  2HP6 A;  2A3U A;  2X01 A;  3NOP C;  4G3V A;  2A2L A;  2HP5 A;  3CHW P;  3ISG A;  2CC1 A;  4UA6 A;  3BM6 A;  2OWJ A;  3UDF A;  1O7E A;  5HX9 A;  1K0K A;  2Y2O A;  3IHB A;  3KSH A;  1TD5 A;  4OON A;  5GLC A;  3KYE A;  1YLT A;  3NEC A;  2PD8 A;  3VFF A;  2QHK A;  1L2S A;  1Y54 A;  3FG8 A;  4ETZ A;  5E2G A;  3GSG A;  1GHM A;  4O0P A;  1LLB A;  2HDQ A;  5GLB A;  3V5M A;  4P6Z M;  5FAS A;  3PR6 A;  2BG1 A;  2ZQ8 A;  1GHP A;  3MBZ A;  3EEA A;  5F1G A;  1J3W A;  4S2P A;  2XLN A;  3W2Z A;  5J3W A;  4GJ4 A;  4K0W A;  5HSQ A;  5LBR A;  5DJT A;  4OPR A;  2HGV A;  1WYC A;  3D4F A;  3W4Q A;  5CER A;  3HRE A;  1XJ6 A;  1ES3 A;  5DJU A;  1HVB A;  1FOF A;  4BBT A;  1BUE A;  4GD6 A;  4WZ5 A;  5A91 A;  2JKT M;  2HPB A;  3OCN A;  1PRQ A;  2ZMA A;  3GR2 A;  2Q0O A;  3IWQ A;  5FAO A;  3UO9 A;  1BUL A;  5GHY A;  4E3J A;  5J7E A;  2XRO A;  2ZC7 A;  3NIA A;  5CTN A;  1TS7 A;  2J3W A;  1MWU A;  3Q07 A;  2JKF A;  2PDR A;  2Y2H A;  3LFV A;  4LCM A;  5HW3 A;  4I3A A;  2PAV P;  3IX3 A;  3OPR A;  1PWD A;  4GKU A;  1LL5 A;  1S1Z A;  1XFN A;  1Q2Q A;  1GA0 A;  1S66 L;  3DWK A;  2V8C A;  2HDR A;  4PM7 A;  4JF6 A;  4HP4 A;  4P85 A;  2QZ6 A;  1MWT A;  5G4Z A;  2P9V B;  2J80 A;  4JGQ A;  4IBX A;  2RL3 A;  4B88 A;  4PM9 A;  1ODV A;  3NDG A;  4ETX A;  3N4I A;  3OPL A;  4O7D A;  1VM1 A;  4WUJ A;  5DF9 A;  2P7J A;  3CPT A;  3T4S A;  1XXM A;  4H6J B;  2XSS A;  4KZ8 A;  1JTD A;  4FOF A;  5GHZ A;  4JXV A;  1XA1 A;  5GLD A;  1N9L A;  5AQB A;  4ZAM A;  3E2K A;  2V9A A;  1G6O A;  4H6J A;  3T1X A;  1FQG A;  4Q0J A;  3BLM A;  2OSU A;  2XD5 A;  3A0V A;  3ZNT A;  2WKE A;  3G34 A;  2VLG A;  1DP9 A;  3CUE C;  4FD8 A;  4U0X A;  3PXP A;  5G18 A;  4E3O A;  1FSW A;  2EXA A;  1OJ5 A;  1PZO A;  2V1B A;  3S22 A;  1ZTU A;  2A24 B;  4KEN B;  1TS8 A;  4QWO A;  4DF6 A;  2IWC A;  1I5Q A;  3QP5 A;  3JVV A;  4QPR A;  3NI9 A;  1YLY A;  2O9C A;  3TE8 A;  5EVI A;  4Y0O A;  2M1C A;  4OPZ A;  4E3I A;  1N4O A;  2HF6 A;  3MQO A;  4OLG A;  3HJK A;  1OT9 A;  1FR1 A;  3WS2 A;  1TVF A;  5F1F A;  5FAQ A;  5A90 A;  4DDS A;  2BTF P;  5CRF A;  4E3M A;  3C4O A;  4ZBE A;  2VKS A;  3W4O A;  4HBU A;  5CEC A;  3G35 A;  1KDW A;  5EPH A;  3QP6 A;  5FL3 A;  1YT4 A;  4EW7 A;  4HQA A;  1PIO A;  4YOF A;  4DXB A;  4WF0 A;  3BFG A;  5HPI A;  3IBR A;  3H7W B;  3IWI A;  3MFX A;  4L0L A;  4UEY A;  3S7N A;  1MBL A;  1YLW A;  3WWX A;  4WMC A;  3E2L A;  4HIA A;  3SH7 A;  2BAS A;  3WS5 A;  4F3L A;  3E4Q A;  3EWK A;  1XFQ A;  3UB8 A;  1K6R A;  1L0E A;  3BFD A;  2YKH A;  5MC7 A;  3LO7 A;  5EFW A;  5HWV A;  4Y0U A;  3Q81 A;  4NXE A;  4IVI A;  4JPM A;  3F1P B;  5DTS A;  3N8S A;  2AVX A;  1UGU A;  1IEM A;  3LID A;  3HLC A;  4NXG A;  1K6S A;  2Y91 A;  4KQQ A;  4HJ6 A;  2Z6C A;  3NOU C;  5DVA A;  4HH2 A;  1F98 A;  3UN7 A;  5AQ7 A;  2G7U A;  1K25 A;  3S7P A;  3HJI A;  2W3D A;  2Y2M A;  4DJ2 A;  1K38 A;  2QJ5 A;  3LEQ A;  5CGX A;  2IWD A;  4MBK A;  1K55 C;  2WZX A;  4IUK A;  2DCF A;  5EM0 A;  2JC7 A;  3DBA A;  5JYO A;  2VV7 A;  3FPW A;  4GZB A;  5HAR A;  4IJG A;  4CJN A;  3G4P A;  5GLA A;  3T4L A;  2WKH A;  2Y2I A;  5HDC A;  2V8F A;  4I3J A;  1ESU A;  1LSW A;  4HOI A;  4OQI A;  3EGD C;  3HUM A;  3QP4 A;  2VK3 A;  4YNR A;  3W8K A;  1CK3 A;  1XJ4 A;  4ME4 A;  3PTE A;  1K54 A;  1GA9 A;  4RX3 A;  1GSV A;  4HBT A;  1FCN A;  1DY6 A;  4GDN A;  4QB8 A;  2XRN A;  4MBF A;  3DAV A;  1PFL A;  4ID4 A;  5FSR A;  3VP2 A;  2VV6 A;  3OPH A;  2UWX A;  5EE8 A;  3Q1F A;  5F82 A;  1IEL A;  4GW9 A;  3RXX A;  4X6T A;  1P9R A;  1GSW A;  1DJC A;  4HY8 A;  5CX7 A;  3FKW A;  1OTA A;  3K3D A;  4S2O A;  2V1A A;  4R70 A;  4YIN A;  3SZT A;  1OTB A;  4K0X A;  1DP8 A;  1GSX A;  2ZQ7 A;  1T18 A;  4OKP A;  2Q9N A;  3U2A A;  2A49 A;  3ZG9 B;  3PAG A;  2VGJ A;  4DKI A;  5F69 A;  1KVL A;  1Y4O A;  2LB9 A;  4JGP A;  2OLU A;  3IF6 B;  1W7F A;  3BW6 A;  4HJ3 A;  1N9B A;  2H10 A;  2ZM2 A;  4RYE A;  2JN7 A;  4E04 A;  1NYY A;  5KMW A;  3QP2 A;  2J3T D;  3HLE A;  4BBV A;  5GHX A;  3T4J A;  4B93 A;  5CHJ A;  2O9B A;  1I2W A;  3VV4 A;  4NKP A;  3MQ0 A;  4KZ7 A;  1VET B;  1HZO A;  4Y5F A;  1CI8 A;  4B4X A;  1K57 A;  3WS0 A;  2ZMV A;  5CHM A;  1OJG A;  1YLJ A;  4M3K A;  3QNC A;  2V0W A;  1DP6 A;  1KGG A;  3HLB A;  3Q7V A;  3KO6 A;  3TOI A;  1BLC A;  1KE4 A;  2BLS A;  3ICY A;  1X0O A;  1E4D A;  2C6W B;  4F94 A;  1VEU B;  3U4L P;  2KDK A;  1HLU P;  3JYI A;  4Y7P A;  3O87 A;  3V3R A;  4AFI A;  2L0W A;  4DE0 A;  1CEF A;  2W27 A;  1WA9 A;  4KZA A;  3C38 A;  3B42 A;  4C6Y A;  3GTC A;  2FFY A;  4FSF A;  5E43 A;  1IKI A;  2OWH A;  1ES5 A;  3ZDJ A;  3MMH A;  3LCE A;  2IA2 A;  4GHI B;  4EBP A;  2H28 A;  4LV0 A;  3R7W B;  3IF6 C;  4PKY A;  3TRC A;  3A0S A;  1NZU A;  3WRZ A;  1IYS A;  1TS0 A;  4KZ5 A;  2J3T C;  2FZ0 A;  1ZG4 A;  5HD5 A;  3BWL A;  2DMW A;  1YKD A;  1BLH A;  1BTL A;  4KQR A;  3UE6 A;  2P74 A;  5EUA A;  1D7E A;  5FAP A;  4KG6 A;  2ZC3 B;  3A3E A;  2R9W A;  1ALQ A;  2VGK A;  3SOI A;  1CQA A;  2I9V A;  4U3T A;  4R3A A;  5CGS A;  4NK3 A;  4WMC D;  1ES2 A;  3NDE A;  3F1O A;  2W3G A;  2XF3 A;  3BFF A;  4Y17 A;  5CTM A;  1BSG A;  3LI9 A;  2EA9 A;  4HEF A;  4JLF A;  3MZE A;  3DTE A;  3P98 A;  3NCK A;  5EVI B;  4QJG A;  4IED A;  2QJ7 A;  1P0Z A;  4M4X A;  1W63 Q;  3CG5 A;  2KLI A;  4BWI A;  3OCL A;  2A24 A;  3LIC A;  4HES A;  1VB6 A;  1YPR A;  3G32 A;  3UDI A;  3RXW A;  2M7V A;  2EX8 A;  4S2N A;  5BOH A;  1MWR A;  4OP8 A;  2PHY A;  2VV8 A;  2GZA A;  3HVF A;  3NOT C;  4KZ9 A;  5HWW A;  1NLZ A;  1NYM A;  1K55 A;  3IF6 A;  3UB6 A;  1D1J A;  1JNU A;  2C5W B;  5IT5 A;  3O88 A;  1KE3 A;  4DMZ A;  5F68 A;  1NLY A;  1IFQ A;  2WGW A;  3S1Y A;  1IOU A;  2XQZ A;  3E4P A;  3TJZ C;  3G30 A;  1U60 A;  2XA7 M;  5F5Y A;  2WKQ A;  2Y2P A;  3A3J A;  4R3J A;  5TJJ A;  3N6I A;  3T4O A;  2Y2J A;  5E2E A;  1P9W A;  1S6R A;  1I2S A;  3V50 A;  4E3K A;  1LT0 A;  4X1M A;  1OTD A;  4EQ1 A;  1FSY A;  1IKG A;  1W8Q A;  1T1C A;  3BRM A;  5C5K A;  1XKZ A;  4MCW A;  2ZJ9 A;  1MKM A;  1QMF A;  5GL9 A;  3VSK A;  4HH3 A;  2HZ5 A;  1HD8 A;  1RGY A;  1M40 A;  3P09 A;  5FDH A;  3T4K A;  4IBR A;  4RA7 A;  4E3L A;  4KZ3 A;  1G28 A;  4PPR A;  3V39 A;  1YSP A;  3FYZ A;  3IH8 A;  3LR4 A;  2P08 A;  4I39 A;  5EVE A;  3R4K A;  2EFU A;  3AGF A;  4HNB A;  2K2N A;  2PRF A;  3HLW A;  4EBN A;  4MDZ A;  3R7W A;  3N8L A;  1CI9 A;  1OTI A;  3UB7 A;  3N8R A;  1LI0 A;  4ZJ2 A;  3PYP A;  1KDS A;  4FTX A;  4L9F A;  3Q7Z A;  1NRJ A;  4KZ6 A;  3AGE A;  3O3V A;  2K7S A;  4EUZ A;  3IX8 A;  3GDI A;  5L10 A;  3ZG0 A;  2EX9 A;  2XGN A;  2ZOI A;  2B18 A;  2Y2L A;  1NJ4 A;  3MZF A;  5M1A A;  3E0Y A;  2JKT I;  2VJW A;  2Y2K A;  1EI5 A;  3PHY A;  3Q82 A;  4WEJ A;  1IYQ A;  4OOL A;  2RCX A;  3MXS A;  3SS4 A;  3LIE A;  4PM8 A;  1H0M A;  4BMW A;  3WS1 A;  1YLP A;  4NET A;  1M6K A;  4N1X A;  3OBF A;  2V20 A;  4RX2 A;  4XT2 B;  2Z6D A;  3BFE A;  1W63 M;  2W3E A;  3BFC A;  5EV0 A;  1BZA A;  1EWZ A;  4PMA A;  1W79 A;  3M6H A;  5FI6 A;  5EOO A;  2WAE A;  4Q0I A;  3PAE A;  1NY0 A;  3PBT A;  4JGR A;  4K91 A;  4PHT A;  2Y8H A;  2WYX A;  1SKF A;  5FEF A;  4EV4 A;  3WRT A;  3G2Z A;  4S2K A;  3ITA A;  4LRY C;  1P97 A;  4X68 A;  4ZDX A;  3UB5 P;  3ZG8 B;  1L0G A;  4IHQ A;  4QD4 A;  1FIK A;  5DTK A;  3M2K A;  5I5L A;  3SS5 A;  3EOI A;  3BY9 A;  1L0F A;  4XXR A;  3HBR A;  4X53 A;  2O0Y A;  2HJE A;  3C4P A;  1V9Z A;  1PW1 A;  1T1B A;  1O07 A;  1VEU A;  1CEG A;  4LRX C;  3D3O A;  3PBR A;  4WM9 A;  4R38 A;  4DN0 A;  5AQ9 A;  1DJA A;  1S0W A;  2PT7 A;  1QME A;  4BJP A;  4D2O A;  1BYW A;  3T1S A;  2V2F F;  1WE4 A;  4ZJ1 A;  5IHV A;  3DWZ A;  4F3L B;  4RQ9 A;  3ZGA B;  5DF7 A;  3A3F A;  4ZTK A;  4UQI S;  3C2W A;  5EVI C;  4R4S A;  2PYR A;  1FCO A;  4LV1 A;  1YLZ A;  4Y2F A;  1ACF A;  2G2W A;  1K4F A;  3JVU A;  3IXD A;  3K2N A;  3UPP A;  2YKF A;  3MR0 A;  3L9K A;  5HPF A;  4P0M A;  1GCE A;  1ONH A;  5KIZ A;  3ZNY A;  1MY8 A;  4B9O A;  4MN6 A;  3GQZ A;  2WKP A;  2Y2Q A;  5DF8 A;  4ZRR A;  3UPO A;  4X1L A;  1S67 L;  3GV9 A;  1FR6 A;  3FKV A;  3GVB A;  1UWP X;  3OZH A;  3D72 A;  3BEB A;  2V1Z A;  4DRT A;  3ITB A;  2PU4 A;  1F9I A;  2PBY A;  3MZD A;  1K4E A;  3FC7 A;  1GHI A;  2Y4A A;  3KYQ A;  1KE0 A;  1ERQ A;  3DW0 A;  4EBL A;  4S2M A;  1FIL A;  4OH0 A;  3LR5 A;  2XD1 A;  2WGW B;  1DRM A;  1MZU A;  2NUT C;  4KZ4 A;  3TSG A;  4PAU A;  3LIA A;  1TEM A;  2HDS A;  1PWG A;  1VET A;  2PU2 A;  2K31 A;  4O8G A;  1LSV A;  5DFX A;  2NUP C;  4CPK A;  3P01 A;  2W1T B;  1W8Y A;  2R78 A;  5EVI D;  3FV7 A;  3MSH A;  1T1A A;  2D01 A;  4B4Z A;  3CUE A;  1TDL A;  3OC2 A;  2XFS A;  4BEN A;  4DE2 A;  3HUO A;  4N1H A;  3UMD A;  4ZJ3 A;  4XT2 A;  4KZB A;  3LR3 A;  1H8Y A;  4R3B A;  1PW8 A;  4L9G A;  4E6W A;  3KSI A;  3IH9 A;  4OPQ A;  4OP5 A;  2Y2N A;  1BLS A;  3LI8 A;  3NBL A;  5FI7 A;  3SH9 A;  2WK0 A;  1YQS A;  1DJB A;  4OLD A;  5CXW A;  2ZC5 B;  4GS9 A;  1CJF A;  2JKG A;  3O86 A;  2ZQ9 A;  4HI4 A;  3BQ8 A;  5FQJ A;  2M7U A;  4L9E A;  3T4Q A;  2VX8 A;  3T12 B;  1SDE A;  2Y2G A;  3T1Q B;  1PWC A;  2ZC4 B;  3H82 B;  4GS9 B;  3CPT B;  2JE5 A;  2KX6 A;  4GLQ A;  4EU0 A;  5F6A A;  3MJQ A;  4KQD A;  5CEB A;  3Q7V B;  3TG9 A;  4R4R A;  4QHC A;  5L8M A;  5HL1 A;  3IF5 A;  3KSF A;  4X55 A;  2WAD A;  3UY6 A;  3MXQ A;  4FH2 A;  5J8X A;  4S2N C;  3HL9 A;  2EX6 A;  3IX4 A;  4PKY G;  5CED A;  1LI9 A;  2VGL M;  5FAT A;  3RTY A;  1AWI A;  2W3F A;  1S4R A;  2OOL A;  3ZHH A;  4RVA A;  3ZVW A;  4X25 A;  1JWV A;  3VP3 A;  4UAA A;  2OLV A;  4O01 A;  4JXW A;  1XGJ A;  2VEA A;  3QP1 A;  4DE1 A;  2EWV A;  5TFQ A;  1N9O A;  1MC0 A;  1KGE A;  2J9P A;  3NHQ A;  4LLO B;  4G3K A;  5HL6 A;  4HJ4 A;  4WLA A;  3VMA A;  5FEG A;  4K08 A;  5FQM A;  3KX0 X;  1OME A;  3BQA A;  1T19 A;  3GRJ A;  4DE3 A;  3E98 A;  1YMX A;  3RFB A;  3IBJ A;  5A8B A;  4UA9 A;  5EOE A;  1STZ A;  2INW A;  1J9M A;  2EWW A;  4P6Z S;  3UE3 A;  3KYZ A;  4CLC B;  3A3I A;  4WBG A;  1XX2 A;  1JVJ A;  3VOZ A;  4DDY A;  2EFX A;  2ZM0 A;  2W1R A;  2D02 A;  2JCH A;  2QPN A;  1SKO B;  2FFF B;  3OLO A;  4UHU A;  1Z09 A;  4YWZ A;  4EEP A;  2ZL1 A;  1PI4 A;  3LIB A;  4YFM A;  2I72 A;  4CLC D;  4BL3 A;  2VA0 A;  1G68 A;  5HD3 A;  1CF0 A;  1IYP A;  2VZW A;  3VP4 A;  3LY3 A;  3VFH A;  4C75 A;  1ERM A;  1SCW A;  1ZKJ A;  4LV3 A;  2GX5 A;  1W5D A;  2VGL S;  5HAI A;  2GJ3 A;  3TW8 A;  4X69 A;  5TR7 A;  1LL8 A;  3S4X A;  2W3H A;  1KGF A;  4X56 A;  5FI2 A;  3EQV A;  2ZC6 B;  3F1N B;  3IS2 B;  4S2L A;  2EXB A;  2XR0 A;  1XA7 A;  4N9K A;  3M6B A;  4EUV A;  2W1T A;  2H0T A;  3FPV A;  3IXH A;  4E3N A;  3B3X A;  3RH8 B;  1RCJ A;  3LIF A;  3EEH A;  4MMN A;  2HP9 A;  4P6B A;  1C3B A;  3CMZ A;  3PBQ A;  4IVK A;  2WKI A;  4II7 A;  3O5Y A;  4FUW A;  4EER A;  5IS1 A;  4EQI A;  1BT5 A;  2JKR M;  4HP9 A;  5EM1 A;  4R0Q A;  5FQQ A;  4ARZ B;  2E8J A;  4NEE D;  1LSX A;  3M2J A;  1YMS A;  3S7O A;  3IHA A;  4G3W A;  2HV1 A;  4XUX A;  2WKR A;  2CMN A;  1JTG A;  3CJM A;  4HHD A;  4IUH A;  3LGO A;  5M19 A;  3ZYT A;  3ZG5 A;  5AVF A;  3CIT A;  3CLO A;  3ZG7 B;  1G5U A;  1ZHH B;  3HUN A;  1ESI A;  5HDD A;  3GMW A;  3MKF A;  3CI6 A;  2Z2M B;  4D60 A;  1H5X A;  2L4R A;  3P7N A;  3VOY A;  3ZFZ A;  1RP5 A;  4CQH A;  2UV0 E;  1XGI A;  3EGX C;  3IS2 A;  4WEK A;  1G6A A;  4R1G A;  1L0D A;  3F1O B;  3IXG A;  3C5A A;  5L2F A;  3LY4 A;  1XP4 A;  4EEU A;  1LHY A;  1OTE A;  2V0U A;  1H8M A;  4I3I A;  3A3D A;  2HDU A;  4JKT A;  3T4T A;  5G4Y A;  1K57 C;  1MXO A;  3HLG A;  4H8R A;  2O9A A;  4LRZ E;  5TBM B;  2PR6 A;  2OAQ 1;  3AGD A;  3WS4 A;  1JWP A;  3HLD A;  4WEL A;  4LFU A;  1NXY A;  4QY5 A;  2DNS A;  4P87 A;  1MKI A;  3VE4 A;  1S4S A;  4EET B;  3L7H A;  2XDM A;  3MFD A;  3SS3 A;  3BJN A;  3MF0 A;  2O99 A;  1NZO A;  1JWZ A;  3BYD A;  2XA7 S;  1PZP A;  5DTT A;  1N9N A;  3ZQ5 A;  2KOI A;  5HWT A;  2P04 A;  4LV2 A;  2B5R A;  4JBF A;  3DTK A;  3K3C A;  2GNX A;  5DKK A;  4Y13 A;  2X02 A;  3MKE A;  4N92 A;  4BL2 A;  3OPP A;  1V9Y A;  5CHU A;  4WYY A;  2WGV A;  3B33 A;  3HCY A;  4R23 A;  5HZH A;  4NXF A;  4LGW A;  4BLM A;  2PD7 A;  1D06 A;  5F83 A;  4DJ3 A;  4R6L A;  5A93 A;  3DTM A;  3FWL A;  4ARZ A;  3PBN A;  1F5M A;  3H82 A;  2ZOH A;  1XPB A;  3C7V A;  4OQ0 A;  3IT9 A;  5E2F A;  4CLC A;  4A5R A;  2DRW A;  3PBO A;  5KZH A;  5CGW A;  2ACG A;  5DFY A;  1ONG A;  2ZQD A;  1H3Q A;  2QMI A;  4PM6 A;  1SHV A;  5AQA A;  5D3O A;  3G6O A;  3G31 A;  2HJ9 C;  2JHE A;  2J8Y A;  1PI5 A;  3T1R A;  5EEC A;  2PR5 A;  1OPX A;  4MEZ A;  5EVL A;  4ESP A;  3VSL A;  4GOG A;  5DKL A;  4Y15 A;  1IYO A;  2Q9M A;  2OV5 A;  4GCZ A;  1Y28 A;  3FZC A;  3OOV A;  4QY6 A;  5AVE A;  4BBU A;  3B47 A;  4CLC C;  4OQG A;  4GD8 A;  4S2I A;  4JF4 A;  5FQ9 A;  5I94 A;  2ZMF A;  2XFT A;  4PM5 A;  4FCF A;  4KQO A;  1NRF A;  1RGZ A;  3CWF A;  5E2H A;  4XUZ A;  3NUL A;  2J9O A;  1VQQ A;  3CAX A;  3VOL A;  1ZC2 A;  3LYX A;  1TDG A;  3LUQ A;  1MPL A;  4Q0H A;  3JPU A;  2W0N A;  4OVD A;  5HFO A;  1PYY A;  5J4E A;  3G2Y A;  4Q8I A;  4BD1 A;  1SKO A;  3HLF A;  3RJU A;  4S2J A;  1TS6 A;  4WZ5 C;  1KOU A;  3T50 A;  4BQM A;  4OQH A;  3SH8 A;  4KG5 A;  3ULF A;  4JF5 A;  3VE3 A;  1FCM A;  3C30 A;  4NXB A;  1H8Z A;  5FA7 A;  1YAX A;  3UME A;  1K56 D;  1HTZ A;  4LCL A;  2X71 A;  1XJ2 A;  2WUQ A;  4DXC A;  3MQQ A;  4KUK A;  2JKR I;  3MS6 A;  3QHY A;  5K5B A;  1EW0 A;  2H0Y A;  1UWN X;  2Z2L B;  4MN7 A;  1K56 A;  3LEZ A;  4Z1W A;  4EWF A;  5FDS A;  2FH5 A;  5IU1 A;  2B02 A;  1PNE A;  3GEC A;  1KVM A;  5FQI A;  2PBD P;  4EXO A;  1VHM A;  3NY4 A;  3I7J A;  3H9W A;  4WZ4 A;  4LPZ A;  4JXG A;  5A92 A;  5M18 A;  2L1M A;  4GN2 A;  2QYB A;  4KUO A;  4UA7 A;  2WZZ A;  3D9Y A;  5U47 A;  3NC8 A;  3BY8 A;  3SW1 A;  4NG2 A;  1SZV A;  1OT6 A;  3BEC A;  2LB5 A;  1ERO A;  3F1P A;  3E4O A;  4MN5 A;  2B95 A;  3EQU A;  3ZVT A;  3N7W A;  5FQK A;  2QKP A;  3CZD A;  5HDS A; 
#chains in the Genus database with same CATH homology
 4BD0 A;  2FFF B;  3IQA A;  3IWI A;  4UHU A;  1ES4 A;  4LEN A;  3UNW A;  2JBF A;  4L0L A;  2EFU A;  1PI4 A;  3AGF A;  1MBL A;  2XH9 A;  1YLW A;  3HLW A;  2I72 A;  4YFM A;  3WWX A;  4BL3 A;  1G68 A;  4EBN A;  4WMC A;  2GDN A;  1IYP A;  1SDN A;  1LL9 A;  3E2L A;  3MXR A;  3SH7 A;  3LY3 A;  3N8L A;  1CI9 A;  3VP4 A;  3WS5 A;  3VFH A;  3UDX A;  3N8R A;  4OOY A;  3IH8 A;  1LI0 A;  2ZD8 A;  1YM1 A;  4ZJ2 A;  4C75 A;  3C7U A;  1ERM A;  1K6R A;  1L0E A;  2Y55 A;  3BFD A;  1KDS A;  1SCW A;  1ZKJ A;  3IWO A;  4LV3 A;  2ZQA A;  3LO7 A;  1W5D A;  3Q7Z A;  4KZ6 A;  2ZQC A;  3AGE A;  3O3V A;  4Y0U A;  1Z6F A;  3Q81 A;  4EUZ A;  2XEP A;  4IVI A;  5HAI A;  4JPM A;  3ZG0 A;  5DTS A;  2EX9 A;  3N8S A;  4X69 A;  2XGN A;  5TR7 A;  4FH4 A;  3S4X A;  3UE1 A;  2Y2L A;  1KGF A;  4KG2 A;  1IEM A;  3V3S A;  1NJ4 A;  3HLC A;  3MZF A;  2E8I A;  5M1A A;  4X56 A;  1K6S A;  2WGI A;  5FI2 A;  3EQV A;  2ZC6 B;  1E3U A;  2Y91 A;  2Y2K A;  4KQQ A;  2P9V A;  1EI5 A;  4S2L A;  5DVA A;  3UPN A;  4MLL A;  2EXB A;  2XR0 A;  3Q82 A;  4WEJ A;  2IWB A;  1XA7 A;  5AQ7 A;  3UN7 A;  4N9K A;  1K54 C;  3M6B A;  1IYQ A;  4Y0T A;  4OOM A;  4OOL A;  2H0T A;  2RCX A;  3BLS A;  5TGF A;  5HAQ A;  3MXS A;  5KSC A;  1K25 A;  3SS4 A;  4PM8 A;  4GB7 A;  3WS1 A;  1YLP A;  3BFG A;  2Y2M A;  1K38 A;  3IXH A;  4JXS A;  4E3N A;  3B3X A;  1RCJ A;  4NET A;  1ZG6 A;  5CGX A;  1M6K A;  2IWD A;  4MBK A;  4U0T A;  4N1X A;  1K55 C;  2WZX A;  2HP9 A;  2V20 A;  2R9X A;  1C3B A;  3CMZ A;  2DCF A;  3PBQ A;  4N9L A;  4P6B A;  4RX2 A;  2JC7 A;  3BFE A;  4IVK A;  2WKI A;  3IXB A;  5JYO A;  4EQI A;  2WAF A;  1BT5 A;  4GZB A;  2Y59 A;  3BFC A;  1BZA A;  1EWZ A;  4PMA A;  5HAR A;  4MNR A;  4R0Q A;  5FQQ A;  1W79 A;  3M6H A;  5FI6 A;  5EOO A;  2WAE A;  4CJN A;  4MBH A;  3G4P A;  5GLA A;  3PAE A;  1NY0 A;  2J7V A;  2WKH A;  3M2J A;  3PBT A;  1AXB A;  4K91 A;  2Y2I A;  1MWS A;  3UE0 A;  5KSH A;  1YMS A;  4C3Q A;  3PBS A;  3IHA A;  1E25 A;  1BLP A;  2WYX A;  1SKF A;  1ESU A;  4XUX A;  4EV4 A;  3ZCZ A;  3WRT A;  3G2Z A;  1JTG A;  3CJM A;  4OQI A;  1Q2P A;  4S2K A;  3HUM A;  4GDB A;  1E3U D;  4OPY A;  4E6X A;  2XK1 A;  3ITA A;  3W4P A;  3W8K A;  5M19 A;  1CK3 A;  3ZG5 A;  4X68 A;  4Z9Q A;  3VP0 A;  4ZDX A;  3PTE A;  1K54 A;  4GNU A;  3ZG7 B;  2G2U A;  1L0G A;  3ZG8 B;  3HUN A;  1ESI A;  3VP1 A;  1GA9 A;  2EX2 A;  4RX3 A;  4HBT A;  3GMW A;  1FCN A;  3MKF A;  1DY6 A;  4QD4 A;  4GDN A;  4QB8 A;  5HAP A;  4QU3 A;  4MBF A;  2Z2M B;  1H5X A;  5DTK A;  4ID4 A;  3M2K A;  5FSR A;  5JYP A;  3VP2 A;  3SS5 A;  3VOY A;  3ZFZ A;  3OPH A;  1WYB A;  1L0F A;  1RP5 A;  2ZLY A;  3QNB A;  2UWX A;  4XXR A;  5EE8 A;  3Q1F A;  3HBR A;  4X53 A;  5F82 A;  1IEL A;  1XGI A;  4WEK A;  2ZM8 A;  1G6A A;  3RXX A;  4R1G A;  4X6T A;  1L0D A;  3IXG A;  1DJC A;  2H5S A;  3C5A A;  5L2F A;  2HP6 A;  3C4P A;  3LY4 A;  1XP4 A;  2A3U A;  2X01 A;  1PW1 A;  3FKW A;  1O07 A;  1CEG A;  1LHY A;  3PBR A;  2HP5 A;  4WM9 A;  5AQ9 A;  1DJA A;  4S2O A;  1S0W A;  1QME A;  4YIN A;  4BJP A;  4D2O A;  2V2F F;  3A3D A;  1WE4 A;  4ZJ1 A;  5IHV A;  3DWZ A;  3ISG A;  2CC1 A;  4K0X A;  4UA6 A;  2HDU A;  4JKT A;  2ZQ7 A;  3BM6 A;  3ZGA B;  3UDF A;  1O7E A;  1K57 C;  1MXO A;  4OKP A;  2Q9N A;  3HLG A;  4H8R A;  5DF7 A;  3A3F A;  5HX9 A;  2Y2O A;  3IHB A;  4ZTK A;  2A49 A;  3ZG9 B;  3PAG A;  3AGD A;  2VGJ A;  3WS4 A;  5EVI C;  1JWP A;  4R4S A;  3HLD A;  4WEL A;  4OON A;  4DKI A;  5GLC A;  1KVL A;  1NXY A;  4QY5 A;  1FCO A;  1YLT A;  2DNS A;  4P87 A;  2OLU A;  4LV1 A;  3IF6 B;  1W7F A;  1YLZ A;  1N9B A;  1MKI A;  2H10 A;  3VFF A;  1L2S A;  2ZM2 A;  1Y54 A;  2G2W A;  1K4F A;  5E2G A;  2XDM A;  3GSG A;  4RYE A;  1GHM A;  3IXD A;  3MFD A;  3SS3 A;  1LLB A;  1NYY A;  2HDQ A;  3UPP A;  1NZO A;  1JWZ A;  5KMW A;  3BYD A;  5GLB A;  3HLE A;  5GHX A;  3V5M A;  1PZP A;  5CHJ A;  5DTT A;  1I2W A;  4P0M A;  5FAS A;  1GCE A;  1ONH A;  2BG1 A;  2ZQ8 A;  3ZNY A;  1MY8 A;  1GHP A;  4KZ7 A;  4LV2 A;  2B5R A;  3MBZ A;  5F1G A;  4JBF A;  1HZO A;  1CI8 A;  2X02 A;  1K57 A;  3GQZ A;  4B4X A;  3WS0 A;  2Y2Q A;  3MKE A;  4S2P A;  4N92 A;  5DF8 A;  4BL2 A;  3UPO A;  2XLN A;  3OPP A;  5CHU A;  4WYY A;  2WGV A;  5CHM A;  1YLJ A;  3GV9 A;  4M3K A;  3QNC A;  4R23 A;  4K0W A;  1FR6 A;  1KGG A;  3HLB A;  3Q7V A;  3FKV A;  3GVB A;  4BLM A;  4OPR A;  3OZH A;  1WYC A;  3TOI A;  3D4F A;  3BEB A;  2V1Z A;  5F83 A;  3W4Q A;  1BLC A;  5A93 A;  4DRT A;  5CER A;  3HRE A;  1KE4 A;  2BLS A;  3ITB A;  1ES3 A;  3DTM A;  3FWL A;  2PU4 A;  3PBN A;  1E4D A;  2PBY A;  3MZD A;  1XPB A;  2C6W B;  3C7V A;  1K4E A;  3IT9 A;  4OQ0 A;  1GHI A;  2Y4A A;  5E2F A;  1HVB A;  4F94 A;  4A5R A;  1FOF A;  2DRW A;  3PBO A;  3JYI A;  5KZH A;  1KE0 A;  1ERQ A;  5CGW A;  4Y7P A;  3O87 A;  1BUE A;  4GD6 A;  3V3R A;  3DW0 A;  4EBL A;  4WZ5 A;  4S2M A;  4DE0 A;  1CEF A;  4OH0 A;  5A91 A;  1ONG A;  2XD1 A;  2ZQD A;  2HPB A;  2QMI A;  2WGW B;  4PM6 A;  1SHV A;  3OCN A;  5D3O A;  5AQA A;  4KZ4 A;  4KZA A;  3TSG A;  3G31 A;  4C6Y A;  2ZMA A;  1TEM A;  2HDS A;  3GR2 A;  1PWG A;  2FFY A;  3GTC A;  2PU2 A;  2J8Y A;  1PI5 A;  3IWQ A;  4FSF A;  5FAO A;  3UO9 A;  1BUL A;  5EEC A;  5E43 A;  5GHY A;  4E3J A;  1IKI A;  4CPK A;  4MEZ A;  5EVL A;  1ES5 A;  2ZC7 A;  1W8Y A;  3ZDJ A;  5EVI D;  3NIA A;  3VSL A;  4GOG A;  3FV7 A;  3LCE A;  1IYO A;  5CTN A;  4EBP A;  2Q9M A;  2OV5 A;  4LV0 A;  4B4Z A;  3IF6 C;  3FZC A;  1TDL A;  4QY6 A;  3OC2 A;  1MWU A;  2XFS A;  4BEN A;  1NZU A;  3WRZ A;  1IYS A;  4DE2 A;  3Q07 A;  3HUO A;  4KZ5 A;  4OQG A;  4N1H A;  2Y2H A;  5HW3 A;  4LCM A;  4ZJ3 A;  1ZG4 A;  4GD8 A;  3OPR A;  4KZB A;  1PWD A;  1H8Y A;  4R3B A;  1PW8 A;  4GKU A;  1LL5 A;  4S2I A;  1BLH A;  4JF4 A;  1BTL A;  5FQ9 A;  4E6W A;  5I94 A;  1Q2Q A;  4KQR A;  2XFT A;  2P74 A;  5EUA A;  3IH9 A;  1GA0 A;  4OPQ A;  4PM5 A;  5FAP A;  4FCF A;  4KQO A;  4OP5 A;  1NRF A;  1RGZ A;  1BLS A;  2Y2N A;  3DWK A;  3NBL A;  5E2H A;  5FI7 A;  4XUZ A;  4KG6 A;  3SH9 A;  2WK0 A;  1YQS A;  2HDR A;  2ZC3 B;  4PM7 A;  1DJB A;  3A3E A;  4OLD A;  5CXW A;  2ZC5 B;  4JF6 A;  2R9W A;  1ALQ A;  4P85 A;  2QZ6 A;  1MWT A;  2J9O A;  2VGK A;  3SOI A;  3O86 A;  2ZQ9 A;  1VQQ A;  5FQJ A;  2P9V B;  1ZC2 A;  4U3T A;  1TDG A;  1MPL A;  5CGS A;  4NK3 A;  4IBX A;  4OVD A;  4WMC D;  2RL3 A;  4B88 A;  4PM9 A;  5HFO A;  1PYY A;  1ES2 A;  3NDE A;  3NDG A;  3G2Y A;  4Q8I A;  1SDE A;  2XF3 A;  4BD1 A;  3BFF A;  2Y2G A;  5CTM A;  1PWC A;  2ZC4 B;  1BSG A;  3HLF A;  3RJU A;  4S2J A;  3N4I A;  3OPL A;  4HEF A;  4WZ5 C;  2JE5 A;  4JLF A;  4O7D A;  1VM1 A;  3MZE A;  5DF9 A;  3P98 A;  3NCK A;  4BQM A;  5EVI B;  4QJG A;  4IED A;  4OQH A;  3SH8 A;  1XXM A;  5CEB A;  4KG5 A;  3Q7V B;  4JF5 A;  4KZ8 A;  1JTD A;  3CG5 A;  4R4R A;  3TG9 A;  3OCL A;  1FCM A;  4QHC A;  5GHZ A;  5HL1 A;  3IF5 A;  4HES A;  1H8Z A;  5FA7 A;  4JXV A;  3G32 A;  3UDI A;  4X55 A;  1XA1 A;  3RXW A;  2WAD A;  2EX8 A;  5GLD A;  1K56 D;  1HTZ A;  3UY6 A;  4S2N A;  5AQB A;  4LCL A;  2X71 A;  4FH2 A;  5J8X A;  4S2N C;  3HL9 A;  2EX6 A;  5BOH A;  1MWR A;  4ZAM A;  3E2K A;  5CED A;  2WUQ A;  4OP8 A;  4DXC A;  1FQG A;  1LI9 A;  3BLM A;  3HVF A;  2OSU A;  2XD5 A;  5FAT A;  3ZNT A;  2WKE A;  4KZ9 A;  3G34 A;  3QHY A;  2H0Y A;  4FD8 A;  1NYM A;  1K55 A;  4U0X A;  3IF6 A;  3ZHH A;  4RVA A;  3ZVW A;  2Z2L B;  5G18 A;  4E3O A;  2C5W B;  1JWV A;  1K56 A;  1FSW A;  2EXA A;  3VP3 A;  3O88 A;  4UAA A;  1KE3 A;  1PZO A;  2OLV A;  3LEZ A;  4EWF A;  2WGW A;  4JXW A;  3S22 A;  1XGJ A;  3S1Y A;  4KEN B;  2XQZ A;  4DE1 A;  4DF6 A;  2IWC A;  5TFQ A;  1KVM A;  3G30 A;  1U60 A;  5FQI A;  1KGE A;  1I5Q A;  2J9P A;  2Y2P A;  3NI9 A;  3A3J A;  1YLY A;  3NY4 A;  4R3J A;  3I7J A;  5EVI A;  3VMA A;  3N6I A;  4Y0O A;  5FQM A;  4WZ4 A;  2Y2J A;  4JXG A;  1OME A;  5A92 A;  4OPZ A;  5E2E A;  1N4O A;  4E3I A;  4GN2 A;  5M18 A;  1S6R A;  3GRJ A;  4DE3 A;  1I2S A;  3V50 A;  1YMX A;  2WZZ A;  4UA7 A;  4OLG A;  4E3K A;  5U47 A;  1FR1 A;  3WS2 A;  1TVF A;  5F1F A;  3NC8 A;  5FAQ A;  5A90 A;  1FSY A;  1IKG A;  4DDS A;  1W8Q A;  4UA9 A;  5CRF A;  5EOE A;  4E3M A;  3C4O A;  3BRM A;  1XKZ A;  4ZBE A;  2ZJ9 A;  1QMF A;  1J9M A;  5GL9 A;  3VSK A;  3W4O A;  1HD8 A;  3UE3 A;  1RGY A;  1M40 A;  4HBU A;  3BEC A;  3P09 A;  1ERO A;  5FDH A;  5CEC A;  4IBR A;  4RA7 A;  3G35 A;  4KZ3 A;  4E3L A;  1KDW A;  3A3I A;  4WBG A;  5EPH A;  1XX2 A;  1JVJ A;  3EQU A;  3ZVT A;  1YT4 A;  3VOZ A;  3N7W A;  4PPR A;  3V39 A;  5FQK A;  4DDY A;  1PIO A;  2EFX A;  3CZD A;  3FYZ A;  4DXB A;  2ZM0 A;  2JCH A;  2QPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...