3HUOA

X-ray crystallographic structure of ctx-m-9 s70g in complex with benzylpenicillin
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
262
structure length
262
Chain Sequence
TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CTX-M-9 extended-spectrum beta-lactamase
publication title Dynamic view of the early and late steps of the catalytic mechanism mediated by the emerging enzymes CTX-M.
rcsb
source organism Escherichia coli
total genus 95
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3huoA00
1CK3A 1NY0A 3O86A 1YLYA 3NDGA 4JF5A 1WE4A 5CGSA 4E3JA 3PBSA 2XDMA 1H8ZA 1SHVA 2Y2NA 3IH9A 1YMXA 1HTZA 3RJUA 1NJ4A 1G68A 5D3OA 1IYSA 2WGIA 3E2KA 3ZVTA 2V2FF 2ZC7A 3G4PA 3S22A 4KG6A 3GVBA 1S6RA 3MKEA 2ZC3B 1XA7A 5IHVA 2WGWB 5A91A 3ZG8B 5GLAA 4N9KA 3HLGA 1ES4A 5GHXA 4Y0OA 4OOLA 3O88A 4X68A 1PZOA 4X53A 2BLSA 1BTLA 4OQGA 3MZDA 3Q7ZA 2Y2QA 3TOIA 4UA9A 1K38A 4BENA 3TG9A 4OPQA 3MXRA 1W79A 3DW0A 5HFOA 2P9VB 4N9LA 5BOHA 5F1FA 2HDQA 1ES5A 1MWRA 4ZJ1A 1FCOA 5DF9A 4JKTA 4WELA 3UPPA 1L0FA 3WS2A 3UDFA 3AGFA 1NZOA 4CPKA 2FFFB 4WEKA 1SKFA 2XFTA 1YLWA 4E3IA 4E3OA 1WYCA 2J9OA 3TSGA 3G31A 1N4OA 5CTMA 1PW8A 5EUAA 1KVMA 3SH7A 4EUZA 3BECA 2OLVA 1K54A 4MEZA 3VP1A 4KZ6A 1CEFA 2JCHA 1ES2A 3ITBA 2XK1A 1ZG4A 4DF6A 5FQQA 3UE1A 1PYYA 1JWZA 3C7UA 1LL9A 3OCLA 1E3UD 3ZVWA 4MBKA 1I5QA 4X56A 5DTTA 4XUZA 4WEJA 1KE0A 1TDLA 5FQ9A 3UDXA 2R9XA 4GN2A 3W4QA 1FOFA 1JWVA 3E2LA 1H8YA 3NCKA 5EECA 5GL9A 4LV2A 2Y2JA 4ZDXA 2ZQ7A 2G2WA 5E2EA 2ZD8A 1KDWA 3UNWA 5FQKA 3ZGAB 1DY6A 3G35A 3OCNA 1PI5A 2OV5A 1FR6A 4N1XA 3IWQA 4KG2A 4OLGA 1ZG6A 1FSWA 3FZCA 4OOMA 3V3SA 2H0TA 3HL9A 3PTEA 4X6TA 2H10A 3NBLA 2QMIA 5DF7A 2J8YA 4JXVA 1HD8A 2Y2PA 3PBNA 4U0TA 3VP0A 3IQAA 1K57C 3IXBA 2EX9A 1E25A 1K6SA 2Z2LB 1I2WA 3M2KA 3MBZA 1DJCA 2J7VA 5HAPA 3IWOA 3BFFA 3HVFA 4E3LA 1BLCA 4QU3A 3G2YA 2RCXA 3FKWA 1GA0A 1CI9A 3OPLA 3GRJA 4E3KA 3UY6A 1K56A 2Y55A 4BLMA 5CEBA 4X55A 5CEDA 5HX9A 3WS1A 1K54C 4PM5A 3VMAA 5KZHA 2HDUA 2BG1A 2ZLYA 1O07A 5JYOA 2WKEA 1FCNA 1LLBA 2B5RA 1C3BA 4BL3A 3BFDA 4C6YA 3G2ZA 4WYYA 2HDSA 3VSLA 4FSFA 2Q9MA 5CHJA 2WGWA 5AQ9A 1PWCA 3NIAA 1SDEA 3MXSA 5CERA 3AGDA 1K6RA 3EQUA 1KGEA 3RXWA 5CHMA 4ZJ2A 3ZG5A 1LHYA 5U47A 1YLZA 4PM7A 3SS5A 4WMCD 5EVIC 4S2IA 1N9BA 2XF3A 2Y2HA 1O7EA 3BFCA 4P85A 3I7JA 1MWUA 4E3MA 2ZQAA 3IF6C 4R1GA 4MLLA 4WZ4A 1PWGA 2G2UA 2ZM0A 4F94A 4FH2A 1J9MA 4IVIA 4KZ4A 2ZJ9A 2VGKA 3UDIA 3LCEA 1EWZA 3IF5A 4R3BA 3BRMA 4DDSA 4S2NA 4DE2A 1K4EA 4EQIA 1L2SA 3G32A 4U3TA 5GHZA 3VP3A 1U60A 1WYBA 2WGVA 1IYPA 3WS4A 1ERMA 4OPRA 1XKZA 5CRFA 3N8LA 1H5XA 1HZOA 1S0WA 3QNCA 3JYIA 1BULA 2Y2MA 4C75A 2JE5A 3ITAA 2OLUA 1K4FA 3HLBA 4DXCA 1LI9A 3IHBA 4KZ5A 3LY4A 4OPZA 4B4XA 4KG5A 1NZUA 4KZ7A 1L0GA 3ZCZA 3UN7A 4YFMA 4GD6A 1YLPA 5CTNA 4BD1A 4JBFA 3M6HA 5CHUA 1JTGA 4OQIA 2WAEA 4E3NA 3IH8A 4LV3A 4Y7PA 4EWFA 3FKVA 5EOOA 3GV9A 4JPMA 1KGGA 4OONA 4OVDA 2HP5A 4JLFA 3RXXA 4GD8A 3V3RA 2IWCA 3HLCA 1MWSA 3N4IA 4FD8A 5EVID 4IBRA 1ONHA 4OH0A 5CECA 1GHPA 1FR1A 1RGYA 4EV4A 2WYXA 4S2OA 3V39A 1PZPA 2ZC5B 5EVLA 1BSGA 3N7WA 1W5DA 5KSHA 4C3QA 5AQBA 3C5AA 3MKFA 4S2MA 4IEDA 5FASA 3IHAA 1Q2PA 1DJAA 4OOYA 5HW3A 2XGNA 4MBHA 5AQ7A 2HP9A 5TFQA 1AXBA 1KE3A 3GR2A 1NYMA 1NRFA 1TEMA 1QMEA 3C4PA 1BLSA 5CGXA 2A3UA 5FDHA 5EOEA 3PAEA 1L0EA 4L0LA 1XGJA 3ZFZA 5KSCA 2DRWA 3HREA 4PPRA 1RGZA 3G34A 1TDGA 4R23A 2X01A 3BFGA 4DKIA 1IELA 4S2PA 4KQOA 3VSKA 3Q7VB 4JXSA 2H0YA 1ALQA 1W8QA 2EFUA 3NDEA 1K56D 3C4OA 3BFEA 4P6BA 1VQQA 4RX2A 4B4ZA 3BEBA 4RYEA 3VP4A 5FI2A 2XFSA 3M2JA 2H5SA 1ZC2A 4UHUA 5L2FA 4KZAA 3HLEA 5HAQA 4QHCA 4OQHA 1W7FA 3ZG0A 3C7VA 2Y91A 3N8SA 1MPLA 4ZAMA 1E3UA 3CJMA 4LV1A 3HUNA 5F1GA 3BM6A 1ES3A 4KENB 1JWPA 1BLHA 1ONGA 1YT4A 4P87A 3A3FA 2HDRA 2I72A 5GLBA 2WKHA 3O87A 5FAOA 2XLNA 2IWDA 3OC2A 3WRZA 3ZG9B 4BD0A 4D2OA 3UPOA 2WK0A 1HVBA 2Y2KA 4JF6A 3OPPA 2XD5A 3Q82A 1Q2QA 1EI5A 1FSYA 1PWDA 3FV7A 4HBUA 4OQ0A 1ERQA 3GQZA 3QNBA 4UAAA 5EVIB 3VOZA 1IKGA 3IF6B 1XXMA 1MWTA 3PBOA 5E2GA 2EX2A 3AGEA 3Q1FA 3WRTA 5FAQA 1GHIA 2EX6A 1K25A 2P74A 3MZFA 1XPBA 2C5WB 5AQAA 1PIOA 1RCJA 2CC1A 2EXAA 3IXHA 1L0DA 1MBLA 3PBTA 2XR0A 3HLWA 3ZG7B 1KE4A 2Q9NA 2WKIA 4PM6A 1ESIA 3NC8A 4IVKA 3WS0A 2WAFA 4EBPA 1MKIA 3V50A 5A93A 3MFDA 2P9VA 4Y0UA 1DJBA 4OKPA 4LCLA 3N8RA 5TR7A 4MBFA 4O7DA 3EQVA 5E2HA 4DE1A 2V20A 3M6BA 4LV0A 3LY3A 3DWZA 2ZMAA 2ZQCA 3UO9A 3HLDA 4KZBA 3IWIA 3OPHA 1YQSA 4WZ5A 2R9WA 2X71A 4GB7A 4OP5A 1SCWA 1XP4A 2UWXA 5FQMA 1FQGA 3SH9A 4BJPA 3LO7A 1Y54A 1KGFA 4XXRA 3P98A 3S4XA 3HUOA 4IBXA 4QY5A 1GHMA 1E4DA 4N92A 4DDYA 5A90A 3DTMA 3ZHHA 3IXDA 2ZM2A 3NI9A 4PMAA 3SS4A 4QD4A 3W8KA 2HPBA 4DE0A 3GMWA 4Z9QA 5A92A 3G30A 4KZ3A 3IT9A 5EE8A 4CJNA 4NK3A 4OP8A 4PM9A 4R0QA 5FATA 3PBRA 5E2FA 2VGJA 4K0WA 5DTSA 4EBLA 4Q8IA 5FAPA 2Y2IA 1EROA 2JC7A 4UA7A 4WMCA 3VP2A 4N1HA 3OPRA 1QMFA 4RVAA 5KMWA 1BZAA 5F82A 4YINA 4K91A 5GHYA 2WUQA 3PAGA 2QZ6A 3A3IA 1K57A 4MNRA 3UPNA 4JXWA 3HBRA 3GSGA 5FSRA 3MZEA 2XEPA 2Y2OA 3Q7VA 5DF8A 3ISGA 4KZ8A 4WBGA 3ZNYA 3CZDA 2OSUA 1MXOA 3D4FA 3NY4A 3S1YA 5JYPA 1KDSA 1SDNA 2XH9A 5EPHA 4WM9A 1NYYA 1ZKJA 3PBQA 1CEGA 1ESUA 5HL1A 2FFYA 4FCFA 3W4OA 1FCMA 5FA7A 5FI7A 3DWKA 1BUEA 2EFXA 4R4SA 3VOYA 3HLFA 3HUMA 4R4RA 1W8YA 1Z6FA 4S2NC 1OMEA 3ZDJA 1K55A 4H8RA 1JTDA 1IYOA 1M6KA 2X02A 5CGWA 4GDNA 3BLMA 4WZ5C 4K0XA 3V5MA 4Y0TA 3FYZA 2IWBA 4NETA 3SOIA 4B88A 2XQZA 3WS5A 3ZNTA 3BLSA 3A3JA 2ZC6B 4QJGA 5I94A 2Y59A 4JF4A 3A3DA 5DVAA 3VFHA 4DXBA 3UE3A 1TVFA 4U0XA 1XA1A 1RP5A 3B3XA 4HEFA 1IKIA 4GZBA 5FQJA 1YLJA 5EVIA 2C6WB 3FWLA 5M18A 2ZM8A 5FI6A 4ZBEA 3IF6A 4E6WA 1YLTA 2JBFA 1BLPA 2ZQ9A 3A3EA 3WWXA 4S2KA 2Z2MB 3CMZA 3SS3A 3UE0A 2PU2A 2E8IA 4LENA 4P0MA 5FQIA 1CI8A 1IEMA 3LEZA 4KQRA 4PM8A 1KVLA 4OLDA 4QB8A 4XUXA 5GLCA 4BQMA 4EBNA 4GNUA 1VM1A 2PBYA 2ZQDA 4UA6A 2EX8A 3VFFA 3N6IA 5G18A 5GLDA 1PI4A 2EXBA 2ZC4B 3O3VA 4M3KA 4RX3A 3Q81A 5M19A 1LI0A 2Y2LA 1GA9A 2ZQ8A 5M1AA 3BYDA 3W4PA 2Y2GA 5J8XA 4GDBA 4GKUA 4GOGA 4QY6A 2RL3A 1IYQA 1JVJA 4DE3A 5CXWA 1YM1A 2A49A 3CG5A 1BT5A 3IXGA 3QHYA 5DTKA 4BL2A 3SH8A 4ZJ3A 4S2JA 4FH4A 2WZXA 5HAIA 1LL5A 5TGFA 1MY8A 1GCEA 1XGIA 2QPNA 2J9PA 3Q07A 3GTCA 4HESA 4S2LA 4ZTKA 2DNSA 4E6XA 1NXYA 2DCFA 4RA7A 1K55C 2GDNA 4DRTA 4R3JA 2V1ZA 5E43A 5HARA 2WZZA 3OZHA 4ID4A 2PU4A 3P09A 1YMSA 2WADA 4LCMA 4JXGA 4KQQA 2XD1A 2Y4AA 2HP6A 1M40A 1G6AA 1PW1A 4X69A 4OPYA 1XX2A 4A5RA 4HBTA 5F83A 1I2SA 4KZ9A
chains in the Genus database with same CATH superfamily
1NY0A 4XT2B 2DMWA 2V9AA 3MR0A 4E3JA 2XDMA 1SHVA 1HTZA 1G68A 3E2KA 1Y4OA 3S22A 3GVBA 4N9KA 5GHXA 4OOLA 1PZOA 2OAP1 4X53A 2Z6DA 3MZDA 2NUPC 2W3DA 4IUKA 3TOIA 4OPQA 2A24B 5HFOA 4O8GA 4Q0JA 2P9VB 4N9LA 5BOHA 4HJ4A 4WELA 3UDFA 1NZOA 2FFFB 4WEKA 2YKHA 4Y17A 1WYCA 2KX6A 5CTMA 4EUZA 3BECA 1K54A 1YSQA 3VP1A 2E8JA 1OPXA 4GCZA 5FQQA 1PYYA 3UDXA 2R9XA 4GN2A 3W4QA 1H8YA 3NCKA 3UB8A 1PRQA 2KDKA 3SZTA 2ZD8A 3F1OA 2OV5A 1FSWA 1F9IA 4OOMA 2ZOIA 3PTEA 2Z6CA 2QMIA 2J8YA 4JXVA 1HD8A 3LI8A 3E4OA 3VP0A 3JPUA 1XJ2A 1UWPX 1N9OA 4WF0A 1K6SA 2Z2LB 3UMEA 2M7VA 3IWOA 4PKYG 4I5SA 4E3LA 5G4YA 4HY8A 1CI9A 4E3KA 4KUKA 1OT6A 2Y55A 3NOPC 5CEBA 3NOUC 3WS1A 2Q0OA 2BG1A 2WKEA 1C3BA 3R7WB 4EESA 4WYYA 2HDSA 4FSFA 1MC0A 1PWCA 1SDEA 4DN0A 1KGEA 3RXWA 4ZJ2A 3P7NA 2XA7S 1K0KA 3SS5A 1N9BA 2Y2HA 3I7JA 4E3MA 1PWGA 3F1NA 1P9WA 3VE4A 3E4QA 4IVIA 3H82A 2O9CA 3UDIA 3A0RA 1EWZA 4H6JB 4R3BA 2W3FA 4S2NA 4DE2A 3TW8A 1K4EA 3VP3A 1IYPA 2QWSA 4OPRA 5TJJA 3N8LA 1HZOA 3U2AA 1BULA 4C75A 1LT0A 2FZ0A 4DXCA 4KZ5A 2AVXA 1JTGA 5J3WA 4E3NA 2H28A 1P0ZA 1KGGA 2K7SA 4OVDA 2HP5A 3D3OA 4JLFA 3V3RA 3HLCA 1MWSA 4FD8A 4NG2A 4EU0A 4FUWA 5CECA 1N9NA 1GHPA 2Y79A 2WYXA 2QJ7A 2OOLA 3S7PA 1BSGA 3CI6A 3N7WA 5KSHA 3MKFA 4IEDA 5FASA 4BBVA 5AQ7A 1AXBA 2VX8A 3NECA 3GR2A 1TEMA 3C4PA 1QMEA 4MN6A 1X0OA 5EOEA 3ZFZA 3G34A 2H0YA 3E0YA 1VQQA 1AWIA 4B4ZA 3H9WA 3BEBA 2VKSA 3VP4A 4KZAA 3C7VA 4ZAMA 1MKMA 4KENB 1BLHA 1FILA 3A3FA 4ARZA 3CLOA 3UPOA 2XLNA 4D2OA 1S67L 4ME4A 4YWZA 5EVIB 5HWWA 3UB9A 3NULA 3B47A 4HI4A 3IF6B 2EX2A 4MDZA 4GS9A 3ULFA 5AQAA 1XPBA 3IXHA 2EXAA 3LEQA 4HOIA 3CITA 1MBLA 2VGLS 1F98A 4PM6A 3WS0A 1MKIA 3V50A 2A24A 3MFDA 3DTKA 5FDSA 2P9VA 2V20A 4LV0A 1NRJA 3BY9A 2ZMAA 2ZQCA 3IWIA 2R9WA 2X71A 4OP5A 3C8CA 1Y54A 2M1CA 2NUTC 2OWHA 4QY5A 4QD4A 3GMWA 3LFVA 3LICA 3U4LP 5AJGA 3K3CA 2Y2IA 4UA7A 4WMCA 2LB5A 4N1HA 3OPRA 1SKOA 5FL3A 5KMWA 2D01A 5GHYA 2WUQA 3A3IA 4MNRA 3OLOA 2XEPA 2V0WA 5DF8A 4KZ8A 3ZNYA 1VETA 2OSUA 3D4FA 1SDNA 2XH9A 4HJ3A 4HP9A 1CEGA 4DJ2A 2L4RA 3TJZC 5FI7A 3EGDC 3HLFA 1W8YA 3DTEA 2LB9A 3IX3A 3TRCA 1IYOA 4P6ZM 3V5MA 4Y0TA 3FYZA 2W0NA 3UB6A 4F3LA 3A3JA 3LYXA 5HWVA 3PHYA 1XA1A 1RP5A 3T12B 3HJIA 5FI6A 2Z2MB 3CMZA 4P0MA 5L8MA 2PBYA 2EX8A 2JKGA 3O3VA 3Q81A 2ZQ8A 5M1AA 5J8XA 4CLCC 2RL3A 4H6JA 2XSSA 5DTKA 4BL2A 1CQAA 3F1OB 4FH4A 2WZXA 5HAIA 3P01A 1MY8A 2QPNA 2J9PA 3Q07A 4S2LA 1K55C 4R3JA 5HARA 5F5YA 3P09A 4JXGA 2Y4AA 1M40A 3K2NA 4WLAA 1YLYA 4B9OA 1H8ZA 3RJUA 2OAQ1 1NJ4A 5D3OA 2WGIA 2ZC7A 4PHTA 3G4PA 4KG6A 1S6RA 4CLCD 2WKPA 5J7EA 4WUJA 4WN5A 3MXQA 4X68A 3T1SA 2BLSA 1BTLA 3Q7ZA 2Y2QA 4BENA 4UA9A 1K38A 3EWKA 3TG9A 4EEUA 1W79A 3F1NB 2HDQA 3H82B 1ES5A 4UQIM 5DF9A 2EWWA 3UPPA 4NXEA 3WS2A 1DP6A 4X25A 4CPKA 4YOFA 5HD5A 1YLWA 4E3OA 2W27A 2JKRI 4MEZA 4KZ6A 2JKFA 2JCHA 3UMDA 4O01A 3ITBA 3RTYA 2UV0E 4DF6A 3C7UA 1NLZA 3ZVWA 1I5QA 4XUZA 3E2LA 3ZYTA 4I38A 3NOTC 1H3QA 1HLUP 1KDWA 3UNWA 3ZGAB 5DJTA 3G35A 3OCNA 1OJGA 4HQAA 4N1XA 4KG2A 1S4SA 3FZCA 2H0TA 3HL9A 3NBLA 2Y2PA 1K57C 2EX9A 2QYBA 1I2WA 3MBZA 1DJCA 1XFNA 1BLCA 3DBAA 3S7QA 4WL9A 3UY6A 1K56A 4BLMA 2ZL1A 3A0SA 4X55A 4IHQA 5CEDA 1K54C 2JN7A 2HDUA 1O07A 3F1PA 1G5UA 4NEED 2W3EA 3BFDA 4C6YA 2Q9MA 1D06A 1P97A 3MXSA 1GSWA 3LIAA 5HDSA 3EQUA 4I3AA 5U47A 3MQQA 2XF3A 3BFCA 1O7EA 4ARZB 1MWUA 2ZQAA 4R1GA 1N9LA 4WZ4A 2G2UA 2ZM0A 3LR3A 2QJ5A 2ZJ9A 2VGKA 1LSVA 4DDSA 3G32A 5GHZA 4GS9B 1U60A 4Z1WA 4ETXA 3WS4A 1ERMA 1H5XA 3MQOA 2Y2MA 4BBTA 5EV0A 1K4FA 3HLBA 1LI9A 3MF0A 1OTEA 1NZUA 1L0GA 1LSXA 5CTNA 4BD1A 3M6HA 4OQIA 5F69A 3IH8A 4EWFA 1F5MA 5EOOA 3GV9A 4IJGA 2XA7M 4OONA 3KYEA 2GJ3A 4GD8A 2IWCA 1RGYA 1PZPA 2W3HA 2P7JA 4C3QA 3CAXA 1WA9A 1DJAA 4OOYA 1SKOB 2ZBBA 1G6OA 5CGXA 5FDHA 1L0EA 5KSCA 2DRWA 2WKRA 1TDGA 3EEHA 3L7HA 4GLQA 1IELA 1DP9A 4LRZE 3VSKA 4R70A 1VETB 2EFUA 3NDEA 4RX2A 4P6BA 1SZVA 3M2JA 3E98A 1ZC2A 5HAQA 2L0WA 5DJUA 4HNBA 3N8SA 2HZ5A 3CJMA 4MN5A 5AVFA 1ODVA 4KUOA 4P87A 4F3LB 2VV7A 5GLBA 3O87A 5FAOA 4BD0A 2WK0A 4JF6A 2XD5A 1Q2QA 4LPZA 3FV7A 4HBUA 1ERQA 1XXMA 4CLCE 4I39A 3PBOA 2J3WA 5FAQA 2ACGA 4YNRA 2PYRA 2VLGA 3MZFA 1L0DA 3ZG7B 3CUEC 2Q9NA 2WKIA 1ESIA 3T50A 3RH8B 2JKRM 5A93A 2P04A 1DJBA 4X1LA 1DP8A 1XJ3A 4I3IA 4DE1A 2VV8A 3DWZA 3UO9A 3K3DA 4KZBA 3OPHA 1YQSA 4WZ5A 5FQMA 2UWXA 1FQGA 3SH9A 4XXRA 4IBXA 3KSFA 3LUQA 3QP6A 1E4DA 3DTMA 3ZHHA 1P9RA 2ZM2A 4KZ3A 5EE8A 4OP8A 2VGJA 4K0WA 4Q8IA 5FAPA 1EROA 2VGLM 3LGOA 4YINA 3UPNA 2K31A 4Y2FA 2Y2OA 3ISGA 4NKPA 3ICYA 3NY4A 1ESUA 5HL1A 4FCFA 3W4OA 1FCMA 3DWKA 2EFXA 4R4SA 3HUMA 1OMEA 1GSVA 2X02A 3FPWA 4GDNA 1TF1A 4B88A 2PAVP 3BLSA 2ZC6B 2PBDP 5DVAA 2ZOHA 3PXPA 1TVFA 3S7OA 2OWJA 4HEFA 2QKPA 1IKIA 4GZBA 4ETZA 2C6WB 4UEYA 4M4XA 1YLTA 2JBFA 3WWXA 3SS3A 2E8IA 4LENA 1CI8A 1IEMA 3LIEA 4PM8A 5GLCA 4XUXA 4BQMA 4HP4A 2ZQDA 4UA6A 3N6IA 5G18A 1NLYA 4MCWA 2Y2LA 4QY6A 1IYQA 2VJWA 1YSPA 3IXGA 4Q0IA 4R6LA 3SH8A 4S2JA 5HDCA 3D9YA 5TGFA 4HH2A 4Y13A 1ACFA 2M7UA 1XGIA 3GTCA 2EWVA 4HESA 2W1RA 2GNXA 4DRTA 2V1ZA 4JGRA 4QPRA 4LCMA 3UB7A 2WADA 2B18A 2XD1A 1VEUB 4DJ3A 3MS6A 3T4QA 5F83A 4O0PA 4KZ9A 5IT5A 3O86A 2ZL1B 4JF5A 1T18A 4EEPA 2Y2NA 2PHYA 4MN7A 4EXOA 3F1PB 3ZVTA 2V2FF 3GECA 2O9BA 3ZG8B 1XA7A 5A91A 5GLAA 1ES4A 3EEAA 4PAUA 2L1MA 4OQGA 2JKTI 3SW1A 1Y28A 2G7UA 2PR6A 5F1FA 3ZQ5A 4ZJ1A 1FCOA 1S1YA 1SKFA 4E3IA 1V9ZA 1TS6A 3NJAA 3G31A 1N4OA 2B95A 3S7NA 1CEFA 1ES2A 2XROA 2XK1A 1ZG4A 1H8MA 3UE1A 1JWZA 2K2NA 3OCLA 1E3UD 4MBKA 4X56A 3T4OA 3KX0X 3LIFA 2GX5A 4WEJA 2KLIA 5FQ9A 1JWVA 5EECA 5GL9A 1S4RA 4LV2A 2Y2JA 4ZDXA 2ZQ7A 2G2WA 5FQKA 1PI5A 2XRNA 1FR6A 3IWQA 4OLGA 2V0UA 5CX7A 1H0MA 3V3SA 2H10A 1TS7A 3PBNA 4U0TA 1G28A 4L9FA 4LFUA 5HZHA 1CJFA 3M2KA 5HAPA 3BFFA 3HVFA 2RCXA 3IS2B 3OPLA 3LI9A 3QP2A 3CWFA 3OOVA 1BYWA 1XJ4A 5HX9A 4PM5A 3VMAA 5KZHA 2ZLYA 3C2WA 1FCNA 3G2ZA 4NXBA 3VSLA 5CHJA 2WGWA 5AQ9A 3NIAA 5CERA 3AGDA 3MMHA 5CHMA 3ZG5A 1LHYA 2PRFA 4EQ1A 1YPRA 4PM7A 5EVIC 4S2IA 1PNEA 4HJ6A 4P85A 3IF6C 4MLLA 2V8FA 4PKYA 4FH2A 1J9MA 4KZ4A 3LCEA 3BRMA 3IBJA 4L9EA 4EUVA 3JVUA 1S0WA 1F2KA 4ZRRA 4NXFA 3ITAA 3BQAA 1OTBA 3LY4A 4B4XA 4KG5A 3UN7A 4YFMA 5CHUA 4LLOB 1T19A 1YKDA 4LV3A 3QP5A 2J3TC 3RXXA 5EVID 4LGWA 4IBRA 4CLCA 3LR5A 1FR1A 4EV4A 4S2OA 3V39A 2GZAA 3QP4A 1W5DA 5AQBA 4G3WA 3IHAA 2XGNA 2HJ9C 2HP9A 3OBFA 3MFXA 3KSGA 3PAEA 4L0LA 1XGJA 1RGZA 3B33A 4R23A 2X01A 3BY8A 4S2PA 4JXSA 5EFWA 1K56D 3C4OA 3UB5P 1A0KA 5FI2A 2XFSA 1T1BA 1PFLA 4UHUA 1YAXA 1VEUA 2J3TD 2Y91A 4LV1A 3HUNA 5F1GA 5HD3A 1JWPA 1ONGA 3T4KA 1MZUA 5AVEA 2IWDA 3OC2A 2W1TA 3OPPA 5L09A 2JKTM 1FSYA 4HH3A 5A92A 3VOZA 1MWTA 5E2GA 3Q1FA 1GHIA 3BWLA 3KO6A 1PIOA 1RCJA 2PYPA 3HLWA 1KE4A 4Y3IA 3NC8A 3LIDA 1FIKA 2WAFA 3V67A 4Y0UA 4OKPA 3N8RA 4MBFA 3EQVA 1IFQA 5E2HA 1S1ZA 4GB7A 3R4KA 5KIZA 4MMNA 4BJPA 3LO7A 1KGFA 3P98A 4B93A 4GW9A 5IS1A 1GHMA 4DDYA 5A90A 3IXDA 4PMAA 3W8KA 2HPBA 4Z9QA 1NWZA 4CJNA 4NK3A 2PD8A 1TS8A 1OT9A 2I9VA 4R0QA 3PBRA 5E2FA 5DTSA 5TBMA 2JC7A 4RVAA 4K91A 5FEGA 3EOIA 3PAGA 1K57A 4JXWA 3HBRA 3GSGA 4K08A 3MZEA 3Q7VA 5MC7A 4WBGA 4JGPA 4Q0HA 3S1YA 5JYPA 1KDSA 5EPHA 4WM9A 1W63M 3BJNA 1ZKJA 3D72A 3PBQA 1VB6A 2FFYA 5FA7A 1BUEA 3LR4A 4S2NC 1Z6FA 3IS2A 4H8RA 2JHEA 4EW7A 5CGWA 1Z09A 3BLMA 4WZ5C 3A0VA 4NETA 2XQZA 3ZNTA 4QJGA 5I94A 2O99A 2Y59A 2V1AA 4DXBA 3UE3A 4U0XA 2BTFP 3FG8A 3FWLA 5M18A 2ZM8A 4HHDA 4E6WA 2HV1A 2ZQ9A 2ZMFA 3A3EA 5HSQA 4DMZA 1J3WA 5FQIA 4KQRA 4QB8A 1KVLA 4OLDA 4FTXA 1VM1A 5DFYA 1PI4A 4M3KA 4RX3A 5M19A 2V8CA 1LI0A 3W4PA 1GA9A 1DRMA 4JGOA 1JVJA 1YM1A 2A49A 5HWTA 1BT5A 3QHYA 3T4LA 1LL5A 3H7WB 5K5BA 2HF6A 2DNSA 4E6XA 2DCFA 4RA7A 1XFQA 2GDNA 5E43A 3CPTA 3T4JA 1PW1A 4X69A 3KSIA 4A5RA 4HBTA 1I2SA 4D60A 1CK3A 3NDGA 1WE4A 5CGSA 3PBSA 2KOIA 3IH9A 1YMXA 2MJ6A 1V9YA 1IYSA 5EVEA 5L10A 3MKEA 2ZC3B 5IHVA 2WGWB 3HLGA 4Y0OA 3O88A 4R3AA 5HPFA 5A8BA 3VOLA 5HDDA 3MXRA 3DW0A 1MWRA 4JKTA 3W2ZA 1L0FA 3AGFA 4QWOA 2XFTA 1UGUA 2J9OA 3TSGA 5EUAA 3SH7A 1PW8A 1KVMA 5I5LA 2OLVA 3BQ8A 4LRYC 1EW0A 1LL8A 4AFIA 3O5YA 1LL9A 5DTTA 2R78A 3LR0A 3IX4A 1KE0A 1TDLA 1UWNX 1FOFA 3CUEA 2V1BA 5E2EA 4R38A 1DY6A 4CLCB 1ZG6A 2PD7A 3BW6A 4X6TA 5DF7A 5FEFA 5G4ZA 3IQAA 3IXBA 3PR6A 2O9AA 1E25A 5HPIA 2IA2A 3EGXC 4LRXC 4CQHA 2J7VA 2D02A 4QU3A 3G2YA 3FKWA 2BASA 1GA0A 2PDRA 3GRJA 4G3VA 5IU1A 2W3GA 4XT2A 4GHIB 1JNUA 1VHMA 5JYOA 4X1MA 1LLBA 2B5RA 4BL3A 2QHKA 2INWA 4EERA 1K6RA 3C38A 1YLZA 4WMCD 1L3LA 5L07A 4F94A 1ZHHB 2W1TB 5C5KA 5DKKA 3IF5A 4EQIA 1L2SA 4U3TA 3TE8A 4GJ4A 1WYBA 2WGVA 1XKZA 5CRFA 5F68A 3QNCA 3JYIA 2JE5A 2OLUA 4RQ9A 3IHBA 4OPZA 4BBUA 4KZ7A 1W63Q 3ZCZA 4BWIA 4GD6A 3C30A 1YLPA 1CF0A 4JBFA 2WAEA 4Y7PA 2PR5A 3FKVA 4JPMA 1T1AA 5EM1A 2J80A 1S66L 3N4IA 3DAVA 5DFXA 1ONHA 4OH0A 5F6AA 4II7A 2ZC5B 5EVLA 2HGVA 2Y8HA 3QP1A 2VZWA 4IUHA 3QP8A 3C5AA 4Y15A 4S2MA 5TBMB 3T1RA 1Q2PA 5HW3A 2EA9A 4MBHA 5TFQA 1KE3A 3T4SA 4FOFA 1NYMA 5EM0A 1NRFA 1KOUA 1BLSA 2A3UA 2O0YA 1TS0A 3HREA 4PPRA 2P08A 3MJQA 3BFGA 4DKIA 4KQOA 3Q7VB 3T4TA 1OTIA 2WKQA 1ALQA 3H7WA 1W8QA 3IBRA 3CHWP 3BFEA 4L9GA 4RYEA 3R7WA 1TD5A 2H5SA 5L2FA 3HLEA 3FC7A 4QHCA 3KSHA 4OQHA 1W7FA 3ZG0A 1MPLA 1E3UA 1IOUA 3BM6A 1ES3A 1YT4A 1D1JA 2HDRA 2I72A 5DKLA 5LBRA 4BMWA 3RFBA 3T1QB 1XJ6A 2WKHA 3ZG9B 3WRZA 1HVBA 2VK3A 2Y2KA 3Q82A 1EI5A 1PWDA 4UAAA 4OQ0A 3GQZA 3PYPA 3QNBA 1IKGA 3HJKA 3AGEA 2YKFA 3WRTA 2EX6A 1K25A 2P74A 2C5WB 3PBTA 2CC1A 3NHQA 2XR0A 4IVKA 4EBPA 1D7EA 2VA0A 4LCLA 5TR7A 4O7DA 3E4PA 3UE6A 3M6BA 3T1XA 3KYZA 3LY3A 2HJEA 2VV6A 3HLDA 3MSHA 3JVVA 1SCWA 1XP4A 3S4XA 2ZMVA 3HUOA 1GSXA 4N92A 3NI9A 4P6ZS 3SS4A 4Y5FA 4DE0A 3CPTB 3G30A 3IT9A 5J4EA 4I3JA 4PM9A 5FATA 4EBLA 5HL6A 3VP2A 1QMFA 4HIAA 1BZAA 5F82A 2PT7A 2A2LA 2QZ6A 1STZA 5FSRA 3CZDA 3IX8A 1MXOA 1NYYA 3FPVA 4NXGA 4ESPA 3B42A 3GDIA 3VOYA 4R4RA 3ZDJA 1K55A 1JTDA 1M6KA 4K0XA 3KYQA 4GHIA 2IWBA 3SOIA 2B02A 1OTAA 3WS5A 3VFHA 4JF4A 3A3DA 3DTIA 3B3XA 5FQJA 3L9KA 1YLJA 3VV4A 5EVIA 3G6OA 4ZBEA 3IF6A 1BLPA 4S2KA 3UE0A 2PU2A 4E04A 3LEZA 3VE3A 4EBNA 4GNUA 3VFFA 5GLDA 2EXBA 2ZC4B 4JGQA 3BYDA 2Y2GA 4GDBA 4G3KA 4GKUA 4GOGA 1T1CA 4DE3A 3LIBA 5CXWA 3CG5A 2CMNA 4ZJ3A 1GCEA 1ZTUA 4ZTKA 1LSWA 1NXYA 1OTDA 2FH5A 2VEAA 4KQDA 2WZZA 3OZHA 4ID4A 4UQIS 2PU4A 1YMSA 3HCYA 4KQQA 4EETB 2HP6A 1G6AA 3MQ0A 4OPYA 1XX2A 1OJ5A
chains in the Genus database with same CATH topology
1CK3A 1NY0A 3O86A 1YLYA 3NDGA 4JF5A 1WE4A 5CGSA 4E3JA 3PBSA 2XDMA 1H8ZA 1SHVA 2Y2NA 3IH9A 1YMXA 1HTZA 3RJUA 1NJ4A 1G68A 5D3OA 1IYSA 2WGIA 3E2KA 3ZVTA 2V2FF 2ZC7A 3G4PA 3S22A 4KG6A 3GVBA 1S6RA 3MKEA 2ZC3B 1XA7A 5IHVA 2WGWB 5A91A 3ZG8B 5GLAA 4N9KA 3HLGA 1ES4A 5GHXA 4Y0OA 4OOLA 3O88A 4X68A 1PZOA 4X53A 2BLSA 1BTLA 4OQGA 3MZDA 3Q7ZA 2Y2QA 3TOIA 4UA9A 1K38A 4BENA 3TG9A 4OPQA 3MXRA 1W79A 3DW0A 5HFOA 2P9VB 4N9LA 5BOHA 5F1FA 2HDQA 1ES5A 1MWRA 4ZJ1A 1FCOA 5DF9A 4JKTA 4WELA 3UPPA 1L0FA 3WS2A 3UDFA 3AGFA 1NZOA 4CPKA 2FFFB 4WEKA 1SKFA 2XFTA 1YLWA 4E3IA 4E3OA 1WYCA 2J9OA 3TSGA 3G31A 1N4OA 5CTMA 1PW8A 5EUAA 1KVMA 3SH7A 4EUZA 3BECA 2OLVA 1K54A 4MEZA 3VP1A 4KZ6A 1CEFA 2JCHA 1ES2A 3ITBA 2XK1A 1ZG4A 4DF6A 5FQQA 3UE1A 1PYYA 1JWZA 3C7UA 1LL9A 3OCLA 1E3UD 3ZVWA 4MBKA 1I5QA 4X56A 5DTTA 4XUZA 4WEJA 1KE0A 1TDLA 5FQ9A 3UDXA 2R9XA 4GN2A 3W4QA 1FOFA 1JWVA 3E2LA 1H8YA 3NCKA 5EECA 5GL9A 4LV2A 2Y2JA 4ZDXA 2ZQ7A 2G2WA 5E2EA 2ZD8A 1KDWA 3UNWA 5FQKA 3ZGAB 1DY6A 3G35A 3OCNA 1PI5A 2OV5A 1FR6A 4N1XA 3IWQA 4KG2A 4OLGA 1ZG6A 1FSWA 3FZCA 4OOMA 3V3SA 2H0TA 3HL9A 3PTEA 4X6TA 2H10A 3NBLA 2QMIA 5DF7A 2J8YA 4JXVA 1HD8A 2Y2PA 3PBNA 4U0TA 3VP0A 3IQAA 1K57C 3IXBA 2EX9A 1E25A 1K6SA 2Z2LB 1I2WA 3M2KA 3MBZA 1DJCA 2J7VA 5HAPA 3IWOA 3BFFA 3HVFA 4E3LA 1BLCA 4QU3A 3G2YA 2RCXA 3FKWA 1GA0A 1CI9A 3OPLA 3GRJA 4E3KA 3UY6A 1K56A 2Y55A 4BLMA 5CEBA 4X55A 5CEDA 5HX9A 3WS1A 1K54C 4PM5A 3VMAA 5KZHA 2HDUA 2BG1A 2ZLYA 1O07A 5JYOA 2WKEA 1FCNA 1LLBA 2B5RA 1C3BA 4BL3A 3BFDA 4C6YA 3G2ZA 4WYYA 2HDSA 3VSLA 4FSFA 2Q9MA 5CHJA 2WGWA 5AQ9A 1PWCA 3NIAA 1SDEA 3MXSA 5CERA 3AGDA 1K6RA 3EQUA 1KGEA 3RXWA 5CHMA 4ZJ2A 3ZG5A 1LHYA 5U47A 1YLZA 4PM7A 3SS5A 4WMCD 5EVIC 4S2IA 1N9BA 2XF3A 2Y2HA 1O7EA 3BFCA 4P85A 3I7JA 1MWUA 4E3MA 2ZQAA 3IF6C 4R1GA 4MLLA 4WZ4A 1PWGA 2G2UA 2ZM0A 4F94A 4FH2A 1J9MA 4IVIA 4KZ4A 2ZJ9A 2VGKA 3UDIA 3LCEA 1EWZA 3IF5A 4R3BA 3BRMA 4DDSA 4S2NA 4DE2A 1K4EA 4EQIA 1L2SA 3G32A 4U3TA 5GHZA 3VP3A 1U60A 1WYBA 2WGVA 1IYPA 3WS4A 1ERMA 4OPRA 1XKZA 5CRFA 3N8LA 1H5XA 1HZOA 1S0WA 3QNCA 3JYIA 1BULA 2Y2MA 4C75A 2JE5A 3ITAA 2OLUA 1K4FA 3HLBA 4DXCA 1LI9A 3IHBA 4KZ5A 3LY4A 4OPZA 4B4XA 4KG5A 1NZUA 4KZ7A 1L0GA 3ZCZA 3UN7A 4YFMA 4GD6A 1YLPA 5CTNA 4BD1A 4JBFA 3M6HA 5CHUA 1JTGA 4OQIA 2WAEA 4E3NA 3IH8A 4LV3A 4Y7PA 4EWFA 3FKVA 5EOOA 3GV9A 4JPMA 1KGGA 4OONA 4OVDA 2HP5A 4JLFA 3RXXA 4GD8A 3V3RA 2IWCA 3HLCA 1MWSA 3N4IA 4FD8A 5EVID 4IBRA 1ONHA 4OH0A 5CECA 1GHPA 1FR1A 1RGYA 4EV4A 2WYXA 4S2OA 3V39A 1PZPA 2ZC5B 5EVLA 1BSGA 3N7WA 1W5DA 5KSHA 4C3QA 5AQBA 3C5AA 3MKFA 4S2MA 4IEDA 5FASA 3IHAA 1Q2PA 1DJAA 4OOYA 5HW3A 2XGNA 4MBHA 5AQ7A 2HP9A 5TFQA 1AXBA 1KE3A 3GR2A 1NYMA 1NRFA 1TEMA 1QMEA 3C4PA 1BLSA 5CGXA 2A3UA 5FDHA 5EOEA 3PAEA 1L0EA 4L0LA 1XGJA 3ZFZA 5KSCA 2DRWA 3HREA 4PPRA 1RGZA 3G34A 1TDGA 4R23A 2X01A 3BFGA 4DKIA 1IELA 4S2PA 4KQOA 3VSKA 3Q7VB 4JXSA 2H0YA 1ALQA 1W8QA 2EFUA 3NDEA 1K56D 3C4OA 3BFEA 4P6BA 1VQQA 4RX2A 4B4ZA 3BEBA 4RYEA 3VP4A 5FI2A 2XFSA 3M2JA 2H5SA 1ZC2A 4UHUA 5L2FA 4KZAA 3HLEA 5HAQA 4QHCA 4OQHA 1W7FA 3ZG0A 3C7VA 2Y91A 3N8SA 1MPLA 4ZAMA 1E3UA 3CJMA 4LV1A 3HUNA 5F1GA 3BM6A 1ES3A 4KENB 1JWPA 1BLHA 1ONGA 1YT4A 4P87A 3A3FA 2HDRA 2I72A 5GLBA 2WKHA 3O87A 5FAOA 2XLNA 2IWDA 3OC2A 3WRZA 3ZG9B 4BD0A 4D2OA 3UPOA 2WK0A 1HVBA 2Y2KA 4JF6A 3OPPA 2XD5A 3Q82A 1Q2QA 1EI5A 1FSYA 1PWDA 3FV7A 4HBUA 4OQ0A 1ERQA 3GQZA 3QNBA 4UAAA 5EVIB 3VOZA 1IKGA 3IF6B 1XXMA 1MWTA 3PBOA 5E2GA 2EX2A 3AGEA 3Q1FA 3WRTA 5FAQA 1GHIA 2EX6A 1K25A 2P74A 3MZFA 1XPBA 2C5WB 5AQAA 1PIOA 1RCJA 2CC1A 2EXAA 3IXHA 1L0DA 1MBLA 3PBTA 2XR0A 3HLWA 3ZG7B 1KE4A 2Q9NA 2WKIA 4PM6A 1ESIA 3NC8A 4IVKA 3WS0A 2WAFA 4EBPA 1MKIA 3V50A 5A93A 3MFDA 2P9VA 4Y0UA 1DJBA 4OKPA 4LCLA 3N8RA 5TR7A 4MBFA 4O7DA 3EQVA 5E2HA 4DE1A 2V20A 3M6BA 4LV0A 3LY3A 3DWZA 2ZMAA 2ZQCA 3UO9A 3HLDA 4KZBA 3IWIA 3OPHA 1YQSA 4WZ5A 2R9WA 2X71A 4GB7A 4OP5A 1SCWA 1XP4A 2UWXA 5FQMA 1FQGA 3SH9A 4BJPA 3LO7A 1Y54A 1KGFA 4XXRA 3P98A 3S4XA 3HUOA 4IBXA 4QY5A 1GHMA 1E4DA 4N92A 4DDYA 5A90A 3DTMA 3ZHHA 3IXDA 2ZM2A 3NI9A 4PMAA 3SS4A 4QD4A 3W8KA 2HPBA 4DE0A 3GMWA 4Z9QA 5A92A 3G30A 4KZ3A 3IT9A 5EE8A 4CJNA 4NK3A 4OP8A 4PM9A 4R0QA 5FATA 3PBRA 5E2FA 2VGJA 4K0WA 5DTSA 4EBLA 4Q8IA 5FAPA 2Y2IA 1EROA 2JC7A 4UA7A 4WMCA 3VP2A 4N1HA 3OPRA 1QMFA 4RVAA 5KMWA 1BZAA 5F82A 4YINA 4K91A 5GHYA 2WUQA 3PAGA 2QZ6A 3A3IA 1K57A 4MNRA 3UPNA 4JXWA 3HBRA 3GSGA 5FSRA 3MZEA 2XEPA 2Y2OA 3Q7VA 5DF8A 3ISGA 4KZ8A 4WBGA 3ZNYA 3CZDA 2OSUA 1MXOA 3D4FA 3NY4A 3S1YA 5JYPA 1KDSA 1SDNA 2XH9A 5EPHA 4WM9A 1NYYA 1ZKJA 3PBQA 1CEGA 1ESUA 5HL1A 2FFYA 4FCFA 3W4OA 1FCMA 5FA7A 5FI7A 3DWKA 1BUEA 2EFXA 4R4SA 3VOYA 3HLFA 3HUMA 4R4RA 1W8YA 1Z6FA 4S2NC 1OMEA 3ZDJA 1K55A 4H8RA 1JTDA 1IYOA 1M6KA 2X02A 5CGWA 4GDNA 3BLMA 4WZ5C 4K0XA 3V5MA 4Y0TA 3FYZA 2IWBA 4NETA 3SOIA 4B88A 2XQZA 3WS5A 3ZNTA 3BLSA 3A3JA 2ZC6B 4QJGA 5I94A 2Y59A 4JF4A 3A3DA 5DVAA 3VFHA 4DXBA 3UE3A 1TVFA 4U0XA 1XA1A 1RP5A 3B3XA 4HEFA 1IKIA 4GZBA 5FQJA 1YLJA 5EVIA 2C6WB 3FWLA 5M18A 2ZM8A 5FI6A 4ZBEA 3IF6A 4E6WA 1YLTA 2JBFA 1BLPA 2ZQ9A 3A3EA 3WWXA 4S2KA 2Z2MB 3CMZA 3SS3A 3UE0A 2PU2A 2E8IA 4LENA 4P0MA 5FQIA 1CI8A 1IEMA 3LEZA 4KQRA 4PM8A 1KVLA 4OLDA 4QB8A 4XUXA 5GLCA 4BQMA 4EBNA 4GNUA 1VM1A 2PBYA 2ZQDA 4UA6A 2EX8A 3VFFA 3N6IA 5G18A 5GLDA 1PI4A 2EXBA 2ZC4B 3O3VA 4M3KA 4RX3A 3Q81A 5M19A 1LI0A 2Y2LA 1GA9A 2ZQ8A 5M1AA 3BYDA 3W4PA 2Y2GA 5J8XA 4GDBA 4GKUA 4GOGA 4QY6A 2RL3A 1IYQA 1JVJA 4DE3A 5CXWA 1YM1A 2A49A 3CG5A 1BT5A 3IXGA 3QHYA 5DTKA 4BL2A 3SH8A 4ZJ3A 4S2JA 4FH4A 2WZXA 5HAIA 1LL5A 5TGFA 1MY8A 1GCEA 1XGIA 2QPNA 2J9PA 3Q07A 3GTCA 4HESA 4S2LA 4ZTKA 2DNSA 4E6XA 1NXYA 2DCFA 4RA7A 1K55C 2GDNA 4DRTA 4R3JA 2V1ZA 5E43A 5HARA 2WZZA 3OZHA 4ID4A 2PU4A 3P09A 1YMSA 2WADA 4LCMA 4JXGA 4KQQA 2XD1A 2Y4AA 2HP6A 1M40A 1G6AA 1PW1A 4X69A 4OPYA 1XX2A 4A5RA 4HBTA 5F83A 1I2SA 4KZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CK3 A;  1NY0 A;  3O86 A;  1YLY A;  3NDG A;  4JF5 A;  1WE4 A;  5CGS A;  4E3J A;  3PBS A;  2XDM A;  1H8Z A;  1SHV A;  2Y2N A;  3IH9 A;  1YMX A;  1HTZ A;  3RJU A;  1NJ4 A;  1G68 A;  5D3O A;  1IYS A;  2WGI A;  3E2K A;  3ZVT A;  2V2F F;  2ZC7 A;  3G4P A;  3S22 A;  4KG6 A;  3GVB A;  1S6R A;  3MKE A;  2ZC3 B;  1XA7 A;  5IHV A;  2WGW B;  5A91 A;  3ZG8 B;  5GLA A;  4N9K A;  3HLG A;  1ES4 A;  5GHX A;  4Y0O A;  4OOL A;  3O88 A;  4X68 A;  1PZO A;  4X53 A;  2BLS A;  1BTL A;  4OQG A;  3MZD A;  3Q7Z A;  2Y2Q A;  3TOI A;  4UA9 A;  1K38 A;  4BEN A;  3TG9 A;  4OPQ A;  3MXR A;  1W79 A;  3DW0 A;  5HFO A;  2P9V B;  4N9L A;  5BOH A;  5F1F A;  2HDQ A;  1ES5 A;  1MWR A;  4ZJ1 A;  1FCO A;  5DF9 A;  4JKT A;  4WEL A;  3UPP A;  1L0F A;  3WS2 A;  3UDF A;  3AGF A;  1NZO A;  4CPK A;  2FFF B;  4WEK A;  1SKF A;  2XFT A;  1YLW A;  4E3I A;  4E3O A;  1WYC A;  2J9O A;  3TSG A;  3G31 A;  1N4O A;  5CTM A;  1PW8 A;  5EUA A;  1KVM A;  3SH7 A;  4EUZ A;  3BEC A;  2OLV A;  1K54 A;  4MEZ A;  3VP1 A;  4KZ6 A;  1CEF A;  2JCH A;  1ES2 A;  3ITB A;  2XK1 A;  1ZG4 A;  4DF6 A;  5FQQ A;  3UE1 A;  1PYY A;  1JWZ A;  3C7U A;  1LL9 A;  3OCL A;  1E3U D;  3ZVW A;  4MBK A;  1I5Q A;  4X56 A;  5DTT A;  4XUZ A;  4WEJ A;  1KE0 A;  1TDL A;  5FQ9 A;  3UDX A;  2R9X A;  4GN2 A;  3W4Q A;  1FOF A;  1JWV A;  3E2L A;  1H8Y A;  3NCK A;  5EEC A;  5GL9 A;  4LV2 A;  2Y2J A;  4ZDX A;  2ZQ7 A;  2G2W A;  5E2E A;  2ZD8 A;  1KDW A;  3UNW A;  5FQK A;  3ZGA B;  1DY6 A;  3G35 A;  3OCN A;  1PI5 A;  2OV5 A;  1FR6 A;  4N1X A;  3IWQ A;  4KG2 A;  4OLG A;  1ZG6 A;  1FSW A;  3FZC A;  4OOM A;  3V3S A;  2H0T A;  3HL9 A;  3PTE A;  4X6T A;  2H10 A;  3NBL A;  2QMI A;  5DF7 A;  2J8Y A;  4JXV A;  1HD8 A;  2Y2P A;  3PBN A;  4U0T A;  3VP0 A;  3IQA A;  1K57 C;  3IXB A;  2EX9 A;  1E25 A;  1K6S A;  2Z2L B;  1I2W A;  3M2K A;  3MBZ A;  1DJC A;  2J7V A;  5HAP A;  3IWO A;  3BFF A;  3HVF A;  4E3L A;  1BLC A;  4QU3 A;  3G2Y A;  2RCX A;  3FKW A;  1GA0 A;  1CI9 A;  3OPL A;  3GRJ A;  4E3K A;  3UY6 A;  1K56 A;  2Y55 A;  4BLM A;  5CEB A;  4X55 A;  5CED A;  5HX9 A;  3WS1 A;  1K54 C;  4PM5 A;  3VMA A;  5KZH A;  2HDU A;  2BG1 A;  2ZLY A;  1O07 A;  5JYO A;  2WKE A;  1FCN A;  1LLB A;  2B5R A;  1C3B A;  4BL3 A;  3BFD A;  4C6Y A;  3G2Z A;  4WYY A;  2HDS A;  3VSL A;  4FSF A;  2Q9M A;  5CHJ A;  2WGW A;  5AQ9 A;  1PWC A;  3NIA A;  1SDE A;  3MXS A;  5CER A;  3AGD A;  1K6R A;  3EQU A;  1KGE A;  3RXW A;  5CHM A;  4ZJ2 A;  3ZG5 A;  1LHY A;  5U47 A;  1YLZ A;  4PM7 A;  3SS5 A;  4WMC D;  5EVI C;  4S2I A;  1N9B A;  2XF3 A;  2Y2H A;  1O7E A;  3BFC A;  4P85 A;  3I7J A;  1MWU A;  4E3M A;  2ZQA A;  3IF6 C;  4R1G A;  4MLL A;  4WZ4 A;  1PWG A;  2G2U A;  2ZM0 A;  4F94 A;  4FH2 A;  1J9M A;  4IVI A;  4KZ4 A;  2ZJ9 A;  2VGK A;  3UDI A;  3LCE A;  1EWZ A;  3IF5 A;  4R3B A;  3BRM A;  4DDS A;  4S2N A;  4DE2 A;  1K4E A;  4EQI A;  1L2S A;  3G32 A;  4U3T A;  5GHZ A;  3VP3 A;  1U60 A;  1WYB A;  2WGV A;  1IYP A;  3WS4 A;  1ERM A;  4OPR A;  1XKZ A;  5CRF A;  3N8L A;  1H5X A;  1HZO A;  1S0W A;  3QNC A;  3JYI A;  1BUL A;  2Y2M A;  4C75 A;  2JE5 A;  3ITA A;  2OLU A;  1K4F A;  3HLB A;  4DXC A;  1LI9 A;  3IHB A;  4KZ5 A;  3LY4 A;  4OPZ A;  4B4X A;  4KG5 A;  1NZU A;  4KZ7 A;  1L0G A;  3ZCZ A;  3UN7 A;  4YFM A;  4GD6 A;  1YLP A;  5CTN A;  4BD1 A;  4JBF A;  3M6H A;  5CHU A;  1JTG A;  4OQI A;  2WAE A;  4E3N A;  3IH8 A;  4LV3 A;  4Y7P A;  4EWF A;  3FKV A;  5EOO A;  3GV9 A;  4JPM A;  1KGG A;  4OON A;  4OVD A;  2HP5 A;  4JLF A;  3RXX A;  4GD8 A;  3V3R A;  2IWC A;  3HLC A;  1MWS A;  3N4I A;  4FD8 A;  5EVI D;  4IBR A;  1ONH A;  4OH0 A;  5CEC A;  1GHP A;  1FR1 A;  1RGY A;  4EV4 A;  2WYX A;  4S2O A;  3V39 A;  1PZP A;  2ZC5 B;  5EVL A;  1BSG A;  3N7W A;  1W5D A;  5KSH A;  4C3Q A;  5AQB A;  3C5A A;  3MKF A;  4S2M A;  4IED A;  5FAS A;  3IHA A;  1Q2P A;  1DJA A;  4OOY A;  5HW3 A;  2XGN A;  4MBH A;  5AQ7 A;  2HP9 A;  5TFQ A;  1AXB A;  1KE3 A;  3GR2 A;  1NYM A;  1NRF A;  1TEM A;  1QME A;  3C4P A;  1BLS A;  5CGX A;  2A3U A;  5FDH A;  5EOE A;  3PAE A;  1L0E A;  4L0L A;  1XGJ A;  3ZFZ A;  5KSC A;  2DRW A;  3HRE A;  4PPR A;  1RGZ A;  3G34 A;  1TDG A;  4R23 A;  2X01 A;  3BFG A;  4DKI A;  1IEL A;  4S2P A;  4KQO A;  3VSK A;  3Q7V B;  4JXS A;  2H0Y A;  1ALQ A;  1W8Q A;  2EFU A;  3NDE A;  1K56 D;  3C4O A;  3BFE A;  4P6B A;  1VQQ A;  4RX2 A;  4B4Z A;  3BEB A;  4RYE A;  3VP4 A;  5FI2 A;  2XFS A;  3M2J A;  2H5S A;  1ZC2 A;  4UHU A;  5L2F A;  4KZA A;  3HLE A;  5HAQ A;  4QHC A;  4OQH A;  1W7F A;  3ZG0 A;  3C7V A;  2Y91 A;  3N8S A;  1MPL A;  4ZAM A;  1E3U A;  3CJM A;  4LV1 A;  3HUN A;  5F1G A;  3BM6 A;  1ES3 A;  4KEN B;  1JWP A;  1BLH A;  1ONG A;  1YT4 A;  4P87 A;  3A3F A;  2HDR A;  2I72 A;  5GLB A;  2WKH A;  3O87 A;  5FAO A;  2XLN A;  2IWD A;  3OC2 A;  3WRZ A;  3ZG9 B;  4BD0 A;  4D2O A;  3UPO A;  2WK0 A;  1HVB A;  2Y2K A;  4JF6 A;  3OPP A;  2XD5 A;  3Q82 A;  1Q2Q A;  1EI5 A;  1FSY A;  1PWD A;  3FV7 A;  4HBU A;  4OQ0 A;  1ERQ A;  3GQZ A;  3QNB A;  4UAA A;  5EVI B;  3VOZ A;  1IKG A;  3IF6 B;  1XXM A;  1MWT A;  3PBO A;  5E2G A;  2EX2 A;  3AGE A;  3Q1F A;  3WRT A;  5FAQ A;  1GHI A;  2EX6 A;  1K25 A;  2P74 A;  3MZF A;  1XPB A;  2C5W B;  5AQA A;  1PIO A;  1RCJ A;  2CC1 A;  2EXA A;  3IXH A;  1L0D A;  1MBL A;  3PBT A;  2XR0 A;  3HLW A;  3ZG7 B;  1KE4 A;  2Q9N A;  2WKI A;  4PM6 A;  1ESI A;  3NC8 A;  4IVK A;  3WS0 A;  2WAF A;  4EBP A;  1MKI A;  3V50 A;  5A93 A;  3MFD A;  2P9V A;  4Y0U A;  1DJB A;  4OKP A;  4LCL A;  3N8R A;  5TR7 A;  4MBF A;  4O7D A;  3EQV A;  5E2H A;  4DE1 A;  2V20 A;  3M6B A;  4LV0 A;  3LY3 A;  3DWZ A;  2ZMA A;  2ZQC A;  3UO9 A;  3HLD A;  4KZB A;  3IWI A;  3OPH A;  1YQS A;  4WZ5 A;  2R9W A;  2X71 A;  4GB7 A;  4OP5 A;  1SCW A;  1XP4 A;  2UWX A;  5FQM A;  1FQG A;  3SH9 A;  4BJP A;  3LO7 A;  1Y54 A;  1KGF A;  4XXR A;  3P98 A;  3S4X A;  3HUO A;  4IBX A;  4QY5 A;  1GHM A;  1E4D A;  4N92 A;  4DDY A;  5A90 A;  3DTM A;  3ZHH A;  3IXD A;  2ZM2 A;  3NI9 A;  4PMA A;  3SS4 A;  4QD4 A;  3W8K A;  2HPB A;  4DE0 A;  3GMW A;  4Z9Q A;  5A92 A;  3G30 A;  4KZ3 A;  3IT9 A;  5EE8 A;  4CJN A;  4NK3 A;  4OP8 A;  4PM9 A;  4R0Q A;  5FAT A;  3PBR A;  5E2F A;  2VGJ A;  4K0W A;  5DTS A;  4EBL A;  4Q8I A;  5FAP A;  2Y2I A;  1ERO A;  2JC7 A;  4UA7 A;  4WMC A;  3VP2 A;  4N1H A;  3OPR A;  1QMF A;  4RVA A;  5KMW A;  1BZA A;  5F82 A;  4YIN A;  4K91 A;  5GHY A;  2WUQ A;  3PAG A;  2QZ6 A;  3A3I A;  1K57 A;  4MNR A;  3UPN A;  4JXW A;  3HBR A;  3GSG A;  5FSR A;  3MZE A;  2XEP A;  2Y2O A;  3Q7V A;  5DF8 A;  3ISG A;  4KZ8 A;  4WBG A;  3ZNY A;  3CZD A;  2OSU A;  1MXO A;  3D4F A;  3NY4 A;  3S1Y A;  5JYP A;  1KDS A;  1SDN A;  2XH9 A;  5EPH A;  4WM9 A;  1NYY A;  1ZKJ A;  3PBQ A;  1CEG A;  1ESU A;  5HL1 A;  2FFY A;  4FCF A;  3W4O A;  1FCM A;  5FA7 A;  5FI7 A;  3DWK A;  1BUE A;  2EFX A;  4R4S A;  3VOY A;  3HLF A;  3HUM A;  4R4R A;  1W8Y A;  1Z6F A;  4S2N C;  1OME A;  3ZDJ A;  1K55 A;  4H8R A;  1JTD A;  1IYO A;  1M6K A;  2X02 A;  5CGW A;  4GDN A;  3BLM A;  4WZ5 C;  4K0X A;  3V5M A;  4Y0T A;  3FYZ A;  2IWB A;  4NET A;  3SOI A;  4B88 A;  2XQZ A;  3WS5 A;  3ZNT A;  3BLS A;  3A3J A;  2ZC6 B;  4QJG A;  5I94 A;  2Y59 A;  4JF4 A;  3A3D A;  5DVA A;  3VFH A;  4DXB A;  3UE3 A;  1TVF A;  4U0X A;  1XA1 A;  1RP5 A;  3B3X A;  4HEF A;  1IKI A;  4GZB A;  5FQJ A;  1YLJ A;  5EVI A;  2C6W B;  3FWL A;  5M18 A;  2ZM8 A;  5FI6 A;  4ZBE A;  3IF6 A;  4E6W A;  1YLT A;  2JBF A;  1BLP A;  2ZQ9 A;  3A3E A;  3WWX A;  4S2K A;  2Z2M B;  3CMZ A;  3SS3 A;  3UE0 A;  2PU2 A;  2E8I A;  4LEN A;  4P0M A;  5FQI A;  1CI8 A;  1IEM A;  3LEZ A;  4KQR A;  4PM8 A;  1KVL A;  4OLD A;  4QB8 A;  4XUX A;  5GLC A;  4BQM A;  4EBN A;  4GNU A;  1VM1 A;  2PBY A;  2ZQD A;  4UA6 A;  2EX8 A;  3VFF A;  3N6I A;  5G18 A;  5GLD A;  1PI4 A;  2EXB A;  2ZC4 B;  3O3V A;  4M3K A;  4RX3 A;  3Q81 A;  5M19 A;  1LI0 A;  2Y2L A;  1GA9 A;  2ZQ8 A;  5M1A A;  3BYD A;  3W4P A;  2Y2G A;  5J8X A;  4GDB A;  4GKU A;  4GOG A;  4QY6 A;  2RL3 A;  1IYQ A;  1JVJ A;  4DE3 A;  5CXW A;  1YM1 A;  2A49 A;  3CG5 A;  1BT5 A;  3IXG A;  3QHY A;  5DTK A;  4BL2 A;  3SH8 A;  4ZJ3 A;  4S2J A;  4FH4 A;  2WZX A;  5HAI A;  1LL5 A;  5TGF A;  1MY8 A;  1GCE A;  1XGI A;  2QPN A;  2J9P A;  3Q07 A;  3GTC A;  4HES A;  4S2L A;  4ZTK A;  2DNS A;  4E6X A;  1NXY A;  2DCF A;  4RA7 A;  1K55 C;  2GDN A;  4DRT A;  4R3J A;  2V1Z A;  5E43 A;  5HAR A;  2WZZ A;  3OZH A;  4ID4 A;  2PU4 A;  3P09 A;  1YMS A;  2WAD A;  4LCM A;  4JXG A;  4KQQ A;  2XD1 A;  2Y4A A;  2HP6 A;  1M40 A;  1G6A A;  1PW1 A;  4X69 A;  4OPY A;  1XX2 A;  4A5R A;  4HBT A;  5F83 A;  1I2S A;  4KZ9 A; 
#chains in the Genus database with same CATH topology
 1NY0 A;  4XT2 B;  2DMW A;  2V9A A;  3MR0 A;  4E3J A;  2XDM A;  1SHV A;  1HTZ A;  1G68 A;  3E2K A;  1Y4O A;  3S22 A;  3GVB A;  4N9K A;  5GHX A;  4OOL A;  1PZO A;  2OAP 1;  4X53 A;  2Z6D A;  3MZD A;  2NUP C;  2W3D A;  4IUK A;  3TOI A;  4OPQ A;  2A24 B;  5HFO A;  4O8G A;  4Q0J A;  2P9V B;  4N9L A;  5BOH A;  4HJ4 A;  4WEL A;  3UDF A;  1NZO A;  2FFF B;  4WEK A;  2YKH A;  4Y17 A;  1WYC A;  2KX6 A;  5CTM A;  4EUZ A;  3BEC A;  1K54 A;  1YSQ A;  3VP1 A;  2E8J A;  1OPX A;  4GCZ A;  5FQQ A;  1PYY A;  3UDX A;  2R9X A;  4GN2 A;  3W4Q A;  1H8Y A;  3NCK A;  3UB8 A;  1PRQ A;  2KDK A;  3SZT A;  2ZD8 A;  3F1O A;  2OV5 A;  1FSW A;  1F9I A;  4OOM A;  2ZOI A;  3PTE A;  2Z6C A;  2QMI A;  2J8Y A;  4JXV A;  1HD8 A;  3LI8 A;  3E4O A;  3VP0 A;  3JPU A;  1XJ2 A;  1UWP X;  1N9O A;  4WF0 A;  1K6S A;  2Z2L B;  3UME A;  2M7V A;  3IWO A;  4PKY G;  4I5S A;  4E3L A;  5G4Y A;  4HY8 A;  1CI9 A;  4E3K A;  4KUK A;  1OT6 A;  2Y55 A;  3NOP C;  5CEB A;  3NOU C;  3WS1 A;  2Q0O A;  2BG1 A;  2WKE A;  1C3B A;  3R7W B;  4EES A;  4WYY A;  2HDS A;  4FSF A;  1MC0 A;  1PWC A;  1SDE A;  4DN0 A;  1KGE A;  3RXW A;  4ZJ2 A;  3P7N A;  2XA7 S;  1K0K A;  3SS5 A;  1N9B A;  2Y2H A;  3I7J A;  4E3M A;  1PWG A;  3F1N A;  1P9W A;  3VE4 A;  3E4Q A;  4IVI A;  3H82 A;  2O9C A;  3UDI A;  3A0R A;  1EWZ A;  4H6J B;  4R3B A;  2W3F A;  4S2N A;  4DE2 A;  3TW8 A;  1K4E A;  3VP3 A;  1IYP A;  2QWS A;  4OPR A;  5TJJ A;  3N8L A;  1HZO A;  3U2A A;  1BUL A;  4C75 A;  1LT0 A;  2FZ0 A;  4DXC A;  4KZ5 A;  2AVX A;  1JTG A;  5J3W A;  4E3N A;  2H28 A;  1P0Z A;  1KGG A;  2K7S A;  4OVD A;  2HP5 A;  3D3O A;  4JLF A;  3V3R A;  3HLC A;  1MWS A;  4FD8 A;  4NG2 A;  4EU0 A;  4FUW A;  5CEC A;  1N9N A;  1GHP A;  2Y79 A;  2WYX A;  2QJ7 A;  2OOL A;  3S7P A;  1BSG A;  3CI6 A;  3N7W A;  5KSH A;  3MKF A;  4IED A;  5FAS A;  4BBV A;  5AQ7 A;  1AXB A;  2VX8 A;  3NEC A;  3GR2 A;  1TEM A;  3C4P A;  1QME A;  4MN6 A;  1X0O A;  5EOE A;  3ZFZ A;  3G34 A;  2H0Y A;  3E0Y A;  1VQQ A;  1AWI A;  4B4Z A;  3H9W A;  3BEB A;  2VKS A;  3VP4 A;  4KZA A;  3C7V A;  4ZAM A;  1MKM A;  4KEN B;  1BLH A;  1FIL A;  3A3F A;  4ARZ A;  3CLO A;  3UPO A;  2XLN A;  4D2O A;  1S67 L;  4ME4 A;  4YWZ A;  5EVI B;  5HWW A;  3UB9 A;  3NUL A;  3B47 A;  4HI4 A;  3IF6 B;  2EX2 A;  4MDZ A;  4GS9 A;  3ULF A;  5AQA A;  1XPB A;  3IXH A;  2EXA A;  3LEQ A;  4HOI A;  3CIT A;  1MBL A;  2VGL S;  1F98 A;  4PM6 A;  3WS0 A;  1MKI A;  3V50 A;  2A24 A;  3MFD A;  3DTK A;  5FDS A;  2P9V A;  2V20 A;  4LV0 A;  1NRJ A;  3BY9 A;  2ZMA A;  2ZQC A;  3IWI A;  2R9W A;  2X71 A;  4OP5 A;  3C8C A;  1Y54 A;  2M1C A;  2NUT C;  2OWH A;  4QY5 A;  4QD4 A;  3GMW A;  3LFV A;  3LIC A;  3U4L P;  5AJG A;  3K3C A;  2Y2I A;  4UA7 A;  4WMC A;  2LB5 A;  4N1H A;  3OPR A;  1SKO A;  5FL3 A;  5KMW A;  2D01 A;  5GHY A;  2WUQ A;  3A3I A;  4MNR A;  3OLO A;  2XEP A;  2V0W A;  5DF8 A;  4KZ8 A;  3ZNY A;  1VET A;  2OSU A;  3D4F A;  1SDN A;  2XH9 A;  4HJ3 A;  4HP9 A;  1CEG A;  4DJ2 A;  2L4R A;  3TJZ C;  5FI7 A;  3EGD C;  3HLF A;  1W8Y A;  3DTE A;  2LB9 A;  3IX3 A;  3TRC A;  1IYO A;  4P6Z M;  3V5M A;  4Y0T A;  3FYZ A;  2W0N A;  3UB6 A;  4F3L A;  3A3J A;  3LYX A;  5HWV A;  3PHY A;  1XA1 A;  1RP5 A;  3T12 B;  3HJI A;  5FI6 A;  2Z2M B;  3CMZ A;  4P0M A;  5L8M A;  2PBY A;  2EX8 A;  2JKG A;  3O3V A;  3Q81 A;  2ZQ8 A;  5M1A A;  5J8X A;  4CLC C;  2RL3 A;  4H6J A;  2XSS A;  5DTK A;  4BL2 A;  1CQA A;  3F1O B;  4FH4 A;  2WZX A;  5HAI A;  3P01 A;  1MY8 A;  2QPN A;  2J9P A;  3Q07 A;  4S2L A;  1K55 C;  4R3J A;  5HAR A;  5F5Y A;  3P09 A;  4JXG A;  2Y4A A;  1M40 A;  3K2N A;  4WLA A;  1YLY A;  4B9O A;  1H8Z A;  3RJU A;  2OAQ 1;  1NJ4 A;  5D3O A;  2WGI A;  2ZC7 A;  4PHT A;  3G4P A;  4KG6 A;  1S6R A;  4CLC D;  2WKP A;  5J7E A;  4WUJ A;  4WN5 A;  3MXQ A;  4X68 A;  3T1S A;  2BLS A;  1BTL A;  3Q7Z A;  2Y2Q A;  4BEN A;  4UA9 A;  1K38 A;  3EWK A;  3TG9 A;  4EEU A;  1W79 A;  3F1N B;  2HDQ A;  3H82 B;  1ES5 A;  4UQI M;  5DF9 A;  2EWW A;  3UPP A;  4NXE A;  3WS2 A;  1DP6 A;  4X25 A;  4CPK A;  4YOF A;  5HD5 A;  1YLW A;  4E3O A;  2W27 A;  2JKR I;  4MEZ A;  4KZ6 A;  2JKF A;  2JCH A;  3UMD A;  4O01 A;  3ITB A;  3RTY A;  2UV0 E;  4DF6 A;  3C7U A;  1NLZ A;  3ZVW A;  1I5Q A;  4XUZ A;  3E2L A;  3ZYT A;  4I38 A;  3NOT C;  1H3Q A;  1HLU P;  1KDW A;  3UNW A;  3ZGA B;  5DJT A;  3G35 A;  3OCN A;  1OJG A;  4HQA A;  4N1X A;  4KG2 A;  1S4S A;  3FZC A;  2H0T A;  3HL9 A;  3NBL A;  2Y2P A;  1K57 C;  2EX9 A;  2QYB A;  1I2W A;  3MBZ A;  1DJC A;  1XFN A;  1BLC A;  3DBA A;  3S7Q A;  4WL9 A;  3UY6 A;  1K56 A;  4BLM A;  2ZL1 A;  3A0S A;  4X55 A;  4IHQ A;  5CED A;  1K54 C;  2JN7 A;  2HDU A;  1O07 A;  3F1P A;  1G5U A;  4NEE D;  2W3E A;  3BFD A;  4C6Y A;  2Q9M A;  1D06 A;  1P97 A;  3MXS A;  1GSW A;  3LIA A;  5HDS A;  3EQU A;  4I3A A;  5U47 A;  3MQQ A;  2XF3 A;  3BFC A;  1O7E A;  4ARZ B;  1MWU A;  2ZQA A;  4R1G A;  1N9L A;  4WZ4 A;  2G2U A;  2ZM0 A;  3LR3 A;  2QJ5 A;  2ZJ9 A;  2VGK A;  1LSV A;  4DDS A;  3G32 A;  5GHZ A;  4GS9 B;  1U60 A;  4Z1W A;  4ETX A;  3WS4 A;  1ERM A;  1H5X A;  3MQO A;  2Y2M A;  4BBT A;  5EV0 A;  1K4F A;  3HLB A;  1LI9 A;  3MF0 A;  1OTE A;  1NZU A;  1L0G A;  1LSX A;  5CTN A;  4BD1 A;  3M6H A;  4OQI A;  5F69 A;  3IH8 A;  4EWF A;  1F5M A;  5EOO A;  3GV9 A;  4IJG A;  2XA7 M;  4OON A;  3KYE A;  2GJ3 A;  4GD8 A;  2IWC A;  1RGY A;  1PZP A;  2W3H A;  2P7J A;  4C3Q A;  3CAX A;  1WA9 A;  1DJA A;  4OOY A;  1SKO B;  2ZBB A;  1G6O A;  5CGX A;  5FDH A;  1L0E A;  5KSC A;  2DRW A;  2WKR A;  1TDG A;  3EEH A;  3L7H A;  4GLQ A;  1IEL A;  1DP9 A;  4LRZ E;  3VSK A;  4R70 A;  1VET B;  2EFU A;  3NDE A;  4RX2 A;  4P6B A;  1SZV A;  3M2J A;  3E98 A;  1ZC2 A;  5HAQ A;  2L0W A;  5DJU A;  4HNB A;  3N8S A;  2HZ5 A;  3CJM A;  4MN5 A;  5AVF A;  1ODV A;  4KUO A;  4P87 A;  4F3L B;  2VV7 A;  5GLB A;  3O87 A;  5FAO A;  4BD0 A;  2WK0 A;  4JF6 A;  2XD5 A;  1Q2Q A;  4LPZ A;  3FV7 A;  4HBU A;  1ERQ A;  1XXM A;  4CLC E;  4I39 A;  3PBO A;  2J3W A;  5FAQ A;  2ACG A;  4YNR A;  2PYR A;  2VLG A;  3MZF A;  1L0D A;  3ZG7 B;  3CUE C;  2Q9N A;  2WKI A;  1ESI A;  3T50 A;  3RH8 B;  2JKR M;  5A93 A;  2P04 A;  1DJB A;  4X1L A;  1DP8 A;  1XJ3 A;  4I3I A;  4DE1 A;  2VV8 A;  3DWZ A;  3UO9 A;  3K3D A;  4KZB A;  3OPH A;  1YQS A;  4WZ5 A;  5FQM A;  2UWX A;  1FQG A;  3SH9 A;  4XXR A;  4IBX A;  3KSF A;  3LUQ A;  3QP6 A;  1E4D A;  3DTM A;  3ZHH A;  1P9R A;  2ZM2 A;  4KZ3 A;  5EE8 A;  4OP8 A;  2VGJ A;  4K0W A;  4Q8I A;  5FAP A;  1ERO A;  2VGL M;  3LGO A;  4YIN A;  3UPN A;  2K31 A;  4Y2F A;  2Y2O A;  3ISG A;  4NKP A;  3ICY A;  3NY4 A;  1ESU A;  5HL1 A;  4FCF A;  3W4O A;  1FCM A;  3DWK A;  2EFX A;  4R4S A;  3HUM A;  1OME A;  1GSV A;  2X02 A;  3FPW A;  4GDN A;  1TF1 A;  4B88 A;  2PAV P;  3BLS A;  2ZC6 B;  2PBD P;  5DVA A;  2ZOH A;  3PXP A;  1TVF A;  3S7O A;  2OWJ A;  4HEF A;  2QKP A;  1IKI A;  4GZB A;  4ETZ A;  2C6W B;  4UEY A;  4M4X A;  1YLT A;  2JBF A;  3WWX A;  3SS3 A;  2E8I A;  4LEN A;  1CI8 A;  1IEM A;  3LIE A;  4PM8 A;  5GLC A;  4XUX A;  4BQM A;  4HP4 A;  2ZQD A;  4UA6 A;  3N6I A;  5G18 A;  1NLY A;  4MCW A;  2Y2L A;  4QY6 A;  1IYQ A;  2VJW A;  1YSP A;  3IXG A;  4Q0I A;  4R6L A;  3SH8 A;  4S2J A;  5HDC A;  3D9Y A;  5TGF A;  4HH2 A;  4Y13 A;  1ACF A;  2M7U A;  1XGI A;  3GTC A;  2EWV A;  4HES A;  2W1R A;  2GNX A;  4DRT A;  2V1Z A;  4JGR A;  4QPR A;  4LCM A;  3UB7 A;  2WAD A;  2B18 A;  2XD1 A;  1VEU B;  4DJ3 A;  3MS6 A;  3T4Q A;  5F83 A;  4O0P A;  4KZ9 A;  5IT5 A;  3O86 A;  2ZL1 B;  4JF5 A;  1T18 A;  4EEP A;  2Y2N A;  2PHY A;  4MN7 A;  4EXO A;  3F1P B;  3ZVT A;  2V2F F;  3GEC A;  2O9B A;  3ZG8 B;  1XA7 A;  5A91 A;  5GLA A;  1ES4 A;  3EEA A;  4PAU A;  2L1M A;  4OQG A;  2JKT I;  3SW1 A;  1Y28 A;  2G7U A;  2PR6 A;  5F1F A;  3ZQ5 A;  4ZJ1 A;  1FCO A;  1S1Y A;  1SKF A;  4E3I A;  1V9Z A;  1TS6 A;  3NJA A;  3G31 A;  1N4O A;  2B95 A;  3S7N A;  1CEF A;  1ES2 A;  2XRO A;  2XK1 A;  1ZG4 A;  1H8M A;  3UE1 A;  1JWZ A;  2K2N A;  3OCL A;  1E3U D;  4MBK A;  4X56 A;  3T4O A;  3KX0 X;  3LIF A;  2GX5 A;  4WEJ A;  2KLI A;  5FQ9 A;  1JWV A;  5EEC A;  5GL9 A;  1S4R A;  4LV2 A;  2Y2J A;  4ZDX A;  2ZQ7 A;  2G2W A;  5FQK A;  1PI5 A;  2XRN A;  1FR6 A;  3IWQ A;  4OLG A;  2V0U A;  5CX7 A;  1H0M A;  3V3S A;  2H10 A;  1TS7 A;  3PBN A;  4U0T A;  1G28 A;  4L9F A;  4LFU A;  5HZH A;  1CJF A;  3M2K A;  5HAP A;  3BFF A;  3HVF A;  2RCX A;  3IS2 B;  3OPL A;  3LI9 A;  3QP2 A;  3CWF A;  3OOV A;  1BYW A;  1XJ4 A;  5HX9 A;  4PM5 A;  3VMA A;  5KZH A;  2ZLY A;  3C2W A;  1FCN A;  3G2Z A;  4NXB A;  3VSL A;  5CHJ A;  2WGW A;  5AQ9 A;  3NIA A;  5CER A;  3AGD A;  3MMH A;  5CHM A;  3ZG5 A;  1LHY A;  2PRF A;  4EQ1 A;  1YPR A;  4PM7 A;  5EVI C;  4S2I A;  1PNE A;  4HJ6 A;  4P85 A;  3IF6 C;  4MLL A;  2V8F A;  4PKY A;  4FH2 A;  1J9M A;  4KZ4 A;  3LCE A;  3BRM A;  3IBJ A;  4L9E A;  4EUV A;  3JVU A;  1S0W A;  1F2K A;  4ZRR A;  4NXF A;  3ITA A;  3BQA A;  1OTB A;  3LY4 A;  4B4X A;  4KG5 A;  3UN7 A;  4YFM A;  5CHU A;  4LLO B;  1T19 A;  1YKD A;  4LV3 A;  3QP5 A;  2J3T C;  3RXX A;  5EVI D;  4LGW A;  4IBR A;  4CLC A;  3LR5 A;  1FR1 A;  4EV4 A;  4S2O A;  3V39 A;  2GZA A;  3QP4 A;  1W5D A;  5AQB A;  4G3W A;  3IHA A;  2XGN A;  2HJ9 C;  2HP9 A;  3OBF A;  3MFX A;  3KSG A;  3PAE A;  4L0L A;  1XGJ A;  1RGZ A;  3B33 A;  4R23 A;  2X01 A;  3BY8 A;  4S2P A;  4JXS A;  5EFW A;  1K56 D;  3C4O A;  3UB5 P;  1A0K A;  5FI2 A;  2XFS A;  1T1B A;  1PFL A;  4UHU A;  1YAX A;  1VEU A;  2J3T D;  2Y91 A;  4LV1 A;  3HUN A;  5F1G A;  5HD3 A;  1JWP A;  1ONG A;  3T4K A;  1MZU A;  5AVE A;  2IWD A;  3OC2 A;  2W1T A;  3OPP A;  5L09 A;  2JKT M;  1FSY A;  4HH3 A;  5A92 A;  3VOZ A;  1MWT A;  5E2G A;  3Q1F A;  1GHI A;  3BWL A;  3KO6 A;  1PIO A;  1RCJ A;  2PYP A;  3HLW A;  1KE4 A;  4Y3I A;  3NC8 A;  3LID A;  1FIK A;  2WAF A;  3V67 A;  4Y0U A;  4OKP A;  3N8R A;  4MBF A;  3EQV A;  1IFQ A;  5E2H A;  1S1Z A;  4GB7 A;  3R4K A;  5KIZ A;  4MMN A;  4BJP A;  3LO7 A;  1KGF A;  3P98 A;  4B93 A;  4GW9 A;  5IS1 A;  1GHM A;  4DDY A;  5A90 A;  3IXD A;  4PMA A;  3W8K A;  2HPB A;  4Z9Q A;  1NWZ A;  4CJN A;  4NK3 A;  2PD8 A;  1TS8 A;  1OT9 A;  2I9V A;  4R0Q A;  3PBR A;  5E2F A;  5DTS A;  5TBM A;  2JC7 A;  4RVA A;  4K91 A;  5FEG A;  3EOI A;  3PAG A;  1K57 A;  4JXW A;  3HBR A;  3GSG A;  4K08 A;  3MZE A;  3Q7V A;  5MC7 A;  4WBG A;  4JGP A;  4Q0H A;  3S1Y A;  5JYP A;  1KDS A;  5EPH A;  4WM9 A;  1W63 M;  3BJN A;  1ZKJ A;  3D72 A;  3PBQ A;  1VB6 A;  2FFY A;  5FA7 A;  1BUE A;  3LR4 A;  4S2N C;  1Z6F A;  3IS2 A;  4H8R A;  2JHE A;  4EW7 A;  5CGW A;  1Z09 A;  3BLM A;  4WZ5 C;  3A0V A;  4NET A;  2XQZ A;  3ZNT A;  4QJG A;  5I94 A;  2O99 A;  2Y59 A;  2V1A A;  4DXB A;  3UE3 A;  4U0X A;  2BTF P;  3FG8 A;  3FWL A;  5M18 A;  2ZM8 A;  4HHD A;  4E6W A;  2HV1 A;  2ZQ9 A;  2ZMF A;  3A3E A;  5HSQ A;  4DMZ A;  1J3W A;  5FQI A;  4KQR A;  4QB8 A;  1KVL A;  4OLD A;  4FTX A;  1VM1 A;  5DFY A;  1PI4 A;  4M3K A;  4RX3 A;  5M19 A;  2V8C A;  1LI0 A;  3W4P A;  1GA9 A;  1DRM A;  4JGO A;  1JVJ A;  1YM1 A;  2A49 A;  5HWT A;  1BT5 A;  3QHY A;  3T4L A;  1LL5 A;  3H7W B;  5K5B A;  2HF6 A;  2DNS A;  4E6X A;  2DCF A;  4RA7 A;  1XFQ A;  2GDN A;  5E43 A;  3CPT A;  3T4J A;  1PW1 A;  4X69 A;  3KSI A;  4A5R A;  4HBT A;  1I2S A;  4D60 A;  1CK3 A;  3NDG A;  1WE4 A;  5CGS A;  3PBS A;  2KOI A;  3IH9 A;  1YMX A;  2MJ6 A;  1V9Y A;  1IYS A;  5EVE A;  5L10 A;  3MKE A;  2ZC3 B;  5IHV A;  2WGW B;  3HLG A;  4Y0O A;  3O88 A;  4R3A A;  5HPF A;  5A8B A;  3VOL A;  5HDD A;  3MXR A;  3DW0 A;  1MWR A;  4JKT A;  3W2Z A;  1L0F A;  3AGF A;  4QWO A;  2XFT A;  1UGU A;  2J9O A;  3TSG A;  5EUA A;  3SH7 A;  1PW8 A;  1KVM A;  5I5L A;  2OLV A;  3BQ8 A;  4LRY C;  1EW0 A;  1LL8 A;  4AFI A;  3O5Y A;  1LL9 A;  5DTT A;  2R78 A;  3LR0 A;  3IX4 A;  1KE0 A;  1TDL A;  1UWN X;  1FOF A;  3CUE A;  2V1B A;  5E2E A;  4R38 A;  1DY6 A;  4CLC B;  1ZG6 A;  2PD7 A;  3BW6 A;  4X6T A;  5DF7 A;  5FEF A;  5G4Z A;  3IQA A;  3IXB A;  3PR6 A;  2O9A A;  1E25 A;  5HPI A;  2IA2 A;  3EGX C;  4LRX C;  4CQH A;  2J7V A;  2D02 A;  4QU3 A;  3G2Y A;  3FKW A;  2BAS A;  1GA0 A;  2PDR A;  3GRJ A;  4G3V A;  5IU1 A;  2W3G A;  4XT2 A;  4GHI B;  1JNU A;  1VHM A;  5JYO A;  4X1M A;  1LLB A;  2B5R A;  4BL3 A;  2QHK A;  2INW A;  4EER A;  1K6R A;  3C38 A;  1YLZ A;  4WMC D;  1L3L A;  5L07 A;  4F94 A;  1ZHH B;  2W1T B;  5C5K A;  5DKK A;  3IF5 A;  4EQI A;  1L2S A;  4U3T A;  3TE8 A;  4GJ4 A;  1WYB A;  2WGV A;  1XKZ A;  5CRF A;  5F68 A;  3QNC A;  3JYI A;  2JE5 A;  2OLU A;  4RQ9 A;  3IHB A;  4OPZ A;  4BBU A;  4KZ7 A;  1W63 Q;  3ZCZ A;  4BWI A;  4GD6 A;  3C30 A;  1YLP A;  1CF0 A;  4JBF A;  2WAE A;  4Y7P A;  2PR5 A;  3FKV A;  4JPM A;  1T1A A;  5EM1 A;  2J80 A;  1S66 L;  3N4I A;  3DAV A;  5DFX A;  1ONH A;  4OH0 A;  5F6A A;  4II7 A;  2ZC5 B;  5EVL A;  2HGV A;  2Y8H A;  3QP1 A;  2VZW A;  4IUH A;  3QP8 A;  3C5A A;  4Y15 A;  4S2M A;  5TBM B;  3T1R A;  1Q2P A;  5HW3 A;  2EA9 A;  4MBH A;  5TFQ A;  1KE3 A;  3T4S A;  4FOF A;  1NYM A;  5EM0 A;  1NRF A;  1KOU A;  1BLS A;  2A3U A;  2O0Y A;  1TS0 A;  3HRE A;  4PPR A;  2P08 A;  3MJQ A;  3BFG A;  4DKI A;  4KQO A;  3Q7V B;  3T4T A;  1OTI A;  2WKQ A;  1ALQ A;  3H7W A;  1W8Q A;  3IBR A;  3CHW P;  3BFE A;  4L9G A;  4RYE A;  3R7W A;  1TD5 A;  2H5S A;  5L2F A;  3HLE A;  3FC7 A;  4QHC A;  3KSH A;  4OQH A;  1W7F A;  3ZG0 A;  1MPL A;  1E3U A;  1IOU A;  3BM6 A;  1ES3 A;  1YT4 A;  1D1J A;  2HDR A;  2I72 A;  5DKL A;  5LBR A;  4BMW A;  3RFB A;  3T1Q B;  1XJ6 A;  2WKH A;  3ZG9 B;  3WRZ A;  1HVB A;  2VK3 A;  2Y2K A;  3Q82 A;  1EI5 A;  1PWD A;  4UAA A;  4OQ0 A;  3GQZ A;  3PYP A;  3QNB A;  1IKG A;  3HJK A;  3AGE A;  2YKF A;  3WRT A;  2EX6 A;  1K25 A;  2P74 A;  2C5W B;  3PBT A;  2CC1 A;  3NHQ A;  2XR0 A;  4IVK A;  4EBP A;  1D7E A;  2VA0 A;  4LCL A;  5TR7 A;  4O7D A;  3E4P A;  3UE6 A;  3M6B A;  3T1X A;  3KYZ A;  3LY3 A;  2HJE A;  2VV6 A;  3HLD A;  3MSH A;  3JVV A;  1SCW A;  1XP4 A;  3S4X A;  2ZMV A;  3HUO A;  1GSX A;  4N92 A;  3NI9 A;  4P6Z S;  3SS4 A;  4Y5F A;  4DE0 A;  3CPT B;  3G30 A;  3IT9 A;  5J4E A;  4I3J A;  4PM9 A;  5FAT A;  4EBL A;  5HL6 A;  3VP2 A;  1QMF A;  4HIA A;  1BZA A;  5F82 A;  2PT7 A;  2A2L A;  2QZ6 A;  1STZ A;  5FSR A;  3CZD A;  3IX8 A;  1MXO A;  1NYY A;  3FPV A;  4NXG A;  4ESP A;  3B42 A;  3GDI A;  3VOY A;  4R4R A;  3ZDJ A;  1K55 A;  1JTD A;  1M6K A;  4K0X A;  3KYQ A;  4GHI A;  2IWB A;  3SOI A;  2B02 A;  1OTA A;  3WS5 A;  3VFH A;  4JF4 A;  3A3D A;  3DTI A;  3B3X A;  5FQJ A;  3L9K A;  1YLJ A;  3VV4 A;  5EVI A;  3G6O A;  4ZBE A;  3IF6 A;  1BLP A;  4S2K A;  3UE0 A;  2PU2 A;  4E04 A;  3LEZ A;  3VE3 A;  4EBN A;  4GNU A;  3VFF A;  5GLD A;  2EXB A;  2ZC4 B;  4JGQ A;  3BYD A;  2Y2G A;  4GDB A;  4G3K A;  4GKU A;  4GOG A;  1T1C A;  4DE3 A;  3LIB A;  5CXW A;  3CG5 A;  2CMN A;  4ZJ3 A;  1GCE A;  1ZTU A;  4ZTK A;  1LSW A;  1NXY A;  1OTD A;  2FH5 A;  2VEA A;  4KQD A;  2WZZ A;  3OZH A;  4ID4 A;  4UQI S;  2PU4 A;  1YMS A;  3HCY A;  4KQQ A;  4EET B;  2HP6 A;  1G6A A;  3MQ0 A;  4OPY A;  1XX2 A;  1OJ5 A; 
#chains in the Genus database with same CATH homology
 1CK3 A;  1NY0 A;  3O86 A;  1YLY A;  3NDG A;  4JF5 A;  1WE4 A;  5CGS A;  4E3J A;  3PBS A;  2XDM A;  1H8Z A;  1SHV A;  2Y2N A;  3IH9 A;  1YMX A;  1HTZ A;  3RJU A;  1NJ4 A;  1G68 A;  5D3O A;  1IYS A;  2WGI A;  3E2K A;  3ZVT A;  2V2F F;  2ZC7 A;  3G4P A;  3S22 A;  4KG6 A;  3GVB A;  1S6R A;  3MKE A;  2ZC3 B;  1XA7 A;  5IHV A;  2WGW B;  5A91 A;  3ZG8 B;  5GLA A;  4N9K A;  3HLG A;  1ES4 A;  5GHX A;  4Y0O A;  4OOL A;  3O88 A;  4X68 A;  1PZO A;  4X53 A;  2BLS A;  1BTL A;  4OQG A;  3MZD A;  3Q7Z A;  2Y2Q A;  3TOI A;  4UA9 A;  1K38 A;  4BEN A;  3TG9 A;  4OPQ A;  3MXR A;  1W79 A;  3DW0 A;  5HFO A;  2P9V B;  4N9L A;  5BOH A;  5F1F A;  2HDQ A;  1ES5 A;  1MWR A;  4ZJ1 A;  1FCO A;  5DF9 A;  4JKT A;  4WEL A;  3UPP A;  1L0F A;  3WS2 A;  3UDF A;  3AGF A;  1NZO A;  4CPK A;  2FFF B;  4WEK A;  1SKF A;  2XFT A;  1YLW A;  4E3I A;  4E3O A;  1WYC A;  2J9O A;  3TSG A;  3G31 A;  1N4O A;  5CTM A;  1PW8 A;  5EUA A;  1KVM A;  3SH7 A;  4EUZ A;  3BEC A;  2OLV A;  1K54 A;  4MEZ A;  3VP1 A;  4KZ6 A;  1CEF A;  2JCH A;  1ES2 A;  3ITB A;  2XK1 A;  1ZG4 A;  4DF6 A;  5FQQ A;  3UE1 A;  1PYY A;  1JWZ A;  3C7U A;  1LL9 A;  3OCL A;  1E3U D;  3ZVW A;  4MBK A;  1I5Q A;  4X56 A;  5DTT A;  4XUZ A;  4WEJ A;  1KE0 A;  1TDL A;  5FQ9 A;  3UDX A;  2R9X A;  4GN2 A;  3W4Q A;  1FOF A;  1JWV A;  3E2L A;  1H8Y A;  3NCK A;  5EEC A;  5GL9 A;  4LV2 A;  2Y2J A;  4ZDX A;  2ZQ7 A;  2G2W A;  5E2E A;  2ZD8 A;  1KDW A;  3UNW A;  5FQK A;  3ZGA B;  1DY6 A;  3G35 A;  3OCN A;  1PI5 A;  2OV5 A;  1FR6 A;  4N1X A;  3IWQ A;  4KG2 A;  4OLG A;  1ZG6 A;  1FSW A;  3FZC A;  4OOM A;  3V3S A;  2H0T A;  3HL9 A;  3PTE A;  4X6T A;  2H10 A;  3NBL A;  2QMI A;  5DF7 A;  2J8Y A;  4JXV A;  1HD8 A;  2Y2P A;  3PBN A;  4U0T A;  3VP0 A;  3IQA A;  1K57 C;  3IXB A;  2EX9 A;  1E25 A;  1K6S A;  2Z2L B;  1I2W A;  3M2K A;  3MBZ A;  1DJC A;  2J7V A;  5HAP A;  3IWO A;  3BFF A;  3HVF A;  4E3L A;  1BLC A;  4QU3 A;  3G2Y A;  2RCX A;  3FKW A;  1GA0 A;  1CI9 A;  3OPL A;  3GRJ A;  4E3K A;  3UY6 A;  1K56 A;  2Y55 A;  4BLM A;  5CEB A;  4X55 A;  5CED A;  5HX9 A;  3WS1 A;  1K54 C;  4PM5 A;  3VMA A;  5KZH A;  2HDU A;  2BG1 A;  2ZLY A;  1O07 A;  5JYO A;  2WKE A;  1FCN A;  1LLB A;  2B5R A;  1C3B A;  4BL3 A;  3BFD A;  4C6Y A;  3G2Z A;  4WYY A;  2HDS A;  3VSL A;  4FSF A;  2Q9M A;  5CHJ A;  2WGW A;  5AQ9 A;  1PWC A;  3NIA A;  1SDE A;  3MXS A;  5CER A;  3AGD A;  1K6R A;  3EQU A;  1KGE A;  3RXW A;  5CHM A;  4ZJ2 A;  3ZG5 A;  1LHY A;  5U47 A;  1YLZ A;  4PM7 A;  3SS5 A;  4WMC D;  5EVI C;  4S2I A;  1N9B A;  2XF3 A;  2Y2H A;  1O7E A;  3BFC A;  4P85 A;  3I7J A;  1MWU A;  4E3M A;  2ZQA A;  3IF6 C;  4R1G A;  4MLL A;  4WZ4 A;  1PWG A;  2G2U A;  2ZM0 A;  4F94 A;  4FH2 A;  1J9M A;  4IVI A;  4KZ4 A;  2ZJ9 A;  2VGK A;  3UDI A;  3LCE A;  1EWZ A;  3IF5 A;  4R3B A;  3BRM A;  4DDS A;  4S2N A;  4DE2 A;  1K4E A;  4EQI A;  1L2S A;  3G32 A;  4U3T A;  5GHZ A;  3VP3 A;  1U60 A;  1WYB A;  2WGV A;  1IYP A;  3WS4 A;  1ERM A;  4OPR A;  1XKZ A;  5CRF A;  3N8L A;  1H5X A;  1HZO A;  1S0W A;  3QNC A;  3JYI A;  1BUL A;  2Y2M A;  4C75 A;  2JE5 A;  3ITA A;  2OLU A;  1K4F A;  3HLB A;  4DXC A;  1LI9 A;  3IHB A;  4KZ5 A;  3LY4 A;  4OPZ A;  4B4X A;  4KG5 A;  1NZU A;  4KZ7 A;  1L0G A;  3ZCZ A;  3UN7 A;  4YFM A;  4GD6 A;  1YLP A;  5CTN A;  4BD1 A;  4JBF A;  3M6H A;  5CHU A;  1JTG A;  4OQI A;  2WAE A;  4E3N A;  3IH8 A;  4LV3 A;  4Y7P A;  4EWF A;  3FKV A;  5EOO A;  3GV9 A;  4JPM A;  1KGG A;  4OON A;  4OVD A;  2HP5 A;  4JLF A;  3RXX A;  4GD8 A;  3V3R A;  2IWC A;  3HLC A;  1MWS A;  3N4I A;  4FD8 A;  5EVI D;  4IBR A;  1ONH A;  4OH0 A;  5CEC A;  1GHP A;  1FR1 A;  1RGY A;  4EV4 A;  2WYX A;  4S2O A;  3V39 A;  1PZP A;  2ZC5 B;  5EVL A;  1BSG A;  3N7W A;  1W5D A;  5KSH A;  4C3Q A;  5AQB A;  3C5A A;  3MKF A;  4S2M A;  4IED A;  5FAS A;  3IHA A;  1Q2P A;  1DJA A;  4OOY A;  5HW3 A;  2XGN A;  4MBH A;  5AQ7 A;  2HP9 A;  5TFQ A;  1AXB A;  1KE3 A;  3GR2 A;  1NYM A;  1NRF A;  1TEM A;  1QME A;  3C4P A;  1BLS A;  5CGX A;  2A3U A;  5FDH A;  5EOE A;  3PAE A;  1L0E A;  4L0L A;  1XGJ A;  3ZFZ A;  5KSC A;  2DRW A;  3HRE A;  4PPR A;  1RGZ A;  3G34 A;  1TDG A;  4R23 A;  2X01 A;  3BFG A;  4DKI A;  1IEL A;  4S2P A;  4KQO A;  3VSK A;  3Q7V B;  4JXS A;  2H0Y A;  1ALQ A;  1W8Q A;  2EFU A;  3NDE A;  1K56 D;  3C4O A;  3BFE A;  4P6B A;  1VQQ A;  4RX2 A;  4B4Z A;  3BEB A;  4RYE A;  3VP4 A;  5FI2 A;  2XFS A;  3M2J A;  2H5S A;  1ZC2 A;  4UHU A;  5L2F A;  4KZA A;  3HLE A;  5HAQ A;  4QHC A;  4OQH A;  1W7F A;  3ZG0 A;  3C7V A;  2Y91 A;  3N8S A;  1MPL A;  4ZAM A;  1E3U A;  3CJM A;  4LV1 A;  3HUN A;  5F1G A;  3BM6 A;  1ES3 A;  4KEN B;  1JWP A;  1BLH A;  1ONG A;  1YT4 A;  4P87 A;  3A3F A;  2HDR A;  2I72 A;  5GLB A;  2WKH A;  3O87 A;  5FAO A;  2XLN A;  2IWD A;  3OC2 A;  3WRZ A;  3ZG9 B;  4BD0 A;  4D2O A;  3UPO A;  2WK0 A;  1HVB A;  2Y2K A;  4JF6 A;  3OPP A;  2XD5 A;  3Q82 A;  1Q2Q A;  1EI5 A;  1FSY A;  1PWD A;  3FV7 A;  4HBU A;  4OQ0 A;  1ERQ A;  3GQZ A;  3QNB A;  4UAA A;  5EVI B;  3VOZ A;  1IKG A;  3IF6 B;  1XXM A;  1MWT A;  3PBO A;  5E2G A;  2EX2 A;  3AGE A;  3Q1F A;  3WRT A;  5FAQ A;  1GHI A;  2EX6 A;  1K25 A;  2P74 A;  3MZF A;  1XPB A;  2C5W B;  5AQA A;  1PIO A;  1RCJ A;  2CC1 A;  2EXA A;  3IXH A;  1L0D A;  1MBL A;  3PBT A;  2XR0 A;  3HLW A;  3ZG7 B;  1KE4 A;  2Q9N A;  2WKI A;  4PM6 A;  1ESI A;  3NC8 A;  4IVK A;  3WS0 A;  2WAF A;  4EBP A;  1MKI A;  3V50 A;  5A93 A;  3MFD A;  2P9V A;  4Y0U A;  1DJB A;  4OKP A;  4LCL A;  3N8R A;  5TR7 A;  4MBF A;  4O7D A;  3EQV A;  5E2H A;  4DE1 A;  2V20 A;  3M6B A;  4LV0 A;  3LY3 A;  3DWZ A;  2ZMA A;  2ZQC A;  3UO9 A;  3HLD A;  4KZB A;  3IWI A;  3OPH A;  1YQS A;  4WZ5 A;  2R9W A;  2X71 A;  4GB7 A;  4OP5 A;  1SCW A;  1XP4 A;  2UWX A;  5FQM A;  1FQG A;  3SH9 A;  4BJP A;  3LO7 A;  1Y54 A;  1KGF A;  4XXR A;  3P98 A;  3S4X A;  3HUO A;  4IBX A;  4QY5 A;  1GHM A;  1E4D A;  4N92 A;  4DDY A;  5A90 A;  3DTM A;  3ZHH A;  3IXD A;  2ZM2 A;  3NI9 A;  4PMA A;  3SS4 A;  4QD4 A;  3W8K A;  2HPB A;  4DE0 A;  3GMW A;  4Z9Q A;  5A92 A;  3G30 A;  4KZ3 A;  3IT9 A;  5EE8 A;  4CJN A;  4NK3 A;  4OP8 A;  4PM9 A;  4R0Q A;  5FAT A;  3PBR A;  5E2F A;  2VGJ A;  4K0W A;  5DTS A;  4EBL A;  4Q8I A;  5FAP A;  2Y2I A;  1ERO A;  2JC7 A;  4UA7 A;  4WMC A;  3VP2 A;  4N1H A;  3OPR A;  1QMF A;  4RVA A;  5KMW A;  1BZA A;  5F82 A;  4YIN A;  4K91 A;  5GHY A;  2WUQ A;  3PAG A;  2QZ6 A;  3A3I A;  1K57 A;  4MNR A;  3UPN A;  4JXW A;  3HBR A;  3GSG A;  5FSR A;  3MZE A;  2XEP A;  2Y2O A;  3Q7V A;  5DF8 A;  3ISG A;  4KZ8 A;  4WBG A;  3ZNY A;  3CZD A;  2OSU A;  1MXO A;  3D4F A;  3NY4 A;  3S1Y A;  5JYP A;  1KDS A;  1SDN A;  2XH9 A;  5EPH A;  4WM9 A;  1NYY A;  1ZKJ A;  3PBQ A;  1CEG A;  1ESU A;  5HL1 A;  2FFY A;  4FCF A;  3W4O A;  1FCM A;  5FA7 A;  5FI7 A;  3DWK A;  1BUE A;  2EFX A;  4R4S A;  3VOY A;  3HLF A;  3HUM A;  4R4R A;  1W8Y A;  1Z6F A;  4S2N C;  1OME A;  3ZDJ A;  1K55 A;  4H8R A;  1JTD A;  1IYO A;  1M6K A;  2X02 A;  5CGW A;  4GDN A;  3BLM A;  4WZ5 C;  4K0X A;  3V5M A;  4Y0T A;  3FYZ A;  2IWB A;  4NET A;  3SOI A;  4B88 A;  2XQZ A;  3WS5 A;  3ZNT A;  3BLS A;  3A3J A;  2ZC6 B;  4QJG A;  5I94 A;  2Y59 A;  4JF4 A;  3A3D A;  5DVA A;  3VFH A;  4DXB A;  3UE3 A;  1TVF A;  4U0X A;  1XA1 A;  1RP5 A;  3B3X A;  4HEF A;  1IKI A;  4GZB A;  5FQJ A;  1YLJ A;  5EVI A;  2C6W B;  3FWL A;  5M18 A;  2ZM8 A;  5FI6 A;  4ZBE A;  3IF6 A;  4E6W A;  1YLT A;  2JBF A;  1BLP A;  2ZQ9 A;  3A3E A;  3WWX A;  4S2K A;  2Z2M B;  3CMZ A;  3SS3 A;  3UE0 A;  2PU2 A;  2E8I A;  4LEN A;  4P0M A;  5FQI A;  1CI8 A;  1IEM A;  3LEZ A;  4KQR A;  4PM8 A;  1KVL A;  4OLD A;  4QB8 A;  4XUX A;  5GLC A;  4BQM A;  4EBN A;  4GNU A;  1VM1 A;  2PBY A;  2ZQD A;  4UA6 A;  2EX8 A;  3VFF A;  3N6I A;  5G18 A;  5GLD A;  1PI4 A;  2EXB A;  2ZC4 B;  3O3V A;  4M3K A;  4RX3 A;  3Q81 A;  5M19 A;  1LI0 A;  2Y2L A;  1GA9 A;  2ZQ8 A;  5M1A A;  3BYD A;  3W4P A;  2Y2G A;  5J8X A;  4GDB A;  4GKU A;  4GOG A;  4QY6 A;  2RL3 A;  1IYQ A;  1JVJ A;  4DE3 A;  5CXW A;  1YM1 A;  2A49 A;  3CG5 A;  1BT5 A;  3IXG A;  3QHY A;  5DTK A;  4BL2 A;  3SH8 A;  4ZJ3 A;  4S2J A;  4FH4 A;  2WZX A;  5HAI A;  1LL5 A;  5TGF A;  1MY8 A;  1GCE A;  1XGI A;  2QPN A;  2J9P A;  3Q07 A;  3GTC A;  4HES A;  4S2L A;  4ZTK A;  2DNS A;  4E6X A;  1NXY A;  2DCF A;  4RA7 A;  1K55 C;  2GDN A;  4DRT A;  4R3J A;  2V1Z A;  5E43 A;  5HAR A;  2WZZ A;  3OZH A;  4ID4 A;  2PU4 A;  3P09 A;  1YMS A;  2WAD A;  4LCM A;  4JXG A;  4KQQ A;  2XD1 A;  2Y4A A;  2HP6 A;  1M40 A;  1G6A A;  1PW1 A;  4X69 A;  4OPY A;  1XX2 A;  4A5R A;  4HBT A;  5F83 A;  1I2S A;  4KZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...