3HUOA

X-ray crystallographic structure of ctx-m-9 s70g in complex with benzylpenicillin
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
262
structure length
262
Chain Sequence
TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dynamic view of the early and late steps of the catalytic mechanism mediated by the emerging enzymes CTX-M.
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords CTX-M-9 extended-spectrum beta-lactamase
total genus 95
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3huoA00
4E3JA 1W7FA 1YQSA 4IEDA 3WRZA 4S2OA 3OZHA 1L0FA 3M6BA 3UPOA 1HZOA 3UDFA 3UDIA 4X53A 2JC7A 2WGVA 1XKZA 1SCWA 5CEDA 4EBNA 1JTDA 3VP1A 5TGFA 1MBLA 2H5SA 2WGWB 1L2SA 3CMZA 4S2KA 3NC8A 4UHUA 1H5XA 1HD8A 3HLBA 3GQZA 4GZBA 4JF6A 4X6TA 3HLEA 3NDGA 3EQVA 3S4XA 1O7EA 4GN2A 3DWZA 4S2NA 2RCXA 4GD8A 3PTEA 4O7DA 5FI7A 3MKFA 3VOZA 4RX2A 3W8KA 2Q9NA 4OH0A 3VP3A 1GA9A 1FSWA 3G2YA 3Q07A 4QY5A 3ISGA 1SDEA 4DRTA 2WZXA 1Q2QA 4KZ8A 3NIAA 4WMCA 2H10A 5GHXA 5CECA 4M3KA 1CK3A 5GL9A 4WM9A 5AQBA 1ESUA 3HLDA 4BL3A 1ERMA 3IXGA 3GSGA 1TEMA 4N92A 5EVLA 3IF5A 5JYPA 1PIOA 1PW8A 3V3RA 3MBZA 4KZ7A 4BJPA 5KSCA 2PU4A 1MXOA 2ZC4B 1MWTA 4HESA 1CEGA 3IXBA 4KQOA 3UE3A 3WS2A 4PM7A 2XD5A 3OPPA 3ZG0A 4EBPA 1ERQA 4GDNA 3OPHA 4RA7A 3ZG5A 3VP0A 2BG1A 4JF5A 5CGSA 1H8ZA 3BYDA 1NJ4A 3MZFA 4L0LA 3OPLA 3IT9A 4OQIA 5D3OA 1BTLA 1BLPA 3WS5A 5CTMA 1KGEA 2P9VA 4E3OA 1I2SA 3HLFA 5FASA 1K57A 4KZBA 1I2WA 3PBTA 3GV9A 3C4OA 4JXSA 5EVIC 1K38A 1KGFA 2Y59A 1IEMA 3ZDJA 3BRMA 5DF7A 5FI2A 2ZLYA 4E3NA 2EXAA 1LHYA 1YLZA 2C5WB 2XD1A 1IKIA 3Q7VA 4PM9A 2E8IA 4MLLA 1CI8A 3ZG9B 4S2LA 4OQHA 1K6RA 5FATA 2X01A 3QNCA 4HBTA 2Y2KA 4GNUA 1K54A 3NY4A 4ZJ3A 4ID4A 1NZUA 4WYYA 1JTGA 1TDGA 5GHZA 2Y2PA 2XH9A 3TOIA 4E6XA 1K4FA 1K54C 5A90A 2Q9MA 2H0YA 2V2FF 4QHCA 4DE2A 1M6KA 1J9MA 2OSUA 2WGWA 4OPQA 2WAEA 3HUNA 4PM6A 1E3UD 3C7VA 3G34A 5EUAA 5L2FA 3SS3A 4K0XA 3VP2A 2EX6A 1QMFA 3S22A 4MBFA 2G2UA 4RX3A 4R3BA 1YLJA 1HVBA 3AGEA 2Y2NA 3D4FA 3LY3A 3JYIA 3IF6C 4OLGA 3BFFA 3SS5A 3N8LA 3Q7ZA 2ZD8A 1BT5A 2WYXA 4KG6A 1BULA 1K4EA 4WZ5C 1CEFA 1EWZA 3WRTA 4JXGA 1PYYA 2EXBA 4K0WA 3C4PA 4KENB 4PPRA 2J7VA 3IWQA 5CXWA 5CTNA 1KGGA 4KQRA 2P74A 5AQ9A 5CHJA 5KZHA 1MWRA 3OC2A 4WELA 5EOEA 1KE0A 3BFDA 2J9OA 4DE0A 1L0EA 2ZQ9A 2WZZA 1PWDA 1NRFA 1YMSA 3UN7A 4QB8A 2WKIA 1FCMA 3LEZA 5A92A 2ZQCA 1BLHA 2ZQ8A 5A93A 2IWBA 1FQGA 3ZFZA 2CC1A 5FQKA 2A49A 2V20A 4S2JA 5CGWA 1JWZA 3HLWA 4PM5A 4R1GA 1ES3A 4IBRA 5CEBA 1NYYA 3WS4A 4PM8A 1NY0A 4P85A 1HTZA 4N9KA 4XXRA 3UY6A 5DVAA 3BM6A 3MXSA 4KZ9A 2HP9A 3ITAA 2EX9A 3HBRA 4UA9A 1BLSA 2V1ZA 3VMAA 3IXDA 2HP5A 3EQUA 3HLGA 3PBOA 5HARA 1VQQA 1W8YA 4U3TA 5FAOA 2EFXA 1W5DA 4N1XA 3CJMA 1ONGA 5HFOA 2IWCA 4U0XA 5TFQA 3MFDA 1BUEA 4ZJ1A 4KZ6A 4EWFA 1GHPA 1ZKJA 2XR0A 1KDWA 3GRJA 4B4ZA 1M40A 3PBSA 1OMEA 1XPBA 3UNWA 4ZJ2A 3OPRA 1WYCA 4EV4A 4DXBA 3C5AA 4QJGA 4E6WA 2QZ6A 4MBHA 1MWSA 4OP5A 1YLYA 4UAAA 3BLMA 1ESIA 3E2LA 3IQAA 4ZDXA 1AXBA 1ES2A 1FSYA 1GHMA 2PU2A 3IH8A 4HBUA 2J8YA 1EI5A 4N1HA 5CGXA 3FV7A 4E3LA 5E2GA 2Y2IA 1SDNA 3N8RA 4LCLA 2IWDA 1LL9A 3OCNA 1L0GA 1K55A 3HREA 3GR2A 4LV2A 2ZMAA 5CRFA 4BLMA 1K57C 3M2JA 1XGJA 3FKWA 3OCLA 2GDNA 5E2EA 5HAIA 1JWPA 1IELA 4C6YA 1GA0A 4DDYA 5FAQA 4RVAA 3BECA 3PBNA 4WMCD 3C7UA 2A3UA 1CI9A 2XK1A 1N4OA 3HUOA 3LO7A 4WEKA 3HL9A 1FCNA 4Z9QA 3RXXA 5EVIB 3MZEA 2P9VB 5EPHA 5FA7A 5KMWA 4QU3A 5FQJA 2R9WA 1S0WA 3IHAA 4OOLA 4EBLA 1I5QA 1PZOA 2WUQA 3G35A 4LENA 5HAQA 3SS4A 3SH9A 3WS0A 3N7WA 1NYMA 1YM1A 4Y0OA 5CHUA 1XXMA 3HVFA 4JXVA 1C3BA 4GDBA 5DTTA 5AQ7A 1E4DA 3WWXA 1ZC2A 4D2OA 5A91A 3UE0A 3IHBA 4WBGA 5HW3A 1XGIA 4R4RA 5FQQA 3TSGA 5J8XA 3O86A 3ZVTA 4DXCA 2HDQA 1LL5A 3NBLA 4C75A 1Y54A 3IF6A 4ZBEA 4RYEA 1FOFA 4DKIA 5M19A 4OQGA 3LCEA 1GHIA 1K25A 3O87A 3CZDA 3TG9A 1QMEA 3QHYA 1MPLA 4WZ4A 4GOGA 2X02A 3CG5A 4JLFA 1MY8A 4P6BA 3Q1FA 4QD4A 4S2MA 1XX2A 1IYSA 1DY6A 2VGKA 3DTMA 4JKTA 2C6WB 2ZJ9A 1IKGA 2XFSA 3B3XA 2Y2OA 4GKUA 1YLTA 5FDHA 4F94A 4OVDA 4R23A 3WS1A 1RGYA 4KZ4A 1SHVA 2EFUA 4LCMA 3A3JA 4KZ5A 3M6HA 2Y2QA 4OPZA 2HPBA 2FFFB 3VSLA 1EROA 1L0DA 1IYPA 4IVKA 3V3SA 2ZQDA 1W79A 4KG2A 5KSHA 1SKFA 3M2KA 2XF3A 2PBYA 3AGDA 3PBRA 1G6AA 1KVLA 1RP5A 4B88A 1ES4A 1WYBA 1WE4A 2WADA 3IXHA 1FR1A 3A3DA 3ZG7B 5FQ9A 3UO9A 4LV3A 2VGJA 4JF4A 2OLVA 1KE3A 4N9LA 4U0TA 2FFYA 3ZGAB 1JWVA 3GVBA 4QY6A 3GMWA 2WAFA 1XA7A 3MKEA 4NK3A 5FQIA 4S2PA 4BENA 3ZNTA 5GLDA 5GLAA 5FQMA 2BLSA 3BLSA 3ZNYA 5EVIA 4CJNA 3V5MA 4UA7A 2OLUA 2X71A 2OV5A 4FCFA 1TDLA 3A3IA 5HAPA 2HDUA 2RL3A 1U60A 4DDSA 1Z6FA 4MNRA 4P87A 3W4OA 4IBXA 1IYQA 1NZOA 1LI0A 3G32A 4DF6A 1FR6A 5AQAA 4GB7A 1PW1A 5E43A 4ZTKA 4FH4A 4OOMA 2Z2MB 3VFHA 4KZAA 1PWCA 4DE3A 3NDEA 1KE4A 4LV1A 1ONHA 3FWLA 4LV0A 5IHVA 4R4SA 2HDRA 5U47A 4Y0TA 1YT4A 3IH9A 2WKHA 2Y2LA 3MZDA 3FYZA 3NCKA 5M1AA 2ZM0A 3ZCZA 1VM1A 5I94A 3PAGA 3RXWA 3SH8A 2WK0A 4OONA 3O88A 1YLWA 4EQIA 2Z2LB 4MBKA 1K55C 4YFMA 3MXRA 4OLDA 5G18A 5F83A 1ZG6A 1N9BA 2ZM8A 2Y2HA 2DRWA 1XP4A 1RCJA 4OKPA 2G2WA 1G68A 2JE5A 4KZ3A 2HP6A 2WGIA 4X68A 2Y55A 4KG5A 4OOYA 4X56A 5FI6A 5FSRA 1PI4A 5F1GA 4E3MA 3LY4A 3BFCA 5GHYA 3P98A 3PAEA 1MKIA 1DJBA 4JPMA 4E3IA 2ZC3B 4GD6A 2ZQ7A 2Y4AA 1DJAA 3IWOA 4Y0UA 4BD1A 3Q7VB 1K6SA 2QMIA 4OP8A 3O3VA 5CERA 4FH2A 2J9PA 2Y2GA 4PMAA 4X69A 2ZC5B 3G31A 3IWIA 3Q82A 5EVID 1NXYA 3VP4A 4OPYA 2XLNA 5EE8A 4EUZA 4FD8A 5DTSA 5HX9A 2XDMA 1MWUA 2QPNA 1ALQA 1W8QA 4P0MA 5M18A 3IF6B 3V39A 1PZPA 3ZHHA 2ZM2A 3GTCA 2ZC7A 3QNBA 4OPRA 1BLCA 3BEBA 4BQMA 4FSFA 5F82A 2XGNA 3AGFA 4S2IA 5DF9A 5JYOA 4S2NC 2Y2JA 4XUZA 4X55A 4K91A 4MEZA 2EX2A 5E2FA 1E3UA 4E3KA 5TR7A 5DF8A 3S1YA 1H8YA 3ZG8B 3PBQA 1Q2PA 4JXWA 3I7JA 4NETA 3UE1A 3W4QA 2H0TA 3BFGA 3E2KA 3N4IA 3RJUA 4Q8IA 5EOOA 3A3FA 3ITBA 1YMXA 4BD0A 2DNSA 2Y2MA 4CPKA 1BSGA 3VSKA 1S6RA 2ZQAA 5F1FA 4Y7PA 1E25A 1PWGA 4BL2A 3DWKA 1RGZA 3N6IA 1K56A 1LLBA 4A5RA 2JCHA 1K56D 1TVFA 2HDSA 2XFTA 4IVIA 3N8SA 5E2HA 3SOIA 1KVMA 4R3JA 2DCFA 5GLCA 3UDXA 3W4PA 5EECA 5FAPA 4KQQA 3A3EA 3VFFA 3UPNA 1ZG4A 3ZVWA 4JBFA 5GLBA 2UWXA 5DTKA 2R9XA 3FZCA 3UPPA 4OQ0A 2Y91A 2JBFA 4R0QA 1DJCA 4ZAMA 1BZAA 1IYOA 2XEPA 3VOYA 3G2ZA 3DW0A 1LI9A 4XUXA 1XA1A 3HUMA 4DE1A 3P09A 1O07A 4HEFA 4C3QA 3SH7A 1ES5A 5CHMA 4B4XA 1JVJA 3G4PA 3NI9A 1YLPA 3G30A 4YINA 4UA6A 5BOHA 2ZC6B 1FCOA 1PI5A 2B5RA 1GCEA 2WKEA 3FKVA 3HLCA 2EX8A 4H8RA 5HL1A 4WZ5A 3Q81A 2XQZA 3V50A 3BFEA 4WEJA 2I72A 1KDSA
chains in the Genus database with same CATH superfamily
1YQSA 2GZAA 1L0FA 4FTXA 1HZOA 3UDIA 4X53A 2WGVA 4HY8A 3LR4A 5CEDA 1JTDA 5HWWA 4HI4A 1MBLA 5LBRA 1P9WA 2H5SA 3CMZA 3NC8A 2A24B 1HD8A 4JF6A 2MJ6A 3HLEA 3NDGA 3S4XA 2W1RA 4GN2A 4ZRRA 1D06A 2W3GA 5FI7A 1J3WA 2JKTM 4OH0A 3VP3A 1GA9A 4QY5A 4II7A 1TS7A 1LT0A 2H10A 3T4LA 5AQBA 1ERMA 2V8CA 3GSGA 1TEMA 4N92A 3LR5A 3IF5A 2Q0OA 4BWIA 3V3RA 4G3WA 3SW1A 3JPUA 1IFQA 1CEGA 3WS2A 2B18A 4PM7A 3OPPA 4WF0A 1ERQA 1WA9A 4RA7A 3QP6A 3VP0A 5CGSA 4LPZA 3T12B 2QKPA 4OQIA 4L0LA 1V9ZA 3OPLA 2JKRI 5F6AA 5CTMA 3UB5P 1KGEA 5FASA 1K57A 2GNXA 4ETZA 1I2WA 2HZ5A 3C4OA 3G6OA 5EVIC 4EUVA 3NECA 2ZLYA 2EXAA 3Q7VA 2E8IA 5FATA 2Y2KA 5HDSA 4GNUA 1OTAA 4ZJ3A 4Y17A 4ID4A 1Y28A 1TDGA 2VZWA 2KDKA 4HJ4A 2Y2PA 3T1SA 5EUAA 4LRXC 3SS3A 4K0XA 3S7QA 4GCZA 1YLJA 1CF0A 3SS5A 2V1BA 5TBMA 1EWZA 4JXGA 3E4QA 4PPRA 1VETB 3NOUC 3H82B 5CTNA 5KZHA 1MWRA 4WELA 3D3OA 4DE0A 1S1ZA 4F3LB 4QB8A 4HIAA 4BMWA 3LEZA 2ZQCA 2IWBA 3CLOA 3LEQA 3CPTA 1G6OA 3K3CA 3HLWA 3ZQ5A 4KUOA 3MXSA 2EX9A 3HBRA 2DMWA 3UMDA 2HV1A 2HP5A 2HJEA 5FAOA 3F1PB 4GJ4A 4U0XA 2OWJA 4KZ6A 3SZTA 1ZKJA 1M40A 2KX6A 3PBSA 3U4LP 3OPRA 4QJGA 1S4RA 4I5SA 4NXFA 1YLYA 1FSYA 1FILA 5HZHA 2Y2IA 3N8RA 3TJZC 3HREA 2VX8A 2ZMAA 5AVEA 3NULA 3F1PA 3OCLA 2GDNA 5E2EA 1IELA 4C6YA 4RVAA 3C7UA 1CI9A 3HL9A 1FCNA 4XT2A 4AFIA 4WL9A 3BJNA 4MDZA 4QU3A 3W2ZA 3IHAA 4OOLA 5DKLA 3LFVA 4I3AA 2ZMVA 4Q0JA 1YM1A 4Y0OA 3NHQA 3HVFA 3WWXA 1C3BA 4GDBA 5AQ7A 4D2OA 1AWIA 3PHYA 5A91A 4NXGA 3LIFA 3TSGA 3ZVTA 2OAP1 1G28A 1GHIA 3CZDA 3LIBA 4MN7A 4WLAA 1DY6A 2VGKA 2XFSA 1YLTA 4F94A 4OVDA 3MMHA 4EETB 1SHVA 2OAQ1 5TJJA 3A3JA 4KZ5A 2HPBA 3V3SA 3BW6A 1W79A 5KSHA 1SKFA 3FPVA 3PBRA 2L4RA 1ES4A 3ZG7B 4MMNA 2OLVA 1JWVA 4EW7A 2WAFA 1XA7A 3MKEA 4NK3A 2EA9A 3ZNTA 5HWTA 4UA7A 2X71A 1T1CA 2RL3A 1U60A 3EEAA 1IYQA 4DF6A 4GB7A 4HOIA 3NDEA 4L9EA 3FWLA 4Y0TA 2WKHA 2Y2LA 3MZDA 3FYZA 1SKOA 5M1AA 3C30A 1VM1A 5I94A 3PAGA 3RXWA 3LR0A 5FDSA 1A0KA 5G4YA 5F83A 2VGLS 1N9BA 3DTIA 2Y2HA 4O8GA 3K3DA 1H0MA 3A0RA 5G4ZA 2GJ3A 4X68A 4KG5A 4Q0IA 3BFCA 3PAEA 4JPMA 4E3IA 3LIDA 2VA0A 2ZQ7A 3KSHA 3IWOA 3Q7VB 1K6SA 2QMIA 1LSXA 2J9PA 3G31A 5J3WA 4OPYA 5EE8A 3EGXC 5DTSA 5HX9A 4M4XA 4PAUA 2PYPA 1H8MA 2QPNA 2ZM2A 1BLCA 3BEBA 3H82A 4S2NC 4PKYA 1Y4OA 5TR7A 1N9LA 5TBMB 3S1YA 1Q2PA 2PR6A 3I7JA 3A0VA 3BFGA 3RJUA 1TS6A 1JNUA 4Q8IA 2FZ0A 3C2WA 3JVUA 1BSGA 1S6RA 5F1FA 2VJWA 1PWGA 1XFQA 3DWKA 1RGZA 1X0OA 2JCHA 3LYXA 3UDXA 5GLCA 2DCFA 2V0WA 5EECA 5FAPA 3A3EA 3VFFA 3VE4A 1ZG4A 3UPPA 4KUKA 2Y91A 4R0QA 2K2NA 3VOYA 3HUMA 1O07A 1UWNX 5DFYA 4EQ1A 4B4XA 2B95A 3G4PA 4EU0A 1FIKA 1YLPA 2XRNA 1FCOA 1PI5A 1GCEA 2WKEA 4H8RA 3Q81A 2FH5A 5CHUA 5FSRA 5DJUA 2PAVP 3UPOA 3UDFA 3D9YA 3VP1A 4CLCC 3EWKA 3GQZA 5FL3A 5F68A 1O7EA 4GD8A 4O7DA 2LB9A 4RX2A 1FSWA 3Q07A 2WZXA 1Q2QA 2Y79A 1F5MA 4M3KA 2ZOHA 4UQIM 2PU4A 2ZC4B 4HESA 3UE3A 3IXBA 3OPHA 4JF5A 3UE6A 3BYDA 3CITA 1NJ4A 5D3OA 1BTLA 4NXBA 2P9VA 3HLFA 3MF0A 2XA7S 4KZBA 1SKOB 4JXSA 3LGOA 4DJ2A 2Y59A 1IEMA 4G3VA 4HH3A 2GX5A 2C5WB 1CI8A 4HBTA 3NY4A 1NZUA 3E4PA 5DJTA 5GHZA 1G5UA 5F5YA 3TOIA 2Q9MA 2V2FF 1TS8A 2WAEA 5HL6A 1VEUB 5L2FA 5FEGA 1QMFA 3LY3A 3JYIA 4EERA 2JKTI 3N8LA 1Z09A 4KG6A 2WYXA 1BULA 1K4EA 3WRTA 1CEFA 1PYYA 4K0WA 4KENB 5CXWA 4Y15A 1OJGA 3A0SA 3OC2A 4JGPA 3BFDA 1L0EA 2ZQ9A 2WZZA 1W63M 1BLHA 2L1MA 2CC1A 5FQKA 3V67A 2V20A 4S2JA 4PM5A 4R1GA 1ES3A 5CEBA 1NYYA 1HTZA 2XSSA 4HJ6A 3UY6A 2ZL1B 1YSPA 2V1AA 2HP9A 3ITAA 5J7EA 3KSFA 3CUEC 3VMAA 2O0YA 3EQUA 3HLGA 5HARA 5EVEA 5AJGA 1W8YA 3P7NA 3UB6A 3DAVA 2EFXA 5MC7A 2Z6CA 4N1XA 3CJMA 1ONGA 2B02A 5TFQA 3JVVA 4R6LA 3C8CA 4ZJ2A 4YOFA 2YKFA 1WYCA 5EFWA 4DXBA 3C5AA 2QZ6A 3BLMA 3E2LA 1ES2A 1GHMA 2PU2A 2J8YA 1EI5A 5CX7A 1SDNA 2IWDA 1L0GA 4LV2A 5CRFA 3DBAA 2CMNA 3T4QA 4BLMA 2NUPC 1XGJA 2PYRA 4K08A 2E8JA 3UMEA 2XK1A 3RXXA 4Z9QA 5EVIB 2XROA 3MZEA 2P9VB 5EPHA 5KMWA 1XJ2A 2R9WA 1I5QA 1PZOA 3SH9A 3WS0A 3IS2B 4HH2A 4JXVA 5L10A 3UE0A 5HW3A 4CQHA 1XGIA 4R4RA 5FQQA 2EWWA 4CLCA 2HDQA 3L9KA 4NKPA 1FOFA 4DKIA 3FG8A 3ZYTA 1K25A 3QHYA 1MPLA 4P6BA 4X25A 2C6WB 1IKGA 2Y2OA 4GKUA 1RGYA 2M1CA 3KSGA 4OPZA 2FFFB 1EROA 1L0DA 3M2KA 4B9OA 1ZHHB 5HWVA 1WYBA 2WADA 3A3DA 5FQ9A 2LB5A 2VGJA 4N9LA 1F98A 2ZBBA 4PKYG 1GSWA 4GHIB 4WN5A 4X1MA 3ZNYA 4JGQA 1TDLA 3A3IA 4I3JA 1XJ3A 1S66L 2JHEA 4IJGA 1Z6FA 4P87A 2XA7M 1LI0A 1DP9A 1FR6A 4QWOA 5AQAA 4ESPA 3VFHA 3P01A 2P7JA 1YT4A 1HLUP 1YLWA 4GS9A 4OLDA 1NWZA 1OTIA 2ZM8A 1XP4A 3F1NA 1GSXA 5J4EA 2HP6A 2WGIA 2Y55A 1H3QA 4EESA 3S7NA 3P98A 4GD6A 3CAXA 4HNBA 5CERA 3O3VA 3KYQA 3IWIA 5EVID 1PFLA 2XLNA 4FD8A 2XDMA 5M18A 3V39A 2K7SA 4FSFA 2JKGA 1L3LA 4E3KA 4K91A 2EX2A 1E3UA 5EM1A 3W4QA 3E2KA 1MC0A 5EOOA 5L09A 1YMXA 2PR5A 2DNSA 4CPKA 3VSKA 3KSIA 1VETA 4BL2A 1SZVA 3MFXA 1VEUA 2HDSA 4IVIA 3SOIA 1OT9A 3HJKA 2YKHA 4WUJA 3B47A 4JBFA 4R70A 4HP9A 2JKFA 1DJCA 4ZAMA 1IYOA 4B93A 1XA1A 4DE1A 3P09A 2V9AA 1JVJA 4CLCE 5BOHA 5HL1A 2XQZA 4FUWA 3BFEA 4WEJA 2I72A 1KDSA 4E3JA 3WRZA 4S2OA 3IX3A 4GW9A 2VEAA 1XKZA 4EBNA 5TGFA 2WGWB 4UHUA 4GZBA 4O01A 3T1QB 1PRQA 2RCXA 2QHKA 3KYEA 3MKFA 3VOZA 2JKRM 5EV0A 2WKQA 3NIAA 5GHXA 3OLOA 2P08A 4WM9A 1ESUA 3HLDA 4BL3A 5JYPA 4HP4A 4KZ7A 1TF1A 2VV6A 1MWTA 2R78A 3LI8A 4GDNA 1H8ZA 3IT9A 2D01A 4JGOA 3CUEA 1BLPA 2HGVA 3WS5A 4E3OA 4XT2B 3PBTA 4LLOB 1NLZA 3GV9A 1KGFA 2J3TC 3ZDJA 2W0NA 5DF7A 5FI2A 1P97A 1YLZA 2XD1A 1IKIA 4PM9A 4BBVA 4MLLA 3ZG9B 4IUHA 4OQHA 3QNCA 4E6XA 1K54C 1J9MA 2OSUA 4OPQA 3C7VA 3G34A 2G2UA 1S1YA 4RX3A 3AGEA 1P0ZA 3IF6C 3QP1A 3BFFA 1DP6A 1ZTUA 3MXQA 1BT5A 4WZ5C 4Q0HA 2EXBA 2G7UA 3IWQA 5AQ9A 2P74A 5CHJA 1KE0A 3EOIA 1PWDA 2WKIA 1LSVA 4CLCD 1KOUA 3LICA 1FQGA 3ZFZA 2A49A 2HF6A 3IX4A 4IBRA 4PM8A 3T1XA 4N9KA 1TS0A 5DVAA 3BM6A 4KZ9A 4UA9A 1BLSA 1MZUA 2V0UA 2V1ZA 1D1JA 2PD7A 3S7PA 3PBOA 2W3FA 4G3KA 1W5DA 2QJ7A 3T4JA 5HFOA 1XFNA 4IUKA 2IWCA 5HSQA 4ZJ1A 4EWFA 5IU1A 3GRJA 4X1LA 3F1OB 3UNWA 2KOIA 1T19A 4EV4A 1CQAA 4MBHA 2INWA 4OP5A 4UAAA 1ESIA 1AXBA 3IH8A 4HBUA 5CGXA 2UV0E 3FV7A 2PRFA 1LL9A 3OCNA 1MKMA 3M2JA 3FKWA 5HAIA 1JWPA 4DDYA 5L8MA 3VOLA 3MJQA 5FAQA 3PBNA 4WMCD 1YKDA 1N4OA 4WEKA 3T50A 3H7WB 1T1AA 3PYPA 5AVFA 2BTFP 5FA7A 5FQJA 2O9CA 1S0WA 4EBLA 3CPTB 5EM0A 2WUQA 5FEFA 3G35A 5HAQA 3N7WA 4F3LA 1K0KA 1E4DA 3PR6A 3IHBA 5HDCA 2JN7A 5J8XA 5DKKA 2VK3A 1IOUA 4C75A 1Y54A 3IF6A 4O0PA 4RYEA 3LCEA 1S67L 2D02A 4D60A 4Y3IA 4GOGA 2X02A 3CG5A 4NG2A 2J3TD 3F1NB 1IYSA 3DTMA 4JKTA 3B3XA 5FDHA 3WS1A 1DP8A 2EFUA 1ODVA 3M6HA 4QPRA 2Y2QA 4P6ZS 4IVKA 1IYPA 1XJ6A 3VE3A 1UWPX 2H28A 3AGDA 1RP5A 5HD5A 2OOLA 1WE4A 3IXHA 1FR1A 4LV3A 1KE3A 3ICYA 3UB8A 3ZGAB 3GVBA 3GMWA 4ARZB 4BENA 3FC7A 4CJNA 2M7VA 2OLUA 2NUTC 5HAPA 2HDUA 5IT5A 3D72A 4DDSA 3W4OA 4IBXA 3G32A 4ZTKA 5HD3A 4FH4A 4OOMA 3RTYA 4KZAA 1PWCA 3VV4A 4DE3A 1ACFA 3IH9A 3T4TA 3NCKA 3KYZA 3OOVA 3O88A 4MCWA 4UQIS 2WKRA 2Z2LB 1GSVA 4P6ZM 3MXRA 5G18A 1ZG6A 3HJIA 1BYWA 2DRWA 2G2WA 1G68A 2JE5A 1NRJA 1F2KA 3K2NA 1DRMA 1PI4A 2W1TA 3H7WA 3R4KA 1MKIA 1V9YA 4KQDA 4BD1A 2V8FA 4OP8A 1N9OA 2ZC5B 3Q82A 1NXYA 4DMZA 1ALQA 3UB9A 3GTCA 4NEED 4H6JB 2I9VA 3QP4A 5HDDA 3AGFA 2W27A 5JYOA 1UGUA 4GHIA 4X55A 5E2FA 1VHMA 4L9GA 1H8YA 3TW8A 3ZG8B 3UE1A 4NETA 2H0TA 1T18A 1D7EA 3N4IA 2VV7A 3ITBA 4YWZA 2Y2MA 4Y7PA 1E25A 4EEUA 4A5RA 1TVFA 2XFTA 5L07A 5E2HA 5KIZA 4R3JA 4MN6A 3W4PA 3U2AA 4R38A 3R7WA 4RQ9A 4MN5A 3UPNA 2UWXA 5DTKA 1BZAA 2XEPA 3G2ZA 2P04A 3DW0A 4XUXA 2A24A 4C3QA 3SH7A 1ES5A 5DFXA 5C5KA 2PHYA 4ETXA 3NI9A 4UA6A 4HJ3A 4PHTA 1YPRA 2EWVA 3HLCA 3TE8A 4WZ5A 3V50A 3MQOA 3CWFA 1W7FA 4IEDA 3OZHA 1OTEA 3M6BA 4Y13A 2JC7A 1SCWA 4DN0A 5A8BA 2ZL1A 4S2KA 1L2SA 1N9NA 1CJFA 1H5XA 3HLBA 4X6TA 3EQVA 3DWZA 5IS1A 4S2NA 4R3AA 3PTEA 3W8KA 5HPIA 2Q9NA 4Y5FA 3G2YA 3ISGA 1SDEA 4DRTA 5HPFA 4KZ8A 4WMCA 5CECA 5GL9A 1CK3A 1LSWA 1S4SA 3L7HA 3GDIA 2OWHA 3IXGA 5EVLA 1PIOA 2W3HA 1PW8A 2PD8A 3MBZA 4BJPA 5KSCA 1MXOA 4KQOA 2WKPA 1OTDA 3IX8A 2XD5A 3ZG0A 4EBPA 3EGDC 3ZG5A 1T1BA 2BG1A 2BASA 3NOPC 3MZFA 4BBTA 1I2SA 1YSQA 1K38A 3DTKA 3BY8A 3BRMA 4E3NA 1LHYA 3IBJA 4S2LA 1K6RA 4I38A 2X01A 3FPWA 1K54A 4LFUA 4Z1WA 4WYYA 1JTGA 2XH9A 1K4FA 4FOFA 5A90A 4QHCA 2H0YA 4DE2A 1M6KA 2WGWA 3HUNA 4PM6A 1E3UD 3VP2A 2EX6A 3S22A 4MBFA 4EXOA 2Z6DA 2VGLM 4R3BA 1HVBA 3RH8B 2Y2NA 3D4FA 4OLGA 3MS6A 3Q7ZA 2ZD8A 3CI6A 3C4PA 3RFBA 2J7VA 2K31A 1KGGA 2W1TB 4KQRA 5EOEA 3B42A 2J9OA 3LUQA 1P9RA 1NRFA 2PDRA 3NJAA 1YMSA 3UN7A 2PBDP 4ME4A 1FCMA 5A92A 5A93A 2ZQ8A 3KO6A 2AVXA 5CGWA 1JWZA 3PXPA 4DJ3A 3WS4A 1NY0A 4P85A 2KLIA 4XXRA 3BQ8A 3LIAA 3KX0X 3OBFA 3IXDA 1VQQA 3ULFA 1OTBA 4U3TA 2VLGA 2VKSA 1OPXA 3HCYA 3MFDA 1BUEA 3C38A 1GHPA 2XR0A 3S7OA 1KDWA 4HHDA 4B4ZA 1OMEA 1XPBA 4GS9B 3T4KA 3LIEA 4L9FA 4E6WA 1MWSA 1TD5A 4UEYA 3DTEA 3LI9A 3IQAA 4ZDXA 4N1HA 3CHWP 4E3LA 5E2GA 4LCLA 1F9IA 4NXEA 1K55A 4I39A 3GR2A 3LR3A 1K57C 1GA0A 3BECA 3IS2A 4EEPA 2A3UA 3O5YA 3HUOA 3LO7A 4H6JA 3BY9A 2ZMFA 4LENA 3SS4A 1NYMA 3BQAA 1XXMA 5DTTA 1ZC2A 4WBGA 3O86A 4DXCA 3NBLA 1LL5A 4ZBEA 5M19A 4OQGA 3O87A 3TG9A 1QMEA 4WZ4A 4JLFA 1MY8A 3T4SA 3T1RA 3Q1FA 4QD4A 4S2MA 1XX2A 2ZJ9A 3QP5A 4R23A 2VV8A 4KZ4A 4LCMA 2ZOIA 3B33A 4E04A 3EEHA 3VSLA 2ZQDA 4KG2A 2XF3A 2PBYA 1G6AA 1KVLA 4B88A 1EW0A 3UO9A 4JF4A 1XJ4A 4U0TA 2FFYA 3IBRA 4QY6A 5FQIA 4S2PA 5GLDA 5GLAA 5FQMA 2BLSA 4LRYC 3BLSA 2QWSA 5EVIA 3UB7A 3V5MA 2OV5A 4FCFA 2O9AA 4MNRA 1NZOA 3MQ0A 1PW1A 5E43A 2Z2MB 4ARZA 1KE4A 4LV1A 3E98A 1ONHA 4LV0A 5IHVA 4R4SA 3BWLA 2HDRA 5U47A 4CLCB 2J3WA 2ZM0A 3ZCZA 3R7WB 1OJ5A 2J80A 3SH8A 2WK0A 4OONA 4EQIA 2M7UA 4MBKA 1K55C 4YFMA 4BBUA 3T4OA 1STZA 4IHQA 4I3IA 5K5BA 4LRZE 1RCJA 4OKPA 4YNRA 4KZ3A 4OOYA 4X56A 5FI6A 5F1GA 4E3MA 3LY4A 5GHYA 3NOTC 2L0WA 1LL8A 1DJBA 2ZC3B 2O9BA 2Y4AA 1DJAA 4Y0UA 4FH2A 2Y2GA 3MQQA 4PMAA 4X69A 2Y8HA 2IA2A 1NLYA 3VP4A 4EUZA 3E4OA 1MWUA 1W8QA 3MR0A 2A2LA 3IF6B 4P0MA 1PZPA 3ZHHA 3QNBA 4OPRA 2ZC7A 4BQMA 5F82A 2XGNA 4S2IA 5DF9A 3GECA 2Y2JA 4XUZA 4MEZA 5DF8A 2W3EA 3PBQA 4JXWA 2HJ9C 3MSHA 2O99A 3A3FA 3QP2A 2ACGA 4BD0A 4HQAA 2QYBA 1OT6A 4Y2FA 2ZQAA 4LGWA 3TRCA 3N6IA 1K56A 1LLBA 3H9WA 5F69A 2QJ5A 1K56D 3N8SA 1PNEA 2W3DA 1KVMA 4KQQA 4JGRA 3ZVWA 5GLBA 1VB6A 2R9XA 3FZCA 4OQ0A 2JBFA 1LI9A 1W63Q 4GLQA 5I5LA 4HEFA 3E0YA 5CHMA 3G30A 4YINA 3F1OA 2ZC6B 2B5RA 3QP8A 3FKVA 2EX8A 2PT7A 1YAXA
chains in the Genus database with same CATH topology
4E3JA 1W7FA 1YQSA 4IEDA 3WRZA 4S2OA 3OZHA 1L0FA 3M6BA 3UPOA 1HZOA 3UDFA 3UDIA 4X53A 2JC7A 2WGVA 1XKZA 1SCWA 5CEDA 4EBNA 1JTDA 3VP1A 5TGFA 1MBLA 2H5SA 2WGWB 1L2SA 3CMZA 4S2KA 3NC8A 4UHUA 1H5XA 1HD8A 3HLBA 3GQZA 4GZBA 4JF6A 4X6TA 3HLEA 3NDGA 3EQVA 3S4XA 1O7EA 4GN2A 3DWZA 4S2NA 2RCXA 4GD8A 3PTEA 4O7DA 5FI7A 3MKFA 3VOZA 4RX2A 3W8KA 2Q9NA 4OH0A 3VP3A 1GA9A 1FSWA 3G2YA 3Q07A 4QY5A 3ISGA 1SDEA 4DRTA 2WZXA 1Q2QA 4KZ8A 3NIAA 4WMCA 2H10A 5GHXA 5CECA 4M3KA 1CK3A 5GL9A 4WM9A 5AQBA 1ESUA 3HLDA 4BL3A 1ERMA 3IXGA 3GSGA 1TEMA 4N92A 5EVLA 3IF5A 5JYPA 1PIOA 1PW8A 3V3RA 3MBZA 4KZ7A 4BJPA 5KSCA 2PU4A 1MXOA 2ZC4B 1MWTA 4HESA 1CEGA 3IXBA 4KQOA 3UE3A 3WS2A 4PM7A 2XD5A 3OPPA 3ZG0A 4EBPA 1ERQA 4GDNA 3OPHA 4RA7A 3ZG5A 3VP0A 2BG1A 4JF5A 5CGSA 1H8ZA 3BYDA 1NJ4A 3MZFA 4L0LA 3OPLA 3IT9A 4OQIA 5D3OA 1BTLA 1BLPA 3WS5A 5CTMA 1KGEA 2P9VA 4E3OA 1I2SA 3HLFA 5FASA 1K57A 4KZBA 1I2WA 3PBTA 3GV9A 3C4OA 4JXSA 5EVIC 1K38A 1KGFA 2Y59A 1IEMA 3ZDJA 3BRMA 5DF7A 5FI2A 2ZLYA 4E3NA 2EXAA 1LHYA 1YLZA 2C5WB 2XD1A 1IKIA 3Q7VA 4PM9A 2E8IA 4MLLA 1CI8A 3ZG9B 4S2LA 4OQHA 1K6RA 5FATA 2X01A 3QNCA 4HBTA 2Y2KA 4GNUA 1K54A 3NY4A 4ZJ3A 4ID4A 1NZUA 4WYYA 1JTGA 1TDGA 5GHZA 2Y2PA 2XH9A 3TOIA 4E6XA 1K4FA 1K54C 5A90A 2Q9MA 2H0YA 2V2FF 4QHCA 4DE2A 1M6KA 1J9MA 2OSUA 2WGWA 4OPQA 2WAEA 3HUNA 4PM6A 1E3UD 3C7VA 3G34A 5EUAA 5L2FA 3SS3A 4K0XA 3VP2A 2EX6A 1QMFA 3S22A 4MBFA 2G2UA 4RX3A 4R3BA 1YLJA 1HVBA 3AGEA 2Y2NA 3D4FA 3LY3A 3JYIA 3IF6C 4OLGA 3BFFA 3SS5A 3N8LA 3Q7ZA 2ZD8A 1BT5A 2WYXA 4KG6A 1BULA 1K4EA 4WZ5C 1CEFA 1EWZA 3WRTA 4JXGA 1PYYA 2EXBA 4K0WA 3C4PA 4KENB 4PPRA 2J7VA 3IWQA 5CXWA 5CTNA 1KGGA 4KQRA 2P74A 5AQ9A 5CHJA 5KZHA 1MWRA 3OC2A 4WELA 5EOEA 1KE0A 3BFDA 2J9OA 4DE0A 1L0EA 2ZQ9A 2WZZA 1PWDA 1NRFA 1YMSA 3UN7A 4QB8A 2WKIA 1FCMA 3LEZA 5A92A 2ZQCA 1BLHA 2ZQ8A 5A93A 2IWBA 1FQGA 3ZFZA 2CC1A 5FQKA 2A49A 2V20A 4S2JA 5CGWA 1JWZA 3HLWA 4PM5A 4R1GA 1ES3A 4IBRA 5CEBA 1NYYA 3WS4A 4PM8A 1NY0A 4P85A 1HTZA 4N9KA 4XXRA 3UY6A 5DVAA 3BM6A 3MXSA 4KZ9A 2HP9A 3ITAA 2EX9A 3HBRA 4UA9A 1BLSA 2V1ZA 3VMAA 3IXDA 2HP5A 3EQUA 3HLGA 3PBOA 5HARA 1VQQA 1W8YA 4U3TA 5FAOA 2EFXA 1W5DA 4N1XA 3CJMA 1ONGA 5HFOA 2IWCA 4U0XA 5TFQA 3MFDA 1BUEA 4ZJ1A 4KZ6A 4EWFA 1GHPA 1ZKJA 2XR0A 1KDWA 3GRJA 4B4ZA 1M40A 3PBSA 1OMEA 1XPBA 3UNWA 4ZJ2A 3OPRA 1WYCA 4EV4A 4DXBA 3C5AA 4QJGA 4E6WA 2QZ6A 4MBHA 1MWSA 4OP5A 1YLYA 4UAAA 3BLMA 1ESIA 3E2LA 3IQAA 4ZDXA 1AXBA 1ES2A 1FSYA 1GHMA 2PU2A 3IH8A 4HBUA 2J8YA 1EI5A 4N1HA 5CGXA 3FV7A 4E3LA 5E2GA 2Y2IA 1SDNA 3N8RA 4LCLA 2IWDA 1LL9A 3OCNA 1L0GA 1K55A 3HREA 3GR2A 4LV2A 2ZMAA 5CRFA 4BLMA 1K57C 3M2JA 1XGJA 3FKWA 3OCLA 2GDNA 5E2EA 5HAIA 1JWPA 1IELA 4C6YA 1GA0A 4DDYA 5FAQA 4RVAA 3BECA 3PBNA 4WMCD 3C7UA 2A3UA 1CI9A 2XK1A 1N4OA 3HUOA 3LO7A 4WEKA 3HL9A 1FCNA 4Z9QA 3RXXA 5EVIB 3MZEA 2P9VB 5EPHA 5FA7A 5KMWA 4QU3A 5FQJA 2R9WA 1S0WA 3IHAA 4OOLA 4EBLA 1I5QA 1PZOA 2WUQA 3G35A 4LENA 5HAQA 3SS4A 3SH9A 3WS0A 3N7WA 1NYMA 1YM1A 4Y0OA 5CHUA 1XXMA 3HVFA 4JXVA 1C3BA 4GDBA 5DTTA 5AQ7A 1E4DA 3WWXA 1ZC2A 4D2OA 5A91A 3UE0A 3IHBA 4WBGA 5HW3A 1XGIA 4R4RA 5FQQA 3TSGA 5J8XA 3O86A 3ZVTA 4DXCA 2HDQA 1LL5A 3NBLA 4C75A 1Y54A 3IF6A 4ZBEA 4RYEA 1FOFA 4DKIA 5M19A 4OQGA 3LCEA 1GHIA 1K25A 3O87A 3CZDA 3TG9A 1QMEA 3QHYA 1MPLA 4WZ4A 4GOGA 2X02A 3CG5A 4JLFA 1MY8A 4P6BA 3Q1FA 4QD4A 4S2MA 1XX2A 1IYSA 1DY6A 2VGKA 3DTMA 4JKTA 2C6WB 2ZJ9A 1IKGA 2XFSA 3B3XA 2Y2OA 4GKUA 1YLTA 5FDHA 4F94A 4OVDA 4R23A 3WS1A 1RGYA 4KZ4A 1SHVA 2EFUA 4LCMA 3A3JA 4KZ5A 3M6HA 2Y2QA 4OPZA 2HPBA 2FFFB 3VSLA 1EROA 1L0DA 1IYPA 4IVKA 3V3SA 2ZQDA 1W79A 4KG2A 5KSHA 1SKFA 3M2KA 2XF3A 2PBYA 3AGDA 3PBRA 1G6AA 1KVLA 1RP5A 4B88A 1ES4A 1WYBA 1WE4A 2WADA 3IXHA 1FR1A 3A3DA 3ZG7B 5FQ9A 3UO9A 4LV3A 2VGJA 4JF4A 2OLVA 1KE3A 4N9LA 4U0TA 2FFYA 3ZGAB 1JWVA 3GVBA 4QY6A 3GMWA 2WAFA 1XA7A 3MKEA 4NK3A 5FQIA 4S2PA 4BENA 3ZNTA 5GLDA 5GLAA 5FQMA 2BLSA 3BLSA 3ZNYA 5EVIA 4CJNA 3V5MA 4UA7A 2OLUA 2X71A 2OV5A 4FCFA 1TDLA 3A3IA 5HAPA 2HDUA 2RL3A 1U60A 4DDSA 1Z6FA 4MNRA 4P87A 3W4OA 4IBXA 1IYQA 1NZOA 1LI0A 3G32A 4DF6A 1FR6A 5AQAA 4GB7A 1PW1A 5E43A 4ZTKA 4FH4A 4OOMA 2Z2MB 3VFHA 4KZAA 1PWCA 4DE3A 3NDEA 1KE4A 4LV1A 1ONHA 3FWLA 4LV0A 5IHVA 4R4SA 2HDRA 5U47A 4Y0TA 1YT4A 3IH9A 2WKHA 2Y2LA 3MZDA 3FYZA 3NCKA 5M1AA 2ZM0A 3ZCZA 1VM1A 5I94A 3PAGA 3RXWA 3SH8A 2WK0A 4OONA 3O88A 1YLWA 4EQIA 2Z2LB 4MBKA 1K55C 4YFMA 3MXRA 4OLDA 5G18A 5F83A 1ZG6A 1N9BA 2ZM8A 2Y2HA 2DRWA 1XP4A 1RCJA 4OKPA 2G2WA 1G68A 2JE5A 4KZ3A 2HP6A 2WGIA 4X68A 2Y55A 4KG5A 4OOYA 4X56A 5FI6A 5FSRA 1PI4A 5F1GA 4E3MA 3LY4A 3BFCA 5GHYA 3P98A 3PAEA 1MKIA 1DJBA 4JPMA 4E3IA 2ZC3B 4GD6A 2ZQ7A 2Y4AA 1DJAA 3IWOA 4Y0UA 4BD1A 3Q7VB 1K6SA 2QMIA 4OP8A 3O3VA 5CERA 4FH2A 2J9PA 2Y2GA 4PMAA 4X69A 2ZC5B 3G31A 3IWIA 3Q82A 5EVID 1NXYA 3VP4A 4OPYA 2XLNA 5EE8A 4EUZA 4FD8A 5DTSA 5HX9A 2XDMA 1MWUA 2QPNA 1ALQA 1W8QA 4P0MA 5M18A 3IF6B 3V39A 1PZPA 3ZHHA 2ZM2A 3GTCA 2ZC7A 3QNBA 4OPRA 1BLCA 3BEBA 4BQMA 4FSFA 5F82A 2XGNA 3AGFA 4S2IA 5DF9A 5JYOA 4S2NC 2Y2JA 4XUZA 4X55A 4K91A 4MEZA 2EX2A 5E2FA 1E3UA 4E3KA 5TR7A 5DF8A 3S1YA 1H8YA 3ZG8B 3PBQA 1Q2PA 4JXWA 3I7JA 4NETA 3UE1A 3W4QA 2H0TA 3BFGA 3E2KA 3N4IA 3RJUA 4Q8IA 5EOOA 3A3FA 3ITBA 1YMXA 4BD0A 2DNSA 2Y2MA 4CPKA 1BSGA 3VSKA 1S6RA 2ZQAA 5F1FA 4Y7PA 1E25A 1PWGA 4BL2A 3DWKA 1RGZA 3N6IA 1K56A 1LLBA 4A5RA 2JCHA 1K56D 1TVFA 2HDSA 2XFTA 4IVIA 3N8SA 5E2HA 3SOIA 1KVMA 4R3JA 2DCFA 5GLCA 3UDXA 3W4PA 5EECA 5FAPA 4KQQA 3A3EA 3VFFA 3UPNA 1ZG4A 3ZVWA 4JBFA 5GLBA 2UWXA 5DTKA 2R9XA 3FZCA 3UPPA 4OQ0A 2Y91A 2JBFA 4R0QA 1DJCA 4ZAMA 1BZAA 1IYOA 2XEPA 3VOYA 3G2ZA 3DW0A 1LI9A 4XUXA 1XA1A 3HUMA 4DE1A 3P09A 1O07A 4HEFA 4C3QA 3SH7A 1ES5A 5CHMA 4B4XA 1JVJA 3G4PA 3NI9A 1YLPA 3G30A 4YINA 4UA6A 5BOHA 2ZC6B 1FCOA 1PI5A 2B5RA 1GCEA 2WKEA 3FKVA 3HLCA 2EX8A 4H8RA 5HL1A 4WZ5A 3Q81A 2XQZA 3V50A 3BFEA 4WEJA 2I72A 1KDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E3J A;  1W7F A;  1YQS A;  4IED A;  3WRZ A;  4S2O A;  3OZH A;  1L0F A;  3M6B A;  3UPO A;  1HZO A;  3UDF A;  3UDI A;  4X53 A;  2JC7 A;  2WGV A;  1XKZ A;  1SCW A;  5CED A;  4EBN A;  1JTD A;  3VP1 A;  5TGF A;  1MBL A;  2H5S A;  2WGW B;  1L2S A;  3CMZ A;  4S2K A;  3NC8 A;  4UHU A;  1H5X A;  1HD8 A;  3HLB A;  3GQZ A;  4GZB A;  4JF6 A;  4X6T A;  3HLE A;  3NDG A;  3EQV A;  3S4X A;  1O7E A;  4GN2 A;  3DWZ A;  4S2N A;  2RCX A;  4GD8 A;  3PTE A;  4O7D A;  5FI7 A;  3MKF A;  3VOZ A;  4RX2 A;  3W8K A;  2Q9N A;  4OH0 A;  3VP3 A;  1GA9 A;  1FSW A;  3G2Y A;  3Q07 A;  4QY5 A;  3ISG A;  1SDE A;  4DRT A;  2WZX A;  1Q2Q A;  4KZ8 A;  3NIA A;  4WMC A;  2H10 A;  5GHX A;  5CEC A;  4M3K A;  1CK3 A;  5GL9 A;  4WM9 A;  5AQB A;  1ESU A;  3HLD A;  4BL3 A;  1ERM A;  3IXG A;  3GSG A;  1TEM A;  4N92 A;  5EVL A;  3IF5 A;  5JYP A;  1PIO A;  1PW8 A;  3V3R A;  3MBZ A;  4KZ7 A;  4BJP A;  5KSC A;  2PU4 A;  1MXO A;  2ZC4 B;  1MWT A;  4HES A;  1CEG A;  3IXB A;  4KQO A;  3UE3 A;  3WS2 A;  4PM7 A;  2XD5 A;  3OPP A;  3ZG0 A;  4EBP A;  1ERQ A;  4GDN A;  3OPH A;  4RA7 A;  3ZG5 A;  3VP0 A;  2BG1 A;  4JF5 A;  5CGS A;  1H8Z A;  3BYD A;  1NJ4 A;  3MZF A;  4L0L A;  3OPL A;  3IT9 A;  4OQI A;  5D3O A;  1BTL A;  1BLP A;  3WS5 A;  5CTM A;  1KGE A;  2P9V A;  4E3O A;  1I2S A;  3HLF A;  5FAS A;  1K57 A;  4KZB A;  1I2W A;  3PBT A;  3GV9 A;  3C4O A;  4JXS A;  5EVI C;  1K38 A;  1KGF A;  2Y59 A;  1IEM A;  3ZDJ A;  3BRM A;  5DF7 A;  5FI2 A;  2ZLY A;  4E3N A;  2EXA A;  1LHY A;  1YLZ A;  2C5W B;  2XD1 A;  1IKI A;  3Q7V A;  4PM9 A;  2E8I A;  4MLL A;  1CI8 A;  3ZG9 B;  4S2L A;  4OQH A;  1K6R A;  5FAT A;  2X01 A;  3QNC A;  4HBT A;  2Y2K A;  4GNU A;  1K54 A;  3NY4 A;  4ZJ3 A;  4ID4 A;  1NZU A;  4WYY A;  1JTG A;  1TDG A;  5GHZ A;  2Y2P A;  2XH9 A;  3TOI A;  4E6X A;  1K4F A;  1K54 C;  5A90 A;  2Q9M A;  2H0Y A;  2V2F F;  4QHC A;  4DE2 A;  1M6K A;  1J9M A;  2OSU A;  2WGW A;  4OPQ A;  2WAE A;  3HUN A;  4PM6 A;  1E3U D;  3C7V A;  3G34 A;  5EUA A;  5L2F A;  3SS3 A;  4K0X A;  3VP2 A;  2EX6 A;  1QMF A;  3S22 A;  4MBF A;  2G2U A;  4RX3 A;  4R3B A;  1YLJ A;  1HVB A;  3AGE A;  2Y2N A;  3D4F A;  3LY3 A;  3JYI A;  3IF6 C;  4OLG A;  3BFF A;  3SS5 A;  3N8L A;  3Q7Z A;  2ZD8 A;  1BT5 A;  2WYX A;  4KG6 A;  1BUL A;  1K4E A;  4WZ5 C;  1CEF A;  1EWZ A;  3WRT A;  4JXG A;  1PYY A;  2EXB A;  4K0W A;  3C4P A;  4KEN B;  4PPR A;  2J7V A;  3IWQ A;  5CXW A;  5CTN A;  1KGG A;  4KQR A;  2P74 A;  5AQ9 A;  5CHJ A;  5KZH A;  1MWR A;  3OC2 A;  4WEL A;  5EOE A;  1KE0 A;  3BFD A;  2J9O A;  4DE0 A;  1L0E A;  2ZQ9 A;  2WZZ A;  1PWD A;  1NRF A;  1YMS A;  3UN7 A;  4QB8 A;  2WKI A;  1FCM A;  3LEZ A;  5A92 A;  2ZQC A;  1BLH A;  2ZQ8 A;  5A93 A;  2IWB A;  1FQG A;  3ZFZ A;  2CC1 A;  5FQK A;  2A49 A;  2V20 A;  4S2J A;  5CGW A;  1JWZ A;  3HLW A;  4PM5 A;  4R1G A;  1ES3 A;  4IBR A;  5CEB A;  1NYY A;  3WS4 A;  4PM8 A;  1NY0 A;  4P85 A;  1HTZ A;  4N9K A;  4XXR A;  3UY6 A;  5DVA A;  3BM6 A;  3MXS A;  4KZ9 A;  2HP9 A;  3ITA A;  2EX9 A;  3HBR A;  4UA9 A;  1BLS A;  2V1Z A;  3VMA A;  3IXD A;  2HP5 A;  3EQU A;  3HLG A;  3PBO A;  5HAR A;  1VQQ A;  1W8Y A;  4U3T A;  5FAO A;  2EFX A;  1W5D A;  4N1X A;  3CJM A;  1ONG A;  5HFO A;  2IWC A;  4U0X A;  5TFQ A;  3MFD A;  1BUE A;  4ZJ1 A;  4KZ6 A;  4EWF A;  1GHP A;  1ZKJ A;  2XR0 A;  1KDW A;  3GRJ A;  4B4Z A;  1M40 A;  3PBS A;  1OME A;  1XPB A;  3UNW A;  4ZJ2 A;  3OPR A;  1WYC A;  4EV4 A;  4DXB A;  3C5A A;  4QJG A;  4E6W A;  2QZ6 A;  4MBH A;  1MWS A;  4OP5 A;  1YLY A;  4UAA A;  3BLM A;  1ESI A;  3E2L A;  3IQA A;  4ZDX A;  1AXB A;  1ES2 A;  1FSY A;  1GHM A;  2PU2 A;  3IH8 A;  4HBU A;  2J8Y A;  1EI5 A;  4N1H A;  5CGX A;  3FV7 A;  4E3L A;  5E2G A;  2Y2I A;  1SDN A;  3N8R A;  4LCL A;  2IWD A;  1LL9 A;  3OCN A;  1L0G A;  1K55 A;  3HRE A;  3GR2 A;  4LV2 A;  2ZMA A;  5CRF A;  4BLM A;  1K57 C;  3M2J A;  1XGJ A;  3FKW A;  3OCL A;  2GDN A;  5E2E A;  5HAI A;  1JWP A;  1IEL A;  4C6Y A;  1GA0 A;  4DDY A;  5FAQ A;  4RVA A;  3BEC A;  3PBN A;  4WMC D;  3C7U A;  2A3U A;  1CI9 A;  2XK1 A;  1N4O A;  3HUO A;  3LO7 A;  4WEK A;  3HL9 A;  1FCN A;  4Z9Q A;  3RXX A;  5EVI B;  3MZE A;  2P9V B;  5EPH A;  5FA7 A;  5KMW A;  4QU3 A;  5FQJ A;  2R9W A;  1S0W A;  3IHA A;  4OOL A;  4EBL A;  1I5Q A;  1PZO A;  2WUQ A;  3G35 A;  4LEN A;  5HAQ A;  3SS4 A;  3SH9 A;  3WS0 A;  3N7W A;  1NYM A;  1YM1 A;  4Y0O A;  5CHU A;  1XXM A;  3HVF A;  4JXV A;  1C3B A;  4GDB A;  5DTT A;  5AQ7 A;  1E4D A;  3WWX A;  1ZC2 A;  4D2O A;  5A91 A;  3UE0 A;  3IHB A;  4WBG A;  5HW3 A;  1XGI A;  4R4R A;  5FQQ A;  3TSG A;  5J8X A;  3O86 A;  3ZVT A;  4DXC A;  2HDQ A;  1LL5 A;  3NBL A;  4C75 A;  1Y54 A;  3IF6 A;  4ZBE A;  4RYE A;  1FOF A;  4DKI A;  5M19 A;  4OQG A;  3LCE A;  1GHI A;  1K25 A;  3O87 A;  3CZD A;  3TG9 A;  1QME A;  3QHY A;  1MPL A;  4WZ4 A;  4GOG A;  2X02 A;  3CG5 A;  4JLF A;  1MY8 A;  4P6B A;  3Q1F A;  4QD4 A;  4S2M A;  1XX2 A;  1IYS A;  1DY6 A;  2VGK A;  3DTM A;  4JKT A;  2C6W B;  2ZJ9 A;  1IKG A;  2XFS A;  3B3X A;  2Y2O A;  4GKU A;  1YLT A;  5FDH A;  4F94 A;  4OVD A;  4R23 A;  3WS1 A;  1RGY A;  4KZ4 A;  1SHV A;  2EFU A;  4LCM A;  3A3J A;  4KZ5 A;  3M6H A;  2Y2Q A;  4OPZ A;  2HPB A;  2FFF B;  3VSL A;  1ERO A;  1L0D A;  1IYP A;  4IVK A;  3V3S A;  2ZQD A;  1W79 A;  4KG2 A;  5KSH A;  1SKF A;  3M2K A;  2XF3 A;  2PBY A;  3AGD A;  3PBR A;  1G6A A;  1KVL A;  1RP5 A;  4B88 A;  1ES4 A;  1WYB A;  1WE4 A;  2WAD A;  3IXH A;  1FR1 A;  3A3D A;  3ZG7 B;  5FQ9 A;  3UO9 A;  4LV3 A;  2VGJ A;  4JF4 A;  2OLV A;  1KE3 A;  4N9L A;  4U0T A;  2FFY A;  3ZGA B;  1JWV A;  3GVB A;  4QY6 A;  3GMW A;  2WAF A;  1XA7 A;  3MKE A;  4NK3 A;  5FQI A;  4S2P A;  4BEN A;  3ZNT A;  5GLD A;  5GLA A;  5FQM A;  2BLS A;  3BLS A;  3ZNY A;  5EVI A;  4CJN A;  3V5M A;  4UA7 A;  2OLU A;  2X71 A;  2OV5 A;  4FCF A;  1TDL A;  3A3I A;  5HAP A;  2HDU A;  2RL3 A;  1U60 A;  4DDS A;  1Z6F A;  4MNR A;  4P87 A;  3W4O A;  4IBX A;  1IYQ A;  1NZO A;  1LI0 A;  3G32 A;  4DF6 A;  1FR6 A;  5AQA A;  4GB7 A;  1PW1 A;  5E43 A;  4ZTK A;  4FH4 A;  4OOM A;  2Z2M B;  3VFH A;  4KZA A;  1PWC A;  4DE3 A;  3NDE A;  1KE4 A;  4LV1 A;  1ONH A;  3FWL A;  4LV0 A;  5IHV A;  4R4S A;  2HDR A;  5U47 A;  4Y0T A;  1YT4 A;  3IH9 A;  2WKH A;  2Y2L A;  3MZD A;  3FYZ A;  3NCK A;  5M1A A;  2ZM0 A;  3ZCZ A;  1VM1 A;  5I94 A;  3PAG A;  3RXW A;  3SH8 A;  2WK0 A;  4OON A;  3O88 A;  1YLW A;  4EQI A;  2Z2L B;  4MBK A;  1K55 C;  4YFM A;  3MXR A;  4OLD A;  5G18 A;  5F83 A;  1ZG6 A;  1N9B A;  2ZM8 A;  2Y2H A;  2DRW A;  1XP4 A;  1RCJ A;  4OKP A;  2G2W A;  1G68 A;  2JE5 A;  4KZ3 A;  2HP6 A;  2WGI A;  4X68 A;  2Y55 A;  4KG5 A;  4OOY A;  4X56 A;  5FI6 A;  5FSR A;  1PI4 A;  5F1G A;  4E3M A;  3LY4 A;  3BFC A;  5GHY A;  3P98 A;  3PAE A;  1MKI A;  1DJB A;  4JPM A;  4E3I A;  2ZC3 B;  4GD6 A;  2ZQ7 A;  2Y4A A;  1DJA A;  3IWO A;  4Y0U A;  4BD1 A;  3Q7V B;  1K6S A;  2QMI A;  4OP8 A;  3O3V A;  5CER A;  4FH2 A;  2J9P A;  2Y2G A;  4PMA A;  4X69 A;  2ZC5 B;  3G31 A;  3IWI A;  3Q82 A;  5EVI D;  1NXY A;  3VP4 A;  4OPY A;  2XLN A;  5EE8 A;  4EUZ A;  4FD8 A;  5DTS A;  5HX9 A;  2XDM A;  1MWU A;  2QPN A;  1ALQ A;  1W8Q A;  4P0M A;  5M18 A;  3IF6 B;  3V39 A;  1PZP A;  3ZHH A;  2ZM2 A;  3GTC A;  2ZC7 A;  3QNB A;  4OPR A;  1BLC A;  3BEB A;  4BQM A;  4FSF A;  5F82 A;  2XGN A;  3AGF A;  4S2I A;  5DF9 A;  5JYO A;  4S2N C;  2Y2J A;  4XUZ A;  4X55 A;  4K91 A;  4MEZ A;  2EX2 A;  5E2F A;  1E3U A;  4E3K A;  5TR7 A;  5DF8 A;  3S1Y A;  1H8Y A;  3ZG8 B;  3PBQ A;  1Q2P A;  4JXW A;  3I7J A;  4NET A;  3UE1 A;  3W4Q A;  2H0T A;  3BFG A;  3E2K A;  3N4I A;  3RJU A;  4Q8I A;  5EOO A;  3A3F A;  3ITB A;  1YMX A;  4BD0 A;  2DNS A;  2Y2M A;  4CPK A;  1BSG A;  3VSK A;  1S6R A;  2ZQA A;  5F1F A;  4Y7P A;  1E25 A;  1PWG A;  4BL2 A;  3DWK A;  1RGZ A;  3N6I A;  1K56 A;  1LLB A;  4A5R A;  2JCH A;  1K56 D;  1TVF A;  2HDS A;  2XFT A;  4IVI A;  3N8S A;  5E2H A;  3SOI A;  1KVM A;  4R3J A;  2DCF A;  5GLC A;  3UDX A;  3W4P A;  5EEC A;  5FAP A;  4KQQ A;  3A3E A;  3VFF A;  3UPN A;  1ZG4 A;  3ZVW A;  4JBF A;  5GLB A;  2UWX A;  5DTK A;  2R9X A;  3FZC A;  3UPP A;  4OQ0 A;  2Y91 A;  2JBF A;  4R0Q A;  1DJC A;  4ZAM A;  1BZA A;  1IYO A;  2XEP A;  3VOY A;  3G2Z A;  3DW0 A;  1LI9 A;  4XUX A;  1XA1 A;  3HUM A;  4DE1 A;  3P09 A;  1O07 A;  4HEF A;  4C3Q A;  3SH7 A;  1ES5 A;  5CHM A;  4B4X A;  1JVJ A;  3G4P A;  3NI9 A;  1YLP A;  3G30 A;  4YIN A;  4UA6 A;  5BOH A;  2ZC6 B;  1FCO A;  1PI5 A;  2B5R A;  1GCE A;  2WKE A;  3FKV A;  3HLC A;  2EX8 A;  4H8R A;  5HL1 A;  4WZ5 A;  3Q81 A;  2XQZ A;  3V50 A;  3BFE A;  4WEJ A;  2I72 A;  1KDS A; 
#chains in the Genus database with same CATH topology
 1YQS A;  2GZA A;  1L0F A;  4FTX A;  1HZO A;  3UDI A;  4X53 A;  2WGV A;  4HY8 A;  3LR4 A;  5CED A;  1JTD A;  5HWW A;  4HI4 A;  1MBL A;  5LBR A;  1P9W A;  2H5S A;  3CMZ A;  3NC8 A;  2A24 B;  1HD8 A;  4JF6 A;  2MJ6 A;  3HLE A;  3NDG A;  3S4X A;  2W1R A;  4GN2 A;  4ZRR A;  1D06 A;  2W3G A;  5FI7 A;  1J3W A;  2JKT M;  4OH0 A;  3VP3 A;  1GA9 A;  4QY5 A;  4II7 A;  1TS7 A;  1LT0 A;  2H10 A;  3T4L A;  5AQB A;  1ERM A;  2V8C A;  3GSG A;  1TEM A;  4N92 A;  3LR5 A;  3IF5 A;  2Q0O A;  4BWI A;  3V3R A;  4G3W A;  3SW1 A;  3JPU A;  1IFQ A;  1CEG A;  3WS2 A;  2B18 A;  4PM7 A;  3OPP A;  4WF0 A;  1ERQ A;  1WA9 A;  4RA7 A;  3QP6 A;  3VP0 A;  5CGS A;  4LPZ A;  3T12 B;  2QKP A;  4OQI A;  4L0L A;  1V9Z A;  3OPL A;  2JKR I;  5F6A A;  5CTM A;  3UB5 P;  1KGE A;  5FAS A;  1K57 A;  2GNX A;  4ETZ A;  1I2W A;  2HZ5 A;  3C4O A;  3G6O A;  5EVI C;  4EUV A;  3NEC A;  2ZLY A;  2EXA A;  3Q7V A;  2E8I A;  5FAT A;  2Y2K A;  5HDS A;  4GNU A;  1OTA A;  4ZJ3 A;  4Y17 A;  4ID4 A;  1Y28 A;  1TDG A;  2VZW A;  2KDK A;  4HJ4 A;  2Y2P A;  3T1S A;  5EUA A;  4LRX C;  3SS3 A;  4K0X A;  3S7Q A;  4GCZ A;  1YLJ A;  1CF0 A;  3SS5 A;  2V1B A;  5TBM A;  1EWZ A;  4JXG A;  3E4Q A;  4PPR A;  1VET B;  3NOU C;  3H82 B;  5CTN A;  5KZH A;  1MWR A;  4WEL A;  3D3O A;  4DE0 A;  1S1Z A;  4F3L B;  4QB8 A;  4HIA A;  4BMW A;  3LEZ A;  2ZQC A;  2IWB A;  3CLO A;  3LEQ A;  3CPT A;  1G6O A;  3K3C A;  3HLW A;  3ZQ5 A;  4KUO A;  3MXS A;  2EX9 A;  3HBR A;  2DMW A;  3UMD A;  2HV1 A;  2HP5 A;  2HJE A;  5FAO A;  3F1P B;  4GJ4 A;  4U0X A;  2OWJ A;  4KZ6 A;  3SZT A;  1ZKJ A;  1M40 A;  2KX6 A;  3PBS A;  3U4L P;  3OPR A;  4QJG A;  1S4R A;  4I5S A;  4NXF A;  1YLY A;  1FSY A;  1FIL A;  5HZH A;  2Y2I A;  3N8R A;  3TJZ C;  3HRE A;  2VX8 A;  2ZMA A;  5AVE A;  3NUL A;  3F1P A;  3OCL A;  2GDN A;  5E2E A;  1IEL A;  4C6Y A;  4RVA A;  3C7U A;  1CI9 A;  3HL9 A;  1FCN A;  4XT2 A;  4AFI A;  4WL9 A;  3BJN A;  4MDZ A;  4QU3 A;  3W2Z A;  3IHA A;  4OOL A;  5DKL A;  3LFV A;  4I3A A;  2ZMV A;  4Q0J A;  1YM1 A;  4Y0O A;  3NHQ A;  3HVF A;  3WWX A;  1C3B A;  4GDB A;  5AQ7 A;  4D2O A;  1AWI A;  3PHY A;  5A91 A;  4NXG A;  3LIF A;  3TSG A;  3ZVT A;  2OAP 1;  1G28 A;  1GHI A;  3CZD A;  3LIB A;  4MN7 A;  4WLA A;  1DY6 A;  2VGK A;  2XFS A;  1YLT A;  4F94 A;  4OVD A;  3MMH A;  4EET B;  1SHV A;  2OAQ 1;  5TJJ A;  3A3J A;  4KZ5 A;  2HPB A;  3V3S A;  3BW6 A;  1W79 A;  5KSH A;  1SKF A;  3FPV A;  3PBR A;  2L4R A;  1ES4 A;  3ZG7 B;  4MMN A;  2OLV A;  1JWV A;  4EW7 A;  2WAF A;  1XA7 A;  3MKE A;  4NK3 A;  2EA9 A;  3ZNT A;  5HWT A;  4UA7 A;  2X71 A;  1T1C A;  2RL3 A;  1U60 A;  3EEA A;  1IYQ A;  4DF6 A;  4GB7 A;  4HOI A;  3NDE A;  4L9E A;  3FWL A;  4Y0T A;  2WKH A;  2Y2L A;  3MZD A;  3FYZ A;  1SKO A;  5M1A A;  3C30 A;  1VM1 A;  5I94 A;  3PAG A;  3RXW A;  3LR0 A;  5FDS A;  1A0K A;  5G4Y A;  5F83 A;  2VGL S;  1N9B A;  3DTI A;  2Y2H A;  4O8G A;  3K3D A;  1H0M A;  3A0R A;  5G4Z A;  2GJ3 A;  4X68 A;  4KG5 A;  4Q0I A;  3BFC A;  3PAE A;  4JPM A;  4E3I A;  3LID A;  2VA0 A;  2ZQ7 A;  3KSH A;  3IWO A;  3Q7V B;  1K6S A;  2QMI A;  1LSX A;  2J9P A;  3G31 A;  5J3W A;  4OPY A;  5EE8 A;  3EGX C;  5DTS A;  5HX9 A;  4M4X A;  4PAU A;  2PYP A;  1H8M A;  2QPN A;  2ZM2 A;  1BLC A;  3BEB A;  3H82 A;  4S2N C;  4PKY A;  1Y4O A;  5TR7 A;  1N9L A;  5TBM B;  3S1Y A;  1Q2P A;  2PR6 A;  3I7J A;  3A0V A;  3BFG A;  3RJU A;  1TS6 A;  1JNU A;  4Q8I A;  2FZ0 A;  3C2W A;  3JVU A;  1BSG A;  1S6R A;  5F1F A;  2VJW A;  1PWG A;  1XFQ A;  3DWK A;  1RGZ A;  1X0O A;  2JCH A;  3LYX A;  3UDX A;  5GLC A;  2DCF A;  2V0W A;  5EEC A;  5FAP A;  3A3E A;  3VFF A;  3VE4 A;  1ZG4 A;  3UPP A;  4KUK A;  2Y91 A;  4R0Q A;  2K2N A;  3VOY A;  3HUM A;  1O07 A;  1UWN X;  5DFY A;  4EQ1 A;  4B4X A;  2B95 A;  3G4P A;  4EU0 A;  1FIK A;  1YLP A;  2XRN A;  1FCO A;  1PI5 A;  1GCE A;  2WKE A;  4H8R A;  3Q81 A;  2FH5 A;  5CHU A;  5FSR A;  5DJU A;  2PAV P;  3UPO A;  3UDF A;  3D9Y A;  3VP1 A;  4CLC C;  3EWK A;  3GQZ A;  5FL3 A;  5F68 A;  1O7E A;  4GD8 A;  4O7D A;  2LB9 A;  4RX2 A;  1FSW A;  3Q07 A;  2WZX A;  1Q2Q A;  2Y79 A;  1F5M A;  4M3K A;  2ZOH A;  4UQI M;  2PU4 A;  2ZC4 B;  4HES A;  3UE3 A;  3IXB A;  3OPH A;  4JF5 A;  3UE6 A;  3BYD A;  3CIT A;  1NJ4 A;  5D3O A;  1BTL A;  4NXB A;  2P9V A;  3HLF A;  3MF0 A;  2XA7 S;  4KZB A;  1SKO B;  4JXS A;  3LGO A;  4DJ2 A;  2Y59 A;  1IEM A;  4G3V A;  4HH3 A;  2GX5 A;  2C5W B;  1CI8 A;  4HBT A;  3NY4 A;  1NZU A;  3E4P A;  5DJT A;  5GHZ A;  1G5U A;  5F5Y A;  3TOI A;  2Q9M A;  2V2F F;  1TS8 A;  2WAE A;  5HL6 A;  1VEU B;  5L2F A;  5FEG A;  1QMF A;  3LY3 A;  3JYI A;  4EER A;  2JKT I;  3N8L A;  1Z09 A;  4KG6 A;  2WYX A;  1BUL A;  1K4E A;  3WRT A;  1CEF A;  1PYY A;  4K0W A;  4KEN B;  5CXW A;  4Y15 A;  1OJG A;  3A0S A;  3OC2 A;  4JGP A;  3BFD A;  1L0E A;  2ZQ9 A;  2WZZ A;  1W63 M;  1BLH A;  2L1M A;  2CC1 A;  5FQK A;  3V67 A;  2V20 A;  4S2J A;  4PM5 A;  4R1G A;  1ES3 A;  5CEB A;  1NYY A;  1HTZ A;  2XSS A;  4HJ6 A;  3UY6 A;  2ZL1 B;  1YSP A;  2V1A A;  2HP9 A;  3ITA A;  5J7E A;  3KSF A;  3CUE C;  3VMA A;  2O0Y A;  3EQU A;  3HLG A;  5HAR A;  5EVE A;  5AJG A;  1W8Y A;  3P7N A;  3UB6 A;  3DAV A;  2EFX A;  5MC7 A;  2Z6C A;  4N1X A;  3CJM A;  1ONG A;  2B02 A;  5TFQ A;  3JVV A;  4R6L A;  3C8C A;  4ZJ2 A;  4YOF A;  2YKF A;  1WYC A;  5EFW A;  4DXB A;  3C5A A;  2QZ6 A;  3BLM A;  3E2L A;  1ES2 A;  1GHM A;  2PU2 A;  2J8Y A;  1EI5 A;  5CX7 A;  1SDN A;  2IWD A;  1L0G A;  4LV2 A;  5CRF A;  3DBA A;  2CMN A;  3T4Q A;  4BLM A;  2NUP C;  1XGJ A;  2PYR A;  4K08 A;  2E8J A;  3UME A;  2XK1 A;  3RXX A;  4Z9Q A;  5EVI B;  2XRO A;  3MZE A;  2P9V B;  5EPH A;  5KMW A;  1XJ2 A;  2R9W A;  1I5Q A;  1PZO A;  3SH9 A;  3WS0 A;  3IS2 B;  4HH2 A;  4JXV A;  5L10 A;  3UE0 A;  5HW3 A;  4CQH A;  1XGI A;  4R4R A;  5FQQ A;  2EWW A;  4CLC A;  2HDQ A;  3L9K A;  4NKP A;  1FOF A;  4DKI A;  3FG8 A;  3ZYT A;  1K25 A;  3QHY A;  1MPL A;  4P6B A;  4X25 A;  2C6W B;  1IKG A;  2Y2O A;  4GKU A;  1RGY A;  2M1C A;  3KSG A;  4OPZ A;  2FFF B;  1ERO A;  1L0D A;  3M2K A;  4B9O A;  1ZHH B;  5HWV A;  1WYB A;  2WAD A;  3A3D A;  5FQ9 A;  2LB5 A;  2VGJ A;  4N9L A;  1F98 A;  2ZBB A;  4PKY G;  1GSW A;  4GHI B;  4WN5 A;  4X1M A;  3ZNY A;  4JGQ A;  1TDL A;  3A3I A;  4I3J A;  1XJ3 A;  1S66 L;  2JHE A;  4IJG A;  1Z6F A;  4P87 A;  2XA7 M;  1LI0 A;  1DP9 A;  1FR6 A;  4QWO A;  5AQA A;  4ESP A;  3VFH A;  3P01 A;  2P7J A;  1YT4 A;  1HLU P;  1YLW A;  4GS9 A;  4OLD A;  1NWZ A;  1OTI A;  2ZM8 A;  1XP4 A;  3F1N A;  1GSX A;  5J4E A;  2HP6 A;  2WGI A;  2Y55 A;  1H3Q A;  4EES A;  3S7N A;  3P98 A;  4GD6 A;  3CAX A;  4HNB A;  5CER A;  3O3V A;  3KYQ A;  3IWI A;  5EVI D;  1PFL A;  2XLN A;  4FD8 A;  2XDM A;  5M18 A;  3V39 A;  2K7S A;  4FSF A;  2JKG A;  1L3L A;  4E3K A;  4K91 A;  2EX2 A;  1E3U A;  5EM1 A;  3W4Q A;  3E2K A;  1MC0 A;  5EOO A;  5L09 A;  1YMX A;  2PR5 A;  2DNS A;  4CPK A;  3VSK A;  3KSI A;  1VET A;  4BL2 A;  1SZV A;  3MFX A;  1VEU A;  2HDS A;  4IVI A;  3SOI A;  1OT9 A;  3HJK A;  2YKH A;  4WUJ A;  3B47 A;  4JBF A;  4R70 A;  4HP9 A;  2JKF A;  1DJC A;  4ZAM A;  1IYO A;  4B93 A;  1XA1 A;  4DE1 A;  3P09 A;  2V9A A;  1JVJ A;  4CLC E;  5BOH A;  5HL1 A;  2XQZ A;  4FUW A;  3BFE A;  4WEJ A;  2I72 A;  1KDS A;  4E3J A;  3WRZ A;  4S2O A;  3IX3 A;  4GW9 A;  2VEA A;  1XKZ A;  4EBN A;  5TGF A;  2WGW B;  4UHU A;  4GZB A;  4O01 A;  3T1Q B;  1PRQ A;  2RCX A;  2QHK A;  3KYE A;  3MKF A;  3VOZ A;  2JKR M;  5EV0 A;  2WKQ A;  3NIA A;  5GHX A;  3OLO A;  2P08 A;  4WM9 A;  1ESU A;  3HLD A;  4BL3 A;  5JYP A;  4HP4 A;  4KZ7 A;  1TF1 A;  2VV6 A;  1MWT A;  2R78 A;  3LI8 A;  4GDN A;  1H8Z A;  3IT9 A;  2D01 A;  4JGO A;  3CUE A;  1BLP A;  2HGV A;  3WS5 A;  4E3O A;  4XT2 B;  3PBT A;  4LLO B;  1NLZ A;  3GV9 A;  1KGF A;  2J3T C;  3ZDJ A;  2W0N A;  5DF7 A;  5FI2 A;  1P97 A;  1YLZ A;  2XD1 A;  1IKI A;  4PM9 A;  4BBV A;  4MLL A;  3ZG9 B;  4IUH A;  4OQH A;  3QNC A;  4E6X A;  1K54 C;  1J9M A;  2OSU A;  4OPQ A;  3C7V A;  3G34 A;  2G2U A;  1S1Y A;  4RX3 A;  3AGE A;  1P0Z A;  3IF6 C;  3QP1 A;  3BFF A;  1DP6 A;  1ZTU A;  3MXQ A;  1BT5 A;  4WZ5 C;  4Q0H A;  2EXB A;  2G7U A;  3IWQ A;  5AQ9 A;  2P74 A;  5CHJ A;  1KE0 A;  3EOI A;  1PWD A;  2WKI A;  1LSV A;  4CLC D;  1KOU A;  3LIC A;  1FQG A;  3ZFZ A;  2A49 A;  2HF6 A;  3IX4 A;  4IBR A;  4PM8 A;  3T1X A;  4N9K A;  1TS0 A;  5DVA A;  3BM6 A;  4KZ9 A;  4UA9 A;  1BLS A;  1MZU A;  2V0U A;  2V1Z A;  1D1J A;  2PD7 A;  3S7P A;  3PBO A;  2W3F A;  4G3K A;  1W5D A;  2QJ7 A;  3T4J A;  5HFO A;  1XFN A;  4IUK A;  2IWC A;  5HSQ A;  4ZJ1 A;  4EWF A;  5IU1 A;  3GRJ A;  4X1L A;  3F1O B;  3UNW A;  2KOI A;  1T19 A;  4EV4 A;  1CQA A;  4MBH A;  2INW A;  4OP5 A;  4UAA A;  1ESI A;  1AXB A;  3IH8 A;  4HBU A;  5CGX A;  2UV0 E;  3FV7 A;  2PRF A;  1LL9 A;  3OCN A;  1MKM A;  3M2J A;  3FKW A;  5HAI A;  1JWP A;  4DDY A;  5L8M A;  3VOL A;  3MJQ A;  5FAQ A;  3PBN A;  4WMC D;  1YKD A;  1N4O A;  4WEK A;  3T50 A;  3H7W B;  1T1A A;  3PYP A;  5AVF A;  2BTF P;  5FA7 A;  5FQJ A;  2O9C A;  1S0W A;  4EBL A;  3CPT B;  5EM0 A;  2WUQ A;  5FEF A;  3G35 A;  5HAQ A;  3N7W A;  4F3L A;  1K0K A;  1E4D A;  3PR6 A;  3IHB A;  5HDC A;  2JN7 A;  5J8X A;  5DKK A;  2VK3 A;  1IOU A;  4C75 A;  1Y54 A;  3IF6 A;  4O0P A;  4RYE A;  3LCE A;  1S67 L;  2D02 A;  4D60 A;  4Y3I A;  4GOG A;  2X02 A;  3CG5 A;  4NG2 A;  2J3T D;  3F1N B;  1IYS A;  3DTM A;  4JKT A;  3B3X A;  5FDH A;  3WS1 A;  1DP8 A;  2EFU A;  1ODV A;  3M6H A;  4QPR A;  2Y2Q A;  4P6Z S;  4IVK A;  1IYP A;  1XJ6 A;  3VE3 A;  1UWP X;  2H28 A;  3AGD A;  1RP5 A;  5HD5 A;  2OOL A;  1WE4 A;  3IXH A;  1FR1 A;  4LV3 A;  1KE3 A;  3ICY A;  3UB8 A;  3ZGA B;  3GVB A;  3GMW A;  4ARZ B;  4BEN A;  3FC7 A;  4CJN A;  2M7V A;  2OLU A;  2NUT C;  5HAP A;  2HDU A;  5IT5 A;  3D72 A;  4DDS A;  3W4O A;  4IBX A;  3G32 A;  4ZTK A;  5HD3 A;  4FH4 A;  4OOM A;  3RTY A;  4KZA A;  1PWC A;  3VV4 A;  4DE3 A;  1ACF A;  3IH9 A;  3T4T A;  3NCK A;  3KYZ A;  3OOV A;  3O88 A;  4MCW A;  4UQI S;  2WKR A;  2Z2L B;  1GSV A;  4P6Z M;  3MXR A;  5G18 A;  1ZG6 A;  3HJI A;  1BYW A;  2DRW A;  2G2W A;  1G68 A;  2JE5 A;  1NRJ A;  1F2K A;  3K2N A;  1DRM A;  1PI4 A;  2W1T A;  3H7W A;  3R4K A;  1MKI A;  1V9Y A;  4KQD A;  4BD1 A;  2V8F A;  4OP8 A;  1N9O A;  2ZC5 B;  3Q82 A;  1NXY A;  4DMZ A;  1ALQ A;  3UB9 A;  3GTC A;  4NEE D;  4H6J B;  2I9V A;  3QP4 A;  5HDD A;  3AGF A;  2W27 A;  5JYO A;  1UGU A;  4GHI A;  4X55 A;  5E2F A;  1VHM A;  4L9G A;  1H8Y A;  3TW8 A;  3ZG8 B;  3UE1 A;  4NET A;  2H0T A;  1T18 A;  1D7E A;  3N4I A;  2VV7 A;  3ITB A;  4YWZ A;  2Y2M A;  4Y7P A;  1E25 A;  4EEU A;  4A5R A;  1TVF A;  2XFT A;  5L07 A;  5E2H A;  5KIZ A;  4R3J A;  4MN6 A;  3W4P A;  3U2A A;  4R38 A;  3R7W A;  4RQ9 A;  4MN5 A;  3UPN A;  2UWX A;  5DTK A;  1BZA A;  2XEP A;  3G2Z A;  2P04 A;  3DW0 A;  4XUX A;  2A24 A;  4C3Q A;  3SH7 A;  1ES5 A;  5DFX A;  5C5K A;  2PHY A;  4ETX A;  3NI9 A;  4UA6 A;  4HJ3 A;  4PHT A;  1YPR A;  2EWV A;  3HLC A;  3TE8 A;  4WZ5 A;  3V50 A;  3MQO A;  3CWF A;  1W7F A;  4IED A;  3OZH A;  1OTE A;  3M6B A;  4Y13 A;  2JC7 A;  1SCW A;  4DN0 A;  5A8B A;  2ZL1 A;  4S2K A;  1L2S A;  1N9N A;  1CJF A;  1H5X A;  3HLB A;  4X6T A;  3EQV A;  3DWZ A;  5IS1 A;  4S2N A;  4R3A A;  3PTE A;  3W8K A;  5HPI A;  2Q9N A;  4Y5F A;  3G2Y A;  3ISG A;  1SDE A;  4DRT A;  5HPF A;  4KZ8 A;  4WMC A;  5CEC A;  5GL9 A;  1CK3 A;  1LSW A;  1S4S A;  3L7H A;  3GDI A;  2OWH A;  3IXG A;  5EVL A;  1PIO A;  2W3H A;  1PW8 A;  2PD8 A;  3MBZ A;  4BJP A;  5KSC A;  1MXO A;  4KQO A;  2WKP A;  1OTD A;  3IX8 A;  2XD5 A;  3ZG0 A;  4EBP A;  3EGD C;  3ZG5 A;  1T1B A;  2BG1 A;  2BAS A;  3NOP C;  3MZF A;  4BBT A;  1I2S A;  1YSQ A;  1K38 A;  3DTK A;  3BY8 A;  3BRM A;  4E3N A;  1LHY A;  3IBJ A;  4S2L A;  1K6R A;  4I38 A;  2X01 A;  3FPW A;  1K54 A;  4LFU A;  4Z1W A;  4WYY A;  1JTG A;  2XH9 A;  1K4F A;  4FOF A;  5A90 A;  4QHC A;  2H0Y A;  4DE2 A;  1M6K A;  2WGW A;  3HUN A;  4PM6 A;  1E3U D;  3VP2 A;  2EX6 A;  3S22 A;  4MBF A;  4EXO A;  2Z6D A;  2VGL M;  4R3B A;  1HVB A;  3RH8 B;  2Y2N A;  3D4F A;  4OLG A;  3MS6 A;  3Q7Z A;  2ZD8 A;  3CI6 A;  3C4P A;  3RFB A;  2J7V A;  2K31 A;  1KGG A;  2W1T B;  4KQR A;  5EOE A;  3B42 A;  2J9O A;  3LUQ A;  1P9R A;  1NRF A;  2PDR A;  3NJA A;  1YMS A;  3UN7 A;  2PBD P;  4ME4 A;  1FCM A;  5A92 A;  5A93 A;  2ZQ8 A;  3KO6 A;  2AVX A;  5CGW A;  1JWZ A;  3PXP A;  4DJ3 A;  3WS4 A;  1NY0 A;  4P85 A;  2KLI A;  4XXR A;  3BQ8 A;  3LIA A;  3KX0 X;  3OBF A;  3IXD A;  1VQQ A;  3ULF A;  1OTB A;  4U3T A;  2VLG A;  2VKS A;  1OPX A;  3HCY A;  3MFD A;  1BUE A;  3C38 A;  1GHP A;  2XR0 A;  3S7O A;  1KDW A;  4HHD A;  4B4Z A;  1OME A;  1XPB A;  4GS9 B;  3T4K A;  3LIE A;  4L9F A;  4E6W A;  1MWS A;  1TD5 A;  4UEY A;  3DTE A;  3LI9 A;  3IQA A;  4ZDX A;  4N1H A;  3CHW P;  4E3L A;  5E2G A;  4LCL A;  1F9I A;  4NXE A;  1K55 A;  4I39 A;  3GR2 A;  3LR3 A;  1K57 C;  1GA0 A;  3BEC A;  3IS2 A;  4EEP A;  2A3U A;  3O5Y A;  3HUO A;  3LO7 A;  4H6J A;  3BY9 A;  2ZMF A;  4LEN A;  3SS4 A;  1NYM A;  3BQA A;  1XXM A;  5DTT A;  1ZC2 A;  4WBG A;  3O86 A;  4DXC A;  3NBL A;  1LL5 A;  4ZBE A;  5M19 A;  4OQG A;  3O87 A;  3TG9 A;  1QME A;  4WZ4 A;  4JLF A;  1MY8 A;  3T4S A;  3T1R A;  3Q1F A;  4QD4 A;  4S2M A;  1XX2 A;  2ZJ9 A;  3QP5 A;  4R23 A;  2VV8 A;  4KZ4 A;  4LCM A;  2ZOI A;  3B33 A;  4E04 A;  3EEH A;  3VSL A;  2ZQD A;  4KG2 A;  2XF3 A;  2PBY A;  1G6A A;  1KVL A;  4B88 A;  1EW0 A;  3UO9 A;  4JF4 A;  1XJ4 A;  4U0T A;  2FFY A;  3IBR A;  4QY6 A;  5FQI A;  4S2P A;  5GLD A;  5GLA A;  5FQM A;  2BLS A;  4LRY C;  3BLS A;  2QWS A;  5EVI A;  3UB7 A;  3V5M A;  2OV5 A;  4FCF A;  2O9A A;  4MNR A;  1NZO A;  3MQ0 A;  1PW1 A;  5E43 A;  2Z2M B;  4ARZ A;  1KE4 A;  4LV1 A;  3E98 A;  1ONH A;  4LV0 A;  5IHV A;  4R4S A;  3BWL A;  2HDR A;  5U47 A;  4CLC B;  2J3W A;  2ZM0 A;  3ZCZ A;  3R7W B;  1OJ5 A;  2J80 A;  3SH8 A;  2WK0 A;  4OON A;  4EQI A;  2M7U A;  4MBK A;  1K55 C;  4YFM A;  4BBU A;  3T4O A;  1STZ A;  4IHQ A;  4I3I A;  5K5B A;  4LRZ E;  1RCJ A;  4OKP A;  4YNR A;  4KZ3 A;  4OOY A;  4X56 A;  5FI6 A;  5F1G A;  4E3M A;  3LY4 A;  5GHY A;  3NOT C;  2L0W A;  1LL8 A;  1DJB A;  2ZC3 B;  2O9B A;  2Y4A A;  1DJA A;  4Y0U A;  4FH2 A;  2Y2G A;  3MQQ A;  4PMA A;  4X69 A;  2Y8H A;  2IA2 A;  1NLY A;  3VP4 A;  4EUZ A;  3E4O A;  1MWU A;  1W8Q A;  3MR0 A;  2A2L A;  3IF6 B;  4P0M A;  1PZP A;  3ZHH A;  3QNB A;  4OPR A;  2ZC7 A;  4BQM A;  5F82 A;  2XGN A;  4S2I A;  5DF9 A;  3GEC A;  2Y2J A;  4XUZ A;  4MEZ A;  5DF8 A;  2W3E A;  3PBQ A;  4JXW A;  2HJ9 C;  3MSH A;  2O99 A;  3A3F A;  3QP2 A;  2ACG A;  4BD0 A;  4HQA A;  2QYB A;  1OT6 A;  4Y2F A;  2ZQA A;  4LGW A;  3TRC A;  3N6I A;  1K56 A;  1LLB A;  3H9W A;  5F69 A;  2QJ5 A;  1K56 D;  3N8S A;  1PNE A;  2W3D A;  1KVM A;  4KQQ A;  4JGR A;  3ZVW A;  5GLB A;  1VB6 A;  2R9X A;  3FZC A;  4OQ0 A;  2JBF A;  1LI9 A;  1W63 Q;  4GLQ A;  5I5L A;  4HEF A;  3E0Y A;  5CHM A;  3G30 A;  4YIN A;  3F1O A;  2ZC6 B;  2B5R A;  3QP8 A;  3FKV A;  2EX8 A;  2PT7 A;  1YAX A; 
#chains in the Genus database with same CATH homology
 4E3J A;  1W7F A;  1YQS A;  4IED A;  3WRZ A;  4S2O A;  3OZH A;  1L0F A;  3M6B A;  3UPO A;  1HZO A;  3UDF A;  3UDI A;  4X53 A;  2JC7 A;  2WGV A;  1XKZ A;  1SCW A;  5CED A;  4EBN A;  1JTD A;  3VP1 A;  5TGF A;  1MBL A;  2H5S A;  2WGW B;  1L2S A;  3CMZ A;  4S2K A;  3NC8 A;  4UHU A;  1H5X A;  1HD8 A;  3HLB A;  3GQZ A;  4GZB A;  4JF6 A;  4X6T A;  3HLE A;  3NDG A;  3EQV A;  3S4X A;  1O7E A;  4GN2 A;  3DWZ A;  4S2N A;  2RCX A;  4GD8 A;  3PTE A;  4O7D A;  5FI7 A;  3MKF A;  3VOZ A;  4RX2 A;  3W8K A;  2Q9N A;  4OH0 A;  3VP3 A;  1GA9 A;  1FSW A;  3G2Y A;  3Q07 A;  4QY5 A;  3ISG A;  1SDE A;  4DRT A;  2WZX A;  1Q2Q A;  4KZ8 A;  3NIA A;  4WMC A;  2H10 A;  5GHX A;  5CEC A;  4M3K A;  1CK3 A;  5GL9 A;  4WM9 A;  5AQB A;  1ESU A;  3HLD A;  4BL3 A;  1ERM A;  3IXG A;  3GSG A;  1TEM A;  4N92 A;  5EVL A;  3IF5 A;  5JYP A;  1PIO A;  1PW8 A;  3V3R A;  3MBZ A;  4KZ7 A;  4BJP A;  5KSC A;  2PU4 A;  1MXO A;  2ZC4 B;  1MWT A;  4HES A;  1CEG A;  3IXB A;  4KQO A;  3UE3 A;  3WS2 A;  4PM7 A;  2XD5 A;  3OPP A;  3ZG0 A;  4EBP A;  1ERQ A;  4GDN A;  3OPH A;  4RA7 A;  3ZG5 A;  3VP0 A;  2BG1 A;  4JF5 A;  5CGS A;  1H8Z A;  3BYD A;  1NJ4 A;  3MZF A;  4L0L A;  3OPL A;  3IT9 A;  4OQI A;  5D3O A;  1BTL A;  1BLP A;  3WS5 A;  5CTM A;  1KGE A;  2P9V A;  4E3O A;  1I2S A;  3HLF A;  5FAS A;  1K57 A;  4KZB A;  1I2W A;  3PBT A;  3GV9 A;  3C4O A;  4JXS A;  5EVI C;  1K38 A;  1KGF A;  2Y59 A;  1IEM A;  3ZDJ A;  3BRM A;  5DF7 A;  5FI2 A;  2ZLY A;  4E3N A;  2EXA A;  1LHY A;  1YLZ A;  2C5W B;  2XD1 A;  1IKI A;  3Q7V A;  4PM9 A;  2E8I A;  4MLL A;  1CI8 A;  3ZG9 B;  4S2L A;  4OQH A;  1K6R A;  5FAT A;  2X01 A;  3QNC A;  4HBT A;  2Y2K A;  4GNU A;  1K54 A;  3NY4 A;  4ZJ3 A;  4ID4 A;  1NZU A;  4WYY A;  1JTG A;  1TDG A;  5GHZ A;  2Y2P A;  2XH9 A;  3TOI A;  4E6X A;  1K4F A;  1K54 C;  5A90 A;  2Q9M A;  2H0Y A;  2V2F F;  4QHC A;  4DE2 A;  1M6K A;  1J9M A;  2OSU A;  2WGW A;  4OPQ A;  2WAE A;  3HUN A;  4PM6 A;  1E3U D;  3C7V A;  3G34 A;  5EUA A;  5L2F A;  3SS3 A;  4K0X A;  3VP2 A;  2EX6 A;  1QMF A;  3S22 A;  4MBF A;  2G2U A;  4RX3 A;  4R3B A;  1YLJ A;  1HVB A;  3AGE A;  2Y2N A;  3D4F A;  3LY3 A;  3JYI A;  3IF6 C;  4OLG A;  3BFF A;  3SS5 A;  3N8L A;  3Q7Z A;  2ZD8 A;  1BT5 A;  2WYX A;  4KG6 A;  1BUL A;  1K4E A;  4WZ5 C;  1CEF A;  1EWZ A;  3WRT A;  4JXG A;  1PYY A;  2EXB A;  4K0W A;  3C4P A;  4KEN B;  4PPR A;  2J7V A;  3IWQ A;  5CXW A;  5CTN A;  1KGG A;  4KQR A;  2P74 A;  5AQ9 A;  5CHJ A;  5KZH A;  1MWR A;  3OC2 A;  4WEL A;  5EOE A;  1KE0 A;  3BFD A;  2J9O A;  4DE0 A;  1L0E A;  2ZQ9 A;  2WZZ A;  1PWD A;  1NRF A;  1YMS A;  3UN7 A;  4QB8 A;  2WKI A;  1FCM A;  3LEZ A;  5A92 A;  2ZQC A;  1BLH A;  2ZQ8 A;  5A93 A;  2IWB A;  1FQG A;  3ZFZ A;  2CC1 A;  5FQK A;  2A49 A;  2V20 A;  4S2J A;  5CGW A;  1JWZ A;  3HLW A;  4PM5 A;  4R1G A;  1ES3 A;  4IBR A;  5CEB A;  1NYY A;  3WS4 A;  4PM8 A;  1NY0 A;  4P85 A;  1HTZ A;  4N9K A;  4XXR A;  3UY6 A;  5DVA A;  3BM6 A;  3MXS A;  4KZ9 A;  2HP9 A;  3ITA A;  2EX9 A;  3HBR A;  4UA9 A;  1BLS A;  2V1Z A;  3VMA A;  3IXD A;  2HP5 A;  3EQU A;  3HLG A;  3PBO A;  5HAR A;  1VQQ A;  1W8Y A;  4U3T A;  5FAO A;  2EFX A;  1W5D A;  4N1X A;  3CJM A;  1ONG A;  5HFO A;  2IWC A;  4U0X A;  5TFQ A;  3MFD A;  1BUE A;  4ZJ1 A;  4KZ6 A;  4EWF A;  1GHP A;  1ZKJ A;  2XR0 A;  1KDW A;  3GRJ A;  4B4Z A;  1M40 A;  3PBS A;  1OME A;  1XPB A;  3UNW A;  4ZJ2 A;  3OPR A;  1WYC A;  4EV4 A;  4DXB A;  3C5A A;  4QJG A;  4E6W A;  2QZ6 A;  4MBH A;  1MWS A;  4OP5 A;  1YLY A;  4UAA A;  3BLM A;  1ESI A;  3E2L A;  3IQA A;  4ZDX A;  1AXB A;  1ES2 A;  1FSY A;  1GHM A;  2PU2 A;  3IH8 A;  4HBU A;  2J8Y A;  1EI5 A;  4N1H A;  5CGX A;  3FV7 A;  4E3L A;  5E2G A;  2Y2I A;  1SDN A;  3N8R A;  4LCL A;  2IWD A;  1LL9 A;  3OCN A;  1L0G A;  1K55 A;  3HRE A;  3GR2 A;  4LV2 A;  2ZMA A;  5CRF A;  4BLM A;  1K57 C;  3M2J A;  1XGJ A;  3FKW A;  3OCL A;  2GDN A;  5E2E A;  5HAI A;  1JWP A;  1IEL A;  4C6Y A;  1GA0 A;  4DDY A;  5FAQ A;  4RVA A;  3BEC A;  3PBN A;  4WMC D;  3C7U A;  2A3U A;  1CI9 A;  2XK1 A;  1N4O A;  3HUO A;  3LO7 A;  4WEK A;  3HL9 A;  1FCN A;  4Z9Q A;  3RXX A;  5EVI B;  3MZE A;  2P9V B;  5EPH A;  5FA7 A;  5KMW A;  4QU3 A;  5FQJ A;  2R9W A;  1S0W A;  3IHA A;  4OOL A;  4EBL A;  1I5Q A;  1PZO A;  2WUQ A;  3G35 A;  4LEN A;  5HAQ A;  3SS4 A;  3SH9 A;  3WS0 A;  3N7W A;  1NYM A;  1YM1 A;  4Y0O A;  5CHU A;  1XXM A;  3HVF A;  4JXV A;  1C3B A;  4GDB A;  5DTT A;  5AQ7 A;  1E4D A;  3WWX A;  1ZC2 A;  4D2O A;  5A91 A;  3UE0 A;  3IHB A;  4WBG A;  5HW3 A;  1XGI A;  4R4R A;  5FQQ A;  3TSG A;  5J8X A;  3O86 A;  3ZVT A;  4DXC A;  2HDQ A;  1LL5 A;  3NBL A;  4C75 A;  1Y54 A;  3IF6 A;  4ZBE A;  4RYE A;  1FOF A;  4DKI A;  5M19 A;  4OQG A;  3LCE A;  1GHI A;  1K25 A;  3O87 A;  3CZD A;  3TG9 A;  1QME A;  3QHY A;  1MPL A;  4WZ4 A;  4GOG A;  2X02 A;  3CG5 A;  4JLF A;  1MY8 A;  4P6B A;  3Q1F A;  4QD4 A;  4S2M A;  1XX2 A;  1IYS A;  1DY6 A;  2VGK A;  3DTM A;  4JKT A;  2C6W B;  2ZJ9 A;  1IKG A;  2XFS A;  3B3X A;  2Y2O A;  4GKU A;  1YLT A;  5FDH A;  4F94 A;  4OVD A;  4R23 A;  3WS1 A;  1RGY A;  4KZ4 A;  1SHV A;  2EFU A;  4LCM A;  3A3J A;  4KZ5 A;  3M6H A;  2Y2Q A;  4OPZ A;  2HPB A;  2FFF B;  3VSL A;  1ERO A;  1L0D A;  1IYP A;  4IVK A;  3V3S A;  2ZQD A;  1W79 A;  4KG2 A;  5KSH A;  1SKF A;  3M2K A;  2XF3 A;  2PBY A;  3AGD A;  3PBR A;  1G6A A;  1KVL A;  1RP5 A;  4B88 A;  1ES4 A;  1WYB A;  1WE4 A;  2WAD A;  3IXH A;  1FR1 A;  3A3D A;  3ZG7 B;  5FQ9 A;  3UO9 A;  4LV3 A;  2VGJ A;  4JF4 A;  2OLV A;  1KE3 A;  4N9L A;  4U0T A;  2FFY A;  3ZGA B;  1JWV A;  3GVB A;  4QY6 A;  3GMW A;  2WAF A;  1XA7 A;  3MKE A;  4NK3 A;  5FQI A;  4S2P A;  4BEN A;  3ZNT A;  5GLD A;  5GLA A;  5FQM A;  2BLS A;  3BLS A;  3ZNY A;  5EVI A;  4CJN A;  3V5M A;  4UA7 A;  2OLU A;  2X71 A;  2OV5 A;  4FCF A;  1TDL A;  3A3I A;  5HAP A;  2HDU A;  2RL3 A;  1U60 A;  4DDS A;  1Z6F A;  4MNR A;  4P87 A;  3W4O A;  4IBX A;  1IYQ A;  1NZO A;  1LI0 A;  3G32 A;  4DF6 A;  1FR6 A;  5AQA A;  4GB7 A;  1PW1 A;  5E43 A;  4ZTK A;  4FH4 A;  4OOM A;  2Z2M B;  3VFH A;  4KZA A;  1PWC A;  4DE3 A;  3NDE A;  1KE4 A;  4LV1 A;  1ONH A;  3FWL A;  4LV0 A;  5IHV A;  4R4S A;  2HDR A;  5U47 A;  4Y0T A;  1YT4 A;  3IH9 A;  2WKH A;  2Y2L A;  3MZD A;  3FYZ A;  3NCK A;  5M1A A;  2ZM0 A;  3ZCZ A;  1VM1 A;  5I94 A;  3PAG A;  3RXW A;  3SH8 A;  2WK0 A;  4OON A;  3O88 A;  1YLW A;  4EQI A;  2Z2L B;  4MBK A;  1K55 C;  4YFM A;  3MXR A;  4OLD A;  5G18 A;  5F83 A;  1ZG6 A;  1N9B A;  2ZM8 A;  2Y2H A;  2DRW A;  1XP4 A;  1RCJ A;  4OKP A;  2G2W A;  1G68 A;  2JE5 A;  4KZ3 A;  2HP6 A;  2WGI A;  4X68 A;  2Y55 A;  4KG5 A;  4OOY A;  4X56 A;  5FI6 A;  5FSR A;  1PI4 A;  5F1G A;  4E3M A;  3LY4 A;  3BFC A;  5GHY A;  3P98 A;  3PAE A;  1MKI A;  1DJB A;  4JPM A;  4E3I A;  2ZC3 B;  4GD6 A;  2ZQ7 A;  2Y4A A;  1DJA A;  3IWO A;  4Y0U A;  4BD1 A;  3Q7V B;  1K6S A;  2QMI A;  4OP8 A;  3O3V A;  5CER A;  4FH2 A;  2J9P A;  2Y2G A;  4PMA A;  4X69 A;  2ZC5 B;  3G31 A;  3IWI A;  3Q82 A;  5EVI D;  1NXY A;  3VP4 A;  4OPY A;  2XLN A;  5EE8 A;  4EUZ A;  4FD8 A;  5DTS A;  5HX9 A;  2XDM A;  1MWU A;  2QPN A;  1ALQ A;  1W8Q A;  4P0M A;  5M18 A;  3IF6 B;  3V39 A;  1PZP A;  3ZHH A;  2ZM2 A;  3GTC A;  2ZC7 A;  3QNB A;  4OPR A;  1BLC A;  3BEB A;  4BQM A;  4FSF A;  5F82 A;  2XGN A;  3AGF A;  4S2I A;  5DF9 A;  5JYO A;  4S2N C;  2Y2J A;  4XUZ A;  4X55 A;  4K91 A;  4MEZ A;  2EX2 A;  5E2F A;  1E3U A;  4E3K A;  5TR7 A;  5DF8 A;  3S1Y A;  1H8Y A;  3ZG8 B;  3PBQ A;  1Q2P A;  4JXW A;  3I7J A;  4NET A;  3UE1 A;  3W4Q A;  2H0T A;  3BFG A;  3E2K A;  3N4I A;  3RJU A;  4Q8I A;  5EOO A;  3A3F A;  3ITB A;  1YMX A;  4BD0 A;  2DNS A;  2Y2M A;  4CPK A;  1BSG A;  3VSK A;  1S6R A;  2ZQA A;  5F1F A;  4Y7P A;  1E25 A;  1PWG A;  4BL2 A;  3DWK A;  1RGZ A;  3N6I A;  1K56 A;  1LLB A;  4A5R A;  2JCH A;  1K56 D;  1TVF A;  2HDS A;  2XFT A;  4IVI A;  3N8S A;  5E2H A;  3SOI A;  1KVM A;  4R3J A;  2DCF A;  5GLC A;  3UDX A;  3W4P A;  5EEC A;  5FAP A;  4KQQ A;  3A3E A;  3VFF A;  3UPN A;  1ZG4 A;  3ZVW A;  4JBF A;  5GLB A;  2UWX A;  5DTK A;  2R9X A;  3FZC A;  3UPP A;  4OQ0 A;  2Y91 A;  2JBF A;  4R0Q A;  1DJC A;  4ZAM A;  1BZA A;  1IYO A;  2XEP A;  3VOY A;  3G2Z A;  3DW0 A;  1LI9 A;  4XUX A;  1XA1 A;  3HUM A;  4DE1 A;  3P09 A;  1O07 A;  4HEF A;  4C3Q A;  3SH7 A;  1ES5 A;  5CHM A;  4B4X A;  1JVJ A;  3G4P A;  3NI9 A;  1YLP A;  3G30 A;  4YIN A;  4UA6 A;  5BOH A;  2ZC6 B;  1FCO A;  1PI5 A;  2B5R A;  1GCE A;  2WKE A;  3FKV A;  3HLC A;  2EX8 A;  4H8R A;  5HL1 A;  4WZ5 A;  3Q81 A;  2XQZ A;  3V50 A;  3BFE A;  4WEJ A;  2I72 A;  1KDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...