3HUOA

X-ray crystallographic structure of ctx-m-9 s70g in complex with benzylpenicillin
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
262
structure length
262
Chain Sequence
TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CTX-M-9 extended-spectrum beta-lactamase
publication title Dynamic view of the early and late steps of the catalytic mechanism mediated by the emerging enzymes CTX-M.
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 95
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3huoA00
3S1YA 5M19A 1WE4A 2DRWA 5CGSA 4DF6A 5GL9A 5F82A 1BLCA 2H5SA 5AQBA 1PYYA 2JE5A 4E3LA 2WZZA 3IWIA 3UE1A 1M40A 4BQMA 5FQQA 2OLUA 1YLPA 3GVBA 3IHAA 1K25A 4KZBA 1PIOA 1TEMA 5AQ9A 3ISGA 1ERQA 5CERA 2RCXA 3HUOA 2RL3A 3UY6A 3A3DA 1YLJA 1FR6A 1BLPA 1VM1A 3C5AA 4OPQA 3VP4A 5GHXA 1LI9A 5EOEA 3C7UA 3N4IA 2ZQ9A 1L0DA 5AQAA 5KSHA 1GHPA 3IH8A 4S2NA 3HBRA 4X56A 3ZG8B 4QJGA 3V39A 4B4XA 3BLMA 3LY4A 4X53A 3ZNTA 2ZM0A 3HLBA 2Y2KA 3SH9A 1NYMA 4RA7A 2JCHA 4NETA 1FOFA 3I7JA 1LI0A 3C7VA 3OCLA 4IBRA 1JWZA 4RX3A 1SCWA 4XUXA 3ZG9B 1HD8A 4PM6A 1L2SA 2Y55A 1BLHA 4S2MA 1JWPA 3BECA 1MXOA 1S6RA 2QPNA 3EQUA 1Z6FA 2B5RA 4JKTA 4S2PA 5FAOA 2Y59A 4WM9A 3G35A 2G2UA 1KDWA 1TVFA 2DNSA 3NDGA 4WZ5A 1FSWA 4OLDA 1CEFA 1YQSA 3AGEA 3P98A 5U47A 1E4DA 2WGVA 3LCEA 4X68A 2QZ6A 1FQGA 3OPLA 4Y7PA 2ZQDA 3UN7A 3MZDA 3G32A 3BLSA 3MKFA 5EVLA 3UNWA 4B88A 1E25A 4BENA 3Q7ZA 3N6IA 1NZUA 4WZ5C 1W7FA 5DF7A 2EX8A 3JYIA 5A93A 5FQIA 1J9MA 4ZTKA 3WWXA 4CJNA 1K57A 5DTTA 1XA7A 3BM6A 2V2FF 4UA9A 4WEKA 3RXWA 3AGDA 4S2KA 4JXWA 5DVAA 1WYCA 1CI9A 4PM5A 5A91A 4BJPA 5IHVA 5E43A 1KDSA 1DJCA 1JTDA 3G34A 2V20A 1I5QA 4GB7A 1FCOA 4M3KA 2VGKA 3P09A 1E3UA 3FYZA 3DTMA 3SOIA 5M1AA 4LV3A 1K57C 2J9OA 2X01A 5KMWA 1K4FA 4LV2A 1NRFA 5AQ7A 4HBTA 1Y54A 1YLTA 2A3UA 3UE3A 4OQHA 5HAPA 4LCMA 3QHYA 1SHVA 3OPHA 2EFXA 4XUZA 3WS5A 3VP3A 4ZDXA 5F1FA 1E3UD 1LLBA 2J8YA 3AGFA 3OZHA 4N1HA 2XGNA 4PMAA 4OQIA 4X69A 3ZG7B 3V3SA 1ERMA 3SS4A 3UPOA 2R9WA 1CEGA 4YINA 2XLNA 3HVFA 3HLEA 1YM1A 3FKWA 4LV0A 3SH7A 1ALQA 2P74A 1C3BA 2XF3A 2WYXA 3OCNA 2Y2OA 4KZAA 2HP6A 1MPLA 1YLZA 4JF5A 4E6WA 5FI7A 3VSKA 5CECA 1MKIA 3PBTA 2H0TA 2Y2NA 1RGYA 3UDXA 1H8YA 3BFEA 1FCNA 2H0YA 1PWDA 3IQAA 4ZJ2A 1FCMA 1BSGA 1GA9A 5F83A 2WGIA 3PTEA 4QY6A 1XP4A 3HL9A 3HUMA 4F94A 1L0EA 2ZQAA 3UO9A 4L0LA 1K6RA 1NYYA 2Y2IA 3CJMA 3UE0A 4U0TA 3N8SA 4WYYA 5GHZA 3VSLA 3BRMA 2HDUA 1ES3A 2JC7A 1W79A 4HEFA 4UHUA 2Y2LA 1EROA 3NIAA 5KZHA 1W5DA 1K55A 1ZG4A 4HESA 5CEBA 1IKIA 4GDBA 3HUNA 1KVLA 3HLCA 5FQJA 4OPRA 5JYPA 1ES4A 3IHBA 4QY5A 3MFDA 4Y0UA 4E3KA 4EBNA 4K0XA 4P6BA 2HDRA 1K54C 2Z2LB 2IWDA 1JTGA 3N8LA 5KSCA 2WKHA 2XFSA 4KENB 5GLAA 4U3TA 1FR1A 1NXYA 2OSUA 4DE3A 3QNCA 4IVKA 4K91A 2OLVA 1U60A 1K55C 2XEPA 3CZDA 1HZOA 4E3IA 3PBRA 3ZDJA 4A5RA 5FAPA 5FASA 2XFTA 5EVIB 4OLGA 1LL5A 1PI5A 1VQQA 3W8KA 5EUAA 3WS1A 5CHUA 2GDNA 4OPYA 4OPZA 5HL1A 3RXXA 4UAAA 1K56D 3HLFA 4EWFA 4Y0OA 3ITAA 3W4OA 2EX2A 2ZC3B 4P87A 3A3FA 3UPNA 3UDIA 4OOMA 3GR2A 1IELA 4EQIA 3LEZA 1IYPA 1W8QA 3BYDA 3NI9A 5EE8A 4MBFA 2EXBA 3UPPA 3V5MA 5E2EA 1DJBA 1KGEA 1MWUA 2EX9A 4KQQA 1CK3A 1IYQA 4C75A 3FV7A 4MBHA 4PM9A 2EX6A 1IYSA 3MZEA 4R3JA 3TSGA 1KGFA 2A49A 1GCEA 3MZFA 4C3QA 5TGFA 3HLWA 1NJ4A 1BTLA 1GHIA 1PI4A 2Q9NA 4KG6A 2X02A 4N9LA 3S22A 4JXGA 5EVIA 1XX2A 4E3NA 3D4FA 3PBQA 4X6TA 4E3OA 5CEDA 3OPRA 5JYOA 5TR7A 1MWTA 1W8YA 2R9XA 3HLDA 3VP1A 1KE3A 4JLFA 4GD6A 4H8RA 1ZKJA 4GDNA 2FFYA 1Q2PA 1MY8A 1K38A 5EVID 2V1ZA 1KE0A 1JVJA 3Q82A 5A90A 2XD1A 4KZ7A 3ZGAB 5EVIC 1K6SA 2PU2A 3IXGA 4ID4A 2DCFA 5CXWA 4DE2A 3N8RA 1XGJA 4OQGA 1G6AA 1L0FA 1BULA 4GN2A 3ZVTA 3IF6C 4WELA 2XK1A 2PU4A 2H10A 4KQOA 4OP5A 4KZ4A 3SS5A 1BLSA 4DXBA 5FATA 4OP8A 5EOOA 5HARA 2XR0A 3A3JA 4OOYA 3Q1FA 4R23A 3FKVA 5M18A 1OMEA 4JXVA 4Z9QA 4RYEA 1EI5A 3O87A 4ZJ3A 3SS3A 1I2WA 3V3RA 3BEBA 3Q7VB 3E2KA 1DJAA 1H5XA 3GQZA 1L0GA 3UDFA 1GHMA 3WS4A 4LCLA 4BL3A 1PZOA 4FH2A 5CTMA 4BD0A 4IBXA 3LO7A 2Y2PA 1H8ZA 2ZQ8A 1WYBA 3DW0A 3Q07A 2C6WB 3ZHHA 2Y91A 5J8XA 2XDMA 2WADA 1QMFA 3ZNYA 1HVBA 2XD5A 1I2SA 1KE4A 2ZQ7A 5HAQA 3C4PA 3ZG0A 2EFUA 4E3JA 5I94A 4KQRA 3VFFA 5F1GA 4MEZA 3S4XA 1NZOA 1NY0A 2P9VB 3O3VA 1TDLA 4QU3A 4OQ0A 4RVAA 1MBLA 2Y2QA 3GRJA 4KG5A 4KZ3A 2WUQA 2XQZA 1QMEA 3BFDA 4UA6A 2Y4AA 1K54A 3EQVA 3M2JA 1LHYA 2ZC4B 3O86A 3N7WA 4OH0A 1O07A 3HREA 4N92A 5FQKA 3ZCZA 1YT4A 1PZPA 3M6BA 3PAEA 5D3OA 5DF8A 4MNRA 3PAGA 4PM8A 4WEJA 3A3IA 1K4EA 1N9BA 3IWQA 3Q7VA 4KZ6A 4X55A 5EPHA 5HFOA 4HBUA 4GZBA 3PBNA 4JF4A 5G18A 3WS0A 5A92A 4R4RA 3RJUA 5CHMA 1JWVA 3GTCA 3NDEA 4JPMA 5CTNA 4R0QA 1BUEA 3OC2A 1ESIA 2Y2HA 2Z2MB 2ZC6B 3FWLA 4DXCA 1CI8A 3MBZA 5CRFA 4R3BA 4DDYA 3IF5A 1BT5A 2WGWA 3WRTA 1YLYA 3IH9A 4FH4A 4GOGA 5FSRA 4PPRA 3OPPA 3ZG5A 1K56A 1S0WA 4R1GA 2P9VA 3IXHA 4WMCA 4Y0TA 5FQ9A 3LY3A 2FFFB 4QB8A 4OOLA 4OVDA 4DKIA 3BFCA 1MWRA 3E2LA 1YMXA 2X71A 3G31A 4B4ZA 1DY6A 3IWOA 4WBGA 2UWXA 3TOIA 1SKFA 3IF6B 4C6YA 3IT9A 4KZ5A 4CPKA 3ZFZA 3NC8A 4OKPA 4WMCD 4DRTA 5GHYA 1O7EA 5GLDA 5CHJA 5DF9A 2IWCA 3G4PA 5EECA 4BLMA 4FCFA 4IVIA 2XH9A 3NY4A 1XPBA 3MXSA 4ZBEA 3Q81A 2HP5A 2J7VA 4BD1A 3G30A 5HX9A 4FD8A 4UA7A 2CC1A 3M2KA 4O7DA 4JBFA 1YLWA 2G2WA 2I72A 3M6HA 4FSFA 4IEDA 5FI6A 3V50A 4U0XA 2ZQCA 4GD8A 4Q8IA 4S2NC 4YFMA 4P0MA 3PBOA 5E2GA 1RP5A 4EV4A 2EXAA 2ZC7A 3IXBA 3TG9A 3VMAA 1PW8A 2Y2MA 3MKEA 3G2ZA 3NBLA 3GSGA 1ESUA 1RGZA 4GKUA 1N4OA 4ZAMA 1ONHA 3IF6A 2ZM8A 5CGWA 2WAFA 4LENA 1IYOA 3VOYA 4JXSA 4EUZA 3IXDA 1FSYA 1TDGA 3SH8A 4RX2A 5TFQA 2OV5A 3ZVWA 2Q9MA 1PWGA 3O88A 4QD4A 3BFFA 1ZC2A 2HP9A 2ZD8A 2ZC5B 4GNUA 5GLCA 3W4QA 5FAQA 1PW1A 3BFGA 1HTZA 1LL9A 2BLSA 2HDSA 3CG5A 4K0WA 5DTSA 3VP2A 1G68A 3B3XA 2JBFA 4E6XA 1RCJA 1Q2QA 2QMIA 5L2FA 1AXBA 4R4SA 4DE0A 1KVMA 5E2FA 3WRZA 3DWZA 2Y2GA 1XKZA 4EBLA 5FQMA 5GLBA 1ES2A 4N9KA 2IWBA 1YMSA 2HDQA 4MBKA 1ES5A 1ONGA 1XGIA 4PM7A 3ITBA 1EWZA 4D2OA 4S2IA 4XXRA 3GMWA 4NK3A 4ZJ1A 4KG2A 5FDHA 4E3MA 3HLGA 3A3EA 4N1XA 4MLLA 3GV9A 2E8IA 5HAIA 3NCKA 1ZG6A 4LV1A 3VOZA 2Y2JA 3C4OA 1IEMA 2WGWB 2WKIA 2ZLYA 4S2LA 2PBYA 2WKEA 2ZMAA 5FI2A 1MWSA 4KZ8A 4EBPA 3WS2A 1IKGA 2BG1A 1M6KA 5CGXA 3MXRA 2ZM2A 3VFHA 1GA0A 2ZJ9A 3PBSA 2J9PA 1SDNA 1BZAA 4OONA 4QHCA 1SDEA 2WK0A 2WAEA 3QNBA 1PWCA 5HW3A 2C5WB 3DWKA 3FZCA 3CMZA 2WZXA 2HPBA 5E2HA 4DDSA 4P85A 4KZ9A 1XA1A 4DE1A 2VGJA 4JF6A 5FA7A 5BOHA 4S2JA 3W4PA 1KGGA 4S2OA 1XXMA 3VP0A 4WZ4A 5DTKA 4BL2A 3G2YA
chains in the Genus database with same CATH superfamily
3S1YA 2W0NA 4G3VA 2DRWA 4DF6A 5HWTA 1BLCA 5AQBA 1V9YA 2JE5A 2WZZA 3IWIA 5FQQA 3IHAA 4KZBA 1TEMA 1ERQA 4WL9A 4CLCB 3UY6A 3CI6A 4OPQA 5GHXA 1T18A 2ZQ9A 3F1NA 5AQAA 4NKPA 5KSHA 3IH8A 3HBRA 3BLMA 2KOIA 1FOFA 3OCLA 1JWZA 1BLHA 4S2MA 4S2PA 4JKTA 1Z6FA 2B5RA 5FAOA 3G35A 3S7QA 1FSWA 2V9AA 4CLCA 1CEFA 5EV0A 3P98A 1OT6A 2QZ6A 4F3LB 3G32A 3BLSA 4NXFA 3V67A 1NZUA 4WZ5C 5DF7A 5DJTA 5A93A 4ZTKA 3WWXA 4CJNA 1K57A 4WEKA 2Z6CA 3A0VA 3AGDA 5DVAA 5A91A 3C30A 3KSIA 2V20A 4YWZA 2JKGA 3KYQA 3FG8A 5M1AA 4LV2A 1NRFA 4OQHA 1SHVA 4F3LA 4ZDXA 2O99A 3AGFA 1LLBA 4PMAA 2PRFA 1W63M 3BQ8A 4BBUA 1YM1A 2W27A 3KYZA 3NJAA 2GJ3A 3R7WB 3LIEA 1XJ3A 2WYXA 2Y2OA 1MPLA 2W1TB 4JF5A 4E6WA 5CECA 2Y2NA 3H7WB 3DBAA 3UB6A 1PWDA 2WKPA 2QYBA 2WGIA 3D3OA 3PTEA 4F94A 2PYPA 1NYYA 3CJMA 3BRMA 5IU1A 1ES3A 3U4LP 1W5DA 4HESA 5CEBA 4BWIA 3R7WA 4OPRA 1LSWA 4QY5A 4Y0UA 4P6BA 2W1TA 1K54C 5KSCA 2IWDA 3N8LA 2XA7M 5F68A 4DE3A 3H7WA 2OLVA 3CZDA 1HZOA 3PBRA 3ZDJA 5FASA 1OTBA 4OLGA 3KX0X 1VQQA 5EUAA 5F6AA 5HL1A 1K56D 3HLFA 3LI8A 3ITAA 2QJ7A 4NEED 3A3FA 3UDIA 4CLCE 3UPPA 2JKTI 1KGEA 4UQIS 4MBHA 4PM9A 1GCEA 1F98A 1FILA 2J3TC 2XSSA 4MN6A 5TR7A 3NHQA 3E4PA 3T4KA 1Q2PA 5EVID 3B33A 5A90A 5KIZA 2G7UA 3IXGA 2Z6DA 2DCFA 4DE2A 2ZOHA 4OQGA 4LRZE 5AVEA 4WELA 2PR6A 2XK1A 2PU4A 4KQOA 1BLSA 4IUHA 4DXBA 3A0SA 3Q1FA 4JXVA 3SS3A 1H0MA 1DJAA 1H5XA 5FEGA 4LCLA 5CTMA 4BD0A 3UMDA 3DW0A 3Q07A 5J8XA 1OTDA 2ZMVA 4HHDA 2JN7A 5I94A 4KQRA 1HLUP 1NZOA 2V8FA 5U47A 1IFQA 2Y4AA 1MZUA 4LPZA 3ZCZA 4PAUA 4ETZA 3M6BA 3PAEA 4I3JA 4BBTA 2PDRA 4PM8A 4WEJA 3IWQA 1VETB 5G18A 3LIAA 4PKYA 3WS0A 5L07A 5A92A 3S7OA 3RJUA 2D02A 5CHMA 2R78A 5DKKA 3B47A 3A0RA 1P97A 4R3BA 4DDYA 3MMHA 4PPRA 1UWNX 1K56A 5FQ9A 4OVDA 3E2LA 3G31A 4B4ZA 3IWOA 4CPKA 1SKFA 3IF6B 3NC8A 1VETA 4DRTA 3IBRA 4LRYC 5DF9A 2IWCA 1G5UA 5HPFA 2PR5A 4XT2B 4BD1A 3MSHA 4JBFA 4IEDA 4Q8IA 3MQ0A 4P0MA 2KDKA 5HZHA 1P9WA 2EXAA 2ZC7A 2Y2MA 2K7SA 3NBLA 3GSGA 1ESUA 1RGZA 5AVFA 4ZAMA 1ONHA 3IF6A 5CGWA 4EETB 5HD5A 4FTXA 2QJ5A 1PWGA 3O88A 3CPTB 2ZD8A 4GNUA 5GLCA 4CLCC 4XT2A 1XFQA 5HDDA 3CG5A 1OT9A 3T1RA 1G68A 3B3XA 1Y28A 1RCJA 1Q2QA 2QMIA 4DE0A 3WRZA 3T4OA 2Y2GA 5GLBA 4GCZA 2IWBA 1YMSA 3MJQA 1XGIA 3KSFA 4D2OA 5HSQA 4XXRA 4NK3A 4KG2A 4E3MA 3IS2B 5L8MA 4KQDA 3GV9A 5HAIA 2V0UA 3ZQ5A 3CPTA 3C4OA 4S2LA 1LL8A 1K0KA 2WKEA 3HJIA 3WS2A 5CGXA 3VFHA 2VJWA 1SDNA 4NXGA 3CUEA 3QP1A 1SDEA 3QNBA 1PWCA 1NLZA 5E2HA 4BMWA 3CMZA 2WZXA 4Y5FA 5FA7A 3LIBA 3IS2A 3NOTC 3LIFA 4RQ9A 3G2YA 3LR5A 3IX4A 4G3KA 5F82A 1NRJA 1PYYA 3C2WA 1M40A 5AQ9A 1YLPA 1PIOA 3E98A 5FL3A 3HUOA 1FR6A 1VM1A 2V1AA 3VP4A 4O01A 1LI9A 5EOEA 3C7UA 3T1SA 1DP9A 5DFXA 1ODVA 3T1QB 2B95A 4B4XA 4X53A 3HLBA 2V0WA 4RA7A 2JCHA 4NETA 3I7JA 1F9IA 1LI0A 5EFWA 3ZG9B 1SCWA 2HV1A 4PM6A 1L2SA 1VEUB 2Y55A 3BECA 1MXOA 3EQUA 2HJ9C 4NXBA 3EEHA 2I9VA 3AGEA 2WGVA 4X68A 1NWZA 3OPLA 4Y7PA 3UNWA 4B88A 3Q7ZA 2VX8A 4CLCD 1W7FA 5DTTA 3BM6A 1OTEA 1VEUA 1S4SA 1WYCA 4PM5A 5IHVA 1DJCA 2ACGA 3G34A 4M3KA 1I5QA 1FCOA 3SOIA 2INWA 3HCYA 1KOUA 4LV3A 2X01A 2J9OA 3K3DA 2GX5A 4LLOB 3LR4A 1YLTA 4HBTA 3TRCA 1TF1A 4LCMA 2EFXA 4XUZA 3VP3A 2J8YA 3OZHA 4N1HA 3V3SA 1ERMA 3UPOA 2VEAA 3JPUA 3HVFA 4Y17A 3FKWA 4LV0A 3SH7A 4B9OA 2XROA 3O5YA 2XF3A 1YLZA 1T1AA 2CMNA 5FI7A 1FCNA 3T4LA 4ZJ2A 1FCMA 3EEAA 1GA9A 1XP4A 3HL9A 3HUMA 2WKQA 4L0LA 2XA7S 4R3AA 3KO6A 3UE0A 3N8SA 3VSLA 2HDUA 5AJGA 2Y2LA 3UMEA 3HLCA 2BASA 5JYPA 1ES4A 3T50A 1N9NA 1TS0A 1X0OA 3MFDA 4JGPA 2HDRA 2Z2LB 2XFSA 4U3TA 2LB9A 3PHYA 4IVKA 3H82B 4I3IA 1U60A 1K55C 5FDSA 2YKFA 4X1MA 4ME4A 1Y4OA 3W8KA 3WS1A 3S7PA 5CHUA 1ZHHB 4UAAA 1D7EA 2HF6A 2P08A 2EX2A 1IELA 2KX6A 1W8QA 3V5MA 4DJ3A 1MWUA 3H82A 3FV7A 3LYXA 4R3JA 3MZEA 3KSGA 3TSGA 1OPXA 3MZFA 2V1BA 4KG6A 4E3NA 4E3OA 5CEDA 2R9XA 1KE3A 1YSQA 4GD6A 4GDNA 5A8BA 1MY8A 1K38A 4EERA 4G3WA 2VA0A 5EVIC 1K6SA 4ID4A 4HNBA 5CXWA 3N8RA 2J80A 1XGJA 4GN2A 3IF6C 5FATA 2O9CA 5HARA 4OOYA 4R23A 1OMEA 2VV6A 4ZJ3A 4D60A 5K5BA 3V3RA 3BEBA 3Q7VB 4Y15A 3E2KA 1L0GA 3UDFA 4Q0HA 2Y2PA 2C6WB 2Y91A 2XDMA 1H3QA 2WADA 1HVBA 1KE4A 1CJFA 5EVEA 2LB5A 3ZG0A 2EFUA 5MC7A 1UGUA 4IHQA 5F1GA 2MJ6A 4MEZA 4OQ0A 2KLIA 3EQVA 1LHYA 2ZC4B 4OH0A 1O07A 3HREA 1YT4A 4R70A 5DF8A 5D3OA 1VHMA 5EPHA 3A3IA 2XRNA 3Q7VA 4X55A 3EWKA 4HBUA 4JF4A 3PBNA 2EWWA 4KUOA 1STZA 4LGWA 3LUQA 3CUEC 3FWLA 2ZMFA 4QWOA 3H9WA 2WGWA 3WRTA 4FH4A 1S0WA 4WMCA 2FFFB 4QB8A 1MWRA 1YMXA 2X71A 3BW6A 1J3WA 1DY6A 3CAXA 3HJKA 3TOIA 1O7EA 5GLDA 3G4PA 5EECA 4FCFA 3EOIA 4PHTA 2J7VA 2VV7A 5HX9A 4FD8A 1Z09A 3B42A 4FSFA 3V50A 4U0XA 3RFBA 3PBOA 3QP4A 4BBVA 1PW8A 3MKEA 5HD3A 3DTEA 4WN5A 1L3LA 4EEUA 2ZM8A 4KUKA 2WAFA 3VOYA 4X1LA 1FSYA 3SW1A 5TFQA 2OV5A 1P0ZA 2Q9MA 1H8MA 3LI9A 1S67L 2HP9A 4II7A 2ZC5B 3F1OB 4EUVA 1LL9A 2W3DA 1YKDA 2PD7A 3T4QA 5L2FA 1KVMA 3E4QA 5FQMA 1ES2A 2HDQA 4MBKA 4JGOA 1ONGA 3ITBA 2QHKA 4S2IA 2IA2A 3GMWA 4ZJ1A 3HLGA 3A3EA 2E8IA 4GHIB 3NCKA 5HL6A 3VOZA 3K3CA 3F1OA 1IEMA 2WKIA 2ZMAA 5FI2A 1PRQA 4KZ8A 1IKGA 2BG1A 3PR6A 2ZM2A 4LFUA 1IOUA 1BZAA 4L9FA 3T4TA 4MN5A 2C5WB 3DWKA 3FZCA 2HPBA 3F1PB 4P85A 4DE1A 3U2AA 4JF6A 1SZVA 1T19A 2Y8HA 5DTKA 4GHIA 4BL2A 5M19A 3VE3A 1PNEA 1WE4A 4HP9A 2H5SA 4L9EA 1OJ5A 4E3LA 3T1XA 2OLUA 1K25A 3ISGA 5CERA 2A2LA 3DTKA 1BLPA 3C5AA 3F1PA 3N4IA 4HJ3A 1GHPA 4S2NA 4X56A 4QJGA 3LY4A 2VGLM 3ZNTA 2ZM0A 2Y2KA 2A24B 3SH9A 1NYMA 2JKRM 5DKLA 4XUXA 1F2KA 2K2NA 3L7HA 5HDCA 1JWPA 1S6RA 2QPNA 2Y59A 1LSVA 4WM9A 1KDWA 2QKPA 2DNSA 3NDGA 4WZ5A 4R6LA 1E4DA 3LCEA 4HH2A 2ZQDA 3UN7A 1YAXA 4BENA 3MKFA 5HPIA 5EVLA 1E25A 3N6IA 4HJ6A 2EX8A 2A24A 5FQIA 1XA7A 2V2FF 4UA9A 3RXWA 2GNXA 4S2KA 1CI9A 4BJPA 3CITA 4IJGA 1KDSA 1JTDA 2VGKA 3P09A 1E3UA 3FYZA 3NECA 3DTMA 3E0YA 5KMWA 1K57C 5AQ7A 3UE3A 2A3UA 5HAPA 2ZL1B 3QHYA 5EM0A 3WS5A 5F1FA 2OAQ1 3QP6A 4R38A 4MN7A 4X69A 3SS4A 2R9WA 1CEGA 4YINA 2W3FA 3HLEA 3PYPA 1ALQA 3FPWA 1C3BA 1F5MA 2P04A 4KZAA 4Z1WA 3VSKA 1MKIA 3PBTA 2H0TA 1RGYA 3UDXA 4Q0JA 4WLAA 1H8YA 1TS6A 4EEPA 3IQAA 1BSGA 2ZL1A 1TS8A 4QY6A 3BY8A 1VB6A 1L0EA 1S4RA 2V8CA 1K6RA 2Y2IA 4U0TA 4WYYA 4HEFA 2JC7A 2PBDP 2OAP1 2PT7A 1ZG4A 1KVLA 4Q0IA 3IHBA 4K0XA 4KENB 1NXYA 2OSUA 3QNCA 2XEPA 1T1CA 1LL5A 2NUTC 2VK3A 3RH8B 3IX3A 2EA9A 3W4OA 4GW9A 4Y3IA 3UB9A 4GLQA 4P6ZM 2BTFP 3LEZA 3BYDA 3NI9A 3OOVA 5EE8A 2EXBA 1CK3A 4C75A 1KGFA 2A49A 4C3QA 5TGFA 3HLWA 1NJ4A 4N9LA 1BTLA 1PI4A 4IUKA 3S22A 4JXGA 5L09A 1XX2A 3D4FA 4X6TA 1UWPX 1GSVA 3OPRA 1W8YA 3HLDA 3VP1A 4H8RA 1ZKJA 2FFYA 5IT5A 2V1ZA 1KE0A 1JVJA 3Q82A 4KZ7A 4DN0A 2PU2A 5L10A 3L9KA 5TBMB 1G6AA 1BULA 3ZVTA 3VV4A 4OP5A 4KZ4A 5EOOA 3FKVA 5M18A 4Z9QA 3NOUC 3LR0A 3GQZA 1GHMA 3WS4A 4FH2A 1T1BA 1H8ZA 3ZHHA 3IX8A 3ZNYA 1QMFA 4LRXC 4O8GA 2ZQ7A 5TBMA 3C4PA 4E3JA 3S4XA 1NY0A 2P9VB 4QU3A 1MBLA 4KG5A 1ACFA 3O86A 4N92A 5FQKA 3EGDC 1K4EA 4KZ6A 1N9BA 5J7EA 4HI4A 4GZBA 4EU0A 4K08A 4R4RA 3NDEA 4JPMA 5CTNA 4R0QA 1BUEA 2Y2HA 4DXCA 1P9RA 3MBZA 5CRFA 3UE6A 3IF5A 3IH9A 4GOGA 3OPPA 3BWLA 4GS9B 2P9VA 3LY3A 3ZYTA 4DKIA 3BFCA 2UWXA 4C6YA 4KZ5A 3LGOA 4WMCD 5GHYA 2B02A 4BLMA 2XH9A 3MXSA 1S1YA 1OTAA 3G30A 2CC1A 4O7DA 3UB7A 2G2WA 2I72A 5FI6A 2JHEA 4YFMA 4S2NC 5E2GA 4GS9A 3GECA 2J3WA 3DTIA 3IXBA 3VMAA 1G28A 5DFYA 1N4OA 4I3AA 4LENA 1IYOA 4JXSA 1TDGA 4I5SA 2GZAA 3ZVWA 1LT0A 2Y79A 3BFFA 3SZTA 1ZC2A 3W4QA 5DTSA 3VP2A 2JBFA 3EGXC 4E6XA 1OJGA 3DWZA 4EBLA 3P01A 4N9KA 2FZ0A 4PM7A 2JKTM 4B93A 1EWZA 5FDHA 3BQAA 1XJ4A 1D06A 4MLLA 2M7UA 3KSHA 1ZG6A 4LV1A 2ZLYA 2WGWB 1BYWA 3VE4A 1M6KA 3MXRA 1GA0A 1ZTUA 3PBSA 2J9PA 4FUWA 4OONA 4QHCA 2WK0A 2WAEA 2L1MA 5HW3A 2VGJA 2VLGA 3W4PA 2H28A 2K31A 1AWIA 3IBJA 2JKFA 4WZ4A 5DJUA 1GSWA 3C8CA 5CGSA 5GL9A 1NLYA 5HWWA 3UE1A 3T4JA 4BQMA 2VGLS 3GVBA 4M4XA 2RCXA 2RL3A 3A3DA 1YLJA 3R4KA 4HQAA 1L0DA 3ZG8B 3V39A 1XJ6A 3LEQA 4IBRA 4RX3A 3C7VA 4Y2FA 1HD8A 2M7VA 3FC7A 2M1CA 3DAVA 2O0YA 2Q0OA 3FPVA 4CQHA 2OWJA 2G2UA 3BJNA 1TVFA 4HP4A 4OLDA 1YQSA 3JVVA 1FQGA 1XJ2A 3MZDA 1XFNA 3NOPC 1PFLA 3JYIA 1J9MA 3C38A 4MDZA 5J4EA 2P7JA 4JXWA 3MF0A 3PXPA 3QP2A 1N9OA 4MMNA 5E43A 4GB7A 3MFXA 2B18A 2WKRA 3TW8A 1K4FA 4L9GA 1Y54A 3OPHA 4ETXA 1E3UD 3QP8A 1N9LA 4AFIA 2XGNA 4OQIA 3T4SA 3ZG7B 3W2ZA 3BY9A 2XLNA 4E04A 2E8JA 2HJEA 2P74A 3RTYA 2L0WA 3OCNA 2HP6A 2DMWA 5LBRA 3CHWP 3T12B 3BFEA 2H0YA 1W63Q 1G6OA 2W3GA 5F83A 2ZQAA 3UO9A 3JVUA 5FEFA 4YNRA 4JGQA 5GHZA 1W79A 4UHUA 1EROA 3NIAA 5KZHA 1K55A 5TJJA 1IKIA 4GDBA 3HUNA 4MCWA 5FQJA 4E3KA 4EBNA 1JTGA 3G6OA 2WKHA 2ZOIA 5GLAA 3CLOA 1FR1A 4HJ4A 4HY8A 3MXQA 4K91A 1WA9A 4E3IA 4A5RA 1FIKA 5FAPA 2XFTA 5EVIB 1PI5A 4P6ZS 4YOFA 2GDNA 4OPYA 4OPZA 5F5YA 3RXXA 3NULA 5EM1A 4EWFA 3TE8A 4Y0OA 2ZC3B 4P87A 1SKOB 3UPNA 1A0KA 4OOMA 3K2NA 3GR2A 2PHYA 5I5LA 1CF0A 4EQIA 1IYPA 4MBFA 1JNUA 1DJBA 3D72A 5E2EA 2EX9A 4KQQA 4DJ2A 1IYQA 2FH5A 5J3WA 2W3EA 2EX6A 1IYSA 2VZWA 4NXEA 2L4RA 3ULFA 1DP6A 1GHIA 2J3TD 2Q9NA 4UEYA 2X02A 4Y13A 1EW0A 5EVIA 3PBQA 3LICA 5JYOA 1MWTA 2OWHA 4QPRA 4JLFA 4UQIM 1DP8A 3E4OA 1DRMA 4ARZB 1D1JA 2W1RA 2XD1A 3ZGAB 1SKOA 3GDIA 5C5KA 4HH3A 4FOFA 1L0FA 3KYEA 2H10A 3UB5P 3SS5A 2O9AA 4OP8A 2XR0A 3A3JA 4RYEA 1EI5A 5G4YA 3O87A 1I2WA 3VOLA 1YSPA 4BL3A 4HOIA 1PZOA 3MQQA 4IBXA 3LO7A 1TS7A 4ARZA 2ZQ8A 1WYBA 2XD5A 1I2SA 5HAQA 3S7NA 5HDSA 3VFFA 1TD5A 3O3VA 1TDLA 4RVAA 2Y2QA 4KZ3A 3GRJA 4WUJA 2WUQA 2XQZA 1QMEA 3BFDA 3MQOA 4UA6A 2JKRI 1K54A 3M2JA 3N7WA 4EQ1A 1PZPA 4MNRA 3PAGA 5HFOA 2YKHA 2VKSA 4GJ4A 2D01A 1JWVA 3GTCA 3OC2A 1V9ZA 4PKYG 1ESIA 2Z2MB 2ZC6B 1CI8A 3LIDA 5CX7A 4I38A 1BT5A 1YLYA 5FSRA 3ZG5A 1OTIA 4R1GA 3IXHA 2PYRA 4Y0TA 4OOLA 4WBGA 3IT9A 4EESA 3ZFZA 4OKPA 5CHJA 1MC0A 1S66L 4IVIA 1S1ZA 3NY4A 1XPBA 4ZBEA 3Q81A 2HP5A 3ICYA 4UA7A 3M2KA 3CWFA 1YLWA 3LR3A 3M6HA 4JGRA 2ZQCA 3QP5A 4GD8A 3MS6A 3MR0A 2QWSA 1RP5A 4EV4A 3TG9A 2OOLA 3G2ZA 4GKUA 4H6JB 4EUZA 3IXDA 2W3HA 3SH8A 2NUPC 4RX2A 2PD8A 2HZ5A 4QD4A 3LFVA 5FAQA 1PW1A 3BFGA 1HTZA 2BLSA 2HDSA 4K0WA 4WF0A 3P7NA 1MKMA 2VV8A 4EXOA 5G4ZA 2AVXA 4HIAA 1AXBA 4R4SA 5E2FA 1XKZA 1GSXA 4EW7A 2ZBBA 1ES5A 4H6JA 2O9BA 3OLOA 4N1XA 4O0PA 1YPRA 3OBFA 2Y2JA 4X25A 2PBYA 4NG2A 1LSXA 4DMZA 1MWSA 4EBPA 3D9YA 2UV0E 2ZJ9A 4ZRRA 3TJZC 4DDSA 3F1NB 4KZ9A 1CQAA 1XA1A 4I39A 2HGVA 3UB8A 2EWVA 5BOHA 4S2JA 1KGGA 4ESPA 4S2OA 1XXMA 5F69A 5HWVA 2PAVP 3VP0A 5IS1A
chains in the Genus database with same CATH topology
3S1YA 5M19A 1WE4A 2DRWA 5CGSA 4DF6A 5GL9A 5F82A 1BLCA 2H5SA 5AQBA 1PYYA 2JE5A 4E3LA 2WZZA 3IWIA 3UE1A 1M40A 4BQMA 5FQQA 2OLUA 1YLPA 3GVBA 3IHAA 1K25A 4KZBA 1PIOA 1TEMA 5AQ9A 3ISGA 1ERQA 5CERA 2RCXA 3HUOA 2RL3A 3UY6A 3A3DA 1YLJA 1FR6A 1BLPA 1VM1A 3C5AA 4OPQA 3VP4A 5GHXA 1LI9A 5EOEA 3C7UA 3N4IA 2ZQ9A 1L0DA 5AQAA 5KSHA 1GHPA 3IH8A 4S2NA 3HBRA 4X56A 3ZG8B 4QJGA 3V39A 4B4XA 3BLMA 3LY4A 4X53A 3ZNTA 2ZM0A 3HLBA 2Y2KA 3SH9A 1NYMA 4RA7A 2JCHA 4NETA 1FOFA 3I7JA 1LI0A 3C7VA 3OCLA 4IBRA 1JWZA 4RX3A 1SCWA 4XUXA 3ZG9B 1HD8A 4PM6A 1L2SA 2Y55A 1BLHA 4S2MA 1JWPA 3BECA 1MXOA 1S6RA 2QPNA 3EQUA 1Z6FA 2B5RA 4JKTA 4S2PA 5FAOA 2Y59A 4WM9A 3G35A 2G2UA 1KDWA 1TVFA 2DNSA 3NDGA 4WZ5A 1FSWA 4OLDA 1CEFA 1YQSA 3AGEA 3P98A 5U47A 1E4DA 2WGVA 3LCEA 4X68A 2QZ6A 1FQGA 3OPLA 4Y7PA 2ZQDA 3UN7A 3MZDA 3G32A 3BLSA 3MKFA 5EVLA 3UNWA 4B88A 1E25A 4BENA 3Q7ZA 3N6IA 1NZUA 4WZ5C 1W7FA 5DF7A 2EX8A 3JYIA 5A93A 5FQIA 1J9MA 4ZTKA 3WWXA 4CJNA 1K57A 5DTTA 1XA7A 3BM6A 2V2FF 4UA9A 4WEKA 3RXWA 3AGDA 4S2KA 4JXWA 5DVAA 1WYCA 1CI9A 4PM5A 5A91A 4BJPA 5IHVA 5E43A 1KDSA 1DJCA 1JTDA 3G34A 2V20A 1I5QA 4GB7A 1FCOA 4M3KA 2VGKA 3P09A 1E3UA 3FYZA 3DTMA 3SOIA 5M1AA 4LV3A 1K57C 2J9OA 2X01A 5KMWA 1K4FA 4LV2A 1NRFA 5AQ7A 4HBTA 1Y54A 1YLTA 2A3UA 3UE3A 4OQHA 5HAPA 4LCMA 3QHYA 1SHVA 3OPHA 2EFXA 4XUZA 3WS5A 3VP3A 4ZDXA 5F1FA 1E3UD 1LLBA 2J8YA 3AGFA 3OZHA 4N1HA 2XGNA 4PMAA 4OQIA 4X69A 3ZG7B 3V3SA 1ERMA 3SS4A 3UPOA 2R9WA 1CEGA 4YINA 2XLNA 3HVFA 3HLEA 1YM1A 3FKWA 4LV0A 3SH7A 1ALQA 2P74A 1C3BA 2XF3A 2WYXA 3OCNA 2Y2OA 4KZAA 2HP6A 1MPLA 1YLZA 4JF5A 4E6WA 5FI7A 3VSKA 5CECA 1MKIA 3PBTA 2H0TA 2Y2NA 1RGYA 3UDXA 1H8YA 3BFEA 1FCNA 2H0YA 1PWDA 3IQAA 4ZJ2A 1FCMA 1BSGA 1GA9A 5F83A 2WGIA 3PTEA 4QY6A 1XP4A 3HL9A 3HUMA 4F94A 1L0EA 2ZQAA 3UO9A 4L0LA 1K6RA 1NYYA 2Y2IA 3CJMA 3UE0A 4U0TA 3N8SA 4WYYA 5GHZA 3VSLA 3BRMA 2HDUA 1ES3A 2JC7A 1W79A 4HEFA 4UHUA 2Y2LA 1EROA 3NIAA 5KZHA 1W5DA 1K55A 1ZG4A 4HESA 5CEBA 1IKIA 4GDBA 3HUNA 1KVLA 3HLCA 5FQJA 4OPRA 5JYPA 1ES4A 3IHBA 4QY5A 3MFDA 4Y0UA 4E3KA 4EBNA 4K0XA 4P6BA 2HDRA 1K54C 2Z2LB 2IWDA 1JTGA 3N8LA 5KSCA 2WKHA 2XFSA 4KENB 5GLAA 4U3TA 1FR1A 1NXYA 2OSUA 4DE3A 3QNCA 4IVKA 4K91A 2OLVA 1U60A 1K55C 2XEPA 3CZDA 1HZOA 4E3IA 3PBRA 3ZDJA 4A5RA 5FAPA 5FASA 2XFTA 5EVIB 4OLGA 1LL5A 1PI5A 1VQQA 3W8KA 5EUAA 3WS1A 5CHUA 2GDNA 4OPYA 4OPZA 5HL1A 3RXXA 4UAAA 1K56D 3HLFA 4EWFA 4Y0OA 3ITAA 3W4OA 2EX2A 2ZC3B 4P87A 3A3FA 3UPNA 3UDIA 4OOMA 3GR2A 1IELA 4EQIA 3LEZA 1IYPA 1W8QA 3BYDA 3NI9A 5EE8A 4MBFA 2EXBA 3UPPA 3V5MA 5E2EA 1DJBA 1KGEA 1MWUA 2EX9A 4KQQA 1CK3A 1IYQA 4C75A 3FV7A 4MBHA 4PM9A 2EX6A 1IYSA 3MZEA 4R3JA 3TSGA 1KGFA 2A49A 1GCEA 3MZFA 4C3QA 5TGFA 3HLWA 1NJ4A 1BTLA 1GHIA 1PI4A 2Q9NA 4KG6A 2X02A 4N9LA 3S22A 4JXGA 5EVIA 1XX2A 4E3NA 3D4FA 3PBQA 4X6TA 4E3OA 5CEDA 3OPRA 5JYOA 5TR7A 1MWTA 1W8YA 2R9XA 3HLDA 3VP1A 1KE3A 4JLFA 4GD6A 4H8RA 1ZKJA 4GDNA 2FFYA 1Q2PA 1MY8A 1K38A 5EVID 2V1ZA 1KE0A 1JVJA 3Q82A 5A90A 2XD1A 4KZ7A 3ZGAB 5EVIC 1K6SA 2PU2A 3IXGA 4ID4A 2DCFA 5CXWA 4DE2A 3N8RA 1XGJA 4OQGA 1G6AA 1L0FA 1BULA 4GN2A 3ZVTA 3IF6C 4WELA 2XK1A 2PU4A 2H10A 4KQOA 4OP5A 4KZ4A 3SS5A 1BLSA 4DXBA 5FATA 4OP8A 5EOOA 5HARA 2XR0A 3A3JA 4OOYA 3Q1FA 4R23A 3FKVA 5M18A 1OMEA 4JXVA 4Z9QA 4RYEA 1EI5A 3O87A 4ZJ3A 3SS3A 1I2WA 3V3RA 3BEBA 3Q7VB 3E2KA 1DJAA 1H5XA 3GQZA 1L0GA 3UDFA 1GHMA 3WS4A 4LCLA 4BL3A 1PZOA 4FH2A 5CTMA 4BD0A 4IBXA 3LO7A 2Y2PA 1H8ZA 2ZQ8A 1WYBA 3DW0A 3Q07A 2C6WB 3ZHHA 2Y91A 5J8XA 2XDMA 2WADA 1QMFA 3ZNYA 1HVBA 2XD5A 1I2SA 1KE4A 2ZQ7A 5HAQA 3C4PA 3ZG0A 2EFUA 4E3JA 5I94A 4KQRA 3VFFA 5F1GA 4MEZA 3S4XA 1NZOA 1NY0A 2P9VB 3O3VA 1TDLA 4QU3A 4OQ0A 4RVAA 1MBLA 2Y2QA 3GRJA 4KG5A 4KZ3A 2WUQA 2XQZA 1QMEA 3BFDA 4UA6A 2Y4AA 1K54A 3EQVA 3M2JA 1LHYA 2ZC4B 3O86A 3N7WA 4OH0A 1O07A 3HREA 4N92A 5FQKA 3ZCZA 1YT4A 1PZPA 3M6BA 3PAEA 5D3OA 5DF8A 4MNRA 3PAGA 4PM8A 4WEJA 3A3IA 1K4EA 1N9BA 3IWQA 3Q7VA 4KZ6A 4X55A 5EPHA 5HFOA 4HBUA 4GZBA 3PBNA 4JF4A 5G18A 3WS0A 5A92A 4R4RA 3RJUA 5CHMA 1JWVA 3GTCA 3NDEA 4JPMA 5CTNA 4R0QA 1BUEA 3OC2A 1ESIA 2Y2HA 2Z2MB 2ZC6B 3FWLA 4DXCA 1CI8A 3MBZA 5CRFA 4R3BA 4DDYA 3IF5A 1BT5A 2WGWA 3WRTA 1YLYA 3IH9A 4FH4A 4GOGA 5FSRA 4PPRA 3OPPA 3ZG5A 1K56A 1S0WA 4R1GA 2P9VA 3IXHA 4WMCA 4Y0TA 5FQ9A 3LY3A 2FFFB 4QB8A 4OOLA 4OVDA 4DKIA 3BFCA 1MWRA 3E2LA 1YMXA 2X71A 3G31A 4B4ZA 1DY6A 3IWOA 4WBGA 2UWXA 3TOIA 1SKFA 3IF6B 4C6YA 3IT9A 4KZ5A 4CPKA 3ZFZA 3NC8A 4OKPA 4WMCD 4DRTA 5GHYA 1O7EA 5GLDA 5CHJA 5DF9A 2IWCA 3G4PA 5EECA 4BLMA 4FCFA 4IVIA 2XH9A 3NY4A 1XPBA 3MXSA 4ZBEA 3Q81A 2HP5A 2J7VA 4BD1A 3G30A 5HX9A 4FD8A 4UA7A 2CC1A 3M2KA 4O7DA 4JBFA 1YLWA 2G2WA 2I72A 3M6HA 4FSFA 4IEDA 5FI6A 3V50A 4U0XA 2ZQCA 4GD8A 4Q8IA 4S2NC 4YFMA 4P0MA 3PBOA 5E2GA 1RP5A 4EV4A 2EXAA 2ZC7A 3IXBA 3TG9A 3VMAA 1PW8A 2Y2MA 3MKEA 3G2ZA 3NBLA 3GSGA 1ESUA 1RGZA 4GKUA 1N4OA 4ZAMA 1ONHA 3IF6A 2ZM8A 5CGWA 2WAFA 4LENA 1IYOA 3VOYA 4JXSA 4EUZA 3IXDA 1FSYA 1TDGA 3SH8A 4RX2A 5TFQA 2OV5A 3ZVWA 2Q9MA 1PWGA 3O88A 4QD4A 3BFFA 1ZC2A 2HP9A 2ZD8A 2ZC5B 4GNUA 5GLCA 3W4QA 5FAQA 1PW1A 3BFGA 1HTZA 1LL9A 2BLSA 2HDSA 3CG5A 4K0WA 5DTSA 3VP2A 1G68A 3B3XA 2JBFA 4E6XA 1RCJA 1Q2QA 2QMIA 5L2FA 1AXBA 4R4SA 4DE0A 1KVMA 5E2FA 3WRZA 3DWZA 2Y2GA 1XKZA 4EBLA 5FQMA 5GLBA 1ES2A 4N9KA 2IWBA 1YMSA 2HDQA 4MBKA 1ES5A 1ONGA 1XGIA 4PM7A 3ITBA 1EWZA 4D2OA 4S2IA 4XXRA 3GMWA 4NK3A 4ZJ1A 4KG2A 5FDHA 4E3MA 3HLGA 3A3EA 4N1XA 4MLLA 3GV9A 2E8IA 5HAIA 3NCKA 1ZG6A 4LV1A 3VOZA 2Y2JA 3C4OA 1IEMA 2WGWB 2WKIA 2ZLYA 4S2LA 2PBYA 2WKEA 2ZMAA 5FI2A 1MWSA 4KZ8A 4EBPA 3WS2A 1IKGA 2BG1A 1M6KA 5CGXA 3MXRA 2ZM2A 3VFHA 1GA0A 2ZJ9A 3PBSA 2J9PA 1SDNA 1BZAA 4OONA 4QHCA 1SDEA 2WK0A 2WAEA 3QNBA 1PWCA 5HW3A 2C5WB 3DWKA 3FZCA 3CMZA 2WZXA 2HPBA 5E2HA 4DDSA 4P85A 4KZ9A 1XA1A 4DE1A 2VGJA 4JF6A 5FA7A 5BOHA 4S2JA 3W4PA 1KGGA 4S2OA 1XXMA 3VP0A 4WZ4A 5DTKA 4BL2A 3G2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1Y A;  5M19 A;  1WE4 A;  2DRW A;  5CGS A;  4DF6 A;  5GL9 A;  5F82 A;  1BLC A;  2H5S A;  5AQB A;  1PYY A;  2JE5 A;  4E3L A;  2WZZ A;  3IWI A;  3UE1 A;  1M40 A;  4BQM A;  5FQQ A;  2OLU A;  1YLP A;  3GVB A;  3IHA A;  1K25 A;  4KZB A;  1PIO A;  1TEM A;  5AQ9 A;  3ISG A;  1ERQ A;  5CER A;  2RCX A;  3HUO A;  2RL3 A;  3UY6 A;  3A3D A;  1YLJ A;  1FR6 A;  1BLP A;  1VM1 A;  3C5A A;  4OPQ A;  3VP4 A;  5GHX A;  1LI9 A;  5EOE A;  3C7U A;  3N4I A;  2ZQ9 A;  1L0D A;  5AQA A;  5KSH A;  1GHP A;  3IH8 A;  4S2N A;  3HBR A;  4X56 A;  3ZG8 B;  4QJG A;  3V39 A;  4B4X A;  3BLM A;  3LY4 A;  4X53 A;  3ZNT A;  2ZM0 A;  3HLB A;  2Y2K A;  3SH9 A;  1NYM A;  4RA7 A;  2JCH A;  4NET A;  1FOF A;  3I7J A;  1LI0 A;  3C7V A;  3OCL A;  4IBR A;  1JWZ A;  4RX3 A;  1SCW A;  4XUX A;  3ZG9 B;  1HD8 A;  4PM6 A;  1L2S A;  2Y55 A;  1BLH A;  4S2M A;  1JWP A;  3BEC A;  1MXO A;  1S6R A;  2QPN A;  3EQU A;  1Z6F A;  2B5R A;  4JKT A;  4S2P A;  5FAO A;  2Y59 A;  4WM9 A;  3G35 A;  2G2U A;  1KDW A;  1TVF A;  2DNS A;  3NDG A;  4WZ5 A;  1FSW A;  4OLD A;  1CEF A;  1YQS A;  3AGE A;  3P98 A;  5U47 A;  1E4D A;  2WGV A;  3LCE A;  4X68 A;  2QZ6 A;  1FQG A;  3OPL A;  4Y7P A;  2ZQD A;  3UN7 A;  3MZD A;  3G32 A;  3BLS A;  3MKF A;  5EVL A;  3UNW A;  4B88 A;  1E25 A;  4BEN A;  3Q7Z A;  3N6I A;  1NZU A;  4WZ5 C;  1W7F A;  5DF7 A;  2EX8 A;  3JYI A;  5A93 A;  5FQI A;  1J9M A;  4ZTK A;  3WWX A;  4CJN A;  1K57 A;  5DTT A;  1XA7 A;  3BM6 A;  2V2F F;  4UA9 A;  4WEK A;  3RXW A;  3AGD A;  4S2K A;  4JXW A;  5DVA A;  1WYC A;  1CI9 A;  4PM5 A;  5A91 A;  4BJP A;  5IHV A;  5E43 A;  1KDS A;  1DJC A;  1JTD A;  3G34 A;  2V20 A;  1I5Q A;  4GB7 A;  1FCO A;  4M3K A;  2VGK A;  3P09 A;  1E3U A;  3FYZ A;  3DTM A;  3SOI A;  5M1A A;  4LV3 A;  1K57 C;  2J9O A;  2X01 A;  5KMW A;  1K4F A;  4LV2 A;  1NRF A;  5AQ7 A;  4HBT A;  1Y54 A;  1YLT A;  2A3U A;  3UE3 A;  4OQH A;  5HAP A;  4LCM A;  3QHY A;  1SHV A;  3OPH A;  2EFX A;  4XUZ A;  3WS5 A;  3VP3 A;  4ZDX A;  5F1F A;  1E3U D;  1LLB A;  2J8Y A;  3AGF A;  3OZH A;  4N1H A;  2XGN A;  4PMA A;  4OQI A;  4X69 A;  3ZG7 B;  3V3S A;  1ERM A;  3SS4 A;  3UPO A;  2R9W A;  1CEG A;  4YIN A;  2XLN A;  3HVF A;  3HLE A;  1YM1 A;  3FKW A;  4LV0 A;  3SH7 A;  1ALQ A;  2P74 A;  1C3B A;  2XF3 A;  2WYX A;  3OCN A;  2Y2O A;  4KZA A;  2HP6 A;  1MPL A;  1YLZ A;  4JF5 A;  4E6W A;  5FI7 A;  3VSK A;  5CEC A;  1MKI A;  3PBT A;  2H0T A;  2Y2N A;  1RGY A;  3UDX A;  1H8Y A;  3BFE A;  1FCN A;  2H0Y A;  1PWD A;  3IQA A;  4ZJ2 A;  1FCM A;  1BSG A;  1GA9 A;  5F83 A;  2WGI A;  3PTE A;  4QY6 A;  1XP4 A;  3HL9 A;  3HUM A;  4F94 A;  1L0E A;  2ZQA A;  3UO9 A;  4L0L A;  1K6R A;  1NYY A;  2Y2I A;  3CJM A;  3UE0 A;  4U0T A;  3N8S A;  4WYY A;  5GHZ A;  3VSL A;  3BRM A;  2HDU A;  1ES3 A;  2JC7 A;  1W79 A;  4HEF A;  4UHU A;  2Y2L A;  1ERO A;  3NIA A;  5KZH A;  1W5D A;  1K55 A;  1ZG4 A;  4HES A;  5CEB A;  1IKI A;  4GDB A;  3HUN A;  1KVL A;  3HLC A;  5FQJ A;  4OPR A;  5JYP A;  1ES4 A;  3IHB A;  4QY5 A;  3MFD A;  4Y0U A;  4E3K A;  4EBN A;  4K0X A;  4P6B A;  2HDR A;  1K54 C;  2Z2L B;  2IWD A;  1JTG A;  3N8L A;  5KSC A;  2WKH A;  2XFS A;  4KEN B;  5GLA A;  4U3T A;  1FR1 A;  1NXY A;  2OSU A;  4DE3 A;  3QNC A;  4IVK A;  4K91 A;  2OLV A;  1U60 A;  1K55 C;  2XEP A;  3CZD A;  1HZO A;  4E3I A;  3PBR A;  3ZDJ A;  4A5R A;  5FAP A;  5FAS A;  2XFT A;  5EVI B;  4OLG A;  1LL5 A;  1PI5 A;  1VQQ A;  3W8K A;  5EUA A;  3WS1 A;  5CHU A;  2GDN A;  4OPY A;  4OPZ A;  5HL1 A;  3RXX A;  4UAA A;  1K56 D;  3HLF A;  4EWF A;  4Y0O A;  3ITA A;  3W4O A;  2EX2 A;  2ZC3 B;  4P87 A;  3A3F A;  3UPN A;  3UDI A;  4OOM A;  3GR2 A;  1IEL A;  4EQI A;  3LEZ A;  1IYP A;  1W8Q A;  3BYD A;  3NI9 A;  5EE8 A;  4MBF A;  2EXB A;  3UPP A;  3V5M A;  5E2E A;  1DJB A;  1KGE A;  1MWU A;  2EX9 A;  4KQQ A;  1CK3 A;  1IYQ A;  4C75 A;  3FV7 A;  4MBH A;  4PM9 A;  2EX6 A;  1IYS A;  3MZE A;  4R3J A;  3TSG A;  1KGF A;  2A49 A;  1GCE A;  3MZF A;  4C3Q A;  5TGF A;  3HLW A;  1NJ4 A;  1BTL A;  1GHI A;  1PI4 A;  2Q9N A;  4KG6 A;  2X02 A;  4N9L A;  3S22 A;  4JXG A;  5EVI A;  1XX2 A;  4E3N A;  3D4F A;  3PBQ A;  4X6T A;  4E3O A;  5CED A;  3OPR A;  5JYO A;  5TR7 A;  1MWT A;  1W8Y A;  2R9X A;  3HLD A;  3VP1 A;  1KE3 A;  4JLF A;  4GD6 A;  4H8R A;  1ZKJ A;  4GDN A;  2FFY A;  1Q2P A;  1MY8 A;  1K38 A;  5EVI D;  2V1Z A;  1KE0 A;  1JVJ A;  3Q82 A;  5A90 A;  2XD1 A;  4KZ7 A;  3ZGA B;  5EVI C;  1K6S A;  2PU2 A;  3IXG A;  4ID4 A;  2DCF A;  5CXW A;  4DE2 A;  3N8R A;  1XGJ A;  4OQG A;  1G6A A;  1L0F A;  1BUL A;  4GN2 A;  3ZVT A;  3IF6 C;  4WEL A;  2XK1 A;  2PU4 A;  2H10 A;  4KQO A;  4OP5 A;  4KZ4 A;  3SS5 A;  1BLS A;  4DXB A;  5FAT A;  4OP8 A;  5EOO A;  5HAR A;  2XR0 A;  3A3J A;  4OOY A;  3Q1F A;  4R23 A;  3FKV A;  5M18 A;  1OME A;  4JXV A;  4Z9Q A;  4RYE A;  1EI5 A;  3O87 A;  4ZJ3 A;  3SS3 A;  1I2W A;  3V3R A;  3BEB A;  3Q7V B;  3E2K A;  1DJA A;  1H5X A;  3GQZ A;  1L0G A;  3UDF A;  1GHM A;  3WS4 A;  4LCL A;  4BL3 A;  1PZO A;  4FH2 A;  5CTM A;  4BD0 A;  4IBX A;  3LO7 A;  2Y2P A;  1H8Z A;  2ZQ8 A;  1WYB A;  3DW0 A;  3Q07 A;  2C6W B;  3ZHH A;  2Y91 A;  5J8X A;  2XDM A;  2WAD A;  1QMF A;  3ZNY A;  1HVB A;  2XD5 A;  1I2S A;  1KE4 A;  2ZQ7 A;  5HAQ A;  3C4P A;  3ZG0 A;  2EFU A;  4E3J A;  5I94 A;  4KQR A;  3VFF A;  5F1G A;  4MEZ A;  3S4X A;  1NZO A;  1NY0 A;  2P9V B;  3O3V A;  1TDL A;  4QU3 A;  4OQ0 A;  4RVA A;  1MBL A;  2Y2Q A;  3GRJ A;  4KG5 A;  4KZ3 A;  2WUQ A;  2XQZ A;  1QME A;  3BFD A;  4UA6 A;  2Y4A A;  1K54 A;  3EQV A;  3M2J A;  1LHY A;  2ZC4 B;  3O86 A;  3N7W A;  4OH0 A;  1O07 A;  3HRE A;  4N92 A;  5FQK A;  3ZCZ A;  1YT4 A;  1PZP A;  3M6B A;  3PAE A;  5D3O A;  5DF8 A;  4MNR A;  3PAG A;  4PM8 A;  4WEJ A;  3A3I A;  1K4E A;  1N9B A;  3IWQ A;  3Q7V A;  4KZ6 A;  4X55 A;  5EPH A;  5HFO A;  4HBU A;  4GZB A;  3PBN A;  4JF4 A;  5G18 A;  3WS0 A;  5A92 A;  4R4R A;  3RJU A;  5CHM A;  1JWV A;  3GTC A;  3NDE A;  4JPM A;  5CTN A;  4R0Q A;  1BUE A;  3OC2 A;  1ESI A;  2Y2H A;  2Z2M B;  2ZC6 B;  3FWL A;  4DXC A;  1CI8 A;  3MBZ A;  5CRF A;  4R3B A;  4DDY A;  3IF5 A;  1BT5 A;  2WGW A;  3WRT A;  1YLY A;  3IH9 A;  4FH4 A;  4GOG A;  5FSR A;  4PPR A;  3OPP A;  3ZG5 A;  1K56 A;  1S0W A;  4R1G A;  2P9V A;  3IXH A;  4WMC A;  4Y0T A;  5FQ9 A;  3LY3 A;  2FFF B;  4QB8 A;  4OOL A;  4OVD A;  4DKI A;  3BFC A;  1MWR A;  3E2L A;  1YMX A;  2X71 A;  3G31 A;  4B4Z A;  1DY6 A;  3IWO A;  4WBG A;  2UWX A;  3TOI A;  1SKF A;  3IF6 B;  4C6Y A;  3IT9 A;  4KZ5 A;  4CPK A;  3ZFZ A;  3NC8 A;  4OKP A;  4WMC D;  4DRT A;  5GHY A;  1O7E A;  5GLD A;  5CHJ A;  5DF9 A;  2IWC A;  3G4P A;  5EEC A;  4BLM A;  4FCF A;  4IVI A;  2XH9 A;  3NY4 A;  1XPB A;  3MXS A;  4ZBE A;  3Q81 A;  2HP5 A;  2J7V A;  4BD1 A;  3G30 A;  5HX9 A;  4FD8 A;  4UA7 A;  2CC1 A;  3M2K A;  4O7D A;  4JBF A;  1YLW A;  2G2W A;  2I72 A;  3M6H A;  4FSF A;  4IED A;  5FI6 A;  3V50 A;  4U0X A;  2ZQC A;  4GD8 A;  4Q8I A;  4S2N C;  4YFM A;  4P0M A;  3PBO A;  5E2G A;  1RP5 A;  4EV4 A;  2EXA A;  2ZC7 A;  3IXB A;  3TG9 A;  3VMA A;  1PW8 A;  2Y2M A;  3MKE A;  3G2Z A;  3NBL A;  3GSG A;  1ESU A;  1RGZ A;  4GKU A;  1N4O A;  4ZAM A;  1ONH A;  3IF6 A;  2ZM8 A;  5CGW A;  2WAF A;  4LEN A;  1IYO A;  3VOY A;  4JXS A;  4EUZ A;  3IXD A;  1FSY A;  1TDG A;  3SH8 A;  4RX2 A;  5TFQ A;  2OV5 A;  3ZVW A;  2Q9M A;  1PWG A;  3O88 A;  4QD4 A;  3BFF A;  1ZC2 A;  2HP9 A;  2ZD8 A;  2ZC5 B;  4GNU A;  5GLC A;  3W4Q A;  5FAQ A;  1PW1 A;  3BFG A;  1HTZ A;  1LL9 A;  2BLS A;  2HDS A;  3CG5 A;  4K0W A;  5DTS A;  3VP2 A;  1G68 A;  3B3X A;  2JBF A;  4E6X A;  1RCJ A;  1Q2Q A;  2QMI A;  5L2F A;  1AXB A;  4R4S A;  4DE0 A;  1KVM A;  5E2F A;  3WRZ A;  3DWZ A;  2Y2G A;  1XKZ A;  4EBL A;  5FQM A;  5GLB A;  1ES2 A;  4N9K A;  2IWB A;  1YMS A;  2HDQ A;  4MBK A;  1ES5 A;  1ONG A;  1XGI A;  4PM7 A;  3ITB A;  1EWZ A;  4D2O A;  4S2I A;  4XXR A;  3GMW A;  4NK3 A;  4ZJ1 A;  4KG2 A;  5FDH A;  4E3M A;  3HLG A;  3A3E A;  4N1X A;  4MLL A;  3GV9 A;  2E8I A;  5HAI A;  3NCK A;  1ZG6 A;  4LV1 A;  3VOZ A;  2Y2J A;  3C4O A;  1IEM A;  2WGW B;  2WKI A;  2ZLY A;  4S2L A;  2PBY A;  2WKE A;  2ZMA A;  5FI2 A;  1MWS A;  4KZ8 A;  4EBP A;  3WS2 A;  1IKG A;  2BG1 A;  1M6K A;  5CGX A;  3MXR A;  2ZM2 A;  3VFH A;  1GA0 A;  2ZJ9 A;  3PBS A;  2J9P A;  1SDN A;  1BZA A;  4OON A;  4QHC A;  1SDE A;  2WK0 A;  2WAE A;  3QNB A;  1PWC A;  5HW3 A;  2C5W B;  3DWK A;  3FZC A;  3CMZ A;  2WZX A;  2HPB A;  5E2H A;  4DDS A;  4P85 A;  4KZ9 A;  1XA1 A;  4DE1 A;  2VGJ A;  4JF6 A;  5FA7 A;  5BOH A;  4S2J A;  3W4P A;  1KGG A;  4S2O A;  1XXM A;  3VP0 A;  4WZ4 A;  5DTK A;  4BL2 A;  3G2Y A; 
#chains in the Genus database with same CATH topology
 3S1Y A;  2W0N A;  4G3V A;  2DRW A;  4DF6 A;  5HWT A;  1BLC A;  5AQB A;  1V9Y A;  2JE5 A;  2WZZ A;  3IWI A;  5FQQ A;  3IHA A;  4KZB A;  1TEM A;  1ERQ A;  4WL9 A;  4CLC B;  3UY6 A;  3CI6 A;  4OPQ A;  5GHX A;  1T18 A;  2ZQ9 A;  3F1N A;  5AQA A;  4NKP A;  5KSH A;  3IH8 A;  3HBR A;  3BLM A;  2KOI A;  1FOF A;  3OCL A;  1JWZ A;  1BLH A;  4S2M A;  4S2P A;  4JKT A;  1Z6F A;  2B5R A;  5FAO A;  3G35 A;  3S7Q A;  1FSW A;  2V9A A;  4CLC A;  1CEF A;  5EV0 A;  3P98 A;  1OT6 A;  2QZ6 A;  4F3L B;  3G32 A;  3BLS A;  4NXF A;  3V67 A;  1NZU A;  4WZ5 C;  5DF7 A;  5DJT A;  5A93 A;  4ZTK A;  3WWX A;  4CJN A;  1K57 A;  4WEK A;  2Z6C A;  3A0V A;  3AGD A;  5DVA A;  5A91 A;  3C30 A;  3KSI A;  2V20 A;  4YWZ A;  2JKG A;  3KYQ A;  3FG8 A;  5M1A A;  4LV2 A;  1NRF A;  4OQH A;  1SHV A;  4F3L A;  4ZDX A;  2O99 A;  3AGF A;  1LLB A;  4PMA A;  2PRF A;  1W63 M;  3BQ8 A;  4BBU A;  1YM1 A;  2W27 A;  3KYZ A;  3NJA A;  2GJ3 A;  3R7W B;  3LIE A;  1XJ3 A;  2WYX A;  2Y2O A;  1MPL A;  2W1T B;  4JF5 A;  4E6W A;  5CEC A;  2Y2N A;  3H7W B;  3DBA A;  3UB6 A;  1PWD A;  2WKP A;  2QYB A;  2WGI A;  3D3O A;  3PTE A;  4F94 A;  2PYP A;  1NYY A;  3CJM A;  3BRM A;  5IU1 A;  1ES3 A;  3U4L P;  1W5D A;  4HES A;  5CEB A;  4BWI A;  3R7W A;  4OPR A;  1LSW A;  4QY5 A;  4Y0U A;  4P6B A;  2W1T A;  1K54 C;  5KSC A;  2IWD A;  3N8L A;  2XA7 M;  5F68 A;  4DE3 A;  3H7W A;  2OLV A;  3CZD A;  1HZO A;  3PBR A;  3ZDJ A;  5FAS A;  1OTB A;  4OLG A;  3KX0 X;  1VQQ A;  5EUA A;  5F6A A;  5HL1 A;  1K56 D;  3HLF A;  3LI8 A;  3ITA A;  2QJ7 A;  4NEE D;  3A3F A;  3UDI A;  4CLC E;  3UPP A;  2JKT I;  1KGE A;  4UQI S;  4MBH A;  4PM9 A;  1GCE A;  1F98 A;  1FIL A;  2J3T C;  2XSS A;  4MN6 A;  5TR7 A;  3NHQ A;  3E4P A;  3T4K A;  1Q2P A;  5EVI D;  3B33 A;  5A90 A;  5KIZ A;  2G7U A;  3IXG A;  2Z6D A;  2DCF A;  4DE2 A;  2ZOH A;  4OQG A;  4LRZ E;  5AVE A;  4WEL A;  2PR6 A;  2XK1 A;  2PU4 A;  4KQO A;  1BLS A;  4IUH A;  4DXB A;  3A0S A;  3Q1F A;  4JXV A;  3SS3 A;  1H0M A;  1DJA A;  1H5X A;  5FEG A;  4LCL A;  5CTM A;  4BD0 A;  3UMD A;  3DW0 A;  3Q07 A;  5J8X A;  1OTD A;  2ZMV A;  4HHD A;  2JN7 A;  5I94 A;  4KQR A;  1HLU P;  1NZO A;  2V8F A;  5U47 A;  1IFQ A;  2Y4A A;  1MZU A;  4LPZ A;  3ZCZ A;  4PAU A;  4ETZ A;  3M6B A;  3PAE A;  4I3J A;  4BBT A;  2PDR A;  4PM8 A;  4WEJ A;  3IWQ A;  1VET B;  5G18 A;  3LIA A;  4PKY A;  3WS0 A;  5L07 A;  5A92 A;  3S7O A;  3RJU A;  2D02 A;  5CHM A;  2R78 A;  5DKK A;  3B47 A;  3A0R A;  1P97 A;  4R3B A;  4DDY A;  3MMH A;  4PPR A;  1UWN X;  1K56 A;  5FQ9 A;  4OVD A;  3E2L A;  3G31 A;  4B4Z A;  3IWO A;  4CPK A;  1SKF A;  3IF6 B;  3NC8 A;  1VET A;  4DRT A;  3IBR A;  4LRY C;  5DF9 A;  2IWC A;  1G5U A;  5HPF A;  2PR5 A;  4XT2 B;  4BD1 A;  3MSH A;  4JBF A;  4IED A;  4Q8I A;  3MQ0 A;  4P0M A;  2KDK A;  5HZH A;  1P9W A;  2EXA A;  2ZC7 A;  2Y2M A;  2K7S A;  3NBL A;  3GSG A;  1ESU A;  1RGZ A;  5AVF A;  4ZAM A;  1ONH A;  3IF6 A;  5CGW A;  4EET B;  5HD5 A;  4FTX A;  2QJ5 A;  1PWG A;  3O88 A;  3CPT B;  2ZD8 A;  4GNU A;  5GLC A;  4CLC C;  4XT2 A;  1XFQ A;  5HDD A;  3CG5 A;  1OT9 A;  3T1R A;  1G68 A;  3B3X A;  1Y28 A;  1RCJ A;  1Q2Q A;  2QMI A;  4DE0 A;  3WRZ A;  3T4O A;  2Y2G A;  5GLB A;  4GCZ A;  2IWB A;  1YMS A;  3MJQ A;  1XGI A;  3KSF A;  4D2O A;  5HSQ A;  4XXR A;  4NK3 A;  4KG2 A;  4E3M A;  3IS2 B;  5L8M A;  4KQD A;  3GV9 A;  5HAI A;  2V0U A;  3ZQ5 A;  3CPT A;  3C4O A;  4S2L A;  1LL8 A;  1K0K A;  2WKE A;  3HJI A;  3WS2 A;  5CGX A;  3VFH A;  2VJW A;  1SDN A;  4NXG A;  3CUE A;  3QP1 A;  1SDE A;  3QNB A;  1PWC A;  1NLZ A;  5E2H A;  4BMW A;  3CMZ A;  2WZX A;  4Y5F A;  5FA7 A;  3LIB A;  3IS2 A;  3NOT C;  3LIF A;  4RQ9 A;  3G2Y A;  3LR5 A;  3IX4 A;  4G3K A;  5F82 A;  1NRJ A;  1PYY A;  3C2W A;  1M40 A;  5AQ9 A;  1YLP A;  1PIO A;  3E98 A;  5FL3 A;  3HUO A;  1FR6 A;  1VM1 A;  2V1A A;  3VP4 A;  4O01 A;  1LI9 A;  5EOE A;  3C7U A;  3T1S A;  1DP9 A;  5DFX A;  1ODV A;  3T1Q B;  2B95 A;  4B4X A;  4X53 A;  3HLB A;  2V0W A;  4RA7 A;  2JCH A;  4NET A;  3I7J A;  1F9I A;  1LI0 A;  5EFW A;  3ZG9 B;  1SCW A;  2HV1 A;  4PM6 A;  1L2S A;  1VEU B;  2Y55 A;  3BEC A;  1MXO A;  3EQU A;  2HJ9 C;  4NXB A;  3EEH A;  2I9V A;  3AGE A;  2WGV A;  4X68 A;  1NWZ A;  3OPL A;  4Y7P A;  3UNW A;  4B88 A;  3Q7Z A;  2VX8 A;  4CLC D;  1W7F A;  5DTT A;  3BM6 A;  1OTE A;  1VEU A;  1S4S A;  1WYC A;  4PM5 A;  5IHV A;  1DJC A;  2ACG A;  3G34 A;  4M3K A;  1I5Q A;  1FCO A;  3SOI A;  2INW A;  3HCY A;  1KOU A;  4LV3 A;  2X01 A;  2J9O A;  3K3D A;  2GX5 A;  4LLO B;  3LR4 A;  1YLT A;  4HBT A;  3TRC A;  1TF1 A;  4LCM A;  2EFX A;  4XUZ A;  3VP3 A;  2J8Y A;  3OZH A;  4N1H A;  3V3S A;  1ERM A;  3UPO A;  2VEA A;  3JPU A;  3HVF A;  4Y17 A;  3FKW A;  4LV0 A;  3SH7 A;  4B9O A;  2XRO A;  3O5Y A;  2XF3 A;  1YLZ A;  1T1A A;  2CMN A;  5FI7 A;  1FCN A;  3T4L A;  4ZJ2 A;  1FCM A;  3EEA A;  1GA9 A;  1XP4 A;  3HL9 A;  3HUM A;  2WKQ A;  4L0L A;  2XA7 S;  4R3A A;  3KO6 A;  3UE0 A;  3N8S A;  3VSL A;  2HDU A;  5AJG A;  2Y2L A;  3UME A;  3HLC A;  2BAS A;  5JYP A;  1ES4 A;  3T50 A;  1N9N A;  1TS0 A;  1X0O A;  3MFD A;  4JGP A;  2HDR A;  2Z2L B;  2XFS A;  4U3T A;  2LB9 A;  3PHY A;  4IVK A;  3H82 B;  4I3I A;  1U60 A;  1K55 C;  5FDS A;  2YKF A;  4X1M A;  4ME4 A;  1Y4O A;  3W8K A;  3WS1 A;  3S7P A;  5CHU A;  1ZHH B;  4UAA A;  1D7E A;  2HF6 A;  2P08 A;  2EX2 A;  1IEL A;  2KX6 A;  1W8Q A;  3V5M A;  4DJ3 A;  1MWU A;  3H82 A;  3FV7 A;  3LYX A;  4R3J A;  3MZE A;  3KSG A;  3TSG A;  1OPX A;  3MZF A;  2V1B A;  4KG6 A;  4E3N A;  4E3O A;  5CED A;  2R9X A;  1KE3 A;  1YSQ A;  4GD6 A;  4GDN A;  5A8B A;  1MY8 A;  1K38 A;  4EER A;  4G3W A;  2VA0 A;  5EVI C;  1K6S A;  4ID4 A;  4HNB A;  5CXW A;  3N8R A;  2J80 A;  1XGJ A;  4GN2 A;  3IF6 C;  5FAT A;  2O9C A;  5HAR A;  4OOY A;  4R23 A;  1OME A;  2VV6 A;  4ZJ3 A;  4D60 A;  5K5B A;  3V3R A;  3BEB A;  3Q7V B;  4Y15 A;  3E2K A;  1L0G A;  3UDF A;  4Q0H A;  2Y2P A;  2C6W B;  2Y91 A;  2XDM A;  1H3Q A;  2WAD A;  1HVB A;  1KE4 A;  1CJF A;  5EVE A;  2LB5 A;  3ZG0 A;  2EFU A;  5MC7 A;  1UGU A;  4IHQ A;  5F1G A;  2MJ6 A;  4MEZ A;  4OQ0 A;  2KLI A;  3EQV A;  1LHY A;  2ZC4 B;  4OH0 A;  1O07 A;  3HRE A;  1YT4 A;  4R70 A;  5DF8 A;  5D3O A;  1VHM A;  5EPH A;  3A3I A;  2XRN A;  3Q7V A;  4X55 A;  3EWK A;  4HBU A;  4JF4 A;  3PBN A;  2EWW A;  4KUO A;  1STZ A;  4LGW A;  3LUQ A;  3CUE C;  3FWL A;  2ZMF A;  4QWO A;  3H9W A;  2WGW A;  3WRT A;  4FH4 A;  1S0W A;  4WMC A;  2FFF B;  4QB8 A;  1MWR A;  1YMX A;  2X71 A;  3BW6 A;  1J3W A;  1DY6 A;  3CAX A;  3HJK A;  3TOI A;  1O7E A;  5GLD A;  3G4P A;  5EEC A;  4FCF A;  3EOI A;  4PHT A;  2J7V A;  2VV7 A;  5HX9 A;  4FD8 A;  1Z09 A;  3B42 A;  4FSF A;  3V50 A;  4U0X A;  3RFB A;  3PBO A;  3QP4 A;  4BBV A;  1PW8 A;  3MKE A;  5HD3 A;  3DTE A;  4WN5 A;  1L3L A;  4EEU A;  2ZM8 A;  4KUK A;  2WAF A;  3VOY A;  4X1L A;  1FSY A;  3SW1 A;  5TFQ A;  2OV5 A;  1P0Z A;  2Q9M A;  1H8M A;  3LI9 A;  1S67 L;  2HP9 A;  4II7 A;  2ZC5 B;  3F1O B;  4EUV A;  1LL9 A;  2W3D A;  1YKD A;  2PD7 A;  3T4Q A;  5L2F A;  1KVM A;  3E4Q A;  5FQM A;  1ES2 A;  2HDQ A;  4MBK A;  4JGO A;  1ONG A;  3ITB A;  2QHK A;  4S2I A;  2IA2 A;  3GMW A;  4ZJ1 A;  3HLG A;  3A3E A;  2E8I A;  4GHI B;  3NCK A;  5HL6 A;  3VOZ A;  3K3C A;  3F1O A;  1IEM A;  2WKI A;  2ZMA A;  5FI2 A;  1PRQ A;  4KZ8 A;  1IKG A;  2BG1 A;  3PR6 A;  2ZM2 A;  4LFU A;  1IOU A;  1BZA A;  4L9F A;  3T4T A;  4MN5 A;  2C5W B;  3DWK A;  3FZC A;  2HPB A;  3F1P B;  4P85 A;  4DE1 A;  3U2A A;  4JF6 A;  1SZV A;  1T19 A;  2Y8H A;  5DTK A;  4GHI A;  4BL2 A;  5M19 A;  3VE3 A;  1PNE A;  1WE4 A;  4HP9 A;  2H5S A;  4L9E A;  1OJ5 A;  4E3L A;  3T1X A;  2OLU A;  1K25 A;  3ISG A;  5CER A;  2A2L A;  3DTK A;  1BLP A;  3C5A A;  3F1P A;  3N4I A;  4HJ3 A;  1GHP A;  4S2N A;  4X56 A;  4QJG A;  3LY4 A;  2VGL M;  3ZNT A;  2ZM0 A;  2Y2K A;  2A24 B;  3SH9 A;  1NYM A;  2JKR M;  5DKL A;  4XUX A;  1F2K A;  2K2N A;  3L7H A;  5HDC A;  1JWP A;  1S6R A;  2QPN A;  2Y59 A;  1LSV A;  4WM9 A;  1KDW A;  2QKP A;  2DNS A;  3NDG A;  4WZ5 A;  4R6L A;  1E4D A;  3LCE A;  4HH2 A;  2ZQD A;  3UN7 A;  1YAX A;  4BEN A;  3MKF A;  5HPI A;  5EVL A;  1E25 A;  3N6I A;  4HJ6 A;  2EX8 A;  2A24 A;  5FQI A;  1XA7 A;  2V2F F;  4UA9 A;  3RXW A;  2GNX A;  4S2K A;  1CI9 A;  4BJP A;  3CIT A;  4IJG A;  1KDS A;  1JTD A;  2VGK A;  3P09 A;  1E3U A;  3FYZ A;  3NEC A;  3DTM A;  3E0Y A;  5KMW A;  1K57 C;  5AQ7 A;  3UE3 A;  2A3U A;  5HAP A;  2ZL1 B;  3QHY A;  5EM0 A;  3WS5 A;  5F1F A;  2OAQ 1;  3QP6 A;  4R38 A;  4MN7 A;  4X69 A;  3SS4 A;  2R9W A;  1CEG A;  4YIN A;  2W3F A;  3HLE A;  3PYP A;  1ALQ A;  3FPW A;  1C3B A;  1F5M A;  2P04 A;  4KZA A;  4Z1W A;  3VSK A;  1MKI A;  3PBT A;  2H0T A;  1RGY A;  3UDX A;  4Q0J A;  4WLA A;  1H8Y A;  1TS6 A;  4EEP A;  3IQA A;  1BSG A;  2ZL1 A;  1TS8 A;  4QY6 A;  3BY8 A;  1VB6 A;  1L0E A;  1S4R A;  2V8C A;  1K6R A;  2Y2I A;  4U0T A;  4WYY A;  4HEF A;  2JC7 A;  2PBD P;  2OAP 1;  2PT7 A;  1ZG4 A;  1KVL A;  4Q0I A;  3IHB A;  4K0X A;  4KEN B;  1NXY A;  2OSU A;  3QNC A;  2XEP A;  1T1C A;  1LL5 A;  2NUT C;  2VK3 A;  3RH8 B;  3IX3 A;  2EA9 A;  3W4O A;  4GW9 A;  4Y3I A;  3UB9 A;  4GLQ A;  4P6Z M;  2BTF P;  3LEZ A;  3BYD A;  3NI9 A;  3OOV A;  5EE8 A;  2EXB A;  1CK3 A;  4C75 A;  1KGF A;  2A49 A;  4C3Q A;  5TGF A;  3HLW A;  1NJ4 A;  4N9L A;  1BTL A;  1PI4 A;  4IUK A;  3S22 A;  4JXG A;  5L09 A;  1XX2 A;  3D4F A;  4X6T A;  1UWP X;  1GSV A;  3OPR A;  1W8Y A;  3HLD A;  3VP1 A;  4H8R A;  1ZKJ A;  2FFY A;  5IT5 A;  2V1Z A;  1KE0 A;  1JVJ A;  3Q82 A;  4KZ7 A;  4DN0 A;  2PU2 A;  5L10 A;  3L9K A;  5TBM B;  1G6A A;  1BUL A;  3ZVT A;  3VV4 A;  4OP5 A;  4KZ4 A;  5EOO A;  3FKV A;  5M18 A;  4Z9Q A;  3NOU C;  3LR0 A;  3GQZ A;  1GHM A;  3WS4 A;  4FH2 A;  1T1B A;  1H8Z A;  3ZHH A;  3IX8 A;  3ZNY A;  1QMF A;  4LRX C;  4O8G A;  2ZQ7 A;  5TBM A;  3C4P A;  4E3J A;  3S4X A;  1NY0 A;  2P9V B;  4QU3 A;  1MBL A;  4KG5 A;  1ACF A;  3O86 A;  4N92 A;  5FQK A;  3EGD C;  1K4E A;  4KZ6 A;  1N9B A;  5J7E A;  4HI4 A;  4GZB A;  4EU0 A;  4K08 A;  4R4R A;  3NDE A;  4JPM A;  5CTN A;  4R0Q A;  1BUE A;  2Y2H A;  4DXC A;  1P9R A;  3MBZ A;  5CRF A;  3UE6 A;  3IF5 A;  3IH9 A;  4GOG A;  3OPP A;  3BWL A;  4GS9 B;  2P9V A;  3LY3 A;  3ZYT A;  4DKI A;  3BFC A;  2UWX A;  4C6Y A;  4KZ5 A;  3LGO A;  4WMC D;  5GHY A;  2B02 A;  4BLM A;  2XH9 A;  3MXS A;  1S1Y A;  1OTA A;  3G30 A;  2CC1 A;  4O7D A;  3UB7 A;  2G2W A;  2I72 A;  5FI6 A;  2JHE A;  4YFM A;  4S2N C;  5E2G A;  4GS9 A;  3GEC A;  2J3W A;  3DTI A;  3IXB A;  3VMA A;  1G28 A;  5DFY A;  1N4O A;  4I3A A;  4LEN A;  1IYO A;  4JXS A;  1TDG A;  4I5S A;  2GZA A;  3ZVW A;  1LT0 A;  2Y79 A;  3BFF A;  3SZT A;  1ZC2 A;  3W4Q A;  5DTS A;  3VP2 A;  2JBF A;  3EGX C;  4E6X A;  1OJG A;  3DWZ A;  4EBL A;  3P01 A;  4N9K A;  2FZ0 A;  4PM7 A;  2JKT M;  4B93 A;  1EWZ A;  5FDH A;  3BQA A;  1XJ4 A;  1D06 A;  4MLL A;  2M7U A;  3KSH A;  1ZG6 A;  4LV1 A;  2ZLY A;  2WGW B;  1BYW A;  3VE4 A;  1M6K A;  3MXR A;  1GA0 A;  1ZTU A;  3PBS A;  2J9P A;  4FUW A;  4OON A;  4QHC A;  2WK0 A;  2WAE A;  2L1M A;  5HW3 A;  2VGJ A;  2VLG A;  3W4P A;  2H28 A;  2K31 A;  1AWI A;  3IBJ A;  2JKF A;  4WZ4 A;  5DJU A;  1GSW A;  3C8C A;  5CGS A;  5GL9 A;  1NLY A;  5HWW A;  3UE1 A;  3T4J A;  4BQM A;  2VGL S;  3GVB A;  4M4X A;  2RCX A;  2RL3 A;  3A3D A;  1YLJ A;  3R4K A;  4HQA A;  1L0D A;  3ZG8 B;  3V39 A;  1XJ6 A;  3LEQ A;  4IBR A;  4RX3 A;  3C7V A;  4Y2F A;  1HD8 A;  2M7V A;  3FC7 A;  2M1C A;  3DAV A;  2O0Y A;  2Q0O A;  3FPV A;  4CQH A;  2OWJ A;  2G2U A;  3BJN A;  1TVF A;  4HP4 A;  4OLD A;  1YQS A;  3JVV A;  1FQG A;  1XJ2 A;  3MZD A;  1XFN A;  3NOP C;  1PFL A;  3JYI A;  1J9M A;  3C38 A;  4MDZ A;  5J4E A;  2P7J A;  4JXW A;  3MF0 A;  3PXP A;  3QP2 A;  1N9O A;  4MMN A;  5E43 A;  4GB7 A;  3MFX A;  2B18 A;  2WKR A;  3TW8 A;  1K4F A;  4L9G A;  1Y54 A;  3OPH A;  4ETX A;  1E3U D;  3QP8 A;  1N9L A;  4AFI A;  2XGN A;  4OQI A;  3T4S A;  3ZG7 B;  3W2Z A;  3BY9 A;  2XLN A;  4E04 A;  2E8J A;  2HJE A;  2P74 A;  3RTY A;  2L0W A;  3OCN A;  2HP6 A;  2DMW A;  5LBR A;  3CHW P;  3T12 B;  3BFE A;  2H0Y A;  1W63 Q;  1G6O A;  2W3G A;  5F83 A;  2ZQA A;  3UO9 A;  3JVU A;  5FEF A;  4YNR A;  4JGQ A;  5GHZ A;  1W79 A;  4UHU A;  1ERO A;  3NIA A;  5KZH A;  1K55 A;  5TJJ A;  1IKI A;  4GDB A;  3HUN A;  4MCW A;  5FQJ A;  4E3K A;  4EBN A;  1JTG A;  3G6O A;  2WKH A;  2ZOI A;  5GLA A;  3CLO A;  1FR1 A;  4HJ4 A;  4HY8 A;  3MXQ A;  4K91 A;  1WA9 A;  4E3I A;  4A5R A;  1FIK A;  5FAP A;  2XFT A;  5EVI B;  1PI5 A;  4P6Z S;  4YOF A;  2GDN A;  4OPY A;  4OPZ A;  5F5Y A;  3RXX A;  3NUL A;  5EM1 A;  4EWF A;  3TE8 A;  4Y0O A;  2ZC3 B;  4P87 A;  1SKO B;  3UPN A;  1A0K A;  4OOM A;  3K2N A;  3GR2 A;  2PHY A;  5I5L A;  1CF0 A;  4EQI A;  1IYP A;  4MBF A;  1JNU A;  1DJB A;  3D72 A;  5E2E A;  2EX9 A;  4KQQ A;  4DJ2 A;  1IYQ A;  2FH5 A;  5J3W A;  2W3E A;  2EX6 A;  1IYS A;  2VZW A;  4NXE A;  2L4R A;  3ULF A;  1DP6 A;  1GHI A;  2J3T D;  2Q9N A;  4UEY A;  2X02 A;  4Y13 A;  1EW0 A;  5EVI A;  3PBQ A;  3LIC A;  5JYO A;  1MWT A;  2OWH A;  4QPR A;  4JLF A;  4UQI M;  1DP8 A;  3E4O A;  1DRM A;  4ARZ B;  1D1J A;  2W1R A;  2XD1 A;  3ZGA B;  1SKO A;  3GDI A;  5C5K A;  4HH3 A;  4FOF A;  1L0F A;  3KYE A;  2H10 A;  3UB5 P;  3SS5 A;  2O9A A;  4OP8 A;  2XR0 A;  3A3J A;  4RYE A;  1EI5 A;  5G4Y A;  3O87 A;  1I2W A;  3VOL A;  1YSP A;  4BL3 A;  4HOI A;  1PZO A;  3MQQ A;  4IBX A;  3LO7 A;  1TS7 A;  4ARZ A;  2ZQ8 A;  1WYB A;  2XD5 A;  1I2S A;  5HAQ A;  3S7N A;  5HDS A;  3VFF A;  1TD5 A;  3O3V A;  1TDL A;  4RVA A;  2Y2Q A;  4KZ3 A;  3GRJ A;  4WUJ A;  2WUQ A;  2XQZ A;  1QME A;  3BFD A;  3MQO A;  4UA6 A;  2JKR I;  1K54 A;  3M2J A;  3N7W A;  4EQ1 A;  1PZP A;  4MNR A;  3PAG A;  5HFO A;  2YKH A;  2VKS A;  4GJ4 A;  2D01 A;  1JWV A;  3GTC A;  3OC2 A;  1V9Z A;  4PKY G;  1ESI A;  2Z2M B;  2ZC6 B;  1CI8 A;  3LID A;  5CX7 A;  4I38 A;  1BT5 A;  1YLY A;  5FSR A;  3ZG5 A;  1OTI A;  4R1G A;  3IXH A;  2PYR A;  4Y0T A;  4OOL A;  4WBG A;  3IT9 A;  4EES A;  3ZFZ A;  4OKP A;  5CHJ A;  1MC0 A;  1S66 L;  4IVI A;  1S1Z A;  3NY4 A;  1XPB A;  4ZBE A;  3Q81 A;  2HP5 A;  3ICY A;  4UA7 A;  3M2K A;  3CWF A;  1YLW A;  3LR3 A;  3M6H A;  4JGR A;  2ZQC A;  3QP5 A;  4GD8 A;  3MS6 A;  3MR0 A;  2QWS A;  1RP5 A;  4EV4 A;  3TG9 A;  2OOL A;  3G2Z A;  4GKU A;  4H6J B;  4EUZ A;  3IXD A;  2W3H A;  3SH8 A;  2NUP C;  4RX2 A;  2PD8 A;  2HZ5 A;  4QD4 A;  3LFV A;  5FAQ A;  1PW1 A;  3BFG A;  1HTZ A;  2BLS A;  2HDS A;  4K0W A;  4WF0 A;  3P7N A;  1MKM A;  2VV8 A;  4EXO A;  5G4Z A;  2AVX A;  4HIA A;  1AXB A;  4R4S A;  5E2F A;  1XKZ A;  1GSX A;  4EW7 A;  2ZBB A;  1ES5 A;  4H6J A;  2O9B A;  3OLO A;  4N1X A;  4O0P A;  1YPR A;  3OBF A;  2Y2J A;  4X25 A;  2PBY A;  4NG2 A;  1LSX A;  4DMZ A;  1MWS A;  4EBP A;  3D9Y A;  2UV0 E;  2ZJ9 A;  4ZRR A;  3TJZ C;  4DDS A;  3F1N B;  4KZ9 A;  1CQA A;  1XA1 A;  4I39 A;  2HGV A;  3UB8 A;  2EWV A;  5BOH A;  4S2J A;  1KGG A;  4ESP A;  4S2O A;  1XXM A;  5F69 A;  5HWV A;  2PAV P;  3VP0 A;  5IS1 A; 
#chains in the Genus database with same CATH homology
 3S1Y A;  5M19 A;  1WE4 A;  2DRW A;  5CGS A;  4DF6 A;  5GL9 A;  5F82 A;  1BLC A;  2H5S A;  5AQB A;  1PYY A;  2JE5 A;  4E3L A;  2WZZ A;  3IWI A;  3UE1 A;  1M40 A;  4BQM A;  5FQQ A;  2OLU A;  1YLP A;  3GVB A;  3IHA A;  1K25 A;  4KZB A;  1PIO A;  1TEM A;  5AQ9 A;  3ISG A;  1ERQ A;  5CER A;  2RCX A;  3HUO A;  2RL3 A;  3UY6 A;  3A3D A;  1YLJ A;  1FR6 A;  1BLP A;  1VM1 A;  3C5A A;  4OPQ A;  3VP4 A;  5GHX A;  1LI9 A;  5EOE A;  3C7U A;  3N4I A;  2ZQ9 A;  1L0D A;  5AQA A;  5KSH A;  1GHP A;  3IH8 A;  4S2N A;  3HBR A;  4X56 A;  3ZG8 B;  4QJG A;  3V39 A;  4B4X A;  3BLM A;  3LY4 A;  4X53 A;  3ZNT A;  2ZM0 A;  3HLB A;  2Y2K A;  3SH9 A;  1NYM A;  4RA7 A;  2JCH A;  4NET A;  1FOF A;  3I7J A;  1LI0 A;  3C7V A;  3OCL A;  4IBR A;  1JWZ A;  4RX3 A;  1SCW A;  4XUX A;  3ZG9 B;  1HD8 A;  4PM6 A;  1L2S A;  2Y55 A;  1BLH A;  4S2M A;  1JWP A;  3BEC A;  1MXO A;  1S6R A;  2QPN A;  3EQU A;  1Z6F A;  2B5R A;  4JKT A;  4S2P A;  5FAO A;  2Y59 A;  4WM9 A;  3G35 A;  2G2U A;  1KDW A;  1TVF A;  2DNS A;  3NDG A;  4WZ5 A;  1FSW A;  4OLD A;  1CEF A;  1YQS A;  3AGE A;  3P98 A;  5U47 A;  1E4D A;  2WGV A;  3LCE A;  4X68 A;  2QZ6 A;  1FQG A;  3OPL A;  4Y7P A;  2ZQD A;  3UN7 A;  3MZD A;  3G32 A;  3BLS A;  3MKF A;  5EVL A;  3UNW A;  4B88 A;  1E25 A;  4BEN A;  3Q7Z A;  3N6I A;  1NZU A;  4WZ5 C;  1W7F A;  5DF7 A;  2EX8 A;  3JYI A;  5A93 A;  5FQI A;  1J9M A;  4ZTK A;  3WWX A;  4CJN A;  1K57 A;  5DTT A;  1XA7 A;  3BM6 A;  2V2F F;  4UA9 A;  4WEK A;  3RXW A;  3AGD A;  4S2K A;  4JXW A;  5DVA A;  1WYC A;  1CI9 A;  4PM5 A;  5A91 A;  4BJP A;  5IHV A;  5E43 A;  1KDS A;  1DJC A;  1JTD A;  3G34 A;  2V20 A;  1I5Q A;  4GB7 A;  1FCO A;  4M3K A;  2VGK A;  3P09 A;  1E3U A;  3FYZ A;  3DTM A;  3SOI A;  5M1A A;  4LV3 A;  1K57 C;  2J9O A;  2X01 A;  5KMW A;  1K4F A;  4LV2 A;  1NRF A;  5AQ7 A;  4HBT A;  1Y54 A;  1YLT A;  2A3U A;  3UE3 A;  4OQH A;  5HAP A;  4LCM A;  3QHY A;  1SHV A;  3OPH A;  2EFX A;  4XUZ A;  3WS5 A;  3VP3 A;  4ZDX A;  5F1F A;  1E3U D;  1LLB A;  2J8Y A;  3AGF A;  3OZH A;  4N1H A;  2XGN A;  4PMA A;  4OQI A;  4X69 A;  3ZG7 B;  3V3S A;  1ERM A;  3SS4 A;  3UPO A;  2R9W A;  1CEG A;  4YIN A;  2XLN A;  3HVF A;  3HLE A;  1YM1 A;  3FKW A;  4LV0 A;  3SH7 A;  1ALQ A;  2P74 A;  1C3B A;  2XF3 A;  2WYX A;  3OCN A;  2Y2O A;  4KZA A;  2HP6 A;  1MPL A;  1YLZ A;  4JF5 A;  4E6W A;  5FI7 A;  3VSK A;  5CEC A;  1MKI A;  3PBT A;  2H0T A;  2Y2N A;  1RGY A;  3UDX A;  1H8Y A;  3BFE A;  1FCN A;  2H0Y A;  1PWD A;  3IQA A;  4ZJ2 A;  1FCM A;  1BSG A;  1GA9 A;  5F83 A;  2WGI A;  3PTE A;  4QY6 A;  1XP4 A;  3HL9 A;  3HUM A;  4F94 A;  1L0E A;  2ZQA A;  3UO9 A;  4L0L A;  1K6R A;  1NYY A;  2Y2I A;  3CJM A;  3UE0 A;  4U0T A;  3N8S A;  4WYY A;  5GHZ A;  3VSL A;  3BRM A;  2HDU A;  1ES3 A;  2JC7 A;  1W79 A;  4HEF A;  4UHU A;  2Y2L A;  1ERO A;  3NIA A;  5KZH A;  1W5D A;  1K55 A;  1ZG4 A;  4HES A;  5CEB A;  1IKI A;  4GDB A;  3HUN A;  1KVL A;  3HLC A;  5FQJ A;  4OPR A;  5JYP A;  1ES4 A;  3IHB A;  4QY5 A;  3MFD A;  4Y0U A;  4E3K A;  4EBN A;  4K0X A;  4P6B A;  2HDR A;  1K54 C;  2Z2L B;  2IWD A;  1JTG A;  3N8L A;  5KSC A;  2WKH A;  2XFS A;  4KEN B;  5GLA A;  4U3T A;  1FR1 A;  1NXY A;  2OSU A;  4DE3 A;  3QNC A;  4IVK A;  4K91 A;  2OLV A;  1U60 A;  1K55 C;  2XEP A;  3CZD A;  1HZO A;  4E3I A;  3PBR A;  3ZDJ A;  4A5R A;  5FAP A;  5FAS A;  2XFT A;  5EVI B;  4OLG A;  1LL5 A;  1PI5 A;  1VQQ A;  3W8K A;  5EUA A;  3WS1 A;  5CHU A;  2GDN A;  4OPY A;  4OPZ A;  5HL1 A;  3RXX A;  4UAA A;  1K56 D;  3HLF A;  4EWF A;  4Y0O A;  3ITA A;  3W4O A;  2EX2 A;  2ZC3 B;  4P87 A;  3A3F A;  3UPN A;  3UDI A;  4OOM A;  3GR2 A;  1IEL A;  4EQI A;  3LEZ A;  1IYP A;  1W8Q A;  3BYD A;  3NI9 A;  5EE8 A;  4MBF A;  2EXB A;  3UPP A;  3V5M A;  5E2E A;  1DJB A;  1KGE A;  1MWU A;  2EX9 A;  4KQQ A;  1CK3 A;  1IYQ A;  4C75 A;  3FV7 A;  4MBH A;  4PM9 A;  2EX6 A;  1IYS A;  3MZE A;  4R3J A;  3TSG A;  1KGF A;  2A49 A;  1GCE A;  3MZF A;  4C3Q A;  5TGF A;  3HLW A;  1NJ4 A;  1BTL A;  1GHI A;  1PI4 A;  2Q9N A;  4KG6 A;  2X02 A;  4N9L A;  3S22 A;  4JXG A;  5EVI A;  1XX2 A;  4E3N A;  3D4F A;  3PBQ A;  4X6T A;  4E3O A;  5CED A;  3OPR A;  5JYO A;  5TR7 A;  1MWT A;  1W8Y A;  2R9X A;  3HLD A;  3VP1 A;  1KE3 A;  4JLF A;  4GD6 A;  4H8R A;  1ZKJ A;  4GDN A;  2FFY A;  1Q2P A;  1MY8 A;  1K38 A;  5EVI D;  2V1Z A;  1KE0 A;  1JVJ A;  3Q82 A;  5A90 A;  2XD1 A;  4KZ7 A;  3ZGA B;  5EVI C;  1K6S A;  2PU2 A;  3IXG A;  4ID4 A;  2DCF A;  5CXW A;  4DE2 A;  3N8R A;  1XGJ A;  4OQG A;  1G6A A;  1L0F A;  1BUL A;  4GN2 A;  3ZVT A;  3IF6 C;  4WEL A;  2XK1 A;  2PU4 A;  2H10 A;  4KQO A;  4OP5 A;  4KZ4 A;  3SS5 A;  1BLS A;  4DXB A;  5FAT A;  4OP8 A;  5EOO A;  5HAR A;  2XR0 A;  3A3J A;  4OOY A;  3Q1F A;  4R23 A;  3FKV A;  5M18 A;  1OME A;  4JXV A;  4Z9Q A;  4RYE A;  1EI5 A;  3O87 A;  4ZJ3 A;  3SS3 A;  1I2W A;  3V3R A;  3BEB A;  3Q7V B;  3E2K A;  1DJA A;  1H5X A;  3GQZ A;  1L0G A;  3UDF A;  1GHM A;  3WS4 A;  4LCL A;  4BL3 A;  1PZO A;  4FH2 A;  5CTM A;  4BD0 A;  4IBX A;  3LO7 A;  2Y2P A;  1H8Z A;  2ZQ8 A;  1WYB A;  3DW0 A;  3Q07 A;  2C6W B;  3ZHH A;  2Y91 A;  5J8X A;  2XDM A;  2WAD A;  1QMF A;  3ZNY A;  1HVB A;  2XD5 A;  1I2S A;  1KE4 A;  2ZQ7 A;  5HAQ A;  3C4P A;  3ZG0 A;  2EFU A;  4E3J A;  5I94 A;  4KQR A;  3VFF A;  5F1G A;  4MEZ A;  3S4X A;  1NZO A;  1NY0 A;  2P9V B;  3O3V A;  1TDL A;  4QU3 A;  4OQ0 A;  4RVA A;  1MBL A;  2Y2Q A;  3GRJ A;  4KG5 A;  4KZ3 A;  2WUQ A;  2XQZ A;  1QME A;  3BFD A;  4UA6 A;  2Y4A A;  1K54 A;  3EQV A;  3M2J A;  1LHY A;  2ZC4 B;  3O86 A;  3N7W A;  4OH0 A;  1O07 A;  3HRE A;  4N92 A;  5FQK A;  3ZCZ A;  1YT4 A;  1PZP A;  3M6B A;  3PAE A;  5D3O A;  5DF8 A;  4MNR A;  3PAG A;  4PM8 A;  4WEJ A;  3A3I A;  1K4E A;  1N9B A;  3IWQ A;  3Q7V A;  4KZ6 A;  4X55 A;  5EPH A;  5HFO A;  4HBU A;  4GZB A;  3PBN A;  4JF4 A;  5G18 A;  3WS0 A;  5A92 A;  4R4R A;  3RJU A;  5CHM A;  1JWV A;  3GTC A;  3NDE A;  4JPM A;  5CTN A;  4R0Q A;  1BUE A;  3OC2 A;  1ESI A;  2Y2H A;  2Z2M B;  2ZC6 B;  3FWL A;  4DXC A;  1CI8 A;  3MBZ A;  5CRF A;  4R3B A;  4DDY A;  3IF5 A;  1BT5 A;  2WGW A;  3WRT A;  1YLY A;  3IH9 A;  4FH4 A;  4GOG A;  5FSR A;  4PPR A;  3OPP A;  3ZG5 A;  1K56 A;  1S0W A;  4R1G A;  2P9V A;  3IXH A;  4WMC A;  4Y0T A;  5FQ9 A;  3LY3 A;  2FFF B;  4QB8 A;  4OOL A;  4OVD A;  4DKI A;  3BFC A;  1MWR A;  3E2L A;  1YMX A;  2X71 A;  3G31 A;  4B4Z A;  1DY6 A;  3IWO A;  4WBG A;  2UWX A;  3TOI A;  1SKF A;  3IF6 B;  4C6Y A;  3IT9 A;  4KZ5 A;  4CPK A;  3ZFZ A;  3NC8 A;  4OKP A;  4WMC D;  4DRT A;  5GHY A;  1O7E A;  5GLD A;  5CHJ A;  5DF9 A;  2IWC A;  3G4P A;  5EEC A;  4BLM A;  4FCF A;  4IVI A;  2XH9 A;  3NY4 A;  1XPB A;  3MXS A;  4ZBE A;  3Q81 A;  2HP5 A;  2J7V A;  4BD1 A;  3G30 A;  5HX9 A;  4FD8 A;  4UA7 A;  2CC1 A;  3M2K A;  4O7D A;  4JBF A;  1YLW A;  2G2W A;  2I72 A;  3M6H A;  4FSF A;  4IED A;  5FI6 A;  3V50 A;  4U0X A;  2ZQC A;  4GD8 A;  4Q8I A;  4S2N C;  4YFM A;  4P0M A;  3PBO A;  5E2G A;  1RP5 A;  4EV4 A;  2EXA A;  2ZC7 A;  3IXB A;  3TG9 A;  3VMA A;  1PW8 A;  2Y2M A;  3MKE A;  3G2Z A;  3NBL A;  3GSG A;  1ESU A;  1RGZ A;  4GKU A;  1N4O A;  4ZAM A;  1ONH A;  3IF6 A;  2ZM8 A;  5CGW A;  2WAF A;  4LEN A;  1IYO A;  3VOY A;  4JXS A;  4EUZ A;  3IXD A;  1FSY A;  1TDG A;  3SH8 A;  4RX2 A;  5TFQ A;  2OV5 A;  3ZVW A;  2Q9M A;  1PWG A;  3O88 A;  4QD4 A;  3BFF A;  1ZC2 A;  2HP9 A;  2ZD8 A;  2ZC5 B;  4GNU A;  5GLC A;  3W4Q A;  5FAQ A;  1PW1 A;  3BFG A;  1HTZ A;  1LL9 A;  2BLS A;  2HDS A;  3CG5 A;  4K0W A;  5DTS A;  3VP2 A;  1G68 A;  3B3X A;  2JBF A;  4E6X A;  1RCJ A;  1Q2Q A;  2QMI A;  5L2F A;  1AXB A;  4R4S A;  4DE0 A;  1KVM A;  5E2F A;  3WRZ A;  3DWZ A;  2Y2G A;  1XKZ A;  4EBL A;  5FQM A;  5GLB A;  1ES2 A;  4N9K A;  2IWB A;  1YMS A;  2HDQ A;  4MBK A;  1ES5 A;  1ONG A;  1XGI A;  4PM7 A;  3ITB A;  1EWZ A;  4D2O A;  4S2I A;  4XXR A;  3GMW A;  4NK3 A;  4ZJ1 A;  4KG2 A;  5FDH A;  4E3M A;  3HLG A;  3A3E A;  4N1X A;  4MLL A;  3GV9 A;  2E8I A;  5HAI A;  3NCK A;  1ZG6 A;  4LV1 A;  3VOZ A;  2Y2J A;  3C4O A;  1IEM A;  2WGW B;  2WKI A;  2ZLY A;  4S2L A;  2PBY A;  2WKE A;  2ZMA A;  5FI2 A;  1MWS A;  4KZ8 A;  4EBP A;  3WS2 A;  1IKG A;  2BG1 A;  1M6K A;  5CGX A;  3MXR A;  2ZM2 A;  3VFH A;  1GA0 A;  2ZJ9 A;  3PBS A;  2J9P A;  1SDN A;  1BZA A;  4OON A;  4QHC A;  1SDE A;  2WK0 A;  2WAE A;  3QNB A;  1PWC A;  5HW3 A;  2C5W B;  3DWK A;  3FZC A;  3CMZ A;  2WZX A;  2HPB A;  5E2H A;  4DDS A;  4P85 A;  4KZ9 A;  1XA1 A;  4DE1 A;  2VGJ A;  4JF6 A;  5FA7 A;  5BOH A;  4S2J A;  3W4P A;  1KGG A;  4S2O A;  1XXM A;  3VP0 A;  4WZ4 A;  5DTK A;  4BL2 A;  3G2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...