1S1YA

Photoactivated chromophore conformation in photoactive yellow protein (e46q mutant) from 10 microseconds to 3 milliseconds
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photoreceptor
molecule keywords Photoactive yellow protein
publication title Chromophore conformation and the evolution of tertiary structural changes in photoactive yellow protein
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 36
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1s1yA00
2V9AA 1S66L 3NJAA 2QJ5A 1GSVA 1LSXA 4R38A 4RQ9A 4WF0A 5F5YA 1NWZA 2W27A 4H6JB 3C8CA 2PDRA 4GS9A 3ICYA 3BWLA 1XJ4A 2PYPA 4HY8A 3E4OA 4GHIA 4JGPA 3UB7A 4NXEA 4KQDA 5HSQA 4EQ1A 3C2WA 1XJ6A 1V9ZA 1P97A 2QHKA 1D7EA 1OT6A 3EWKA 1LT0A 5AVEA 4GCZA 2V1AA 3FG8A 4LPZA 2OWHA 2JN7A 4HJ6A 4L9GA 3B33A 3MR0A 4XT2A 1F9IA 3K3CA 1MZUA 1DP8A 4MN5A 1UWPX 3H82A 2KX6A 2WKQA 5G4ZA 2YKHA 4WUJA 5HDSA 5EFWA 3MXQA 4I3JA 2PHYA 2V0WA 1F98A 1X0OA 5HWWA 3IBRA 5HD5A 1OJGA 1UGUA 4HOIA 1P0ZA 4JGQA 2WKRA 4BBVA 5HZHA 5F69A 4H6JA 3MQQA 4KUOA 1XFQA 4HNBA 3LIFA 3F1OB 3D72A 3SW1A 3UMDA 1N9OA 4HIAA 4EETB 3LIBA 1TS0A 3CWFA 3EEHA 1BYWA 4I5SA 1XJ3A 4I39A 2H28A 3CLOA 2PR6A 4BBUA 4NXFA 1VB6A 1Y28A 1LL8A 4EEUA 1XFNA 2YKFA 4I3IA 5J3WA 5IS1A 3T50A 3IS2B 1KOUA 2D01A 1ODVA 4EXOA 4HJ3A 2GJ3A 2M1CA 2CMNA 3A0SA 3E4PA 1WA9A 4WL9A 3GDIA 2EA9A 4F3LB 5A8BA 3GECA 4HJ4A 3H7WB 3HJIA 1D06A 3NOUC 2D02A 4L9FA 2PYRA 2QJ7A 5KIZA 4NXBA 3E4QA 4EERA 3F1PB 3NOTC 3UE6A 1OTAA 4JGRA 5TBMB 3ZQ5A 3MJQA 3F1OA 2J80A 4EEPA 1TS6A 3LIAA 3H9WA 5AVFA 5HDDA 5J4EA 4K08A 3A0VA 1DP6A 5HDCA 2W0NA 3LUQA 1DP9A 4HP4A 2OOLA 2QWSA 3NOPC 1S4SA 1OTEA 4LRXC 4MN6A 3IS2A 2VEAA 1S1YA 5DKKA 4HH2A 4YWZA 3LIDA 3VE4A 3F1NB 1OTDA 4M4XA 2A24B 3CAXA 2V1BA 4HI4A 4F3LA 4NXGA 3K3DA 3FC7A 3H7WA 3HJKA 5HD3A 3UB8A 3VOLA 1DRMA 2R78A 3PHYA 2VLGA 4I3AA 5DKLA 4R6LA 5DJUA 5F68A 5DJTA 2V0UA 5HWTA 2ZBBA 3A0RA 4EW7A 1OT9A 3ULFA 4R70A 1OTIA 3LYXA 1OTBA 2ZOHA 3F1PA 5TBMA 1UWNX 3NHQA 1S1ZA 2VV8A 3MQOA 3LI8A 1GSWA 4HQAA 4I38A 2P7JA 3VE3A 2PR5A 3P7NA 1T19A 2PD8A 2B02A 4LRYC 4WN5A 2K7SA 1LSWA 1T1AA 4L9EA 3LICA 1T1BA 3BY8A 2L0WA 2L1MA 2JHEA 3BY9A 1GSXA 4R3AA 1TS8A 3F1NA 1N9LA 2HV1A 3LIEA 2A24A 4KUKA 1N9NA 2VV7A 2WKPA 5I5LA 4PKYG 5G4YA 1OJ5A 4LLOB 3G6OA 2Z6DA 4BBTA 2OWJA 5IU1A 4GS9B 5HWVA 1S4RA 2Z6CA 4DJ2A 2KDKA 4LRZE 4EESA 4HP9A 2VV6A 4WLAA 4E04A 1V9YA 3MFXA 1TS7A 3OLOA 1EW0A 4GHIB 1T18A 5J7EA 2QKPA 3RTYA 4HH3A 4GW9A 3UMEA 2PD7A 3KX0X 2ZOIA 4PKYA 2BASA 2L4RA 1T1CA 3UB9A 2INWA 3UB6A 3RH8B 4HHDA 1LSVA 1XJ2A 4JGOA 3PYPA 4XT2B 2I9VA 1G28A 4B9OA 1JNUA 5F6AA 3H82B 1S67L 4DJ3A 3LI9A
chains in the Genus database with same CATH superfamily
4S2KA 4X1LA 4BL2A 4G3WA 3S22A 4R38A 4WF0A 4BENA 2PT7A 2W27A 4UHUA 4JF4A 4CLCC 2XA7S 3G4PA 5A92A 1XJ4A 1FCNA 1I5QA 3LR4A 2IA2A 3QNBA 2A2LA 3ZG5A 5GLDA 1XX2A 1LI9A 4UQIM 2M7VA 2WAFA 4GHIA 1TVFA 4OPYA 2ZQDA 1I2WA 3C2WA 3JVUA 4X56A 2ZMVA 1K54C 3U4LP 2DMWA 1OT6A 3W4OA 2JKRM 3EWKA 1FCMA 1BSGA 3IF5A 2X71A 2V1AA 3OPPA 3HREA 4UA7A 1TDLA 2UWXA 1WYBA 1PWDA 4HJ6A 4L9GA 2W1RA 3W4PA 3ZFZA 3K3CA 4E3LA 2XGNA 5J8XA 1DP8A 4MN5A 2WUQA 4XXRA 1UWPX 1MY8A 2WKQA 1XP4A 3UE3A 3MXQA 4DRTA 3DBAA 1PFLA 4G3KA 4HBUA 1X0OA 2J7VA 4HESA 2JCHA 1OJGA 1P0ZA 4JGQA 3NDEA 3DW0A 1NXYA 2Y2HA 4DE0A 2Y91A 1ZG6A 4LV0A 4MN7A 4NK3A 4ZAMA 2QZ6A 1MC0A 2WGIA 4WZ5C 4ARZB 4WBGA 3BECA 3BJNA 3A3JA 3DWKA 3V3RA 3ZNTA 4IHQA 4WEKA 3MS6A 1K25A 4ZJ2A 1BLSA 3MQ0A 1FCOA 1NY0A 4Q0HA 3Q7ZA 3SS3A 4BBUA 2B18A 4P6ZM 3Q1FA 5EVLA 3T4LA 2WZXA 5FI2A 1Y28A 4UQIS 1LL8A 4P87A 5J3WA 5KMWA 1FSYA 1J9MA 5DTTA 2D01A 5FDSA 1ODVA 2ZQ9A 2Y2JA 3C7VA 4HJ3A 4JXSA 3T1SA 4CLCB 3IWOA 1XA7A 2XQZA 2QMIA 2CMNA 5FQJA 2EA9A 5CGWA 5A8BA 3GECA 4L0LA 3QP4A 1D06A 5D3OA 1YAXA 4CLCE 3R7WB 3HLWA 4AFIA 3ZNYA 3SH7A 3NECA 4EU0A 1XKZA 1ONHA 1AWIA 4OH0A 1ES4A 5CHMA 2ZJ9A 1W5DA 4OOLA 2A49A 3NOTC 3UE6A 5M18A 2BG1A 4ARZA 1YT4A 3MJQA 2J80A 4PM7A 4KZ7A 4OLGA 3H9WA 4OQ0A 3UB5P 3MXRA 4RVAA 2ZC3B 3O3VA 3C7UA 1DP6A 1PWGA 1G68A 2ZC7A 2W0NA 3LUQA 1DP9A 3HBRA 3OCNA 2DRWA 1S4SA 4GD8A 4O01A 5CECA 4Y5FA 4PM5A 4LV3A 4MN6A 2NUTC 2ZM8A 4PAUA 2Y55A 3MXSA 4P6ZS 3LIDA 3WS4A 3VE4A 1Q2QA 2HF6A 3T4SA 4GD6A 4JF5A 1KVLA 5DTSA 1PZPA 2Y2GA 4CLCA 4YOFA 3CAXA 2R9WA 4HI4A 4NXGA 3V67A 3UN7A 3HJKA 3BQAA 5CGXA 4WZ4A 2ZD8A 3R7WA 3V39A 4DXBA 1MKIA 3AGDA 3M6HA 1DJCA 1K4FA 3SZTA 5F68A 3VP4A 1K54A 2GX5A 2V0UA 5HWTA 3KSIA 3AGEA 3HUOA 3ULFA 3I7JA 4Y3IA 3UPPA 4R70A 3TRCA 2Q0OA 3E2LA 3BFDA 3LYXA 4EQIA 2ZOHA 4X69A 4OOMA 3ZG8B 4K0XA 3NHQA 1A0KA 3T4QA 2G2UA 4OPZA 3S4XA 2WKEA 4LV1A 1VHMA 1FOFA 1E3UD 1SZVA 2PD8A 4LRYC 4WN5A 4KZBA 3GV9A 1YMSA 3R4KA 2Y2PA 1LSWA 3IH8A 4S2OA 4OOYA 5GHXA 1BLCA 2B95A 2L0WA 1CEFA 5JYOA 3BY9A 5FEFA 4R3AA 4X68A 3LIEA 4WZ5A 1N9NA 4R1GA 2VV7A 3KYZA 3S1YA 2WKPA 4A5RA 5G4YA 2FFYA 3ZCZA 3G6OA 3P09A 3G32A 5FQMA 4N1XA 3FZCA 1YLTA 3IX3A 5HWVA 1W63M 1K56D 4S2IA 3TOIA 4E04A 4GB7A 1V9YA 3RJUA 5MC7A 4QD4A 1OMEA 4B4ZA 2ZC5B 3LR3A 5J7EA 4LCLA 2QKPA 1H8ZA 4HH3A 3FWLA 4FUWA 3UMEA 2PD7A 2EX2A 2ZOIA 4R3JA 3IX4A 2L4RA 2ZC6B 5AQBA 5M19A 2INWA 5EVIC 1EWZA 3Q81A 1KGEA 3IWQA 3T4JA 1LSVA 2PBDP 3S7NA 3FPWA 3V50A 3VP2A 2P04A 4QWOA 4YNRA 4UA9A 3BW6A 1CEGA 4S2NA 1W8QA 4JBFA 1JNUA 5F6AA 3H82B 1ACFA 2EX9A 2ACGA 3LI9A 5EVEA 3A3DA 5FQKA 4C6YA 1NZOA 1O07A 3IXHA 3NCKA 4JPMA 1QMEA 3BQ8A 4U0XA 5CEDA 1S66L 3NJAA 2QJ5A 2K31A 5L8MA 2H0YA 5F1GA 5HPIA 2EWWA 4GN2A 2XFSA 3ZG7B 5F5YA 4Y0UA 2O99A 4E3KA 4HBTA 1IKGA 2PRFA 3QP2A 3DTMA 4Y17A 3BWLA 4BL3A 4ZJ3A 2ZMFA 2PYPA 2HP9A 4B4XA 1SDNA 3SS5A 2W1TB 4GKUA 4HY8A 3D3OA 1L0EA 2XFTA 5GLCA 4WELA 5AJGA 2DCFA 4BJPA 4Y0OA 4JF6A 5FAQA 1F2KA 4EQ1A 1XJ6A 1M40A 1V9ZA 3UY6A 1BZAA 4OQIA 3EGDC 5KSCA 2XA7M 3IXDA 4IVIA 1LT0A 3PBQA 5KSHA 4ETZA 4GCZA 4NG2A 4OVDA 4WMCA 4BWIA 4H8RA 5A91A 4RA7A 2JN7A 4KZAA 4O0PA 3MR0A 3QP8A 2ZM2A 1JWVA 2OAP1 3H82A 2KX6A 3MBZA 5EFWA 5HW3A 2XEPA 3T1RA 3JPUA 4KQRA 2V0WA 1F98A 4KZ4A 5HWWA 1BT5A 5L10A 3ITBA 5HPFA 4U3TA 1KE0A 4KZ6A 3L9KA 2WKRA 4DF6A 5F69A 1J3WA 4ZBEA 5EVIB 2H5SA 4HNBA 5HL6A 2Y59A 1W63Q 1BULA 2Z2MB 2UV0E 3VFHA 3D72A 4EBPA 2JKFA 3QHYA 1VETB 1LI0A 5DF7A 4HIAA 2W1TA 3CWFA 2EWVA 3ISGA 4I5SA 4ZDXA 2H28A 1N4OA 2P9VB 3UO9A 1IOUA 3OCLA 4XUXA 5KZHA 3N4IA 3PBOA 2ZQCA 3SH9A 2RCXA 1NRJA 1L2SA 2YKFA 4I3IA 3SOIA 4OP8A 2JE5A 4KQOA 1KOUA 2JBFA 1M6KA 2O9AA 4DDSA 4EXOA 5DFYA 4R3BA 1K55A 5EM0A 2J9OA 3NBLA 2J3TD 2I72A 4MBKA 1OPXA 1K38A 4Q0IA 3A0SA 4WL9A 4F3LB 3GDIA 1K6SA 1KDWA 3E0YA 4HJ4A 2MJ6A 2XLNA 3DAVA 3HJIA 5BOHA 1PRQA 3K2NA 1JTDA 2HDRA 4OLDA 1SKOB 2NUPC 1FQGA 1RP5A 1NLZA 4KZ5A 2ZL1B 1YLWA 4L9FA 1KVMA 2GZAA 4MEZA 3BLMA 4E3NA 3BLSA 4UA6A 4NXBA 5DFXA 3MKFA 4OQHA 1LL5A 3OC2A 4EERA 4Y15A 5EVIA 4JGRA 4GJ4A 2ZLYA 3IWIA 5TBMB 3ZQ5A 2Y4AA 4KZ8A 4EEPA 5FQ9A 3LIAA 1VM1A 5AVFA 1VETA 5HDDA 5J4EA 4K08A 3VSLA 4N92A 4U0TA 4PM6A 5HDCA 4ETXA 1G6AA 2P9VA 3KSGA 4PMAA 1JWZA 2EX8A 4QHCA 5FDHA 1OTEA 5FAOA 5FQQA 3VP0A 3A3EA 2WADA 5AQAA 2Y2NA 1E4DA 2EXAA 2PU2A 4ZRRA 4UEYA 4X55A 5DKKA 4YWZA 1Q2PA 4FH4A 1JTGA 1MWSA 3QP6A 1VQQA 1JVJA 2PBYA 5HAQA 4F3LA 3K3DA 1PWCA 4F94A 5HD3A 2GNXA 5DF9A 3VOLA 1DRMA 1TDGA 1MWUA 3BFFA 3PBRA 5HFOA 1E3UA 5DTKA 4OPRA 1SKOA 2XD5A 5DJUA 4EUVA 3BRMA 5GLBA 2ZL1A 1U60A 4PHTA 4DE1A 2ZBBA 4EW7A 1BTLA 1OT9A 4OPQA 4EBLA 1ONGA 3O5YA 4GDNA 2W3DA 5TBMA 2HJ9C 4EV4A 1S1ZA 1GA0A 2VZWA 3BM6A 5IT5A 5E43A 4HQAA 4MDZA 3CJMA 1XPBA 4MNRA 5TJJA 3T4TA 3ZGAB 1EROA 2VJWA 3T12B 4S2NC 3TE8A 1T1AA 4L9EA 3LICA 1Y4OA 3BY8A 3IXGA 5CX7A 2B5RA 4DDYA 5AQ9A 2JHEA 4QU3A 4Z9QA 1SDEA 3C4PA 1N9LA 4NKPA 2XSSA 4KUKA 1O7EA 4B93A 3OPLA 4P85A 4PKYG 1ERQA 5CHJA 1H3QA 2Z6DA 5CTMA 2OWJA 5CRFA 2Z6CA 3P98A 1L3LA 5FASA 2KDKA 4LRZE 3M2JA 4C75A 2VV6A 4WLAA 3IF6B 3MFXA 1ZC2A 3CZDA 3UNWA 5IHVA 5FATA 3GSGA 3OZHA 2WAEA 3HLFA 1ES5A 5EOEA 4KZ3A 3MF0A 4Q0JA 1H0MA 3FKWA 4PKYA 1T1CA 3NY4A 2V8CA 3WS2A 1NYMA 1NLYA 3UB6A 1BLPA 2HJEA 2HDSA 4HHDA 3LO7A 3PYPA 4FD8A 5F82A 1G28A 5CGSA 2XF3A 3MZFA 4IVKA 3PAGA 3MMHA 4E3JA 2H10A 3IQAA 3B47A 5EM1A 4DJ3A 2PU4A 5CTNA 4GOGA 2V9AA 3BFGA 1GSVA 1LSXA 2VA0A 3PBNA 4JKTA 3LFVA 2Q9NA 4H6JB 1ERMA 3C8CA 1YSQA 2PDRA 3ICYA 3LEQA 4O7DA 2XD1A 2WGVA 4RX3A 5CERA 1G5UA 3WS0A 4GLQA 3DTIA 3IF6A 4ME4A 1STZA 3ZG9B 3PAEA 1L0DA 4JGPA 4D60A 2OV5A 1KE3A 4KQDA 1ES2A 3LGOA 3T4KA 1P97A 2QHKA 1D7EA 4PM9A 5AVEA 3EOIA 1CI9A 3CUEC 3HL9A 1QMFA 3EQVA 5E2GA 3CI6A 3PBTA 2HP5A 2IWDA 1K55C 3SS4A 3B33A 1IELA 1NRFA 1F9IA 3NC8A 4QY5A 5HX9A 1NZUA 5A93A 3VP3A 2WZZA 1PZOA 4R4SA 1HLUP 3VSKA 5G4ZA 2YKHA 1P9RA 4O8GA 1VEUB 4E3MA 1H8YA 4BD1A 4GDBA 4I3JA 2J9PA 4IBXA 1FILA 4UAAA 1IFQA 4KQQA 1UGUA 2XH9A 1IYOA 4WEJA 4BBVA 1PIOA 2W3HA 5HZHA 5L09A 4H6JA 3U2AA 3ZYTA 1XFQA 2R9XA 2E8JA 2C5WB 3LIFA 5FL3A 3G35A 2RL3A 1ES3A 4JXVA 4Y2FA 2C6WB 3SW1A 1AXBA 2Q9MA 4EETB 1IYPA 2W3EA 1BYWA 2V2FF 2WKHA 4KG6A 2LB5A 4I39A 3IH9A 4JXWA 4Z1WA 3HVFA 3CLOA 2PR6A 3BEBA 4R4RA 4NXFA 1KGGA 5DVAA 3RXXA 1VB6A 4EEUA 1H5XA 1XFNA 3PTEA 3TW8A 3N8SA 3KSFA 3B42A 5C5KA 1WYCA 3BFEA 1YM1A 3EGXC 3LCEA 4P0MA 2GJ3A 2M1CA 4BLMA 3N8RA 1FIKA 4MBHA 1PW8A 4ESPA 2FH5A 2CC1A 3M2KA 3QP1A 2JKGA 4IUHA 1CJFA 3E4PA 3EQUA 3IX8A 3H7WB 2P08A 3WRTA 1W8YA 3E2KA 1VEUA 3NOUC 3UPNA 3ZDJA 3RXWA 4OONA 5FI7A 2D02A 2OSUA 2HP6A 2PYRA 4KG2A 2QJ7A 3VOYA 4QPRA 5JYPA 1ALQA 5G18A 3F1PB 3OBFA 2JKTI 1GHIA 3MSHA 5EOOA 1CQAA 2XRNA 2EFUA 3C5AA 5E2EA 3VMAA 1GHMA 1P9WA 3VP1A 1C3BA 4MMNA 4MBFA 2OOLA 5HAIA 5L07A 3NOPC 4RX2A 3A3FA 3IHBA 1L0GA 2M7UA 4S2JA 4S2PA 1S1YA 4HH2A 4MCWA 2VX8A 3F1NB 1N9BA 2Y8HA 3T1QB 3TJZC 5L2FA 5TGFA 4DMZA 2XR0A 5EECA 1TEMA 2WK0A 3UE1A 3H7WA 3QP5A 4NETA 1GHPA 3UB8A 2EXBA 4QY6A 3SH8A 5DF8A 2R78A 3PHYA 2KOIA 5DKLA 1HVBA 3PXPA 1PNEA 5DJTA 3WRZA 3WS5A 3LR5A 3DWZA 2FFFB 3CUEA 1K57C 2G7UA 2Y2QA 3F1PA 1WE4A 4OP5A 1ZG4A 5U47A 2JKRI 1IYSA 4WYYA 3HCYA 4X6TA 1KE4A 4BMWA 3DTEA 5GLAA 2P74A 3VE3A 2PR5A 1MWTA 3CITA 2Y2IA 3DTKA 1FSWA 3LEZA 3O86A 3N6IA 1FR1A 4CQHA 2ZM0A 1MXOA 4FOFA 4XUZA 2G2WA 1GSXA 4QB8A 4FTXA 3TSGA 3F1NA 4EBNA 2X01A 2OAQ1 2HDQA 3Q7VB 3UE0A 3CPTB 4EWFA 1L0FA 3CHWP 4E3OA 4LLOB 3QNCA 3HLEA 5EE8A 5FEGA 4N1HA 1JWPA 4GS9B 2H0TA 4DJ2A 2ZC4B 4DE2A 4EESA 1XXMA 3LR0A 3IF6C 4X25A 3T4OA 2BTFP 1TS7A 4Q8IA 4K0WA 1IKIA 1T18A 3MZEA 2AVXA 5GHYA 3RTYA 2O9BA 4D2OA 4DXCA 3ZVTA 3W2ZA 3JVVA 3G2YA 3KX0X 4R23A 4IEDA 1FR6A 1S6RA 4WMCD 5FI6A 1DJBA 2XDMA 1F5MA 3C4OA 2Y2LA 1PW1A 4XT2B 2VK3A 2I9VA 4X53A 3G2ZA 1KGFA 4E3IA 2WGWB 3CG5A 3PR6A 3OPHA 2HZ5A 4M3KA 4B9OA 5HL1A 4BD0A 1S67L 4LGWA 2O0YA 2WKIA 3O87A 1YLYA 3L7HA 1SHVA 1H8MA 3KYQA 1XGJA 3E98A 3Q7VA 4C3QA 3CPTA 4R0QA 1LL9A 3HLGA 4RQ9A 3UDFA 3KSHA 2ZQ8A 1NWZA 3M6BA 4GS9A 2J3TC 2LB9A 1D1JA 1K56A 5TR7A 3LY4A 3E4OA 2EX6A 4K91A 3UB7A 4NXEA 4B88A 1CI8A 5F1FA 5HSQA 4ZJ1A 4LFUA 4IBRA 1K6RA 1K4EA 4GZBA 4Y0TA 1MKMA 2Z2LB 3FG8A 2EFXA 2W3FA 3G34A 4LPZA 4N9LA 3LY3A 1GA9A 2OWHA 3BFCA 1IEMA 5EPHA 5LBRA 3B3XA 3JYIA 2O9CA 4XT2A 3C30A 1G6OA 1MZUA 1TD5A 5M1AA 2WGWA 2HPBA 1RGZA 2A3UA 4Y7PA 5HDSA 4WUJA 2VKSA 3CMZA 1K57A 3TG9A 2OLUA 4OKPA 2DNSA 2PHYA 1ESUA 3FKVA 3IBRA 4OQGA 1PYYA 5HD5A 5K5BA 1ZHHB 3UDIA 4HOIA 3VOZA 3V5MA 5EVID 3MQQA 4KUOA 4LCMA 2V20A 1DJAA 2E8IA 1Y54A 3F1OB 4KENB 5GL9A 3UMDA 5A90A 1N9OA 3BYDA 1W79A 3LIBA 3MFDA 4IJGA 1TS0A 3S7QA 3EEHA 1XJ3A 1XGIA 4HEFA 1BLHA 3T1XA 1ESIA 2X02A 1RGYA 5EUAA 1YQSA 1GCEA 2IWCA 1DY6A 3MKEA 3HLBA 1XA1A 3P01A 3EEAA 1RCJA 3HUNA 1IYQA 3W4QA 1W7FA 2ZMAA 5IS1A 3T50A 3IS2B 2Y2OA 2Y2MA 4KZ9A 3W8KA 2OLVA 5AQ7A 2KLIA 1WA9A 4CJNA 3IHAA 3FYZA 1BUEA 3Q07A 3S7PA 4DN0A 5CHUA 3KO6A 1YLPA 3GQZA 1MWRA 3NULA 3ZG0A 5KIZA 2FZ0A 4MLLA 3IBJA 3E4QA 4EUZA 3VV4A 4S2MA 1OTAA 3N8LA 1PI5A 3UPOA 1MBLA 3F1OA 1TS6A 5FSRA 2IWBA 3G31A 3A0VA 5FAPA 2ZQ7A 4LV2A 1TF1A 2WYXA 4HP4A 1YLJA 2BLSA 1E25A 2QWSA 3WWXA 5CEBA 4P6BA 4FH2A 4LRXC 1KDSA 2HGVA 3MZDA 1YKDA 1YLZA 3IS2A 2VEAA 4DE3A 1K0KA 4BQMA 1S0WA 2VGLM 5F83A 5E2HA 1OTDA 1LHYA 4M4XA 2A24B 3GTCA 2V1BA 2W3GA 1EI5A 2ZQAA 1SCWA 4NEED 5E2FA 3FC7A 3N7WA 4YFMA 4N9KA 3NDGA 1ZKJA 1YMXA 2VLGA 4I3AA 1NJ4A 2VGJA 4R6LA 4GNUA 1NYYA 3A0RA 1LLBA 3ITAA 1OTIA 1OTBA 3ZHHA 3GRJA 5CXWA 4CLCD 3FPVA 2K2NA 2GDNA 1UWNX 2VV8A 5HAPA 3OOVA 4KG5A 3MQOA 3LI8A 1GSWA 4JLFA 4Y13A 4I38A 2P7JA 3P7NA 1T19A 2B02A 2K7SA 2VGKA 5TFQA 3RFBA 4DKIA 5I94A 3V3SA 1T1BA 3WS1A 1Z09A 1HD8A 3IT9A 4II7A 2QYBA 2L1MA 4PM8A 3UDXA 3D9YA 5FQIA 1HTZA 3ZVWA 1TS8A 4G3VA 3OPRA 4WM9A 4E6XA 3C38A 3PBSA 4PPRA 1CK3A 2HV1A 2A24A 4LENA 5FA7A 3S7OA 3HUMA 5I5LA 1HZOA 1OJ5A 2VGLS 4BBTA 3KYEA 4FCFA 3VFFA 5IU1A 5GHZA 1S4RA 3HLDA 1YSPA 2Y79A 5EV0A 4HP9A 4ID4A 3NIAA 3Q82A 4QJGA 3GMWA 2V1ZA 3GR2A 3OLOA 3O88A 3NI9A 2Y2KA 1EW0A 4GHIB 4X1MA 3GVBA 2JC7A 3D4FA 2J8YA 5HARA 4ZTKA 2JKTM 4GW9A 2J3WA 4JXGA 4E6WA 3HLCA 2BASA 3G30A 1I2SA 4RYEA 2XK1A 3UB9A 4FSFA 3AGFA 3RH8B 3A3IA 2XROA 1XJ2A 3IXBA 4S2LA 4JGOA 1PI4A 4IUKA 2PAVP 3FV7A 2HDUA 1YPRA 1ZTUA 1Z6FA 4CPKA 2V8FA 2QPNA 4YINA 1SKFA 1MPLA 1CF0A
chains in the Genus database with same CATH topology
1H8MA 3BQ8A 3KYQA 2V9AA 3E98A 1S66L 4G3WA 3NJAA 2QJ5A 1GSVA 1LSXA 2K31A 5L8MA 2VA0A 3PBNA 4R38A 5HPIA 4RQ9A 4WF0A 2EWWA 3KSHA 2PT7A 5F5YA 1NWZA 3LFVA 2O99A 2W27A 4H6JB 3C8CA 1YSQA 4CLCC 2PDRA 2XA7S 4GS9A 3ICYA 3BWLA 2J3TC 2ZMFA 1XJ4A 2PYPA 3LR4A 2LB9A 2IA2A 2A2LA 4GLQA 2W1TB 4HY8A 3D3OA 4ME4A 1STZA 4WELA 4UQIM 3E4OA 5AJGA 2M7VA 4GHIA 4JGPA 3UB7A 4BJPA 4NXEA 4KQDA 5HSQA 4EQ1A 3C2WA 3JVUA 1XJ6A 3T4KA 1V9ZA 1P97A 2ZMVA 2DMWA 3EGDC 2QHKA 1D7EA 1OT6A 2JKRM 2XA7M 3EWKA 1MKMA 1LT0A 5AVEA 3PBQA 3EOIA 5KSHA 4ETZA 4GCZA 3CUEC 2V1AA 3FG8A 4BWIA 2W3FA 3EQVA 4LPZA 3CI6A 2OWHA 3PBTA 2JN7A 4O0PA 4HJ6A 4L9GA 5LBRA 3B33A 2W1RA 3MR0A 2O9CA 4XT2A 3C30A 1F9IA 1G6OA 3K3CA 1MZUA 1TD5A 1DP8A 2OAP1 4MN5A 1UWPX 3H82A 2KX6A 2WKQA 5G4ZA 2YKHA 4WUJA 5HDSA 2VKSA 1P9RA 4O8GA 5EFWA 3UE3A 3MXQA 3DBAA 4I3JA 4G3KA 2PHYA 2V0WA 1F98A 1X0OA 5HWWA 3IBRA 5HD5A 1IFQA 1OJGA 5K5BA 1UGUA 1ZHHB 4HOIA 1P0ZA 5HPFA 4JGQA 2WKRA 4WEJA 4BBVA 5HZHA 2W3HA 5F69A 4H6JA 3MQQA 3U2AA 4KUOA 3ZYTA 1XFQA 4HNBA 5HL6A 4MN7A 3LIFA 5FL3A 1W63Q 1MC0A 4ARZB 4Y2FA 3BJNA 3F1OB 3D72A 3SW1A 3UMDA 1N9OA 4IHQA 4HIAA 2W1TA 4EETB 3LIBA 4WEKA 4IJGA 1TS0A 3CWFA 3S7QA 3EEHA 2W3EA 2EWVA 1BYWA 4I5SA 1XJ3A 2LB5A 3MQ0A 4I39A 4Z1WA 2H28A 3CLOA 4Q0HA 1IOUA 3OCLA 2PR6A 4BBUA 2B18A 4P6ZM 4NXFA 3PBOA 3T4LA 3P01A 1VB6A 3EEAA 1Y28A 4UQIS 1LL8A 1NRJA 4EEUA 1XFNA 2YKFA 4I3IA 5J3WA 3TW8A 4KQOA 5IS1A 3T50A 3IS2B 1KOUA 3KSFA 2D01A 3B42A 5C5KA 1ODVA 2O9AA 4EXOA 5DFYA 3EGXC 4HJ3A 2GJ3A 2M1CA 4CLCB 2J3TD 2FH5A 2KLIA 1OPXA 2CMNA 4Q0IA 3A0SA 4IUHA 3E4PA 3EQUA 1WA9A 4WL9A 3GDIA 2EA9A 4F3LB 5A8BA 3E0YA 3GECA 4HJ4A 4L0LA 3H7WB 2P08A 2MJ6A 3HJIA 1D06A 1YAXA 4CLCE 3R7WB 3K2NA 4AFIA 3S7PA 2NUPC 3NOUC 4DN0A 3KO6A 1NLZA 4EU0A 2D02A 4L9FA 2GZAA 2PYRA 2QJ7A 5KIZA 2FZ0A 4NXBA 5DFXA 3IBJA 4QPRA 3E4QA 3OC2A 4EERA 4OOLA 3F1PB 3OBFA 3NOTC 3UE6A 3VV4A 1OTAA 4GJ4A 4JGRA 5TBMB 2JKTI 4ARZA 3ZQ5A 3MJQA 3F1OA 2J80A 4EEPA 1TS6A 2XRNA 3LIAA 3H9WA 5AVFA 5HDDA 5J4EA 3A0VA 4K08A 1P9WA 1TF1A 1DP6A 5HDCA 2W0NA 3LUQA 4ETXA 1DP9A 4MMNA 4HP4A 2OOLA 3OCNA 3KSGA 2QWSA 3NOPC 1S4SA 1OTEA 4LRXC 4O01A 4Y5FA 2HGVA 4MN6A 2NUTC 1YKDA 2M7UA 3IS2A 4ZRRA 4PAUA 4UEYA 2VEAA 1S1YA 5DKKA 4HH2A 4MCWA 4YWZA 4P6ZS 3LIDA 3VE4A 2VX8A 2HF6A 2VGLM 3F1NB 3T4SA 4CLCA 1OTDA 2Y8HA 4M4XA 2A24B 4YOFA 3CAXA 2V1BA 2W3GA 3TJZC 4DMZA 4HI4A 4F3LA 4NEED 4NXGA 3K3DA 3V67A 3FC7A 3H7WA 3HJKA 5HD3A 3UB8A 2GNXA 3BQAA 5DF9A 3VOLA 1DRMA 2R78A 3PHYA 2VLGA 3PBRA 4I3AA 2KOIA 3R7WA 5DKLA 3PXPA 4R6LA 5DJUA 4EUVA 5F68A 5DJTA 2GX5A 2V0UA 5HWTA 3KSIA 3LR5A 4PHTA 2ZBBA 3A0RA 4EW7A 1OT9A 3ULFA 4Y3IA 4R70A 3CUEA 3TRCA 1OTIA 3O5YA 3LYXA 1OTBA 2ZOHA 2G7UA 3F1PA 4OOMA 4CLCD 2W3DA 3FPVA 2K2NA 5TBMA 2HJ9C 1UWNX 3NHQA 1S1ZA 2VV8A 3T4QA 2JKRI 2VZWA 3OOVA 3MQOA 3HCYA 5IT5A 1VHMA 3LI8A 4BMWA 1GSWA 4HQAA 4MDZA 4I38A 2P7JA 3VE3A 2PR5A 3P7NA 1T19A 5TJJA 2PD8A 3CITA 2B02A 4LRYC 4WN5A 3T4TA 2K7SA 3R4KA 3RFBA 2VJWA 3TE8A 1LSWA 1T1AA 4L9EA 3LICA 1T1BA 3BY8A 4CQHA 5CX7A 2L0WA 4FOFA 4II7A 2QYBA 2L1MA 2JHEA 3BY9A 1GSXA 4R3AA 1TS8A 4G3VA 3F1NA 3C38A 3PBSA 2OAQ1 1N9LA 2HV1A 2XSSA 3LIEA 2A24A 4NKPA 4KUKA 1N9NA 4B93A 2VV7A 3S7OA 3KYZA 2WKPA 5I5LA 4PKYG 5G4YA 1OJ5A 4LLOB 3G6OA 1H3QA 2VGLS 2Z6DA 4BBTA 2OWJA 5IU1A 4GS9B 5HWVA 1S4RA 2Z6CA 4DJ2A 1W63M 1YSPA 2KDKA 4LRZE 2Y79A 4EESA 3LR0A 4HP9A 2VV6A 4WLAA 3T4OA 4E04A 1V9YA 3MFXA 1TS7A 5MC7A 3OLOA 1EW0A 4GHIB 1T18A 3LR3A 5J7EA 2QKPA 3RTYA 4HH3A 2O9BA 2JKTM 4GW9A 2J3WA 3MF0A 3UMEA 2PD7A 3W2ZA 3JVVA 3KX0X 2ZOIA 4Q0JA 4PKYA 2BASA 2L4RA 1T1CA 3UB9A 1F5MA 4FSFA 2INWA 1NLYA 3RH8B 3UB6A 2HJEA 4HHDA 3T4JA 1LSVA 1XJ2A 2XROA 3S7NA 4JGOA 3PYPA 4IUKA 3FPWA 4XT2B 2I9VA 2P04A 1G28A 4YNRA 3BW6A 3MMHA 1ZTUA 3PR6A 4B9OA 1JNUA 5F6AA 3H82B 1S67L 3B47A 4DJ3A 2O0YA 3LI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V9A A;  1S66 L;  3NJA A;  2QJ5 A;  1GSV A;  1LSX A;  4R38 A;  4RQ9 A;  4WF0 A;  5F5Y A;  1NWZ A;  2W27 A;  4H6J B;  3C8C A;  2PDR A;  4GS9 A;  3ICY A;  3BWL A;  1XJ4 A;  2PYP A;  4HY8 A;  3E4O A;  4GHI A;  4JGP A;  3UB7 A;  4NXE A;  4KQD A;  5HSQ A;  4EQ1 A;  3C2W A;  1XJ6 A;  1V9Z A;  1P97 A;  2QHK A;  1D7E A;  1OT6 A;  3EWK A;  1LT0 A;  5AVE A;  4GCZ A;  2V1A A;  3FG8 A;  4LPZ A;  2OWH A;  2JN7 A;  4HJ6 A;  4L9G A;  3B33 A;  3MR0 A;  4XT2 A;  1F9I A;  3K3C A;  1MZU A;  1DP8 A;  4MN5 A;  1UWP X;  3H82 A;  2KX6 A;  2WKQ A;  5G4Z A;  2YKH A;  4WUJ A;  5HDS A;  5EFW A;  3MXQ A;  4I3J A;  2PHY A;  2V0W A;  1F98 A;  1X0O A;  5HWW A;  3IBR A;  5HD5 A;  1OJG A;  1UGU A;  4HOI A;  1P0Z A;  4JGQ A;  2WKR A;  4BBV A;  5HZH A;  5F69 A;  4H6J A;  3MQQ A;  4KUO A;  1XFQ A;  4HNB A;  3LIF A;  3F1O B;  3D72 A;  3SW1 A;  3UMD A;  1N9O A;  4HIA A;  4EET B;  3LIB A;  1TS0 A;  3CWF A;  3EEH A;  1BYW A;  4I5S A;  1XJ3 A;  4I39 A;  2H28 A;  3CLO A;  2PR6 A;  4BBU A;  4NXF A;  1VB6 A;  1Y28 A;  1LL8 A;  4EEU A;  1XFN A;  2YKF A;  4I3I A;  5J3W A;  5IS1 A;  3T50 A;  3IS2 B;  1KOU A;  2D01 A;  1ODV A;  4EXO A;  4HJ3 A;  2GJ3 A;  2M1C A;  2CMN A;  3A0S A;  3E4P A;  1WA9 A;  4WL9 A;  3GDI A;  2EA9 A;  4F3L B;  5A8B A;  3GEC A;  4HJ4 A;  3H7W B;  3HJI A;  1D06 A;  3NOU C;  2D02 A;  4L9F A;  2PYR A;  2QJ7 A;  5KIZ A;  4NXB A;  3E4Q A;  4EER A;  3F1P B;  3NOT C;  3UE6 A;  1OTA A;  4JGR A;  5TBM B;  3ZQ5 A;  3MJQ A;  3F1O A;  2J80 A;  4EEP A;  1TS6 A;  3LIA A;  3H9W A;  5AVF A;  5HDD A;  5J4E A;  4K08 A;  3A0V A;  1DP6 A;  5HDC A;  2W0N A;  3LUQ A;  1DP9 A;  4HP4 A;  2OOL A;  2QWS A;  3NOP C;  1S4S A;  1OTE A;  4LRX C;  4MN6 A;  3IS2 A;  2VEA A;  1S1Y A;  5DKK A;  4HH2 A;  4YWZ A;  3LID A;  3VE4 A;  3F1N B;  1OTD A;  4M4X A;  2A24 B;  3CAX A;  2V1B A;  4HI4 A;  4F3L A;  4NXG A;  3K3D A;  3FC7 A;  3H7W A;  3HJK A;  5HD3 A;  3UB8 A;  3VOL A;  1DRM A;  2R78 A;  3PHY A;  2VLG A;  4I3A A;  5DKL A;  4R6L A;  5DJU A;  5F68 A;  5DJT A;  2V0U A;  5HWT A;  2ZBB A;  3A0R A;  4EW7 A;  1OT9 A;  3ULF A;  4R70 A;  1OTI A;  3LYX A;  1OTB A;  2ZOH A;  3F1P A;  5TBM A;  1UWN X;  3NHQ A;  1S1Z A;  2VV8 A;  3MQO A;  3LI8 A;  1GSW A;  4HQA A;  4I38 A;  2P7J A;  3VE3 A;  2PR5 A;  3P7N A;  1T19 A;  2PD8 A;  2B02 A;  4LRY C;  4WN5 A;  2K7S A;  1LSW A;  1T1A A;  4L9E A;  3LIC A;  1T1B A;  3BY8 A;  2L0W A;  2L1M A;  2JHE A;  3BY9 A;  1GSX A;  4R3A A;  1TS8 A;  3F1N A;  1N9L A;  2HV1 A;  3LIE A;  2A24 A;  4KUK A;  1N9N A;  2VV7 A;  2WKP A;  5I5L A;  4PKY G;  5G4Y A;  1OJ5 A;  4LLO B;  3G6O A;  2Z6D A;  4BBT A;  2OWJ A;  5IU1 A;  4GS9 B;  5HWV A;  1S4R A;  2Z6C A;  4DJ2 A;  2KDK A;  4LRZ E;  4EES A;  4HP9 A;  2VV6 A;  4WLA A;  4E04 A;  1V9Y A;  3MFX A;  1TS7 A;  3OLO A;  1EW0 A;  4GHI B;  1T18 A;  5J7E A;  2QKP A;  3RTY A;  4HH3 A;  4GW9 A;  3UME A;  2PD7 A;  3KX0 X;  2ZOI A;  4PKY A;  2BAS A;  2L4R A;  1T1C A;  3UB9 A;  2INW A;  3UB6 A;  3RH8 B;  4HHD A;  1LSV A;  1XJ2 A;  4JGO A;  3PYP A;  4XT2 B;  2I9V A;  1G28 A;  4B9O A;  1JNU A;  5F6A A;  3H82 B;  1S67 L;  4DJ3 A;  3LI9 A; 
#chains in the Genus database with same CATH topology
 4S2K A;  4X1L A;  4BL2 A;  4G3W A;  3S22 A;  4R38 A;  4WF0 A;  4BEN A;  2PT7 A;  2W27 A;  4UHU A;  4JF4 A;  4CLC C;  2XA7 S;  3G4P A;  5A92 A;  1XJ4 A;  1FCN A;  1I5Q A;  3LR4 A;  2IA2 A;  3QNB A;  2A2L A;  3ZG5 A;  5GLD A;  1XX2 A;  1LI9 A;  4UQI M;  2M7V A;  2WAF A;  4GHI A;  1TVF A;  4OPY A;  2ZQD A;  1I2W A;  3C2W A;  3JVU A;  4X56 A;  2ZMV A;  1K54 C;  3U4L P;  2DMW A;  1OT6 A;  3W4O A;  2JKR M;  3EWK A;  1FCM A;  1BSG A;  3IF5 A;  2X71 A;  2V1A A;  3OPP A;  3HRE A;  4UA7 A;  1TDL A;  2UWX A;  1WYB A;  1PWD A;  4HJ6 A;  4L9G A;  2W1R A;  3W4P A;  3ZFZ A;  3K3C A;  4E3L A;  2XGN A;  5J8X A;  1DP8 A;  4MN5 A;  2WUQ A;  4XXR A;  1UWP X;  1MY8 A;  2WKQ A;  1XP4 A;  3UE3 A;  3MXQ A;  4DRT A;  3DBA A;  1PFL A;  4G3K A;  4HBU A;  1X0O A;  2J7V A;  4HES A;  2JCH A;  1OJG A;  1P0Z A;  4JGQ A;  3NDE A;  3DW0 A;  1NXY A;  2Y2H A;  4DE0 A;  2Y91 A;  1ZG6 A;  4LV0 A;  4MN7 A;  4NK3 A;  4ZAM A;  2QZ6 A;  1MC0 A;  2WGI A;  4WZ5 C;  4ARZ B;  4WBG A;  3BEC A;  3BJN A;  3A3J A;  3DWK A;  3V3R A;  3ZNT A;  4IHQ A;  4WEK A;  3MS6 A;  1K25 A;  4ZJ2 A;  1BLS A;  3MQ0 A;  1FCO A;  1NY0 A;  4Q0H A;  3Q7Z A;  3SS3 A;  4BBU A;  2B18 A;  4P6Z M;  3Q1F A;  5EVL A;  3T4L A;  2WZX A;  5FI2 A;  1Y28 A;  4UQI S;  1LL8 A;  4P87 A;  5J3W A;  5KMW A;  1FSY A;  1J9M A;  5DTT A;  2D01 A;  5FDS A;  1ODV A;  2ZQ9 A;  2Y2J A;  3C7V A;  4HJ3 A;  4JXS A;  3T1S A;  4CLC B;  3IWO A;  1XA7 A;  2XQZ A;  2QMI A;  2CMN A;  5FQJ A;  2EA9 A;  5CGW A;  5A8B A;  3GEC A;  4L0L A;  3QP4 A;  1D06 A;  5D3O A;  1YAX A;  4CLC E;  3R7W B;  3HLW A;  4AFI A;  3ZNY A;  3SH7 A;  3NEC A;  4EU0 A;  1XKZ A;  1ONH A;  1AWI A;  4OH0 A;  1ES4 A;  5CHM A;  2ZJ9 A;  1W5D A;  4OOL A;  2A49 A;  3NOT C;  3UE6 A;  5M18 A;  2BG1 A;  4ARZ A;  1YT4 A;  3MJQ A;  2J80 A;  4PM7 A;  4KZ7 A;  4OLG A;  3H9W A;  4OQ0 A;  3UB5 P;  3MXR A;  4RVA A;  2ZC3 B;  3O3V A;  3C7U A;  1DP6 A;  1PWG A;  1G68 A;  2ZC7 A;  2W0N A;  3LUQ A;  1DP9 A;  3HBR A;  3OCN A;  2DRW A;  1S4S A;  4GD8 A;  4O01 A;  5CEC A;  4Y5F A;  4PM5 A;  4LV3 A;  4MN6 A;  2NUT C;  2ZM8 A;  4PAU A;  2Y55 A;  3MXS A;  4P6Z S;  3LID A;  3WS4 A;  3VE4 A;  1Q2Q A;  2HF6 A;  3T4S A;  4GD6 A;  4JF5 A;  1KVL A;  5DTS A;  1PZP A;  2Y2G A;  4CLC A;  4YOF A;  3CAX A;  2R9W A;  4HI4 A;  4NXG A;  3V67 A;  3UN7 A;  3HJK A;  3BQA A;  5CGX A;  4WZ4 A;  2ZD8 A;  3R7W A;  3V39 A;  4DXB A;  1MKI A;  3AGD A;  3M6H A;  1DJC A;  1K4F A;  3SZT A;  5F68 A;  3VP4 A;  1K54 A;  2GX5 A;  2V0U A;  5HWT A;  3KSI A;  3AGE A;  3HUO A;  3ULF A;  3I7J A;  4Y3I A;  3UPP A;  4R70 A;  3TRC A;  2Q0O A;  3E2L A;  3BFD A;  3LYX A;  4EQI A;  2ZOH A;  4X69 A;  4OOM A;  3ZG8 B;  4K0X A;  3NHQ A;  1A0K A;  3T4Q A;  2G2U A;  4OPZ A;  3S4X A;  2WKE A;  4LV1 A;  1VHM A;  1FOF A;  1E3U D;  1SZV A;  2PD8 A;  4LRY C;  4WN5 A;  4KZB A;  3GV9 A;  1YMS A;  3R4K A;  2Y2P A;  1LSW A;  3IH8 A;  4S2O A;  4OOY A;  5GHX A;  1BLC A;  2B95 A;  2L0W A;  1CEF A;  5JYO A;  3BY9 A;  5FEF A;  4R3A A;  4X68 A;  3LIE A;  4WZ5 A;  1N9N A;  4R1G A;  2VV7 A;  3KYZ A;  3S1Y A;  2WKP A;  4A5R A;  5G4Y A;  2FFY A;  3ZCZ A;  3G6O A;  3P09 A;  3G32 A;  5FQM A;  4N1X A;  3FZC A;  1YLT A;  3IX3 A;  5HWV A;  1W63 M;  1K56 D;  4S2I A;  3TOI A;  4E04 A;  4GB7 A;  1V9Y A;  3RJU A;  5MC7 A;  4QD4 A;  1OME A;  4B4Z A;  2ZC5 B;  3LR3 A;  5J7E A;  4LCL A;  2QKP A;  1H8Z A;  4HH3 A;  3FWL A;  4FUW A;  3UME A;  2PD7 A;  2EX2 A;  2ZOI A;  4R3J A;  3IX4 A;  2L4R A;  2ZC6 B;  5AQB A;  5M19 A;  2INW A;  5EVI C;  1EWZ A;  3Q81 A;  1KGE A;  3IWQ A;  3T4J A;  1LSV A;  2PBD P;  3S7N A;  3FPW A;  3V50 A;  3VP2 A;  2P04 A;  4QWO A;  4YNR A;  4UA9 A;  3BW6 A;  1CEG A;  4S2N A;  1W8Q A;  4JBF A;  1JNU A;  5F6A A;  3H82 B;  1ACF A;  2EX9 A;  2ACG A;  3LI9 A;  5EVE A;  3A3D A;  5FQK A;  4C6Y A;  1NZO A;  1O07 A;  3IXH A;  3NCK A;  4JPM A;  1QME A;  3BQ8 A;  4U0X A;  5CED A;  1S66 L;  3NJA A;  2QJ5 A;  2K31 A;  5L8M A;  2H0Y A;  5F1G A;  5HPI A;  2EWW A;  4GN2 A;  2XFS A;  3ZG7 B;  5F5Y A;  4Y0U A;  2O99 A;  4E3K A;  4HBT A;  1IKG A;  2PRF A;  3QP2 A;  3DTM A;  4Y17 A;  3BWL A;  4BL3 A;  4ZJ3 A;  2ZMF A;  2PYP A;  2HP9 A;  4B4X A;  1SDN A;  3SS5 A;  2W1T B;  4GKU A;  4HY8 A;  3D3O A;  1L0E A;  2XFT A;  5GLC A;  4WEL A;  5AJG A;  2DCF A;  4BJP A;  4Y0O A;  4JF6 A;  5FAQ A;  1F2K A;  4EQ1 A;  1XJ6 A;  1M40 A;  1V9Z A;  3UY6 A;  1BZA A;  4OQI A;  3EGD C;  5KSC A;  2XA7 M;  3IXD A;  4IVI A;  1LT0 A;  3PBQ A;  5KSH A;  4ETZ A;  4GCZ A;  4NG2 A;  4OVD A;  4WMC A;  4BWI A;  4H8R A;  5A91 A;  4RA7 A;  2JN7 A;  4KZA A;  4O0P A;  3MR0 A;  3QP8 A;  2ZM2 A;  1JWV A;  2OAP 1;  3H82 A;  2KX6 A;  3MBZ A;  5EFW A;  5HW3 A;  2XEP A;  3T1R A;  3JPU A;  4KQR A;  2V0W A;  1F98 A;  4KZ4 A;  5HWW A;  1BT5 A;  5L10 A;  3ITB A;  5HPF A;  4U3T A;  1KE0 A;  4KZ6 A;  3L9K A;  2WKR A;  4DF6 A;  5F69 A;  1J3W A;  4ZBE A;  5EVI B;  2H5S A;  4HNB A;  5HL6 A;  2Y59 A;  1W63 Q;  1BUL A;  2Z2M B;  2UV0 E;  3VFH A;  3D72 A;  4EBP A;  2JKF A;  3QHY A;  1VET B;  1LI0 A;  5DF7 A;  4HIA A;  2W1T A;  3CWF A;  2EWV A;  3ISG A;  4I5S A;  4ZDX A;  2H28 A;  1N4O A;  2P9V B;  3UO9 A;  1IOU A;  3OCL A;  4XUX A;  5KZH A;  3N4I A;  3PBO A;  2ZQC A;  3SH9 A;  2RCX A;  1NRJ A;  1L2S A;  2YKF A;  4I3I A;  3SOI A;  4OP8 A;  2JE5 A;  4KQO A;  1KOU A;  2JBF A;  1M6K A;  2O9A A;  4DDS A;  4EXO A;  5DFY A;  4R3B A;  1K55 A;  5EM0 A;  2J9O A;  3NBL A;  2J3T D;  2I72 A;  4MBK A;  1OPX A;  1K38 A;  4Q0I A;  3A0S A;  4WL9 A;  4F3L B;  3GDI A;  1K6S A;  1KDW A;  3E0Y A;  4HJ4 A;  2MJ6 A;  2XLN A;  3DAV A;  3HJI A;  5BOH A;  1PRQ A;  3K2N A;  1JTD A;  2HDR A;  4OLD A;  1SKO B;  2NUP C;  1FQG A;  1RP5 A;  1NLZ A;  4KZ5 A;  2ZL1 B;  1YLW A;  4L9F A;  1KVM A;  2GZA A;  4MEZ A;  3BLM A;  4E3N A;  3BLS A;  4UA6 A;  4NXB A;  5DFX A;  3MKF A;  4OQH A;  1LL5 A;  3OC2 A;  4EER A;  4Y15 A;  5EVI A;  4JGR A;  4GJ4 A;  2ZLY A;  3IWI A;  5TBM B;  3ZQ5 A;  2Y4A A;  4KZ8 A;  4EEP A;  5FQ9 A;  3LIA A;  1VM1 A;  5AVF A;  1VET A;  5HDD A;  5J4E A;  4K08 A;  3VSL A;  4N92 A;  4U0T A;  4PM6 A;  5HDC A;  4ETX A;  1G6A A;  2P9V A;  3KSG A;  4PMA A;  1JWZ A;  2EX8 A;  4QHC A;  5FDH A;  1OTE A;  5FAO A;  5FQQ A;  3VP0 A;  3A3E A;  2WAD A;  5AQA A;  2Y2N A;  1E4D A;  2EXA A;  2PU2 A;  4ZRR A;  4UEY A;  4X55 A;  5DKK A;  4YWZ A;  1Q2P A;  4FH4 A;  1JTG A;  1MWS A;  3QP6 A;  1VQQ A;  1JVJ A;  2PBY A;  5HAQ A;  4F3L A;  3K3D A;  1PWC A;  4F94 A;  5HD3 A;  2GNX A;  5DF9 A;  3VOL A;  1DRM A;  1TDG A;  1MWU A;  3BFF A;  3PBR A;  5HFO A;  1E3U A;  5DTK A;  4OPR A;  1SKO A;  2XD5 A;  5DJU A;  4EUV A;  3BRM A;  5GLB A;  2ZL1 A;  1U60 A;  4PHT A;  4DE1 A;  2ZBB A;  4EW7 A;  1BTL A;  1OT9 A;  4OPQ A;  4EBL A;  1ONG A;  3O5Y A;  4GDN A;  2W3D A;  5TBM A;  2HJ9 C;  4EV4 A;  1S1Z A;  1GA0 A;  2VZW A;  3BM6 A;  5IT5 A;  5E43 A;  4HQA A;  4MDZ A;  3CJM A;  1XPB A;  4MNR A;  5TJJ A;  3T4T A;  3ZGA B;  1ERO A;  2VJW A;  3T12 B;  4S2N C;  3TE8 A;  1T1A A;  4L9E A;  3LIC A;  1Y4O A;  3BY8 A;  3IXG A;  5CX7 A;  2B5R A;  4DDY A;  5AQ9 A;  2JHE A;  4QU3 A;  4Z9Q A;  1SDE A;  3C4P A;  1N9L A;  4NKP A;  2XSS A;  4KUK A;  1O7E A;  4B93 A;  3OPL A;  4P85 A;  4PKY G;  1ERQ A;  5CHJ A;  1H3Q A;  2Z6D A;  5CTM A;  2OWJ A;  5CRF A;  2Z6C A;  3P98 A;  1L3L A;  5FAS A;  2KDK A;  4LRZ E;  3M2J A;  4C75 A;  2VV6 A;  4WLA A;  3IF6 B;  3MFX A;  1ZC2 A;  3CZD A;  3UNW A;  5IHV A;  5FAT A;  3GSG A;  3OZH A;  2WAE A;  3HLF A;  1ES5 A;  5EOE A;  4KZ3 A;  3MF0 A;  4Q0J A;  1H0M A;  3FKW A;  4PKY A;  1T1C A;  3NY4 A;  2V8C A;  3WS2 A;  1NYM A;  1NLY A;  3UB6 A;  1BLP A;  2HJE A;  2HDS A;  4HHD A;  3LO7 A;  3PYP A;  4FD8 A;  5F82 A;  1G28 A;  5CGS A;  2XF3 A;  3MZF A;  4IVK A;  3PAG A;  3MMH A;  4E3J A;  2H10 A;  3IQA A;  3B47 A;  5EM1 A;  4DJ3 A;  2PU4 A;  5CTN A;  4GOG A;  2V9A A;  3BFG A;  1GSV A;  1LSX A;  2VA0 A;  3PBN A;  4JKT A;  3LFV A;  2Q9N A;  4H6J B;  1ERM A;  3C8C A;  1YSQ A;  2PDR A;  3ICY A;  3LEQ A;  4O7D A;  2XD1 A;  2WGV A;  4RX3 A;  5CER A;  1G5U A;  3WS0 A;  4GLQ A;  3DTI A;  3IF6 A;  4ME4 A;  1STZ A;  3ZG9 B;  3PAE A;  1L0D A;  4JGP A;  4D60 A;  2OV5 A;  1KE3 A;  4KQD A;  1ES2 A;  3LGO A;  3T4K A;  1P97 A;  2QHK A;  1D7E A;  4PM9 A;  5AVE A;  3EOI A;  1CI9 A;  3CUE C;  3HL9 A;  1QMF A;  3EQV A;  5E2G A;  3CI6 A;  3PBT A;  2HP5 A;  2IWD A;  1K55 C;  3SS4 A;  3B33 A;  1IEL A;  1NRF A;  1F9I A;  3NC8 A;  4QY5 A;  5HX9 A;  1NZU A;  5A93 A;  3VP3 A;  2WZZ A;  1PZO A;  4R4S A;  1HLU P;  3VSK A;  5G4Z A;  2YKH A;  1P9R A;  4O8G A;  1VEU B;  4E3M A;  1H8Y A;  4BD1 A;  4GDB A;  4I3J A;  2J9P A;  4IBX A;  1FIL A;  4UAA A;  1IFQ A;  4KQQ A;  1UGU A;  2XH9 A;  1IYO A;  4WEJ A;  4BBV A;  1PIO A;  2W3H A;  5HZH A;  5L09 A;  4H6J A;  3U2A A;  3ZYT A;  1XFQ A;  2R9X A;  2E8J A;  2C5W B;  3LIF A;  5FL3 A;  3G35 A;  2RL3 A;  1ES3 A;  4JXV A;  4Y2F A;  2C6W B;  3SW1 A;  1AXB A;  2Q9M A;  4EET B;  1IYP A;  2W3E A;  1BYW A;  2V2F F;  2WKH A;  4KG6 A;  2LB5 A;  4I39 A;  3IH9 A;  4JXW A;  4Z1W A;  3HVF A;  3CLO A;  2PR6 A;  3BEB A;  4R4R A;  4NXF A;  1KGG A;  5DVA A;  3RXX A;  1VB6 A;  4EEU A;  1H5X A;  1XFN A;  3PTE A;  3TW8 A;  3N8S A;  3KSF A;  3B42 A;  5C5K A;  1WYC A;  3BFE A;  1YM1 A;  3EGX C;  3LCE A;  4P0M A;  2GJ3 A;  2M1C A;  4BLM A;  3N8R A;  1FIK A;  4MBH A;  1PW8 A;  4ESP A;  2FH5 A;  2CC1 A;  3M2K A;  3QP1 A;  2JKG A;  4IUH A;  1CJF A;  3E4P A;  3EQU A;  3IX8 A;  3H7W B;  2P08 A;  3WRT A;  1W8Y A;  3E2K A;  1VEU A;  3NOU C;  3UPN A;  3ZDJ A;  3RXW A;  4OON A;  5FI7 A;  2D02 A;  2OSU A;  2HP6 A;  2PYR A;  4KG2 A;  2QJ7 A;  3VOY A;  4QPR A;  5JYP A;  1ALQ A;  5G18 A;  3F1P B;  3OBF A;  2JKT I;  1GHI A;  3MSH A;  5EOO A;  1CQA A;  2XRN A;  2EFU A;  3C5A A;  5E2E A;  3VMA A;  1GHM A;  1P9W A;  3VP1 A;  1C3B A;  4MMN A;  4MBF A;  2OOL A;  5HAI A;  5L07 A;  3NOP C;  4RX2 A;  3A3F A;  3IHB A;  1L0G A;  2M7U A;  4S2J A;  4S2P A;  1S1Y A;  4HH2 A;  4MCW A;  2VX8 A;  3F1N B;  1N9B A;  2Y8H A;  3T1Q B;  3TJZ C;  5L2F A;  5TGF A;  4DMZ A;  2XR0 A;  5EEC A;  1TEM A;  2WK0 A;  3UE1 A;  3H7W A;  3QP5 A;  4NET A;  1GHP A;  3UB8 A;  2EXB A;  4QY6 A;  3SH8 A;  5DF8 A;  2R78 A;  3PHY A;  2KOI A;  5DKL A;  1HVB A;  3PXP A;  1PNE A;  5DJT A;  3WRZ A;  3WS5 A;  3LR5 A;  3DWZ A;  2FFF B;  3CUE A;  1K57 C;  2G7U A;  2Y2Q A;  3F1P A;  1WE4 A;  4OP5 A;  1ZG4 A;  5U47 A;  2JKR I;  1IYS A;  4WYY A;  3HCY A;  4X6T A;  1KE4 A;  4BMW A;  3DTE A;  5GLA A;  2P74 A;  3VE3 A;  2PR5 A;  1MWT A;  3CIT A;  2Y2I A;  3DTK A;  1FSW A;  3LEZ A;  3O86 A;  3N6I A;  1FR1 A;  4CQH A;  2ZM0 A;  1MXO A;  4FOF A;  4XUZ A;  2G2W A;  1GSX A;  4QB8 A;  4FTX A;  3TSG A;  3F1N A;  4EBN A;  2X01 A;  2OAQ 1;  2HDQ A;  3Q7V B;  3UE0 A;  3CPT B;  4EWF A;  1L0F A;  3CHW P;  4E3O A;  4LLO B;  3QNC A;  3HLE A;  5EE8 A;  5FEG A;  4N1H A;  1JWP A;  4GS9 B;  2H0T A;  4DJ2 A;  2ZC4 B;  4DE2 A;  4EES A;  1XXM A;  3LR0 A;  3IF6 C;  4X25 A;  3T4O A;  2BTF P;  1TS7 A;  4Q8I A;  4K0W A;  1IKI A;  1T18 A;  3MZE A;  2AVX A;  5GHY A;  3RTY A;  2O9B A;  4D2O A;  4DXC A;  3ZVT A;  3W2Z A;  3JVV A;  3G2Y A;  3KX0 X;  4R23 A;  4IED A;  1FR6 A;  1S6R A;  4WMC D;  5FI6 A;  1DJB A;  2XDM A;  1F5M A;  3C4O A;  2Y2L A;  1PW1 A;  4XT2 B;  2VK3 A;  2I9V A;  4X53 A;  3G2Z A;  1KGF A;  4E3I A;  2WGW B;  3CG5 A;  3PR6 A;  3OPH A;  2HZ5 A;  4M3K A;  4B9O A;  5HL1 A;  4BD0 A;  1S67 L;  4LGW A;  2O0Y A;  2WKI A;  3O87 A;  1YLY A;  3L7H A;  1SHV A;  1H8M A;  3KYQ A;  1XGJ A;  3E98 A;  3Q7V A;  4C3Q A;  3CPT A;  4R0Q A;  1LL9 A;  3HLG A;  4RQ9 A;  3UDF A;  3KSH A;  2ZQ8 A;  1NWZ A;  3M6B A;  4GS9 A;  2J3T C;  2LB9 A;  1D1J A;  1K56 A;  5TR7 A;  3LY4 A;  3E4O A;  2EX6 A;  4K91 A;  3UB7 A;  4NXE A;  4B88 A;  1CI8 A;  5F1F A;  5HSQ A;  4ZJ1 A;  4LFU A;  4IBR A;  1K6R A;  1K4E A;  4GZB A;  4Y0T A;  1MKM A;  2Z2L B;  3FG8 A;  2EFX A;  2W3F A;  3G34 A;  4LPZ A;  4N9L A;  3LY3 A;  1GA9 A;  2OWH A;  3BFC A;  1IEM A;  5EPH A;  5LBR A;  3B3X A;  3JYI A;  2O9C A;  4XT2 A;  3C30 A;  1G6O A;  1MZU A;  1TD5 A;  5M1A A;  2WGW A;  2HPB A;  1RGZ A;  2A3U A;  4Y7P A;  5HDS A;  4WUJ A;  2VKS A;  3CMZ A;  1K57 A;  3TG9 A;  2OLU A;  4OKP A;  2DNS A;  2PHY A;  1ESU A;  3FKV A;  3IBR A;  4OQG A;  1PYY A;  5HD5 A;  5K5B A;  1ZHH B;  3UDI A;  4HOI A;  3VOZ A;  3V5M A;  5EVI D;  3MQQ A;  4KUO A;  4LCM A;  2V20 A;  1DJA A;  2E8I A;  1Y54 A;  3F1O B;  4KEN B;  5GL9 A;  3UMD A;  5A90 A;  1N9O A;  3BYD A;  1W79 A;  3LIB A;  3MFD A;  4IJG A;  1TS0 A;  3S7Q A;  3EEH A;  1XJ3 A;  1XGI A;  4HEF A;  1BLH A;  3T1X A;  1ESI A;  2X02 A;  1RGY A;  5EUA A;  1YQS A;  1GCE A;  2IWC A;  1DY6 A;  3MKE A;  3HLB A;  1XA1 A;  3P01 A;  3EEA A;  1RCJ A;  3HUN A;  1IYQ A;  3W4Q A;  1W7F A;  2ZMA A;  5IS1 A;  3T50 A;  3IS2 B;  2Y2O A;  2Y2M A;  4KZ9 A;  3W8K A;  2OLV A;  5AQ7 A;  2KLI A;  1WA9 A;  4CJN A;  3IHA A;  3FYZ A;  1BUE A;  3Q07 A;  3S7P A;  4DN0 A;  5CHU A;  3KO6 A;  1YLP A;  3GQZ A;  1MWR A;  3NUL A;  3ZG0 A;  5KIZ A;  2FZ0 A;  4MLL A;  3IBJ A;  3E4Q A;  4EUZ A;  3VV4 A;  4S2M A;  1OTA A;  3N8L A;  1PI5 A;  3UPO A;  1MBL A;  3F1O A;  1TS6 A;  5FSR A;  2IWB A;  3G31 A;  3A0V A;  5FAP A;  2ZQ7 A;  4LV2 A;  1TF1 A;  2WYX A;  4HP4 A;  1YLJ A;  2BLS A;  1E25 A;  2QWS A;  3WWX A;  5CEB A;  4P6B A;  4FH2 A;  4LRX C;  1KDS A;  2HGV A;  3MZD A;  1YKD A;  1YLZ A;  3IS2 A;  2VEA A;  4DE3 A;  1K0K A;  4BQM A;  1S0W A;  2VGL M;  5F83 A;  5E2H A;  1OTD A;  1LHY A;  4M4X A;  2A24 B;  3GTC A;  2V1B A;  2W3G A;  1EI5 A;  2ZQA A;  1SCW A;  4NEE D;  5E2F A;  3FC7 A;  3N7W A;  4YFM A;  4N9K A;  3NDG A;  1ZKJ A;  1YMX A;  2VLG A;  4I3A A;  1NJ4 A;  2VGJ A;  4R6L A;  4GNU A;  1NYY A;  3A0R A;  1LLB A;  3ITA A;  1OTI A;  1OTB A;  3ZHH A;  3GRJ A;  5CXW A;  4CLC D;  3FPV A;  2K2N A;  2GDN A;  1UWN X;  2VV8 A;  5HAP A;  3OOV A;  4KG5 A;  3MQO A;  3LI8 A;  1GSW A;  4JLF A;  4Y13 A;  4I38 A;  2P7J A;  3P7N A;  1T19 A;  2B02 A;  2K7S A;  2VGK A;  5TFQ A;  3RFB A;  4DKI A;  5I94 A;  3V3S A;  1T1B A;  3WS1 A;  1Z09 A;  1HD8 A;  3IT9 A;  4II7 A;  2QYB A;  2L1M A;  4PM8 A;  3UDX A;  3D9Y A;  5FQI A;  1HTZ A;  3ZVW A;  1TS8 A;  4G3V A;  3OPR A;  4WM9 A;  4E6X A;  3C38 A;  3PBS A;  4PPR A;  1CK3 A;  2HV1 A;  2A24 A;  4LEN A;  5FA7 A;  3S7O A;  3HUM A;  5I5L A;  1HZO A;  1OJ5 A;  2VGL S;  4BBT A;  3KYE A;  4FCF A;  3VFF A;  5IU1 A;  5GHZ A;  1S4R A;  3HLD A;  1YSP A;  2Y79 A;  5EV0 A;  4HP9 A;  4ID4 A;  3NIA A;  3Q82 A;  4QJG A;  3GMW A;  2V1Z A;  3GR2 A;  3OLO A;  3O88 A;  3NI9 A;  2Y2K A;  1EW0 A;  4GHI B;  4X1M A;  3GVB A;  2JC7 A;  3D4F A;  2J8Y A;  5HAR A;  4ZTK A;  2JKT M;  4GW9 A;  2J3W A;  4JXG A;  4E6W A;  3HLC A;  2BAS A;  3G30 A;  1I2S A;  4RYE A;  2XK1 A;  3UB9 A;  4FSF A;  3AGF A;  3RH8 B;  3A3I A;  2XRO A;  1XJ2 A;  3IXB A;  4S2L A;  4JGO A;  1PI4 A;  4IUK A;  2PAV P;  3FV7 A;  2HDU A;  1YPR A;  1ZTU A;  1Z6F A;  4CPK A;  2V8F A;  2QPN A;  4YIN A;  1SKF A;  1MPL A;  1CF0 A; 
#chains in the Genus database with same CATH homology
 1H8M A;  3BQ8 A;  3KYQ A;  2V9A A;  3E98 A;  1S66 L;  4G3W A;  3NJA A;  2QJ5 A;  1GSV A;  1LSX A;  2K31 A;  5L8M A;  2VA0 A;  3PBN A;  4R38 A;  5HPI A;  4RQ9 A;  4WF0 A;  2EWW A;  3KSH A;  2PT7 A;  5F5Y A;  1NWZ A;  3LFV A;  2O99 A;  2W27 A;  4H6J B;  3C8C A;  1YSQ A;  4CLC C;  2PDR A;  2XA7 S;  4GS9 A;  3ICY A;  3BWL A;  2J3T C;  2ZMF A;  1XJ4 A;  2PYP A;  3LR4 A;  2LB9 A;  2IA2 A;  2A2L A;  4GLQ A;  2W1T B;  4HY8 A;  3D3O A;  4ME4 A;  1STZ A;  4WEL A;  4UQI M;  3E4O A;  5AJG A;  2M7V A;  4GHI A;  4JGP A;  3UB7 A;  4BJP A;  4NXE A;  4KQD A;  5HSQ A;  4EQ1 A;  3C2W A;  3JVU A;  1XJ6 A;  3T4K A;  1V9Z A;  1P97 A;  2ZMV A;  2DMW A;  3EGD C;  2QHK A;  1D7E A;  1OT6 A;  2JKR M;  2XA7 M;  3EWK A;  1MKM A;  1LT0 A;  5AVE A;  3PBQ A;  3EOI A;  5KSH A;  4ETZ A;  4GCZ A;  3CUE C;  2V1A A;  3FG8 A;  4BWI A;  2W3F A;  3EQV A;  4LPZ A;  3CI6 A;  2OWH A;  3PBT A;  2JN7 A;  4O0P A;  4HJ6 A;  4L9G A;  5LBR A;  3B33 A;  2W1R A;  3MR0 A;  2O9C A;  4XT2 A;  3C30 A;  1F9I A;  1G6O A;  3K3C A;  1MZU A;  1TD5 A;  1DP8 A;  2OAP 1;  4MN5 A;  1UWP X;  3H82 A;  2KX6 A;  2WKQ A;  5G4Z A;  2YKH A;  4WUJ A;  5HDS A;  2VKS A;  1P9R A;  4O8G A;  5EFW A;  3UE3 A;  3MXQ A;  3DBA A;  4I3J A;  4G3K A;  2PHY A;  2V0W A;  1F98 A;  1X0O A;  5HWW A;  3IBR A;  5HD5 A;  1IFQ A;  1OJG A;  5K5B A;  1UGU A;  1ZHH B;  4HOI A;  1P0Z A;  5HPF A;  4JGQ A;  2WKR A;  4WEJ A;  4BBV A;  5HZH A;  2W3H A;  5F69 A;  4H6J A;  3MQQ A;  3U2A A;  4KUO A;  3ZYT A;  1XFQ A;  4HNB A;  5HL6 A;  4MN7 A;  3LIF A;  5FL3 A;  1W63 Q;  1MC0 A;  4ARZ B;  4Y2F A;  3BJN A;  3F1O B;  3D72 A;  3SW1 A;  3UMD A;  1N9O A;  4IHQ A;  4HIA A;  2W1T A;  4EET B;  3LIB A;  4WEK A;  4IJG A;  1TS0 A;  3CWF A;  3S7Q A;  3EEH A;  2W3E A;  2EWV A;  1BYW A;  4I5S A;  1XJ3 A;  2LB5 A;  3MQ0 A;  4I39 A;  4Z1W A;  2H28 A;  3CLO A;  4Q0H A;  1IOU A;  3OCL A;  2PR6 A;  4BBU A;  2B18 A;  4P6Z M;  4NXF A;  3PBO A;  3T4L A;  3P01 A;  1VB6 A;  3EEA A;  1Y28 A;  4UQI S;  1LL8 A;  1NRJ A;  4EEU A;  1XFN A;  2YKF A;  4I3I A;  5J3W A;  3TW8 A;  4KQO A;  5IS1 A;  3T50 A;  3IS2 B;  1KOU A;  3KSF A;  2D01 A;  3B42 A;  5C5K A;  1ODV A;  2O9A A;  4EXO A;  5DFY A;  3EGX C;  4HJ3 A;  2GJ3 A;  2M1C A;  4CLC B;  2J3T D;  2FH5 A;  2KLI A;  1OPX A;  2CMN A;  4Q0I A;  3A0S A;  4IUH A;  3E4P A;  3EQU A;  1WA9 A;  4WL9 A;  3GDI A;  2EA9 A;  4F3L B;  5A8B A;  3E0Y A;  3GEC A;  4HJ4 A;  4L0L A;  3H7W B;  2P08 A;  2MJ6 A;  3HJI A;  1D06 A;  1YAX A;  4CLC E;  3R7W B;  3K2N A;  4AFI A;  3S7P A;  2NUP C;  3NOU C;  4DN0 A;  3KO6 A;  1NLZ A;  4EU0 A;  2D02 A;  4L9F A;  2GZA A;  2PYR A;  2QJ7 A;  5KIZ A;  2FZ0 A;  4NXB A;  5DFX A;  3IBJ A;  4QPR A;  3E4Q A;  3OC2 A;  4EER A;  4OOL A;  3F1P B;  3OBF A;  3NOT C;  3UE6 A;  3VV4 A;  1OTA A;  4GJ4 A;  4JGR A;  5TBM B;  2JKT I;  4ARZ A;  3ZQ5 A;  3MJQ A;  3F1O A;  2J80 A;  4EEP A;  1TS6 A;  2XRN A;  3LIA A;  3H9W A;  5AVF A;  5HDD A;  5J4E A;  3A0V A;  4K08 A;  1P9W A;  1TF1 A;  1DP6 A;  5HDC A;  2W0N A;  3LUQ A;  4ETX A;  1DP9 A;  4MMN A;  4HP4 A;  2OOL A;  3OCN A;  3KSG A;  2QWS A;  3NOP C;  1S4S A;  1OTE A;  4LRX C;  4O01 A;  4Y5F A;  2HGV A;  4MN6 A;  2NUT C;  1YKD A;  2M7U A;  3IS2 A;  4ZRR A;  4PAU A;  4UEY A;  2VEA A;  1S1Y A;  5DKK A;  4HH2 A;  4MCW A;  4YWZ A;  4P6Z S;  3LID A;  3VE4 A;  2VX8 A;  2HF6 A;  2VGL M;  3F1N B;  3T4S A;  4CLC A;  1OTD A;  2Y8H A;  4M4X A;  2A24 B;  4YOF A;  3CAX A;  2V1B A;  2W3G A;  3TJZ C;  4DMZ A;  4HI4 A;  4F3L A;  4NEE D;  4NXG A;  3K3D A;  3V67 A;  3FC7 A;  3H7W A;  3HJK A;  5HD3 A;  3UB8 A;  2GNX A;  3BQA A;  5DF9 A;  3VOL A;  1DRM A;  2R78 A;  3PHY A;  2VLG A;  3PBR A;  4I3A A;  2KOI A;  3R7W A;  5DKL A;  3PXP A;  4R6L A;  5DJU A;  4EUV A;  5F68 A;  5DJT A;  2GX5 A;  2V0U A;  5HWT A;  3KSI A;  3LR5 A;  4PHT A;  2ZBB A;  3A0R A;  4EW7 A;  1OT9 A;  3ULF A;  4Y3I A;  4R70 A;  3CUE A;  3TRC A;  1OTI A;  3O5Y A;  3LYX A;  1OTB A;  2ZOH A;  2G7U A;  3F1P A;  4OOM A;  4CLC D;  2W3D A;  3FPV A;  2K2N A;  5TBM A;  2HJ9 C;  1UWN X;  3NHQ A;  1S1Z A;  2VV8 A;  3T4Q A;  2JKR I;  2VZW A;  3OOV A;  3MQO A;  3HCY A;  5IT5 A;  1VHM A;  3LI8 A;  4BMW A;  1GSW A;  4HQA A;  4MDZ A;  4I38 A;  2P7J A;  3VE3 A;  2PR5 A;  3P7N A;  1T19 A;  5TJJ A;  2PD8 A;  3CIT A;  2B02 A;  4LRY C;  4WN5 A;  3T4T A;  2K7S A;  3R4K A;  3RFB A;  2VJW A;  3TE8 A;  1LSW A;  1T1A A;  4L9E A;  3LIC A;  1T1B A;  3BY8 A;  4CQH A;  5CX7 A;  2L0W A;  4FOF A;  4II7 A;  2QYB A;  2L1M A;  2JHE A;  3BY9 A;  1GSX A;  4R3A A;  1TS8 A;  4G3V A;  3F1N A;  3C38 A;  3PBS A;  2OAQ 1;  1N9L A;  2HV1 A;  2XSS A;  3LIE A;  2A24 A;  4NKP A;  4KUK A;  1N9N A;  4B93 A;  2VV7 A;  3S7O A;  3KYZ A;  2WKP A;  5I5L A;  4PKY G;  5G4Y A;  1OJ5 A;  4LLO B;  3G6O A;  1H3Q A;  2VGL S;  2Z6D A;  4BBT A;  2OWJ A;  5IU1 A;  4GS9 B;  5HWV A;  1S4R A;  2Z6C A;  4DJ2 A;  1W63 M;  1YSP A;  2KDK A;  4LRZ E;  2Y79 A;  4EES A;  3LR0 A;  4HP9 A;  2VV6 A;  4WLA A;  3T4O A;  4E04 A;  1V9Y A;  3MFX A;  1TS7 A;  5MC7 A;  3OLO A;  1EW0 A;  4GHI B;  1T18 A;  3LR3 A;  5J7E A;  2QKP A;  3RTY A;  4HH3 A;  2O9B A;  2JKT M;  4GW9 A;  2J3W A;  3MF0 A;  3UME A;  2PD7 A;  3W2Z A;  3JVV A;  3KX0 X;  2ZOI A;  4Q0J A;  4PKY A;  2BAS A;  2L4R A;  1T1C A;  3UB9 A;  1F5M A;  4FSF A;  2INW A;  1NLY A;  3RH8 B;  3UB6 A;  2HJE A;  4HHD A;  3T4J A;  1LSV A;  1XJ2 A;  2XRO A;  3S7N A;  4JGO A;  3PYP A;  4IUK A;  3FPW A;  4XT2 B;  2I9V A;  2P04 A;  1G28 A;  4YNR A;  3BW6 A;  3MMH A;  1ZTU A;  3PR6 A;  4B9O A;  1JNU A;  5F6A A;  3H82 B;  1S67 L;  3B47 A;  4DJ3 A;  2O0Y A;  3LI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...