1S1YA

Photoactivated chromophore conformation in photoactive yellow protein (e46q mutant) from 10 microseconds to 3 milliseconds
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Chromophore conformation and the evolution of tertiary structural changes in photoactive yellow protein
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photoreceptor
total genus 36
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1s1yA00
5F69A 4MN5A 1TS8A 1TS0A 5HWVA 2EA9A 3BY8A 1ODVA 4GS9B 4HIAA 1G28A 5AVEA 3UB9A 3H7WA 2PHYA 3E4QA 1XFNA 1DP9A 1XJ4A 2B02A 2QHKA 3PYPA 2WKPA 1OJ5A 2WKRA 3UB8A 4L9GA 2K7SA 5HWWA 2L0WA 5F5YA 3CWFA 3VE3A 2D01A 2V1AA 5AVFA 3IS2B 3C8CA 2VV6A 5EFWA 4EW7A 3FG8A 4HH3A 5TBMB 3H82B 3MQQA 3F1OB 1XFQA 3ULFA 4NXEA 3RH8B 2PD8A 3H9WA 3LI8A 1NWZA 3LIEA 3SW1A 4HQAA 1LSXA 3P7NA 5J7EA 4R38A 3PHYA 1JNUA 5DJUA 3D72A 2L1MA 3A0SA 5A8BA 5F68A 3UMEA 2VV8A 2VEAA 4HI4A 5F6AA 1V9ZA 3B33A 2WKQA 3VE4A 3MQOA 1S4SA 1N9OA 4I3IA 4WUJA 4R3AA 2CMNA 1OTDA 4LPZA 1UGUA 3BY9A 3GDIA 1D06A 1Y28A 3NOPC 2Z6DA 2A24B 4XT2B 1GSVA 1T1AA 2VLGA 4YWZA 2P7JA 2V9AA 1WA9A 3NHQA 4MN6A 1LT0A 3LYXA 2OWJA 4L9FA 2I9VA 5HDSA 5I5LA 1GSXA 1UWPX 3IBRA 2L4RA 4HHDA 3UB7A 3H7WB 5DJTA 2JHEA 4JGPA 2ZOHA 2V0UA 1T19A 3NJAA 5HD3A 2QWSA 2YKFA 4BBVA 2ZOIA 1S1ZA 1XJ3A 3ZQ5A 1DP6A 5HWTA 2PR6A 5IS1A 2HV1A 2PDRA 3EEHA 5HSQA 4R70A 2H28A 4BBTA 1S67L 1LSVA 3LIFA 5HD5A 5IU1A 3UMDA 1D7EA 3VOLA 3NOTC 1OTBA 1P97A 4EESA 4JGRA 3E4PA 3OLOA 4I3JA 4WF0A 1V9YA 4NXFA 4DJ2A 2QKPA 4H6JA 2YKHA 2M1CA 3MXQA 3EWKA 3LUQA 2PD7A 5G4ZA 4EETB 5J3WA 4R6LA 4F3LB 4WLAA 2OOLA 4K08A 4GHIB 2PR5A 2QJ7A 3LIAA 4KQDA 3T50A 5DKKA 3H82A 3HJKA 2V0WA 1VB6A 1T1CA 1LSWA 2W27A 3CLOA 1TS6A 1S1YA 2Z6CA 1OJGA 3BWLA 2VV7A 1DRMA 3F1PB 1T1BA 3KX0X 3MR0A 1S66L 1T18A 3LIDA 1XJ6A 3F1NB 4EERA 1S4RA 2R78A 4KUOA 2D02A 1F98A 4LRZE 3MJQA 2OWHA 4KUKA 3G6OA 4EQ1A 1P0ZA 4PKYA 1BYWA 2PYPA 4M4XA 4RQ9A 4NXGA 1N9LA 1X0OA 4WN5A 3LI9A 3LIBA 4HY8A 1EW0A 1OTIA 3GECA 5KIZA 1OTAA 4JGQA 5DKLA 1DP8A 2GJ3A 4JGOA 4H6JB 4E04A 2W0NA 3K3CA 4GS9A 5HDDA 4L9EA 3A0RA 4HNBA 4EXOA 2BASA 2KX6A 5J4EA 1UWNX 4HOIA 1XJ2A 4GW9A 4I38A 3C2WA 3E4OA 4I3AA 5HDCA 4EEUA 4HH2A 1TS7A 3NOUC 1MZUA 3IS2A 3LICA 4DJ3A 1GSWA 1OT6A 5TBMA 3RTYA 3ICYA 3F1OA 1OTEA 4GCZA 1N9NA 5HZHA 4PKYG 1KOUA 4I39A 4HP9A 3UB6A 4I5SA 4F3LA 4NXBA 2J80A 2KDKA 2V1BA 4HJ3A 4GHIA 4EEPA 4LLOB 3UE6A 4HJ6A 4LRXC 4B9OA 3HJIA 2JN7A 2INWA 3A0VA 4HJ4A 3CAXA 2ZBBA 5G4YA 2PYRA 4WL9A 1F9IA 3FC7A 3K3DA 2QJ5A 1LL8A 1OT9A 3F1PA 4HP4A 4LRYC 4BBUA 2A24A 3F1NA 4XT2A 3MFXA
chains in the Genus database with same CATH superfamily
4CPKA 4WEJA 3V67A 5F69A 1XGJA 3VSLA 3ZG0A 2Y2MA 3ITAA 4E3JA 1RCJA 3DTMA 4PM5A 4UQIS 3PBSA 2EA9A 4FSFA 4GS9B 1I2WA 5AVEA 1MY8A 5DTSA 2Y2PA 2PHYA 1XFNA 1E4DA 1DP9A 3FPVA 4ME4A 2WKPA 5FQMA 1O07A 1OJ5A 4L0LA 3S22A 3P01A 2K7SA 3CITA 2L0WA 1K54A 4O0PA 4DKIA 1XA1A 2OLVA 3S7PA 4JLFA 3C8CA 2VV6A 5FQIA 1F5MA 5EFWA 3FKVA 4HH3A 2V2FF 5FATA 1FILA 1MPLA 2A3UA 1G6AA 4IBXA 3ULFA 3ZFZA 1PWDA 2WGWA 3UE3A 2WADA 2EXAA 3NULA 3RH8B 2PD8A 1TD5A 3CPTB 1ZKJA 1YLYA 5GHYA 3T1RA 4YINA 4GN2A 3LCEA 1JNUA 3D72A 4R4RA 3C4OA 3NBLA 4ZJ2A 4QY6A 4Y2FA 2J3TD 5FL3A 5E2FA 1V9ZA 3B33A 2XDMA 2WKQA 3RFBA 4DE1A 5EVID 2Y79A 1PNEA 3M6HA 3G2YA 4B4XA 4I3IA 3N4IA 4LPZA 4EUVA 2WGVA 3FWLA 5EECA 2Z6DA 2B95A 2A24B 4G3KA 1CF0A 4XT2B 4BD0A 2GZAA 1K54C 3FKWA 2P7JA 2EFXA 4MN6A 3LYXA 1JTDA 4IVKA 3DTEA 1UWPX 3IBRA 4KZBA 2ZQ9A 1K4FA 1I5QA 2W3EA 3UB7A 4JGPA 3T1QB 3HLFA 4MCWA 3Q1FA 2M7VA 2DCFA 3NECA 3MSHA 3ZYTA 4O7DA 2QWSA 4DF6A 2ZOIA 3SOIA 3ZQ5A 4OQGA 3G34A 1DP6A 1K38A 5IS1A 2WZZA 5HSQA 4BBTA 2W1TA 1LI9A 3UMDA 3VOLA 3BLSA 4EESA 4PAUA 1V9YA 1K55C 3EEAA 2CC1A 3C30A 1YLJA 5TFQA 4JXGA 3T4OA 4H6JA 4CLCE 4OP8A 4JF5A 2PU4A 1STZA 1DJBA 2XR0A 1J9MA 2PD7A 5EM0A 3DBAA 4DMZA 2ZD8A 4R6LA 2Q9NA 4OOYA 5CECA 3LR5A 4G3WA 2Y2KA 1FR6A 2HJEA 2PR5A 2O0YA 5LBRA 4KZAA 3LIAA 4KQDA 2OV5A 4E3LA 3BQ8A 2HF6A 3G31A 5F82A 3BFGA 1IFQA 2WKHA 2GDNA 2V8CA 1AXBA 3T4KA 3N6IA 5M18A 2EX8A 1VB6A 2JKFA 5HAPA 4OPRA 3S4XA 1PW8A 1PW1A 3EOIA 1SZVA 1P9WA 4QD4A 3CLOA 1G6OA 3SS5A 2KOIA 3PBOA 4M3KA 1SCWA 3BWLA 3BYDA 1DRMA 3F1PB 1FR1A 3KX0X 3MR0A 3ZG7B 2A2LA 3VFHA 4NETA 3W8KA 1XJ6A 4QJGA 4ZRRA 1KE4A 2AVXA 5F83A 5FQKA 1F98A 4UEYA 4KUKA 3G6OA 4EQ1A 2VGLM 4Y13A 2ZC6B 3T4LA 4M4XA 2OAQ1 3V50A 1YM1A 1FCOA 4NXGA 5FI6A 1X0OA 4JXWA 4WN5A 1H0MA 2UV0E 4C6YA 3ZDJA 4N9KA 1AWIA 3PBTA 1YPRA 1DP8A 1Z09A 2Y2HA 5GL9A 2GJ3A 3HLCA 4GDBA 3T1SA 3HBRA 4E04A 2W0NA 4L9EA 1PWCA 1YLZA 5L10A 2BASA 2KX6A 4KQQA 1XJ2A 4C75A 1YLPA 4Y0OA 2PU2A 3CG5A 1A0KA 4DN0A 1S6RA 4EBLA 1K56D 2XQZA 5EPHA 2IWCA 3LICA 3MMHA 3JPUA 3T4SA 1OPXA 4B4ZA 5EOEA 2XA7S 3ICYA 4S2IA 1ALQA 5HPFA 1IEMA 3NCKA 5A92A 1N9NA 3BRMA 3DTIA 5DFYA 3A3FA 4GB7A 1GHPA 3RJUA 4UHUA 5EOOA 1BLSA 4E6WA 3PXPA 4CLCA 4I39A 3QP6A 1TDGA 5FAOA 4S2KA 4JPMA 1KDSA 1Q2QA 5D3OA 4LLOB 1PWGA 2XD5A 4HJ6A 4F94A 5CEDA 1ESUA 5CHMA 4DDYA 3PAGA 4Q0JA 3IWIA 2JN7A 3P98A 2INWA 5L09A 3A0VA 4QPRA 3EGDC 1E3UA 5JYPA 3CAXA 1DY6A 4RX3A 3LO7A 1KDWA 5G4YA 1Q2PA 3GV9A 2HPBA 4WZ5A 3FC7A 2GNXA 3JYIA 1LLBA 3UN7A 3VP3A 3UB5P 4O8GA 3EQVA 5E2EA 5CX7A 3R4KA 2QJ5A 1LL8A 1OT9A 5FQQA 4JXVA 2A49A 4HP4A 4DXBA 3OC2A 3IHBA 2RCXA 4BBUA 4QWOA 3GQZA 2BG1A 4OQIA 2JKRI 2EXBA 3B42A 1TS0A 5HWVA 3HLDA 1XGIA 3BY8A 1ODVA 2H0YA 4HESA 2WAFA 4BWIA 1NLZA 3AGFA 3H7WA 3WRZA 3P09A 4PHTA 3E4QA 3G4PA 1BULA 2B02A 4WM9A 3PYPA 1H8ZA 2W3FA 3IWQA 3QP1A 4EV4A 1JWPA 2G2WA 1NJ4A 1KVMA 4CLCC 4ID4A 4PM8A 3UB8A 3IX3A 4L9GA 4BLMA 1FSYA 2H0TA 3CWFA 4Y17A 5F5YA 2V1AA 5E43A 4GLQA 1KVLA 5AVFA 3UPNA 3T4TA 2Y55A 1KE3A 4EW7A 1EWZA 5G18A 5TBMB 3FV7A 3F1OB 1CQAA 2Y2JA 4WYYA 1XFQA 4WZ5C 4R3BA 4FD8A 3H9WA 1SDEA 3BJNA 2ZQ8A 2I72A 4OKPA 5FA7A 1NLYA 1VETA 3P7NA 2C5WB 3UO9A 4IVIA 2HDQA 1MWUA 1NZOA 5HAIA 5DJUA 4E3MA 2ZC5B 3A0SA 4WMCA 5A8BA 4MMNA 3FZCA 4KZ9A 2XD1A 3MBZA 1C3BA 5FEGA 4BENA 2WKIA 1ZC2A 3ZG8B 2ZM8A 4U3TA 4WUJA 3OPPA 4IUKA 3MZDA 4S2NA 4EQIA 1LL5A 3GDIA 4RVAA 5GLBA 1D06A 3NOPC 1OMEA 4G3VA 4DRTA 3L9KA 3A3JA 1BLHA 1K25A 1DJCA 1KGEA 2VLGA 1WA9A 3M6BA 1SKOB 2PRFA 2OWJA 4L9FA 4NK3A 4LGWA 5HDSA 1H8MA 3C4PA 3QHYA 4HHDA 4Y15A 1YAXA 1VHMA 5DJTA 4Y0UA 2DMWA 2ZQAA 4E3NA 1T19A 3NJAA 1SDNA 1ONGA 2K2NA 3OPRA 2YKFA 3RXWA 1S1ZA 2HDRA 4OQHA 2PR6A 5HWTA 2HV1A 4R70A 3LIFA 1I2SA 1IOUA 1MWSA 5HD5A 3G35A 2XFTA 2C6WB 1NY0A 2XROA 3E4PA 4JGRA 4LENA 5KSCA 2DNSA 4DJ2A 3PBRA 4LV3A 4QY5A 2WGWB 3JVVA 2JCHA 2PAVP 1ZHHB 3OPLA 1K57A 1K4EA 5FQ9A 4WEKA 4EUZA 4YOFA 4S2NC 5M19A 2IWBA 4EETB 5J3WA 1CJFA 4GHIB 5KMWA 4EBPA 3M2JA 3R7WB 2B18A 4FCFA 2R9WA 4GZBA 3FPWA 5EUAA 3GSGA 3ISGA 2J9OA 3HJKA 3LEZA 2OLUA 4UA7A 1MBLA 4EWFA 4DE0A 3CPTA 2W27A 4DE3A 1BSGA 5A90A 2Z6CA 1OJGA 4JXSA 4ARZB 1L0FA 2XF3A 4KZ8A 3NDEA 3ZVTA 3F1NB 3HLBA 3QNCA 3HLEA 5CERA 5CXWA 1S4RA 3C7UA 1ES4A 1FOFA 2D02A 4LRZE 3O3VA 3O5YA 1XKZA 1RGYA 5DF9A 1GA9A 2X01A 1P0ZA 1HD8A 1W8QA 1BYWA 3HLWA 3HLGA 3TRCA 2Y8HA 4FOFA 2KLIA 3Q7VB 1YQSA 1N9LA 2P04A 3Q7ZA 3TW8A 4BQMA 4HBUA 1NZUA 3N8SA 1YLWA 2IA2A 1OTIA 2Q9MA 3GECA 3MKFA 4R3JA 1OTAA 3VP1A 2M7UA 3WS5A 4X1LA 4IBRA 1P9RA 5DKLA 2P74A 3DTKA 2FZ0A 3LGOA 4JGOA 3ZVWA 1W63Q 4H6JB 2JKRM 3K3CA 2Z2MB 3U2AA 4MBKA 3UPPA 1JWZA 4KG2A 3OCNA 4EXOA 3OOVA 1UWNX 3B47A 4GW9A 1ES2A 2J7VA 4S2OA 4E6XA 3C2WA 5GHZA 3E4OA 1VQQA 2ZQDA 5DFXA 4Y7PA 1MZUA 3IS2A 3O87A 5K5BA 3NY4A 1L0EA 1GSWA 1OT6A 4ESPA 4RX2A 2J3WA 1MKIA 5HZHA 4FH2A 1BLCA 3IBJA 4K0WA 4PKYG 2P9VA 3BFFA 2HGVA 4HP9A 2J80A 2KDKA 1W63M 4U0TA 4EEPA 2ZL1A 5DTKA 4LRXC 4WELA 2VGLS 4BMWA 1NRJA 1IYPA 3MQ0A 3HJIA 2QMIA 3V3SA 4HJ4A 4KZ5A 2W3HA 1SHVA 1PFLA 4II7A 1WYBA 2HP6A 4P85A 2EX2A 1Y54A 1ZG6A 3F1PA 1Z6FA 4DDSA 1BZAA 5CEBA 1VEUB 1FQGA 1ZG4A 2B5RA 3KSGA 4R4SA 4MN5A 2K31A 5L8MA 3IXBA 2JE5A 1TS8A 1U60A 3V5MA 4P6BA 2O9BA 3W2ZA 1G28A 3ZNTA 1PIOA 3UDIA 5AQAA 1XJ4A 3IQAA 2QHKA 2ZMVA 3CUEA 2LB5A 5GLCA 3Q07A 5CGSA 4BL3A 3WS0A 3BW6A 3KYQA 4P0MA 4Q0HA 3VE3A 3IX8A 3CZDA 1GHIA 3VP4A 5HARA 4GJ4A 4CJNA 3C5AA 2JKTI 3BFCA 2XLNA 1ONHA 3H82B 2LB9A 3BM6A 3D4FA 5JYOA 5HX9A 3SZTA 4NXEA 5CHUA 3CMZA 5KZHA 3PR6A 4GOGA 3EGXC 4C3QA 3LI8A 4CLCB 4ETZA 1N9BA 4KQRA 3SW1A 3ITBA 1PRQA 1LSXA 5J7EA 2NUTC 1D1JA 1BLPA 3BQAA 3DW0A 2VV8A 2WK0A 3LY4A 2H5SA 1K6SA 3TSGA 2VK3A 3TJZC 5FSRA 3VE4A 1W8YA 3MQOA 3W4QA 4U0XA 1S4SA 3IT9A 2JKGA 1N9OA 3D3OA 4R3AA 4S2LA 2CMNA 1OTDA 5EM1A 1UGUA 5F1GA 3BY9A 3DAVA 2ACGA 3VOZA 4N1HA 1ES3A 1Y28A 1H8YA 3MZEA 2VX8A 4P6ZS 1GSVA 3Q82A 2XFSA 4YWZA 3VSKA 4OQ0A 3C7VA 3NHQA 4MNRA 5L2FA 2HZ5A 1LL9A 3IF6B 2I9VA 5M1AA 5I5LA 5BOHA 3H7WB 1JVJA 3OPHA 1XXMA 2V0UA 4PM6A 3O88A 1JTGA 3N8RA 2ZLYA 2R9XA 3MKEA 2PDRA 2H28A 4MLLA 1S67L 1VM1A 1LSVA 5EVIA 2VZWA 1D7EA 3OZHA 1PZOA 3NOTC 1PYYA 1NYYA 4I3JA 3SS4A 3GMWA 1XPBA 4NXFA 2QYBA 3SH8A 1KGFA 2QKPA 2YKHA 4MBHA 2M1CA 4OPQA 4KZ7A 4JF4A 4X53A 5AJGA 3PBNA 3MXQA 3LUQA 3KO6A 3GRJA 1VETB 5HW3A 2HDUA 2Y2LA 3PTEA 2BLSA 4E3OA 4P87A 4F3LB 5CGWA 2OOLA 4YNRA 3IH8A 4FH4A 3CHWP 5CGXA 3ZGAB 2WKEA 2QJ7A 3T50A 2OAP1 4A5RA 2W3GA 4S2PA 2V0WA 5GLDA 4WBGA 3I7JA 5EV0A 4ZAMA 4OP5A 1K6RA 1GHMA 1CEGA 1T1CA 5FDSA 1L0DA 4D2OA 1TF1A 1TS6A 1S1YA 1CK3A 2PBYA 3M2KA 3V39A 2Y2QA 4EBNA 3LFVA 2Y2NA 4LFUA 2VV7A 2J3TC 1T1BA 3HUMA 1E25A 4GD6A 3S1YA 1S66L 4IJGA 1T18A 3LIDA 4XXRA 4ZTKA 1BUEA 4CQHA 2WUQA 4Q0IA 3CI6A 4EERA 5EVIC 4KUOA 1DJAA 3UDFA 3GR2A 4OLGA 4R0QA 3MJQA 3U4LP 2OWHA 3DWKA 5FDHA 1ERMA 1TVFA 4LCLA 3SH9A 1PI5A 1YSPA 3TE8A 4RQ9A 2ZMAA 3KSHA 1CEFA 4NKPA 2VGJA 5E2HA 4O01A 3LI9A 4LV0A 1EW0A 3V3RA 4Z1WA 5U47A 4MN7A 3T1XA 5HL6A 5KIZA 1MXOA 5IHVA 4CLCD 3G30A 2HP9A 1SKOA 2EFUA 3WRTA 3E0YA 3RXXA 1YSQA 1WYCA 5A93A 2XGNA 1E3UD 2PT7A 4UA6A 4GS9A 5E2GA 3A0RA 1HZOA 2ZJ9A 3UDXA 4HNBA 4UQIM 4KQOA 1M6KA 1G5UA 3IF5A 4S2MA 2ZC3B 4H8RA 1FCMA 4I38A 3G2ZA 4I3AA 1G68A 1PI4A 2O99A 4RYEA 4EEUA 4HH2A 3NOUC 2V8FA 1QMEA 1MC0A 2VKSA 1FCNA 2G7UA 1MKMA 1YLTA 2EX6A 1KE0A 3RTYA 1HVBA 2VGKA 5HFOA 5CTMA 1OTEA 4FTXA 4GCZA 3UNWA 5GHXA 2JKTM 2X02A 3BEBA 4BL2A 4RA7A 4Z9QA 1NYMA 1KOUA 3UB6A 3UE1A 2G2UA 5L07A 4GHIA 1IELA 3FYZA 1SKFA 3R7WA 3UE6A 1K55A 2WZXA 4B9OA 4X55A 3E98A 4QB8A 5DTTA 3NC8A 5HPIA 2VJWA 2ZM0A 2ZBBA 4KZ4A 3HVFA 1XA7A 1QMFA 2Y4AA 1M40A 4JF6A 3QP4A 4WL9A 3MS6A 4PM9A 1F9IA 3EQUA 3MFDA 4AFIA 2XRNA 5AQ9A 1EROA 3JVUA 1LI0A 1K56A 2FFYA 3IWOA 4LRYC 1JWVA 4ARZA 1K57C 2W3DA 4K0XA 2A24A 2J8YA 4KENB 3F1NA 3BLMA 4XT2A 3TOIA 4KZ6A 3MFXA 1HLUP 4BD1A 5A91A 2W1TB 3VP0A 2Q0OA 2EWWA 3ZCZA 5HAQA 4WMCD 5FQJA 2W1RA 1KGGA 2XH9A 5I94A 2WAEA 2QPNA 4GD8A 2HP5A 5F1FA 4HEFA 4HIAA 2JBFA 3UB9A 2ZMFA 3Q7VA 3HREA 3B3XA 3S7NA 1XP4A 1TDLA 2Y2OA 4X6TA 2XSSA 3LR0A 3A3EA 2WYXA 2WKRA 5CRFA 4HBTA 2O9CA 3NI9A 5FASA 1H5XA 3HL9A 2QZ6A 5HWWA 1N4OA 1GCEA 5C5KA 5TGFA 2D01A 4NG2A 1NRFA 5AQBA 3IS2B 3FG8A 4NEED 5J8XA 4MDZA 3IX4A 3MQQA 3IH9A 1O7EA 3QP5A 3E2LA 4QHCA 3UE0A 3A3DA 2Y91A 2P9VB 4LV2A 1NWZA 3LIEA 4HQAA 2PBDP 3T12B 5MC7A 2ZL1B 4R38A 3D9YA 1L3LA 3PHYA 2L1MA 4IUHA 4D60A 5F68A 3UMEA 4Y3IA 5AQ7A 2VEAA 4HI4A 5F6AA 5CTNA 4N92A 3ZHHA 3DWZA 5DF7A 4OONA 3T4QA 2NUPC 4OOLA 3OCLA 2ZC7A 4X69A 1XX2A 5FEFA 4K91A 1NXYA 4X1MA 3VV4A 4GNUA 4OLDA 3KYEA 1CI9A 5TR7A 3WS1A 2E8JA 1T1AA 3A3IA 5IT5A 1ESIA 2V9AA 3N7WA 1IYSA 1YT4A 1WE4A 1LT0A 4WZ4A 3LR4A 1GSXA 3LR3A 1S0WA 2L4RA 1J3WA 5EVLA 2EX9A 4UAAA 1BTLA 2E8IA 2X71A 2JHEA 3W4PA 2ZOHA 2FH5A 3MXRA 4Q8IA 2P08A 5HD3A 4BBVA 5FI7A 3IHAA 1XJ3A 3QP2A 3K2NA 1VEUA 3PAEA 2RL3A 3VFFA 1ACFA 3EEHA 3LEQA 5TJJA 3S7OA 5IU1A 3AGDA 1F2KA 4FUWA 1FSWA 1OTBA 1P97A 3Q81A 4WF0A 3OLOA 3TG9A 1FIKA 3C38A 3O86A 4Y5FA 4OVDA 3SS3A 3EWKA 2Y2IA 5G4ZA 2GX5A 4QU3A 5CHJA 4WLAA 4K08A 1PZPA 1MWTA 4DE2A 3W4OA 4IHQA 1ZTUA 1L2SA 4MEZA 5FAPA 5DKKA 3H82A 3IXGA 3BECA 4JBFA 3VMAA 1IKGA 3E2KA 4XUZA 3QP8A 1LSWA 3ZNYA 5GLAA 4MBFA 3WS4A 3GTCA 2FFFB 3OBFA 1W79A 3WS2A 3MZFA 2XA7M 4OH0A 4OPYA 3UY6A 2EWVA 4DXCA 2ZC4B 3HCYA 3CUEC 3QNBA 3T4JA 3PBQA 4JKTA 2J9PA 3VP2A 1YMSA 1H3QA 1ES5A 2R78A 2BTFP 1EI5A 2Y2GA 4KZ3A 5DF8A 1IKIA 4ZJ1A 4PKYA 2PYPA 3KSIA 1W5DA 1IYQA 4EU0A 4ZBEA 4E3IA 4HY8A 3LIBA 4BJPA 1RP5A 4S2JA 4ZJ3A 1HTZA 3LY3A 2Z2LB 2ZM2A 5EVIB 4PMAA 5FI2A 4OOMA 4JGQA 5KSHA 3GVBA 2DRWA 4P6ZM 3IF6A 4XUXA 3HUNA 1BT5A 4UA9A 3VOYA 2ZQ7A 4LCMA 2ZQCA 3IXHA 4X56A 2VA0A 3CJMA 1Y4OA 3WWXA 5FAQA 1W7FA 4N1XA 1K0KA 4X68A 1ERQA 5HDDA 1RGZA 2UWXA 2WGIA 3S7QA 5J4EA 4HOIA 3UPOA 4KG6A 4R1GA 2HJ9C 1TEMA 2XEPA 5HDCA 5HL1A 3ZG9B 1TS7A 2V1ZA 4N9LA 5EE8A 5EVEA 3NDGA 4GKUA 2MJ6A 4B93A 4DJ3A 5TBMA 2V20A 4B88A 2OSUA 3F1OA 3N8LA 1YMXA 2HDSA 3KSFA 4E3KA 1GA0A 4IEDA 3AGEA 4I5SA 4F3LA 2IWDA 4NXBA 2O9AA 2V1BA 4HJ3A 4KG5A 1IYOA 2XK1A 4ETXA 4GDNA 3BFEA 4R23A 3BFDA 3IXDA 1YKDA 4PPRA 3SH7A 3NIAA 1CI8A 4PM7A 2JC7A 3L7HA 4LV1A 4OPZA 4ZDXA 2PYRA 3IF6C 4YFMA 1L0GA 3K3DA 3ZG5A 3G32A 2Y59A 4Y0TA 1LHYA 3MF0A 1MWRA 3MXSA 4X25A 3KYZA 2H10A 3HUOA 5DVAA
chains in the Genus database with same CATH topology
4WEJA 3V67A 5F69A 3KSGA 2W1TB 2JKRI 4MN5A 2K31A 3B42A 5L8MA 1TS8A 2EWWA 1TS0A 2W1RA 4UQIS 5HWVA 3PBSA 2EA9A 3BY8A 2O9BA 1ODVA 4FSFA 4GS9B 3W2ZA 4HIAA 4BWIA 1G28A 1NLZA 5AVEA 3UB9A 2ZMFA 3H7WA 2PHYA 4PHTA 3E4QA 3S7NA 1XFNA 1DP9A 3FPVA 4ME4A 1XJ4A 2B02A 2QHKA 3PYPA 2ZMVA 2WKPA 2W3FA 3CUEA 2XSSA 3LR0A 2LB5A 1OJ5A 4L0LA 2WKRA 4CLCC 2O9CA 3P01A 3UB8A 3BW6A 4L9GA 3KYQA 2K7SA 3CITA 5HWWA 2L0WA 4Q0HA 3CWFA 5F5YA 3VE3A 4O0PA 5C5KA 2D01A 2V1AA 4GLQA 4GJ4A 5AVFA 3IS2B 3S7PA 3C8CA 2VV6A 3T4TA 1F5MA 5EFWA 4EW7A 2JKTI 3FG8A 4HH3A 5TBMB 4NEED 3H82B 4MDZA 3MQQA 3F1OB 2LB9A 1XFQA 3ULFA 4NXEA 3UE3A 3PR6A 3RH8B 2PD8A 3EGXC 3H9WA 1TD5A 3BJNA 3LI8A 4CLCB 1NWZA 4ETZA 3LIEA 3SW1A 4HQAA 1LSXA 1NLYA 3P7NA 5J7EA 2NUTC 5MC7A 4R38A 3PHYA 1JNUA 5DJUA 3D72A 3BQAA 2L1MA 4IUHA 3A0SA 5A8BA 5F68A 3UMEA 4Y3IA 2VV8A 4Y2FA 2J3TD 2VEAA 5FL3A 4HI4A 5F6AA 1V9ZA 4MMNA 3B33A 2WKQA 3TJZC 3VE4A 3RFBA 3T4QA 3MQOA 4OOLA 2NUPC 3OCLA 2Y79A 1S4SA 1N9OA 3D3OA 4I3IA 4WUJA 4R3AA 2CMNA 4IUKA 1OTDA 4LPZA 1UGUA 3BY9A 4EUVA 3GDIA 1D06A 1Y28A 3NOPC 4G3VA 2Z6DA 3VV4A 2A24B 4G3KA 2VX8A 4P6ZS 4XT2B 1GSVA 2GZAA 1T1AA 2VLGA 5IT5A 4YWZA 2P7JA 2V9AA 1WA9A 3NHQA 4MN6A 1LT0A 3LYXA 2OWJA 4L9FA 2I9VA 3LR4A 5HDSA 5I5LA 1GSXA 1H8MA 1UWPX 3LR3A 3IBRA 2L4RA 4HHDA 1YAXA 2W3EA 3UB7A 3H7WB 1VHMA 5DJTA 2JHEA 4JGPA 2DMWA 2ZOHA 2FH5A 1T19A 2V0UA 4MCWA 2M7VA 3NJAA 2P08A 5HD3A 2K2NA 3ZYTA 2QWSA 2YKFA 4BBVA 2ZOIA 1S1ZA 1XJ3A 3ZQ5A 3K2NA 1DP6A 2PR6A 5HWTA 5IS1A 2HV1A 2PDRA 3EEHA 5HSQA 4R70A 2H28A 4BBTA 1S67L 2W1TA 1LSVA 3LIFA 5TJJA 1IOUA 3S7OA 5HD5A 5IU1A 3UMDA 2VZWA 1D7EA 3VOLA 3NOTC 1OTBA 1P97A 4EESA 2XROA 3E4PA 3OLOA 4I3JA 4JGRA 4WF0A 4PAUA 1V9YA 3EEAA 3C38A 4Y5FA 4NXFA 3C30A 2QYBA 4DJ2A 3PBRA 2QKPA 3T4OA 4H6JA 2YKHA 3JVVA 2M1CA 1ZHHB 4CLCE 5AJGA 3PBNA 1STZA 3MXQA 4WEKA 3EWKA 3LUQA 3KO6A 2PD7A 4YOFA 5G4ZA 3DBAA 2GX5A 4EETB 5J3WA 4DMZA 4R6LA 4F3LB 3LR5A 4WLAA 2OOLA 4G3WA 4K08A 4GHIB 4YNRA 2HJEA 2PR5A 2O0YA 2QJ7A 5LBRA 3R7WB 3LIAA 2B18A 4KQDA 4IHQA 2OAP1 3T50A 3BQ8A 1ZTUA 2HF6A 5DKKA 2W3GA 3FPWA 3H82A 1IFQA 3HJKA 3T4KA 2V0WA 1VB6A 1T1CA 1LSWA 3EOIA 1P9WA 2W27A 3CLOA 1G6OA 1TF1A 2KOIA 3OBFA 1TS6A 3PBOA 1S1YA 2Z6CA 1OJGA 2XA7M 3LFVA 3BWLA 2VV7A 1DRMA 2J3TC 3F1PB 1T1BA 2EWVA 3KX0X 3MR0A 4ARZB 1S66L 4IJGA 1T18A 2A2LA 3LIDA 3HCYA 3CUEC 4CQHA 1XJ6A 3F1NB 4Q0IA 3T4JA 3PBQA 4ZRRA 3CI6A 4EERA 1H3QA 1S4RA 2R78A 4KUOA 2D02A 1F98A 4LRZE 3MJQA 3O5YA 2OWHA 4UEYA 4KUKA 3G6OA 4EQ1A 5DF9A 1P0ZA 2VGLM 4PKYA 1BYWA 3T4LA 2PYPA 3KSIA 4M4XA 2OAQ1 1YSPA 4EU0A 3TE8A 4RQ9A 3TRCA 3KSHA 2Y8HA 4NKPA 4FOFA 2KLIA 4NXGA 1N9LA 2P04A 1X0OA 4WN5A 4O01A 3LI9A 3LIBA 4HY8A 1EW0A 3TW8A 4BJPA 2IA2A 1OTIA 4Z1WA 3GECA 4MN7A 5HL6A 5KIZA 1OTAA 2M7UA 4CLCD 3PBTA 1P9RA 4OOMA 4JGQA 5DKLA 5KSHA 2FZ0A 4P6ZM 1DP8A 3E0YA 2GJ3A 4JGOA 1YSQA 2VA0A 1W63Q 4H6JB 2JKRM 4E04A 2PT7A 2W0NA 3K3CA 4GS9A 5HDDA 3U2AA 4L9EA 3A0RA 4HNBA 3OCNA 4EXOA 4UQIM 3OOVA 4KQOA 2BASA 2KX6A 3S7QA 5J4EA 1UWNX 4HOIA 1XJ2A 3B47A 4GW9A 4I38A 3C2WA 3E4OA 2HJ9C 4I3AA 4DN0A 2O99A 5DFXA 5HDCA 4EEUA 4HH2A 1TS7A 3NOUC 2MJ6A 1MZUA 1MC0A 3IS2A 4B93A 2VKSA 2G7UA 3LICA 3MMHA 5K5BA 3T4SA 1MKMA 1OPXA 4DJ3A 1GSWA 1OT6A 5TBMA 2XA7S 3ICYA 3RTYA 5HPFA 3F1OA 1OTEA 2J3WA 4GCZA 1N9NA 5HZHA 5DFYA 2JKTM 3IBJA 3KSFA 4PKYG 3PXPA 2HGVA 1KOUA 4I39A 4HP9A 3UB6A 4CLCA 4I5SA 4F3LA 4NXBA 2J80A 2O9AA 2KDKA 2V1BA 4HJ3A 1W63M 4GHIA 4EEPA 4ETXA 4LLOB 3R7WA 1YKDA 3UE6A 4HJ6A 4LRXC 2VGLS 4WELA 4BMWA 4B9OA 1NRJA 3E98A 3MQ0A 3HJIA 4Q0JA 2JN7A 2INWA 5HPIA 3A0VA 2VJWA 3EGDC 4HJ4A 4QPRA 3CAXA 2ZBBA 5G4YA 2PYRA 2W3HA 4WL9A 1F9IA 3EQUA 4II7A 4AFIA 3FC7A 3K3DA 2GNXA 2XRNA 4O8GA 3EQVA 3MF0A 3R4KA 5CX7A 2QJ5A 3JVUA 1LL8A 1OT9A 3F1PA 4HP4A 4LRYC 4ARZA 3OC2A 2W3DA 4BBUA 2A24A 3KYZA 3F1NA 4XT2A 3MFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F69 A;  4MN5 A;  1TS8 A;  1TS0 A;  5HWV A;  2EA9 A;  3BY8 A;  1ODV A;  4GS9 B;  4HIA A;  1G28 A;  5AVE A;  3UB9 A;  3H7W A;  2PHY A;  3E4Q A;  1XFN A;  1DP9 A;  1XJ4 A;  2B02 A;  2QHK A;  3PYP A;  2WKP A;  1OJ5 A;  2WKR A;  3UB8 A;  4L9G A;  2K7S A;  5HWW A;  2L0W A;  5F5Y A;  3CWF A;  3VE3 A;  2D01 A;  2V1A A;  5AVF A;  3IS2 B;  3C8C A;  2VV6 A;  5EFW A;  4EW7 A;  3FG8 A;  4HH3 A;  5TBM B;  3H82 B;  3MQQ A;  3F1O B;  1XFQ A;  3ULF A;  4NXE A;  3RH8 B;  2PD8 A;  3H9W A;  3LI8 A;  1NWZ A;  3LIE A;  3SW1 A;  4HQA A;  1LSX A;  3P7N A;  5J7E A;  4R38 A;  3PHY A;  1JNU A;  5DJU A;  3D72 A;  2L1M A;  3A0S A;  5A8B A;  5F68 A;  3UME A;  2VV8 A;  2VEA A;  4HI4 A;  5F6A A;  1V9Z A;  3B33 A;  2WKQ A;  3VE4 A;  3MQO A;  1S4S A;  1N9O A;  4I3I A;  4WUJ A;  4R3A A;  2CMN A;  1OTD A;  4LPZ A;  1UGU A;  3BY9 A;  3GDI A;  1D06 A;  1Y28 A;  3NOP C;  2Z6D A;  2A24 B;  4XT2 B;  1GSV A;  1T1A A;  2VLG A;  4YWZ A;  2P7J A;  2V9A A;  1WA9 A;  3NHQ A;  4MN6 A;  1LT0 A;  3LYX A;  2OWJ A;  4L9F A;  2I9V A;  5HDS A;  5I5L A;  1GSX A;  1UWP X;  3IBR A;  2L4R A;  4HHD A;  3UB7 A;  3H7W B;  5DJT A;  2JHE A;  4JGP A;  2ZOH A;  2V0U A;  1T19 A;  3NJA A;  5HD3 A;  2QWS A;  2YKF A;  4BBV A;  2ZOI A;  1S1Z A;  1XJ3 A;  3ZQ5 A;  1DP6 A;  5HWT A;  2PR6 A;  5IS1 A;  2HV1 A;  2PDR A;  3EEH A;  5HSQ A;  4R70 A;  2H28 A;  4BBT A;  1S67 L;  1LSV A;  3LIF A;  5HD5 A;  5IU1 A;  3UMD A;  1D7E A;  3VOL A;  3NOT C;  1OTB A;  1P97 A;  4EES A;  4JGR A;  3E4P A;  3OLO A;  4I3J A;  4WF0 A;  1V9Y A;  4NXF A;  4DJ2 A;  2QKP A;  4H6J A;  2YKH A;  2M1C A;  3MXQ A;  3EWK A;  3LUQ A;  2PD7 A;  5G4Z A;  4EET B;  5J3W A;  4R6L A;  4F3L B;  4WLA A;  2OOL A;  4K08 A;  4GHI B;  2PR5 A;  2QJ7 A;  3LIA A;  4KQD A;  3T50 A;  5DKK A;  3H82 A;  3HJK A;  2V0W A;  1VB6 A;  1T1C A;  1LSW A;  2W27 A;  3CLO A;  1TS6 A;  1S1Y A;  2Z6C A;  1OJG A;  3BWL A;  2VV7 A;  1DRM A;  3F1P B;  1T1B A;  3KX0 X;  3MR0 A;  1S66 L;  1T18 A;  3LID A;  1XJ6 A;  3F1N B;  4EER A;  1S4R A;  2R78 A;  4KUO A;  2D02 A;  1F98 A;  4LRZ E;  3MJQ A;  2OWH A;  4KUK A;  3G6O A;  4EQ1 A;  1P0Z A;  4PKY A;  1BYW A;  2PYP A;  4M4X A;  4RQ9 A;  4NXG A;  1N9L A;  1X0O A;  4WN5 A;  3LI9 A;  3LIB A;  4HY8 A;  1EW0 A;  1OTI A;  3GEC A;  5KIZ A;  1OTA A;  4JGQ A;  5DKL A;  1DP8 A;  2GJ3 A;  4JGO A;  4H6J B;  4E04 A;  2W0N A;  3K3C A;  4GS9 A;  5HDD A;  4L9E A;  3A0R A;  4HNB A;  4EXO A;  2BAS A;  2KX6 A;  5J4E A;  1UWN X;  4HOI A;  1XJ2 A;  4GW9 A;  4I38 A;  3C2W A;  3E4O A;  4I3A A;  5HDC A;  4EEU A;  4HH2 A;  1TS7 A;  3NOU C;  1MZU A;  3IS2 A;  3LIC A;  4DJ3 A;  1GSW A;  1OT6 A;  5TBM A;  3RTY A;  3ICY A;  3F1O A;  1OTE A;  4GCZ A;  1N9N A;  5HZH A;  4PKY G;  1KOU A;  4I39 A;  4HP9 A;  3UB6 A;  4I5S A;  4F3L A;  4NXB A;  2J80 A;  2KDK A;  2V1B A;  4HJ3 A;  4GHI A;  4EEP A;  4LLO B;  3UE6 A;  4HJ6 A;  4LRX C;  4B9O A;  3HJI A;  2JN7 A;  2INW A;  3A0V A;  4HJ4 A;  3CAX A;  2ZBB A;  5G4Y A;  2PYR A;  4WL9 A;  1F9I A;  3FC7 A;  3K3D A;  2QJ5 A;  1LL8 A;  1OT9 A;  3F1P A;  4HP4 A;  4LRY C;  4BBU A;  2A24 A;  3F1N A;  4XT2 A;  3MFX A; 
#chains in the Genus database with same CATH topology
 4CPK A;  4WEJ A;  3V67 A;  5F69 A;  1XGJ A;  3VSL A;  3ZG0 A;  2Y2M A;  3ITA A;  4E3J A;  1RCJ A;  3DTM A;  4PM5 A;  4UQI S;  3PBS A;  2EA9 A;  4FSF A;  4GS9 B;  1I2W A;  5AVE A;  1MY8 A;  5DTS A;  2Y2P A;  2PHY A;  1XFN A;  1E4D A;  1DP9 A;  3FPV A;  4ME4 A;  2WKP A;  5FQM A;  1O07 A;  1OJ5 A;  4L0L A;  3S22 A;  3P01 A;  2K7S A;  3CIT A;  2L0W A;  1K54 A;  4O0P A;  4DKI A;  1XA1 A;  2OLV A;  3S7P A;  4JLF A;  3C8C A;  2VV6 A;  5FQI A;  1F5M A;  5EFW A;  3FKV A;  4HH3 A;  2V2F F;  5FAT A;  1FIL A;  1MPL A;  2A3U A;  1G6A A;  4IBX A;  3ULF A;  3ZFZ A;  1PWD A;  2WGW A;  3UE3 A;  2WAD A;  2EXA A;  3NUL A;  3RH8 B;  2PD8 A;  1TD5 A;  3CPT B;  1ZKJ A;  1YLY A;  5GHY A;  3T1R A;  4YIN A;  4GN2 A;  3LCE A;  1JNU A;  3D72 A;  4R4R A;  3C4O A;  3NBL A;  4ZJ2 A;  4QY6 A;  4Y2F A;  2J3T D;  5FL3 A;  5E2F A;  1V9Z A;  3B33 A;  2XDM A;  2WKQ A;  3RFB A;  4DE1 A;  5EVI D;  2Y79 A;  1PNE A;  3M6H A;  3G2Y A;  4B4X A;  4I3I A;  3N4I A;  4LPZ A;  4EUV A;  2WGV A;  3FWL A;  5EEC A;  2Z6D A;  2B95 A;  2A24 B;  4G3K A;  1CF0 A;  4XT2 B;  4BD0 A;  2GZA A;  1K54 C;  3FKW A;  2P7J A;  2EFX A;  4MN6 A;  3LYX A;  1JTD A;  4IVK A;  3DTE A;  1UWP X;  3IBR A;  4KZB A;  2ZQ9 A;  1K4F A;  1I5Q A;  2W3E A;  3UB7 A;  4JGP A;  3T1Q B;  3HLF A;  4MCW A;  3Q1F A;  2M7V A;  2DCF A;  3NEC A;  3MSH A;  3ZYT A;  4O7D A;  2QWS A;  4DF6 A;  2ZOI A;  3SOI A;  3ZQ5 A;  4OQG A;  3G34 A;  1DP6 A;  1K38 A;  5IS1 A;  2WZZ A;  5HSQ A;  4BBT A;  2W1T A;  1LI9 A;  3UMD A;  3VOL A;  3BLS A;  4EES A;  4PAU A;  1V9Y A;  1K55 C;  3EEA A;  2CC1 A;  3C30 A;  1YLJ A;  5TFQ A;  4JXG A;  3T4O A;  4H6J A;  4CLC E;  4OP8 A;  4JF5 A;  2PU4 A;  1STZ A;  1DJB A;  2XR0 A;  1J9M A;  2PD7 A;  5EM0 A;  3DBA A;  4DMZ A;  2ZD8 A;  4R6L A;  2Q9N A;  4OOY A;  5CEC A;  3LR5 A;  4G3W A;  2Y2K A;  1FR6 A;  2HJE A;  2PR5 A;  2O0Y A;  5LBR A;  4KZA A;  3LIA A;  4KQD A;  2OV5 A;  4E3L A;  3BQ8 A;  2HF6 A;  3G31 A;  5F82 A;  3BFG A;  1IFQ A;  2WKH A;  2GDN A;  2V8C A;  1AXB A;  3T4K A;  3N6I A;  5M18 A;  2EX8 A;  1VB6 A;  2JKF A;  5HAP A;  4OPR A;  3S4X A;  1PW8 A;  1PW1 A;  3EOI A;  1SZV A;  1P9W A;  4QD4 A;  3CLO A;  1G6O A;  3SS5 A;  2KOI A;  3PBO A;  4M3K A;  1SCW A;  3BWL A;  3BYD A;  1DRM A;  3F1P B;  1FR1 A;  3KX0 X;  3MR0 A;  3ZG7 B;  2A2L A;  3VFH A;  4NET A;  3W8K A;  1XJ6 A;  4QJG A;  4ZRR A;  1KE4 A;  2AVX A;  5F83 A;  5FQK A;  1F98 A;  4UEY A;  4KUK A;  3G6O A;  4EQ1 A;  2VGL M;  4Y13 A;  2ZC6 B;  3T4L A;  4M4X A;  2OAQ 1;  3V50 A;  1YM1 A;  1FCO A;  4NXG A;  5FI6 A;  1X0O A;  4JXW A;  4WN5 A;  1H0M A;  2UV0 E;  4C6Y A;  3ZDJ A;  4N9K A;  1AWI A;  3PBT A;  1YPR A;  1DP8 A;  1Z09 A;  2Y2H A;  5GL9 A;  2GJ3 A;  3HLC A;  4GDB A;  3T1S A;  3HBR A;  4E04 A;  2W0N A;  4L9E A;  1PWC A;  1YLZ A;  5L10 A;  2BAS A;  2KX6 A;  4KQQ A;  1XJ2 A;  4C75 A;  1YLP A;  4Y0O A;  2PU2 A;  3CG5 A;  1A0K A;  4DN0 A;  1S6R A;  4EBL A;  1K56 D;  2XQZ A;  5EPH A;  2IWC A;  3LIC A;  3MMH A;  3JPU A;  3T4S A;  1OPX A;  4B4Z A;  5EOE A;  2XA7 S;  3ICY A;  4S2I A;  1ALQ A;  5HPF A;  1IEM A;  3NCK A;  5A92 A;  1N9N A;  3BRM A;  3DTI A;  5DFY A;  3A3F A;  4GB7 A;  1GHP A;  3RJU A;  4UHU A;  5EOO A;  1BLS A;  4E6W A;  3PXP A;  4CLC A;  4I39 A;  3QP6 A;  1TDG A;  5FAO A;  4S2K A;  4JPM A;  1KDS A;  1Q2Q A;  5D3O A;  4LLO B;  1PWG A;  2XD5 A;  4HJ6 A;  4F94 A;  5CED A;  1ESU A;  5CHM A;  4DDY A;  3PAG A;  4Q0J A;  3IWI A;  2JN7 A;  3P98 A;  2INW A;  5L09 A;  3A0V A;  4QPR A;  3EGD C;  1E3U A;  5JYP A;  3CAX A;  1DY6 A;  4RX3 A;  3LO7 A;  1KDW A;  5G4Y A;  1Q2P A;  3GV9 A;  2HPB A;  4WZ5 A;  3FC7 A;  2GNX A;  3JYI A;  1LLB A;  3UN7 A;  3VP3 A;  3UB5 P;  4O8G A;  3EQV A;  5E2E A;  5CX7 A;  3R4K A;  2QJ5 A;  1LL8 A;  1OT9 A;  5FQQ A;  4JXV A;  2A49 A;  4HP4 A;  4DXB A;  3OC2 A;  3IHB A;  2RCX A;  4BBU A;  4QWO A;  3GQZ A;  2BG1 A;  4OQI A;  2JKR I;  2EXB A;  3B42 A;  1TS0 A;  5HWV A;  3HLD A;  1XGI A;  3BY8 A;  1ODV A;  2H0Y A;  4HES A;  2WAF A;  4BWI A;  1NLZ A;  3AGF A;  3H7W A;  3WRZ A;  3P09 A;  4PHT A;  3E4Q A;  3G4P A;  1BUL A;  2B02 A;  4WM9 A;  3PYP A;  1H8Z A;  2W3F A;  3IWQ A;  3QP1 A;  4EV4 A;  1JWP A;  2G2W A;  1NJ4 A;  1KVM A;  4CLC C;  4ID4 A;  4PM8 A;  3UB8 A;  3IX3 A;  4L9G A;  4BLM A;  1FSY A;  2H0T A;  3CWF A;  4Y17 A;  5F5Y A;  2V1A A;  5E43 A;  4GLQ A;  1KVL A;  5AVF A;  3UPN A;  3T4T A;  2Y55 A;  1KE3 A;  4EW7 A;  1EWZ A;  5G18 A;  5TBM B;  3FV7 A;  3F1O B;  1CQA A;  2Y2J A;  4WYY A;  1XFQ A;  4WZ5 C;  4R3B A;  4FD8 A;  3H9W A;  1SDE A;  3BJN A;  2ZQ8 A;  2I72 A;  4OKP A;  5FA7 A;  1NLY A;  1VET A;  3P7N A;  2C5W B;  3UO9 A;  4IVI A;  2HDQ A;  1MWU A;  1NZO A;  5HAI A;  5DJU A;  4E3M A;  2ZC5 B;  3A0S A;  4WMC A;  5A8B A;  4MMN A;  3FZC A;  4KZ9 A;  2XD1 A;  3MBZ A;  1C3B A;  5FEG A;  4BEN A;  2WKI A;  1ZC2 A;  3ZG8 B;  2ZM8 A;  4U3T A;  4WUJ A;  3OPP A;  4IUK A;  3MZD A;  4S2N A;  4EQI A;  1LL5 A;  3GDI A;  4RVA A;  5GLB A;  1D06 A;  3NOP C;  1OME A;  4G3V A;  4DRT A;  3L9K A;  3A3J A;  1BLH A;  1K25 A;  1DJC A;  1KGE A;  2VLG A;  1WA9 A;  3M6B A;  1SKO B;  2PRF A;  2OWJ A;  4L9F A;  4NK3 A;  4LGW A;  5HDS A;  1H8M A;  3C4P A;  3QHY A;  4HHD A;  4Y15 A;  1YAX A;  1VHM A;  5DJT A;  4Y0U A;  2DMW A;  2ZQA A;  4E3N A;  1T19 A;  3NJA A;  1SDN A;  1ONG A;  2K2N A;  3OPR A;  2YKF A;  3RXW A;  1S1Z A;  2HDR A;  4OQH A;  2PR6 A;  5HWT A;  2HV1 A;  4R70 A;  3LIF A;  1I2S A;  1IOU A;  1MWS A;  5HD5 A;  3G35 A;  2XFT A;  2C6W B;  1NY0 A;  2XRO A;  3E4P A;  4JGR A;  4LEN A;  5KSC A;  2DNS A;  4DJ2 A;  3PBR A;  4LV3 A;  4QY5 A;  2WGW B;  3JVV A;  2JCH A;  2PAV P;  1ZHH B;  3OPL A;  1K57 A;  1K4E A;  5FQ9 A;  4WEK A;  4EUZ A;  4YOF A;  4S2N C;  5M19 A;  2IWB A;  4EET B;  5J3W A;  1CJF A;  4GHI B;  5KMW A;  4EBP A;  3M2J A;  3R7W B;  2B18 A;  4FCF A;  2R9W A;  4GZB A;  3FPW A;  5EUA A;  3GSG A;  3ISG A;  2J9O A;  3HJK A;  3LEZ A;  2OLU A;  4UA7 A;  1MBL A;  4EWF A;  4DE0 A;  3CPT A;  2W27 A;  4DE3 A;  1BSG A;  5A90 A;  2Z6C A;  1OJG A;  4JXS A;  4ARZ B;  1L0F A;  2XF3 A;  4KZ8 A;  3NDE A;  3ZVT A;  3F1N B;  3HLB A;  3QNC A;  3HLE A;  5CER A;  5CXW A;  1S4R A;  3C7U A;  1ES4 A;  1FOF A;  2D02 A;  4LRZ E;  3O3V A;  3O5Y A;  1XKZ A;  1RGY A;  5DF9 A;  1GA9 A;  2X01 A;  1P0Z A;  1HD8 A;  1W8Q A;  1BYW A;  3HLW A;  3HLG A;  3TRC A;  2Y8H A;  4FOF A;  2KLI A;  3Q7V B;  1YQS A;  1N9L A;  2P04 A;  3Q7Z A;  3TW8 A;  4BQM A;  4HBU A;  1NZU A;  3N8S A;  1YLW A;  2IA2 A;  1OTI A;  2Q9M A;  3GEC A;  3MKF A;  4R3J A;  1OTA A;  3VP1 A;  2M7U A;  3WS5 A;  4X1L A;  4IBR A;  1P9R A;  5DKL A;  2P74 A;  3DTK A;  2FZ0 A;  3LGO A;  4JGO A;  3ZVW A;  1W63 Q;  4H6J B;  2JKR M;  3K3C A;  2Z2M B;  3U2A A;  4MBK A;  3UPP A;  1JWZ A;  4KG2 A;  3OCN A;  4EXO A;  3OOV A;  1UWN X;  3B47 A;  4GW9 A;  1ES2 A;  2J7V A;  4S2O A;  4E6X A;  3C2W A;  5GHZ A;  3E4O A;  1VQQ A;  2ZQD A;  5DFX A;  4Y7P A;  1MZU A;  3IS2 A;  3O87 A;  5K5B A;  3NY4 A;  1L0E A;  1GSW A;  1OT6 A;  4ESP A;  4RX2 A;  2J3W A;  1MKI A;  5HZH A;  4FH2 A;  1BLC A;  3IBJ A;  4K0W A;  4PKY G;  2P9V A;  3BFF A;  2HGV A;  4HP9 A;  2J80 A;  2KDK A;  1W63 M;  4U0T A;  4EEP A;  2ZL1 A;  5DTK A;  4LRX C;  4WEL A;  2VGL S;  4BMW A;  1NRJ A;  1IYP A;  3MQ0 A;  3HJI A;  2QMI A;  3V3S A;  4HJ4 A;  4KZ5 A;  2W3H A;  1SHV A;  1PFL A;  4II7 A;  1WYB A;  2HP6 A;  4P85 A;  2EX2 A;  1Y54 A;  1ZG6 A;  3F1P A;  1Z6F A;  4DDS A;  1BZA A;  5CEB A;  1VEU B;  1FQG A;  1ZG4 A;  2B5R A;  3KSG A;  4R4S A;  4MN5 A;  2K31 A;  5L8M A;  3IXB A;  2JE5 A;  1TS8 A;  1U60 A;  3V5M A;  4P6B A;  2O9B A;  3W2Z A;  1G28 A;  3ZNT A;  1PIO A;  3UDI A;  5AQA A;  1XJ4 A;  3IQA A;  2QHK A;  2ZMV A;  3CUE A;  2LB5 A;  5GLC A;  3Q07 A;  5CGS A;  4BL3 A;  3WS0 A;  3BW6 A;  3KYQ A;  4P0M A;  4Q0H A;  3VE3 A;  3IX8 A;  3CZD A;  1GHI A;  3VP4 A;  5HAR A;  4GJ4 A;  4CJN A;  3C5A A;  2JKT I;  3BFC A;  2XLN A;  1ONH A;  3H82 B;  2LB9 A;  3BM6 A;  3D4F A;  5JYO A;  5HX9 A;  3SZT A;  4NXE A;  5CHU A;  3CMZ A;  5KZH A;  3PR6 A;  4GOG A;  3EGX C;  4C3Q A;  3LI8 A;  4CLC B;  4ETZ A;  1N9B A;  4KQR A;  3SW1 A;  3ITB A;  1PRQ A;  1LSX A;  5J7E A;  2NUT C;  1D1J A;  1BLP A;  3BQA A;  3DW0 A;  2VV8 A;  2WK0 A;  3LY4 A;  2H5S A;  1K6S A;  3TSG A;  2VK3 A;  3TJZ C;  5FSR A;  3VE4 A;  1W8Y A;  3MQO A;  3W4Q A;  4U0X A;  1S4S A;  3IT9 A;  2JKG A;  1N9O A;  3D3O A;  4R3A A;  4S2L A;  2CMN A;  1OTD A;  5EM1 A;  1UGU A;  5F1G A;  3BY9 A;  3DAV A;  2ACG A;  3VOZ A;  4N1H A;  1ES3 A;  1Y28 A;  1H8Y A;  3MZE A;  2VX8 A;  4P6Z S;  1GSV A;  3Q82 A;  2XFS A;  4YWZ A;  3VSK A;  4OQ0 A;  3C7V A;  3NHQ A;  4MNR A;  5L2F A;  2HZ5 A;  1LL9 A;  3IF6 B;  2I9V A;  5M1A A;  5I5L A;  5BOH A;  3H7W B;  1JVJ A;  3OPH A;  1XXM A;  2V0U A;  4PM6 A;  3O88 A;  1JTG A;  3N8R A;  2ZLY A;  2R9X A;  3MKE A;  2PDR A;  2H28 A;  4MLL A;  1S67 L;  1VM1 A;  1LSV A;  5EVI A;  2VZW A;  1D7E A;  3OZH A;  1PZO A;  3NOT C;  1PYY A;  1NYY A;  4I3J A;  3SS4 A;  3GMW A;  1XPB A;  4NXF A;  2QYB A;  3SH8 A;  1KGF A;  2QKP A;  2YKH A;  4MBH A;  2M1C A;  4OPQ A;  4KZ7 A;  4JF4 A;  4X53 A;  5AJG A;  3PBN A;  3MXQ A;  3LUQ A;  3KO6 A;  3GRJ A;  1VET B;  5HW3 A;  2HDU A;  2Y2L A;  3PTE A;  2BLS A;  4E3O A;  4P87 A;  4F3L B;  5CGW A;  2OOL A;  4YNR A;  3IH8 A;  4FH4 A;  3CHW P;  5CGX A;  3ZGA B;  2WKE A;  2QJ7 A;  3T50 A;  2OAP 1;  4A5R A;  2W3G A;  4S2P A;  2V0W A;  5GLD A;  4WBG A;  3I7J A;  5EV0 A;  4ZAM A;  4OP5 A;  1K6R A;  1GHM A;  1CEG A;  1T1C A;  5FDS A;  1L0D A;  4D2O A;  1TF1 A;  1TS6 A;  1S1Y A;  1CK3 A;  2PBY A;  3M2K A;  3V39 A;  2Y2Q A;  4EBN A;  3LFV A;  2Y2N A;  4LFU A;  2VV7 A;  2J3T C;  1T1B A;  3HUM A;  1E25 A;  4GD6 A;  3S1Y A;  1S66 L;  4IJG A;  1T18 A;  3LID A;  4XXR A;  4ZTK A;  1BUE A;  4CQH A;  2WUQ A;  4Q0I A;  3CI6 A;  4EER A;  5EVI C;  4KUO A;  1DJA A;  3UDF A;  3GR2 A;  4OLG A;  4R0Q A;  3MJQ A;  3U4L P;  2OWH A;  3DWK A;  5FDH A;  1ERM A;  1TVF A;  4LCL A;  3SH9 A;  1PI5 A;  1YSP A;  3TE8 A;  4RQ9 A;  2ZMA A;  3KSH A;  1CEF A;  4NKP A;  2VGJ A;  5E2H A;  4O01 A;  3LI9 A;  4LV0 A;  1EW0 A;  3V3R A;  4Z1W A;  5U47 A;  4MN7 A;  3T1X A;  5HL6 A;  5KIZ A;  1MXO A;  5IHV A;  4CLC D;  3G30 A;  2HP9 A;  1SKO A;  2EFU A;  3WRT A;  3E0Y A;  3RXX A;  1YSQ A;  1WYC A;  5A93 A;  2XGN A;  1E3U D;  2PT7 A;  4UA6 A;  4GS9 A;  5E2G A;  3A0R A;  1HZO A;  2ZJ9 A;  3UDX A;  4HNB A;  4UQI M;  4KQO A;  1M6K A;  1G5U A;  3IF5 A;  4S2M A;  2ZC3 B;  4H8R A;  1FCM A;  4I38 A;  3G2Z A;  4I3A A;  1G68 A;  1PI4 A;  2O99 A;  4RYE A;  4EEU A;  4HH2 A;  3NOU C;  2V8F A;  1QME A;  1MC0 A;  2VKS A;  1FCN A;  2G7U A;  1MKM A;  1YLT A;  2EX6 A;  1KE0 A;  3RTY A;  1HVB A;  2VGK A;  5HFO A;  5CTM A;  1OTE A;  4FTX A;  4GCZ A;  3UNW A;  5GHX A;  2JKT M;  2X02 A;  3BEB A;  4BL2 A;  4RA7 A;  4Z9Q A;  1NYM A;  1KOU A;  3UB6 A;  3UE1 A;  2G2U A;  5L07 A;  4GHI A;  1IEL A;  3FYZ A;  1SKF A;  3R7W A;  3UE6 A;  1K55 A;  2WZX A;  4B9O A;  4X55 A;  3E98 A;  4QB8 A;  5DTT A;  3NC8 A;  5HPI A;  2VJW A;  2ZM0 A;  2ZBB A;  4KZ4 A;  3HVF A;  1XA7 A;  1QMF A;  2Y4A A;  1M40 A;  4JF6 A;  3QP4 A;  4WL9 A;  3MS6 A;  4PM9 A;  1F9I A;  3EQU A;  3MFD A;  4AFI A;  2XRN A;  5AQ9 A;  1ERO A;  3JVU A;  1LI0 A;  1K56 A;  2FFY A;  3IWO A;  4LRY C;  1JWV A;  4ARZ A;  1K57 C;  2W3D A;  4K0X A;  2A24 A;  2J8Y A;  4KEN B;  3F1N A;  3BLM A;  4XT2 A;  3TOI A;  4KZ6 A;  3MFX A;  1HLU P;  4BD1 A;  5A91 A;  2W1T B;  3VP0 A;  2Q0O A;  2EWW A;  3ZCZ A;  5HAQ A;  4WMC D;  5FQJ A;  2W1R A;  1KGG A;  2XH9 A;  5I94 A;  2WAE A;  2QPN A;  4GD8 A;  2HP5 A;  5F1F A;  4HEF A;  4HIA A;  2JBF A;  3UB9 A;  2ZMF A;  3Q7V A;  3HRE A;  3B3X A;  3S7N A;  1XP4 A;  1TDL A;  2Y2O A;  4X6T A;  2XSS A;  3LR0 A;  3A3E A;  2WYX A;  2WKR A;  5CRF A;  4HBT A;  2O9C A;  3NI9 A;  5FAS A;  1H5X A;  3HL9 A;  2QZ6 A;  5HWW A;  1N4O A;  1GCE A;  5C5K A;  5TGF A;  2D01 A;  4NG2 A;  1NRF A;  5AQB A;  3IS2 B;  3FG8 A;  4NEE D;  5J8X A;  4MDZ A;  3IX4 A;  3MQQ A;  3IH9 A;  1O7E A;  3QP5 A;  3E2L A;  4QHC A;  3UE0 A;  3A3D A;  2Y91 A;  2P9V B;  4LV2 A;  1NWZ A;  3LIE A;  4HQA A;  2PBD P;  3T12 B;  5MC7 A;  2ZL1 B;  4R38 A;  3D9Y A;  1L3L A;  3PHY A;  2L1M A;  4IUH A;  4D60 A;  5F68 A;  3UME A;  4Y3I A;  5AQ7 A;  2VEA A;  4HI4 A;  5F6A A;  5CTN A;  4N92 A;  3ZHH A;  3DWZ A;  5DF7 A;  4OON A;  3T4Q A;  2NUP C;  4OOL A;  3OCL A;  2ZC7 A;  4X69 A;  1XX2 A;  5FEF A;  4K91 A;  1NXY A;  4X1M A;  3VV4 A;  4GNU A;  4OLD A;  3KYE A;  1CI9 A;  5TR7 A;  3WS1 A;  2E8J A;  1T1A A;  3A3I A;  5IT5 A;  1ESI A;  2V9A A;  3N7W A;  1IYS A;  1YT4 A;  1WE4 A;  1LT0 A;  4WZ4 A;  3LR4 A;  1GSX A;  3LR3 A;  1S0W A;  2L4R A;  1J3W A;  5EVL A;  2EX9 A;  4UAA A;  1BTL A;  2E8I A;  2X71 A;  2JHE A;  3W4P A;  2ZOH A;  2FH5 A;  3MXR A;  4Q8I A;  2P08 A;  5HD3 A;  4BBV A;  5FI7 A;  3IHA A;  1XJ3 A;  3QP2 A;  3K2N A;  1VEU A;  3PAE A;  2RL3 A;  3VFF A;  1ACF A;  3EEH A;  3LEQ A;  5TJJ A;  3S7O A;  5IU1 A;  3AGD A;  1F2K A;  4FUW A;  1FSW A;  1OTB A;  1P97 A;  3Q81 A;  4WF0 A;  3OLO A;  3TG9 A;  1FIK A;  3C38 A;  3O86 A;  4Y5F A;  4OVD A;  3SS3 A;  3EWK A;  2Y2I A;  5G4Z A;  2GX5 A;  4QU3 A;  5CHJ A;  4WLA A;  4K08 A;  1PZP A;  1MWT A;  4DE2 A;  3W4O A;  4IHQ A;  1ZTU A;  1L2S A;  4MEZ A;  5FAP A;  5DKK A;  3H82 A;  3IXG A;  3BEC A;  4JBF A;  3VMA A;  1IKG A;  3E2K A;  4XUZ A;  3QP8 A;  1LSW A;  3ZNY A;  5GLA A;  4MBF A;  3WS4 A;  3GTC A;  2FFF B;  3OBF A;  1W79 A;  3WS2 A;  3MZF A;  2XA7 M;  4OH0 A;  4OPY A;  3UY6 A;  2EWV A;  4DXC A;  2ZC4 B;  3HCY A;  3CUE C;  3QNB A;  3T4J A;  3PBQ A;  4JKT A;  2J9P A;  3VP2 A;  1YMS A;  1H3Q A;  1ES5 A;  2R78 A;  2BTF P;  1EI5 A;  2Y2G A;  4KZ3 A;  5DF8 A;  1IKI A;  4ZJ1 A;  4PKY A;  2PYP A;  3KSI A;  1W5D A;  1IYQ A;  4EU0 A;  4ZBE A;  4E3I A;  4HY8 A;  3LIB A;  4BJP A;  1RP5 A;  4S2J A;  4ZJ3 A;  1HTZ A;  3LY3 A;  2Z2L B;  2ZM2 A;  5EVI B;  4PMA A;  5FI2 A;  4OOM A;  4JGQ A;  5KSH A;  3GVB A;  2DRW A;  4P6Z M;  3IF6 A;  4XUX A;  3HUN A;  1BT5 A;  4UA9 A;  3VOY A;  2ZQ7 A;  4LCM A;  2ZQC A;  3IXH A;  4X56 A;  2VA0 A;  3CJM A;  1Y4O A;  3WWX A;  5FAQ A;  1W7F A;  4N1X A;  1K0K A;  4X68 A;  1ERQ A;  5HDD A;  1RGZ A;  2UWX A;  2WGI A;  3S7Q A;  5J4E A;  4HOI A;  3UPO A;  4KG6 A;  4R1G A;  2HJ9 C;  1TEM A;  2XEP A;  5HDC A;  5HL1 A;  3ZG9 B;  1TS7 A;  2V1Z A;  4N9L A;  5EE8 A;  5EVE A;  3NDG A;  4GKU A;  2MJ6 A;  4B93 A;  4DJ3 A;  5TBM A;  2V20 A;  4B88 A;  2OSU A;  3F1O A;  3N8L A;  1YMX A;  2HDS A;  3KSF A;  4E3K A;  1GA0 A;  4IED A;  3AGE A;  4I5S A;  4F3L A;  2IWD A;  4NXB A;  2O9A A;  2V1B A;  4HJ3 A;  4KG5 A;  1IYO A;  2XK1 A;  4ETX A;  4GDN A;  3BFE A;  4R23 A;  3BFD A;  3IXD A;  1YKD A;  4PPR A;  3SH7 A;  3NIA A;  1CI8 A;  4PM7 A;  2JC7 A;  3L7H A;  4LV1 A;  4OPZ A;  4ZDX A;  2PYR A;  3IF6 C;  4YFM A;  1L0G A;  3K3D A;  3ZG5 A;  3G32 A;  2Y59 A;  4Y0T A;  1LHY A;  3MF0 A;  1MWR A;  3MXS A;  4X25 A;  3KYZ A;  2H10 A;  3HUO A;  5DVA A; 
#chains in the Genus database with same CATH homology
 4WEJ A;  3V67 A;  5F69 A;  3KSG A;  2W1T B;  2JKR I;  4MN5 A;  2K31 A;  3B42 A;  5L8M A;  1TS8 A;  2EWW A;  1TS0 A;  2W1R A;  4UQI S;  5HWV A;  3PBS A;  2EA9 A;  3BY8 A;  2O9B A;  1ODV A;  4FSF A;  4GS9 B;  3W2Z A;  4HIA A;  4BWI A;  1G28 A;  1NLZ A;  5AVE A;  3UB9 A;  2ZMF A;  3H7W A;  2PHY A;  4PHT A;  3E4Q A;  3S7N A;  1XFN A;  1DP9 A;  3FPV A;  4ME4 A;  1XJ4 A;  2B02 A;  2QHK A;  3PYP A;  2ZMV A;  2WKP A;  2W3F A;  3CUE A;  2XSS A;  3LR0 A;  2LB5 A;  1OJ5 A;  4L0L A;  2WKR A;  4CLC C;  2O9C A;  3P01 A;  3UB8 A;  3BW6 A;  4L9G A;  3KYQ A;  2K7S A;  3CIT A;  5HWW A;  2L0W A;  4Q0H A;  3CWF A;  5F5Y A;  3VE3 A;  4O0P A;  5C5K A;  2D01 A;  2V1A A;  4GLQ A;  4GJ4 A;  5AVF A;  3IS2 B;  3S7P A;  3C8C A;  2VV6 A;  3T4T A;  1F5M A;  5EFW A;  4EW7 A;  2JKT I;  3FG8 A;  4HH3 A;  5TBM B;  4NEE D;  3H82 B;  4MDZ A;  3MQQ A;  3F1O B;  2LB9 A;  1XFQ A;  3ULF A;  4NXE A;  3UE3 A;  3PR6 A;  3RH8 B;  2PD8 A;  3EGX C;  3H9W A;  1TD5 A;  3BJN A;  3LI8 A;  4CLC B;  1NWZ A;  4ETZ A;  3LIE A;  3SW1 A;  4HQA A;  1LSX A;  1NLY A;  3P7N A;  5J7E A;  2NUT C;  5MC7 A;  4R38 A;  3PHY A;  1JNU A;  5DJU A;  3D72 A;  3BQA A;  2L1M A;  4IUH A;  3A0S A;  5A8B A;  5F68 A;  3UME A;  4Y3I A;  2VV8 A;  4Y2F A;  2J3T D;  2VEA A;  5FL3 A;  4HI4 A;  5F6A A;  1V9Z A;  4MMN A;  3B33 A;  2WKQ A;  3TJZ C;  3VE4 A;  3RFB A;  3T4Q A;  3MQO A;  4OOL A;  2NUP C;  3OCL A;  2Y79 A;  1S4S A;  1N9O A;  3D3O A;  4I3I A;  4WUJ A;  4R3A A;  2CMN A;  4IUK A;  1OTD A;  4LPZ A;  1UGU A;  3BY9 A;  4EUV A;  3GDI A;  1D06 A;  1Y28 A;  3NOP C;  4G3V A;  2Z6D A;  3VV4 A;  2A24 B;  4G3K A;  2VX8 A;  4P6Z S;  4XT2 B;  1GSV A;  2GZA A;  1T1A A;  2VLG A;  5IT5 A;  4YWZ A;  2P7J A;  2V9A A;  1WA9 A;  3NHQ A;  4MN6 A;  1LT0 A;  3LYX A;  2OWJ A;  4L9F A;  2I9V A;  3LR4 A;  5HDS A;  5I5L A;  1GSX A;  1H8M A;  1UWP X;  3LR3 A;  3IBR A;  2L4R A;  4HHD A;  1YAX A;  2W3E A;  3UB7 A;  3H7W B;  1VHM A;  5DJT A;  2JHE A;  4JGP A;  2DMW A;  2ZOH A;  2FH5 A;  1T19 A;  2V0U A;  4MCW A;  2M7V A;  3NJA A;  2P08 A;  5HD3 A;  2K2N A;  3ZYT A;  2QWS A;  2YKF A;  4BBV A;  2ZOI A;  1S1Z A;  1XJ3 A;  3ZQ5 A;  3K2N A;  1DP6 A;  2PR6 A;  5HWT A;  5IS1 A;  2HV1 A;  2PDR A;  3EEH A;  5HSQ A;  4R70 A;  2H28 A;  4BBT A;  1S67 L;  2W1T A;  1LSV A;  3LIF A;  5TJJ A;  1IOU A;  3S7O A;  5HD5 A;  5IU1 A;  3UMD A;  2VZW A;  1D7E A;  3VOL A;  3NOT C;  1OTB A;  1P97 A;  4EES A;  2XRO A;  3E4P A;  3OLO A;  4I3J A;  4JGR A;  4WF0 A;  4PAU A;  1V9Y A;  3EEA A;  3C38 A;  4Y5F A;  4NXF A;  3C30 A;  2QYB A;  4DJ2 A;  3PBR A;  2QKP A;  3T4O A;  4H6J A;  2YKH A;  3JVV A;  2M1C A;  1ZHH B;  4CLC E;  5AJG A;  3PBN A;  1STZ A;  3MXQ A;  4WEK A;  3EWK A;  3LUQ A;  3KO6 A;  2PD7 A;  4YOF A;  5G4Z A;  3DBA A;  2GX5 A;  4EET B;  5J3W A;  4DMZ A;  4R6L A;  4F3L B;  3LR5 A;  4WLA A;  2OOL A;  4G3W A;  4K08 A;  4GHI B;  4YNR A;  2HJE A;  2PR5 A;  2O0Y A;  2QJ7 A;  5LBR A;  3R7W B;  3LIA A;  2B18 A;  4KQD A;  4IHQ A;  2OAP 1;  3T50 A;  3BQ8 A;  1ZTU A;  2HF6 A;  5DKK A;  2W3G A;  3FPW A;  3H82 A;  1IFQ A;  3HJK A;  3T4K A;  2V0W A;  1VB6 A;  1T1C A;  1LSW A;  3EOI A;  1P9W A;  2W27 A;  3CLO A;  1G6O A;  1TF1 A;  2KOI A;  3OBF A;  1TS6 A;  3PBO A;  1S1Y A;  2Z6C A;  1OJG A;  2XA7 M;  3LFV A;  3BWL A;  2VV7 A;  1DRM A;  2J3T C;  3F1P B;  1T1B A;  2EWV A;  3KX0 X;  3MR0 A;  4ARZ B;  1S66 L;  4IJG A;  1T18 A;  2A2L A;  3LID A;  3HCY A;  3CUE C;  4CQH A;  1XJ6 A;  3F1N B;  4Q0I A;  3T4J A;  3PBQ A;  4ZRR A;  3CI6 A;  4EER A;  1H3Q A;  1S4R A;  2R78 A;  4KUO A;  2D02 A;  1F98 A;  4LRZ E;  3MJQ A;  3O5Y A;  2OWH A;  4UEY A;  4KUK A;  3G6O A;  4EQ1 A;  5DF9 A;  1P0Z A;  2VGL M;  4PKY A;  1BYW A;  3T4L A;  2PYP A;  3KSI A;  4M4X A;  2OAQ 1;  1YSP A;  4EU0 A;  3TE8 A;  4RQ9 A;  3TRC A;  3KSH A;  2Y8H A;  4NKP A;  4FOF A;  2KLI A;  4NXG A;  1N9L A;  2P04 A;  1X0O A;  4WN5 A;  4O01 A;  3LI9 A;  3LIB A;  4HY8 A;  1EW0 A;  3TW8 A;  4BJP A;  2IA2 A;  1OTI A;  4Z1W A;  3GEC A;  4MN7 A;  5HL6 A;  5KIZ A;  1OTA A;  2M7U A;  4CLC D;  3PBT A;  1P9R A;  4OOM A;  4JGQ A;  5DKL A;  5KSH A;  2FZ0 A;  4P6Z M;  1DP8 A;  3E0Y A;  2GJ3 A;  4JGO A;  1YSQ A;  2VA0 A;  1W63 Q;  4H6J B;  2JKR M;  4E04 A;  2PT7 A;  2W0N A;  3K3C A;  4GS9 A;  5HDD A;  3U2A A;  4L9E A;  3A0R A;  4HNB A;  3OCN A;  4EXO A;  4UQI M;  3OOV A;  4KQO A;  2BAS A;  2KX6 A;  3S7Q A;  5J4E A;  1UWN X;  4HOI A;  1XJ2 A;  3B47 A;  4GW9 A;  4I38 A;  3C2W A;  3E4O A;  2HJ9 C;  4I3A A;  4DN0 A;  2O99 A;  5DFX A;  5HDC A;  4EEU A;  4HH2 A;  1TS7 A;  3NOU C;  2MJ6 A;  1MZU A;  1MC0 A;  3IS2 A;  4B93 A;  2VKS A;  2G7U A;  3LIC A;  3MMH A;  5K5B A;  3T4S A;  1MKM A;  1OPX A;  4DJ3 A;  1GSW A;  1OT6 A;  5TBM A;  2XA7 S;  3ICY A;  3RTY A;  5HPF A;  3F1O A;  1OTE A;  2J3W A;  4GCZ A;  1N9N A;  5HZH A;  5DFY A;  2JKT M;  3IBJ A;  3KSF A;  4PKY G;  3PXP A;  2HGV A;  1KOU A;  4I39 A;  4HP9 A;  3UB6 A;  4CLC A;  4I5S A;  4F3L A;  4NXB A;  2J80 A;  2O9A A;  2KDK A;  2V1B A;  4HJ3 A;  1W63 M;  4GHI A;  4EEP A;  4ETX A;  4LLO B;  3R7W A;  1YKD A;  3UE6 A;  4HJ6 A;  4LRX C;  2VGL S;  4WEL A;  4BMW A;  4B9O A;  1NRJ A;  3E98 A;  3MQ0 A;  3HJI A;  4Q0J A;  2JN7 A;  2INW A;  5HPI A;  3A0V A;  2VJW A;  3EGD C;  4HJ4 A;  4QPR A;  3CAX A;  2ZBB A;  5G4Y A;  2PYR A;  2W3H A;  4WL9 A;  1F9I A;  3EQU A;  4II7 A;  4AFI A;  3FC7 A;  3K3D A;  2GNX A;  2XRN A;  4O8G A;  3EQV A;  3MF0 A;  3R4K A;  5CX7 A;  2QJ5 A;  3JVU A;  1LL8 A;  1OT9 A;  3F1P A;  4HP4 A;  4LRY C;  4ARZ A;  3OC2 A;  2W3D A;  4BBU A;  2A24 A;  3KYZ A;  3F1N A;  4XT2 A;  3MFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...