1S1YA

Photoactivated chromophore conformation in photoactive yellow protein (e46q mutant) from 10 microseconds to 3 milliseconds
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
b'MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Chromophore conformation and the evolution of tertiary structural changes in photoactive yellow protein
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photoreceptor
total genus 36
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1s1yA00
4WF0A 2QKPA 4DJ3A 5J4EA 3GDIA 1UGUA 4WLAA 5HWVA 4R38A 4XT2A 4JGRA 2ZOIA 3LIFA 5IS1A 2VEAA 4I38A 4NXFA 1D06A 4I39A 3F1OA 1S4SA 4LRZE 4HJ6A 4I3IA 1T1BA 1OT9A 4HHDA 1T1CA 4EESA 3CWFA 4HI4A 2V0WA 2PR6A 3EEHA 1EW0A 4KQDA 4WL9A 4EXOA 4I5SA 2YKFA 3PYPA 1XJ3A 4DJ2A 1OTIA 3F1PB 4H6JB 3BWLA 2WKRA 1Y28A 1P97A 3H7WB 5HSQA 1V9ZA 4GHIB 3UB7A 1BYWA 3H9WA 4GW9A 4YWZA 2J80A 5AVEA 1XFNA 3RH8B 1S1YA 3F1NA 4HQAA 3UMEA 1S66L 4LPZA 3NOUC 2B02A 3B33A 5KIZA 2CMNA 1KOUA 2H28A 4JGOA 3E4PA 1OTBA 5IU1A 3LIDA 1LSVA 1TS8A 3MFXA 4HH2A 3IBRA 4K08A 3MXQA 4HY8A 4WN5A 2HV1A 4BBUA 3A0RA 2V9AA 4HIAA 2L0WA 5G4YA 4EERA 3BY8A 5F68A 3IS2A 3MQOA 4KUOA 5I5LA 4GS9A 1LSXA 3UB9A 3VE4A 5F5YA 2D02A 1OT6A 4M4XA 2QHKA 3K3CA 4RQ9A 1WA9A 4BBVA 3P7NA 3VOLA 3NJAA 3C8CA 3H82A 2PDRA 3OLOA 5A8BA 3CAXA 1OJGA 5F69A 4BBTA 1OTEA 4EW7A 2A24B 3A0VA 4HP9A 1T1AA 2M1CA 4R3AA 5EFWA 2I9VA 3NOTC 4F3LA 1T19A 5DKKA 5DJTA 3PHYA 4B9OA 4MN6A 1TS0A 5TBMB 3F1NB 3VE3A 1F9IA 5HD3A 4GCZA 1S4RA 4EETB 1DP8A 2INWA 4PKYG 3CLOA 3EWKA 3C2WA 4PKYA 2R78A 2L4RA 1TS7A 1D7EA 4NXEA 2PYPA 3LIBA 1UWPX 2V0UA 2JHEA 4H6JA 1X0OA 3LYXA 3FG8A 4HH3A 2BASA 3LICA 3ULFA 3GECA 3UB6A 3IS2B 1N9LA 4GHIA 3LI9A 3KX0X 5DKLA 3NOPC 4EQ1A 4L9EA 5HDCA 4HP4A 4NXGA 4XT2B 2QJ5A 1DRMA 2PYRA 2K7SA 4LRYC 1GSVA 3UE6A 3RTYA 2QJ7A 1N9OA 2PR5A 3F1OB 1XFQA 2ZOHA 5DJUA 2GJ3A 2JN7A 3D72A 1OTDA 1N9NA 4L9FA 5HWTA 3K3DA 4L9GA 2PD8A 1DP9A 4HJ4A 3ICYA 4F3LB 2ZBBA 3MQQA 4R6LA 4WUJA 3ZQ5A 3MJQA 3E4OA 4JGQA 5J3WA 2WKPA 3HJIA 2OWJA 1JNUA 1XJ2A 2QWSA 2WKQA 2VLGA 1F98A 2V1AA 3SW1A 2D01A 3G6OA 3E4QA 4R70A 4LRXC 2Z6CA 2OOLA 1P0ZA 3MR0A 2KDKA 4JGPA 3UB8A 2PHYA 5J7EA 2A24A 1ODVA 4I3AA 5HWWA 4LLOB 1T18A 1VB6A 2W0NA 4HJ3A 2OWHA 1TS6A 1OTAA 3LUQA 1UWNX 3FC7A 2L1MA 2VV7A 3NHQA 1LL8A 4I3JA 1XJ6A 3F1PA 2V1BA 2P7JA 5G4ZA 1S1ZA 4EEPA 1DP6A 5TBMA 2Z6DA 5HD5A 4HNBA 3UMDA 3H7WA 5AVFA 4HOIA 5HZHA 4NXBA 4GS9B 1LSWA 3A0SA 2VV8A 3LIEA 4EEUA 2VV6A 1OJ5A 5F6AA 3LIAA 1GSXA 1S67L 2W27A 2KX6A 1MZUA 1GSWA 3H82B 3LI8A 1XJ4A 4E04A 1V9YA 2EA9A 5HDSA 1G28A 5HDDA 2PD7A 2YKHA 3BY9A 1LT0A 3T50A 1NWZA 4KUKA 4MN5A 3HJKA
chains in the Genus database with same CATH superfamily
1W63Q 3CUEC 2Y2MA 1PRQA 1K57A 5EVEA 3T4KA 5E2GA 3HLBA 5HWVA 4CLCD 4XT2A 5CHMA 4JGRA 2W3DA 2P9VA 2V8FA 3B3XA 4DE2A 4NEED 4I38A 1D06A 2PU2A 2W1TB 2HZ5A 4LRZE 3IF6A 4HJ6A 1MWUA 1OT9A 3A3EA 4B4ZA 1TD5A 2J9PA 3WS4A 2VKSA 4WELA 2XDMA 2PR6A 2ZC5B 2ZQ9A 1NLYA 1ZTUA 4EXOA 2ACGA 2JKFA 5TGFA 1TDLA 2PBDP 2YKFA 1PI5A 4Y0OA 3HL9A 4XUZA 1OTIA 3V3SA 3EGXC 3B47A 2Y2JA 1RGZA 3C5AA 4EU0A 1I2WA 1KGGA 4MBHA 1E3UA 1P97A 1NLZA 1V9ZA 2J3TC 2RCXA 4QJGA 4R3JA 1CQAA 4KG2A 4YWZA 3T4JA 4XXRA 4UA9A 1GHPA 1YLJA 1FR6A 2FZ0A 3F1NA 4HQAA 2B5RA 1EWZA 3OCLA 4OPYA 3UMEA 5C5KA 3BLMA 1TEMA 4LPZA 2G2UA 4UAAA 3NOUC 3KYQA 3B33A 3CJMA 5CEBA 4JXSA 3LIDA 3UN7A 2Q9NA 2QYBA 5GLBA 4WEJA 4K08A 3MXQA 5AJGA 2V8CA 1KGFA 4BLMA 4M3KA 2XA7S 1DJAA 4Q0JA 3BY8A 4H8RA 1ESUA 3IS2A 3MQOA 4S2JA 5I5LA 4OP8A 2JBFA 1YM1A 4FH4A 5F5YA 4GD6A 4GJ4A 4R23A 1K56A 3G4PA 4FD8A 2JKTM 3IQAA 1O7EA 1M6KA 2Z2MB 1H8ZA 3K3CA 4JPMA 1PNEA 3V39A 1WA9A 5DFYA 4OPZA 3VOLA 3VP0A 2XFTA 1DJBA 2PDRA 3OLOA 4BENA 3UO9A 5A8BA 4U0XA 1J9MA 2EXAA 1OJGA 5AQBA 3KSGA 4BBTA 1LI0A 4WMCA 5M1AA 1XPBA 2ZM0A 5FEGA 2EXBA 1BSGA 4P6ZM 5EFWA 4R3AA 2Y2QA 4X55A 1E3UD 1YLTA 3MS6A 2XR0A 1PIOA 3IXGA 4F3LA 5HARA 3HLWA 3PHYA 1SKFA 1JTGA 2VGLS 5CHUA 3EQVA 3IWQA 1O07A 5KMWA 1ACFA 3A3FA 2W1TA 3VE3A 2W3EA 1FQGA 3LEZA 4EETB 5EVIB 1E4DA 2I72A 4PKYG 5D3OA 3CHWP 4RX3A 1K6RA 1K38A 1ZKJA 5FASA 1TF1A 3O3VA 4PKYA 4MDZA 1TS7A 1D7EA 5M19A 4Y3IA 4GD8A 3PBSA 1L3LA 1NYMA 3LYXA 3MZFA 5FQMA 3ULFA 3GECA 3UB6A 3QP4A 3N8RA 5DTTA 1ES4A 1K54A 3W4OA 5DKLA 4MBKA 2WADA 1K56D 4L9EA 2H0TA 3ISGA 3DTIA 3S22A 1YLPA 2H10A 1K4FA 2BLSA 3NDGA 3T4QA 2PYRA 3HUOA 1VHMA 3UPNA 1SCWA 1GSVA 5DF8A 5U47A 3NIAA 3RTYA 2QJ7A 1N9OA 3ZNTA 5DJUA 2GJ3A 1CI9A 4WMCD 4JF4A 2HDSA 2JN7A 3SH8A 4DMZA 2VJWA 4JF6A 2JKRM 1U60A 1N9NA 5HWTA 4GNUA 1OMEA 2HF6A 3UDFA 1DP9A 1QMEA 3R7WB 3ZG0A 5JYPA 4R6LA 4WYYA 4RX2A 3GTCA 4Q8IA 3O88A 3U2AA 2WKPA 2WK0A 2O9AA 3HJIA 5EM1A 2Y2IA 1IYOA 2H5SA 5F83A 1VETB 1XJ2A 2QWSA 2WKQA 2V1AA 4KZ6A 4CLCC 5KSCA 1G5UA 3MSHA 1J3WA 3HCYA 2KDKA 2B18A 3MKEA 4OP5A 4QB8A 2XLNA 3VSLA 3UB8A 3DBAA 2ZQ7A 4E3IA 1D1JA 1ODVA 1P9WA 4I3AA 1VB6A 1YKDA 4HJ3A 2E8IA 3NDEA 5FAQA 2C6WB 1EI5A 2VV7A 1XGIA 4R4RA 1IKIA 4N9KA 3IXBA 3TW8A 1XJ6A 4JF5A 2P7JA 5DF7A 4MMNA 5TR7A 1S1ZA 1LLBA 4E6XA 4EEPA 4B4XA 2HDQA 4P6ZS 4HNBA 5HD5A 3RXWA 4X25A 4FTXA 5HZHA 2EFUA 4PM7A 1IYPA 3MXRA 1ZC2A 2VV8A 1W7FA 4HBUA 4KZAA 3S7OA 4JXWA 2Y2KA 3A3JA 3BFDA 2BG1A 1OJ5A 3EGDC 3K2NA 3N4IA 3LIAA 4KZ9A 1STZA 5HFOA 2ZL1B 1MZUA 3Q82A 5FQIA 1K25A 3H82B 3LI8A 3ZCZA 1ZHHB 2WZXA 3ZVWA 4NKPA 5FI2A 2LB9A 4PM6A 1L0EA 1P9RA 3TG9A 3AGEA 3SS3A 4D2OA 3BY9A 1LT0A 3T50A 3WRZA 2HP5A 5GLDA 4OONA 4P87A 3V50A 5FA7A 4WF0A 4HEFA 1KE0A 1MKIA 1Y54A 4S2IA 2VK3A 4OPQA 4WLAA 4S2LA 5BOHA 5CGWA 4X6TA 4NG2A 3PBRA 3IXHA 2V2FF 2ZOIA 2VEAA 3ZHHA 5FQJA 2DMWA 4NXFA 1S4SA 1FR1A 1BLHA 2JKRI 1T1BA 3IF6C 4HHDA 4EESA 2V20A 1NY0A 3CWFA 4HI4A 1PWDA 2QPNA 3EOIA 1NXYA 1XKZA 3GMWA 1KE4A 3EEHA 3PXPA 5HAPA 5E2HA 3TOIA 3LCEA 4LENA 3R7WA 4DJ2A 3L7HA 3C4PA 3VFHA 4NK3A 3F1PB 1ERQA 3AGFA 2P74A 2JKGA 2X02A 4HBTA 5CTMA 4LFUA 3DAVA 5KZHA 1Y28A 3Q1FA 3H7WB 3ZNYA 1F2KA 3VP4A 4G3WA 4Y5FA 1BYWA 1FILA 3H9WA 2XROA 1BLCA 1GA9A 2J80A 1XFNA 1BUEA 5CEDA 4OH0A 3W4PA 1S66L 2B02A 4DE1A 5KIZA 1KOUA 3DWZA 1WE4A 3IWOA 1JTDA 3E4PA 4ZRRA 1OTBA 5IU1A 3C7VA 1TS8A 2WGVA 4HESA 4HH2A 4HY8A 4X1LA 1SDEA 4O0PA 3A0RA 1WYBA 5HX9A 5DFXA 4ZTKA 4WZ5C 3QNBA 3DW0A 5CGXA 5A93A 3WRTA 3ZG9B 2WKHA 1H3QA 3D9YA 5F68A 4KUOA 1XX2A 2WGIA 4A5RA 4GKUA 2D02A 1OT6A 4M4XA 4OQGA 1CJFA 1KVMA 1VEUB 4Y0TA 4YNRA 2EX9A 3DWKA 1MY8A 3G31A 3P7NA 4BBVA 4IBRA 2QMIA 3C8CA 3H82A 5E2FA 3BW6A 2RL3A 2Y79A 4FUWA 3QNCA 3N6IA 5AQAA 3VFFA 3UE0A 3QP5A 3DTKA 1CEGA 1T1AA 2IWDA 1FIKA 2M1CA 4MNRA 4YFMA 1JVJA 1L0GA 2J3WA 1YAXA 3BQAA 1YLZA 2ZC3B 2PAVP 5EPHA 5HPIA 5DKKA 3M2JA 3HLDA 3GVBA 4Y7PA 4PPRA 1C3BA 4IEDA 1KE3A 1F9IA 3M6BA 1MXOA 1S4RA 2Y4AA 4EV4A 4K91A 3LR5A 1Z09A 3TE8A 5JYOA 1S6RA 1ONHA 2DCFA 4MN7A 2E8JA 4NXEA 1MWRA 2X71A 3LY4A 1K0KA 2ZMAA 2PYPA 1UWPX 4LGWA 3TSGA 1FCNA 2JHEA 1IOUA 3NBLA 4DN0A 3FG8A 5EOOA 1XP4A 2FFFB 4X68A 2NUPC 1Y4OA 1G6AA 5E2EA 2HJEA 1AXBA 4S2KA 2WAEA 4FCFA 2WGWA 3UE1A 4GN2A 2XK1A 4NXGA 1IYQA 3UPOA 1ES3A 3PAEA 3S7PA 5L09A 3IF5A 1PZOA 4EUVA 4S2NC 3JVUA 1A0KA 4IHQA 4BD0A 2LB5A 3MQ0A 4ZAMA 3UE6A 4E3KA 3F1OB 1XFQA 3SS4A 1CK3A 2Z2LB 2ZOHA 3VSKA 3N8LA 4U0TA 4BMWA 4OLGA 1MPLA 4BL3A 4E6WA 1OTDA 4L9FA 3CUEA 3MXSA 4PM8A 1CF0A 1L0FA 2CC1A 3K3DA 3VMAA 2PD8A 1K6SA 2A49A 3V3RA 3ICYA 4LV2A 3MQQA 4WUJA 3LR0A 3ZQ5A 4GOGA 4RVAA 3MJQA 3NECA 3BFGA 3GV9A 4P85A 5J3WA 5L07A 3O87A 3NY4A 4OOLA 3CG5A 3IH8A 1YPRA 1LL9A 1W63M 1L2SA 3U4LP 2W3HA 1E25A 3GRJA 3SZTA 1F98A 3SW1A 3JPUA 3E4QA 1QMFA 3OPPA 1HLUP 2Y2HA 1H8YA 2ZC4B 2O99A 2Z6CA 2OOLA 1BULA 1P0ZA 2XD1A 4DF6A 1FCMA 4P0MA 3QP2A 2PHYA 2K31A 3LFVA 1RGYA 2ZQ8A 3BQ8A 3P09A 4FH2A 5HWWA 2XQZA 1T18A 5FL3A 3PBNA 3EEAA 2OWHA 1OTAA 4X1MA 3LUQA 1UWNX 2L1MA 3E98A 1DJCA 3NC8A 2WKIA 2V1BA 4QD4A 2HDUA 4E3JA 1I5QA 1PWCA 2DRWA 2Z6DA 5GLAA 5AVFA 2W1RA 2Y55A 1KGEA 3EQUA 3CZDA 2KOIA 3LIEA 3T1RA 3TRCA 5HW3A 5F6AA 2VGKA 1XA1A 4R3BA 4Y2FA 3HUNA 1Q2QA 2KX6A 1GCEA 4ZJ3A 2PU4A 1SKOB 1XJ4A 4C75A 1NZUA 2MJ6A 1Q2PA 2P04A 4JLFA 2EA9A 3FKWA 5HDDA 2PD7A 3FV7A 3A3IA 5G18A 1NWZA 3OCNA 3HJKA 3BRMA 3NULA 3M6HA 1CI8A 4N9LA 1PI4A 2EWVA 1AWIA 5J4EA 3GDIA 3UPPA 4R38A 3BLSA 4DDYA 4CLCB 4GZBA 3PBQA 2A3UA 5GL9A 3LIFA 2WUQA 2JKTI 5IS1A 5LBRA 4I39A 4OOYA 5GHXA 2UV0E 3F1OA 5A92A 3HLFA 2XF3A 4N1HA 5DTKA 2VA0A 1T1CA 3GR2A 1EW0A 2B95A 4IJGA 2C5WB 3UY6A 3PYPA 4KQQA 2XFSA 2WZZA 3IH9A 1VM1A 1RP5A 1JWPA 3FYZA 4LCMA 1YMXA 3MZDA 2P08A 4UQIM 2WKRA 2WKEA 3UB7A 2ZJ9A 4OQIA 4GW9A 5CERA 2ZMFA 1G6OA 2ZQAA 5CGSA 4WM9A 5AVEA 3Q07A 1S1YA 4U3TA 1ZG6A 4MCWA 2PRFA 4KENB 4OLDA 5EVIA 5EOEA 1EROA 2CMNA 2Y2GA 5HAIA 2H28A 2ZM8A 3VP3A 4R4SA 1LSVA 5A91A 4S2OA 4KZ8A 1ALQA 4WN5A 2HV1A 1JWVA 4BBUA 4K0XA 4EWFA 1BTLA 4HIAA 1YLYA 4EBPA 3Q81A 4X53A 5G4YA 3IX4A 1N4OA 2ZC7A 3JYIA 2J7VA 4O01A 1MC0A 4G3KA 4PM9A 1LSXA 2Q9MA 2UWXA 4E3NA 2DNSA 1K57C 3IF6B 2ZQCA 2QHKA 4OOMA 5FSRA 3QHYA 1BZAA 3OC2A 2Y59A 1W5DA 3NJAA 3CPTB 4EBNA 1SKOA 3OPRA 4ZJ2A 4N92A 1G68A 2VZWA 2G2WA 5F69A 3R4KA 4YOFA 4B93A 4HP9A 1FCOA 3ZGAB 1FSYA 1HD8A 4LV0A 2I9VA 3O86A 3N8SA 3ZG8B 1KDSA 1PYYA 3ITBA 1NJ4A 4YINA 2O9CA 4CLCA 3G34A 4E3MA 1ES2A 5CHJA 4BWIA 1XGJA 3OOVA 1TS0A 5E43A 3W2ZA 3T1SA 5TBMB 3F1NB 1S0WA 4KZ7A 3JVVA 5EVID 1IFQA 4UHUA 4DXCA 1YSPA 1VETA 1DP8A 2WYXA 5CX7A 3BYDA 1YMSA 3EWKA 4BJPA 2Q0OA 5GHYA 3RFBA 3HVFA 5F1GA 2Y91A 4LV1A 5TFQA 1N9BA 2R78A 3SOIA 2L4RA 1FSWA 1IYSA 4CQHA 3KSIA 4Z9QA 4DDSA 4E3OA 4PHTA 2XH9A 3LIBA 3ZYTA 2V0UA 4IUHA 1X0OA 2O9BA 4HH3A 3CMZA 2OV5A 2BASA 3LICA 5K5BA 3IS2B 4ZJ1A 3ZG7B 1N9LA 4BL2A 1BT5A 3LI9A 4EQ1A 1TVFA 2G7UA 2HDRA 3N7WA 2QZ6A 1JWZA 2XGNA 1TDGA 2W3GA 4S2MA 2M7UA 2HPBA 1DRMA 5HPFA 4G3VA 5F1FA 3E2KA 4UQIS 5FQ9A 1PZPA 3B42A 2PR5A 1GA0A 4DRTA 3MF0A 3SS5A 1VQQA 1BLSA 1NYYA 2WAFA 2ZL1A 3D72A 5DVAA 3SH9A 4QHCA 4X56A 2Y8HA 5AQ7A 4L9GA 4Y0UA 4II7A 2J8YA 4HJ4A 4F3LB 3SH7A 2ZBBA 3G30A 4JKTA 4GB7A 3MBZA 3MZEA 4C6YA 3E4OA 4JGQA 3S4XA 4PAUA 2W3FA 3D3OA 1RCJA 2OLVA 3G6OA 2X01A 3CPTA 1NRFA 4ID4A 1K55A 3BFFA 5J8XA 2XSSA 3RJUA 3T1XA 4MBFA 5J7EA 3FZCA 4ETXA 4LLOB 2W0NA 1NZOA 3UDXA 3GSGA 5EECA 4O8GA 1TS6A 4P6BA 4CPKA 2O0YA 2EFXA 3NHQA 1OPXA 3IHBA 2HJ9C 5AQ9A 3GQZA 3F1PA 1ES5A 4Q0HA 5G4ZA 4EBLA 3UDIA 3VOZA 5GLCA 4MEZA 5I94A 3PBOA 5TBMA 1KVLA 3H7WA 5TJJA 3BEBA 2IA2A 5EUAA 3S7QA 2HP9A 3V5MA 4GS9B 1K54C 3T12B 2FH5A 3A0SA 3I7JA 5M18A 4OPRA 2VV6A 4L0LA 2EX8A 1K4EA 3IWIA 1S67L 2IWBA 3VP2A 4LCLA 3HLCA 4WZ5A 5IT5A 1LI9A 4E04A 3WS2A 1V9YA 3CITA 3KO6A 5HDSA 1HVBA 2YKHA 4D60A 3FKVA 5FAOA 1XA7A 4MN5A 5HAQA 1Z6FA 5FAPA 2QKPA 5HL6A 4DJ3A 5HL1A 1UGUA 2OSUA 1FOFA 4QY5A 3T4TA 4ME4A 3S7NA 1PWGA 3RXXA 2IWCA 3ZVTA 5IHVA 1MKMA 2OAP1 3G32A 4BD1A 4S2PA 4IUKA 1H5XA 4JXGA 5CTNA 4WZ4A 3O5YA 2Y2NA 4I3IA 1VEUA 2PT7A 1YT4A 2V0WA 4KQDA 4WL9A 4PMAA 2M7VA 1BLPA 5L8MA 2HP6A 4I5SA 4Q0IA 3KYZA 3G2YA 4DE3A 1XJ3A 3FWLA 3IXDA 3BFEA 5MC7A 4O7DA 5F82A 1GHIA 3LGOA 3QP6A 4H6JB 4C3QA 3KSFA 3KSHA 3BWLA 4OKPA 3VP1A 4KZ5A 2GNXA 4AFIA 5HSQA 5DF9A 3BJNA 4GHIB 4KZ4A 5CXWA 5EV0A 2EWWA 3LY3A 3RH8B 3ITAA 1F5MA 3T1QB 3C7UA 5FEFA 2ZLYA 3T4LA 5EVIC 3W4QA 4GDBA 3IT9A 3ZDJA 3LR4A 4ARZB 5L2FA 1HZOA 4PM5A 2EX2A 3UNWA 2H0YA 4FOFA 3NI9A 4JGOA 1GHMA 3T4SA 4B88A 4DKIA 3HLEA 3MFXA 3IBRA 2ZQDA 2ZM2A 3DTEA 4IVKA 2V9AA 5L10A 4KQRA 2XD5A 2L0WA 3A3DA 3BFCA 4EERA 2EX6A 3G2ZA 4KG6A 3IBJA 4S2NA 3PBTA 4X69A 3OZHA 4GS9A 1PFLA 3UB9A 3VE4A 1I2SA 2PBYA 4QWOA 3UE3A 2Y2PA 4JXVA 3ZG5A 2GDNA 3HREA 1CEFA 3L9KA 1ERMA 4RQ9A 4UA6A 4JBFA 4KZBA 3Q7VB 3WS0A 2NUTC 3CAXA 3T4OA 3IHAA 5GHZA 3M2KA 3QP8A 3IX3A 1OTEA 4EW7A 1WYCA 2A24B 3A0VA 1ONGA 2VGJA 3HUMA 4OQ0A 3NOTC 2J3TD 3PTEA 3PAGA 1T19A 2J9OA 2XEPA 5EVLA 5DJTA 2A2LA 4B9OA 1LL5A 3MFDA 3LO7A 2KLIA 2V1ZA 4MN6A 4Z1WA 5FI7A 5HD3A 4Y17A 3LR3A 4EUZA 4GCZA 2HGVA 4QU3A 2INWA 1W8YA 3CLOA 4KG5A 5DTSA 4ZBEA 4DE0A 3P98A 4WBGA 3C2WA 1ZG4A 3CI6A 3S1YA 5CECA 3E0YA 4OVDA 5FQKA 3C4OA 4CJNA 4N1XA 5FATA 1L0DA 5EM0A 4MLLA 4NETA 3WS5A 3ZFZA 3MKFA 3PR6A 4ZDXA 3KYEA 4XUXA 2K2NA 5FI6A 4H6JA 1LHYA 5CRFA 1YLWA 2OAQ1 1MWSA 2XRNA 4GHIA 3E2LA 3G35A 2AVXA 3KX0X 4RYEA 3NOPC 1XXMA 1SZVA 3OPLA 5HDCA 3HBRA 4GDNA 2ZMVA 4HP4A 4XT2B 1KDWA 2QJ5A 3HLGA 2VX8A 2P9VB 2K7SA 1IEMA 4CLCE 1YSQA 3WS1A 4LRYC 4F94A 2JCHA 3OBFA 4ARZA 5FDHA 3FPVA 4E3LA 1ESIA 1M40A 3QP1A 3C30A 1PW8A 5KSHA 1HTZA 4GLQA 2JC7A 4KZ3A 3FPWA 2GZAA 5A90A 3AGDA 2OLUA 1NRJA 5FDSA 4IBXA 3P01A 1W79A 1W8QA 2OWJA 1DY6A 3OPHA 1JNUA 2VLGA 4Y13A 2D01A 2ZD8A 4UEYA 1SHVA 4EQIA 4R70A 5FQQA 4LRXC 3BECA 2FFYA 4WEKA 1K55C 3Q7VA 3MR0A 1MBLA 4ETZA 2Y2LA 4UA7A 3W8KA 4JGPA 2Y2OA 3TJZC 2XA7M 3NCKA 2A24A 4BQMA 4RA7A 4IVIA 2R9WA 3FC7A 1MWTA 4R0QA 4K0WA 3MMHA 1LL8A 4I3JA 4KQOA 4OQHA 4DXBA 2JE5A 2ZC6B 1SDNA 3VOYA 1IELA 2WGWB 1DP6A 1H0MA 2R9XA 1H8MA 3D4FA 3UMDA 4HOIA 1PW1A 4LV3A 4NXBA 3DTMA 1LSWA 1YQSA 5EE8A 4EEUA 3Q7ZA 3C38A 2GX5A 3IX8A 4ESPA 1GSXA 3BM6A 2W27A 4QPRA 2BTFP 1GSWA 3LEQA 4QY6A 4Y15A 4R1GA 3VV4A 1IKGA 1G28A 2VGLM 3V67A 3UB5P 4KUKA 4FSFA 3WWXA
chains in the Genus database with same CATH topology
4WF0A 1W63Q 3CUEC 2EWVA 2QKPA 5HL6A 4DJ3A 5J4EA 3GDIA 1UGUA 4WLAA 3T4KA 5HWVA 3T4TA 4R38A 4ME4A 3S7NA 4CLCD 4XT2A 4JGRA 2W3DA 4CLCB 3PBRA 3PBQA 1MKMA 2ZOIA 2OAP1 3LIFA 5IS1A 2JKTI 2VEAA 4NEED 4IUKA 4I38A 5LBRA 2DMWA 1D06A 4NXFA 4I39A 2W1TB 3O5YA 3F1OA 1S4SA 4LRZE 4HJ6A 4I3IA 2JKRI 1T1BA 1OT9A 4HHDA 1TD5A 2VA0A 1T1CA 2VKSA 4EESA 2PT7A 3CWFA 4HI4A 4WELA 2V0WA 2PR6A 3EOIA 3EEHA 1EW0A 4KQDA 1NLYA 3PXPA 4WL9A 1ZTUA 2M7VA 4EXOA 4IJGA 5L8MA 4I5SA 4Q0IA 3KYZA 2YKFA 3PYPA 1XJ3A 3R7WA 4DJ2A 5MC7A 1OTIA 3F1PB 3EGXC 4H6JB 3B47A 3KSFA 3KSHA 3BWLA 4EU0A 2P08A 4UQIM 2WKRA 1Y28A 1P97A 3H7WB 2GNXA 4AFIA 5HSQA 1NLZA 1V9ZA 5DF9A 2J3TC 3BJNA 4GHIB 3UB7A 4G3WA 4Y5FA 1BYWA 3H9WA 2EWWA 4GW9A 4YWZA 2XROA 2J80A 3T4JA 2ZMFA 1G6OA 5AVEA 1XFNA 3RH8B 1S1YA 1F5MA 2FZ0A 3F1NA 4MCWA 4HQAA 3OCLA 3UMEA 1S66L 5C5KA 3T4LA 4LPZA 3NOUC 2B02A 3LR4A 4ARZB 3KYQA 3B33A 5KIZA 2CMNA 4FOFA 1KOUA 2H28A 4JGOA 3E4PA 4ZRRA 1OTBA 3LIDA 5IU1A 1LSVA 1TS8A 3T4SA 2QYBA 3MFXA 4HH2A 3IBRA 4WEJA 4K08A 3MXQA 5AJGA 4HY8A 4WN5A 2HV1A 4O0PA 4BBUA 3A0RA 2V9AA 5DFXA 2XA7S 4HIAA 2L0WA 4Q0JA 5G4YA 4EERA 3BY8A 1H3QA 5F68A 3IS2A 3IBJA 3MQOA 3PBTA 4KUOA 4O01A 5I5LA 1MC0A 4G3KA 4GS9A 1LSXA 3UB9A 3VE4A 3UE3A 5F5YA 4GJ4A 2D02A 1OT6A 4M4XA 2JKTM 2QHKA 4OOMA 3K3CA 4YNRA 4RQ9A 1WA9A 5DFYA 3OC2A 3P7NA 4BBVA 3VOLA 3NJAA 3C8CA 3H82A 2PDRA 3OLOA 3BW6A 5A8BA 2NUTC 3CAXA 3T4OA 2VZWA 2Y79A 1OJGA 5F69A 3KSGA 3R4KA 4BBTA 1OTEA 4YOFA 4EW7A 2A24B 3A0VA 4B93A 4HP9A 1T1AA 4P6ZM 2M1CA 4R3AA 5EFWA 2J3WA 2I9VA 1YAXA 3NOTC 2J3TD 3BQAA 4F3LA 1T19A 5HPIA 5DKKA 5DJTA 3PHYA 2O9CA 2A2LA 4B9OA 4CLCA 2VGLS 4BWIA 3EQVA 2KLIA 3OOVA 4MN6A 1TS0A 3W2ZA 5TBMB 2W1TA 3F1NB 4Z1WA 3VE3A 1F9IA 2W3EA 5HD3A 3JVVA 3LR3A 4GCZA 1IFQA 2HGVA 1S4RA 1YSPA 4EETB 1DP8A 2INWA 4PKYG 5CX7A 3CLOA 3EWKA 4BJPA 3RFBA 3LR5A 1TF1A 3C2WA 3CI6A 4PKYA 4MDZA 3E0YA 2R78A 3TE8A 2L4RA 1TS7A 4MN7A 1D7EA 4NXEA 4Y3IA 4CQHA 3KSIA 3PBSA 3PR6A 4PHTA 2PYPA 3LIBA 1UWPX 3ZYTA 2K2NA 2V0UA 2JHEA 4H6JA 4IUHA 1IOUA 1X0OA 3LYXA 4DN0A 3FG8A 2O9BA 4HH3A 2OAQ1 2NUPC 2BASA 2HJEA 3LICA 5K5BA 3ULFA 3GECA 3UB6A 3IS2B 2XRNA 1N9LA 4GHIA 3LI9A 3KX0X 5DKLA 3NOPC 4EQ1A 2G7UA 4L9EA 5HDCA 4HP4A 2ZMVA 4NXGA 2W3GA 4XT2B 2QJ5A 2M7UA 3S7PA 2VX8A 1DRMA 3T4QA 2PYRA 4EUVA 2K7SA 5HPFA 1VHMA 4CLCE 4G3VA 1YSQA 3JVUA 4IHQA 4LRYC 1GSVA 4UQIS 2LB5A 3MQ0A 4ARZA 3OBFA 3UE6A 3RTYA 2QJ7A 3B42A 1N9OA 2PR5A 3F1OB 1XFQA 3FPVA 3MF0A 2ZOHA 5DJUA 2GJ3A 4BMWA 2JN7A 3C30A 5KSHA 4GLQA 4DMZA 2VJWA 3D72A 2JKRM 1OTDA 3FPWA 1N9NA 4L9FA 3CUEA 5HWTA 2Y8HA 3K3DA 2GZAA 4L9GA 2PD8A 2HF6A 4II7A 1DP9A 4HJ4A 3ICYA 4F3LB 2ZBBA 3R7WB 3MQQA 4R6LA 4WUJA 3LR0A 1NRJA 3ZQ5A 3P01A 3MJQA 3E4OA 4JGQA 5J3WA 3U2AA 2WKPA 2O9AA 3HJIA 2OWJA 4OOLA 4PAUA 1W63M 2W3HA 1JNUA 2W3FA 1XJ2A 2QWSA 3D3OA 2WKQA 2VLGA 1F98A 2V1AA 4CLCC 3SW1A 2D01A 3G6OA 4UEYA 3E4QA 4R70A 4LRXC 2O99A 2Z6CA 2OOLA 4WEKA 2XSSA 1P0ZA 3MR0A 3HCYA 4ETZA 2KDKA 2B18A 4JGPA 3UB8A 3DBAA 2PHYA 3TJZC 2XA7M 2K31A 5J7EA 2A24A 1ODVA 1P9WA 3BQ8A 3LFVA 4I3AA 4ETXA 5HWWA 4LLOB 1T18A 1VB6A 2W0NA 1YKDA 5FL3A 3PBNA 4HJ3A 3EEAA 2OWHA 4O8GA 1TS6A 1OTAA 3LUQA 1UWNX 3FC7A 2L1MA 2VV7A 3E98A 2O0YA 3NHQA 3TW8A 1OPXA 3MMHA 1LL8A 4I3JA 1XJ6A 2HJ9C 4KQOA 3F1PA 2V1BA 2P7JA 4Q0HA 5G4ZA 4MMNA 3PBOA 1S1ZA 4EEPA 1DP6A 5TBMA 1H8MA 2Z6DA 4P6ZS 4HNBA 5HD5A 3UMDA 3H7WA 5TJJA 5AVFA 4HOIA 2W1RA 5HZHA 2IA2A 3S7QA 4NXBA 4GS9B 1LSWA 2FH5A 3EQUA 3A0SA 2VV8A 2KOIA 3LIEA 4EEUA 3TRCA 3S7OA 2VV6A 4L0LA 1OJ5A 3EGDC 5F6AA 3C38A 3K2NA 2GX5A 3LIAA 1GSXA 1S67L 4Y2FA 2W27A 1STZA 4QPRA 2KX6A 1MZUA 1GSWA 3H82B 3LI8A 1XJ4A 5IT5A 1ZHHB 4E04A 3VV4A 1V9YA 3CITA 2MJ6A 4NKPA 2LB9A 2P04A 1P9RA 2EA9A 3KO6A 1G28A 5HDSA 2VGLM 5HDDA 3V67A 2PD7A 2YKHA 3BY9A 1LT0A 3T50A 1NWZA 3OCNA 4FSFA 4KUKA 4MN5A 3HJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WF0 A;  2QKP A;  4DJ3 A;  5J4E A;  3GDI A;  1UGU A;  4WLA A;  5HWV A;  4R38 A;  4XT2 A;  4JGR A;  2ZOI A;  3LIF A;  5IS1 A;  2VEA A;  4I38 A;  4NXF A;  1D06 A;  4I39 A;  3F1O A;  1S4S A;  4LRZ E;  4HJ6 A;  4I3I A;  1T1B A;  1OT9 A;  4HHD A;  1T1C A;  4EES A;  3CWF A;  4HI4 A;  2V0W A;  2PR6 A;  3EEH A;  1EW0 A;  4KQD A;  4WL9 A;  4EXO A;  4I5S A;  2YKF A;  3PYP A;  1XJ3 A;  4DJ2 A;  1OTI A;  3F1P B;  4H6J B;  3BWL A;  2WKR A;  1Y28 A;  1P97 A;  3H7W B;  5HSQ A;  1V9Z A;  4GHI B;  3UB7 A;  1BYW A;  3H9W A;  4GW9 A;  4YWZ A;  2J80 A;  5AVE A;  1XFN A;  3RH8 B;  1S1Y A;  3F1N A;  4HQA A;  3UME A;  1S66 L;  4LPZ A;  3NOU C;  2B02 A;  3B33 A;  5KIZ A;  2CMN A;  1KOU A;  2H28 A;  4JGO A;  3E4P A;  1OTB A;  5IU1 A;  3LID A;  1LSV A;  1TS8 A;  3MFX A;  4HH2 A;  3IBR A;  4K08 A;  3MXQ A;  4HY8 A;  4WN5 A;  2HV1 A;  4BBU A;  3A0R A;  2V9A A;  4HIA A;  2L0W A;  5G4Y A;  4EER A;  3BY8 A;  5F68 A;  3IS2 A;  3MQO A;  4KUO A;  5I5L A;  4GS9 A;  1LSX A;  3UB9 A;  3VE4 A;  5F5Y A;  2D02 A;  1OT6 A;  4M4X A;  2QHK A;  3K3C A;  4RQ9 A;  1WA9 A;  4BBV A;  3P7N A;  3VOL A;  3NJA A;  3C8C A;  3H82 A;  2PDR A;  3OLO A;  5A8B A;  3CAX A;  1OJG A;  5F69 A;  4BBT A;  1OTE A;  4EW7 A;  2A24 B;  3A0V A;  4HP9 A;  1T1A A;  2M1C A;  4R3A A;  5EFW A;  2I9V A;  3NOT C;  4F3L A;  1T19 A;  5DKK A;  5DJT A;  3PHY A;  4B9O A;  4MN6 A;  1TS0 A;  5TBM B;  3F1N B;  3VE3 A;  1F9I A;  5HD3 A;  4GCZ A;  1S4R A;  4EET B;  1DP8 A;  2INW A;  4PKY G;  3CLO A;  3EWK A;  3C2W A;  4PKY A;  2R78 A;  2L4R A;  1TS7 A;  1D7E A;  4NXE A;  2PYP A;  3LIB A;  1UWP X;  2V0U A;  2JHE A;  4H6J A;  1X0O A;  3LYX A;  3FG8 A;  4HH3 A;  2BAS A;  3LIC A;  3ULF A;  3GEC A;  3UB6 A;  3IS2 B;  1N9L A;  4GHI A;  3LI9 A;  3KX0 X;  5DKL A;  3NOP C;  4EQ1 A;  4L9E A;  5HDC A;  4HP4 A;  4NXG A;  4XT2 B;  2QJ5 A;  1DRM A;  2PYR A;  2K7S A;  4LRY C;  1GSV A;  3UE6 A;  3RTY A;  2QJ7 A;  1N9O A;  2PR5 A;  3F1O B;  1XFQ A;  2ZOH A;  5DJU A;  2GJ3 A;  2JN7 A;  3D72 A;  1OTD A;  1N9N A;  4L9F A;  5HWT A;  3K3D A;  4L9G A;  2PD8 A;  1DP9 A;  4HJ4 A;  3ICY A;  4F3L B;  2ZBB A;  3MQQ A;  4R6L A;  4WUJ A;  3ZQ5 A;  3MJQ A;  3E4O A;  4JGQ A;  5J3W A;  2WKP A;  3HJI A;  2OWJ A;  1JNU A;  1XJ2 A;  2QWS A;  2WKQ A;  2VLG A;  1F98 A;  2V1A A;  3SW1 A;  2D01 A;  3G6O A;  3E4Q A;  4R70 A;  4LRX C;  2Z6C A;  2OOL A;  1P0Z A;  3MR0 A;  2KDK A;  4JGP A;  3UB8 A;  2PHY A;  5J7E A;  2A24 A;  1ODV A;  4I3A A;  5HWW A;  4LLO B;  1T18 A;  1VB6 A;  2W0N A;  4HJ3 A;  2OWH A;  1TS6 A;  1OTA A;  3LUQ A;  1UWN X;  3FC7 A;  2L1M A;  2VV7 A;  3NHQ A;  1LL8 A;  4I3J A;  1XJ6 A;  3F1P A;  2V1B A;  2P7J A;  5G4Z A;  1S1Z A;  4EEP A;  1DP6 A;  5TBM A;  2Z6D A;  5HD5 A;  4HNB A;  3UMD A;  3H7W A;  5AVF A;  4HOI A;  5HZH A;  4NXB A;  4GS9 B;  1LSW A;  3A0S A;  2VV8 A;  3LIE A;  4EEU A;  2VV6 A;  1OJ5 A;  5F6A A;  3LIA A;  1GSX A;  1S67 L;  2W27 A;  2KX6 A;  1MZU A;  1GSW A;  3H82 B;  3LI8 A;  1XJ4 A;  4E04 A;  1V9Y A;  2EA9 A;  5HDS A;  1G28 A;  5HDD A;  2PD7 A;  2YKH A;  3BY9 A;  1LT0 A;  3T50 A;  1NWZ A;  4KUK A;  4MN5 A;  3HJK A; 
#chains in the Genus database with same CATH topology
 1W63 Q;  3CUE C;  2Y2M A;  1PRQ A;  1K57 A;  5EVE A;  3T4K A;  5E2G A;  3HLB A;  5HWV A;  4CLC D;  4XT2 A;  5CHM A;  4JGR A;  2W3D A;  2P9V A;  2V8F A;  3B3X A;  4DE2 A;  4NEE D;  4I38 A;  1D06 A;  2PU2 A;  2W1T B;  2HZ5 A;  4LRZ E;  3IF6 A;  4HJ6 A;  1MWU A;  1OT9 A;  3A3E A;  4B4Z A;  1TD5 A;  2J9P A;  3WS4 A;  2VKS A;  4WEL A;  2XDM A;  2PR6 A;  2ZC5 B;  2ZQ9 A;  1NLY A;  1ZTU A;  4EXO A;  2ACG A;  2JKF A;  5TGF A;  1TDL A;  2PBD P;  2YKF A;  1PI5 A;  4Y0O A;  3HL9 A;  4XUZ A;  1OTI A;  3V3S A;  3EGX C;  3B47 A;  2Y2J A;  1RGZ A;  3C5A A;  4EU0 A;  1I2W A;  1KGG A;  4MBH A;  1E3U A;  1P97 A;  1NLZ A;  1V9Z A;  2J3T C;  2RCX A;  4QJG A;  4R3J A;  1CQA A;  4KG2 A;  4YWZ A;  3T4J A;  4XXR A;  4UA9 A;  1GHP A;  1YLJ A;  1FR6 A;  2FZ0 A;  3F1N A;  4HQA A;  2B5R A;  1EWZ A;  3OCL A;  4OPY A;  3UME A;  5C5K A;  3BLM A;  1TEM A;  4LPZ A;  2G2U A;  4UAA A;  3NOU C;  3KYQ A;  3B33 A;  3CJM A;  5CEB A;  4JXS A;  3LID A;  3UN7 A;  2Q9N A;  2QYB A;  5GLB A;  4WEJ A;  4K08 A;  3MXQ A;  5AJG A;  2V8C A;  1KGF A;  4BLM A;  4M3K A;  2XA7 S;  1DJA A;  4Q0J A;  3BY8 A;  4H8R A;  1ESU A;  3IS2 A;  3MQO A;  4S2J A;  5I5L A;  4OP8 A;  2JBF A;  1YM1 A;  4FH4 A;  5F5Y A;  4GD6 A;  4GJ4 A;  4R23 A;  1K56 A;  3G4P A;  4FD8 A;  2JKT M;  3IQA A;  1O7E A;  1M6K A;  2Z2M B;  1H8Z A;  3K3C A;  4JPM A;  1PNE A;  3V39 A;  1WA9 A;  5DFY A;  4OPZ A;  3VOL A;  3VP0 A;  2XFT A;  1DJB A;  2PDR A;  3OLO A;  4BEN A;  3UO9 A;  5A8B A;  4U0X A;  1J9M A;  2EXA A;  1OJG A;  5AQB A;  3KSG A;  4BBT A;  1LI0 A;  4WMC A;  5M1A A;  1XPB A;  2ZM0 A;  5FEG A;  2EXB A;  1BSG A;  4P6Z M;  5EFW A;  4R3A A;  2Y2Q A;  4X55 A;  1E3U D;  1YLT A;  3MS6 A;  2XR0 A;  1PIO A;  3IXG A;  4F3L A;  5HAR A;  3HLW A;  3PHY A;  1SKF A;  1JTG A;  2VGL S;  5CHU A;  3EQV A;  3IWQ A;  1O07 A;  5KMW A;  1ACF A;  3A3F A;  2W1T A;  3VE3 A;  2W3E A;  1FQG A;  3LEZ A;  4EET B;  5EVI B;  1E4D A;  2I72 A;  4PKY G;  5D3O A;  3CHW P;  4RX3 A;  1K6R A;  1K38 A;  1ZKJ A;  5FAS A;  1TF1 A;  3O3V A;  4PKY A;  4MDZ A;  1TS7 A;  1D7E A;  5M19 A;  4Y3I A;  4GD8 A;  3PBS A;  1L3L A;  1NYM A;  3LYX A;  3MZF A;  5FQM A;  3ULF A;  3GEC A;  3UB6 A;  3QP4 A;  3N8R A;  5DTT A;  1ES4 A;  1K54 A;  3W4O A;  5DKL A;  4MBK A;  2WAD A;  1K56 D;  4L9E A;  2H0T A;  3ISG A;  3DTI A;  3S22 A;  1YLP A;  2H10 A;  1K4F A;  2BLS A;  3NDG A;  3T4Q A;  2PYR A;  3HUO A;  1VHM A;  3UPN A;  1SCW A;  1GSV A;  5DF8 A;  5U47 A;  3NIA A;  3RTY A;  2QJ7 A;  1N9O A;  3ZNT A;  5DJU A;  2GJ3 A;  1CI9 A;  4WMC D;  4JF4 A;  2HDS A;  2JN7 A;  3SH8 A;  4DMZ A;  2VJW A;  4JF6 A;  2JKR M;  1U60 A;  1N9N A;  5HWT A;  4GNU A;  1OME A;  2HF6 A;  3UDF A;  1DP9 A;  1QME A;  3R7W B;  3ZG0 A;  5JYP A;  4R6L A;  4WYY A;  4RX2 A;  3GTC A;  4Q8I A;  3O88 A;  3U2A A;  2WKP A;  2WK0 A;  2O9A A;  3HJI A;  5EM1 A;  2Y2I A;  1IYO A;  2H5S A;  5F83 A;  1VET B;  1XJ2 A;  2QWS A;  2WKQ A;  2V1A A;  4KZ6 A;  4CLC C;  5KSC A;  1G5U A;  3MSH A;  1J3W A;  3HCY A;  2KDK A;  2B18 A;  3MKE A;  4OP5 A;  4QB8 A;  2XLN A;  3VSL A;  3UB8 A;  3DBA A;  2ZQ7 A;  4E3I A;  1D1J A;  1ODV A;  1P9W A;  4I3A A;  1VB6 A;  1YKD A;  4HJ3 A;  2E8I A;  3NDE A;  5FAQ A;  2C6W B;  1EI5 A;  2VV7 A;  1XGI A;  4R4R A;  1IKI A;  4N9K A;  3IXB A;  3TW8 A;  1XJ6 A;  4JF5 A;  2P7J A;  5DF7 A;  4MMN A;  5TR7 A;  1S1Z A;  1LLB A;  4E6X A;  4EEP A;  4B4X A;  2HDQ A;  4P6Z S;  4HNB A;  5HD5 A;  3RXW A;  4X25 A;  4FTX A;  5HZH A;  2EFU A;  4PM7 A;  1IYP A;  3MXR A;  1ZC2 A;  2VV8 A;  1W7F A;  4HBU A;  4KZA A;  3S7O A;  4JXW A;  2Y2K A;  3A3J A;  3BFD A;  2BG1 A;  1OJ5 A;  3EGD C;  3K2N A;  3N4I A;  3LIA A;  4KZ9 A;  1STZ A;  5HFO A;  2ZL1 B;  1MZU A;  3Q82 A;  5FQI A;  1K25 A;  3H82 B;  3LI8 A;  3ZCZ A;  1ZHH B;  2WZX A;  3ZVW A;  4NKP A;  5FI2 A;  2LB9 A;  4PM6 A;  1L0E A;  1P9R A;  3TG9 A;  3AGE A;  3SS3 A;  4D2O A;  3BY9 A;  1LT0 A;  3T50 A;  3WRZ A;  2HP5 A;  5GLD A;  4OON A;  4P87 A;  3V50 A;  5FA7 A;  4WF0 A;  4HEF A;  1KE0 A;  1MKI A;  1Y54 A;  4S2I A;  2VK3 A;  4OPQ A;  4WLA A;  4S2L A;  5BOH A;  5CGW A;  4X6T A;  4NG2 A;  3PBR A;  3IXH A;  2V2F F;  2ZOI A;  2VEA A;  3ZHH A;  5FQJ A;  2DMW A;  4NXF A;  1S4S A;  1FR1 A;  1BLH A;  2JKR I;  1T1B A;  3IF6 C;  4HHD A;  4EES A;  2V20 A;  1NY0 A;  3CWF A;  4HI4 A;  1PWD A;  2QPN A;  3EOI A;  1NXY A;  1XKZ A;  3GMW A;  1KE4 A;  3EEH A;  3PXP A;  5HAP A;  5E2H A;  3TOI A;  3LCE A;  4LEN A;  3R7W A;  4DJ2 A;  3L7H A;  3C4P A;  3VFH A;  4NK3 A;  3F1P B;  1ERQ A;  3AGF A;  2P74 A;  2JKG A;  2X02 A;  4HBT A;  5CTM A;  4LFU A;  3DAV A;  5KZH A;  1Y28 A;  3Q1F A;  3H7W B;  3ZNY A;  1F2K A;  3VP4 A;  4G3W A;  4Y5F A;  1BYW A;  1FIL A;  3H9W A;  2XRO A;  1BLC A;  1GA9 A;  2J80 A;  1XFN A;  1BUE A;  5CED A;  4OH0 A;  3W4P A;  1S66 L;  2B02 A;  4DE1 A;  5KIZ A;  1KOU A;  3DWZ A;  1WE4 A;  3IWO A;  1JTD A;  3E4P A;  4ZRR A;  1OTB A;  5IU1 A;  3C7V A;  1TS8 A;  2WGV A;  4HES A;  4HH2 A;  4HY8 A;  4X1L A;  1SDE A;  4O0P A;  3A0R A;  1WYB A;  5HX9 A;  5DFX A;  4ZTK A;  4WZ5 C;  3QNB A;  3DW0 A;  5CGX A;  5A93 A;  3WRT A;  3ZG9 B;  2WKH A;  1H3Q A;  3D9Y A;  5F68 A;  4KUO A;  1XX2 A;  2WGI A;  4A5R A;  4GKU A;  2D02 A;  1OT6 A;  4M4X A;  4OQG A;  1CJF A;  1KVM A;  1VEU B;  4Y0T A;  4YNR A;  2EX9 A;  3DWK A;  1MY8 A;  3G31 A;  3P7N A;  4BBV A;  4IBR A;  2QMI A;  3C8C A;  3H82 A;  5E2F A;  3BW6 A;  2RL3 A;  2Y79 A;  4FUW A;  3QNC A;  3N6I A;  5AQA A;  3VFF A;  3UE0 A;  3QP5 A;  3DTK A;  1CEG A;  1T1A A;  2IWD A;  1FIK A;  2M1C A;  4MNR A;  4YFM A;  1JVJ A;  1L0G A;  2J3W A;  1YAX A;  3BQA A;  1YLZ A;  2ZC3 B;  2PAV P;  5EPH A;  5HPI A;  5DKK A;  3M2J A;  3HLD A;  3GVB A;  4Y7P A;  4PPR A;  1C3B A;  4IED A;  1KE3 A;  1F9I A;  3M6B A;  1MXO A;  1S4R A;  2Y4A A;  4EV4 A;  4K91 A;  3LR5 A;  1Z09 A;  3TE8 A;  5JYO A;  1S6R A;  1ONH A;  2DCF A;  4MN7 A;  2E8J A;  4NXE A;  1MWR A;  2X71 A;  3LY4 A;  1K0K A;  2ZMA A;  2PYP A;  1UWP X;  4LGW A;  3TSG A;  1FCN A;  2JHE A;  1IOU A;  3NBL A;  4DN0 A;  3FG8 A;  5EOO A;  1XP4 A;  2FFF B;  4X68 A;  2NUP C;  1Y4O A;  1G6A A;  5E2E A;  2HJE A;  1AXB A;  4S2K A;  2WAE A;  4FCF A;  2WGW A;  3UE1 A;  4GN2 A;  2XK1 A;  4NXG A;  1IYQ A;  3UPO A;  1ES3 A;  3PAE A;  3S7P A;  5L09 A;  3IF5 A;  1PZO A;  4EUV A;  4S2N C;  3JVU A;  1A0K A;  4IHQ A;  4BD0 A;  2LB5 A;  3MQ0 A;  4ZAM A;  3UE6 A;  4E3K A;  3F1O B;  1XFQ A;  3SS4 A;  1CK3 A;  2Z2L B;  2ZOH A;  3VSK A;  3N8L A;  4U0T A;  4BMW A;  4OLG A;  1MPL A;  4BL3 A;  4E6W A;  1OTD A;  4L9F A;  3CUE A;  3MXS A;  4PM8 A;  1CF0 A;  1L0F A;  2CC1 A;  3K3D A;  3VMA A;  2PD8 A;  1K6S A;  2A49 A;  3V3R A;  3ICY A;  4LV2 A;  3MQQ A;  4WUJ A;  3LR0 A;  3ZQ5 A;  4GOG A;  4RVA A;  3MJQ A;  3NEC A;  3BFG A;  3GV9 A;  4P85 A;  5J3W A;  5L07 A;  3O87 A;  3NY4 A;  4OOL A;  3CG5 A;  3IH8 A;  1YPR A;  1LL9 A;  1W63 M;  1L2S A;  3U4L P;  2W3H A;  1E25 A;  3GRJ A;  3SZT A;  1F98 A;  3SW1 A;  3JPU A;  3E4Q A;  1QMF A;  3OPP A;  1HLU P;  2Y2H A;  1H8Y A;  2ZC4 B;  2O99 A;  2Z6C A;  2OOL A;  1BUL A;  1P0Z A;  2XD1 A;  4DF6 A;  1FCM A;  4P0M A;  3QP2 A;  2PHY A;  2K31 A;  3LFV A;  1RGY A;  2ZQ8 A;  3BQ8 A;  3P09 A;  4FH2 A;  5HWW A;  2XQZ A;  1T18 A;  5FL3 A;  3PBN A;  3EEA A;  2OWH A;  1OTA A;  4X1M A;  3LUQ A;  1UWN X;  2L1M A;  3E98 A;  1DJC A;  3NC8 A;  2WKI A;  2V1B A;  4QD4 A;  2HDU A;  4E3J A;  1I5Q A;  1PWC A;  2DRW A;  2Z6D A;  5GLA A;  5AVF A;  2W1R A;  2Y55 A;  1KGE A;  3EQU A;  3CZD A;  2KOI A;  3LIE A;  3T1R A;  3TRC A;  5HW3 A;  5F6A A;  2VGK A;  1XA1 A;  4R3B A;  4Y2F A;  3HUN A;  1Q2Q A;  2KX6 A;  1GCE A;  4ZJ3 A;  2PU4 A;  1SKO B;  1XJ4 A;  4C75 A;  1NZU A;  2MJ6 A;  1Q2P A;  2P04 A;  4JLF A;  2EA9 A;  3FKW A;  5HDD A;  2PD7 A;  3FV7 A;  3A3I A;  5G18 A;  1NWZ A;  3OCN A;  3HJK A;  3BRM A;  3NUL A;  3M6H A;  1CI8 A;  4N9L A;  1PI4 A;  2EWV A;  1AWI A;  5J4E A;  3GDI A;  3UPP A;  4R38 A;  3BLS A;  4DDY A;  4CLC B;  4GZB A;  3PBQ A;  2A3U A;  5GL9 A;  3LIF A;  2WUQ A;  2JKT I;  5IS1 A;  5LBR A;  4I39 A;  4OOY A;  5GHX A;  2UV0 E;  3F1O A;  5A92 A;  3HLF A;  2XF3 A;  4N1H A;  5DTK A;  2VA0 A;  1T1C A;  3GR2 A;  1EW0 A;  2B95 A;  4IJG A;  2C5W B;  3UY6 A;  3PYP A;  4KQQ A;  2XFS A;  2WZZ A;  3IH9 A;  1VM1 A;  1RP5 A;  1JWP A;  3FYZ A;  4LCM A;  1YMX A;  3MZD A;  2P08 A;  4UQI M;  2WKR A;  2WKE A;  3UB7 A;  2ZJ9 A;  4OQI A;  4GW9 A;  5CER A;  2ZMF A;  1G6O A;  2ZQA A;  5CGS A;  4WM9 A;  5AVE A;  3Q07 A;  1S1Y A;  4U3T A;  1ZG6 A;  4MCW A;  2PRF A;  4KEN B;  4OLD A;  5EVI A;  5EOE A;  1ERO A;  2CMN A;  2Y2G A;  5HAI A;  2H28 A;  2ZM8 A;  3VP3 A;  4R4S A;  1LSV A;  5A91 A;  4S2O A;  4KZ8 A;  1ALQ A;  4WN5 A;  2HV1 A;  1JWV A;  4BBU A;  4K0X A;  4EWF A;  1BTL A;  4HIA A;  1YLY A;  4EBP A;  3Q81 A;  4X53 A;  5G4Y A;  3IX4 A;  1N4O A;  2ZC7 A;  3JYI A;  2J7V A;  4O01 A;  1MC0 A;  4G3K A;  4PM9 A;  1LSX A;  2Q9M A;  2UWX A;  4E3N A;  2DNS A;  1K57 C;  3IF6 B;  2ZQC A;  2QHK A;  4OOM A;  5FSR A;  3QHY A;  1BZA A;  3OC2 A;  2Y59 A;  1W5D A;  3NJA A;  3CPT B;  4EBN A;  1SKO A;  3OPR A;  4ZJ2 A;  4N92 A;  1G68 A;  2VZW A;  2G2W A;  5F69 A;  3R4K A;  4YOF A;  4B93 A;  4HP9 A;  1FCO A;  3ZGA B;  1FSY A;  1HD8 A;  4LV0 A;  2I9V A;  3O86 A;  3N8S A;  3ZG8 B;  1KDS A;  1PYY A;  3ITB A;  1NJ4 A;  4YIN A;  2O9C A;  4CLC A;  3G34 A;  4E3M A;  1ES2 A;  5CHJ A;  4BWI A;  1XGJ A;  3OOV A;  1TS0 A;  5E43 A;  3W2Z A;  3T1S A;  5TBM B;  3F1N B;  1S0W A;  4KZ7 A;  3JVV A;  5EVI D;  1IFQ A;  4UHU A;  4DXC A;  1YSP A;  1VET A;  1DP8 A;  2WYX A;  5CX7 A;  3BYD A;  1YMS A;  3EWK A;  4BJP A;  2Q0O A;  5GHY A;  3RFB A;  3HVF A;  5F1G A;  2Y91 A;  4LV1 A;  5TFQ A;  1N9B A;  2R78 A;  3SOI A;  2L4R A;  1FSW A;  1IYS A;  4CQH A;  3KSI A;  4Z9Q A;  4DDS A;  4E3O A;  4PHT A;  2XH9 A;  3LIB A;  3ZYT A;  2V0U A;  4IUH A;  1X0O A;  2O9B A;  4HH3 A;  3CMZ A;  2OV5 A;  2BAS A;  3LIC A;  5K5B A;  3IS2 B;  4ZJ1 A;  3ZG7 B;  1N9L A;  4BL2 A;  1BT5 A;  3LI9 A;  4EQ1 A;  1TVF A;  2G7U A;  2HDR A;  3N7W A;  2QZ6 A;  1JWZ A;  2XGN A;  1TDG A;  2W3G A;  4S2M A;  2M7U A;  2HPB A;  1DRM A;  5HPF A;  4G3V A;  5F1F A;  3E2K A;  4UQI S;  5FQ9 A;  1PZP A;  3B42 A;  2PR5 A;  1GA0 A;  4DRT A;  3MF0 A;  3SS5 A;  1VQQ A;  1BLS A;  1NYY A;  2WAF A;  2ZL1 A;  3D72 A;  5DVA A;  3SH9 A;  4QHC A;  4X56 A;  2Y8H A;  5AQ7 A;  4L9G A;  4Y0U A;  4II7 A;  2J8Y A;  4HJ4 A;  4F3L B;  3SH7 A;  2ZBB A;  3G30 A;  4JKT A;  4GB7 A;  3MBZ A;  3MZE A;  4C6Y A;  3E4O A;  4JGQ A;  3S4X A;  4PAU A;  2W3F A;  3D3O A;  1RCJ A;  2OLV A;  3G6O A;  2X01 A;  3CPT A;  1NRF A;  4ID4 A;  1K55 A;  3BFF A;  5J8X A;  2XSS A;  3RJU A;  3T1X A;  4MBF A;  5J7E A;  3FZC A;  4ETX A;  4LLO B;  2W0N A;  1NZO A;  3UDX A;  3GSG A;  5EEC A;  4O8G A;  1TS6 A;  4P6B A;  4CPK A;  2O0Y A;  2EFX A;  3NHQ A;  1OPX A;  3IHB A;  2HJ9 C;  5AQ9 A;  3GQZ A;  3F1P A;  1ES5 A;  4Q0H A;  5G4Z A;  4EBL A;  3UDI A;  3VOZ A;  5GLC A;  4MEZ A;  5I94 A;  3PBO A;  5TBM A;  1KVL A;  3H7W A;  5TJJ A;  3BEB A;  2IA2 A;  5EUA A;  3S7Q A;  2HP9 A;  3V5M A;  4GS9 B;  1K54 C;  3T12 B;  2FH5 A;  3A0S A;  3I7J A;  5M18 A;  4OPR A;  2VV6 A;  4L0L A;  2EX8 A;  1K4E A;  3IWI A;  1S67 L;  2IWB A;  3VP2 A;  4LCL A;  3HLC A;  4WZ5 A;  5IT5 A;  1LI9 A;  4E04 A;  3WS2 A;  1V9Y A;  3CIT A;  3KO6 A;  5HDS A;  1HVB A;  2YKH A;  4D60 A;  3FKV A;  5FAO A;  1XA7 A;  4MN5 A;  5HAQ A;  1Z6F A;  5FAP A;  2QKP A;  5HL6 A;  4DJ3 A;  5HL1 A;  1UGU A;  2OSU A;  1FOF A;  4QY5 A;  3T4T A;  4ME4 A;  3S7N A;  1PWG A;  3RXX A;  2IWC A;  3ZVT A;  5IHV A;  1MKM A;  2OAP 1;  3G32 A;  4BD1 A;  4S2P A;  4IUK A;  1H5X A;  4JXG A;  5CTN A;  4WZ4 A;  3O5Y A;  2Y2N A;  4I3I A;  1VEU A;  2PT7 A;  1YT4 A;  2V0W A;  4KQD A;  4WL9 A;  4PMA A;  2M7V A;  1BLP A;  5L8M A;  2HP6 A;  4I5S A;  4Q0I A;  3KYZ A;  3G2Y A;  4DE3 A;  1XJ3 A;  3FWL A;  3IXD A;  3BFE A;  5MC7 A;  4O7D A;  5F82 A;  1GHI A;  3LGO A;  3QP6 A;  4H6J B;  4C3Q A;  3KSF A;  3KSH A;  3BWL A;  4OKP A;  3VP1 A;  4KZ5 A;  2GNX A;  4AFI A;  5HSQ A;  5DF9 A;  3BJN A;  4GHI B;  4KZ4 A;  5CXW A;  5EV0 A;  2EWW A;  3LY3 A;  3RH8 B;  3ITA A;  1F5M A;  3T1Q B;  3C7U A;  5FEF A;  2ZLY A;  3T4L A;  5EVI C;  3W4Q A;  4GDB A;  3IT9 A;  3ZDJ A;  3LR4 A;  4ARZ B;  5L2F A;  1HZO A;  4PM5 A;  2EX2 A;  3UNW A;  2H0Y A;  4FOF A;  3NI9 A;  4JGO A;  1GHM A;  3T4S A;  4B88 A;  4DKI A;  3HLE A;  3MFX A;  3IBR A;  2ZQD A;  2ZM2 A;  3DTE A;  4IVK A;  2V9A A;  5L10 A;  4KQR A;  2XD5 A;  2L0W A;  3A3D A;  3BFC A;  4EER A;  2EX6 A;  3G2Z A;  4KG6 A;  3IBJ A;  4S2N A;  3PBT A;  4X69 A;  3OZH A;  4GS9 A;  1PFL A;  3UB9 A;  3VE4 A;  1I2S A;  2PBY A;  4QWO A;  3UE3 A;  2Y2P A;  4JXV A;  3ZG5 A;  2GDN A;  3HRE A;  1CEF A;  3L9K A;  1ERM A;  4RQ9 A;  4UA6 A;  4JBF A;  4KZB A;  3Q7V B;  3WS0 A;  2NUT C;  3CAX A;  3T4O A;  3IHA A;  5GHZ A;  3M2K A;  3QP8 A;  3IX3 A;  1OTE A;  4EW7 A;  1WYC A;  2A24 B;  3A0V A;  1ONG A;  2VGJ A;  3HUM A;  4OQ0 A;  3NOT C;  2J3T D;  3PTE A;  3PAG A;  1T19 A;  2J9O A;  2XEP A;  5EVL A;  5DJT A;  2A2L A;  4B9O A;  1LL5 A;  3MFD A;  3LO7 A;  2KLI A;  2V1Z A;  4MN6 A;  4Z1W A;  5FI7 A;  5HD3 A;  4Y17 A;  3LR3 A;  4EUZ A;  4GCZ A;  2HGV A;  4QU3 A;  2INW A;  1W8Y A;  3CLO A;  4KG5 A;  5DTS A;  4ZBE A;  4DE0 A;  3P98 A;  4WBG A;  3C2W A;  1ZG4 A;  3CI6 A;  3S1Y A;  5CEC A;  3E0Y A;  4OVD A;  5FQK A;  3C4O A;  4CJN A;  4N1X A;  5FAT A;  1L0D A;  5EM0 A;  4MLL A;  4NET A;  3WS5 A;  3ZFZ A;  3MKF A;  3PR6 A;  4ZDX A;  3KYE A;  4XUX A;  2K2N A;  5FI6 A;  4H6J A;  1LHY A;  5CRF A;  1YLW A;  2OAQ 1;  1MWS A;  2XRN A;  4GHI A;  3E2L A;  3G35 A;  2AVX A;  3KX0 X;  4RYE A;  3NOP C;  1XXM A;  1SZV A;  3OPL A;  5HDC A;  3HBR A;  4GDN A;  2ZMV A;  4HP4 A;  4XT2 B;  1KDW A;  2QJ5 A;  3HLG A;  2VX8 A;  2P9V B;  2K7S A;  1IEM A;  4CLC E;  1YSQ A;  3WS1 A;  4LRY C;  4F94 A;  2JCH A;  3OBF A;  4ARZ A;  5FDH A;  3FPV A;  4E3L A;  1ESI A;  1M40 A;  3QP1 A;  3C30 A;  1PW8 A;  5KSH A;  1HTZ A;  4GLQ A;  2JC7 A;  4KZ3 A;  3FPW A;  2GZA A;  5A90 A;  3AGD A;  2OLU A;  1NRJ A;  5FDS A;  4IBX A;  3P01 A;  1W79 A;  1W8Q A;  2OWJ A;  1DY6 A;  3OPH A;  1JNU A;  2VLG A;  4Y13 A;  2D01 A;  2ZD8 A;  4UEY A;  1SHV A;  4EQI A;  4R70 A;  5FQQ A;  4LRX C;  3BEC A;  2FFY A;  4WEK A;  1K55 C;  3Q7V A;  3MR0 A;  1MBL A;  4ETZ A;  2Y2L A;  4UA7 A;  3W8K A;  4JGP A;  2Y2O A;  3TJZ C;  2XA7 M;  3NCK A;  2A24 A;  4BQM A;  4RA7 A;  4IVI A;  2R9W A;  3FC7 A;  1MWT A;  4R0Q A;  4K0W A;  3MMH A;  1LL8 A;  4I3J A;  4KQO A;  4OQH A;  4DXB A;  2JE5 A;  2ZC6 B;  1SDN A;  3VOY A;  1IEL A;  2WGW B;  1DP6 A;  1H0M A;  2R9X A;  1H8M A;  3D4F A;  3UMD A;  4HOI A;  1PW1 A;  4LV3 A;  4NXB A;  3DTM A;  1LSW A;  1YQS A;  5EE8 A;  4EEU A;  3Q7Z A;  3C38 A;  2GX5 A;  3IX8 A;  4ESP A;  1GSX A;  3BM6 A;  2W27 A;  4QPR A;  2BTF P;  1GSW A;  3LEQ A;  4QY6 A;  4Y15 A;  4R1G A;  3VV4 A;  1IKG A;  1G28 A;  2VGL M;  3V67 A;  3UB5 P;  4KUK A;  4FSF A;  3WWX A; 
#chains in the Genus database with same CATH homology
 4WF0 A;  1W63 Q;  3CUE C;  2EWV A;  2QKP A;  5HL6 A;  4DJ3 A;  5J4E A;  3GDI A;  1UGU A;  4WLA A;  3T4K A;  5HWV A;  3T4T A;  4R38 A;  4ME4 A;  3S7N A;  4CLC D;  4XT2 A;  4JGR A;  2W3D A;  4CLC B;  3PBR A;  3PBQ A;  1MKM A;  2ZOI A;  2OAP 1;  3LIF A;  5IS1 A;  2JKT I;  2VEA A;  4NEE D;  4IUK A;  4I38 A;  5LBR A;  2DMW A;  1D06 A;  4NXF A;  4I39 A;  2W1T B;  3O5Y A;  3F1O A;  1S4S A;  4LRZ E;  4HJ6 A;  4I3I A;  2JKR I;  1T1B A;  1OT9 A;  4HHD A;  1TD5 A;  2VA0 A;  1T1C A;  2VKS A;  4EES A;  2PT7 A;  3CWF A;  4HI4 A;  4WEL A;  2V0W A;  2PR6 A;  3EOI A;  3EEH A;  1EW0 A;  4KQD A;  1NLY A;  3PXP A;  4WL9 A;  1ZTU A;  2M7V A;  4EXO A;  4IJG A;  5L8M A;  4I5S A;  4Q0I A;  3KYZ A;  2YKF A;  3PYP A;  1XJ3 A;  3R7W A;  4DJ2 A;  5MC7 A;  1OTI A;  3F1P B;  3EGX C;  4H6J B;  3B47 A;  3KSF A;  3KSH A;  3BWL A;  4EU0 A;  2P08 A;  4UQI M;  2WKR A;  1Y28 A;  1P97 A;  3H7W B;  2GNX A;  4AFI A;  5HSQ A;  1NLZ A;  1V9Z A;  5DF9 A;  2J3T C;  3BJN A;  4GHI B;  3UB7 A;  4G3W A;  4Y5F A;  1BYW A;  3H9W A;  2EWW A;  4GW9 A;  4YWZ A;  2XRO A;  2J80 A;  3T4J A;  2ZMF A;  1G6O A;  5AVE A;  1XFN A;  3RH8 B;  1S1Y A;  1F5M A;  2FZ0 A;  3F1N A;  4MCW A;  4HQA A;  3OCL A;  3UME A;  1S66 L;  5C5K A;  3T4L A;  4LPZ A;  3NOU C;  2B02 A;  3LR4 A;  4ARZ B;  3KYQ A;  3B33 A;  5KIZ A;  2CMN A;  4FOF A;  1KOU A;  2H28 A;  4JGO A;  3E4P A;  4ZRR A;  1OTB A;  3LID A;  5IU1 A;  1LSV A;  1TS8 A;  3T4S A;  2QYB A;  3MFX A;  4HH2 A;  3IBR A;  4WEJ A;  4K08 A;  3MXQ A;  5AJG A;  4HY8 A;  4WN5 A;  2HV1 A;  4O0P A;  4BBU A;  3A0R A;  2V9A A;  5DFX A;  2XA7 S;  4HIA A;  2L0W A;  4Q0J A;  5G4Y A;  4EER A;  3BY8 A;  1H3Q A;  5F68 A;  3IS2 A;  3IBJ A;  3MQO A;  3PBT A;  4KUO A;  4O01 A;  5I5L A;  1MC0 A;  4G3K A;  4GS9 A;  1LSX A;  3UB9 A;  3VE4 A;  3UE3 A;  5F5Y A;  4GJ4 A;  2D02 A;  1OT6 A;  4M4X A;  2JKT M;  2QHK A;  4OOM A;  3K3C A;  4YNR A;  4RQ9 A;  1WA9 A;  5DFY A;  3OC2 A;  3P7N A;  4BBV A;  3VOL A;  3NJA A;  3C8C A;  3H82 A;  2PDR A;  3OLO A;  3BW6 A;  5A8B A;  2NUT C;  3CAX A;  3T4O A;  2VZW A;  2Y79 A;  1OJG A;  5F69 A;  3KSG A;  3R4K A;  4BBT A;  1OTE A;  4YOF A;  4EW7 A;  2A24 B;  3A0V A;  4B93 A;  4HP9 A;  1T1A A;  4P6Z M;  2M1C A;  4R3A A;  5EFW A;  2J3W A;  2I9V A;  1YAX A;  3NOT C;  2J3T D;  3BQA A;  4F3L A;  1T19 A;  5HPI A;  5DKK A;  5DJT A;  3PHY A;  2O9C A;  2A2L A;  4B9O A;  4CLC A;  2VGL S;  4BWI A;  3EQV A;  2KLI A;  3OOV A;  4MN6 A;  1TS0 A;  3W2Z A;  5TBM B;  2W1T A;  3F1N B;  4Z1W A;  3VE3 A;  1F9I A;  2W3E A;  5HD3 A;  3JVV A;  3LR3 A;  4GCZ A;  1IFQ A;  2HGV A;  1S4R A;  1YSP A;  4EET B;  1DP8 A;  2INW A;  4PKY G;  5CX7 A;  3CLO A;  3EWK A;  4BJP A;  3RFB A;  3LR5 A;  1TF1 A;  3C2W A;  3CI6 A;  4PKY A;  4MDZ A;  3E0Y A;  2R78 A;  3TE8 A;  2L4R A;  1TS7 A;  4MN7 A;  1D7E A;  4NXE A;  4Y3I A;  4CQH A;  3KSI A;  3PBS A;  3PR6 A;  4PHT A;  2PYP A;  3LIB A;  1UWP X;  3ZYT A;  2K2N A;  2V0U A;  2JHE A;  4H6J A;  4IUH A;  1IOU A;  1X0O A;  3LYX A;  4DN0 A;  3FG8 A;  2O9B A;  4HH3 A;  2OAQ 1;  2NUP C;  2BAS A;  2HJE A;  3LIC A;  5K5B A;  3ULF A;  3GEC A;  3UB6 A;  3IS2 B;  2XRN A;  1N9L A;  4GHI A;  3LI9 A;  3KX0 X;  5DKL A;  3NOP C;  4EQ1 A;  2G7U A;  4L9E A;  5HDC A;  4HP4 A;  2ZMV A;  4NXG A;  2W3G A;  4XT2 B;  2QJ5 A;  2M7U A;  3S7P A;  2VX8 A;  1DRM A;  3T4Q A;  2PYR A;  4EUV A;  2K7S A;  5HPF A;  1VHM A;  4CLC E;  4G3V A;  1YSQ A;  3JVU A;  4IHQ A;  4LRY C;  1GSV A;  4UQI S;  2LB5 A;  3MQ0 A;  4ARZ A;  3OBF A;  3UE6 A;  3RTY A;  2QJ7 A;  3B42 A;  1N9O A;  2PR5 A;  3F1O B;  1XFQ A;  3FPV A;  3MF0 A;  2ZOH A;  5DJU A;  2GJ3 A;  4BMW A;  2JN7 A;  3C30 A;  5KSH A;  4GLQ A;  4DMZ A;  2VJW A;  3D72 A;  2JKR M;  1OTD A;  3FPW A;  1N9N A;  4L9F A;  3CUE A;  5HWT A;  2Y8H A;  3K3D A;  2GZA A;  4L9G A;  2PD8 A;  2HF6 A;  4II7 A;  1DP9 A;  4HJ4 A;  3ICY A;  4F3L B;  2ZBB A;  3R7W B;  3MQQ A;  4R6L A;  4WUJ A;  3LR0 A;  1NRJ A;  3ZQ5 A;  3P01 A;  3MJQ A;  3E4O A;  4JGQ A;  5J3W A;  3U2A A;  2WKP A;  2O9A A;  3HJI A;  2OWJ A;  4OOL A;  4PAU A;  1W63 M;  2W3H A;  1JNU A;  2W3F A;  1XJ2 A;  2QWS A;  3D3O A;  2WKQ A;  2VLG A;  1F98 A;  2V1A A;  4CLC C;  3SW1 A;  2D01 A;  3G6O A;  4UEY A;  3E4Q A;  4R70 A;  4LRX C;  2O99 A;  2Z6C A;  2OOL A;  4WEK A;  2XSS A;  1P0Z A;  3MR0 A;  3HCY A;  4ETZ A;  2KDK A;  2B18 A;  4JGP A;  3UB8 A;  3DBA A;  2PHY A;  3TJZ C;  2XA7 M;  2K31 A;  5J7E A;  2A24 A;  1ODV A;  1P9W A;  3BQ8 A;  3LFV A;  4I3A A;  4ETX A;  5HWW A;  4LLO B;  1T18 A;  1VB6 A;  2W0N A;  1YKD A;  5FL3 A;  3PBN A;  4HJ3 A;  3EEA A;  2OWH A;  4O8G A;  1TS6 A;  1OTA A;  3LUQ A;  1UWN X;  3FC7 A;  2L1M A;  2VV7 A;  3E98 A;  2O0Y A;  3NHQ A;  3TW8 A;  1OPX A;  3MMH A;  1LL8 A;  4I3J A;  1XJ6 A;  2HJ9 C;  4KQO A;  3F1P A;  2V1B A;  2P7J A;  4Q0H A;  5G4Z A;  4MMN A;  3PBO A;  1S1Z A;  4EEP A;  1DP6 A;  5TBM A;  1H8M A;  2Z6D A;  4P6Z S;  4HNB A;  5HD5 A;  3UMD A;  3H7W A;  5TJJ A;  5AVF A;  4HOI A;  2W1R A;  5HZH A;  2IA2 A;  3S7Q A;  4NXB A;  4GS9 B;  1LSW A;  2FH5 A;  3EQU A;  3A0S A;  2VV8 A;  2KOI A;  3LIE A;  4EEU A;  3TRC A;  3S7O A;  2VV6 A;  4L0L A;  1OJ5 A;  3EGD C;  5F6A A;  3C38 A;  3K2N A;  2GX5 A;  3LIA A;  1GSX A;  1S67 L;  4Y2F A;  2W27 A;  1STZ A;  4QPR A;  2KX6 A;  1MZU A;  1GSW A;  3H82 B;  3LI8 A;  1XJ4 A;  5IT5 A;  1ZHH B;  4E04 A;  3VV4 A;  1V9Y A;  3CIT A;  2MJ6 A;  4NKP A;  2LB9 A;  2P04 A;  1P9R A;  2EA9 A;  3KO6 A;  1G28 A;  5HDS A;  2VGL M;  5HDD A;  3V67 A;  2PD7 A;  2YKH A;  3BY9 A;  1LT0 A;  3T50 A;  1NWZ A;  3OCN A;  4FSF A;  4KUK A;  4MN5 A;  3HJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...